data_2XNP
# 
_entry.id   2XNP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XNP         
PDBE  EBI-44973    
WWPDB D_1290044973 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XKC unspecified 'STRUCTURE OF NEK2 BOUND TO CCT241734'                   
PDB 2W5B unspecified 'HUMAN NEK2 KINASE ATPGAMMAS-BOUND'                      
PDB 2XK8 unspecified 'STRUCTURE OF NEK2 BOUND TO CCT241799'                   
PDB 2WQO unspecified 'STRUCTURE OF NEK2 BOUND TO THE AMINOPYRIDINE CCT241950' 
PDB 2JAV unspecified 'HUMAN KINASE WITH PYRROLE-INDOLINONE LIGAND'            
PDB 2XK6 unspecified 'STRUCTURE OF NEK2 BOUND TO'                             
PDB 2XK4 unspecified 'STRUCTURE OF NEK2 BOUND TO CCT242101'                   
PDB 2XK3 unspecified 'STRUCTURE OF NEK2 BOUND TO CCT244744'                   
PDB 2W5A unspecified 'HUMAN NEK2 KINASE ADP-BOUND'                            
PDB 2XKE unspecified 'STRUCTURE OF NEK2 BOUND TO CCT193788'                   
PDB 2XK7 unspecified 'STRUCTURE OF NEK2 BOUND TO CCT242010'                   
PDB 2W5H unspecified 'HUMAN NEK2 KINASE APO'                                  
PDB 2XKD unspecified 'STRUCTURE OF NEK2 BOUND TO CCT231393'                   
PDB 2XKF unspecified 'STRUCTURE OF NEK2 BOUND TO CCT134934'                   
PDB 2XNN unspecified 'STRUCTURE OF NEK2 BOUND TO CCT242430'                   
PDB 2XNM unspecified 'STRUCTURE OF NEK2 BOUND TO CCT'                         
PDB 2XNO unspecified 'STRUCTURE OF NEK2 BOUND TO CCT243779'                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XNP 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-05 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mas-Droux, C.' 1 
'Bayliss, R.'   2 
# 
_citation.id                        primary 
_citation.title                     
;Benzimidazole Inhibitors Induce a Dfg-Out Conformation of Never in Mitosis Gene A-Related Kinase 2 (Nek2) without Binding to the Back Pocket and Reveal a Nonlinear Structure-Activity Relationship.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            54 
_citation.page_first                1626 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21366329 
_citation.pdbx_database_id_DOI      10.1021/JM1011726 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Solanki, S.'        1 
primary 'Innocenti, P.'      2 
primary 'Mas-Droux, C.'      3 
primary 'Boxall, K.'         4 
primary 'Barillari, C.'      5 
primary 'Van Montfort, R.L.' 6 
primary 'Aherne, G.W.'       7 
primary 'Bayliss, R.'        8 
primary 'Hoelder, S.'        9 
# 
_cell.entry_id           2XNP 
_cell.length_a           101.640 
_cell.length_b           56.880 
_cell.length_c           81.840 
_cell.angle_alpha        90.00 
_cell.angle_beta         133.63 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XNP 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE NEK2'                                                                           
32662.479 1   2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 1-271' ? 
2 non-polymer syn '4-{5-[(1-METHYLPIPERIDIN-4-YL)OXY]-1H-BENZIMIDAZOL-1-YL}-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' 
538.561   1   ?        ? ?                               ? 
3 non-polymer syn 'CHLORIDE ION'                                                                                                   
35.453    4   ?        ? ?                               ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                                                   
62.068    5   ?        ? ?                               ? 
5 water       nat water                                                                                                            
18.015    224 ?        ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'NEVER IN MITOSIS A-RELATED KINASE 2, NEK2, NIMA-RELATED PROTEIN KINASE 2, NIMA-LIKE PROTEIN KINASE 1, HSPK 21' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT
TLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDF
GLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   ARG n 
1 5   ALA n 
1 6   GLU n 
1 7   ASP n 
1 8   TYR n 
1 9   GLU n 
1 10  VAL n 
1 11  LEU n 
1 12  TYR n 
1 13  THR n 
1 14  ILE n 
1 15  GLY n 
1 16  THR n 
1 17  GLY n 
1 18  SER n 
1 19  TYR n 
1 20  GLY n 
1 21  ARG n 
1 22  CYS n 
1 23  GLN n 
1 24  LYS n 
1 25  ILE n 
1 26  ARG n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  LYS n 
1 33  ILE n 
1 34  LEU n 
1 35  VAL n 
1 36  TRP n 
1 37  LYS n 
1 38  GLU n 
1 39  LEU n 
1 40  ASP n 
1 41  TYR n 
1 42  GLY n 
1 43  SER n 
1 44  MET n 
1 45  THR n 
1 46  GLU n 
1 47  ALA n 
1 48  GLU n 
1 49  LYS n 
1 50  GLN n 
1 51  MET n 
1 52  LEU n 
1 53  VAL n 
1 54  SER n 
1 55  GLU n 
1 56  VAL n 
1 57  ASN n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  GLU n 
1 62  LEU n 
1 63  LYS n 
1 64  HIS n 
1 65  PRO n 
1 66  ASN n 
1 67  ILE n 
1 68  VAL n 
1 69  ARG n 
1 70  TYR n 
1 71  TYR n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  ILE n 
1 76  ASP n 
1 77  ARG n 
1 78  THR n 
1 79  ASN n 
1 80  THR n 
1 81  THR n 
1 82  LEU n 
1 83  TYR n 
1 84  ILE n 
1 85  VAL n 
1 86  MET n 
1 87  GLU n 
1 88  TYR n 
1 89  CYS n 
1 90  GLU n 
1 91  GLY n 
1 92  GLY n 
1 93  ASP n 
1 94  LEU n 
1 95  ALA n 
1 96  SER n 
1 97  VAL n 
1 98  ILE n 
1 99  THR n 
1 100 LYS n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 GLU n 
1 105 ARG n 
1 106 GLN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASP n 
1 110 GLU n 
1 111 GLU n 
1 112 PHE n 
1 113 VAL n 
1 114 LEU n 
1 115 ARG n 
1 116 VAL n 
1 117 MET n 
1 118 THR n 
1 119 GLN n 
1 120 LEU n 
1 121 THR n 
1 122 LEU n 
1 123 ALA n 
1 124 LEU n 
1 125 LYS n 
1 126 GLU n 
1 127 CYS n 
1 128 HIS n 
1 129 ARG n 
1 130 ARG n 
1 131 SER n 
1 132 ASP n 
1 133 GLY n 
1 134 GLY n 
1 135 HIS n 
1 136 THR n 
1 137 VAL n 
1 138 LEU n 
1 139 HIS n 
1 140 ARG n 
1 141 ASP n 
1 142 LEU n 
1 143 LYS n 
1 144 PRO n 
1 145 ALA n 
1 146 ASN n 
1 147 VAL n 
1 148 PHE n 
1 149 LEU n 
1 150 ASP n 
1 151 GLY n 
1 152 LYS n 
1 153 GLN n 
1 154 ASN n 
1 155 VAL n 
1 156 LYS n 
1 157 LEU n 
1 158 GLY n 
1 159 ASP n 
1 160 PHE n 
1 161 GLY n 
1 162 LEU n 
1 163 ALA n 
1 164 ARG n 
1 165 ILE n 
1 166 LEU n 
1 167 ASN n 
1 168 HIS n 
1 169 ASP n 
1 170 THR n 
1 171 SER n 
1 172 PHE n 
1 173 ALA n 
1 174 LYS n 
1 175 THR n 
1 176 PHE n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 TYR n 
1 182 TYR n 
1 183 MET n 
1 184 SER n 
1 185 PRO n 
1 186 GLU n 
1 187 GLN n 
1 188 MET n 
1 189 ASN n 
1 190 ARG n 
1 191 MET n 
1 192 SER n 
1 193 TYR n 
1 194 ASN n 
1 195 GLU n 
1 196 LYS n 
1 197 SER n 
1 198 ASP n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 LEU n 
1 203 GLY n 
1 204 CYS n 
1 205 LEU n 
1 206 LEU n 
1 207 TYR n 
1 208 GLU n 
1 209 LEU n 
1 210 CYS n 
1 211 ALA n 
1 212 LEU n 
1 213 MET n 
1 214 PRO n 
1 215 PRO n 
1 216 PHE n 
1 217 THR n 
1 218 ALA n 
1 219 PHE n 
1 220 SER n 
1 221 GLN n 
1 222 LYS n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 LYS n 
1 228 ILE n 
1 229 ARG n 
1 230 GLU n 
1 231 GLY n 
1 232 LYS n 
1 233 PHE n 
1 234 ARG n 
1 235 ARG n 
1 236 ILE n 
1 237 PRO n 
1 238 TYR n 
1 239 ARG n 
1 240 TYR n 
1 241 SER n 
1 242 ASP n 
1 243 GLU n 
1 244 LEU n 
1 245 ASN n 
1 246 GLU n 
1 247 ILE n 
1 248 ILE n 
1 249 THR n 
1 250 ARG n 
1 251 MET n 
1 252 LEU n 
1 253 ASN n 
1 254 LEU n 
1 255 LYS n 
1 256 ASP n 
1 257 TYR n 
1 258 HIS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 VAL n 
1 263 GLU n 
1 264 GLU n 
1 265 ILE n 
1 266 LEU n 
1 267 GLU n 
1 268 ASN n 
1 269 PRO n 
1 270 LEU n 
1 271 ILE n 
1 272 LEU n 
1 273 GLU n 
1 274 HIS n 
1 275 HIS n 
1 276 HIS n 
1 277 HIS n 
1 278 HIS n 
1 279 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              RIL 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET30 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NEK2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P51955 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XNP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 271 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P51955 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  271 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XNP LEU A 272 ? UNP P51955 ? ? 'expression tag' 272 1 
1 2XNP GLU A 273 ? UNP P51955 ? ? 'expression tag' 273 2 
1 2XNP HIS A 274 ? UNP P51955 ? ? 'expression tag' 274 3 
1 2XNP HIS A 275 ? UNP P51955 ? ? 'expression tag' 275 4 
1 2XNP HIS A 276 ? UNP P51955 ? ? 'expression tag' 276 5 
1 2XNP HIS A 277 ? UNP P51955 ? ? 'expression tag' 277 6 
1 2XNP HIS A 278 ? UNP P51955 ? ? 'expression tag' 278 7 
1 2XNP HIS A 279 ? UNP P51955 ? ? 'expression tag' 279 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'       133.103 
CL  non-polymer         . 'CHLORIDE ION' ?                 'Cl -1'            35.453  
CYS 'L-peptide linking' y CYSTEINE ?                 'C3 H7 N O2 S'     121.158 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2'         62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?                 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?                 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?                 'C5 H11 N O2'      117.146 
WCX non-polymer         . 
'4-{5-[(1-METHYLPIPERIDIN-4-YL)OXY]-1H-BENZIMIDAZOL-1-YL}-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' ?                 
'C29 H29 F3 N4 O3' 538.561 
# 
_exptl.entry_id          2XNP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_percent_sol   53.08 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2010-04-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97630 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             0.97630 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XNP 
_reflns.observed_criterion_sigma_I   6.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.52 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   26646 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.10 
_reflns.B_iso_Wilson_estimate        18.50 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.40 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.50 
_reflns_shell.pdbx_redundancy        3.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XNP 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22973 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.03 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.784 
_refine.ls_d_res_high                            1.98 
_refine.ls_percent_reflns_obs                    96.84 
_refine.ls_R_factor_obs                          0.1589 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1566 
_refine.ls_R_factor_R_free                       0.2012 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1165 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               30.82 
_refine.aniso_B[1][1]                            -1.0725 
_refine.aniso_B[2][2]                            -4.8910 
_refine.aniso_B[3][3]                            5.9635 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -6.3588 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 60.124 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2W5A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.21 
_refine.pdbx_overall_phase_error                 18.79 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2075 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         63 
_refine_hist.number_atoms_solvent             224 
_refine_hist.number_atoms_total               2362 
_refine_hist.d_res_high                       1.98 
_refine_hist.d_res_low                        36.784 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 2203 'X-RAY DIFFRACTION' ? 
f_angle_d          1.212  ? ? 2966 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.784 ? ? 860  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.087  ? ? 317  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 371  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.9800 2.0701  2625 0.1690 94.00 0.2100 . . 157 . . 
'X-RAY DIFFRACTION' . 2.0701 2.1792  2638 0.1621 95.00 0.2256 . . 143 . . 
'X-RAY DIFFRACTION' . 2.1792 2.3158  2690 0.1483 96.00 0.2052 . . 134 . . 
'X-RAY DIFFRACTION' . 2.3158 2.4945  2745 0.1449 97.00 0.1766 . . 117 . . 
'X-RAY DIFFRACTION' . 2.4945 2.7455  2750 0.1462 97.00 0.2085 . . 145 . . 
'X-RAY DIFFRACTION' . 2.7455 3.1426  2769 0.1488 99.00 0.2193 . . 149 . . 
'X-RAY DIFFRACTION' . 3.1426 3.9586  2789 0.1449 99.00 0.1816 . . 138 . . 
'X-RAY DIFFRACTION' . 3.9586 36.7904 2802 0.1670 98.00 0.1908 . . 182 . . 
# 
_struct.entry_id                  2XNP 
_struct.title                     'Structure of Nek2 bound to CCT244858' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE NEK2 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XNP 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, CENTROSOME, MITOSIS, CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 4   ? GLU A 6   ? ARG A 4   GLU A 6   5 ? 3  
HELX_P HELX_P2  2  THR A 45  ? GLU A 61  ? THR A 45  GLU A 61  1 ? 17 
HELX_P HELX_P3  3  LEU A 94  ? ARG A 105 ? LEU A 94  ARG A 105 1 ? 12 
HELX_P HELX_P4  4  ASP A 109 ? SER A 131 ? ASP A 109 SER A 131 1 ? 23 
HELX_P HELX_P5  5  LYS A 143 ? ALA A 145 ? LYS A 143 ALA A 145 5 ? 3  
HELX_P HELX_P6  6  ASN A 194 ? LEU A 212 ? ASN A 194 LEU A 212 1 ? 19 
HELX_P HELX_P7  7  SER A 220 ? GLY A 231 ? SER A 220 GLY A 231 1 ? 12 
HELX_P HELX_P8  8  SER A 241 ? LEU A 252 ? SER A 241 LEU A 252 1 ? 12 
HELX_P HELX_P9  9  LYS A 255 ? ARG A 259 ? LYS A 255 ARG A 259 5 ? 5  
HELX_P HELX_P10 10 SER A 261 ? GLU A 267 ? SER A 261 GLU A 267 1 ? 7  
HELX_P HELX_P11 11 LEU A 272 ? HIS A 276 ? LEU A 272 HIS A 276 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 8   ? THR A 16  ? TYR A 8   THR A 16  
AA 2 ARG A 21  ? ARG A 27  ? ARG A 21  ARG A 27  
AA 3 ILE A 33  ? ASP A 40  ? ILE A 33  ASP A 40  
AA 4 THR A 81  ? GLU A 87  ? THR A 81  GLU A 87  
AA 5 TYR A 70  ? ASP A 76  ? TYR A 70  ASP A 76  
AB 1 GLY A 92  ? ASP A 93  ? GLY A 92  ASP A 93  
AB 2 VAL A 147 ? LEU A 149 ? VAL A 147 LEU A 149 
AB 3 VAL A 155 ? LEU A 157 ? VAL A 155 LEU A 157 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 14  ? N ILE A 14  O CYS A 22  ? O CYS A 22  
AA 2 3 N ILE A 25  ? N ILE A 25  O LEU A 34  ? O LEU A 34  
AA 3 4 N LEU A 39  ? N LEU A 39  O LEU A 82  ? O LEU A 82  
AA 4 5 O VAL A 85  ? O VAL A 85  N TYR A 71  ? N TYR A 71  
AB 1 2 O GLY A 92  ? O GLY A 92  N LEU A 149 ? N LEU A 149 
AB 2 3 N PHE A 148 ? N PHE A 148 O LYS A 156 ? O LYS A 156 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE WCX A 1280' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 1282'  
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1288'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 1283'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1284' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1285' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 1286' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1287' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO A 1289' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 ILE A 14  ? ILE A 14   . ? 1_555 ? 
2  AC1 16 GLY A 15  ? GLY A 15   . ? 1_555 ? 
3  AC1 16 TYR A 19  ? TYR A 19   . ? 1_555 ? 
4  AC1 16 CYS A 22  ? CYS A 22   . ? 1_555 ? 
5  AC1 16 GLU A 87  ? GLU A 87   . ? 1_555 ? 
6  AC1 16 TYR A 88  ? TYR A 88   . ? 1_555 ? 
7  AC1 16 CYS A 89  ? CYS A 89   . ? 1_555 ? 
8  AC1 16 GLU A 90  ? GLU A 90   . ? 1_555 ? 
9  AC1 16 GLY A 92  ? GLY A 92   . ? 1_555 ? 
10 AC1 16 ASP A 93  ? ASP A 93   . ? 1_555 ? 
11 AC1 16 ALA A 145 ? ALA A 145  . ? 1_555 ? 
12 AC1 16 PHE A 148 ? PHE A 148  . ? 1_555 ? 
13 AC1 16 GLY A 158 ? GLY A 158  . ? 1_555 ? 
14 AC1 16 ASP A 159 ? ASP A 159  . ? 1_555 ? 
15 AC1 16 PHE A 160 ? PHE A 160  . ? 1_555 ? 
16 AC1 16 HOH L .   ? HOH A 2216 . ? 1_555 ? 
17 AC2 4  ASN A 154 ? ASN A 154  . ? 1_555 ? 
18 AC2 4  HIS A 277 ? HIS A 277  . ? 1_555 ? 
19 AC2 4  HIS A 279 ? HIS A 279  . ? 1_555 ? 
20 AC2 4  HOH L .   ? HOH A 2132 . ? 1_555 ? 
21 AC3 1  HOH L .   ? HOH A 2160 . ? 1_555 ? 
22 AC4 4  TYR A 207 ? TYR A 207  . ? 1_555 ? 
23 AC4 4  PRO A 215 ? PRO A 215  . ? 1_555 ? 
24 AC4 4  PHE A 233 ? PHE A 233  . ? 1_555 ? 
25 AC4 4  ARG A 234 ? ARG A 234  . ? 1_555 ? 
26 AC5 6  TYR A 181 ? TYR A 181  . ? 1_555 ? 
27 AC5 6  TYR A 182 ? TYR A 182  . ? 1_555 ? 
28 AC5 6  GLU A 208 ? GLU A 208  . ? 1_555 ? 
29 AC5 6  PRO A 214 ? PRO A 214  . ? 1_555 ? 
30 AC5 6  HOH L .   ? HOH A 2217 . ? 1_555 ? 
31 AC5 6  HOH L .   ? HOH A 2219 . ? 1_555 ? 
32 AC6 6  ASP A 242 ? ASP A 242  . ? 1_555 ? 
33 AC6 6  GLU A 243 ? GLU A 243  . ? 1_555 ? 
34 AC6 6  GLU A 246 ? GLU A 246  . ? 1_555 ? 
35 AC6 6  HIS A 277 ? HIS A 277  . ? 4_556 ? 
36 AC6 6  HIS A 279 ? HIS A 279  . ? 4_556 ? 
37 AC6 6  HOH L .   ? HOH A 2220 . ? 1_555 ? 
38 AC7 5  LYS A 152 ? LYS A 152  . ? 1_555 ? 
39 AC7 5  GLN A 153 ? GLN A 153  . ? 1_555 ? 
40 AC7 5  HOH L .   ? HOH A 2131 . ? 1_555 ? 
41 AC7 5  HOH L .   ? HOH A 2214 . ? 1_555 ? 
42 AC7 5  HOH L .   ? HOH A 2221 . ? 1_555 ? 
43 AC8 6  GLU A 195 ? GLU A 195  . ? 1_555 ? 
44 AC8 6  LYS A 196 ? LYS A 196  . ? 1_555 ? 
45 AC8 6  SER A 261 ? SER A 261  . ? 1_555 ? 
46 AC8 6  VAL A 262 ? VAL A 262  . ? 1_555 ? 
47 AC8 6  HOH L .   ? HOH A 2117 . ? 1_555 ? 
48 AC8 6  HOH L .   ? HOH A 2200 . ? 1_555 ? 
49 AC9 6  ARG A 234 ? ARG A 234  . ? 4_546 ? 
50 AC9 6  ARG A 235 ? ARG A 235  . ? 4_546 ? 
51 AC9 6  LEU A 266 ? LEU A 266  . ? 1_555 ? 
52 AC9 6  HOH L .   ? HOH A 2166 . ? 4_546 ? 
53 AC9 6  HOH L .   ? HOH A 2222 . ? 1_555 ? 
54 AC9 6  HOH L .   ? HOH A 2224 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XNP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XNP 
_atom_sites.fract_transf_matrix[1][1]   0.009839 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009379 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017581 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016881 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 3   ? -30.532 -22.859 8.898   1.00   65.91  ? 3    SER A N   1 
ATOM   2    C  CA  . SER A 1 3   ? -30.712 -21.415 9.018   1.00   61.98  ? 3    SER A CA  1 
ATOM   3    C  C   . SER A 1 3   ? -32.099 -20.991 8.553   1.00   59.90  ? 3    SER A C   1 
ATOM   4    O  O   . SER A 1 3   ? -32.311 -20.733 7.366   1.00   65.77  ? 3    SER A O   1 
ATOM   5    C  CB  . SER A 1 3   ? -29.649 -20.677 8.203   1.00   53.15  ? 3    SER A CB  1 
ATOM   6    O  OG  . SER A 1 3   ? -28.358 -21.047 8.636   1.00   52.73  ? 3    SER A OG  1 
ATOM   7    N  N   . ARG A 1 4   ? -33.046 -20.931 9.483   1.00   50.32  ? 4    ARG A N   1 
ATOM   8    C  CA  . ARG A 1 4   ? -34.380 -20.442 9.164   1.00   41.72  ? 4    ARG A CA  1 
ATOM   9    C  C   . ARG A 1 4   ? -34.847 -19.440 10.206  1.00   36.24  ? 4    ARG A C   1 
ATOM   10   O  O   . ARG A 1 4   ? -34.464 -19.523 11.371  1.00   38.43  ? 4    ARG A O   1 
ATOM   11   C  CB  . ARG A 1 4   ? -35.370 -21.597 9.052   1.00   58.29  ? 4    ARG A CB  1 
ATOM   12   C  CG  . ARG A 1 4   ? -34.918 -22.696 8.097   1.00   72.26  ? 4    ARG A CG  1 
ATOM   13   C  CD  . ARG A 1 4   ? -35.988 -23.758 7.918   1.00   82.12  ? 4    ARG A CD  1 
ATOM   14   N  NE  . ARG A 1 4   ? -36.591 -24.137 9.192   1.00   90.12  ? 4    ARG A NE  1 
ATOM   15   C  CZ  . ARG A 1 4   ? -35.984 -24.871 10.119  1.00   97.78  ? 4    ARG A CZ  1 
ATOM   16   N  NH1 . ARG A 1 4   ? -34.746 -25.308 9.923   1.00   100.77 ? 4    ARG A NH1 1 
ATOM   17   N  NH2 . ARG A 1 4   ? -36.615 -25.165 11.248  1.00   99.45  ? 4    ARG A NH2 1 
ATOM   18   N  N   . ALA A 1 5   ? -35.673 -18.491 9.787   1.00   37.03  ? 5    ALA A N   1 
ATOM   19   C  CA  . ALA A 1 5   ? -36.148 -17.452 10.701  1.00   40.30  ? 5    ALA A CA  1 
ATOM   20   C  C   . ALA A 1 5   ? -36.970 -18.053 11.833  1.00   38.02  ? 5    ALA A C   1 
ATOM   21   O  O   . ALA A 1 5   ? -36.989 -17.545 12.942  1.00   41.07  ? 5    ALA A O   1 
ATOM   22   C  CB  . ALA A 1 5   ? -36.956 -16.417 9.953   1.00   40.48  ? 5    ALA A CB  1 
ATOM   23   N  N   . GLU A 1 6   ? -37.648 -19.154 11.550  1.00   33.56  ? 6    GLU A N   1 
ATOM   24   C  CA  . GLU A 1 6   ? -38.516 -19.763 12.541  1.00   33.83  ? 6    GLU A CA  1 
ATOM   25   C  C   . GLU A 1 6   ? -37.732 -20.414 13.669  1.00   37.63  ? 6    GLU A C   1 
ATOM   26   O  O   . GLU A 1 6   ? -38.314 -20.771 14.691  1.00   40.23  ? 6    GLU A O   1 
ATOM   27   C  CB  . GLU A 1 6   ? -39.433 -20.795 11.872  1.00   43.41  ? 6    GLU A CB  1 
ATOM   28   C  CG  . GLU A 1 6   ? -38.754 -21.589 10.770  1.00   52.25  ? 6    GLU A CG  1 
ATOM   29   C  CD  . GLU A 1 6   ? -39.201 -21.149 9.387   1.00   63.48  ? 6    GLU A CD  1 
ATOM   30   O  OE1 . GLU A 1 6   ? -38.669 -20.129 8.888   1.00   69.50  ? 6    GLU A OE1 1 
ATOM   31   O  OE2 . GLU A 1 6   ? -40.094 -21.818 8.810   1.00   55.77  ? 6    GLU A OE2 1 
ATOM   32   N  N   . ASP A 1 7   ? -36.417 -20.567 13.489  1.00   31.03  ? 7    ASP A N   1 
ATOM   33   C  CA  . ASP A 1 7   ? -35.551 -21.056 14.559  1.00   30.75  ? 7    ASP A CA  1 
ATOM   34   C  C   . ASP A 1 7   ? -35.341 -20.014 15.665  1.00   31.04  ? 7    ASP A C   1 
ATOM   35   O  O   . ASP A 1 7   ? -34.767 -20.321 16.710  1.00   29.09  ? 7    ASP A O   1 
ATOM   36   C  CB  . ASP A 1 7   ? -34.183 -21.475 14.010  1.00   37.86  ? 7    ASP A CB  1 
ATOM   37   C  CG  . ASP A 1 7   ? -34.272 -22.607 13.009  1.00   46.65  ? 7    ASP A CG  1 
ATOM   38   O  OD1 . ASP A 1 7   ? -35.245 -23.389 13.079  1.00   46.52  ? 7    ASP A OD1 1 
ATOM   39   O  OD2 . ASP A 1 7   ? -33.364 -22.706 12.155  1.00   45.50  ? 7    ASP A OD2 1 
ATOM   40   N  N   . TYR A 1 8   ? -35.785 -18.781 15.428  1.00   28.98  ? 8    TYR A N   1 
ATOM   41   C  CA  . TYR A 1 8   ? -35.587 -17.714 16.403  1.00   22.92  ? 8    TYR A CA  1 
ATOM   42   C  C   . TYR A 1 8   ? -36.891 -16.990 16.700  1.00   25.38  ? 8    TYR A C   1 
ATOM   43   O  O   . TYR A 1 8   ? -37.790 -16.953 15.868  1.00   23.17  ? 8    TYR A O   1 
ATOM   44   C  CB  . TYR A 1 8   ? -34.588 -16.682 15.883  1.00   26.18  ? 8    TYR A CB  1 
ATOM   45   C  CG  . TYR A 1 8   ? -33.238 -17.254 15.500  1.00   28.73  ? 8    TYR A CG  1 
ATOM   46   C  CD1 . TYR A 1 8   ? -33.040 -17.851 14.255  1.00   26.80  ? 8    TYR A CD1 1 
ATOM   47   C  CD2 . TYR A 1 8   ? -32.164 -17.193 16.374  1.00   22.67  ? 8    TYR A CD2 1 
ATOM   48   C  CE1 . TYR A 1 8   ? -31.808 -18.368 13.898  1.00   27.38  ? 8    TYR A CE1 1 
ATOM   49   C  CE2 . TYR A 1 8   ? -30.934 -17.707 16.027  1.00   23.83  ? 8    TYR A CE2 1 
ATOM   50   C  CZ  . TYR A 1 8   ? -30.758 -18.282 14.784  1.00   29.95  ? 8    TYR A CZ  1 
ATOM   51   O  OH  . TYR A 1 8   ? -29.523 -18.780 14.436  1.00   30.93  ? 8    TYR A OH  1 
ATOM   52   N  N   . GLU A 1 9   ? -36.961 -16.378 17.873  1.00   23.03  ? 9    GLU A N   1 
ATOM   53   C  CA  . GLU A 1 9   ? -38.087 -15.536 18.236  1.00   28.57  ? 9    GLU A CA  1 
ATOM   54   C  C   . GLU A 1 9   ? -37.640 -14.093 18.523  1.00   19.24  ? 9    GLU A C   1 
ATOM   55   O  O   . GLU A 1 9   ? -36.729 -13.863 19.316  1.00   23.44  ? 9    GLU A O   1 
ATOM   56   C  CB  . GLU A 1 9   ? -38.789 -16.117 19.458  1.00   31.85  ? 9    GLU A CB  1 
ATOM   57   C  CG  . GLU A 1 9   ? -40.032 -15.343 19.841  1.00   52.97  ? 9    GLU A CG  1 
ATOM   58   C  CD  . GLU A 1 9   ? -41.087 -16.214 20.499  1.00   67.51  ? 9    GLU A CD  1 
ATOM   59   O  OE1 . GLU A 1 9   ? -40.718 -17.283 21.036  1.00   72.51  ? 9    GLU A OE1 1 
ATOM   60   O  OE2 . GLU A 1 9   ? -42.279 -15.824 20.478  1.00   67.43  ? 9    GLU A OE2 1 
ATOM   61   N  N   . VAL A 1 10  ? -38.278 -13.115 17.888  1.00   21.67  ? 10   VAL A N   1 
ATOM   62   C  CA  . VAL A 1 10  ? -37.930 -11.716 18.146  1.00   26.03  ? 10   VAL A CA  1 
ATOM   63   C  C   . VAL A 1 10  ? -38.425 -11.278 19.525  1.00   31.55  ? 10   VAL A C   1 
ATOM   64   O  O   . VAL A 1 10  ? -39.584 -11.480 19.850  1.00   28.87  ? 10   VAL A O   1 
ATOM   65   C  CB  . VAL A 1 10  ? -38.532 -10.788 17.081  1.00   30.92  ? 10   VAL A CB  1 
ATOM   66   C  CG1 . VAL A 1 10  ? -38.299 -9.325  17.458  1.00   28.60  ? 10   VAL A CG1 1 
ATOM   67   C  CG2 . VAL A 1 10  ? -37.956 -11.108 15.698  1.00   30.86  ? 10   VAL A CG2 1 
ATOM   68   N  N   . LEU A 1 11  ? -37.547 -10.699 20.343  1.00   21.10  ? 11   LEU A N   1 
ATOM   69   C  CA  . LEU A 1 11  ? -37.965 -10.094 21.608  1.00   27.29  ? 11   LEU A CA  1 
ATOM   70   C  C   . LEU A 1 11  ? -38.437 -8.652  21.397  1.00   37.25  ? 11   LEU A C   1 
ATOM   71   O  O   . LEU A 1 11  ? -39.562 -8.297  21.757  1.00   38.06  ? 11   LEU A O   1 
ATOM   72   C  CB  . LEU A 1 11  ? -36.840 -10.135 22.639  1.00   19.68  ? 11   LEU A CB  1 
ATOM   73   C  CG  . LEU A 1 11  ? -36.328 -11.543 22.945  1.00   28.15  ? 11   LEU A CG  1 
ATOM   74   C  CD1 . LEU A 1 11  ? -35.374 -11.549 24.135  1.00   21.53  ? 11   LEU A CD1 1 
ATOM   75   C  CD2 . LEU A 1 11  ? -37.495 -12.457 23.198  1.00   30.17  ? 11   LEU A CD2 1 
ATOM   76   N  N   . TYR A 1 12  ? -37.576 -7.818  20.821  1.00   25.28  ? 12   TYR A N   1 
ATOM   77   C  CA  . TYR A 1 12  ? -37.987 -6.475  20.423  1.00   25.63  ? 12   TYR A CA  1 
ATOM   78   C  C   . TYR A 1 12  ? -36.934 -5.841  19.544  1.00   20.61  ? 12   TYR A C   1 
ATOM   79   O  O   . TYR A 1 12  ? -35.815 -6.333  19.461  1.00   20.00  ? 12   TYR A O   1 
ATOM   80   C  CB  . TYR A 1 12  ? -38.237 -5.591  21.644  1.00   27.96  ? 12   TYR A CB  1 
ATOM   81   C  CG  . TYR A 1 12  ? -37.126 -5.603  22.659  1.00   28.15  ? 12   TYR A CG  1 
ATOM   82   C  CD1 . TYR A 1 12  ? -36.061 -4.707  22.569  1.00   28.18  ? 12   TYR A CD1 1 
ATOM   83   C  CD2 . TYR A 1 12  ? -37.151 -6.496  23.726  1.00   33.22  ? 12   TYR A CD2 1 
ATOM   84   C  CE1 . TYR A 1 12  ? -35.027 -4.712  23.521  1.00   30.03  ? 12   TYR A CE1 1 
ATOM   85   C  CE2 . TYR A 1 12  ? -36.143 -6.507  24.671  1.00   31.66  ? 12   TYR A CE2 1 
ATOM   86   C  CZ  . TYR A 1 12  ? -35.085 -5.617  24.567  1.00   31.37  ? 12   TYR A CZ  1 
ATOM   87   O  OH  . TYR A 1 12  ? -34.087 -5.648  25.514  1.00   35.99  ? 12   TYR A OH  1 
ATOM   88   N  N   . THR A 1 13  ? -37.302 -4.743  18.903  1.00   19.34  ? 13   THR A N   1 
ATOM   89   C  CA  . THR A 1 13  ? -36.404 -4.003  18.033  1.00   17.99  ? 13   THR A CA  1 
ATOM   90   C  C   . THR A 1 13  ? -35.479 -3.136  18.861  1.00   25.19  ? 13   THR A C   1 
ATOM   91   O  O   . THR A 1 13  ? -35.944 -2.453  19.758  1.00   19.93  ? 13   THR A O   1 
ATOM   92   C  CB  . THR A 1 13  ? -37.229 -3.088  17.103  1.00   20.48  ? 13   THR A CB  1 
ATOM   93   O  OG1 . THR A 1 13  ? -38.032 -3.903  16.249  1.00   23.25  ? 13   THR A OG1 1 
ATOM   94   C  CG2 . THR A 1 13  ? -36.335 -2.177  16.259  1.00   22.67  ? 13   THR A CG2 1 
ATOM   95   N  N   . ILE A 1 14  ? -34.175 -3.138  18.558  1.00   15.28  ? 14   ILE A N   1 
ATOM   96   C  CA  A ILE A 1 14  ? -33.284 -2.275  19.320  0.76   22.15  ? 14   ILE A CA  1 
ATOM   97   C  CA  B ILE A 1 14  ? -33.185 -2.338  19.287  0.24   21.78  ? 14   ILE A CA  1 
ATOM   98   C  C   . ILE A 1 14  ? -32.826 -1.042  18.558  1.00   26.20  ? 14   ILE A C   1 
ATOM   99   O  O   . ILE A 1 14  ? -32.422 -0.060  19.168  1.00   28.40  ? 14   ILE A O   1 
ATOM   100  C  CB  A ILE A 1 14  ? -32.087 -3.023  19.900  0.76   22.77  ? 14   ILE A CB  1 
ATOM   101  C  CB  B ILE A 1 14  ? -31.866 -3.114  19.473  0.24   22.12  ? 14   ILE A CB  1 
ATOM   102  C  CG1 A ILE A 1 14  ? -31.338 -3.804  18.831  0.76   24.51  ? 14   ILE A CG1 1 
ATOM   103  C  CG1 B ILE A 1 14  ? -32.091 -4.410  20.255  0.24   22.28  ? 14   ILE A CG1 1 
ATOM   104  C  CG2 A ILE A 1 14  ? -32.546 -4.003  20.968  0.76   23.62  ? 14   ILE A CG2 1 
ATOM   105  C  CG2 B ILE A 1 14  ? -30.831 -2.249  20.182  0.24   21.52  ? 14   ILE A CG2 1 
ATOM   106  C  CD1 A ILE A 1 14  ? -30.371 -4.832  19.470  0.76   25.66  ? 14   ILE A CD1 1 
ATOM   107  C  CD1 B ILE A 1 14  ? -32.417 -4.190  21.707  0.24   24.59  ? 14   ILE A CD1 1 
ATOM   108  N  N   . GLY A 1 15  ? -32.912 -1.075  17.235  1.00   21.46  ? 15   GLY A N   1 
ATOM   109  C  CA  . GLY A 1 15  ? -32.531 0.084   16.450  1.00   24.29  ? 15   GLY A CA  1 
ATOM   110  C  C   . GLY A 1 15  ? -33.166 0.003   15.077  1.00   31.65  ? 15   GLY A C   1 
ATOM   111  O  O   . GLY A 1 15  ? -33.465 -1.086  14.594  1.00   28.09  ? 15   GLY A O   1 
ATOM   112  N  N   . THR A 1 16  ? -33.395 1.163   14.466  1.00   25.77  ? 16   THR A N   1 
ATOM   113  C  CA  . THR A 1 16  ? -33.882 1.247   13.099  1.00   37.31  ? 16   THR A CA  1 
ATOM   114  C  C   . THR A 1 16  ? -33.053 2.276   12.344  1.00   49.10  ? 16   THR A C   1 
ATOM   115  O  O   . THR A 1 16  ? -32.642 3.289   12.913  1.00   49.14  ? 16   THR A O   1 
ATOM   116  C  CB  . THR A 1 16  ? -35.341 1.683   13.089  1.00   42.03  ? 16   THR A CB  1 
ATOM   117  O  OG1 . THR A 1 16  ? -36.121 0.712   13.805  1.00   38.98  ? 16   THR A OG1 1 
ATOM   118  C  CG2 . THR A 1 16  ? -35.852 1.828   11.654  1.00   45.82  ? 16   THR A CG2 1 
ATOM   119  N  N   . GLY A 1 17  ? -32.793 2.011   11.068  1.00   55.84  ? 17   GLY A N   1 
ATOM   120  C  CA  . GLY A 1 17  ? -31.993 2.913   10.256  1.00   60.08  ? 17   GLY A CA  1 
ATOM   121  C  C   . GLY A 1 17  ? -32.352 2.839   8.788   1.00   64.98  ? 17   GLY A C   1 
ATOM   122  O  O   . GLY A 1 17  ? -33.431 2.363   8.441   1.00   69.77  ? 17   GLY A O   1 
ATOM   123  N  N   . TYR A 1 19  ? -30.527 1.412   6.875   1.00   68.20  ? 19   TYR A N   1 
ATOM   124  C  CA  . TYR A 1 19  ? -30.040 0.071   6.556   1.00   68.80  ? 19   TYR A CA  1 
ATOM   125  C  C   . TYR A 1 19  ? -31.149 -0.978  6.676   1.00   65.37  ? 19   TYR A C   1 
ATOM   126  O  O   . TYR A 1 19  ? -31.188 -1.947  5.917   1.00   61.73  ? 19   TYR A O   1 
ATOM   127  C  CB  . TYR A 1 19  ? -28.867 -0.302  7.468   1.00   62.65  ? 19   TYR A CB  1 
ATOM   128  C  CG  . TYR A 1 19  ? -29.200 -0.231  8.940   1.00   64.36  ? 19   TYR A CG  1 
ATOM   129  C  CD1 . TYR A 1 19  ? -29.079 0.962   9.645   1.00   64.86  ? 19   TYR A CD1 1 
ATOM   130  C  CD2 . TYR A 1 19  ? -29.639 -1.358  9.628   1.00   68.50  ? 19   TYR A CD2 1 
ATOM   131  C  CE1 . TYR A 1 19  ? -29.388 1.032   10.998  1.00   61.35  ? 19   TYR A CE1 1 
ATOM   132  C  CE2 . TYR A 1 19  ? -29.950 -1.299  10.980  1.00   61.53  ? 19   TYR A CE2 1 
ATOM   133  C  CZ  . TYR A 1 19  ? -29.826 -0.102  11.657  1.00   57.43  ? 19   TYR A CZ  1 
ATOM   134  O  OH  . TYR A 1 19  ? -30.142 -0.036  12.992  1.00   49.16  ? 19   TYR A OH  1 
ATOM   135  N  N   . GLY A 1 20  ? -32.056 -0.759  7.624   1.00   62.01  ? 20   GLY A N   1 
ATOM   136  C  CA  . GLY A 1 20  ? -33.075 -1.731  7.989   1.00   56.00  ? 20   GLY A CA  1 
ATOM   137  C  C   . GLY A 1 20  ? -33.196 -1.684  9.504   1.00   50.71  ? 20   GLY A C   1 
ATOM   138  O  O   . GLY A 1 20  ? -33.102 -0.605  10.092  1.00   42.97  ? 20   GLY A O   1 
ATOM   139  N  N   . ARG A 1 21  ? -33.375 -2.825  10.162  1.00   38.28  ? 21   ARG A N   1 
ATOM   140  C  CA  . ARG A 1 21  ? -33.464 -2.762  11.615  1.00   37.11  ? 21   ARG A CA  1 
ATOM   141  C  C   . ARG A 1 21  ? -32.737 -3.883  12.355  1.00   30.69  ? 21   ARG A C   1 
ATOM   142  O  O   . ARG A 1 21  ? -32.501 -4.964  11.824  1.00   26.19  ? 21   ARG A O   1 
ATOM   143  C  CB  . ARG A 1 21  ? -34.923 -2.665  12.062  1.00   32.41  ? 21   ARG A CB  1 
ATOM   144  C  CG  . ARG A 1 21  ? -35.682 -3.947  11.998  1.00   35.81  ? 21   ARG A CG  1 
ATOM   145  C  CD  . ARG A 1 21  ? -37.192 -3.697  12.149  1.00   35.81  ? 21   ARG A CD  1 
ATOM   146  N  NE  . ARG A 1 21  ? -37.942 -4.899  11.813  1.00   38.73  ? 21   ARG A NE  1 
ATOM   147  C  CZ  . ARG A 1 21  ? -39.203 -5.123  12.158  1.00   42.12  ? 21   ARG A CZ  1 
ATOM   148  N  NH1 . ARG A 1 21  ? -39.862 -4.229  12.876  1.00   41.84  ? 21   ARG A NH1 1 
ATOM   149  N  NH2 . ARG A 1 21  ? -39.794 -6.252  11.804  1.00   49.20  ? 21   ARG A NH2 1 
ATOM   150  N  N   . CYS A 1 22  ? -32.393 -3.602  13.597  1.00   21.48  ? 22   CYS A N   1 
ATOM   151  C  CA  A CYS A 1 22  ? -31.659 -4.533  14.441  0.66   17.03  ? 22   CYS A CA  1 
ATOM   152  C  CA  B CYS A 1 22  ? -31.697 -4.579  14.414  0.34   17.52  ? 22   CYS A CA  1 
ATOM   153  C  C   . CYS A 1 22  ? -32.589 -4.972  15.572  1.00   19.43  ? 22   CYS A C   1 
ATOM   154  O  O   . CYS A 1 22  ? -33.195 -4.132  16.227  1.00   18.66  ? 22   CYS A O   1 
ATOM   155  C  CB  A CYS A 1 22  ? -30.436 -3.813  15.015  0.66   18.67  ? 22   CYS A CB  1 
ATOM   156  C  CB  B CYS A 1 22  ? -30.362 -4.027  14.908  0.34   17.69  ? 22   CYS A CB  1 
ATOM   157  S  SG  A CYS A 1 22  ? -29.295 -4.843  15.919  0.66   19.61  ? 22   CYS A SG  1 
ATOM   158  S  SG  B CYS A 1 22  ? -29.125 -3.892  13.603  0.34   18.04  ? 22   CYS A SG  1 
ATOM   159  N  N   . GLN A 1 23  ? -32.699 -6.271  15.800  1.00   16.01  ? 23   GLN A N   1 
ATOM   160  C  CA  . GLN A 1 23  ? -33.624 -6.752  16.814  1.00   15.52  ? 23   GLN A CA  1 
ATOM   161  C  C   . GLN A 1 23  ? -32.949 -7.719  17.744  1.00   16.31  ? 23   GLN A C   1 
ATOM   162  O  O   . GLN A 1 23  ? -32.089 -8.506  17.338  1.00   15.51  ? 23   GLN A O   1 
ATOM   163  C  CB  . GLN A 1 23  ? -34.818 -7.470  16.165  1.00   12.19  ? 23   GLN A CB  1 
ATOM   164  C  CG  . GLN A 1 23  ? -35.474 -6.664  15.076  1.00   15.49  ? 23   GLN A CG  1 
ATOM   165  C  CD  . GLN A 1 23  ? -36.755 -7.301  14.607  1.00   19.78  ? 23   GLN A CD  1 
ATOM   166  O  OE1 . GLN A 1 23  ? -36.721 -8.323  13.951  1.00   24.56  ? 23   GLN A OE1 1 
ATOM   167  N  NE2 . GLN A 1 23  ? -37.888 -6.692  14.938  1.00   18.39  ? 23   GLN A NE2 1 
ATOM   168  N  N   . LYS A 1 24  ? -33.365 -7.678  19.000  1.00   18.20  ? 24   LYS A N   1 
ATOM   169  C  CA  . LYS A 1 24  ? -32.891 -8.640  19.967  1.00   15.82  ? 24   LYS A CA  1 
ATOM   170  C  C   . LYS A 1 24  ? -33.735 -9.894  19.807  1.00   17.32  ? 24   LYS A C   1 
ATOM   171  O  O   . LYS A 1 24  ? -34.966 -9.805  19.709  1.00   22.43  ? 24   LYS A O   1 
ATOM   172  C  CB  . LYS A 1 24  ? -32.995 -8.055  21.369  1.00   15.34  ? 24   LYS A CB  1 
ATOM   173  C  CG  . LYS A 1 24  ? -32.648 -8.999  22.497  1.00   18.81  ? 24   LYS A CG  1 
ATOM   174  C  CD  . LYS A 1 24  ? -32.613 -8.197  23.817  1.00   23.04  ? 24   LYS A CD  1 
ATOM   175  C  CE  . LYS A 1 24  ? -32.233 -9.083  24.994  1.00   27.67  ? 24   LYS A CE  1 
ATOM   176  N  NZ  . LYS A 1 24  ? -32.400 -8.370  26.293  1.00   24.81  ? 24   LYS A NZ  1 
ATOM   177  N  N   . ILE A 1 25  ? -33.095 -11.061 19.742  1.00   15.29  ? 25   ILE A N   1 
ATOM   178  C  CA  . ILE A 1 25  ? -33.837 -12.291 19.435  1.00   23.26  ? 25   ILE A CA  1 
ATOM   179  C  C   . ILE A 1 25  ? -33.412 -13.421 20.351  1.00   18.56  ? 25   ILE A C   1 
ATOM   180  O  O   . ILE A 1 25  ? -32.397 -13.335 21.027  1.00   18.09  ? 25   ILE A O   1 
ATOM   181  C  CB  . ILE A 1 25  ? -33.624 -12.768 17.978  1.00   15.27  ? 25   ILE A CB  1 
ATOM   182  C  CG1 . ILE A 1 25  ? -32.157 -13.246 17.810  1.00   18.40  ? 25   ILE A CG1 1 
ATOM   183  C  CG2 . ILE A 1 25  ? -33.981 -11.647 16.997  1.00   14.68  ? 25   ILE A CG2 1 
ATOM   184  C  CD1 . ILE A 1 25  ? -31.789 -13.670 16.425  1.00   18.04  ? 25   ILE A CD1 1 
ATOM   185  N  N   . ARG A 1 26  ? -34.194 -14.490 20.353  1.00   18.12  ? 26   ARG A N   1 
ATOM   186  C  CA  . ARG A 1 26  ? -33.893 -15.631 21.198  1.00   21.54  ? 26   ARG A CA  1 
ATOM   187  C  C   . ARG A 1 26  ? -33.907 -16.921 20.370  0.94   26.07  ? 26   ARG A C   1 
ATOM   188  O  O   . ARG A 1 26  ? -34.894 -17.244 19.705  1.00   30.96  ? 26   ARG A O   1 
ATOM   189  C  CB  . ARG A 1 26  ? -34.898 -15.710 22.364  1.00   24.19  ? 26   ARG A CB  1 
ATOM   190  C  CG  . ARG A 1 26  ? -34.657 -16.875 23.317  1.00   25.00  ? 26   ARG A CG  1 
ATOM   191  C  CD  . ARG A 1 26  ? -35.966 -17.326 23.958  0.69   39.45  ? 26   ARG A CD  1 
ATOM   192  N  NE  . ARG A 1 26  ? -36.200 -16.617 25.207  1.00   41.50  ? 26   ARG A NE  1 
ATOM   193  C  CZ  . ARG A 1 26  ? -37.390 -16.210 25.646  0.72   41.64  ? 26   ARG A CZ  1 
ATOM   194  N  NH1 . ARG A 1 26  ? -37.478 -15.567 26.802  0.58   39.07  ? 26   ARG A NH1 1 
ATOM   195  N  NH2 . ARG A 1 26  ? -38.486 -16.442 24.944  1.00   43.45  ? 26   ARG A NH2 1 
ATOM   196  N  N   . ARG A 1 27  ? -32.795 -17.648 20.397  1.00   24.57  ? 27   ARG A N   1 
ATOM   197  C  CA  . ARG A 1 27  ? -32.691 -18.899 19.678  1.00   27.97  ? 27   ARG A CA  1 
ATOM   198  C  C   . ARG A 1 27  ? -33.578 -19.931 20.385  1.00   32.82  ? 27   ARG A C   1 
ATOM   199  O  O   . ARG A 1 27  ? -33.457 -20.137 21.595  1.00   32.23  ? 27   ARG A O   1 
ATOM   200  C  CB  . ARG A 1 27  ? -31.218 -19.339 19.584  1.00   24.76  ? 27   ARG A CB  1 
ATOM   201  C  CG  . ARG A 1 27  ? -31.010 -20.516 18.620  1.00   30.48  ? 27   ARG A CG  1 
ATOM   202  C  CD  . ARG A 1 27  ? -29.537 -20.770 18.303  1.00   29.64  ? 27   ARG A CD  1 
ATOM   203  N  NE  . ARG A 1 27  ? -28.708 -20.961 19.492  1.00   29.43  ? 27   ARG A NE  1 
ATOM   204  C  CZ  . ARG A 1 27  ? -27.378 -20.913 19.473  1.00   37.17  ? 27   ARG A CZ  1 
ATOM   205  N  NH1 . ARG A 1 27  ? -26.748 -20.650 18.335  1.00   37.55  ? 27   ARG A NH1 1 
ATOM   206  N  NH2 . ARG A 1 27  ? -26.673 -21.105 20.587  1.00   32.59  ? 27   ARG A NH2 1 
ATOM   207  N  N   . LYS A 1 28  ? -34.512 -20.530 19.643  1.00   26.38  ? 28   LYS A N   1 
ATOM   208  C  CA  . LYS A 1 28  ? -35.475 -21.449 20.237  1.00   33.37  ? 28   LYS A CA  1 
ATOM   209  C  C   . LYS A 1 28  ? -34.852 -22.698 20.865  1.00   40.37  ? 28   LYS A C   1 
ATOM   210  O  O   . LYS A 1 28  ? -35.294 -23.151 21.925  1.00   37.54  ? 28   LYS A O   1 
ATOM   211  C  CB  . LYS A 1 28  ? -36.530 -21.879 19.211  1.00   36.51  ? 28   LYS A CB  1 
ATOM   212  C  CG  . LYS A 1 28  ? -37.594 -20.832 18.941  1.00   33.39  ? 28   LYS A CG  1 
ATOM   213  C  CD  . LYS A 1 28  ? -38.725 -21.427 18.095  1.00   37.05  ? 28   LYS A CD  1 
ATOM   214  C  CE  . LYS A 1 28  ? -39.695 -20.357 17.683  1.00   34.13  ? 28   LYS A CE  1 
ATOM   215  N  NZ  . LYS A 1 28  ? -40.642 -20.838 16.652  1.00   30.63  ? 28   LYS A NZ  1 
ATOM   216  N  N   . SER A 1 29  ? -33.835 -23.251 20.214  1.00   36.00  ? 29   SER A N   1 
ATOM   217  C  CA  . SER A 1 29  ? -33.292 -24.549 20.633  1.00   46.73  ? 29   SER A CA  1 
ATOM   218  C  C   . SER A 1 29  ? -32.720 -24.550 22.055  1.00   43.27  ? 29   SER A C   1 
ATOM   219  O  O   . SER A 1 29  ? -32.889 -25.522 22.785  1.00   49.20  ? 29   SER A O   1 
ATOM   220  C  CB  . SER A 1 29  ? -32.236 -25.043 19.641  1.00   37.41  ? 29   SER A CB  1 
ATOM   221  O  OG  . SER A 1 29  ? -31.126 -24.154 19.614  1.00   34.62  ? 29   SER A OG  1 
ATOM   222  N  N   . ASP A 1 30  ? -32.055 -23.467 22.442  1.00   35.27  ? 30   ASP A N   1 
ATOM   223  C  CA  . ASP A 1 30  ? -31.361 -23.414 23.727  1.00   36.35  ? 30   ASP A CA  1 
ATOM   224  C  C   . ASP A 1 30  ? -31.588 -22.106 24.503  1.00   34.78  ? 30   ASP A C   1 
ATOM   225  O  O   . ASP A 1 30  ? -31.066 -21.920 25.602  1.00   32.49  ? 30   ASP A O   1 
ATOM   226  C  CB  . ASP A 1 30  ? -29.860 -23.653 23.523  1.00   41.08  ? 30   ASP A CB  1 
ATOM   227  C  CG  . ASP A 1 30  ? -29.211 -22.584 22.660  1.00   44.95  ? 30   ASP A CG  1 
ATOM   228  O  OD1 . ASP A 1 30  ? -29.942 -21.760 22.074  1.00   34.33  ? 30   ASP A OD1 1 
ATOM   229  O  OD2 . ASP A 1 30  ? -27.969 -22.565 22.568  1.00   52.29  ? 30   ASP A OD2 1 
ATOM   230  N  N   . GLY A 1 31  ? -32.367 -21.196 23.935  1.00   32.68  ? 31   GLY A N   1 
ATOM   231  C  CA  . GLY A 1 31  ? -32.666 -19.945 24.616  1.00   24.30  ? 31   GLY A CA  1 
ATOM   232  C  C   . GLY A 1 31  ? -31.604 -18.866 24.476  1.00   25.74  ? 31   GLY A C   1 
ATOM   233  O  O   . GLY A 1 31  ? -31.680 -17.840 25.132  1.00   25.26  ? 31   GLY A O   1 
ATOM   234  N  N   . LYS A 1 32  ? -30.610 -19.082 23.621  1.00   23.53  ? 32   LYS A N   1 
ATOM   235  C  CA  . LYS A 1 32  ? -29.511 -18.130 23.548  1.00   21.30  ? 32   LYS A CA  1 
ATOM   236  C  C   . LYS A 1 32  ? -29.986 -16.788 23.043  1.00   22.16  ? 32   LYS A C   1 
ATOM   237  O  O   . LYS A 1 32  ? -30.703 -16.712 22.053  1.00   21.50  ? 32   LYS A O   1 
ATOM   238  C  CB  . LYS A 1 32  ? -28.371 -18.627 22.662  1.00   23.75  ? 32   LYS A CB  1 
ATOM   239  C  CG  . LYS A 1 32  ? -27.203 -17.616 22.618  1.00   24.63  ? 32   LYS A CG  1 
ATOM   240  C  CD  . LYS A 1 32  ? -25.868 -18.310 22.860  1.00   38.17  ? 32   LYS A CD  1 
ATOM   241  C  CE  . LYS A 1 32  ? -24.695 -17.341 22.831  1.00   44.15  ? 32   LYS A CE  1 
ATOM   242  N  NZ  . LYS A 1 32  ? -24.521 -16.566 24.099  1.00   40.55  ? 32   LYS A NZ  1 
ATOM   243  N  N   . ILE A 1 33  ? -29.558 -15.727 23.712  1.00   21.54  ? 33   ILE A N   1 
ATOM   244  C  CA  . ILE A 1 33  ? -29.931 -14.372 23.323  1.00   20.29  ? 33   ILE A CA  1 
ATOM   245  C  C   . ILE A 1 33  ? -28.946 -13.812 22.288  1.00   21.44  ? 33   ILE A C   1 
ATOM   246  O  O   . ILE A 1 33  ? -27.749 -13.813 22.511  1.00   23.99  ? 33   ILE A O   1 
ATOM   247  C  CB  . ILE A 1 33  ? -29.934 -13.458 24.555  1.00   24.77  ? 33   ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1 33  ? -30.927 -13.978 25.613  1.00   27.62  ? 33   ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1 33  ? -30.236 -12.032 24.161  1.00   19.51  ? 33   ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1 33  ? -32.378 -14.101 25.119  1.00   20.73  ? 33   ILE A CD1 1 
ATOM   251  N  N   . LEU A 1 34  ? -29.455 -13.331 21.156  1.00   20.25  ? 34   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 34  ? -28.599 -12.859 20.070  1.00   20.82  ? 34   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 34  ? -29.221 -11.590 19.529  1.00   15.58  ? 34   LEU A C   1 
ATOM   254  O  O   . LEU A 1 34  ? -30.193 -11.093 20.081  1.00   16.87  ? 34   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 34  ? -28.538 -13.915 18.949  1.00   16.70  ? 34   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 34  ? -27.864 -15.223 19.376  1.00   15.50  ? 34   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 34  ? -28.253 -16.407 18.493  1.00   21.38  ? 34   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 34  ? -26.346 -15.030 19.434  1.00   19.26  ? 34   LEU A CD2 1 
ATOM   259  N  N   . VAL A 1 35  ? -28.683 -11.062 18.442  1.00   12.68  ? 35   VAL A N   1 
ATOM   260  C  CA  . VAL A 1 35  ? -29.424 -10.051 17.718  1.00   10.26  ? 35   VAL A CA  1 
ATOM   261  C  C   . VAL A 1 35  ? -29.370 -10.388 16.249  1.00   16.08  ? 35   VAL A C   1 
ATOM   262  O  O   . VAL A 1 35  ? -28.549 -11.212 15.825  1.00   20.39  ? 35   VAL A O   1 
ATOM   263  C  CB  . VAL A 1 35  ? -28.880 -8.606  17.969  1.00   20.72  ? 35   VAL A CB  1 
ATOM   264  C  CG1 . VAL A 1 35  ? -28.781 -8.316  19.450  1.00   17.33  ? 35   VAL A CG1 1 
ATOM   265  C  CG2 . VAL A 1 35  ? -27.561 -8.420  17.307  1.00   21.97  ? 35   VAL A CG2 1 
ATOM   266  N  N   . TRP A 1 36  ? -30.252 -9.785  15.461  1.00   13.02  ? 36   TRP A N   1 
ATOM   267  C  CA  . TRP A 1 36  ? -30.063 -9.872  14.021  1.00   18.55  ? 36   TRP A CA  1 
ATOM   268  C  C   . TRP A 1 36  ? -30.268 -8.535  13.357  1.00   18.94  ? 36   TRP A C   1 
ATOM   269  O  O   . TRP A 1 36  ? -30.987 -7.698  13.878  1.00   18.10  ? 36   TRP A O   1 
ATOM   270  C  CB  . TRP A 1 36  ? -30.879 -10.993 13.343  1.00   16.42  ? 36   TRP A CB  1 
ATOM   271  C  CG  . TRP A 1 36  ? -32.398 -10.892 13.324  1.00   18.02  ? 36   TRP A CG  1 
ATOM   272  C  CD1 . TRP A 1 36  ? -33.182 -9.762  13.447  1.00   16.89  ? 36   TRP A CD1 1 
ATOM   273  C  CD2 . TRP A 1 36  ? -33.306 -11.984 13.113  1.00   19.09  ? 36   TRP A CD2 1 
ATOM   274  N  NE1 . TRP A 1 36  ? -34.515 -10.112 13.370  1.00   19.83  ? 36   TRP A NE1 1 
ATOM   275  C  CE2 . TRP A 1 36  ? -34.612 -11.469 13.188  1.00   18.81  ? 36   TRP A CE2 1 
ATOM   276  C  CE3 . TRP A 1 36  ? -33.134 -13.368 12.936  1.00   23.31  ? 36   TRP A CE3 1 
ATOM   277  C  CZ2 . TRP A 1 36  ? -35.756 -12.285 13.021  1.00   20.48  ? 36   TRP A CZ2 1 
ATOM   278  C  CZ3 . TRP A 1 36  ? -34.261 -14.169 12.806  1.00   27.08  ? 36   TRP A CZ3 1 
ATOM   279  C  CH2 . TRP A 1 36  ? -35.552 -13.623 12.850  1.00   25.60  ? 36   TRP A CH2 1 
ATOM   280  N  N   . LYS A 1 37  ? -29.567 -8.337  12.241  1.00   18.45  ? 37   LYS A N   1 
ATOM   281  C  CA  . LYS A 1 37  ? -29.794 -7.211  11.348  1.00   19.46  ? 37   LYS A CA  1 
ATOM   282  C  C   . LYS A 1 37  ? -30.695 -7.684  10.218  1.00   26.93  ? 37   LYS A C   1 
ATOM   283  O  O   . LYS A 1 37  ? -30.394 -8.670  9.531   1.00   26.65  ? 37   LYS A O   1 
ATOM   284  C  CB  . LYS A 1 37  ? -28.471 -6.704  10.762  1.00   24.62  ? 37   LYS A CB  1 
ATOM   285  C  CG  . LYS A 1 37  ? -27.630 -5.961  11.763  1.00   43.74  ? 37   LYS A CG  1 
ATOM   286  C  CD  . LYS A 1 37  ? -26.580 -5.071  11.096  1.00   59.39  ? 37   LYS A CD  1 
ATOM   287  C  CE  . LYS A 1 37  ? -25.432 -5.875  10.485  1.00   61.36  ? 37   LYS A CE  1 
ATOM   288  N  NZ  . LYS A 1 37  ? -24.291 -4.986  10.111  1.00   63.01  ? 37   LYS A NZ  1 
ATOM   289  N  N   . GLU A 1 38  ? -31.804 -6.973  10.047  1.00   21.54  ? 38   GLU A N   1 
ATOM   290  C  CA  . GLU A 1 38  ? -32.832 -7.319  9.071   1.00   28.60  ? 38   GLU A CA  1 
ATOM   291  C  C   . GLU A 1 38  ? -32.662 -6.400  7.878   1.00   31.21  ? 38   GLU A C   1 
ATOM   292  O  O   . GLU A 1 38  ? -32.752 -5.183  8.016   1.00   34.39  ? 38   GLU A O   1 
ATOM   293  C  CB  . GLU A 1 38  ? -34.211 -7.100  9.695   1.00   35.13  ? 38   GLU A CB  1 
ATOM   294  C  CG  . GLU A 1 38  ? -35.353 -7.759  8.937   1.00   49.72  ? 38   GLU A CG  1 
ATOM   295  C  CD  . GLU A 1 38  ? -36.702 -7.349  9.472   1.00   55.51  ? 38   GLU A CD  1 
ATOM   296  O  OE1 . GLU A 1 38  ? -36.834 -6.177  9.867   1.00   59.10  ? 38   GLU A OE1 1 
ATOM   297  O  OE2 . GLU A 1 38  ? -37.624 -8.191  9.498   1.00   60.25  ? 38   GLU A OE2 1 
ATOM   298  N  N   . LEU A 1 39  ? -32.393 -6.971  6.710   1.00   29.35  ? 39   LEU A N   1 
ATOM   299  C  CA  . LEU A 1 39  ? -32.139 -6.164  5.518   1.00   28.11  ? 39   LEU A CA  1 
ATOM   300  C  C   . LEU A 1 39  ? -33.074 -6.572  4.369   1.00   28.60  ? 39   LEU A C   1 
ATOM   301  O  O   . LEU A 1 39  ? -33.153 -7.747  4.022   0.74   25.44  ? 39   LEU A O   1 
ATOM   302  C  CB  . LEU A 1 39  ? -30.681 -6.313  5.090   1.00   34.98  ? 39   LEU A CB  1 
ATOM   303  C  CG  . LEU A 1 39  ? -29.674 -6.296  6.249   0.52   42.16  ? 39   LEU A CG  1 
ATOM   304  C  CD1 . LEU A 1 39  ? -28.322 -6.827  5.815   0.99   44.15  ? 39   LEU A CD1 1 
ATOM   305  C  CD2 . LEU A 1 39  ? -29.534 -4.900  6.852   0.42   43.45  ? 39   LEU A CD2 1 
ATOM   306  N  N   . ASP A 1 40  ? -33.794 -5.611  3.800   1.00   34.20  ? 40   ASP A N   1 
ATOM   307  C  CA  . ASP A 1 40  ? -34.681 -5.891  2.650   1.00   39.98  ? 40   ASP A CA  1 
ATOM   308  C  C   . ASP A 1 40  ? -33.864 -5.697  1.386   1.00   40.76  ? 40   ASP A C   1 
ATOM   309  O  O   . ASP A 1 40  ? -33.402 -4.597  1.103   1.00   42.63  ? 40   ASP A O   1 
ATOM   310  C  CB  . ASP A 1 40  ? -35.890 -4.953  2.658   1.00   37.12  ? 40   ASP A CB  1 
ATOM   311  C  CG  . ASP A 1 40  ? -36.885 -5.238  1.532   1.00   50.17  ? 40   ASP A CG  1 
ATOM   312  O  OD1 . ASP A 1 40  ? -36.512 -5.870  0.516   1.00   49.06  ? 40   ASP A OD1 1 
ATOM   313  O  OD2 . ASP A 1 40  ? -38.057 -4.815  1.666   1.00   53.04  ? 40   ASP A OD2 1 
ATOM   314  N  N   . TYR A 1 41  ? -33.650 -6.771  0.642   1.00   39.31  ? 41   TYR A N   1 
ATOM   315  C  CA  . TYR A 1 41  ? -32.815 -6.687  -0.552  1.00   43.49  ? 41   TYR A CA  1 
ATOM   316  C  C   . TYR A 1 41  ? -33.649 -6.647  -1.837  1.00   43.26  ? 41   TYR A C   1 
ATOM   317  O  O   . TYR A 1 41  ? -33.115 -6.776  -2.928  1.00   48.48  ? 41   TYR A O   1 
ATOM   318  C  CB  . TYR A 1 41  ? -31.836 -7.862  -0.603  1.00   49.06  ? 41   TYR A CB  1 
ATOM   319  C  CG  . TYR A 1 41  ? -32.516 -9.209  -0.674  1.00   48.49  ? 41   TYR A CG  1 
ATOM   320  C  CD1 . TYR A 1 41  ? -33.023 -9.689  -1.875  1.00   49.18  ? 41   TYR A CD1 1 
ATOM   321  C  CD2 . TYR A 1 41  ? -32.657 -10.001 0.458   1.00   46.91  ? 41   TYR A CD2 1 
ATOM   322  C  CE1 . TYR A 1 41  ? -33.651 -10.914 -1.945  1.00   53.30  ? 41   TYR A CE1 1 
ATOM   323  C  CE2 . TYR A 1 41  ? -33.288 -11.232 0.395   1.00   42.53  ? 41   TYR A CE2 1 
ATOM   324  C  CZ  . TYR A 1 41  ? -33.776 -11.684 -0.810  1.00   52.65  ? 41   TYR A CZ  1 
ATOM   325  O  OH  . TYR A 1 41  ? -34.402 -12.908 -0.886  1.00   56.02  ? 41   TYR A OH  1 
ATOM   326  N  N   . GLY A 1 42  ? -34.956 -6.469  -1.698  1.00   44.75  ? 42   GLY A N   1 
ATOM   327  C  CA  . GLY A 1 42  ? -35.853 -6.447  -2.844  1.00   44.71  ? 42   GLY A CA  1 
ATOM   328  C  C   . GLY A 1 42  ? -35.584 -5.377  -3.894  1.00   47.02  ? 42   GLY A C   1 
ATOM   329  O  O   . GLY A 1 42  ? -35.879 -5.584  -5.071  1.00   46.42  ? 42   GLY A O   1 
ATOM   330  N  N   . SER A 1 43  ? -35.029 -4.238  -3.482  1.00   37.02  ? 43   SER A N   1 
ATOM   331  C  CA  . SER A 1 43  ? -34.728 -3.143  -4.408  1.00   50.18  ? 43   SER A CA  1 
ATOM   332  C  C   . SER A 1 43  ? -33.299 -3.179  -4.941  1.00   51.14  ? 43   SER A C   1 
ATOM   333  O  O   . SER A 1 43  ? -32.871 -2.276  -5.662  1.00   56.52  ? 43   SER A O   1 
ATOM   334  C  CB  . SER A 1 43  ? -34.997 -1.784  -3.750  1.00   60.49  ? 43   SER A CB  1 
ATOM   335  O  OG  . SER A 1 43  ? -36.367 -1.638  -3.408  1.00   65.79  ? 43   SER A OG  1 
ATOM   336  N  N   . MET A 1 44  ? -32.567 -4.227  -4.588  1.00   43.28  ? 44   MET A N   1 
ATOM   337  C  CA  . MET A 1 44  ? -31.163 -4.348  -4.958  1.00   36.67  ? 44   MET A CA  1 
ATOM   338  C  C   . MET A 1 44  ? -30.947 -5.007  -6.310  1.00   47.01  ? 44   MET A C   1 
ATOM   339  O  O   . MET A 1 44  ? -31.698 -5.895  -6.715  1.00   44.15  ? 44   MET A O   1 
ATOM   340  C  CB  . MET A 1 44  ? -30.420 -5.140  -3.893  1.00   34.70  ? 44   MET A CB  1 
ATOM   341  C  CG  . MET A 1 44  ? -30.251 -4.374  -2.604  1.00   39.27  ? 44   MET A CG  1 
ATOM   342  S  SD  . MET A 1 44  ? -29.453 -5.344  -1.314  1.00   50.77  ? 44   MET A SD  1 
ATOM   343  C  CE  . MET A 1 44  ? -29.628 -4.212  0.063   1.00   56.69  ? 44   MET A CE  1 
ATOM   344  N  N   . THR A 1 45  ? -29.906 -4.573  -7.005  1.00   48.97  ? 45   THR A N   1 
ATOM   345  C  CA  . THR A 1 45  ? -29.564 -5.176  -8.284  1.00   55.27  ? 45   THR A CA  1 
ATOM   346  C  C   . THR A 1 45  ? -28.757 -6.435  -8.017  1.00   49.41  ? 45   THR A C   1 
ATOM   347  O  O   . THR A 1 45  ? -28.371 -6.693  -6.880  1.00   46.48  ? 45   THR A O   1 
ATOM   348  C  CB  . THR A 1 45  ? -28.736 -4.222  -9.132  1.00   61.76  ? 45   THR A CB  1 
ATOM   349  O  OG1 . THR A 1 45  ? -27.535 -3.894  -8.422  1.00   61.74  ? 45   THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 45  ? -29.528 -2.947  -9.413  1.00   59.66  ? 45   THR A CG2 1 
ATOM   351  N  N   . GLU A 1 46  ? -28.501 -7.226  -9.052  1.00   49.44  ? 46   GLU A N   1 
ATOM   352  C  CA  . GLU A 1 46  ? -27.701 -8.426  -8.858  1.00   51.97  ? 46   GLU A CA  1 
ATOM   353  C  C   . GLU A 1 46  ? -26.312 -8.039  -8.343  1.00   54.93  ? 46   GLU A C   1 
ATOM   354  O  O   . GLU A 1 46  ? -25.799 -8.658  -7.412  1.00   50.80  ? 46   GLU A O   1 
ATOM   355  C  CB  . GLU A 1 46  ? -27.640 -9.260  -10.138 1.00   54.75  ? 46   GLU A CB  1 
ATOM   356  C  CG  . GLU A 1 46  ? -29.032 -9.690  -10.617 1.00   60.10  ? 46   GLU A CG  1 
ATOM   357  C  CD  . GLU A 1 46  ? -28.995 -10.754 -11.707 1.00   72.98  ? 46   GLU A CD  1 
ATOM   358  O  OE1 . GLU A 1 46  ? -27.885 -11.179 -12.095 1.00   83.28  ? 46   GLU A OE1 1 
ATOM   359  O  OE2 . GLU A 1 46  ? -30.079 -11.170 -12.170 1.00   71.18  ? 46   GLU A OE2 1 
ATOM   360  N  N   . ALA A 1 47  ? -25.744 -6.981  -8.919  1.00   58.22  ? 47   ALA A N   1 
ATOM   361  C  CA  . ALA A 1 47  ? -24.423 -6.485  -8.534  1.00   65.32  ? 47   ALA A CA  1 
ATOM   362  C  C   . ALA A 1 47  ? -24.360 -6.135  -7.056  1.00   65.11  ? 47   ALA A C   1 
ATOM   363  O  O   . ALA A 1 47  ? -23.467 -6.587  -6.339  1.00   72.71  ? 47   ALA A O   1 
ATOM   364  C  CB  . ALA A 1 47  ? -24.047 -5.279  -9.373  1.00   67.05  ? 47   ALA A CB  1 
ATOM   365  N  N   . GLU A 1 48  ? -25.310 -5.325  -6.602  1.00   60.98  ? 48   GLU A N   1 
ATOM   366  C  CA  . GLU A 1 48  ? -25.367 -4.952  -5.197  1.00   56.14  ? 48   GLU A CA  1 
ATOM   367  C  C   . GLU A 1 48  ? -25.619 -6.159  -4.310  1.00   54.76  ? 48   GLU A C   1 
ATOM   368  O  O   . GLU A 1 48  ? -25.078 -6.249  -3.214  1.00   54.09  ? 48   GLU A O   1 
ATOM   369  C  CB  . GLU A 1 48  ? -26.443 -3.897  -4.958  1.00   59.13  ? 48   GLU A CB  1 
ATOM   370  C  CG  . GLU A 1 48  ? -26.227 -2.613  -5.735  1.00   66.26  ? 48   GLU A CG  1 
ATOM   371  C  CD  . GLU A 1 48  ? -27.320 -1.604  -5.473  1.00   76.69  ? 48   GLU A CD  1 
ATOM   372  O  OE1 . GLU A 1 48  ? -27.981 -1.711  -4.420  1.00   80.77  ? 48   GLU A OE1 1 
ATOM   373  O  OE2 . GLU A 1 48  ? -27.523 -0.708  -6.318  1.00   82.19  ? 48   GLU A OE2 1 
ATOM   374  N  N   . LYS A 1 49  ? -26.456 -7.084  -4.771  1.00   52.75  ? 49   LYS A N   1 
ATOM   375  C  CA  . LYS A 1 49  ? -26.700 -8.295  -4.000  1.00   46.37  ? 49   LYS A CA  1 
ATOM   376  C  C   . LYS A 1 49  ? -25.413 -9.116  -3.917  1.00   49.69  ? 49   LYS A C   1 
ATOM   377  O  O   . LYS A 1 49  ? -25.166 -9.800  -2.924  1.00   46.41  ? 49   LYS A O   1 
ATOM   378  C  CB  . LYS A 1 49  ? -27.864 -9.110  -4.577  1.00   51.62  ? 49   LYS A CB  1 
ATOM   379  C  CG  . LYS A 1 49  ? -29.249 -8.653  -4.089  1.00   46.88  ? 49   LYS A CG  1 
ATOM   380  C  CD  . LYS A 1 49  ? -30.372 -9.608  -4.549  1.00   41.67  ? 49   LYS A CD  1 
ATOM   381  C  CE  . LYS A 1 49  ? -30.584 -9.564  -6.047  1.00   40.88  ? 49   LYS A CE  1 
ATOM   382  N  NZ  . LYS A 1 49  ? -31.908 -10.174 -6.462  1.00   45.67  ? 49   LYS A NZ  1 
ATOM   383  N  N   . GLN A 1 50  ? -24.583 -9.018  -4.951  1.00   57.99  ? 50   GLN A N   1 
ATOM   384  C  CA  . GLN A 1 50  ? -23.325 -9.760  -5.005  1.00   67.44  ? 50   GLN A CA  1 
ATOM   385  C  C   . GLN A 1 50  ? -22.285 -9.194  -4.043  1.00   70.94  ? 50   GLN A C   1 
ATOM   386  O  O   . GLN A 1 50  ? -21.554 -9.942  -3.397  1.00   67.49  ? 50   GLN A O   1 
ATOM   387  C  CB  . GLN A 1 50  ? -22.760 -9.768  -6.424  1.00   76.27  ? 50   GLN A CB  1 
ATOM   388  C  CG  . GLN A 1 50  ? -21.414 -10.466 -6.545  1.00   85.89  ? 50   GLN A CG  1 
ATOM   389  C  CD  . GLN A 1 50  ? -21.441 -11.901 -6.041  1.00   89.66  ? 50   GLN A CD  1 
ATOM   390  O  OE1 . GLN A 1 50  ? -22.115 -12.761 -6.612  1.00   89.90  ? 50   GLN A OE1 1 
ATOM   391  N  NE2 . GLN A 1 50  ? -20.694 -12.166 -4.971  1.00   88.68  ? 50   GLN A NE2 1 
ATOM   392  N  N   . MET A 1 51  ? -22.223 -7.868  -3.965  1.00   73.31  ? 51   MET A N   1 
ATOM   393  C  CA  . MET A 1 51  ? -21.352 -7.186  -3.019  1.00   69.76  ? 51   MET A CA  1 
ATOM   394  C  C   . MET A 1 51  ? -21.826 -7.407  -1.589  1.00   64.75  ? 51   MET A C   1 
ATOM   395  O  O   . MET A 1 51  ? -21.083 -7.179  -0.644  1.00   65.19  ? 51   MET A O   1 
ATOM   396  C  CB  . MET A 1 51  ? -21.302 -5.683  -3.315  1.00   73.51  ? 51   MET A CB  1 
ATOM   397  C  CG  . MET A 1 51  ? -20.506 -5.305  -4.555  1.00   80.28  ? 51   MET A CG  1 
ATOM   398  S  SD  . MET A 1 51  ? -18.748 -5.004  -4.240  1.00   146.35 ? 51   MET A SD  1 
ATOM   399  C  CE  . MET A 1 51  ? -18.148 -6.652  -3.870  1.00   73.19  ? 51   MET A CE  1 
ATOM   400  N  N   . LEU A 1 52  ? -23.068 -7.843  -1.432  1.00   57.99  ? 52   LEU A N   1 
ATOM   401  C  CA  . LEU A 1 52  ? -23.604 -8.124  -0.108  1.00   52.36  ? 52   LEU A CA  1 
ATOM   402  C  C   . LEU A 1 52  ? -23.163 -9.515  0.334   1.00   49.31  ? 52   LEU A C   1 
ATOM   403  O  O   . LEU A 1 52  ? -22.883 -9.752  1.509   1.00   54.75  ? 52   LEU A O   1 
ATOM   404  C  CB  . LEU A 1 52  ? -25.129 -8.034  -0.120  1.00   51.21  ? 52   LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 52  ? -25.809 -8.235  1.233   1.00   47.80  ? 52   LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 52  ? -25.367 -7.154  2.197   0.56   45.00  ? 52   LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 52  ? -27.326 -8.235  1.083   1.00   49.95  ? 52   LEU A CD2 1 
ATOM   408  N  N   . VAL A 1 53  ? -23.107 -10.432 -0.623  1.00   49.01  ? 53   VAL A N   1 
ATOM   409  C  CA  . VAL A 1 53  ? -22.637 -11.792 -0.373  1.00   54.40  ? 53   VAL A CA  1 
ATOM   410  C  C   . VAL A 1 53  ? -21.180 -11.801 0.087   1.00   53.70  ? 53   VAL A C   1 
ATOM   411  O  O   . VAL A 1 53  ? -20.839 -12.439 1.079   1.00   56.87  ? 53   VAL A O   1 
ATOM   412  C  CB  . VAL A 1 53  ? -22.780 -12.668 -1.638  1.00   55.24  ? 53   VAL A CB  1 
ATOM   413  C  CG1 . VAL A 1 53  ? -22.058 -13.987 -1.463  1.00   55.32  ? 53   VAL A CG1 1 
ATOM   414  C  CG2 . VAL A 1 53  ? -24.251 -12.897 -1.955  1.00   52.70  ? 53   VAL A CG2 1 
ATOM   415  N  N   . SER A 1 54  ? -20.332 -11.080 -0.637  1.00   54.48  ? 54   SER A N   1 
ATOM   416  C  CA  . SER A 1 54  ? -18.909 -11.036 -0.337  0.0000 58.22  ? 54   SER A CA  1 
ATOM   417  C  C   . SER A 1 54  ? -18.674 -10.402 1.028   1.00   57.14  ? 54   SER A C   1 
ATOM   418  O  O   . SER A 1 54  ? -17.932 -10.936 1.847   0.85   58.78  ? 54   SER A O   1 
ATOM   419  C  CB  . SER A 1 54  ? -18.174 -10.257 -1.422  1.00   62.32  ? 54   SER A CB  1 
ATOM   420  O  OG  . SER A 1 54  ? -18.606 -8.910  -1.456  0.76   62.44  ? 54   SER A OG  1 
ATOM   421  N  N   . GLU A 1 55  ? -19.304 -9.254  1.254   1.00   50.39  ? 55   GLU A N   1 
ATOM   422  C  CA  . GLU A 1 55  ? -19.352 -8.625  2.570   1.00   52.35  ? 55   GLU A CA  1 
ATOM   423  C  C   . GLU A 1 55  ? -19.638 -9.629  3.682   1.00   49.25  ? 55   GLU A C   1 
ATOM   424  O  O   . GLU A 1 55  ? -18.867 -9.736  4.633   1.00   50.71  ? 55   GLU A O   1 
ATOM   425  C  CB  . GLU A 1 55  ? -20.425 -7.535  2.591   1.00   63.05  ? 55   GLU A CB  1 
ATOM   426  C  CG  . GLU A 1 55  ? -19.905 -6.137  2.875   1.00   73.99  ? 55   GLU A CG  1 
ATOM   427  C  CD  . GLU A 1 55  ? -20.777 -5.055  2.256   1.00   82.61  ? 55   GLU A CD  1 
ATOM   428  O  OE1 . GLU A 1 55  ? -21.957 -4.928  2.658   1.00   83.83  ? 55   GLU A OE1 1 
ATOM   429  O  OE2 . GLU A 1 55  ? -20.276 -4.331  1.366   1.00   83.70  ? 55   GLU A OE2 1 
ATOM   430  N  N   . VAL A 1 56  ? -20.748 -10.355 3.569   1.00   44.08  ? 56   VAL A N   1 
ATOM   431  C  CA  . VAL A 1 56  ? -21.144 -11.322 4.594   1.00   42.40  ? 56   VAL A CA  1 
ATOM   432  C  C   . VAL A 1 56  ? -20.073 -12.397 4.772   1.00   44.93  ? 56   VAL A C   1 
ATOM   433  O  O   . VAL A 1 56  ? -19.816 -12.862 5.895   1.00   38.60  ? 56   VAL A O   1 
ATOM   434  C  CB  . VAL A 1 56  ? -22.497 -11.985 4.277   1.00   49.47  ? 56   VAL A CB  1 
ATOM   435  C  CG1 . VAL A 1 56  ? -22.739 -13.163 5.210   1.00   49.68  ? 56   VAL A CG1 1 
ATOM   436  C  CG2 . VAL A 1 56  ? -23.626 -10.972 4.374   1.00   43.75  ? 56   VAL A CG2 1 
ATOM   437  N  N   . ASN A 1 57  ? -19.442 -12.770 3.661   1.00   45.98  ? 57   ASN A N   1 
ATOM   438  C  CA  . ASN A 1 57  ? -18.300 -13.693 3.675   1.00   56.52  ? 57   ASN A CA  1 
ATOM   439  C  C   . ASN A 1 57  ? -17.087 -13.168 4.430   1.00   56.00  ? 57   ASN A C   1 
ATOM   440  O  O   . ASN A 1 57  ? -16.360 -13.937 5.049   1.00   58.09  ? 57   ASN A O   1 
ATOM   441  C  CB  . ASN A 1 57  ? -17.880 -14.057 2.253   1.00   62.22  ? 57   ASN A CB  1 
ATOM   442  C  CG  . ASN A 1 57  ? -18.842 -15.009 1.594   1.00   69.48  ? 57   ASN A CG  1 
ATOM   443  O  OD1 . ASN A 1 57  ? -19.876 -15.358 2.163   1.00   74.71  ? 57   ASN A OD1 1 
ATOM   444  N  ND2 . ASN A 1 57  ? -18.507 -15.442 0.387   1.00   74.01  ? 57   ASN A ND2 1 
ATOM   445  N  N   . LEU A 1 58  ? -16.861 -11.861 4.356   1.00   57.41  ? 58   LEU A N   1 
ATOM   446  C  CA  . LEU A 1 58  ? -15.788 -11.218 5.115   1.00   59.59  ? 58   LEU A CA  1 
ATOM   447  C  C   . LEU A 1 58  ? -16.091 -11.140 6.611   1.00   55.65  ? 58   LEU A C   1 
ATOM   448  O  O   . LEU A 1 58  ? -15.192 -11.234 7.442   1.00   60.56  ? 58   LEU A O   1 
ATOM   449  C  CB  . LEU A 1 58  ? -15.519 -9.820  4.570   1.00   63.28  ? 58   LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 58  ? -14.950 -9.822  3.158   1.00   73.58  ? 58   LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 58  ? -14.555 -8.417  2.754   1.00   77.98  ? 58   LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 58  ? -13.755 -10.762 3.095   1.00   77.15  ? 58   LEU A CD2 1 
ATOM   453  N  N   . LEU A 1 59  ? -17.362 -10.957 6.947   1.00   50.39  ? 59   LEU A N   1 
ATOM   454  C  CA  . LEU A 1 59  ? -17.796 -10.928 8.335   1.00   48.54  ? 59   LEU A CA  1 
ATOM   455  C  C   . LEU A 1 59  ? -17.593 -12.287 8.991   1.00   47.98  ? 59   LEU A C   1 
ATOM   456  O  O   . LEU A 1 59  ? -17.301 -12.385 10.181  1.00   59.81  ? 59   LEU A O   1 
ATOM   457  C  CB  . LEU A 1 59  ? -19.267 -10.526 8.396   1.00   54.08  ? 59   LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 59  ? -20.028 -10.554 9.720   1.00   61.37  ? 59   LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 59  ? -19.376 -9.653  10.778  1.00   59.05  ? 59   LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 59  ? -21.467 -10.136 9.463   1.00   61.65  ? 59   LEU A CD2 1 
ATOM   461  N  N   . ARG A 1 60  ? -17.733 -13.341 8.204   1.00   51.52  ? 60   ARG A N   1 
ATOM   462  C  CA  . ARG A 1 60  ? -17.704 -14.694 8.737   1.00   64.70  ? 60   ARG A CA  1 
ATOM   463  C  C   . ARG A 1 60  ? -16.276 -15.227 8.942   1.00   64.34  ? 60   ARG A C   1 
ATOM   464  O  O   . ARG A 1 60  ? -16.076 -16.213 9.646   1.00   67.33  ? 60   ARG A O   1 
ATOM   465  C  CB  . ARG A 1 60  ? -18.501 -15.617 7.813   1.00   75.03  ? 60   ARG A CB  1 
ATOM   466  C  CG  . ARG A 1 60  ? -18.767 -17.004 8.364   1.00   84.57  ? 60   ARG A CG  1 
ATOM   467  C  CD  . ARG A 1 60  ? -19.344 -17.884 7.268   1.00   94.86  ? 60   ARG A CD  1 
ATOM   468  N  NE  . ARG A 1 60  ? -18.555 -17.767 6.044   1.00   100.34 ? 60   ARG A NE  1 
ATOM   469  C  CZ  . ARG A 1 60  ? -18.787 -18.451 4.930   1.00   102.97 ? 60   ARG A CZ  1 
ATOM   470  N  NH1 . ARG A 1 60  ? -19.793 -19.313 4.874   1.00   103.31 ? 60   ARG A NH1 1 
ATOM   471  N  NH2 . ARG A 1 60  ? -18.010 -18.271 3.872   1.00   105.31 ? 60   ARG A NH2 1 
ATOM   472  N  N   . GLU A 1 61  ? -15.292 -14.561 8.341   1.00   60.32  ? 61   GLU A N   1 
ATOM   473  C  CA  . GLU A 1 61  ? -13.899 -15.011 8.396   1.00   67.09  ? 61   GLU A CA  1 
ATOM   474  C  C   . GLU A 1 61  ? -13.078 -14.523 9.601   1.00   59.10  ? 61   GLU A C   1 
ATOM   475  O  O   . GLU A 1 61  ? -11.974 -15.014 9.841   1.00   64.12  ? 61   GLU A O   1 
ATOM   476  C  CB  . GLU A 1 61  ? -13.171 -14.627 7.106   1.00   79.52  ? 61   GLU A CB  1 
ATOM   477  C  CG  . GLU A 1 61  ? -13.643 -15.387 5.876   1.00   89.96  ? 61   GLU A CG  1 
ATOM   478  C  CD  . GLU A 1 61  ? -12.841 -15.035 4.642   1.00   99.82  ? 61   GLU A CD  1 
ATOM   479  O  OE1 . GLU A 1 61  ? -11.779 -14.393 4.798   1.00   101.35 ? 61   GLU A OE1 1 
ATOM   480  O  OE2 . GLU A 1 61  ? -13.269 -15.396 3.522   1.00   103.60 ? 61   GLU A OE2 1 
ATOM   481  N  N   . LEU A 1 62  ? -13.602 -13.554 10.343  1.00   49.08  ? 62   LEU A N   1 
ATOM   482  C  CA  . LEU A 1 62  ? -12.876 -12.997 11.483  1.00   53.46  ? 62   LEU A CA  1 
ATOM   483  C  C   . LEU A 1 62  ? -13.481 -13.499 12.790  1.00   49.67  ? 62   LEU A C   1 
ATOM   484  O  O   . LEU A 1 62  ? -14.599 -13.122 13.145  1.00   51.16  ? 62   LEU A O   1 
ATOM   485  C  CB  . LEU A 1 62  ? -12.933 -11.468 11.448  1.00   57.45  ? 62   LEU A CB  1 
ATOM   486  C  CG  . LEU A 1 62  ? -11.605 -10.716 11.409  1.00   61.45  ? 62   LEU A CG  1 
ATOM   487  C  CD1 . LEU A 1 62  ? -11.847 -9.212  11.457  1.00   59.51  ? 62   LEU A CD1 1 
ATOM   488  C  CD2 . LEU A 1 62  ? -10.708 -11.167 12.548  1.00   55.78  ? 62   LEU A CD2 1 
ATOM   489  N  N   . LYS A 1 63  ? -12.756 -14.360 13.498  1.00   35.69  ? 63   LYS A N   1 
ATOM   490  C  CA  . LYS A 1 63  ? -13.211 -14.824 14.809  1.00   37.25  ? 63   LYS A CA  1 
ATOM   491  C  C   . LYS A 1 63  ? -12.192 -14.438 15.869  1.00   34.49  ? 63   LYS A C   1 
ATOM   492  O  O   . LYS A 1 63  ? -11.044 -14.848 15.798  1.00   31.97  ? 63   LYS A O   1 
ATOM   493  C  CB  . LYS A 1 63  ? -13.471 -16.334 14.814  1.00   43.42  ? 63   LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 63  ? -14.888 -16.688 14.378  1.00   64.50  ? 63   LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 63  ? -15.031 -18.143 13.947  1.00   76.83  ? 63   LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 63  ? -14.574 -18.350 12.508  1.00   83.16  ? 63   LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 63  ? -14.878 -19.728 12.025  1.00   84.43  ? 63   LYS A NZ  1 
ATOM   498  N  N   . HIS A 1 64  ? -12.627 -13.642 16.838  1.00   18.59  ? 64   HIS A N   1 
ATOM   499  C  CA  . HIS A 1 64  ? -11.725 -13.060 17.832  1.00   15.65  ? 64   HIS A CA  1 
ATOM   500  C  C   . HIS A 1 64  ? -12.595 -12.561 18.988  1.00   14.25  ? 64   HIS A C   1 
ATOM   501  O  O   . HIS A 1 64  ? -13.697 -12.086 18.764  1.00   15.26  ? 64   HIS A O   1 
ATOM   502  C  CB  . HIS A 1 64  ? -10.968 -11.900 17.183  1.00   14.95  ? 64   HIS A CB  1 
ATOM   503  C  CG  . HIS A 1 64  ? -9.826  -11.383 17.996  1.00   18.05  ? 64   HIS A CG  1 
ATOM   504  N  ND1 . HIS A 1 64  ? -9.994  -10.472 19.013  1.00   18.02  ? 64   HIS A ND1 1 
ATOM   505  C  CD2 . HIS A 1 64  ? -8.495  -11.651 17.941  1.00   20.00  ? 64   HIS A CD2 1 
ATOM   506  C  CE1 . HIS A 1 64  ? -8.816  -10.198 19.554  1.00   18.01  ? 64   HIS A CE1 1 
ATOM   507  N  NE2 . HIS A 1 64  ? -7.889  -10.893 18.912  1.00   17.41  ? 64   HIS A NE2 1 
ATOM   508  N  N   . PRO A 1 65  ? -12.113 -12.695 20.232  1.00   15.59  ? 65   PRO A N   1 
ATOM   509  C  CA  . PRO A 1 65  ? -12.886 -12.303 21.417  1.00   13.22  ? 65   PRO A CA  1 
ATOM   510  C  C   . PRO A 1 65  ? -13.221 -10.814 21.410  1.00   11.45  ? 65   PRO A C   1 
ATOM   511  O  O   . PRO A 1 65  ? -14.190 -10.411 22.042  1.00   12.45  ? 65   PRO A O   1 
ATOM   512  C  CB  . PRO A 1 65  ? -11.930 -12.561 22.598  1.00   20.27  ? 65   PRO A CB  1 
ATOM   513  C  CG  . PRO A 1 65  ? -10.796 -13.351 22.058  1.00   24.86  ? 65   PRO A CG  1 
ATOM   514  C  CD  . PRO A 1 65  ? -10.827 -13.333 20.557  1.00   16.35  ? 65   PRO A CD  1 
ATOM   515  N  N   . ASN A 1 66  ? -12.411 -9.999  20.746  1.00   10.39  ? 66   ASN A N   1 
ATOM   516  C  CA  . ASN A 1 66  ? -12.708 -8.560  20.730  1.00   10.67  ? 66   ASN A CA  1 
ATOM   517  C  C   . ASN A 1 66  ? -13.316 -8.045  19.410  1.00   13.96  ? 66   ASN A C   1 
ATOM   518  O  O   . ASN A 1 66  ? -13.270 -6.851  19.113  1.00   10.17  ? 66   ASN A O   1 
ATOM   519  C  CB  . ASN A 1 66  ? -11.451 -7.777  21.108  1.00   12.80  ? 66   ASN A CB  1 
ATOM   520  C  CG  . ASN A 1 66  ? -10.980 -8.123  22.513  1.00   14.10  ? 66   ASN A CG  1 
ATOM   521  O  OD1 . ASN A 1 66  ? -9.869  -8.609  22.706  1.00   14.63  ? 66   ASN A OD1 1 
ATOM   522  N  ND2 . ASN A 1 66  ? -11.854 -7.910  23.492  1.00   8.91   ? 66   ASN A ND2 1 
ATOM   523  N  N   . ILE A 1 67  ? -13.856 -8.966  18.618  1.00   11.19  ? 67   ILE A N   1 
ATOM   524  C  CA  A ILE A 1 67  ? -14.574 -8.601  17.404  0.44   9.67   ? 67   ILE A CA  1 
ATOM   525  C  CA  B ILE A 1 67  ? -14.561 -8.634  17.381  0.56   9.54   ? 67   ILE A CA  1 
ATOM   526  C  C   . ILE A 1 67  ? -15.998 -9.168  17.505  1.00   15.16  ? 67   ILE A C   1 
ATOM   527  O  O   . ILE A 1 67  ? -16.191 -10.315 17.859  1.00   12.74  ? 67   ILE A O   1 
ATOM   528  C  CB  A ILE A 1 67  ? -13.871 -9.145  16.157  0.44   12.46  ? 67   ILE A CB  1 
ATOM   529  C  CB  B ILE A 1 67  ? -13.910 -9.324  16.183  0.56   11.33  ? 67   ILE A CB  1 
ATOM   530  C  CG1 A ILE A 1 67  ? -12.448 -8.593  16.071  0.44   15.57  ? 67   ILE A CG1 1 
ATOM   531  C  CG1 B ILE A 1 67  ? -12.486 -8.816  15.978  0.56   14.78  ? 67   ILE A CG1 1 
ATOM   532  C  CG2 A ILE A 1 67  ? -14.665 -8.800  14.895  0.44   17.26  ? 67   ILE A CG2 1 
ATOM   533  C  CG2 B ILE A 1 67  ? -14.749 -9.115  14.916  0.56   16.34  ? 67   ILE A CG2 1 
ATOM   534  C  CD1 A ILE A 1 67  ? -11.680 -9.065  14.854  0.44   11.84  ? 67   ILE A CD1 1 
ATOM   535  C  CD1 B ILE A 1 67  ? -12.423 -7.384  15.501  0.56   12.04  ? 67   ILE A CD1 1 
ATOM   536  N  N   . VAL A 1 68  ? -17.006 -8.342  17.230  1.00   13.29  ? 68   VAL A N   1 
ATOM   537  C  CA  . VAL A 1 68  ? -18.389 -8.809  17.389  1.00   12.75  ? 68   VAL A CA  1 
ATOM   538  C  C   . VAL A 1 68  ? -18.574 -10.078 16.527  1.00   14.61  ? 68   VAL A C   1 
ATOM   539  O  O   . VAL A 1 68  ? -18.247 -10.084 15.338  1.00   15.75  ? 68   VAL A O   1 
ATOM   540  C  CB  . VAL A 1 68  ? -19.419 -7.727  16.987  1.00   12.63  ? 68   VAL A CB  1 
ATOM   541  C  CG1 . VAL A 1 68  ? -20.821 -8.333  16.935  1.00   17.82  ? 68   VAL A CG1 1 
ATOM   542  C  CG2 . VAL A 1 68  ? -19.394 -6.540  17.981  1.00   6.82   ? 68   VAL A CG2 1 
ATOM   543  N  N   . ARG A 1 69  ? -19.083 -11.139 17.129  1.00   12.76  ? 69   ARG A N   1 
ATOM   544  C  CA  . ARG A 1 69  ? -19.091 -12.441 16.466  1.00   15.67  ? 69   ARG A CA  1 
ATOM   545  C  C   . ARG A 1 69  ? -20.323 -12.613 15.595  1.00   21.04  ? 69   ARG A C   1 
ATOM   546  O  O   . ARG A 1 69  ? -21.439 -12.308 16.014  1.00   17.16  ? 69   ARG A O   1 
ATOM   547  C  CB  . ARG A 1 69  ? -19.046 -13.577 17.504  1.00   22.09  ? 69   ARG A CB  1 
ATOM   548  C  CG  . ARG A 1 69  ? -18.760 -14.953 16.880  1.00   32.37  ? 69   ARG A CG  1 
ATOM   549  C  CD  . ARG A 1 69  ? -19.927 -15.904 17.014  0.0000 38.32  ? 69   ARG A CD  1 
ATOM   550  N  NE  . ARG A 1 69  ? -19.863 -16.666 18.256  0.32   44.59  ? 69   ARG A NE  1 
ATOM   551  C  CZ  . ARG A 1 69  ? -19.277 -17.853 18.376  0.94   46.43  ? 69   ARG A CZ  1 
ATOM   552  N  NH1 . ARG A 1 69  ? -19.274 -18.467 19.551  0.82   47.34  ? 69   ARG A NH1 1 
ATOM   553  N  NH2 . ARG A 1 69  ? -18.694 -18.422 17.330  0.0000 47.35  ? 69   ARG A NH2 1 
ATOM   554  N  N   . TYR A 1 70  ? -20.095 -13.106 14.388  1.00   20.66  ? 70   TYR A N   1 
ATOM   555  C  CA  . TYR A 1 70  ? -21.146 -13.461 13.453  1.00   21.81  ? 70   TYR A CA  1 
ATOM   556  C  C   . TYR A 1 70  ? -21.584 -14.907 13.743  1.00   28.43  ? 70   TYR A C   1 
ATOM   557  O  O   . TYR A 1 70  ? -20.746 -15.763 13.998  1.00   24.91  ? 70   TYR A O   1 
ATOM   558  C  CB  . TYR A 1 70  ? -20.584 -13.322 12.040  1.00   26.86  ? 70   TYR A CB  1 
ATOM   559  C  CG  . TYR A 1 70  ? -21.330 -14.062 10.965  1.00   44.49  ? 70   TYR A CG  1 
ATOM   560  C  CD1 . TYR A 1 70  ? -21.030 -15.389 10.663  1.00   52.25  ? 70   TYR A CD1 1 
ATOM   561  C  CD2 . TYR A 1 70  ? -22.325 -13.431 10.231  1.00   47.73  ? 70   TYR A CD2 1 
ATOM   562  C  CE1 . TYR A 1 70  ? -21.720 -16.072 9.656   1.00   50.33  ? 70   TYR A CE1 1 
ATOM   563  C  CE2 . TYR A 1 70  ? -23.015 -14.096 9.227   1.00   43.50  ? 70   TYR A CE2 1 
ATOM   564  C  CZ  . TYR A 1 70  ? -22.709 -15.413 8.945   1.00   52.92  ? 70   TYR A CZ  1 
ATOM   565  O  OH  . TYR A 1 70  ? -23.400 -16.057 7.949   1.00   56.53  ? 70   TYR A OH  1 
ATOM   566  N  N   . TYR A 1 71  ? -22.890 -15.171 13.714  1.00   24.94  ? 71   TYR A N   1 
ATOM   567  C  CA  . TYR A 1 71  ? -23.421 -16.510 13.995  1.00   26.87  ? 71   TYR A CA  1 
ATOM   568  C  C   . TYR A 1 71  ? -24.032 -17.219 12.798  1.00   32.62  ? 71   TYR A C   1 
ATOM   569  O  O   . TYR A 1 71  ? -23.935 -18.441 12.672  1.00   38.07  ? 71   TYR A O   1 
ATOM   570  C  CB  . TYR A 1 71  ? -24.480 -16.450 15.095  1.00   20.54  ? 71   TYR A CB  1 
ATOM   571  C  CG  . TYR A 1 71  ? -23.877 -16.439 16.470  1.00   22.21  ? 71   TYR A CG  1 
ATOM   572  C  CD1 . TYR A 1 71  ? -23.510 -15.247 17.073  1.00   22.40  ? 71   TYR A CD1 1 
ATOM   573  C  CD2 . TYR A 1 71  ? -23.635 -17.622 17.151  1.00   38.03  ? 71   TYR A CD2 1 
ATOM   574  C  CE1 . TYR A 1 71  ? -22.941 -15.221 18.324  1.00   17.07  ? 71   TYR A CE1 1 
ATOM   575  C  CE2 . TYR A 1 71  ? -23.061 -17.611 18.408  1.00   40.01  ? 71   TYR A CE2 1 
ATOM   576  C  CZ  . TYR A 1 71  ? -22.710 -16.411 18.987  1.00   32.87  ? 71   TYR A CZ  1 
ATOM   577  O  OH  . TYR A 1 71  ? -22.131 -16.403 20.231  1.00   31.84  ? 71   TYR A OH  1 
ATOM   578  N  N   . ASP A 1 72  ? -24.687 -16.472 11.923  1.00   26.67  ? 72   ASP A N   1 
ATOM   579  C  CA  . ASP A 1 72  ? -25.570 -17.127 10.954  1.00   27.91  ? 72   ASP A CA  1 
ATOM   580  C  C   . ASP A 1 72  ? -26.096 -16.092 9.992   1.00   28.30  ? 72   ASP A C   1 
ATOM   581  O  O   . ASP A 1 72  ? -26.068 -14.892 10.281  1.00   25.49  ? 72   ASP A O   1 
ATOM   582  C  CB  . ASP A 1 72  ? -26.727 -17.797 11.704  1.00   27.06  ? 72   ASP A CB  1 
ATOM   583  C  CG  . ASP A 1 72  ? -27.460 -18.846 10.865  1.00   41.42  ? 72   ASP A CG  1 
ATOM   584  O  OD1 . ASP A 1 72  ? -26.971 -19.211 9.772   1.00   39.12  ? 72   ASP A OD1 1 
ATOM   585  O  OD2 . ASP A 1 72  ? -28.535 -19.309 11.315  1.00   43.55  ? 72   ASP A OD2 1 
ATOM   586  N  N   . ARG A 1 73  ? -26.534 -16.543 8.824   1.00   28.31  ? 73   ARG A N   1 
ATOM   587  C  CA  . ARG A 1 73  ? -27.182 -15.665 7.855   1.00   29.91  ? 73   ARG A CA  1 
ATOM   588  C  C   . ARG A 1 73  ? -28.409 -16.408 7.393   0.60   35.79  ? 73   ARG A C   1 
ATOM   589  O  O   . ARG A 1 73  ? -28.347 -17.608 7.111   1.00   36.02  ? 73   ARG A O   1 
ATOM   590  C  CB  . ARG A 1 73  ? -26.271 -15.395 6.659   1.00   42.41  ? 73   ARG A CB  1 
ATOM   591  C  CG  . ARG A 1 73  ? -25.725 -16.676 6.039   1.00   51.27  ? 73   ARG A CG  1 
ATOM   592  C  CD  . ARG A 1 73  ? -25.300 -16.489 4.607   1.00   59.69  ? 73   ARG A CD  1 
ATOM   593  N  NE  . ARG A 1 73  ? -24.624 -17.679 4.097   0.33   66.76  ? 73   ARG A NE  1 
ATOM   594  C  CZ  . ARG A 1 73  ? -25.241 -18.805 3.749   0.45   71.45  ? 73   ARG A CZ  1 
ATOM   595  N  NH1 . ARG A 1 73  ? -26.560 -18.908 3.861   1.00   73.85  ? 73   ARG A NH1 1 
ATOM   596  N  NH2 . ARG A 1 73  ? -24.538 -19.833 3.294   0.27   73.24  ? 73   ARG A NH2 1 
ATOM   597  N  N   . ILE A 1 74  ? -29.528 -15.703 7.333   1.00   32.74  ? 74   ILE A N   1 
ATOM   598  C  CA  . ILE A 1 74  ? -30.794 -16.325 6.988   1.00   34.70  ? 74   ILE A CA  1 
ATOM   599  C  C   . ILE A 1 74  ? -31.444 -15.555 5.868   1.00   35.23  ? 74   ILE A C   1 
ATOM   600  O  O   . ILE A 1 74  ? -31.575 -14.335 5.935   1.00   33.21  ? 74   ILE A O   1 
ATOM   601  C  CB  . ILE A 1 74  ? -31.775 -16.322 8.166   1.00   34.68  ? 74   ILE A CB  1 
ATOM   602  C  CG1 . ILE A 1 74  ? -31.163 -17.002 9.390   1.00   40.40  ? 74   ILE A CG1 1 
ATOM   603  C  CG2 . ILE A 1 74  ? -33.109 -16.975 7.747   1.00   38.85  ? 74   ILE A CG2 1 
ATOM   604  C  CD1 . ILE A 1 74  ? -31.977 -16.821 10.647  1.00   41.17  ? 74   ILE A CD1 1 
ATOM   605  N  N   . ILE A 1 75  ? -31.863 -16.278 4.839   1.00   41.91  ? 75   ILE A N   1 
ATOM   606  C  CA  . ILE A 1 75  ? -32.526 -15.672 3.693   1.00   41.16  ? 75   ILE A CA  1 
ATOM   607  C  C   . ILE A 1 75  ? -34.013 -15.991 3.747   1.00   41.99  ? 75   ILE A C   1 
ATOM   608  O  O   . ILE A 1 75  ? -34.404 -17.155 3.747   1.00   50.43  ? 75   ILE A O   1 
ATOM   609  C  CB  . ILE A 1 75  ? -31.922 -16.188 2.371   1.00   50.22  ? 75   ILE A CB  1 
ATOM   610  C  CG1 . ILE A 1 75  ? -30.412 -15.929 2.342   1.00   51.51  ? 75   ILE A CG1 1 
ATOM   611  C  CG2 . ILE A 1 75  ? -32.615 -15.558 1.165   1.00   48.63  ? 75   ILE A CG2 1 
ATOM   612  C  CD1 . ILE A 1 75  ? -29.776 -16.194 0.994   1.00   54.88  ? 75   ILE A CD1 1 
ATOM   613  N  N   . ASP A 1 76  ? -34.834 -14.954 3.847   1.00   44.67  ? 76   ASP A N   1 
ATOM   614  C  CA  . ASP A 1 76  ? -36.279 -15.104 3.694   1.00   54.61  ? 76   ASP A CA  1 
ATOM   615  C  C   . ASP A 1 76  ? -36.666 -14.590 2.304   1.00   59.34  ? 76   ASP A C   1 
ATOM   616  O  O   . ASP A 1 76  ? -37.145 -13.465 2.157   1.00   54.47  ? 76   ASP A O   1 
ATOM   617  C  CB  . ASP A 1 76  ? -37.025 -14.336 4.789   1.00   56.72  ? 76   ASP A CB  1 
ATOM   618  C  CG  . ASP A 1 76  ? -38.522 -14.600 4.779   1.00   62.75  ? 76   ASP A CG  1 
ATOM   619  O  OD1 . ASP A 1 76  ? -39.042 -15.065 3.743   1.00   66.42  ? 76   ASP A OD1 1 
ATOM   620  O  OD2 . ASP A 1 76  ? -39.181 -14.340 5.810   1.00   59.72  ? 76   ASP A OD2 1 
ATOM   621  N  N   . ARG A 1 77  ? -36.439 -15.421 1.288   1.00   68.51  ? 77   ARG A N   1 
ATOM   622  C  CA  . ARG A 1 77  ? -36.651 -15.029 -0.107  1.00   75.93  ? 77   ARG A CA  1 
ATOM   623  C  C   . ARG A 1 77  ? -38.092 -14.611 -0.391  1.00   82.81  ? 77   ARG A C   1 
ATOM   624  O  O   . ARG A 1 77  ? -38.381 -14.015 -1.427  1.00   81.84  ? 77   ARG A O   1 
ATOM   625  C  CB  . ARG A 1 77  ? -36.228 -16.153 -1.060  1.00   73.41  ? 77   ARG A CB  1 
ATOM   626  N  N   . THR A 1 78  ? -38.992 -14.924 0.534   1.00   88.80  ? 78   THR A N   1 
ATOM   627  C  CA  . THR A 1 78  ? -40.385 -14.522 0.404   1.00   96.44  ? 78   THR A CA  1 
ATOM   628  C  C   . THR A 1 78  ? -40.546 -13.021 0.605   1.00   90.79  ? 78   THR A C   1 
ATOM   629  O  O   . THR A 1 78  ? -41.047 -12.316 -0.272  1.00   91.43  ? 78   THR A O   1 
ATOM   630  C  CB  . THR A 1 78  ? -41.270 -15.253 1.416   1.00   107.69 ? 78   THR A CB  1 
ATOM   631  O  OG1 . THR A 1 78  ? -41.263 -16.655 1.126   1.00   111.84 ? 78   THR A OG1 1 
ATOM   632  C  CG2 . THR A 1 78  ? -42.695 -14.729 1.344   1.00   113.39 ? 78   THR A CG2 1 
ATOM   633  N  N   . ASN A 1 79  ? -40.125 -12.538 1.770   1.00   78.83  ? 79   ASN A N   1 
ATOM   634  C  CA  . ASN A 1 79  ? -40.193 -11.116 2.077   1.00   68.88  ? 79   ASN A CA  1 
ATOM   635  C  C   . ASN A 1 79  ? -38.956 -10.389 1.565   1.00   60.06  ? 79   ASN A C   1 
ATOM   636  O  O   . ASN A 1 79  ? -38.695 -9.239  1.936   1.00   57.10  ? 79   ASN A O   1 
ATOM   637  C  CB  . ASN A 1 79  ? -40.344 -10.905 3.584   1.00   69.99  ? 79   ASN A CB  1 
ATOM   638  N  N   . THR A 1 80  ? -38.208 -11.071 0.701   1.00   47.07  ? 80   THR A N   1 
ATOM   639  C  CA  . THR A 1 80  ? -36.903 -10.604 0.251   1.00   33.54  ? 80   THR A CA  1 
ATOM   640  C  C   . THR A 1 80  ? -36.155 -9.945  1.424   1.00   27.10  ? 80   THR A C   1 
ATOM   641  O  O   . THR A 1 80  ? -35.678 -8.814  1.322   1.00   29.82  ? 80   THR A O   1 
ATOM   642  C  CB  . THR A 1 80  ? -36.991 -9.619  -0.930  1.00   41.99  ? 80   THR A CB  1 
ATOM   643  O  OG1 . THR A 1 80  ? -37.493 -8.356  -0.483  1.00   48.74  ? 80   THR A OG1 1 
ATOM   644  C  CG2 . THR A 1 80  ? -37.910 -10.167 -2.025  1.00   48.27  ? 80   THR A CG2 1 
ATOM   645  N  N   . THR A 1 81  ? -36.068 -10.662 2.531   1.00   31.17  ? 81   THR A N   1 
ATOM   646  C  CA  . THR A 1 81  ? -35.303 -10.160 3.662   1.00   36.75  ? 81   THR A CA  1 
ATOM   647  C  C   . THR A 1 81  ? -34.137 -11.074 4.001   1.00   35.58  ? 81   THR A C   1 
ATOM   648  O  O   . THR A 1 81  ? -34.284 -12.293 4.018   1.00   40.35  ? 81   THR A O   1 
ATOM   649  C  CB  . THR A 1 81  ? -36.195 -9.969  4.889   1.00   39.61  ? 81   THR A CB  1 
ATOM   650  O  OG1 . THR A 1 81  ? -37.159 -8.946  4.606   1.00   46.08  ? 81   THR A OG1 1 
ATOM   651  C  CG2 . THR A 1 81  ? -35.355 -9.540  6.082   1.00   39.57  ? 81   THR A CG2 1 
ATOM   652  N  N   . LEU A 1 82  ? -32.976 -10.468 4.257   1.00   30.69  ? 82   LEU A N   1 
ATOM   653  C  CA  . LEU A 1 82  ? -31.799 -11.184 4.726   1.00   31.13  ? 82   LEU A CA  1 
ATOM   654  C  C   . LEU A 1 82  ? -31.531 -10.804 6.189   1.00   30.18  ? 82   LEU A C   1 
ATOM   655  O  O   . LEU A 1 82  ? -31.473 -9.618  6.517   1.00   34.27  ? 82   LEU A O   1 
ATOM   656  C  CB  . LEU A 1 82  ? -30.596 -10.794 3.867   1.00   31.29  ? 82   LEU A CB  1 
ATOM   657  C  CG  . LEU A 1 82  ? -29.207 -11.099 4.438   1.00   40.99  ? 82   LEU A CG  1 
ATOM   658  C  CD1 . LEU A 1 82  ? -28.917 -12.587 4.421   1.00   37.91  ? 82   LEU A CD1 1 
ATOM   659  C  CD2 . LEU A 1 82  ? -28.134 -10.334 3.662   1.00   43.13  ? 82   LEU A CD2 1 
ATOM   660  N  N   . TYR A 1 83  ? -31.377 -11.801 7.057   1.00   25.03  ? 83   TYR A N   1 
ATOM   661  C  CA  . TYR A 1 83  ? -31.032 -11.573 8.464   1.00   27.66  ? 83   TYR A CA  1 
ATOM   662  C  C   . TYR A 1 83  ? -29.595 -11.961 8.759   1.00   28.13  ? 83   TYR A C   1 
ATOM   663  O  O   . TYR A 1 83  ? -29.179 -13.093 8.485   1.00   27.74  ? 83   TYR A O   1 
ATOM   664  C  CB  . TYR A 1 83  ? -31.922 -12.405 9.380   1.00   26.81  ? 83   TYR A CB  1 
ATOM   665  C  CG  . TYR A 1 83  ? -33.387 -12.164 9.194   1.00   31.83  ? 83   TYR A CG  1 
ATOM   666  C  CD1 . TYR A 1 83  ? -34.109 -12.869 8.228   1.00   34.93  ? 83   TYR A CD1 1 
ATOM   667  C  CD2 . TYR A 1 83  ? -34.063 -11.239 9.977   1.00   32.37  ? 83   TYR A CD2 1 
ATOM   668  C  CE1 . TYR A 1 83  ? -35.451 -12.655 8.053   1.00   38.88  ? 83   TYR A CE1 1 
ATOM   669  C  CE2 . TYR A 1 83  ? -35.411 -11.020 9.808   1.00   42.51  ? 83   TYR A CE2 1 
ATOM   670  C  CZ  . TYR A 1 83  ? -36.101 -11.734 8.842   1.00   47.52  ? 83   TYR A CZ  1 
ATOM   671  O  OH  . TYR A 1 83  ? -37.446 -11.522 8.662   1.00   56.59  ? 83   TYR A OH  1 
ATOM   672  N  N   . ILE A 1 84  ? -28.838 -11.047 9.352   1.00   18.46  ? 84   ILE A N   1 
ATOM   673  C  CA  . ILE A 1 84  ? -27.516 -11.411 9.824   1.00   12.37  ? 84   ILE A CA  1 
ATOM   674  C  C   . ILE A 1 84  ? -27.559 -11.529 11.349  1.00   20.42  ? 84   ILE A C   1 
ATOM   675  O  O   . ILE A 1 84  ? -27.885 -10.574 12.040  1.00   17.44  ? 84   ILE A O   1 
ATOM   676  C  CB  . ILE A 1 84  ? -26.455 -10.357 9.400   0.97   25.84  ? 84   ILE A CB  1 
ATOM   677  C  CG1 . ILE A 1 84  ? -26.487 -10.129 7.887   1.00   26.48  ? 84   ILE A CG1 1 
ATOM   678  C  CG2 . ILE A 1 84  ? -25.074 -10.783 9.865   1.00   24.71  ? 84   ILE A CG2 1 
ATOM   679  C  CD1 . ILE A 1 84  ? -26.371 -11.408 7.073   0.49   26.61  ? 84   ILE A CD1 1 
ATOM   680  N  N   . VAL A 1 85  ? -27.241 -12.710 11.856  1.00   11.22  ? 85   VAL A N   1 
ATOM   681  C  CA  . VAL A 1 85  ? -27.322 -13.018 13.270  1.00   12.47  ? 85   VAL A CA  1 
ATOM   682  C  C   . VAL A 1 85  ? -25.971 -12.793 13.896  1.00   18.55  ? 85   VAL A C   1 
ATOM   683  O  O   . VAL A 1 85  ? -24.952 -13.281 13.380  1.00   16.23  ? 85   VAL A O   1 
ATOM   684  C  CB  . VAL A 1 85  ? -27.724 -14.483 13.502  1.00   17.31  ? 85   VAL A CB  1 
ATOM   685  C  CG1 . VAL A 1 85  ? -27.850 -14.779 14.984  1.00   14.82  ? 85   VAL A CG1 1 
ATOM   686  C  CG2 . VAL A 1 85  ? -29.061 -14.770 12.804  1.00   23.57  ? 85   VAL A CG2 1 
ATOM   687  N  N   . MET A 1 86  ? -25.957 -12.047 14.995  1.00   16.29  ? 86   MET A N   1 
ATOM   688  C  CA  . MET A 1 86  ? -24.700 -11.714 15.673  1.00   16.58  ? 86   MET A CA  1 
ATOM   689  C  C   . MET A 1 86  ? -24.860 -11.751 17.199  0.93   15.13  ? 86   MET A C   1 
ATOM   690  O  O   . MET A 1 86  ? -25.970 -11.894 17.705  1.00   15.94  ? 86   MET A O   1 
ATOM   691  C  CB  . MET A 1 86  ? -24.241 -10.319 15.224  1.00   15.84  ? 86   MET A CB  1 
ATOM   692  C  CG  . MET A 1 86  ? -25.347 -9.296  15.270  0.15   18.63  ? 86   MET A CG  1 
ATOM   693  S  SD  . MET A 1 86  ? -24.835 -7.664  14.733  1.00   62.51  ? 86   MET A SD  1 
ATOM   694  C  CE  . MET A 1 86  ? -23.766 -8.092  13.388  1.00   20.42  ? 86   MET A CE  1 
ATOM   695  N  N   . GLU A 1 87  ? -23.759 -11.598 17.934  1.00   12.30  ? 87   GLU A N   1 
ATOM   696  C  CA  . GLU A 1 87  ? -23.827 -11.616 19.394  1.00   14.97  ? 87   GLU A CA  1 
ATOM   697  C  C   . GLU A 1 87  ? -24.547 -10.399 19.951  1.00   18.70  ? 87   GLU A C   1 
ATOM   698  O  O   . GLU A 1 87  ? -24.487 -9.299  19.387  1.00   13.08  ? 87   GLU A O   1 
ATOM   699  C  CB  . GLU A 1 87  ? -22.437 -11.778 20.055  1.00   19.97  ? 87   GLU A CB  1 
ATOM   700  C  CG  . GLU A 1 87  ? -21.427 -10.687 19.808  1.00   28.90  ? 87   GLU A CG  1 
ATOM   701  C  CD  . GLU A 1 87  ? -20.061 -10.997 20.474  1.00   21.65  ? 87   GLU A CD  1 
ATOM   702  O  OE1 . GLU A 1 87  ? -19.988 -11.085 21.712  1.00   26.67  ? 87   GLU A OE1 1 
ATOM   703  O  OE2 . GLU A 1 87  ? -19.069 -11.150 19.750  1.00   19.06  ? 87   GLU A OE2 1 
ATOM   704  N  N   . TYR A 1 88  ? -25.235 -10.616 21.062  1.00   10.95  ? 88   TYR A N   1 
ATOM   705  C  CA  . TYR A 1 88  ? -25.923 -9.555  21.788  1.00   14.07  ? 88   TYR A CA  1 
ATOM   706  C  C   . TYR A 1 88  ? -24.949 -8.910  22.768  1.00   15.42  ? 88   TYR A C   1 
ATOM   707  O  O   . TYR A 1 88  ? -24.318 -9.603  23.571  1.00   16.07  ? 88   TYR A O   1 
ATOM   708  C  CB  . TYR A 1 88  ? -27.096 -10.139 22.574  1.00   12.44  ? 88   TYR A CB  1 
ATOM   709  C  CG  . TYR A 1 88  ? -27.798 -9.143  23.443  1.00   13.87  ? 88   TYR A CG  1 
ATOM   710  C  CD1 . TYR A 1 88  ? -28.397 -8.016  22.890  1.00   16.25  ? 88   TYR A CD1 1 
ATOM   711  C  CD2 . TYR A 1 88  ? -27.843 -9.306  24.826  1.00   15.80  ? 88   TYR A CD2 1 
ATOM   712  C  CE1 . TYR A 1 88  ? -29.048 -7.103  23.674  1.00   19.01  ? 88   TYR A CE1 1 
ATOM   713  C  CE2 . TYR A 1 88  ? -28.493 -8.392  25.620  1.00   16.20  ? 88   TYR A CE2 1 
ATOM   714  C  CZ  . TYR A 1 88  ? -29.088 -7.286  25.033  1.00   20.71  ? 88   TYR A CZ  1 
ATOM   715  O  OH  . TYR A 1 88  ? -29.748 -6.366  25.798  1.00   20.39  ? 88   TYR A OH  1 
ATOM   716  N  N   . CYS A 1 89  ? -24.819 -7.594  22.698  1.00   13.38  ? 89   CYS A N   1 
ATOM   717  C  CA  . CYS A 1 89  ? -23.885 -6.869  23.577  1.00   16.88  ? 89   CYS A CA  1 
ATOM   718  C  C   . CYS A 1 89  ? -24.665 -6.030  24.559  1.00   17.33  ? 89   CYS A C   1 
ATOM   719  O  O   . CYS A 1 89  ? -25.080 -4.934  24.236  1.00   12.51  ? 89   CYS A O   1 
ATOM   720  C  CB  . CYS A 1 89  ? -22.980 -5.986  22.732  1.00   14.65  ? 89   CYS A CB  1 
ATOM   721  S  SG  . CYS A 1 89  ? -21.988 -6.980  21.563  1.00   19.06  ? 89   CYS A SG  1 
ATOM   722  N  N   . GLU A 1 90  ? -24.884 -6.557  25.754  1.00   15.01  ? 90   GLU A N   1 
ATOM   723  C  CA  . GLU A 1 90  ? -25.838 -5.949  26.677  1.00   14.49  ? 90   GLU A CA  1 
ATOM   724  C  C   . GLU A 1 90  ? -25.508 -4.512  27.097  1.00   14.05  ? 90   GLU A C   1 
ATOM   725  O  O   . GLU A 1 90  ? -26.408 -3.759  27.485  1.00   17.41  ? 90   GLU A O   1 
ATOM   726  C  CB  . GLU A 1 90  ? -26.052 -6.850  27.904  1.00   25.97  ? 90   GLU A CB  1 
ATOM   727  C  CG  . GLU A 1 90  ? -26.136 -6.065  29.199  1.00   43.05  ? 90   GLU A CG  1 
ATOM   728  C  CD  . GLU A 1 90  ? -25.708 -6.857  30.414  1.00   34.21  ? 90   GLU A CD  1 
ATOM   729  O  OE1 . GLU A 1 90  ? -24.871 -6.340  31.194  1.00   37.31  ? 90   GLU A OE1 1 
ATOM   730  O  OE2 . GLU A 1 90  ? -26.190 -7.994  30.575  1.00   44.73  ? 90   GLU A OE2 1 
ATOM   731  N  N   . GLY A 1 91  ? -24.229 -4.122  27.035  1.00   16.13  ? 91   GLY A N   1 
ATOM   732  C  CA  . GLY A 1 91  ? -23.844 -2.779  27.434  1.00   13.10  ? 91   GLY A CA  1 
ATOM   733  C  C   . GLY A 1 91  ? -23.998 -1.776  26.302  1.00   21.69  ? 91   GLY A C   1 
ATOM   734  O  O   . GLY A 1 91  ? -23.752 -0.577  26.474  1.00   19.05  ? 91   GLY A O   1 
ATOM   735  N  N   . GLY A 1 92  ? -24.389 -2.251  25.127  1.00   15.42  ? 92   GLY A N   1 
ATOM   736  C  CA  . GLY A 1 92  ? -24.623 -1.331  24.019  1.00   16.19  ? 92   GLY A CA  1 
ATOM   737  C  C   . GLY A 1 92  ? -23.330 -0.751  23.448  1.00   16.58  ? 92   GLY A C   1 
ATOM   738  O  O   . GLY A 1 92  ? -22.263 -1.333  23.623  1.00   13.56  ? 92   GLY A O   1 
ATOM   739  N  N   . ASP A 1 93  ? -23.414 0.391   22.763  1.00   12.97  ? 93   ASP A N   1 
ATOM   740  C  CA  . ASP A 1 93  ? -22.250 0.940   22.058  1.00   12.00  ? 93   ASP A CA  1 
ATOM   741  C  C   . ASP A 1 93  ? -21.588 2.064   22.846  1.00   15.15  ? 93   ASP A C   1 
ATOM   742  O  O   . ASP A 1 93  ? -22.205 2.654   23.716  1.00   17.49  ? 93   ASP A O   1 
ATOM   743  C  CB  . ASP A 1 93  ? -22.659 1.504   20.709  1.00   11.39  ? 93   ASP A CB  1 
ATOM   744  C  CG  . ASP A 1 93  ? -23.545 2.736   20.851  1.00   27.55  ? 93   ASP A CG  1 
ATOM   745  O  OD1 . ASP A 1 93  ? -24.710 2.614   21.298  1.00   34.32  ? 93   ASP A OD1 1 
ATOM   746  O  OD2 . ASP A 1 93  ? -23.066 3.834   20.538  1.00   30.30  ? 93   ASP A OD2 1 
ATOM   747  N  N   . LEU A 1 94  ? -20.338 2.380   22.503  1.00   11.33  ? 94   LEU A N   1 
ATOM   748  C  CA  . LEU A 1 94  ? -19.562 3.357   23.272  1.00   8.00   ? 94   LEU A CA  1 
ATOM   749  C  C   . LEU A 1 94  ? -20.042 4.791   23.026  1.00   14.92  ? 94   LEU A C   1 
ATOM   750  O  O   . LEU A 1 94  ? -19.919 5.640   23.902  1.00   16.45  ? 94   LEU A O   1 
ATOM   751  C  CB  . LEU A 1 94  ? -18.086 3.275   22.865  1.00   14.11  ? 94   LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 94  ? -16.991 2.843   23.835  1.00   37.70  ? 94   LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 94  ? -15.651 3.414   23.339  1.00   29.93  ? 94   LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 94  ? -17.262 3.283   25.264  1.00   32.89  ? 94   LEU A CD2 1 
ATOM   755  N  N   . ALA A 1 95  ? -20.577 5.083   21.835  1.00   14.73  ? 95   ALA A N   1 
ATOM   756  C  CA  . ALA A 1 95  ? -21.046 6.458   21.597  1.00   19.03  ? 95   ALA A CA  1 
ATOM   757  C  C   . ALA A 1 95  ? -22.135 6.802   22.605  1.00   24.35  ? 95   ALA A C   1 
ATOM   758  O  O   . ALA A 1 95  ? -22.201 7.933   23.104  1.00   22.45  ? 95   ALA A O   1 
ATOM   759  C  CB  . ALA A 1 95  ? -21.571 6.636   20.151  1.00   23.22  ? 95   ALA A CB  1 
ATOM   760  N  N   . SER A 1 96  ? -23.000 5.832   22.913  1.00   20.28  ? 96   SER A N   1 
ATOM   761  C  CA  . SER A 1 96  ? -24.077 6.088   23.867  1.00   19.66  ? 96   SER A CA  1 
ATOM   762  C  C   . SER A 1 96  ? -23.517 6.246   25.268  1.00   20.88  ? 96   SER A C   1 
ATOM   763  O  O   . SER A 1 96  ? -24.043 7.010   26.072  1.00   18.43  ? 96   SER A O   1 
ATOM   764  C  CB  . SER A 1 96  ? -25.168 4.990   23.830  1.00   24.37  ? 96   SER A CB  1 
ATOM   765  O  OG  . SER A 1 96  ? -25.728 4.903   22.531  1.00   26.17  ? 96   SER A OG  1 
ATOM   766  N  N   . VAL A 1 97  ? -22.428 5.542   25.565  1.00   18.67  ? 97   VAL A N   1 
ATOM   767  C  CA  . VAL A 1 97  ? -21.766 5.717   26.846  1.00   18.84  ? 97   VAL A CA  1 
ATOM   768  C  C   . VAL A 1 97  ? -21.170 7.144   27.020  1.00   18.54  ? 97   VAL A C   1 
ATOM   769  O  O   . VAL A 1 97  ? -21.268 7.747   28.079  1.00   23.61  ? 97   VAL A O   1 
ATOM   770  C  CB  . VAL A 1 97  ? -20.623 4.681   27.010  1.00   20.64  ? 97   VAL A CB  1 
ATOM   771  C  CG1 . VAL A 1 97  ? -19.675 5.107   28.112  1.00   21.56  ? 97   VAL A CG1 1 
ATOM   772  C  CG2 . VAL A 1 97  ? -21.207 3.284   27.283  1.00   22.06  ? 97   VAL A CG2 1 
ATOM   773  N  N   . ILE A 1 98  ? -20.535 7.656   25.978  1.00   15.54  ? 98   ILE A N   1 
ATOM   774  C  CA  . ILE A 1 98  ? -19.966 9.006   25.998  1.00   15.01  ? 98   ILE A CA  1 
ATOM   775  C  C   . ILE A 1 98  ? -21.080 10.050  26.133  1.00   23.46  ? 98   ILE A C   1 
ATOM   776  O  O   . ILE A 1 98  ? -21.027 10.958  26.978  1.00   22.89  ? 98   ILE A O   1 
ATOM   777  C  CB  . ILE A 1 98  ? -19.125 9.227   24.716  1.00   18.97  ? 98   ILE A CB  1 
ATOM   778  C  CG1 . ILE A 1 98  ? -17.859 8.347   24.809  1.00   12.55  ? 98   ILE A CG1 1 
ATOM   779  C  CG2 . ILE A 1 98  ? -18.781 10.713  24.521  1.00   20.57  ? 98   ILE A CG2 1 
ATOM   780  C  CD1 . ILE A 1 98  ? -17.071 8.195   23.515  1.00   18.58  ? 98   ILE A CD1 1 
ATOM   781  N  N   . THR A 1 99  ? -22.112 9.900   25.315  1.00   19.73  ? 99   THR A N   1 
ATOM   782  C  CA  . THR A 1 99  ? -23.263 10.796  25.385  1.00   24.66  ? 99   THR A CA  1 
ATOM   783  C  C   . THR A 1 99  ? -23.840 10.814  26.793  1.00   23.37  ? 99   THR A C   1 
ATOM   784  O  O   . THR A 1 99  ? -24.108 11.873  27.363  1.00   28.92  ? 99   THR A O   1 
ATOM   785  C  CB  . THR A 1 99  ? -24.341 10.386  24.379  1.00   26.88  ? 99   THR A CB  1 
ATOM   786  O  OG1 . THR A 1 99  ? -23.841 10.626  23.054  1.00   33.17  ? 99   THR A OG1 1 
ATOM   787  C  CG2 . THR A 1 99  ? -25.582 11.210  24.588  1.00   34.96  ? 99   THR A CG2 1 
ATOM   788  N  N   . LYS A 1 100 ? -24.019 9.637   27.364  1.00   26.13  ? 100  LYS A N   1 
ATOM   789  C  CA  . LYS A 1 100 ? -24.506 9.551   28.727  1.00   29.46  ? 100  LYS A CA  1 
ATOM   790  C  C   . LYS A 1 100 ? -23.611 10.306  29.698  1.00   32.66  ? 100  LYS A C   1 
ATOM   791  O  O   . LYS A 1 100 ? -24.111 11.047  30.538  1.00   31.03  ? 100  LYS A O   1 
ATOM   792  C  CB  . LYS A 1 100 ? -24.650 8.100   29.155  1.00   27.76  ? 100  LYS A CB  1 
ATOM   793  C  CG  . LYS A 1 100 ? -25.027 7.909   30.606  1.00   27.41  ? 100  LYS A CG  1 
ATOM   794  C  CD  . LYS A 1 100 ? -25.435 6.440   30.852  1.00   34.75  ? 100  LYS A CD  1 
ATOM   795  C  CE  . LYS A 1 100 ? -25.076 5.958   32.240  1.00   40.21  ? 100  LYS A CE  1 
ATOM   796  N  NZ  . LYS A 1 100 ? -25.535 6.866   33.312  1.00   46.34  ? 100  LYS A NZ  1 
ATOM   797  N  N   . GLY A 1 101 ? -22.293 10.116  29.604  1.00   27.67  ? 101  GLY A N   1 
ATOM   798  C  CA  . GLY A 1 101 ? -21.377 10.842  30.467  1.00   24.44  ? 101  GLY A CA  1 
ATOM   799  C  C   . GLY A 1 101 ? -21.480 12.355  30.267  1.00   25.31  ? 101  GLY A C   1 
ATOM   800  O  O   . GLY A 1 101 ? -21.423 13.125  31.223  1.00   26.20  ? 101  GLY A O   1 
ATOM   801  N  N   . THR A 1 102 ? -21.609 12.768  29.011  1.00   23.40  ? 102  THR A N   1 
ATOM   802  C  CA  . THR A 1 102 ? -21.658 14.179  28.638  1.00   28.98  ? 102  THR A CA  1 
ATOM   803  C  C   . THR A 1 102 ? -22.904 14.818  29.248  1.00   30.19  ? 102  THR A C   1 
ATOM   804  O  O   . THR A 1 102 ? -22.839 15.871  29.878  1.00   33.25  ? 102  THR A O   1 
ATOM   805  C  CB  . THR A 1 102 ? -21.754 14.329  27.109  1.00   31.69  ? 102  THR A CB  1 
ATOM   806  O  OG1 . THR A 1 102 ? -20.528 13.913  26.496  1.00   36.10  ? 102  THR A OG1 1 
ATOM   807  C  CG2 . THR A 1 102 ? -22.062 15.767  26.726  1.00   33.31  ? 102  THR A CG2 1 
ATOM   808  N  N   . LYS A 1 103 ? -24.042 14.154  29.064  1.00   29.40  ? 103  LYS A N   1 
ATOM   809  C  CA  . LYS A 1 103 ? -25.322 14.646  29.593  1.00   40.72  ? 103  LYS A CA  1 
ATOM   810  C  C   . LYS A 1 103 ? -25.398 14.551  31.119  1.00   44.39  ? 103  LYS A C   1 
ATOM   811  O  O   . LYS A 1 103 ? -25.926 15.446  31.766  1.00   42.81  ? 103  LYS A O   1 
ATOM   812  C  CB  . LYS A 1 103 ? -26.500 13.904  28.961  1.00   44.48  ? 103  LYS A CB  1 
ATOM   813  C  CG  . LYS A 1 103 ? -26.533 13.988  27.449  1.00   47.04  ? 103  LYS A CG  1 
ATOM   814  C  CD  . LYS A 1 103 ? -26.755 15.409  26.983  1.00   49.94  ? 103  LYS A CD  1 
ATOM   815  C  CE  . LYS A 1 103 ? -26.470 15.543  25.495  1.00   51.79  ? 103  LYS A CE  1 
ATOM   816  N  NZ  . LYS A 1 103 ? -27.228 14.551  24.678  1.00   53.60  ? 103  LYS A NZ  1 
ATOM   817  N  N   . GLU A 1 104 ? -24.859 13.480  31.694  1.00   39.09  ? 104  GLU A N   1 
ATOM   818  C  CA  . GLU A 1 104 ? -24.869 13.300  33.153  1.00   43.72  ? 104  GLU A CA  1 
ATOM   819  C  C   . GLU A 1 104 ? -23.734 14.052  33.848  1.00   45.90  ? 104  GLU A C   1 
ATOM   820  O  O   . GLU A 1 104 ? -23.651 14.076  35.077  1.00   52.96  ? 104  GLU A O   1 
ATOM   821  C  CB  . GLU A 1 104 ? -24.791 11.808  33.511  1.00   51.30  ? 104  GLU A CB  1 
ATOM   822  C  CG  . GLU A 1 104 ? -26.121 11.132  33.883  1.00   66.88  ? 104  GLU A CG  1 
ATOM   823  C  CD  . GLU A 1 104 ? -27.129 11.062  32.734  1.00   78.88  ? 104  GLU A CD  1 
ATOM   824  O  OE1 . GLU A 1 104 ? -27.281 12.068  32.007  1.00   87.16  ? 104  GLU A OE1 1 
ATOM   825  O  OE2 . GLU A 1 104 ? -27.791 10.008  32.571  1.00   76.74  ? 104  GLU A OE2 1 
ATOM   826  N  N   . ARG A 1 105 ? -22.850 14.656  33.059  1.00   31.56  ? 105  ARG A N   1 
ATOM   827  C  CA  . ARG A 1 105 ? -21.666 15.307  33.602  1.00   31.49  ? 105  ARG A CA  1 
ATOM   828  C  C   . ARG A 1 105 ? -20.896 14.387  34.550  1.00   40.14  ? 105  ARG A C   1 
ATOM   829  O  O   . ARG A 1 105 ? -20.590 14.743  35.692  1.00   38.14  ? 105  ARG A O   1 
ATOM   830  C  CB  . ARG A 1 105 ? -22.047 16.638  34.281  1.00   42.45  ? 105  ARG A CB  1 
ATOM   831  C  CG  . ARG A 1 105 ? -22.743 17.606  33.329  1.00   59.13  ? 105  ARG A CG  1 
ATOM   832  C  CD  . ARG A 1 105 ? -22.941 18.997  33.937  1.00   72.32  ? 105  ARG A CD  1 
ATOM   833  N  NE  . ARG A 1 105 ? -21.670 19.618  34.304  1.00   83.19  ? 105  ARG A NE  1 
ATOM   834  C  CZ  . ARG A 1 105 ? -20.797 20.113  33.430  1.00   91.65  ? 105  ARG A CZ  1 
ATOM   835  N  NH1 . ARG A 1 105 ? -21.052 20.055  32.129  1.00   94.50  ? 105  ARG A NH1 1 
ATOM   836  N  NH2 . ARG A 1 105 ? -19.664 20.660  33.856  1.00   91.96  ? 105  ARG A NH2 1 
ATOM   837  N  N   . GLN A 1 106 ? -20.562 13.200  34.053  1.00   37.62  ? 106  GLN A N   1 
ATOM   838  C  CA  . GLN A 1 106 ? -19.800 12.244  34.833  1.00   26.49  ? 106  GLN A CA  1 
ATOM   839  C  C   . GLN A 1 106 ? -18.750 11.552  33.948  1.00   20.89  ? 106  GLN A C   1 
ATOM   840  O  O   . GLN A 1 106 ? -19.098 10.894  32.956  1.00   20.45  ? 106  GLN A O   1 
ATOM   841  C  CB  . GLN A 1 106 ? -20.755 11.218  35.453  1.00   34.95  ? 106  GLN A CB  1 
ATOM   842  C  CG  . GLN A 1 106 ? -20.065 10.022  36.077  0.70   40.37  ? 106  GLN A CG  1 
ATOM   843  C  CD  . GLN A 1 106 ? -19.287 10.395  37.316  0.42   45.08  ? 106  GLN A CD  1 
ATOM   844  O  OE1 . GLN A 1 106 ? -19.830 11.010  38.231  1.00   50.48  ? 106  GLN A OE1 1 
ATOM   845  N  NE2 . GLN A 1 106 ? -18.007 10.026  37.355  0.86   45.32  ? 106  GLN A NE2 1 
ATOM   846  N  N   . TYR A 1 107 ? -17.479 11.739  34.295  1.00   22.33  ? 107  TYR A N   1 
ATOM   847  C  CA  . TYR A 1 107 ? -16.370 11.128  33.571  1.00   25.30  ? 107  TYR A CA  1 
ATOM   848  C  C   . TYR A 1 107 ? -16.319 9.611   33.831  1.00   20.44  ? 107  TYR A C   1 
ATOM   849  O  O   . TYR A 1 107 ? -16.757 9.135   34.885  1.00   22.07  ? 107  TYR A O   1 
ATOM   850  C  CB  . TYR A 1 107 ? -15.040 11.763  33.986  1.00   17.50  ? 107  TYR A CB  1 
ATOM   851  C  CG  . TYR A 1 107 ? -14.785 13.174  33.467  1.00   24.68  ? 107  TYR A CG  1 
ATOM   852  C  CD1 . TYR A 1 107 ? -14.408 14.200  34.330  1.00   28.36  ? 107  TYR A CD1 1 
ATOM   853  C  CD2 . TYR A 1 107 ? -14.907 13.474  32.119  1.00   22.72  ? 107  TYR A CD2 1 
ATOM   854  C  CE1 . TYR A 1 107 ? -14.163 15.499  33.855  1.00   29.26  ? 107  TYR A CE1 1 
ATOM   855  C  CE2 . TYR A 1 107 ? -14.666 14.757  31.638  1.00   17.86  ? 107  TYR A CE2 1 
ATOM   856  C  CZ  . TYR A 1 107 ? -14.300 15.768  32.507  1.00   27.79  ? 107  TYR A CZ  1 
ATOM   857  O  OH  . TYR A 1 107 ? -14.055 17.036  32.005  1.00   22.09  ? 107  TYR A OH  1 
ATOM   858  N  N   . LEU A 1 108 ? -15.778 8.852   32.883  1.00   16.13  ? 108  LEU A N   1 
ATOM   859  C  CA  A LEU A 1 108 ? -15.618 7.414   33.082  0.19   18.90  ? 108  LEU A CA  1 
ATOM   860  C  CA  B LEU A 1 108 ? -15.590 7.400   33.047  0.81   18.57  ? 108  LEU A CA  1 
ATOM   861  C  C   . LEU A 1 108 ? -14.352 7.052   33.862  1.00   21.33  ? 108  LEU A C   1 
ATOM   862  O  O   . LEU A 1 108 ? -13.345 7.741   33.797  1.00   14.54  ? 108  LEU A O   1 
ATOM   863  C  CB  A LEU A 1 108 ? -15.635 6.697   31.738  0.19   19.72  ? 108  LEU A CB  1 
ATOM   864  C  CB  B LEU A 1 108 ? -15.443 6.724   31.686  0.81   16.65  ? 108  LEU A CB  1 
ATOM   865  C  CG  A LEU A 1 108 ? -16.987 6.814   31.035  0.19   22.56  ? 108  LEU A CG  1 
ATOM   866  C  CG  B LEU A 1 108 ? -16.735 6.515   30.885  0.81   23.94  ? 108  LEU A CG  1 
ATOM   867  C  CD1 A LEU A 1 108 ? -16.812 6.677   29.544  0.19   20.89  ? 108  LEU A CD1 1 
ATOM   868  C  CD1 B LEU A 1 108 ? -17.820 5.759   31.701  0.81   24.41  ? 108  LEU A CD1 1 
ATOM   869  C  CD2 A LEU A 1 108 ? -17.978 5.784   31.577  0.19   23.79  ? 108  LEU A CD2 1 
ATOM   870  C  CD2 B LEU A 1 108 ? -17.254 7.837   30.381  0.81   18.68  ? 108  LEU A CD2 1 
ATOM   871  N  N   . ASP A 1 109 ? -14.413 5.952   34.600  1.00   16.13  ? 109  ASP A N   1 
ATOM   872  C  CA  . ASP A 1 109 ? -13.249 5.493   35.368  1.00   15.93  ? 109  ASP A CA  1 
ATOM   873  C  C   . ASP A 1 109 ? -12.033 5.197   34.484  1.00   15.61  ? 109  ASP A C   1 
ATOM   874  O  O   . ASP A 1 109 ? -12.184 4.630   33.393  1.00   17.59  ? 109  ASP A O   1 
ATOM   875  C  CB  . ASP A 1 109 ? -13.601 4.185   36.075  1.00   26.94  ? 109  ASP A CB  1 
ATOM   876  C  CG  . ASP A 1 109 ? -14.559 4.383   37.222  1.00   43.13  ? 109  ASP A CG  1 
ATOM   877  O  OD1 . ASP A 1 109 ? -14.648 5.510   37.752  1.00   47.13  ? 109  ASP A OD1 1 
ATOM   878  O  OD2 . ASP A 1 109 ? -15.217 3.397   37.603  1.00   52.83  ? 109  ASP A OD2 1 
ATOM   879  N  N   . GLU A 1 110 ? -10.836 5.506   34.981  1.00   10.63  ? 110  GLU A N   1 
ATOM   880  C  CA  . GLU A 1 110 ? -9.608  5.133   34.286  1.00   14.13  ? 110  GLU A CA  1 
ATOM   881  C  C   . GLU A 1 110 ? -9.578  3.624   33.980  1.00   16.41  ? 110  GLU A C   1 
ATOM   882  O  O   . GLU A 1 110 ? -9.180  3.220   32.891  1.00   14.72  ? 110  GLU A O   1 
ATOM   883  C  CB  . GLU A 1 110 ? -8.340  5.586   35.053  1.00   11.72  ? 110  GLU A CB  1 
ATOM   884  C  CG  . GLU A 1 110 ? -7.032  5.121   34.392  1.00   12.81  ? 110  GLU A CG  1 
ATOM   885  C  CD  . GLU A 1 110 ? -5.844  6.055   34.601  1.00   20.97  ? 110  GLU A CD  1 
ATOM   886  O  OE1 . GLU A 1 110 ? -6.041  7.213   35.043  1.00   15.36  ? 110  GLU A OE1 1 
ATOM   887  O  OE2 . GLU A 1 110 ? -4.700  5.642   34.269  1.00   14.51  ? 110  GLU A OE2 1 
ATOM   888  N  N   . GLU A 1 111 ? -10.018 2.790   34.923  1.00   12.23  ? 111  GLU A N   1 
ATOM   889  C  CA  . GLU A 1 111 ? -10.024 1.347   34.687  1.00   12.86  ? 111  GLU A CA  1 
ATOM   890  C  C   . GLU A 1 111 ? -10.806 0.993   33.423  1.00   12.46  ? 111  GLU A C   1 
ATOM   891  O  O   . GLU A 1 111 ? -10.415 0.102   32.654  1.00   11.93  ? 111  GLU A O   1 
ATOM   892  C  CB  . GLU A 1 111 ? -10.604 0.591   35.897  1.00   12.02  ? 111  GLU A CB  1 
ATOM   893  C  CG  . GLU A 1 111 ? -9.595  0.517   37.079  1.00   14.48  ? 111  GLU A CG  1 
ATOM   894  C  CD  . GLU A 1 111 ? -8.453  -0.457  36.776  1.00   23.20  ? 111  GLU A CD  1 
ATOM   895  O  OE1 . GLU A 1 111 ? -7.385  -0.056  36.236  1.00   19.90  ? 111  GLU A OE1 1 
ATOM   896  O  OE2 . GLU A 1 111 ? -8.632  -1.648  37.084  1.00   21.59  ? 111  GLU A OE2 1 
ATOM   897  N  N   . PHE A 1 112 ? -11.945 1.639   33.240  1.00   13.24  ? 112  PHE A N   1 
ATOM   898  C  CA  . PHE A 1 112 ? -12.758 1.345   32.057  1.00   10.29  ? 112  PHE A CA  1 
ATOM   899  C  C   . PHE A 1 112 ? -12.037 1.809   30.802  1.00   9.27   ? 112  PHE A C   1 
ATOM   900  O  O   . PHE A 1 112 ? -12.086 1.148   29.736  1.00   9.20   ? 112  PHE A O   1 
ATOM   901  C  CB  . PHE A 1 112 ? -14.109 2.042   32.152  1.00   15.32  ? 112  PHE A CB  1 
ATOM   902  C  CG  . PHE A 1 112 ? -14.948 1.849   30.937  1.00   20.68  ? 112  PHE A CG  1 
ATOM   903  C  CD1 . PHE A 1 112 ? -15.551 0.629   30.689  1.00   23.57  ? 112  PHE A CD1 1 
ATOM   904  C  CD2 . PHE A 1 112 ? -15.116 2.874   30.037  1.00   13.39  ? 112  PHE A CD2 1 
ATOM   905  C  CE1 . PHE A 1 112 ? -16.333 0.448   29.557  1.00   24.88  ? 112  PHE A CE1 1 
ATOM   906  C  CE2 . PHE A 1 112 ? -15.887 2.705   28.910  1.00   17.46  ? 112  PHE A CE2 1 
ATOM   907  C  CZ  . PHE A 1 112 ? -16.497 1.490   28.663  1.00   19.67  ? 112  PHE A CZ  1 
ATOM   908  N  N   . VAL A 1 113 ? -11.400 2.973   30.873  1.00   10.98  ? 113  VAL A N   1 
ATOM   909  C  CA  . VAL A 1 113 ? -10.642 3.437   29.704  1.00   7.11   ? 113  VAL A CA  1 
ATOM   910  C  C   . VAL A 1 113 ? -9.498  2.483   29.322  1.00   11.55  ? 113  VAL A C   1 
ATOM   911  O  O   . VAL A 1 113 ? -9.234  2.245   28.148  1.00   10.00  ? 113  VAL A O   1 
ATOM   912  C  CB  . VAL A 1 113 ? -10.051 4.855   29.902  1.00   13.13  ? 113  VAL A CB  1 
ATOM   913  C  CG1 . VAL A 1 113 ? -9.171  5.218   28.683  1.00   9.82   ? 113  VAL A CG1 1 
ATOM   914  C  CG2 . VAL A 1 113 ? -11.181 5.891   30.080  1.00   9.36   ? 113  VAL A CG2 1 
ATOM   915  N  N   . LEU A 1 114 ? -8.819  1.936   30.322  1.00   7.37   ? 114  LEU A N   1 
ATOM   916  C  CA  . LEU A 1 114 ? -7.746  0.955   30.073  1.00   9.37   ? 114  LEU A CA  1 
ATOM   917  C  C   . LEU A 1 114 ? -8.265  -0.329  29.437  1.00   10.89  ? 114  LEU A C   1 
ATOM   918  O  O   . LEU A 1 114 ? -7.601  -0.919  28.559  1.00   11.13  ? 114  LEU A O   1 
ATOM   919  C  CB  . LEU A 1 114 ? -7.028  0.623   31.395  1.00   6.89   ? 114  LEU A CB  1 
ATOM   920  C  CG  . LEU A 1 114 ? -6.345  1.848   32.009  1.00   12.53  ? 114  LEU A CG  1 
ATOM   921  C  CD1 . LEU A 1 114 ? -5.665  1.522   33.346  1.00   15.63  ? 114  LEU A CD1 1 
ATOM   922  C  CD2 . LEU A 1 114 ? -5.310  2.409   31.054  1.00   15.94  ? 114  LEU A CD2 1 
ATOM   923  N  N   . ARG A 1 115 ? -9.443  -0.779  29.870  1.00   9.49   ? 115  ARG A N   1 
ATOM   924  C  CA  A ARG A 1 115 ? -10.045 -1.960  29.260  0.72   11.83  ? 115  ARG A CA  1 
ATOM   925  C  CA  B ARG A 1 115 ? -10.078 -1.956  29.268  0.28   13.29  ? 115  ARG A CA  1 
ATOM   926  C  C   . ARG A 1 115 ? -10.334 -1.707  27.779  1.00   14.23  ? 115  ARG A C   1 
ATOM   927  O  O   . ARG A 1 115 ? -10.020 -2.534  26.923  1.00   8.00   ? 115  ARG A O   1 
ATOM   928  C  CB  A ARG A 1 115 ? -11.323 -2.367  29.992  0.72   16.89  ? 115  ARG A CB  1 
ATOM   929  C  CB  B ARG A 1 115 ? -11.406 -2.297  29.966  0.28   16.75  ? 115  ARG A CB  1 
ATOM   930  C  CG  A ARG A 1 115 ? -11.056 -2.963  31.372  0.72   20.60  ? 115  ARG A CG  1 
ATOM   931  C  CG  B ARG A 1 115 ? -11.305 -2.568  31.470  0.28   20.95  ? 115  ARG A CG  1 
ATOM   932  C  CD  A ARG A 1 115 ? -12.332 -3.599  31.938  0.72   21.77  ? 115  ARG A CD  1 
ATOM   933  C  CD  B ARG A 1 115 ? -12.586 -3.231  32.024  0.28   20.13  ? 115  ARG A CD  1 
ATOM   934  N  NE  A ARG A 1 115 ? -12.008 -4.477  33.043  0.72   15.80  ? 115  ARG A NE  1 
ATOM   935  N  NE  B ARG A 1 115 ? -13.756 -3.013  31.171  0.28   14.16  ? 115  ARG A NE  1 
ATOM   936  C  CZ  A ARG A 1 115 ? -12.020 -4.112  34.320  0.72   22.56  ? 115  ARG A CZ  1 
ATOM   937  C  CZ  B ARG A 1 115 ? -14.965 -2.690  31.624  0.28   10.78  ? 115  ARG A CZ  1 
ATOM   938  N  NH1 A ARG A 1 115 ? -12.372 -2.875  34.677  0.72   13.70  ? 115  ARG A NH1 1 
ATOM   939  N  NH1 B ARG A 1 115 ? -15.180 -2.540  32.923  0.28   6.96   ? 115  ARG A NH1 1 
ATOM   940  N  NH2 A ARG A 1 115 ? -11.709 -5.004  35.243  0.72   21.64  ? 115  ARG A NH2 1 
ATOM   941  N  NH2 B ARG A 1 115 ? -15.970 -2.520  30.779  0.28   4.38   ? 115  ARG A NH2 1 
ATOM   942  N  N   . VAL A 1 116 ? -10.901 -0.549  27.477  1.00   6.87   ? 116  VAL A N   1 
ATOM   943  C  CA  . VAL A 1 116 ? -11.171 -0.210  26.080  1.00   6.43   ? 116  VAL A CA  1 
ATOM   944  C  C   . VAL A 1 116 ? -9.868  -0.140  25.281  1.00   8.15   ? 116  VAL A C   1 
ATOM   945  O  O   . VAL A 1 116 ? -9.754  -0.719  24.200  1.00   11.09  ? 116  VAL A O   1 
ATOM   946  C  CB  . VAL A 1 116 ? -11.930 1.125   25.976  1.00   10.39  ? 116  VAL A CB  1 
ATOM   947  C  CG1 . VAL A 1 116 ? -12.023 1.547   24.502  1.00   11.29  ? 116  VAL A CG1 1 
ATOM   948  C  CG2 . VAL A 1 116 ? -13.325 0.957   26.572  1.00   7.37   ? 116  VAL A CG2 1 
ATOM   949  N  N   . MET A 1 117 ? -8.871  0.566   25.818  1.00   4.99   ? 117  MET A N   1 
ATOM   950  C  CA  . MET A 1 117 ? -7.595  0.657   25.121  1.00   8.46   ? 117  MET A CA  1 
ATOM   951  C  C   . MET A 1 117 ? -7.006  -0.738  24.849  1.00   9.20   ? 117  MET A C   1 
ATOM   952  O  O   . MET A 1 117 ? -6.555  -1.031  23.734  1.00   8.35   ? 117  MET A O   1 
ATOM   953  C  CB  . MET A 1 117 ? -6.595  1.508   25.930  1.00   10.87  ? 117  MET A CB  1 
ATOM   954  C  CG  . MET A 1 117 ? -5.186  1.577   25.290  1.00   10.73  ? 117  MET A CG  1 
ATOM   955  S  SD  . MET A 1 117 ? -4.057  2.747   26.144  1.00   17.35  ? 117  MET A SD  1 
ATOM   956  C  CE  . MET A 1 117 ? -3.924  2.047   27.738  1.00   18.96  ? 117  MET A CE  1 
ATOM   957  N  N   . THR A 1 118 ? -6.950  -1.567  25.886  1.00   5.94   ? 118  THR A N   1 
ATOM   958  C  CA  . THR A 1 118 ? -6.315  -2.910  25.766  1.00   6.97   ? 118  THR A CA  1 
ATOM   959  C  C   . THR A 1 118 ? -7.053  -3.762  24.727  1.00   9.89   ? 118  THR A C   1 
ATOM   960  O  O   . THR A 1 118 ? -6.466  -4.317  23.800  1.00   9.21   ? 118  THR A O   1 
ATOM   961  C  CB  . THR A 1 118 ? -6.347  -3.614  27.148  1.00   10.96  ? 118  THR A CB  1 
ATOM   962  O  OG1 . THR A 1 118 ? -5.626  -2.802  28.103  1.00   9.50   ? 118  THR A OG1 1 
ATOM   963  C  CG2 . THR A 1 118 ? -5.735  -5.014  27.093  1.00   11.00  ? 118  THR A CG2 1 
ATOM   964  N  N   . GLN A 1 119 ? -8.363  -3.856  24.871  1.00   9.71   ? 119  GLN A N   1 
ATOM   965  C  CA  . GLN A 1 119 ? -9.128  -4.767  24.023  1.00   7.23   ? 119  GLN A CA  1 
ATOM   966  C  C   . GLN A 1 119 ? -9.291  -4.266  22.570  1.00   10.36  ? 119  GLN A C   1 
ATOM   967  O  O   . GLN A 1 119 ? -9.276  -5.060  21.625  1.00   10.50  ? 119  GLN A O   1 
ATOM   968  C  CB  . GLN A 1 119 ? -10.462 -5.085  24.690  1.00   3.38   ? 119  GLN A CB  1 
ATOM   969  C  CG  . GLN A 1 119 ? -10.244 -5.883  26.026  1.00   12.74  ? 119  GLN A CG  1 
ATOM   970  C  CD  . GLN A 1 119 ? -11.542 -6.294  26.718  1.00   13.05  ? 119  GLN A CD  1 
ATOM   971  O  OE1 . GLN A 1 119 ? -12.463 -6.830  26.084  1.00   9.41   ? 119  GLN A OE1 1 
ATOM   972  N  NE2 . GLN A 1 119 ? -11.612 -6.072  28.039  1.00   12.62  ? 119  GLN A NE2 1 
ATOM   973  N  N   . LEU A 1 120 ? -9.440  -2.964  22.375  1.00   10.66  ? 120  LEU A N   1 
ATOM   974  C  CA  . LEU A 1 120 ? -9.474  -2.439  21.006  1.00   9.35   ? 120  LEU A CA  1 
ATOM   975  C  C   . LEU A 1 120 ? -8.122  -2.528  20.305  1.00   9.88   ? 120  LEU A C   1 
ATOM   976  O  O   . LEU A 1 120 ? -8.070  -2.681  19.084  1.00   13.57  ? 120  LEU A O   1 
ATOM   977  C  CB  . LEU A 1 120 ? -9.971  -0.968  20.958  1.00   5.94   ? 120  LEU A CB  1 
ATOM   978  C  CG  . LEU A 1 120 ? -11.466 -0.779  21.257  1.00   9.20   ? 120  LEU A CG  1 
ATOM   979  C  CD1 . LEU A 1 120 ? -11.901 0.686   20.987  1.00   14.48  ? 120  LEU A CD1 1 
ATOM   980  C  CD2 . LEU A 1 120 ? -12.311 -1.769  20.419  1.00   16.52  ? 120  LEU A CD2 1 
ATOM   981  N  N   . THR A 1 121 ? -7.028  -2.349  21.053  1.00   7.43   ? 121  THR A N   1 
ATOM   982  C  CA  . THR A 1 121 ? -5.704  -2.505  20.454  1.00   8.32   ? 121  THR A CA  1 
ATOM   983  C  C   . THR A 1 121 ? -5.526  -3.982  20.022  1.00   10.01  ? 121  THR A C   1 
ATOM   984  O  O   . THR A 1 121 ? -4.946  -4.274  18.975  1.00   14.47  ? 121  THR A O   1 
ATOM   985  C  CB  . THR A 1 121 ? -4.564  -2.075  21.437  1.00   11.72  ? 121  THR A CB  1 
ATOM   986  O  OG1 . THR A 1 121 ? -4.706  -0.682  21.743  1.00   13.97  ? 121  THR A OG1 1 
ATOM   987  C  CG2 . THR A 1 121 ? -3.225  -2.282  20.792  1.00   13.62  ? 121  THR A CG2 1 
ATOM   988  N  N   . LEU A 1 122 ? -6.041  -4.919  20.813  1.00   9.90   ? 122  LEU A N   1 
ATOM   989  C  CA  . LEU A 1 122 ? -6.012  -6.324  20.377  1.00   10.85  ? 122  LEU A CA  1 
ATOM   990  C  C   . LEU A 1 122 ? -6.913  -6.591  19.158  1.00   15.95  ? 122  LEU A C   1 
ATOM   991  O  O   . LEU A 1 122 ? -6.557  -7.367  18.276  1.00   14.36  ? 122  LEU A O   1 
ATOM   992  C  CB  . LEU A 1 122 ? -6.351  -7.254  21.526  1.00   7.38   ? 122  LEU A CB  1 
ATOM   993  C  CG  . LEU A 1 122 ? -5.196  -7.202  22.545  1.00   12.07  ? 122  LEU A CG  1 
ATOM   994  C  CD1 . LEU A 1 122 ? -5.650  -7.664  23.911  1.00   17.44  ? 122  LEU A CD1 1 
ATOM   995  C  CD2 . LEU A 1 122 ? -3.980  -8.003  22.034  1.00   15.25  ? 122  LEU A CD2 1 
ATOM   996  N  N   . ALA A 1 123 ? -8.072  -5.948  19.100  1.00   13.87  ? 123  ALA A N   1 
ATOM   997  C  CA  . ALA A 1 123 ? -8.932  -6.100  17.924  1.00   14.90  ? 123  ALA A CA  1 
ATOM   998  C  C   . ALA A 1 123 ? -8.201  -5.564  16.712  1.00   16.84  ? 123  ALA A C   1 
ATOM   999  O  O   . ALA A 1 123 ? -8.184  -6.174  15.623  1.00   15.08  ? 123  ALA A O   1 
ATOM   1000 C  CB  . ALA A 1 123 ? -10.265 -5.355  18.140  1.00   11.72  ? 123  ALA A CB  1 
ATOM   1001 N  N   . LEU A 1 124 ? -7.595  -4.393  16.888  1.00   12.83  ? 124  LEU A N   1 
ATOM   1002 C  CA  . LEU A 1 124 ? -6.830  -3.799  15.807  1.00   12.03  ? 124  LEU A CA  1 
ATOM   1003 C  C   . LEU A 1 124 ? -5.691  -4.689  15.357  1.00   16.24  ? 124  LEU A C   1 
ATOM   1004 O  O   . LEU A 1 124 ? -5.469  -4.864  14.176  1.00   21.87  ? 124  LEU A O   1 
ATOM   1005 C  CB  . LEU A 1 124 ? -6.291  -2.432  16.250  1.00   16.88  ? 124  LEU A CB  1 
ATOM   1006 C  CG  . LEU A 1 124 ? -5.617  -1.559  15.229  1.00   21.26  ? 124  LEU A CG  1 
ATOM   1007 C  CD1 . LEU A 1 124 ? -6.533  -1.397  14.023  1.00   26.43  ? 124  LEU A CD1 1 
ATOM   1008 C  CD2 . LEU A 1 124 ? -5.313  -0.192  15.918  1.00   23.70  ? 124  LEU A CD2 1 
ATOM   1009 N  N   . LYS A 1 125 ? -4.965  -5.265  16.304  1.00   14.86  ? 125  LYS A N   1 
ATOM   1010 C  CA  . LYS A 1 125 ? -3.871  -6.158  15.945  1.00   16.27  ? 125  LYS A CA  1 
ATOM   1011 C  C   . LYS A 1 125 ? -4.357  -7.304  15.052  1.00   22.64  ? 125  LYS A C   1 
ATOM   1012 O  O   . LYS A 1 125 ? -3.707  -7.679  14.072  1.00   19.54  ? 125  LYS A O   1 
ATOM   1013 C  CB  . LYS A 1 125 ? -3.262  -6.724  17.207  1.00   17.52  ? 125  LYS A CB  1 
ATOM   1014 C  CG  . LYS A 1 125 ? -2.043  -7.645  16.993  1.00   29.58  ? 125  LYS A CG  1 
ATOM   1015 C  CD  . LYS A 1 125 ? -1.585  -8.107  18.388  1.00   32.71  ? 125  LYS A CD  1 
ATOM   1016 C  CE  . LYS A 1 125 ? -0.409  -9.046  18.394  1.00   40.59  ? 125  LYS A CE  1 
ATOM   1017 N  NZ  . LYS A 1 125 ? -0.156  -9.489  19.799  1.00   32.96  ? 125  LYS A NZ  1 
ATOM   1018 N  N   . GLU A 1 126 ? -5.499  -7.872  15.407  1.00   18.49  ? 126  GLU A N   1 
ATOM   1019 C  CA  . GLU A 1 126 ? -6.064  -8.958  14.617  1.00   20.97  ? 126  GLU A CA  1 
ATOM   1020 C  C   . GLU A 1 126 ? -6.500  -8.465  13.227  1.00   25.06  ? 126  GLU A C   1 
ATOM   1021 O  O   . GLU A 1 126 ? -6.310  -9.170  12.231  1.00   29.17  ? 126  GLU A O   1 
ATOM   1022 C  CB  . GLU A 1 126 ? -7.224  -9.589  15.367  1.00   24.98  ? 126  GLU A CB  1 
ATOM   1023 C  CG  . GLU A 1 126 ? -7.994  -10.613 14.560  1.00   26.47  ? 126  GLU A CG  1 
ATOM   1024 C  CD  . GLU A 1 126 ? -7.173  -11.875 14.287  1.00   32.08  ? 126  GLU A CD  1 
ATOM   1025 O  OE1 . GLU A 1 126 ? -6.047  -12.005 14.815  1.00   33.54  ? 126  GLU A OE1 1 
ATOM   1026 O  OE2 . GLU A 1 126 ? -7.664  -12.736 13.543  1.00   37.43  ? 126  GLU A OE2 1 
ATOM   1027 N  N   . CYS A 1 127 ? -7.061  -7.255  13.139  1.00   20.04  ? 127  CYS A N   1 
ATOM   1028 C  CA  . CYS A 1 127 ? -7.434  -6.713  11.821  1.00   23.38  ? 127  CYS A CA  1 
ATOM   1029 C  C   . CYS A 1 127 ? -6.204  -6.555  10.943  1.00   21.22  ? 127  CYS A C   1 
ATOM   1030 O  O   . CYS A 1 127 ? -6.237  -6.886  9.760   1.00   29.99  ? 127  CYS A O   1 
ATOM   1031 C  CB  . CYS A 1 127 ? -8.207  -5.383  11.903  1.00   20.98  ? 127  CYS A CB  1 
ATOM   1032 S  SG  . CYS A 1 127 ? -9.845  -5.493  12.674  1.00   27.63  ? 127  CYS A SG  1 
ATOM   1033 N  N   . HIS A 1 128 ? -5.110  -6.072  11.523  1.00   22.26  ? 128  HIS A N   1 
ATOM   1034 C  CA  . HIS A 1 128 ? -3.896  -5.879  10.743  1.00   27.65  ? 128  HIS A CA  1 
ATOM   1035 C  C   . HIS A 1 128 ? -3.336  -7.229  10.322  1.00   37.28  ? 128  HIS A C   1 
ATOM   1036 O  O   . HIS A 1 128 ? -2.844  -7.381  9.206   1.00   38.48  ? 128  HIS A O   1 
ATOM   1037 C  CB  . HIS A 1 128 ? -2.858  -5.105  11.552  1.00   25.10  ? 128  HIS A CB  1 
ATOM   1038 C  CG  . HIS A 1 128 ? -3.222  -3.670  11.757  1.00   26.68  ? 128  HIS A CG  1 
ATOM   1039 N  ND1 . HIS A 1 128 ? -2.609  -2.870  12.700  1.00   27.21  ? 128  HIS A ND1 1 
ATOM   1040 C  CD2 . HIS A 1 128 ? -4.140  -2.888  11.137  1.00   22.86  ? 128  HIS A CD2 1 
ATOM   1041 C  CE1 . HIS A 1 128 ? -3.128  -1.655  12.648  1.00   28.86  ? 128  HIS A CE1 1 
ATOM   1042 N  NE2 . HIS A 1 128 ? -4.063  -1.640  11.713  1.00   29.57  ? 128  HIS A NE2 1 
ATOM   1043 N  N   . ARG A 1 129 ? -3.410  -8.208  11.221  1.00   34.86  ? 129  ARG A N   1 
ATOM   1044 C  CA  . ARG A 1 129 ? -2.856  -9.527  10.929  1.00   41.18  ? 129  ARG A CA  1 
ATOM   1045 C  C   . ARG A 1 129 ? -3.530  -10.101 9.689   1.00   45.47  ? 129  ARG A C   1 
ATOM   1046 O  O   . ARG A 1 129 ? -2.863  -10.584 8.779   1.00   46.21  ? 129  ARG A O   1 
ATOM   1047 C  CB  . ARG A 1 129 ? -3.030  -10.477 12.115  1.00   41.03  ? 129  ARG A CB  1 
ATOM   1048 C  CG  . ARG A 1 129 ? -2.299  -11.801 11.941  1.00   51.96  ? 129  ARG A CG  1 
ATOM   1049 C  CD  . ARG A 1 129 ? -2.648  -12.789 13.043  1.00   51.99  ? 129  ARG A CD  1 
ATOM   1050 N  NE  . ARG A 1 129 ? -4.062  -13.142 13.018  1.00   59.04  ? 129  ARG A NE  1 
ATOM   1051 C  CZ  . ARG A 1 129 ? -4.601  -13.987 12.144  1.00   68.49  ? 129  ARG A CZ  1 
ATOM   1052 N  NH1 . ARG A 1 129 ? -3.843  -14.559 11.219  1.00   70.90  ? 129  ARG A NH1 1 
ATOM   1053 N  NH2 . ARG A 1 129 ? -5.897  -14.257 12.190  1.00   70.74  ? 129  ARG A NH2 1 
ATOM   1054 N  N   . ARG A 1 130 ? -4.856  -10.020 9.651   1.00   57.23  ? 130  ARG A N   1 
ATOM   1055 C  CA  . ARG A 1 130 ? -5.622  -10.518 8.516   1.00   61.36  ? 130  ARG A CA  1 
ATOM   1056 C  C   . ARG A 1 130 ? -5.164  -9.849  7.220   1.00   69.81  ? 130  ARG A C   1 
ATOM   1057 O  O   . ARG A 1 130 ? -4.815  -10.525 6.247   1.00   69.47  ? 130  ARG A O   1 
ATOM   1058 C  CB  . ARG A 1 130 ? -7.117  -10.291 8.744   1.00   59.80  ? 130  ARG A CB  1 
ATOM   1059 C  CG  . ARG A 1 130 ? -7.668  -10.981 9.985   1.00   60.73  ? 130  ARG A CG  1 
ATOM   1060 C  CD  . ARG A 1 130 ? -7.507  -12.494 9.912   1.00   62.47  ? 130  ARG A CD  1 
ATOM   1061 N  N   . SER A 1 131 ? -5.155  -8.519  7.219   1.00   71.22  ? 131  SER A N   1 
ATOM   1062 C  CA  . SER A 1 131 ? -4.717  -7.757  6.055   1.00   76.50  ? 131  SER A CA  1 
ATOM   1063 C  C   . SER A 1 131 ? -3.251  -8.018  5.734   1.00   77.47  ? 131  SER A C   1 
ATOM   1064 O  O   . SER A 1 131 ? -2.734  -7.518  4.738   1.00   79.47  ? 131  SER A O   1 
ATOM   1065 C  CB  . SER A 1 131 ? -4.942  -6.260  6.275   1.00   78.73  ? 131  SER A CB  1 
ATOM   1066 O  OG  . SER A 1 131 ? -6.319  -5.977  6.442   1.00   79.68  ? 131  SER A OG  1 
ATOM   1067 N  N   . HIS A 1 139 ? -12.125 -2.423  5.931   1.00   62.27  ? 139  HIS A N   1 
ATOM   1068 C  CA  . HIS A 1 139 ? -11.629 -1.925  7.214   1.00   63.41  ? 139  HIS A CA  1 
ATOM   1069 C  C   . HIS A 1 139 ? -12.782 -1.547  8.141   1.00   56.92  ? 139  HIS A C   1 
ATOM   1070 O  O   . HIS A 1 139 ? -13.735 -0.895  7.719   1.00   55.34  ? 139  HIS A O   1 
ATOM   1071 C  CB  . HIS A 1 139 ? -10.703 -0.719  7.008   1.00   63.45  ? 139  HIS A CB  1 
ATOM   1072 N  N   . ARG A 1 140 ? -12.684 -1.960  9.403   1.00   48.48  ? 140  ARG A N   1 
ATOM   1073 C  CA  . ARG A 1 140 ? -13.702 -1.661  10.408  1.00   36.73  ? 140  ARG A CA  1 
ATOM   1074 C  C   . ARG A 1 140 ? -13.408 -0.312  11.071  1.00   33.64  ? 140  ARG A C   1 
ATOM   1075 O  O   . ARG A 1 140 ? -12.291 -0.060  11.513  1.00   36.87  ? 140  ARG A O   1 
ATOM   1076 C  CB  . ARG A 1 140 ? -13.722 -2.761  11.469  1.00   23.55  ? 140  ARG A CB  1 
ATOM   1077 C  CG  . ARG A 1 140 ? -14.101 -4.134  10.941  1.00   27.25  ? 140  ARG A CG  1 
ATOM   1078 C  CD  . ARG A 1 140 ? -13.798 -5.218  11.981  1.00   30.52  ? 140  ARG A CD  1 
ATOM   1079 N  NE  . ARG A 1 140 ? -14.190 -6.544  11.498  1.00   37.78  ? 140  ARG A NE  1 
ATOM   1080 C  CZ  . ARG A 1 140 ? -15.330 -7.147  11.815  1.00   30.58  ? 140  ARG A CZ  1 
ATOM   1081 N  NH1 . ARG A 1 140 ? -16.193 -6.553  12.630  1.00   28.90  ? 140  ARG A NH1 1 
ATOM   1082 N  NH2 . ARG A 1 140 ? -15.601 -8.354  11.331  1.00   32.00  ? 140  ARG A NH2 1 
ATOM   1083 N  N   . ASP A 1 141 ? -14.414 0.545   11.154  1.00   28.11  ? 141  ASP A N   1 
ATOM   1084 C  CA  . ASP A 1 141 ? -14.229 1.894   11.685  1.00   28.03  ? 141  ASP A CA  1 
ATOM   1085 C  C   . ASP A 1 141 ? -13.901 1.902   13.168  1.00   26.35  ? 141  ASP A C   1 
ATOM   1086 O  O   . ASP A 1 141 ? -14.638 1.342   13.966  1.00   19.19  ? 141  ASP A O   1 
ATOM   1087 C  CB  . ASP A 1 141 ? -15.498 2.704   11.487  1.00   32.04  ? 141  ASP A CB  1 
ATOM   1088 C  CG  . ASP A 1 141 ? -15.733 3.080   10.032  1.00   45.29  ? 141  ASP A CG  1 
ATOM   1089 O  OD1 . ASP A 1 141 ? -16.911 3.104   9.612   1.00   47.88  ? 141  ASP A OD1 1 
ATOM   1090 O  OD2 . ASP A 1 141 ? -14.744 3.349   9.316   1.00   48.38  ? 141  ASP A OD2 1 
ATOM   1091 N  N   . LEU A 1 142 ? -12.801 2.551   13.537  1.00   29.91  ? 142  LEU A N   1 
ATOM   1092 C  CA  . LEU A 1 142 ? -12.525 2.814   14.941  1.00   24.46  ? 142  LEU A CA  1 
ATOM   1093 C  C   . LEU A 1 142 ? -13.239 4.092   15.363  1.00   24.76  ? 142  LEU A C   1 
ATOM   1094 O  O   . LEU A 1 142 ? -12.678 5.187   15.287  1.00   27.74  ? 142  LEU A O   1 
ATOM   1095 C  CB  . LEU A 1 142 ? -11.025 2.937   15.191  1.00   34.17  ? 142  LEU A CB  1 
ATOM   1096 C  CG  . LEU A 1 142 ? -10.318 1.741   15.850  1.00   39.24  ? 142  LEU A CG  1 
ATOM   1097 C  CD1 . LEU A 1 142 ? -10.287 0.540   14.936  1.00   42.71  ? 142  LEU A CD1 1 
ATOM   1098 C  CD2 . LEU A 1 142 ? -8.906  2.122   16.246  0.50   35.83  ? 142  LEU A CD2 1 
ATOM   1099 N  N   . LYS A 1 143 ? -14.481 3.949   15.795  1.00   16.20  ? 143  LYS A N   1 
ATOM   1100 C  CA  . LYS A 1 143 ? -15.277 5.073   16.251  1.00   15.79  ? 143  LYS A CA  1 
ATOM   1101 C  C   . LYS A 1 143 ? -16.228 4.553   17.317  1.00   21.14  ? 143  LYS A C   1 
ATOM   1102 O  O   . LYS A 1 143 ? -16.576 3.368   17.310  1.00   19.33  ? 143  LYS A O   1 
ATOM   1103 C  CB  . LYS A 1 143 ? -16.036 5.699   15.088  1.00   24.38  ? 143  LYS A CB  1 
ATOM   1104 C  CG  . LYS A 1 143 ? -17.054 4.778   14.477  1.00   36.67  ? 143  LYS A CG  1 
ATOM   1105 C  CD  . LYS A 1 143 ? -17.907 5.467   13.417  1.00   40.35  ? 143  LYS A CD  1 
ATOM   1106 C  CE  . LYS A 1 143 ? -19.058 4.546   13.020  1.00   42.17  ? 143  LYS A CE  1 
ATOM   1107 N  NZ  . LYS A 1 143 ? -20.014 5.184   12.076  1.00   56.66  ? 143  LYS A NZ  1 
ATOM   1108 N  N   . PRO A 1 144 ? -16.639 5.426   18.248  1.00   17.91  ? 144  PRO A N   1 
ATOM   1109 C  CA  . PRO A 1 144 ? -17.437 4.985   19.398  1.00   19.58  ? 144  PRO A CA  1 
ATOM   1110 C  C   . PRO A 1 144 ? -18.702 4.200   19.008  1.00   22.89  ? 144  PRO A C   1 
ATOM   1111 O  O   . PRO A 1 144 ? -19.024 3.221   19.674  1.00   18.18  ? 144  PRO A O   1 
ATOM   1112 C  CB  . PRO A 1 144 ? -17.801 6.300   20.081  1.00   20.65  ? 144  PRO A CB  1 
ATOM   1113 C  CG  . PRO A 1 144 ? -16.605 7.199   19.764  1.00   18.66  ? 144  PRO A CG  1 
ATOM   1114 C  CD  . PRO A 1 144 ? -16.237 6.843   18.356  1.00   19.21  ? 144  PRO A CD  1 
ATOM   1115 N  N   . ALA A 1 145 ? -19.402 4.619   17.954  1.00   14.06  ? 145  ALA A N   1 
ATOM   1116 C  CA  . ALA A 1 145 ? -20.612 3.922   17.527  1.00   18.10  ? 145  ALA A CA  1 
ATOM   1117 C  C   . ALA A 1 145 ? -20.340 2.491   17.067  1.00   18.33  ? 145  ALA A C   1 
ATOM   1118 O  O   . ALA A 1 145 ? -21.265 1.710   16.884  1.00   21.98  ? 145  ALA A O   1 
ATOM   1119 C  CB  . ALA A 1 145 ? -21.293 4.706   16.398  1.00   22.09  ? 145  ALA A CB  1 
ATOM   1120 N  N   . ASN A 1 146 ? -19.081 2.165   16.812  1.00   15.85  ? 146  ASN A N   1 
ATOM   1121 C  CA  . ASN A 1 146 ? -18.749 0.836   16.297  1.00   18.50  ? 146  ASN A CA  1 
ATOM   1122 C  C   . ASN A 1 146 ? -18.039 -0.009  17.353  1.00   13.27  ? 146  ASN A C   1 
ATOM   1123 O  O   . ASN A 1 146 ? -17.399 -1.030  17.026  1.00   15.45  ? 146  ASN A O   1 
ATOM   1124 C  CB  . ASN A 1 146 ? -17.882 0.923   15.039  1.00   18.56  ? 146  ASN A CB  1 
ATOM   1125 C  CG  . ASN A 1 146 ? -17.784 -0.416  14.306  1.00   24.73  ? 146  ASN A CG  1 
ATOM   1126 O  OD1 . ASN A 1 146 ? -18.746 -1.185  14.266  1.00   20.95  ? 146  ASN A OD1 1 
ATOM   1127 N  ND2 . ASN A 1 146 ? -16.622 -0.702  13.735  1.00   16.68  ? 146  ASN A ND2 1 
ATOM   1128 N  N   . VAL A 1 147 ? -18.151 0.402   18.614  1.00   12.08  ? 147  VAL A N   1 
ATOM   1129 C  CA  . VAL A 1 147 ? -17.507 -0.348  19.713  1.00   8.08   ? 147  VAL A CA  1 
ATOM   1130 C  C   . VAL A 1 147 ? -18.566 -0.744  20.733  1.00   13.18  ? 147  VAL A C   1 
ATOM   1131 O  O   . VAL A 1 147 ? -19.361 0.102   21.169  1.00   11.42  ? 147  VAL A O   1 
ATOM   1132 C  CB  . VAL A 1 147 ? -16.428 0.473   20.413  1.00   13.76  ? 147  VAL A CB  1 
ATOM   1133 C  CG1 . VAL A 1 147 ? -15.852 -0.318  21.658  1.00   7.75   ? 147  VAL A CG1 1 
ATOM   1134 C  CG2 . VAL A 1 147 ? -15.336 0.844   19.409  1.00   13.31  ? 147  VAL A CG2 1 
ATOM   1135 N  N   . PHE A 1 148 ? -18.566 -2.017  21.121  1.00   14.96  ? 148  PHE A N   1 
ATOM   1136 C  CA  . PHE A 1 148 ? -19.689 -2.599  21.850  1.00   14.74  ? 148  PHE A CA  1 
ATOM   1137 C  C   . PHE A 1 148 ? -19.204 -3.236  23.140  1.00   13.54  ? 148  PHE A C   1 
ATOM   1138 O  O   . PHE A 1 148 ? -18.080 -3.710  23.217  1.00   17.23  ? 148  PHE A O   1 
ATOM   1139 C  CB  . PHE A 1 148 ? -20.457 -3.612  20.946  1.00   11.33  ? 148  PHE A CB  1 
ATOM   1140 C  CG  . PHE A 1 148 ? -20.982 -2.968  19.686  1.00   14.82  ? 148  PHE A CG  1 
ATOM   1141 C  CD1 . PHE A 1 148 ? -20.217 -2.934  18.536  1.00   13.25  ? 148  PHE A CD1 1 
ATOM   1142 C  CD2 . PHE A 1 148 ? -22.188 -2.278  19.698  1.00   13.18  ? 148  PHE A CD2 1 
ATOM   1143 C  CE1 . PHE A 1 148 ? -20.681 -2.281  17.393  1.00   16.31  ? 148  PHE A CE1 1 
ATOM   1144 C  CE2 . PHE A 1 148 ? -22.659 -1.626  18.560  1.00   17.17  ? 148  PHE A CE2 1 
ATOM   1145 C  CZ  . PHE A 1 148 ? -21.906 -1.620  17.412  1.00   17.62  ? 148  PHE A CZ  1 
ATOM   1146 N  N   . LEU A 1 149 ? -20.079 -3.266  24.136  1.00   10.27  ? 149  LEU A N   1 
ATOM   1147 C  CA  . LEU A 1 149 ? -19.726 -3.769  25.462  1.00   10.71  ? 149  LEU A CA  1 
ATOM   1148 C  C   . LEU A 1 149 ? -20.663 -4.913  25.772  1.00   16.78  ? 149  LEU A C   1 
ATOM   1149 O  O   . LEU A 1 149 ? -21.882 -4.765  25.620  1.00   12.92  ? 149  LEU A O   1 
ATOM   1150 C  CB  . LEU A 1 149 ? -19.966 -2.650  26.484  1.00   9.24   ? 149  LEU A CB  1 
ATOM   1151 C  CG  . LEU A 1 149 ? -19.151 -1.384  26.226  1.00   22.38  ? 149  LEU A CG  1 
ATOM   1152 C  CD1 . LEU A 1 149 ? -19.611 -0.240  27.106  1.00   31.99  ? 149  LEU A CD1 1 
ATOM   1153 C  CD2 . LEU A 1 149 ? -17.685 -1.685  26.482  1.00   13.14  ? 149  LEU A CD2 1 
ATOM   1154 N  N   . ASP A 1 150 ? -20.133 -6.057  26.185  1.00   12.80  ? 150  ASP A N   1 
ATOM   1155 C  CA  . ASP A 1 150 ? -21.006 -7.174  26.534  1.00   9.70   ? 150  ASP A CA  1 
ATOM   1156 C  C   . ASP A 1 150 ? -21.305 -7.129  28.035  1.00   14.54  ? 150  ASP A C   1 
ATOM   1157 O  O   . ASP A 1 150 ? -21.100 -6.103  28.669  1.00   15.93  ? 150  ASP A O   1 
ATOM   1158 C  CB  . ASP A 1 150 ? -20.400 -8.514  26.106  1.00   14.16  ? 150  ASP A CB  1 
ATOM   1159 C  CG  . ASP A 1 150 ? -19.223 -8.940  26.975  1.00   19.75  ? 150  ASP A CG  1 
ATOM   1160 O  OD1 . ASP A 1 150 ? -18.862 -8.213  27.927  1.00   17.34  ? 150  ASP A OD1 1 
ATOM   1161 O  OD2 . ASP A 1 150 ? -18.665 -10.028 26.698  1.00   19.52  ? 150  ASP A OD2 1 
ATOM   1162 N  N   . GLY A 1 151 ? -21.793 -8.222  28.605  1.00   12.93  ? 151  GLY A N   1 
ATOM   1163 C  CA  . GLY A 1 151 ? -22.209 -8.197  30.002  1.00   18.36  ? 151  GLY A CA  1 
ATOM   1164 C  C   . GLY A 1 151 ? -21.125 -8.608  30.996  1.00   17.05  ? 151  GLY A C   1 
ATOM   1165 O  O   . GLY A 1 151 ? -21.392 -8.775  32.203  1.00   15.88  ? 151  GLY A O   1 
ATOM   1166 N  N   . LYS A 1 152 ? -19.893 -8.727  30.501  1.00   13.35  ? 152  LYS A N   1 
ATOM   1167 C  CA  . LYS A 1 152 ? -18.788 -9.263  31.291  1.00   13.61  ? 152  LYS A CA  1 
ATOM   1168 C  C   . LYS A 1 152 ? -17.546 -8.397  31.233  1.00   17.96  ? 152  LYS A C   1 
ATOM   1169 O  O   . LYS A 1 152 ? -16.434 -8.890  31.476  1.00   17.39  ? 152  LYS A O   1 
ATOM   1170 C  CB  . LYS A 1 152 ? -18.422 -10.658 30.766  1.00   15.14  ? 152  LYS A CB  1 
ATOM   1171 C  CG  . LYS A 1 152 ? -19.569 -11.649 30.854  0.79   25.17  ? 152  LYS A CG  1 
ATOM   1172 C  CD  . LYS A 1 152 ? -19.185 -13.045 30.370  1.00   32.50  ? 152  LYS A CD  1 
ATOM   1173 C  CE  . LYS A 1 152 ? -19.076 -13.112 28.857  0.90   37.49  ? 152  LYS A CE  1 
ATOM   1174 N  NZ  . LYS A 1 152 ? -19.231 -14.522 28.357  1.00   42.87  ? 152  LYS A NZ  1 
ATOM   1175 N  N   . GLN A 1 153 ? -17.737 -7.128  30.898  1.00   13.66  ? 153  GLN A N   1 
ATOM   1176 C  CA  . GLN A 1 153 ? -16.645 -6.153  30.844  1.00   18.03  ? 153  GLN A CA  1 
ATOM   1177 C  C   . GLN A 1 153 ? -15.757 -6.318  29.619  1.00   19.50  ? 153  GLN A C   1 
ATOM   1178 O  O   . GLN A 1 153 ? -14.585 -5.912  29.618  1.00   26.32  ? 153  GLN A O   1 
ATOM   1179 C  CB  . GLN A 1 153 ? -15.813 -6.179  32.141  1.00   19.50  ? 153  GLN A CB  1 
ATOM   1180 C  CG  . GLN A 1 153 ? -16.606 -5.725  33.354  1.00   23.08  ? 153  GLN A CG  1 
ATOM   1181 C  CD  . GLN A 1 153 ? -15.754 -5.597  34.613  1.00   23.85  ? 153  GLN A CD  1 
ATOM   1182 O  OE1 . GLN A 1 153 ? -14.985 -6.496  34.962  1.00   26.71  ? 153  GLN A OE1 1 
ATOM   1183 N  NE2 . GLN A 1 153 ? -15.902 -4.484  35.301  1.00   20.39  ? 153  GLN A NE2 1 
ATOM   1184 N  N   . ASN A 1 154 ? -16.312 -6.912  28.569  1.00   11.58  ? 154  ASN A N   1 
ATOM   1185 C  CA  . ASN A 1 154 ? -15.550 -7.113  27.362  1.00   8.57   ? 154  ASN A CA  1 
ATOM   1186 C  C   . ASN A 1 154 ? -15.946 -6.064  26.354  1.00   16.84  ? 154  ASN A C   1 
ATOM   1187 O  O   . ASN A 1 154 ? -17.069 -5.560  26.374  1.00   17.27  ? 154  ASN A O   1 
ATOM   1188 C  CB  . ASN A 1 154 ? -15.779 -8.508  26.810  1.00   11.09  ? 154  ASN A CB  1 
ATOM   1189 C  CG  . ASN A 1 154 ? -15.356 -9.595  27.807  1.00   20.68  ? 154  ASN A CG  1 
ATOM   1190 O  OD1 . ASN A 1 154 ? -14.308 -9.476  28.455  1.00   15.74  ? 154  ASN A OD1 1 
ATOM   1191 N  ND2 . ASN A 1 154 ? -16.187 -10.635 27.955  1.00   11.25  ? 154  ASN A ND2 1 
ATOM   1192 N  N   . VAL A 1 155 ? -15.019 -5.758  25.464  1.00   10.47  ? 155  VAL A N   1 
ATOM   1193 C  CA  . VAL A 1 155 ? -15.198 -4.689  24.489  1.00   8.21   ? 155  VAL A CA  1 
ATOM   1194 C  C   . VAL A 1 155 ? -14.980 -5.280  23.103  1.00   10.21  ? 155  VAL A C   1 
ATOM   1195 O  O   . VAL A 1 155 ? -13.981 -5.986  22.878  1.00   17.92  ? 155  VAL A O   1 
ATOM   1196 C  CB  . VAL A 1 155 ? -14.100 -3.638  24.705  1.00   10.38  ? 155  VAL A CB  1 
ATOM   1197 C  CG1 . VAL A 1 155 ? -14.310 -2.485  23.773  1.00   10.00  ? 155  VAL A CG1 1 
ATOM   1198 C  CG2 . VAL A 1 155 ? -14.031 -3.187  26.225  1.00   5.56   ? 155  VAL A CG2 1 
ATOM   1199 N  N   . LYS A 1 156 ? -15.865 -4.973  22.150  1.00   10.83  ? 156  LYS A N   1 
ATOM   1200 C  CA  . LYS A 1 156 ? -15.764 -5.604  20.833  1.00   10.36  ? 156  LYS A CA  1 
ATOM   1201 C  C   . LYS A 1 156 ? -15.982 -4.602  19.721  1.00   18.83  ? 156  LYS A C   1 
ATOM   1202 O  O   . LYS A 1 156 ? -16.808 -3.717  19.847  1.00   17.42  ? 156  LYS A O   1 
ATOM   1203 C  CB  . LYS A 1 156 ? -16.817 -6.700  20.681  1.00   10.10  ? 156  LYS A CB  1 
ATOM   1204 C  CG  . LYS A 1 156 ? -16.572 -7.945  21.520  1.00   19.95  ? 156  LYS A CG  1 
ATOM   1205 C  CD  . LYS A 1 156 ? -17.725 -8.185  22.458  1.00   27.65  ? 156  LYS A CD  1 
ATOM   1206 C  CE  . LYS A 1 156 ? -17.414 -9.325  23.410  1.00   28.93  ? 156  LYS A CE  1 
ATOM   1207 N  NZ  . LYS A 1 156 ? -17.318 -10.617 22.738  1.00   19.54  ? 156  LYS A NZ  1 
ATOM   1208 N  N   . LEU A 1 157 ? -15.235 -4.769  18.639  1.00   13.50  ? 157  LEU A N   1 
ATOM   1209 C  CA  . LEU A 1 157 ? -15.301 -3.900  17.484  1.00   13.34  ? 157  LEU A CA  1 
ATOM   1210 C  C   . LEU A 1 157 ? -16.304 -4.486  16.495  1.00   14.55  ? 157  LEU A C   1 
ATOM   1211 O  O   . LEU A 1 157 ? -16.270 -5.688  16.222  1.00   13.69  ? 157  LEU A O   1 
ATOM   1212 C  CB  . LEU A 1 157 ? -13.907 -3.831  16.853  1.00   16.49  ? 157  LEU A CB  1 
ATOM   1213 C  CG  . LEU A 1 157 ? -13.626 -2.809  15.762  1.00   27.02  ? 157  LEU A CG  1 
ATOM   1214 C  CD1 . LEU A 1 157 ? -13.813 -1.403  16.316  1.00   24.34  ? 157  LEU A CD1 1 
ATOM   1215 C  CD2 . LEU A 1 157 ? -12.218 -2.997  15.222  1.00   20.71  ? 157  LEU A CD2 1 
ATOM   1216 N  N   . GLY A 1 158 ? -17.203 -3.650  15.982  1.00   13.69  ? 158  GLY A N   1 
ATOM   1217 C  CA  . GLY A 1 158 ? -18.234 -4.108  15.054  1.00   17.11  ? 158  GLY A CA  1 
ATOM   1218 C  C   . GLY A 1 158 ? -17.887 -3.933  13.581  1.00   23.31  ? 158  GLY A C   1 
ATOM   1219 O  O   . GLY A 1 158 ? -16.726 -3.710  13.227  1.00   18.90  ? 158  GLY A O   1 
ATOM   1220 N  N   . ASP A 1 159 ? -18.900 -4.025  12.714  1.00   25.34  ? 159  ASP A N   1 
ATOM   1221 C  CA  . ASP A 1 159 ? -18.649 -4.133  11.273  1.00   25.35  ? 159  ASP A CA  1 
ATOM   1222 C  C   . ASP A 1 159 ? -18.861 -2.845  10.477  1.00   33.85  ? 159  ASP A C   1 
ATOM   1223 O  O   . ASP A 1 159 ? -18.794 -2.883  9.247   1.00   36.81  ? 159  ASP A O   1 
ATOM   1224 C  CB  . ASP A 1 159 ? -19.510 -5.243  10.661  1.00   25.45  ? 159  ASP A CB  1 
ATOM   1225 C  CG  . ASP A 1 159 ? -21.005 -4.909  10.688  1.00   40.06  ? 159  ASP A CG  1 
ATOM   1226 O  OD1 . ASP A 1 159 ? -21.365 -3.710  10.767  1.00   32.96  ? 159  ASP A OD1 1 
ATOM   1227 O  OD2 . ASP A 1 159 ? -21.827 -5.847  10.632  1.00   48.87  ? 159  ASP A OD2 1 
ATOM   1228 N  N   . PHE A 1 160 ? -19.133 -1.724  11.149  1.00   28.10  ? 160  PHE A N   1 
ATOM   1229 C  CA  . PHE A 1 160 ? -19.235 -0.427  10.451  1.00   31.70  ? 160  PHE A CA  1 
ATOM   1230 C  C   . PHE A 1 160 ? -17.980 -0.173  9.623   1.00   39.04  ? 160  PHE A C   1 
ATOM   1231 O  O   . PHE A 1 160 ? -16.872 -0.410  10.091  1.00   34.39  ? 160  PHE A O   1 
ATOM   1232 C  CB  . PHE A 1 160 ? -19.472 0.740   11.426  1.00   22.99  ? 160  PHE A CB  1 
ATOM   1233 C  CG  . PHE A 1 160 ? -20.886 0.820   11.933  1.00   42.08  ? 160  PHE A CG  1 
ATOM   1234 C  CD1 . PHE A 1 160 ? -21.153 1.074   13.269  1.00   39.87  ? 160  PHE A CD1 1 
ATOM   1235 C  CD2 . PHE A 1 160 ? -21.958 0.621   11.068  1.00   47.85  ? 160  PHE A CD2 1 
ATOM   1236 C  CE1 . PHE A 1 160 ? -22.459 1.144   13.733  1.00   37.77  ? 160  PHE A CE1 1 
ATOM   1237 C  CE2 . PHE A 1 160 ? -23.268 0.692   11.528  1.00   43.81  ? 160  PHE A CE2 1 
ATOM   1238 C  CZ  . PHE A 1 160 ? -23.518 0.957   12.859  1.00   38.50  ? 160  PHE A CZ  1 
ATOM   1239 N  N   . GLY A 1 161 ? -18.155 0.270   8.380   1.00   39.66  ? 161  GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 161 ? -17.033 0.475   7.479   1.00   47.46  ? 161  GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 161 ? -16.562 -0.775  6.745   1.00   58.04  ? 161  GLY A C   1 
ATOM   1242 O  O   . GLY A 1 161 ? -15.913 -0.682  5.700   1.00   63.07  ? 161  GLY A O   1 
ATOM   1243 N  N   . LEU A 1 162 ? -16.887 -1.944  7.291   1.00   56.43  ? 162  LEU A N   1 
ATOM   1244 C  CA  . LEU A 1 162 ? -16.404 -3.211  6.747   1.00   64.48  ? 162  LEU A CA  1 
ATOM   1245 C  C   . LEU A 1 162 ? -17.454 -3.880  5.866   1.00   70.35  ? 162  LEU A C   1 
ATOM   1246 O  O   . LEU A 1 162 ? -18.654 -3.760  6.115   1.00   76.38  ? 162  LEU A O   1 
ATOM   1247 C  CB  . LEU A 1 162 ? -15.981 -4.147  7.887   1.00   67.29  ? 162  LEU A CB  1 
ATOM   1248 C  CG  . LEU A 1 162 ? -15.217 -5.434  7.557   1.00   70.28  ? 162  LEU A CG  1 
ATOM   1249 C  CD1 . LEU A 1 162 ? -16.163 -6.606  7.361   1.00   73.11  ? 162  LEU A CD1 1 
ATOM   1250 C  CD2 . LEU A 1 162 ? -14.341 -5.236  6.327   1.00   74.22  ? 162  LEU A CD2 1 
ATOM   1251 N  N   . PHE A 1 176 ? -21.036 11.884  4.712   1.00   68.72  ? 176  PHE A N   1 
ATOM   1252 C  CA  . PHE A 1 176 ? -20.816 13.138  3.996   1.00   60.99  ? 176  PHE A CA  1 
ATOM   1253 C  C   . PHE A 1 176 ? -21.158 14.343  4.857   1.00   57.65  ? 176  PHE A C   1 
ATOM   1254 O  O   . PHE A 1 176 ? -20.355 15.267  4.987   1.00   60.96  ? 176  PHE A O   1 
ATOM   1255 C  CB  . PHE A 1 176 ? -21.635 13.190  2.704   1.00   60.80  ? 176  PHE A CB  1 
ATOM   1256 C  CG  . PHE A 1 176 ? -21.715 14.568  2.094   1.00   57.47  ? 176  PHE A CG  1 
ATOM   1257 C  CD1 . PHE A 1 176 ? -20.683 15.056  1.313   1.00   58.90  ? 176  PHE A CD1 1 
ATOM   1258 C  CD2 . PHE A 1 176 ? -22.817 15.377  2.315   1.00   59.70  ? 176  PHE A CD2 1 
ATOM   1259 C  CE1 . PHE A 1 176 ? -20.752 16.324  0.759   1.00   60.90  ? 176  PHE A CE1 1 
ATOM   1260 C  CE2 . PHE A 1 176 ? -22.891 16.647  1.761   1.00   61.84  ? 176  PHE A CE2 1 
ATOM   1261 C  CZ  . PHE A 1 176 ? -21.859 17.119  0.983   1.00   62.04  ? 176  PHE A CZ  1 
ATOM   1262 N  N   . VAL A 1 177 ? -22.359 14.339  5.428   1.00   54.48  ? 177  VAL A N   1 
ATOM   1263 C  CA  . VAL A 1 177 ? -22.791 15.433  6.292   1.00   57.21  ? 177  VAL A CA  1 
ATOM   1264 C  C   . VAL A 1 177 ? -21.878 15.577  7.514   1.00   58.74  ? 177  VAL A C   1 
ATOM   1265 O  O   . VAL A 1 177 ? -21.597 16.688  7.965   1.00   57.81  ? 177  VAL A O   1 
ATOM   1266 C  CB  . VAL A 1 177 ? -24.252 15.241  6.751   1.00   63.08  ? 177  VAL A CB  1 
ATOM   1267 C  CG1 . VAL A 1 177 ? -24.654 16.324  7.744   1.00   67.33  ? 177  VAL A CG1 1 
ATOM   1268 C  CG2 . VAL A 1 177 ? -25.183 15.246  5.553   1.00   68.00  ? 177  VAL A CG2 1 
ATOM   1269 N  N   . GLY A 1 178 ? -21.401 14.450  8.034   1.00   56.80  ? 178  GLY A N   1 
ATOM   1270 C  CA  . GLY A 1 178 ? -20.632 14.445  9.266   1.00   56.60  ? 178  GLY A CA  1 
ATOM   1271 C  C   . GLY A 1 178 ? -19.243 15.053  9.170   1.00   56.56  ? 178  GLY A C   1 
ATOM   1272 O  O   . GLY A 1 178 ? -18.602 15.034  8.120   1.00   55.59  ? 178  GLY A O   1 
ATOM   1273 N  N   . THR A 1 179 ? -18.778 15.605  10.282  1.00   57.57  ? 179  THR A N   1 
ATOM   1274 C  CA  . THR A 1 179 ? -17.405 16.076  10.376  1.00   57.03  ? 179  THR A CA  1 
ATOM   1275 C  C   . THR A 1 179 ? -16.515 14.859  10.634  1.00   43.81  ? 179  THR A C   1 
ATOM   1276 O  O   . THR A 1 179 ? -16.832 14.041  11.491  1.00   42.39  ? 179  THR A O   1 
ATOM   1277 C  CB  . THR A 1 179 ? -17.257 17.079  11.531  1.00   61.13  ? 179  THR A CB  1 
ATOM   1278 O  OG1 . THR A 1 179 ? -18.328 18.031  11.478  1.00   63.79  ? 179  THR A OG1 1 
ATOM   1279 C  CG2 . THR A 1 179 ? -15.934 17.807  11.443  1.00   59.44  ? 179  THR A CG2 1 
ATOM   1280 N  N   . PRO A 1 180 ? -15.405 14.722  9.885   1.00   43.01  ? 180  PRO A N   1 
ATOM   1281 C  CA  . PRO A 1 180 ? -14.528 13.554  10.077  1.00   40.38  ? 180  PRO A CA  1 
ATOM   1282 C  C   . PRO A 1 180 ? -13.544 13.771  11.233  1.00   27.52  ? 180  PRO A C   1 
ATOM   1283 O  O   . PRO A 1 180 ? -12.339 13.844  11.004  1.00   33.05  ? 180  PRO A O   1 
ATOM   1284 C  CB  . PRO A 1 180 ? -13.750 13.470  8.753   1.00   41.70  ? 180  PRO A CB  1 
ATOM   1285 C  CG  . PRO A 1 180 ? -14.219 14.655  7.914   1.00   43.30  ? 180  PRO A CG  1 
ATOM   1286 C  CD  . PRO A 1 180 ? -14.889 15.617  8.842   1.00   42.19  ? 180  PRO A CD  1 
ATOM   1287 N  N   . TYR A 1 181 ? -14.068 13.877  12.450  1.00   31.01  ? 181  TYR A N   1 
ATOM   1288 C  CA  . TYR A 1 181 ? -13.265 14.165  13.644  1.00   32.18  ? 181  TYR A CA  1 
ATOM   1289 C  C   . TYR A 1 181 ? -11.980 13.345  13.788  1.00   30.22  ? 181  TYR A C   1 
ATOM   1290 O  O   . TYR A 1 181 ? -10.980 13.849  14.304  1.00   27.18  ? 181  TYR A O   1 
ATOM   1291 C  CB  . TYR A 1 181 ? -14.111 13.948  14.895  1.00   28.22  ? 181  TYR A CB  1 
ATOM   1292 C  CG  . TYR A 1 181 ? -15.198 14.968  15.080  1.00   34.43  ? 181  TYR A CG  1 
ATOM   1293 C  CD1 . TYR A 1 181 ? -16.539 14.633  14.882  1.00   35.71  ? 181  TYR A CD1 1 
ATOM   1294 C  CD2 . TYR A 1 181 ? -14.888 16.273  15.432  1.00   32.05  ? 181  TYR A CD2 1 
ATOM   1295 C  CE1 . TYR A 1 181 ? -17.547 15.578  15.061  1.00   39.30  ? 181  TYR A CE1 1 
ATOM   1296 C  CE2 . TYR A 1 181 ? -15.881 17.224  15.605  1.00   38.40  ? 181  TYR A CE2 1 
ATOM   1297 C  CZ  . TYR A 1 181 ? -17.206 16.875  15.421  1.00   45.19  ? 181  TYR A CZ  1 
ATOM   1298 O  OH  . TYR A 1 181 ? -18.183 17.834  15.598  1.00   48.10  ? 181  TYR A OH  1 
ATOM   1299 N  N   . TYR A 1 182 ? -12.025 12.077  13.368  1.00   26.21  ? 182  TYR A N   1 
ATOM   1300 C  CA  . TYR A 1 182 ? -10.910 11.153  13.595  1.00   33.49  ? 182  TYR A CA  1 
ATOM   1301 C  C   . TYR A 1 182 ? -9.930  10.973  12.435  1.00   38.11  ? 182  TYR A C   1 
ATOM   1302 O  O   . TYR A 1 182 ? -9.081  10.090  12.503  1.00   38.83  ? 182  TYR A O   1 
ATOM   1303 C  CB  . TYR A 1 182 ? -11.418 9.760   13.967  1.00   26.64  ? 182  TYR A CB  1 
ATOM   1304 C  CG  . TYR A 1 182 ? -12.095 9.637   15.305  1.00   25.74  ? 182  TYR A CG  1 
ATOM   1305 C  CD1 . TYR A 1 182 ? -12.556 10.758  15.992  1.00   25.15  ? 182  TYR A CD1 1 
ATOM   1306 C  CD2 . TYR A 1 182 ? -12.303 8.385   15.871  1.00   17.19  ? 182  TYR A CD2 1 
ATOM   1307 C  CE1 . TYR A 1 182 ? -13.200 10.626  17.207  1.00   29.15  ? 182  TYR A CE1 1 
ATOM   1308 C  CE2 . TYR A 1 182 ? -12.934 8.251   17.069  1.00   19.37  ? 182  TYR A CE2 1 
ATOM   1309 C  CZ  . TYR A 1 182 ? -13.388 9.361   17.731  1.00   24.53  ? 182  TYR A CZ  1 
ATOM   1310 O  OH  . TYR A 1 182 ? -14.004 9.198   18.947  1.00   24.04  ? 182  TYR A OH  1 
ATOM   1311 N  N   . MET A 1 183 ? -10.046 11.757  11.367  1.00   38.90  ? 183  MET A N   1 
ATOM   1312 C  CA  . MET A 1 183 ? -9.109  11.584  10.257  1.00   37.73  ? 183  MET A CA  1 
ATOM   1313 C  C   . MET A 1 183 ? -7.700  11.985  10.679  1.00   29.51  ? 183  MET A C   1 
ATOM   1314 O  O   . MET A 1 183 ? -7.514  13.021  11.313  0.66   18.64  ? 183  MET A O   1 
ATOM   1315 C  CB  . MET A 1 183 ? -9.541  12.372  9.011   0.92   35.27  ? 183  MET A CB  1 
ATOM   1316 C  CG  . MET A 1 183 ? -9.340  13.880  9.079   0.66   32.78  ? 183  MET A CG  1 
ATOM   1317 S  SD  . MET A 1 183 ? -9.494  14.680  7.449   0.73   49.62  ? 183  MET A SD  1 
ATOM   1318 C  CE  . MET A 1 183 ? -9.350  16.418  7.910   1.00   37.60  ? 183  MET A CE  1 
ATOM   1319 N  N   . SER A 1 184 ? -6.714  11.160  10.326  1.00   25.74  ? 184  SER A N   1 
ATOM   1320 C  CA  . SER A 1 184 ? -5.326  11.418  10.666  1.00   28.80  ? 184  SER A CA  1 
ATOM   1321 C  C   . SER A 1 184 ? -4.708  12.432  9.721   1.00   26.33  ? 184  SER A C   1 
ATOM   1322 O  O   . SER A 1 184 ? -5.209  12.651  8.622   1.00   30.69  ? 184  SER A O   1 
ATOM   1323 C  CB  . SER A 1 184 ? -4.521  10.121  10.606  1.00   33.97  ? 184  SER A CB  1 
ATOM   1324 O  OG  . SER A 1 184 ? -4.527  9.601   9.289   1.00   36.30  ? 184  SER A OG  1 
ATOM   1325 N  N   . PRO A 1 185 ? -3.602  13.046  10.146  1.00   28.03  ? 185  PRO A N   1 
ATOM   1326 C  CA  . PRO A 1 185 ? -2.906  14.044  9.326   1.00   30.53  ? 185  PRO A CA  1 
ATOM   1327 C  C   . PRO A 1 185 ? -2.546  13.497  7.945   1.00   36.22  ? 185  PRO A C   1 
ATOM   1328 O  O   . PRO A 1 185 ? -2.757  14.184  6.948   1.00   34.74  ? 185  PRO A O   1 
ATOM   1329 C  CB  . PRO A 1 185 ? -1.621  14.328  10.119  1.00   34.97  ? 185  PRO A CB  1 
ATOM   1330 C  CG  . PRO A 1 185 ? -1.914  13.912  11.527  1.00   27.80  ? 185  PRO A CG  1 
ATOM   1331 C  CD  . PRO A 1 185 ? -2.957  12.833  11.462  1.00   25.10  ? 185  PRO A CD  1 
ATOM   1332 N  N   . GLU A 1 186 ? -2.010  12.281  7.883   1.00   41.91  ? 186  GLU A N   1 
ATOM   1333 C  CA  . GLU A 1 186 ? -1.550  11.739  6.609   1.00   45.44  ? 186  GLU A CA  1 
ATOM   1334 C  C   . GLU A 1 186 ? -2.714  11.340  5.718   1.00   46.25  ? 186  GLU A C   1 
ATOM   1335 O  O   . GLU A 1 186 ? -2.557  11.202  4.514   1.00   45.96  ? 186  GLU A O   1 
ATOM   1336 C  CB  . GLU A 1 186 ? -0.573  10.569  6.791   1.00   42.59  ? 186  GLU A CB  1 
ATOM   1337 C  CG  . GLU A 1 186 ? -1.146  9.361   7.518   1.00   38.56  ? 186  GLU A CG  1 
ATOM   1338 C  CD  . GLU A 1 186 ? -0.978  9.468   9.035   1.00   35.01  ? 186  GLU A CD  1 
ATOM   1339 O  OE1 . GLU A 1 186 ? -0.602  10.549  9.536   1.00   31.66  ? 186  GLU A OE1 1 
ATOM   1340 O  OE2 . GLU A 1 186 ? -1.222  8.464   9.719   1.00   35.09  ? 186  GLU A OE2 1 
ATOM   1341 N  N   . GLN A 1 187 ? -3.887  11.171  6.311   1.00   45.69  ? 187  GLN A N   1 
ATOM   1342 C  CA  . GLN A 1 187 ? -5.086  10.904  5.528   1.00   54.07  ? 187  GLN A CA  1 
ATOM   1343 C  C   . GLN A 1 187 ? -5.675  12.200  4.987   1.00   50.00  ? 187  GLN A C   1 
ATOM   1344 O  O   . GLN A 1 187 ? -6.296  12.208  3.928   1.00   48.82  ? 187  GLN A O   1 
ATOM   1345 C  CB  . GLN A 1 187 ? -6.119  10.132  6.344   1.00   64.20  ? 187  GLN A CB  1 
ATOM   1346 C  CG  . GLN A 1 187 ? -5.803  8.655   6.472   1.00   76.86  ? 187  GLN A CG  1 
ATOM   1347 C  CD  . GLN A 1 187 ? -6.789  7.922   7.363   1.00   86.97  ? 187  GLN A CD  1 
ATOM   1348 O  OE1 . GLN A 1 187 ? -7.056  8.343   8.492   1.00   88.61  ? 187  GLN A OE1 1 
ATOM   1349 N  NE2 . GLN A 1 187 ? -7.329  6.813   6.862   1.00   89.84  ? 187  GLN A NE2 1 
ATOM   1350 N  N   . MET A 1 188 ? -5.461  13.297  5.705   1.00   47.61  ? 188  MET A N   1 
ATOM   1351 C  CA  . MET A 1 188 ? -5.866  14.609  5.210   1.00   54.00  ? 188  MET A CA  1 
ATOM   1352 C  C   . MET A 1 188 ? -5.374  14.850  3.780   1.00   60.52  ? 188  MET A C   1 
ATOM   1353 O  O   . MET A 1 188 ? -5.896  15.717  3.082   0.46   60.78  ? 188  MET A O   1 
ATOM   1354 C  CB  . MET A 1 188 ? -5.326  15.723  6.101   1.00   52.28  ? 188  MET A CB  1 
ATOM   1355 C  CG  . MET A 1 188 ? -6.024  15.911  7.419   0.0000 51.88  ? 188  MET A CG  1 
ATOM   1356 S  SD  . MET A 1 188 ? -5.517  17.493  8.109   0.97   87.37  ? 188  MET A SD  1 
ATOM   1357 C  CE  . MET A 1 188 ? -3.735  17.312  8.112   1.00   66.81  ? 188  MET A CE  1 
ATOM   1358 N  N   . ASN A 1 189 ? -4.371  14.088  3.348   1.00   65.35  ? 189  ASN A N   1 
ATOM   1359 C  CA  . ASN A 1 189 ? -3.759  14.308  2.039   1.00   69.20  ? 189  ASN A CA  1 
ATOM   1360 C  C   . ASN A 1 189 ? -3.342  13.050  1.268   1.00   74.66  ? 189  ASN A C   1 
ATOM   1361 O  O   . ASN A 1 189 ? -3.306  13.052  0.038   1.00   79.65  ? 189  ASN A O   1 
ATOM   1362 C  CB  . ASN A 1 189 ? -2.567  15.267  2.162   1.00   74.06  ? 189  ASN A CB  1 
ATOM   1363 C  CG  . ASN A 1 189 ? -2.223  15.598  3.610   1.00   76.71  ? 189  ASN A CG  1 
ATOM   1364 O  OD1 . ASN A 1 189 ? -2.279  16.756  4.030   1.00   76.38  ? 189  ASN A OD1 1 
ATOM   1365 N  ND2 . ASN A 1 189 ? -1.861  14.581  4.375   1.00   80.02  ? 189  ASN A ND2 1 
ATOM   1366 N  N   . ARG A 1 190 ? -3.025  11.982  1.987   1.00   79.19  ? 190  ARG A N   1 
ATOM   1367 C  CA  . ARG A 1 190 ? -2.529  10.761  1.360   1.00   81.10  ? 190  ARG A CA  1 
ATOM   1368 C  C   . ARG A 1 190 ? -2.911  9.529   2.173   1.00   81.57  ? 190  ARG A C   1 
ATOM   1369 O  O   . ARG A 1 190 ? -3.734  8.720   1.748   1.00   82.11  ? 190  ARG A O   1 
ATOM   1370 C  CB  . ARG A 1 190 ? -1.011  10.815  1.237   1.00   83.39  ? 190  ARG A CB  1 
ATOM   1371 C  CG  . ARG A 1 190 ? -0.290  10.420  2.512   1.00   86.04  ? 190  ARG A CG  1 
ATOM   1372 C  CD  . ARG A 1 190 ? 0.400   11.609  3.164   1.00   90.90  ? 190  ARG A CD  1 
ATOM   1373 N  NE  . ARG A 1 190 ? 1.842   11.581  2.940   1.00   98.40  ? 190  ARG A NE  1 
ATOM   1374 C  CZ  . ARG A 1 190 ? 2.718   10.983  3.748   1.00   102.74 ? 190  ARG A CZ  1 
ATOM   1375 N  NH1 . ARG A 1 190 ? 2.306   10.361  4.846   1.00   100.20 ? 190  ARG A NH1 1 
ATOM   1376 N  NH2 . ARG A 1 190 ? 4.012   11.009  3.457   1.00   106.56 ? 190  ARG A NH2 1 
ATOM   1377 N  N   . ASN A 1 194 ? -1.933  2.726   5.855   1.00   54.10  ? 194  ASN A N   1 
ATOM   1378 C  CA  . ASN A 1 194 ? -0.970  2.979   6.917   1.00   42.22  ? 194  ASN A CA  1 
ATOM   1379 C  C   . ASN A 1 194 ? -1.540  2.560   8.264   1.00   32.32  ? 194  ASN A C   1 
ATOM   1380 O  O   . ASN A 1 194 ? -2.473  3.172   8.765   1.00   35.35  ? 194  ASN A O   1 
ATOM   1381 C  CB  . ASN A 1 194 ? -0.605  4.458   6.933   1.00   45.47  ? 194  ASN A CB  1 
ATOM   1382 C  CG  . ASN A 1 194 ? 0.592   4.762   7.818   1.00   39.82  ? 194  ASN A CG  1 
ATOM   1383 O  OD1 . ASN A 1 194 ? 1.003   3.951   8.650   1.00   44.79  ? 194  ASN A OD1 1 
ATOM   1384 N  ND2 . ASN A 1 194 ? 1.161   5.936   7.632   1.00   38.63  ? 194  ASN A ND2 1 
ATOM   1385 N  N   . GLU A 1 195 ? -0.983  1.500   8.840   1.00   30.88  ? 195  GLU A N   1 
ATOM   1386 C  CA  . GLU A 1 195 ? -1.451  0.987   10.122  1.00   31.96  ? 195  GLU A CA  1 
ATOM   1387 C  C   . GLU A 1 195 ? -1.268  2.021   11.241  1.00   19.43  ? 195  GLU A C   1 
ATOM   1388 O  O   . GLU A 1 195 ? -1.996  2.015   12.222  1.00   19.94  ? 195  GLU A O   1 
ATOM   1389 C  CB  . GLU A 1 195 ? -0.722  -0.312  10.462  1.00   31.72  ? 195  GLU A CB  1 
ATOM   1390 C  CG  . GLU A 1 195 ? -1.040  -1.437  9.470   1.00   39.02  ? 195  GLU A CG  1 
ATOM   1391 C  CD  . GLU A 1 195 ? -0.186  -2.680  9.672   1.00   51.88  ? 195  GLU A CD  1 
ATOM   1392 O  OE1 . GLU A 1 195 ? 0.720   -2.658  10.534  1.00   55.01  ? 195  GLU A OE1 1 
ATOM   1393 O  OE2 . GLU A 1 195 ? -0.433  -3.683  8.968   1.00   57.47  ? 195  GLU A OE2 1 
ATOM   1394 N  N   . LYS A 1 196 ? -0.311  2.918   11.081  1.00   19.57  ? 196  LYS A N   1 
ATOM   1395 C  CA  . LYS A 1 196 ? -0.134  3.972   12.084  1.00   21.22  ? 196  LYS A CA  1 
ATOM   1396 C  C   . LYS A 1 196 ? -1.315  4.932   12.063  1.00   22.68  ? 196  LYS A C   1 
ATOM   1397 O  O   . LYS A 1 196 ? -1.617  5.567   13.063  1.00   19.13  ? 196  LYS A O   1 
ATOM   1398 C  CB  . LYS A 1 196 ? 1.215   4.689   11.917  1.00   25.75  ? 196  LYS A CB  1 
ATOM   1399 C  CG  . LYS A 1 196 ? 2.450   3.816   12.341  1.00   21.63  ? 196  LYS A CG  1 
ATOM   1400 C  CD  . LYS A 1 196 ? 2.334   3.397   13.802  1.00   21.36  ? 196  LYS A CD  1 
ATOM   1401 C  CE  . LYS A 1 196 ? 3.585   2.692   14.310  1.00   21.32  ? 196  LYS A CE  1 
ATOM   1402 N  NZ  . LYS A 1 196 ? 4.692   3.661   14.488  1.00   25.84  ? 196  LYS A NZ  1 
ATOM   1403 N  N   . SER A 1 197 ? -2.025  5.011   10.940  1.00   21.39  ? 197  SER A N   1 
ATOM   1404 C  CA  . SER A 1 197 ? -3.206  5.872   10.892  1.00   21.97  ? 197  SER A CA  1 
ATOM   1405 C  C   . SER A 1 197 ? -4.294  5.311   11.777  1.00   20.74  ? 197  SER A C   1 
ATOM   1406 O  O   . SER A 1 197 ? -5.068  6.059   12.351  1.00   17.94  ? 197  SER A O   1 
ATOM   1407 C  CB  . SER A 1 197 ? -3.740  6.046   9.455   1.00   28.26  ? 197  SER A CB  1 
ATOM   1408 O  OG  . SER A 1 197 ? -2.735  6.598   8.609   1.00   36.48  ? 197  SER A OG  1 
ATOM   1409 N  N   . ASP A 1 198 ? -4.359  3.987   11.900  1.00   16.09  ? 198  ASP A N   1 
ATOM   1410 C  CA  . ASP A 1 198 ? -5.338  3.394   12.792  1.00   13.96  ? 198  ASP A CA  1 
ATOM   1411 C  C   . ASP A 1 198 ? -5.001  3.755   14.242  1.00   14.75  ? 198  ASP A C   1 
ATOM   1412 O  O   . ASP A 1 198 ? -5.892  3.869   15.081  1.00   14.63  ? 198  ASP A O   1 
ATOM   1413 C  CB  . ASP A 1 198 ? -5.347  1.868   12.626  1.00   13.69  ? 198  ASP A CB  1 
ATOM   1414 C  CG  . ASP A 1 198 ? -5.837  1.433   11.241  1.00   31.25  ? 198  ASP A CG  1 
ATOM   1415 O  OD1 . ASP A 1 198 ? -6.557  2.222   10.595  1.00   28.91  ? 198  ASP A OD1 1 
ATOM   1416 O  OD2 . ASP A 1 198 ? -5.523  0.302   10.813  1.00   34.38  ? 198  ASP A OD2 1 
ATOM   1417 N  N   . ILE A 1 199 ? -3.711  3.918   14.533  1.00   13.25  ? 199  ILE A N   1 
ATOM   1418 C  CA  . ILE A 1 199 ? -3.301  4.271   15.895  1.00   10.54  ? 199  ILE A CA  1 
ATOM   1419 C  C   . ILE A 1 199 ? -3.773  5.689   16.235  1.00   15.45  ? 199  ILE A C   1 
ATOM   1420 O  O   . ILE A 1 199 ? -4.243  5.967   17.347  1.00   12.84  ? 199  ILE A O   1 
ATOM   1421 C  CB  . ILE A 1 199 ? -1.763  4.138   16.070  1.00   12.58  ? 199  ILE A CB  1 
ATOM   1422 C  CG1 . ILE A 1 199 ? -1.323  2.692   15.814  1.00   14.91  ? 199  ILE A CG1 1 
ATOM   1423 C  CG2 . ILE A 1 199 ? -1.354  4.508   17.479  1.00   9.40   ? 199  ILE A CG2 1 
ATOM   1424 C  CD1 . ILE A 1 199 ? -1.877  1.706   16.829  1.00   18.40  ? 199  ILE A CD1 1 
ATOM   1425 N  N   . TRP A 1 200 ? -3.680  6.586   15.264  1.00   11.26  ? 200  TRP A N   1 
ATOM   1426 C  CA  . TRP A 1 200 ? -4.206  7.939   15.474  1.00   11.35  ? 200  TRP A CA  1 
ATOM   1427 C  C   . TRP A 1 200 ? -5.706  7.880   15.789  1.00   11.97  ? 200  TRP A C   1 
ATOM   1428 O  O   . TRP A 1 200 ? -6.175  8.507   16.742  1.00   13.38  ? 200  TRP A O   1 
ATOM   1429 C  CB  . TRP A 1 200 ? -3.958  8.789   14.230  1.00   19.14  ? 200  TRP A CB  1 
ATOM   1430 C  CG  . TRP A 1 200 ? -4.664  10.108  14.257  1.00   20.96  ? 200  TRP A CG  1 
ATOM   1431 C  CD1 . TRP A 1 200 ? -5.972  10.325  14.008  1.00   17.74  ? 200  TRP A CD1 1 
ATOM   1432 C  CD2 . TRP A 1 200 ? -4.078  11.396  14.522  1.00   18.53  ? 200  TRP A CD2 1 
ATOM   1433 N  NE1 . TRP A 1 200 ? -6.261  11.677  14.107  1.00   25.46  ? 200  TRP A NE1 1 
ATOM   1434 C  CE2 . TRP A 1 200 ? -5.109  12.353  14.424  1.00   19.90  ? 200  TRP A CE2 1 
ATOM   1435 C  CE3 . TRP A 1 200 ? -2.783  11.828  14.835  1.00   21.87  ? 200  TRP A CE3 1 
ATOM   1436 C  CZ2 . TRP A 1 200 ? -4.889  13.723  14.622  1.00   14.93  ? 200  TRP A CZ2 1 
ATOM   1437 C  CZ3 . TRP A 1 200 ? -2.559  13.194  15.028  1.00   21.80  ? 200  TRP A CZ3 1 
ATOM   1438 C  CH2 . TRP A 1 200 ? -3.612  14.124  14.918  1.00   18.97  ? 200  TRP A CH2 1 
ATOM   1439 N  N   . SER A 1 201 ? -6.463  7.107   15.007  1.00   13.92  ? 201  SER A N   1 
ATOM   1440 C  CA  . SER A 1 201 ? -7.918  7.035   15.234  1.00   11.01  ? 201  SER A CA  1 
ATOM   1441 C  C   . SER A 1 201 ? -8.223  6.460   16.595  1.00   14.40  ? 201  SER A C   1 
ATOM   1442 O  O   . SER A 1 201 ? -9.118  6.935   17.280  1.00   12.88  ? 201  SER A O   1 
ATOM   1443 C  CB  . SER A 1 201 ? -8.624  6.202   14.154  1.00   17.76  ? 201  SER A CB  1 
ATOM   1444 O  OG  . SER A 1 201 ? -8.231  6.660   12.876  1.00   26.93  ? 201  SER A OG  1 
ATOM   1445 N  N   . LEU A 1 202 ? -7.491  5.428   17.002  1.00   12.71  ? 202  LEU A N   1 
ATOM   1446 C  CA  . LEU A 1 202 ? -7.714  4.867   18.337  1.00   11.82  ? 202  LEU A CA  1 
ATOM   1447 C  C   . LEU A 1 202 ? -7.395  5.915   19.401  1.00   9.72   ? 202  LEU A C   1 
ATOM   1448 O  O   . LEU A 1 202 ? -8.039  5.984   20.449  1.00   11.41  ? 202  LEU A O   1 
ATOM   1449 C  CB  . LEU A 1 202 ? -6.811  3.636   18.565  1.00   16.89  ? 202  LEU A CB  1 
ATOM   1450 C  CG  . LEU A 1 202 ? -6.793  3.101   20.008  1.00   17.16  ? 202  LEU A CG  1 
ATOM   1451 C  CD1 . LEU A 1 202 ? -8.190  2.592   20.451  1.00   14.46  ? 202  LEU A CD1 1 
ATOM   1452 C  CD2 . LEU A 1 202 ? -5.745  1.971   20.112  1.00   22.71  ? 202  LEU A CD2 1 
ATOM   1453 N  N   . GLY A 1 203 ? -6.360  6.704   19.154  1.00   11.61  ? 203  GLY A N   1 
ATOM   1454 C  CA  . GLY A 1 203 ? -6.012  7.766   20.082  1.00   9.28   ? 203  GLY A CA  1 
ATOM   1455 C  C   . GLY A 1 203 ? -7.177  8.735   20.197  1.00   14.01  ? 203  GLY A C   1 
ATOM   1456 O  O   . GLY A 1 203 ? -7.507  9.183   21.299  1.00   9.52   ? 203  GLY A O   1 
ATOM   1457 N  N   . CYS A 1 204 ? -7.832  9.046   19.074  1.00   8.41   ? 204  CYS A N   1 
ATOM   1458 C  CA  . CYS A 1 204 ? -8.913  10.029  19.123  1.00   12.81  ? 204  CYS A CA  1 
ATOM   1459 C  C   . CYS A 1 204 ? -10.061 9.465   19.952  1.00   11.78  ? 204  CYS A C   1 
ATOM   1460 O  O   . CYS A 1 204 ? -10.742 10.184  20.694  1.00   10.46  ? 204  CYS A O   1 
ATOM   1461 C  CB  . CYS A 1 204 ? -9.451  10.359  17.707  1.00   13.18  ? 204  CYS A CB  1 
ATOM   1462 S  SG  . CYS A 1 204 ? -8.336  11.413  16.697  1.00   15.66  ? 204  CYS A SG  1 
ATOM   1463 N  N   . LEU A 1 205 ? -10.279 8.165   19.788  1.00   10.99  ? 205  LEU A N   1 
ATOM   1464 C  CA  . LEU A 1 205 ? -11.404 7.490   20.420  1.00   11.37  ? 205  LEU A CA  1 
ATOM   1465 C  C   . LEU A 1 205 ? -11.182 7.468   21.915  1.00   10.52  ? 205  LEU A C   1 
ATOM   1466 O  O   . LEU A 1 205 ? -12.100 7.759   22.691  1.00   9.05   ? 205  LEU A O   1 
ATOM   1467 C  CB  . LEU A 1 205 ? -11.515 6.043   19.880  1.00   12.40  ? 205  LEU A CB  1 
ATOM   1468 C  CG  . LEU A 1 205 ? -12.670 5.199   20.406  1.00   16.32  ? 205  LEU A CG  1 
ATOM   1469 C  CD1 . LEU A 1 205 ? -13.012 4.054   19.429  1.00   19.09  ? 205  LEU A CD1 1 
ATOM   1470 C  CD2 . LEU A 1 205 ? -12.305 4.650   21.770  1.00   19.66  ? 205  LEU A CD2 1 
ATOM   1471 N  N   . LEU A 1 206 ? -9.971  7.086   22.335  1.00   5.47   ? 206  LEU A N   1 
ATOM   1472 C  CA  . LEU A 1 206 ? -9.667  7.015   23.763  1.00   11.03  ? 206  LEU A CA  1 
ATOM   1473 C  C   . LEU A 1 206 ? -9.680  8.411   24.384  1.00   10.93  ? 206  LEU A C   1 
ATOM   1474 O  O   . LEU A 1 206 ? -10.097 8.590   25.521  1.00   10.63  ? 206  LEU A O   1 
ATOM   1475 C  CB  . LEU A 1 206 ? -8.284  6.374   23.985  1.00   11.24  ? 206  LEU A CB  1 
ATOM   1476 C  CG  . LEU A 1 206 ? -8.173  4.887   23.617  1.00   14.75  ? 206  LEU A CG  1 
ATOM   1477 C  CD1 . LEU A 1 206 ? -6.720  4.402   23.775  1.00   10.92  ? 206  LEU A CD1 1 
ATOM   1478 C  CD2 . LEU A 1 206 ? -9.131  4.049   24.496  1.00   7.61   ? 206  LEU A CD2 1 
ATOM   1479 N  N   . TYR A 1 207 ? -9.172  9.388   23.644  1.00   11.28  ? 207  TYR A N   1 
ATOM   1480 C  CA  . TYR A 1 207 ? -9.214  10.790  24.104  1.00   11.54  ? 207  TYR A CA  1 
ATOM   1481 C  C   . TYR A 1 207 ? -10.678 11.206  24.360  1.00   15.97  ? 207  TYR A C   1 
ATOM   1482 O  O   . TYR A 1 207 ? -11.005 11.816  25.395  1.00   16.06  ? 207  TYR A O   1 
ATOM   1483 C  CB  . TYR A 1 207 ? -8.574  11.728  23.048  1.00   7.24   ? 207  TYR A CB  1 
ATOM   1484 C  CG  . TYR A 1 207 ? -8.504  13.198  23.514  1.00   8.06   ? 207  TYR A CG  1 
ATOM   1485 C  CD1 . TYR A 1 207 ? -9.653  13.992  23.550  1.00   12.47  ? 207  TYR A CD1 1 
ATOM   1486 C  CD2 . TYR A 1 207 ? -7.301  13.753  23.944  1.00   8.76   ? 207  TYR A CD2 1 
ATOM   1487 C  CE1 . TYR A 1 207 ? -9.598  15.317  23.987  1.00   15.03  ? 207  TYR A CE1 1 
ATOM   1488 C  CE2 . TYR A 1 207 ? -7.227  15.060  24.392  1.00   8.38   ? 207  TYR A CE2 1 
ATOM   1489 C  CZ  . TYR A 1 207 ? -8.380  15.841  24.408  1.00   14.49  ? 207  TYR A CZ  1 
ATOM   1490 O  OH  . TYR A 1 207 ? -8.324  17.146  24.851  1.00   15.76  ? 207  TYR A OH  1 
ATOM   1491 N  N   . GLU A 1 208 ? -11.565 10.890  23.413  1.00   13.16  ? 208  GLU A N   1 
ATOM   1492 C  CA  . GLU A 1 208 ? -12.974 11.314  23.551  1.00   11.42  ? 208  GLU A CA  1 
ATOM   1493 C  C   . GLU A 1 208 ? -13.647 10.588  24.721  1.00   11.27  ? 208  GLU A C   1 
ATOM   1494 O  O   . GLU A 1 208 ? -14.484 11.155  25.443  1.00   12.26  ? 208  GLU A O   1 
ATOM   1495 C  CB  . GLU A 1 208 ? -13.760 11.102  22.236  1.00   10.89  ? 208  GLU A CB  1 
ATOM   1496 C  CG  . GLU A 1 208 ? -15.156 11.749  22.261  1.00   19.94  ? 208  GLU A CG  1 
ATOM   1497 C  CD  . GLU A 1 208 ? -15.978 11.527  20.989  1.00   20.41  ? 208  GLU A CD  1 
ATOM   1498 O  OE1 . GLU A 1 208 ? -15.406 11.199  19.929  1.00   24.90  ? 208  GLU A OE1 1 
ATOM   1499 O  OE2 . GLU A 1 208 ? -17.211 11.697  21.052  1.00   28.10  ? 208  GLU A OE2 1 
ATOM   1500 N  N   . LEU A 1 209 ? -13.260 9.333   24.942  1.00   11.79  ? 209  LEU A N   1 
ATOM   1501 C  CA  . LEU A 1 209 ? -13.787 8.569   26.064  1.00   15.71  ? 209  LEU A CA  1 
ATOM   1502 C  C   . LEU A 1 209 ? -13.414 9.263   27.361  1.00   15.72  ? 209  LEU A C   1 
ATOM   1503 O  O   . LEU A 1 209 ? -14.213 9.302   28.292  1.00   13.78  ? 209  LEU A O   1 
ATOM   1504 C  CB  . LEU A 1 209 ? -13.187 7.155   26.108  1.00   13.43  ? 209  LEU A CB  1 
ATOM   1505 C  CG  . LEU A 1 209 ? -14.004 5.873   26.162  1.00   32.29  ? 209  LEU A CG  1 
ATOM   1506 C  CD1 . LEU A 1 209 ? -13.139 4.700   26.711  1.00   11.92  ? 209  LEU A CD1 1 
ATOM   1507 C  CD2 . LEU A 1 209 ? -15.225 6.054   27.001  1.00   27.80  ? 209  LEU A CD2 1 
ATOM   1508 N  N   . CYS A 1 210 ? -12.189 9.781   27.432  1.00   8.41   ? 210  CYS A N   1 
ATOM   1509 C  CA  . CYS A 1 210 ? -11.729 10.450  28.667  1.00   8.59   ? 210  CYS A CA  1 
ATOM   1510 C  C   . CYS A 1 210 ? -12.309 11.845  28.844  1.00   13.75  ? 210  CYS A C   1 
ATOM   1511 O  O   . CYS A 1 210 ? -12.769 12.196  29.941  1.00   13.27  ? 210  CYS A O   1 
ATOM   1512 C  CB  . CYS A 1 210 ? -10.204 10.620  28.665  1.00   12.94  ? 210  CYS A CB  1 
ATOM   1513 S  SG  . CYS A 1 210 ? -9.311  9.056   28.836  1.00   12.57  ? 210  CYS A SG  1 
ATOM   1514 N  N   . ALA A 1 211 ? -12.197 12.652  27.782  1.00   14.37  ? 211  ALA A N   1 
ATOM   1515 C  CA  . ALA A 1 211 ? -12.586 14.076  27.818  1.00   17.45  ? 211  ALA A CA  1 
ATOM   1516 C  C   . ALA A 1 211 ? -14.074 14.293  27.523  1.00   18.72  ? 211  ALA A C   1 
ATOM   1517 O  O   . ALA A 1 211 ? -14.627 15.342  27.826  1.00   14.54  ? 211  ALA A O   1 
ATOM   1518 C  CB  . ALA A 1 211 ? -11.742 14.875  26.845  1.00   14.01  ? 211  ALA A CB  1 
ATOM   1519 N  N   . LEU A 1 212 ? -14.722 13.295  26.939  1.00   13.26  ? 212  LEU A N   1 
ATOM   1520 C  CA  . LEU A 1 212 ? -16.127 13.403  26.545  1.00   15.82  ? 212  LEU A CA  1 
ATOM   1521 C  C   . LEU A 1 212 ? -16.294 14.330  25.366  1.00   27.62  ? 212  LEU A C   1 
ATOM   1522 O  O   . LEU A 1 212 ? -17.405 14.732  25.049  1.00   27.81  ? 212  LEU A O   1 
ATOM   1523 C  CB  . LEU A 1 212 ? -17.033 13.796  27.721  1.00   15.76  ? 212  LEU A CB  1 
ATOM   1524 C  CG  . LEU A 1 212 ? -17.052 12.811  28.897  1.00   18.15  ? 212  LEU A CG  1 
ATOM   1525 C  CD1 . LEU A 1 212 ? -18.019 13.243  30.016  1.00   19.05  ? 212  LEU A CD1 1 
ATOM   1526 C  CD2 . LEU A 1 212 ? -17.349 11.381  28.442  1.00   16.53  ? 212  LEU A CD2 1 
ATOM   1527 N  N   . MET A 1 213 ? -15.186 14.628  24.689  1.00   16.97  ? 213  MET A N   1 
ATOM   1528 C  CA  . MET A 1 213 ? -15.226 15.432  23.473  1.00   18.59  ? 213  MET A CA  1 
ATOM   1529 C  C   . MET A 1 213 ? -13.993 15.066  22.670  1.00   18.05  ? 213  MET A C   1 
ATOM   1530 O  O   . MET A 1 213 ? -13.005 14.671  23.257  1.00   16.26  ? 213  MET A O   1 
ATOM   1531 C  CB  . MET A 1 213 ? -15.202 16.936  23.814  1.00   20.45  ? 213  MET A CB  1 
ATOM   1532 C  CG  . MET A 1 213 ? -14.025 17.341  24.668  1.00   27.09  ? 213  MET A CG  1 
ATOM   1533 S  SD  . MET A 1 213 ? -14.017 19.120  25.064  1.00   50.38  ? 213  MET A SD  1 
ATOM   1534 C  CE  . MET A 1 213 ? -15.616 19.261  25.863  1.00   93.34  ? 213  MET A CE  1 
ATOM   1535 N  N   . PRO A 1 214 ? -14.051 15.180  21.330  1.00   20.63  ? 214  PRO A N   1 
ATOM   1536 C  CA  . PRO A 1 214 ? -12.905 14.752  20.516  1.00   17.83  ? 214  PRO A CA  1 
ATOM   1537 C  C   . PRO A 1 214 ? -11.770 15.726  20.707  1.00   13.54  ? 214  PRO A C   1 
ATOM   1538 O  O   . PRO A 1 214 ? -12.026 16.840  21.161  1.00   13.84  ? 214  PRO A O   1 
ATOM   1539 C  CB  . PRO A 1 214 ? -13.405 14.886  19.060  1.00   23.19  ? 214  PRO A CB  1 
ATOM   1540 C  CG  . PRO A 1 214 ? -14.831 15.310  19.127  1.00   25.92  ? 214  PRO A CG  1 
ATOM   1541 C  CD  . PRO A 1 214 ? -15.158 15.740  20.523  1.00   23.41  ? 214  PRO A CD  1 
ATOM   1542 N  N   . PRO A 1 215 ? -10.546 15.342  20.327  1.00   12.79  ? 215  PRO A N   1 
ATOM   1543 C  CA  . PRO A 1 215 ? -9.415  16.233  20.625  1.00   10.21  ? 215  PRO A CA  1 
ATOM   1544 C  C   . PRO A 1 215 ? -9.385  17.455  19.722  1.00   20.89  ? 215  PRO A C   1 
ATOM   1545 O  O   . PRO A 1 215 ? -8.853  18.487  20.136  1.00   12.56  ? 215  PRO A O   1 
ATOM   1546 C  CB  . PRO A 1 215 ? -8.172  15.351  20.355  1.00   9.75   ? 215  PRO A CB  1 
ATOM   1547 C  CG  . PRO A 1 215 ? -8.654  14.220  19.447  1.00   13.90  ? 215  PRO A CG  1 
ATOM   1548 C  CD  . PRO A 1 215 ? -10.127 14.028  19.786  1.00   12.33  ? 215  PRO A CD  1 
ATOM   1549 N  N   . PHE A 1 216 ? -9.930  17.333  18.507  1.00   15.92  ? 216  PHE A N   1 
ATOM   1550 C  CA  . PHE A 1 216 ? -10.000 18.453  17.571  1.00   19.38  ? 216  PHE A CA  1 
ATOM   1551 C  C   . PHE A 1 216 ? -11.453 18.666  17.140  1.00   23.10  ? 216  PHE A C   1 
ATOM   1552 O  O   . PHE A 1 216 ? -12.112 17.736  16.681  1.00   19.76  ? 216  PHE A O   1 
ATOM   1553 C  CB  . PHE A 1 216 ? -9.197  18.157  16.319  1.00   18.06  ? 216  PHE A CB  1 
ATOM   1554 C  CG  . PHE A 1 216 ? -7.794  17.687  16.585  1.00   23.26  ? 216  PHE A CG  1 
ATOM   1555 C  CD1 . PHE A 1 216 ? -6.786  18.598  16.798  1.00   17.25  ? 216  PHE A CD1 1 
ATOM   1556 C  CD2 . PHE A 1 216 ? -7.490  16.339  16.601  1.00   18.00  ? 216  PHE A CD2 1 
ATOM   1557 C  CE1 . PHE A 1 216 ? -5.481  18.175  17.026  1.00   16.94  ? 216  PHE A CE1 1 
ATOM   1558 C  CE2 . PHE A 1 216 ? -6.197  15.901  16.842  1.00   17.85  ? 216  PHE A CE2 1 
ATOM   1559 C  CZ  . PHE A 1 216 ? -5.191  16.819  17.046  1.00   16.48  ? 216  PHE A CZ  1 
ATOM   1560 N  N   . THR A 1 217 ? -11.949 19.884  17.281  1.00   24.28  ? 217  THR A N   1 
ATOM   1561 C  CA  . THR A 1 217 ? -13.350 20.150  16.970  1.00   28.77  ? 217  THR A CA  1 
ATOM   1562 C  C   . THR A 1 217 ? -13.382 21.373  16.086  1.00   27.24  ? 217  THR A C   1 
ATOM   1563 O  O   . THR A 1 217 ? -12.451 22.170  16.097  1.00   23.34  ? 217  THR A O   1 
ATOM   1564 C  CB  . THR A 1 217 ? -14.183 20.394  18.243  1.00   34.34  ? 217  THR A CB  1 
ATOM   1565 O  OG1 . THR A 1 217 ? -13.677 21.549  18.929  1.00   36.46  ? 217  THR A OG1 1 
ATOM   1566 C  CG2 . THR A 1 217 ? -14.083 19.195  19.172  1.00   41.56  ? 217  THR A CG2 1 
ATOM   1567 N  N   . ALA A 1 218 ? -14.434 21.510  15.294  1.00   24.40  ? 218  ALA A N   1 
ATOM   1568 C  CA  . ALA A 1 218 ? -14.540 22.639  14.403  1.00   26.88  ? 218  ALA A CA  1 
ATOM   1569 C  C   . ALA A 1 218 ? -15.890 22.561  13.735  1.00   33.50  ? 218  ALA A C   1 
ATOM   1570 O  O   . ALA A 1 218 ? -16.579 21.535  13.805  1.00   28.47  ? 218  ALA A O   1 
ATOM   1571 C  CB  . ALA A 1 218 ? -13.428 22.624  13.352  1.00   32.06  ? 218  ALA A CB  1 
ATOM   1572 N  N   . PHE A 1 219 ? -16.262 23.643  13.075  1.00   32.86  ? 219  PHE A N   1 
ATOM   1573 C  CA  . PHE A 1 219 ? -17.569 23.693  12.445  1.00   42.26  ? 219  PHE A CA  1 
ATOM   1574 C  C   . PHE A 1 219 ? -17.555 23.184  10.999  1.00   48.32  ? 219  PHE A C   1 
ATOM   1575 O  O   . PHE A 1 219 ? -18.582 22.733  10.487  1.00   56.60  ? 219  PHE A O   1 
ATOM   1576 C  CB  . PHE A 1 219 ? -18.146 25.102  12.560  1.00   44.71  ? 219  PHE A CB  1 
ATOM   1577 C  CG  . PHE A 1 219 ? -18.485 25.496  13.973  1.00   51.22  ? 219  PHE A CG  1 
ATOM   1578 C  CD1 . PHE A 1 219 ? -17.897 26.599  14.565  1.00   55.89  ? 219  PHE A CD1 1 
ATOM   1579 C  CD2 . PHE A 1 219 ? -19.379 24.744  14.714  1.00   57.17  ? 219  PHE A CD2 1 
ATOM   1580 C  CE1 . PHE A 1 219 ? -18.211 26.958  15.865  1.00   57.14  ? 219  PHE A CE1 1 
ATOM   1581 C  CE2 . PHE A 1 219 ? -19.693 25.094  16.016  1.00   60.62  ? 219  PHE A CE2 1 
ATOM   1582 C  CZ  . PHE A 1 219 ? -19.109 26.203  16.591  1.00   57.97  ? 219  PHE A CZ  1 
ATOM   1583 N  N   . SER A 1 220 ? -16.393 23.233  10.353  1.00   37.76  ? 220  SER A N   1 
ATOM   1584 C  CA  . SER A 1 220 ? -16.272 22.743  8.980   1.00   36.73  ? 220  SER A CA  1 
ATOM   1585 C  C   . SER A 1 220 ? -15.078 21.819  8.860   1.00   37.33  ? 220  SER A C   1 
ATOM   1586 O  O   . SER A 1 220 ? -14.222 21.799  9.739   1.00   33.01  ? 220  SER A O   1 
ATOM   1587 C  CB  . SER A 1 220 ? -16.100 23.914  8.030   1.00   32.02  ? 220  SER A CB  1 
ATOM   1588 O  OG  . SER A 1 220 ? -14.886 24.594  8.308   1.00   41.89  ? 220  SER A OG  1 
ATOM   1589 N  N   . GLN A 1 221 ? -14.996 21.068  7.769   1.00   32.74  ? 221  GLN A N   1 
ATOM   1590 C  CA  . GLN A 1 221 ? -13.866 20.167  7.594   1.00   36.50  ? 221  GLN A CA  1 
ATOM   1591 C  C   . GLN A 1 221 ? -12.564 20.929  7.379   1.00   32.07  ? 221  GLN A C   1 
ATOM   1592 O  O   . GLN A 1 221 ? -11.487 20.475  7.773   1.00   31.58  ? 221  GLN A O   1 
ATOM   1593 C  CB  . GLN A 1 221 ? -14.098 19.183  6.443   1.00   38.25  ? 221  GLN A CB  1 
ATOM   1594 C  CG  . GLN A 1 221 ? -12.940 18.199  6.267   1.00   39.51  ? 221  GLN A CG  1 
ATOM   1595 C  CD  . GLN A 1 221 ? -13.204 17.135  5.214   1.00   44.38  ? 221  GLN A CD  1 
ATOM   1596 O  OE1 . GLN A 1 221 ? -14.352 16.819  4.900   0.0000 45.07  ? 221  GLN A OE1 1 
ATOM   1597 N  NE2 . GLN A 1 221 ? -12.126 16.576  4.660   1.00   39.64  ? 221  GLN A NE2 1 
ATOM   1598 N  N   . LYS A 1 222 ? -12.666 22.092  6.751   1.00   34.26  ? 222  LYS A N   1 
ATOM   1599 C  CA  . LYS A 1 222 ? -11.499 22.912  6.478   1.00   34.30  ? 222  LYS A CA  1 
ATOM   1600 C  C   . LYS A 1 222 ? -10.895 23.445  7.777   1.00   33.79  ? 222  LYS A C   1 
ATOM   1601 O  O   . LYS A 1 222 ? -9.681  23.404  7.955   1.00   33.67  ? 222  LYS A O   1 
ATOM   1602 C  CB  . LYS A 1 222 ? -11.881 24.070  5.543   1.00   42.37  ? 222  LYS A CB  1 
ATOM   1603 C  CG  . LYS A 1 222 ? -10.821 25.139  5.377   1.00   53.49  ? 222  LYS A CG  1 
ATOM   1604 C  CD  . LYS A 1 222 ? -11.462 26.471  4.998   1.00   67.44  ? 222  LYS A CD  1 
ATOM   1605 C  CE  . LYS A 1 222 ? -10.428 27.487  4.549   1.00   72.15  ? 222  LYS A CE  1 
ATOM   1606 N  NZ  . LYS A 1 222 ? -9.897  27.160  3.198   1.00   75.85  ? 222  LYS A NZ  1 
ATOM   1607 N  N   . GLU A 1 223 ? -11.746 23.951  8.669   1.00   32.67  ? 223  GLU A N   1 
ATOM   1608 C  CA  . GLU A 1 223 ? -11.314 24.419  9.984   1.00   38.98  ? 223  GLU A CA  1 
ATOM   1609 C  C   . GLU A 1 223 ? -10.713 23.246  10.766  1.00   28.94  ? 223  GLU A C   1 
ATOM   1610 O  O   . GLU A 1 223 ? -9.656  23.361  11.410  1.00   27.32  ? 223  GLU A O   1 
ATOM   1611 C  CB  . GLU A 1 223 ? -12.502 25.013  10.751  1.00   46.75  ? 223  GLU A CB  1 
ATOM   1612 C  CG  . GLU A 1 223 ? -12.144 25.573  12.124  1.00   56.66  ? 223  GLU A CG  1 
ATOM   1613 C  CD  . GLU A 1 223 ? -13.364 25.985  12.947  1.00   63.43  ? 223  GLU A CD  1 
ATOM   1614 O  OE1 . GLU A 1 223 ? -14.505 25.646  12.553  1.00   62.12  ? 223  GLU A OE1 1 
ATOM   1615 O  OE2 . GLU A 1 223 ? -13.173 26.637  14.000  1.00   63.59  ? 223  GLU A OE2 1 
ATOM   1616 N  N   . LEU A 1 224 ? -11.388 22.109  10.692  1.00   26.41  ? 224  LEU A N   1 
ATOM   1617 C  CA  . LEU A 1 224 ? -10.891 20.893  11.317  1.00   24.09  ? 224  LEU A CA  1 
ATOM   1618 C  C   . LEU A 1 224 ? -9.488  20.544  10.851  1.00   24.18  ? 224  LEU A C   1 
ATOM   1619 O  O   . LEU A 1 224 ? -8.615  20.202  11.660  1.00   25.19  ? 224  LEU A O   1 
ATOM   1620 C  CB  . LEU A 1 224 ? -11.829 19.725  11.013  1.00   23.98  ? 224  LEU A CB  1 
ATOM   1621 C  CG  . LEU A 1 224 ? -11.419 18.410  11.677  1.00   29.40  ? 224  LEU A CG  1 
ATOM   1622 C  CD1 . LEU A 1 224 ? -11.482 18.561  13.206  1.00   25.44  ? 224  LEU A CD1 1 
ATOM   1623 C  CD2 . LEU A 1 224 ? -12.312 17.273  11.203  1.00   30.97  ? 224  LEU A CD2 1 
ATOM   1624 N  N   . ALA A 1 225 ? -9.276  20.586  9.540   1.00   23.83  ? 225  ALA A N   1 
ATOM   1625 C  CA  . ALA A 1 225 ? -8.001  20.159  8.970   1.00   25.47  ? 225  ALA A CA  1 
ATOM   1626 C  C   . ALA A 1 225 ? -6.933  21.108  9.463   1.00   28.03  ? 225  ALA A C   1 
ATOM   1627 O  O   . ALA A 1 225 ? -5.803  20.701  9.708   1.00   23.41  ? 225  ALA A O   1 
ATOM   1628 C  CB  . ALA A 1 225 ? -8.052  20.146  7.434   1.00   31.00  ? 225  ALA A CB  1 
ATOM   1629 N  N   . GLY A 1 226 ? -7.306  22.375  9.618   1.00   25.09  ? 226  GLY A N   1 
ATOM   1630 C  CA  . GLY A 1 226 ? -6.411  23.355  10.214  1.00   29.27  ? 226  GLY A CA  1 
ATOM   1631 C  C   . GLY A 1 226 ? -5.975  22.978  11.621  1.00   27.86  ? 226  GLY A C   1 
ATOM   1632 O  O   . GLY A 1 226 ? -4.785  22.985  11.918  1.00   23.70  ? 226  GLY A O   1 
ATOM   1633 N  N   . LYS A 1 227 ? -6.930  22.653  12.489  1.00   22.35  ? 227  LYS A N   1 
ATOM   1634 C  CA  . LYS A 1 227 ? -6.595  22.249  13.871  1.00   23.29  ? 227  LYS A CA  1 
ATOM   1635 C  C   . LYS A 1 227 ? -5.767  20.966  13.932  1.00   24.65  ? 227  LYS A C   1 
ATOM   1636 O  O   . LYS A 1 227 ? -4.849  20.845  14.745  1.00   21.01  ? 227  LYS A O   1 
ATOM   1637 C  CB  . LYS A 1 227 ? -7.866  22.092  14.712  1.00   27.05  ? 227  LYS A CB  1 
ATOM   1638 C  CG  . LYS A 1 227 ? -8.621  23.398  14.914  1.00   33.30  ? 227  LYS A CG  1 
ATOM   1639 C  CD  . LYS A 1 227 ? -9.603  23.286  16.056  1.00   42.90  ? 227  LYS A CD  1 
ATOM   1640 C  CE  . LYS A 1 227 ? -10.436 24.558  16.173  1.00   57.55  ? 227  LYS A CE  1 
ATOM   1641 N  NZ  . LYS A 1 227 ? -11.374 24.497  17.325  1.00   62.28  ? 227  LYS A NZ  1 
ATOM   1642 N  N   . ILE A 1 228 ? -6.091  20.006  13.071  1.00   17.44  ? 228  ILE A N   1 
ATOM   1643 C  CA  . ILE A 1 228 ? -5.412  18.711  13.078  1.00   20.21  ? 228  ILE A CA  1 
ATOM   1644 C  C   . ILE A 1 228 ? -3.961  18.892  12.708  1.00   29.00  ? 228  ILE A C   1 
ATOM   1645 O  O   . ILE A 1 228 ? -3.081  18.363  13.381  1.00   33.05  ? 228  ILE A O   1 
ATOM   1646 C  CB  . ILE A 1 228 ? -6.063  17.666  12.130  1.00   27.39  ? 228  ILE A CB  1 
ATOM   1647 C  CG1 . ILE A 1 228 ? -7.336  17.096  12.755  1.00   19.81  ? 228  ILE A CG1 1 
ATOM   1648 C  CG2 . ILE A 1 228 ? -5.095  16.514  11.882  1.00   28.91  ? 228  ILE A CG2 1 
ATOM   1649 C  CD1 . ILE A 1 228 ? -8.342  16.525  11.736  1.00   22.09  ? 228  ILE A CD1 1 
ATOM   1650 N  N   . ARG A 1 229 ? -3.711  19.658  11.647  1.00   25.46  ? 229  ARG A N   1 
ATOM   1651 C  CA  . ARG A 1 229 ? -2.338  20.005  11.242  1.00   30.90  ? 229  ARG A CA  1 
ATOM   1652 C  C   . ARG A 1 229 ? -1.474  20.627  12.342  1.00   30.60  ? 229  ARG A C   1 
ATOM   1653 O  O   . ARG A 1 229 ? -0.293  20.324  12.428  1.00   35.72  ? 229  ARG A O   1 
ATOM   1654 C  CB  . ARG A 1 229 ? -2.331  20.967  10.044  1.00   30.52  ? 229  ARG A CB  1 
ATOM   1655 C  CG  . ARG A 1 229 ? -2.965  20.386  8.779   1.00   44.33  ? 229  ARG A CG  1 
ATOM   1656 C  CD  . ARG A 1 229 ? -2.501  21.153  7.550   1.00   56.46  ? 229  ARG A CD  1 
ATOM   1657 N  NE  . ARG A 1 229 ? -3.610  21.526  6.684   1.00   66.63  ? 229  ARG A NE  1 
ATOM   1658 C  CZ  . ARG A 1 229 ? -4.147  20.719  5.777   1.00   70.22  ? 229  ARG A CZ  1 
ATOM   1659 N  NH1 . ARG A 1 229 ? -3.681  19.484  5.619   1.00   69.78  ? 229  ARG A NH1 1 
ATOM   1660 N  NH2 . ARG A 1 229 ? -5.151  21.148  5.032   1.00   73.33  ? 229  ARG A NH2 1 
ATOM   1661 N  N   . GLU A 1 230 ? -2.042  21.541  13.127  1.00   24.03  ? 230  GLU A N   1 
ATOM   1662 C  CA  . GLU A 1 230 ? -1.307  22.158  14.229  1.00   20.55  ? 230  GLU A CA  1 
ATOM   1663 C  C   . GLU A 1 230 ? -0.998  21.121  15.325  1.00   24.59  ? 230  GLU A C   1 
ATOM   1664 O  O   . GLU A 1 230 ? 0.026   21.212  15.974  1.00   28.54  ? 230  GLU A O   1 
ATOM   1665 C  CB  . GLU A 1 230 ? -2.095  23.323  14.835  1.00   29.61  ? 230  GLU A CB  1 
ATOM   1666 C  CG  . GLU A 1 230 ? -2.179  24.560  13.941  1.00   51.24  ? 230  GLU A CG  1 
ATOM   1667 C  CD  . GLU A 1 230 ? -0.828  25.249  13.770  1.00   63.84  ? 230  GLU A CD  1 
ATOM   1668 O  OE1 . GLU A 1 230 ? -0.588  25.850  12.702  1.00   68.43  ? 230  GLU A OE1 1 
ATOM   1669 O  OE2 . GLU A 1 230 ? -0.003  25.185  14.707  1.00   68.75  ? 230  GLU A OE2 1 
ATOM   1670 N  N   . GLY A 1 231 ? -1.902  20.171  15.537  1.00   22.96  ? 231  GLY A N   1 
ATOM   1671 C  CA  . GLY A 1 231 ? -1.652  19.018  16.401  1.00   17.30  ? 231  GLY A CA  1 
ATOM   1672 C  C   . GLY A 1 231 ? -1.715  19.319  17.887  1.00   18.97  ? 231  GLY A C   1 
ATOM   1673 O  O   . GLY A 1 231 ? -1.158  18.571  18.695  1.00   20.08  ? 231  GLY A O   1 
ATOM   1674 N  N   . LYS A 1 232 ? -2.379  20.422  18.248  1.00   15.95  ? 232  LYS A N   1 
ATOM   1675 C  CA  . LYS A 1 232 ? -2.542  20.826  19.647  1.00   12.74  ? 232  LYS A CA  1 
ATOM   1676 C  C   . LYS A 1 232 ? -3.930  20.450  20.160  1.00   19.84  ? 232  LYS A C   1 
ATOM   1677 O  O   . LYS A 1 232 ? -4.908  20.486  19.403  1.00   14.36  ? 232  LYS A O   1 
ATOM   1678 C  CB  . LYS A 1 232 ? -2.363  22.346  19.793  1.00   17.55  ? 232  LYS A CB  1 
ATOM   1679 C  CG  . LYS A 1 232 ? -0.977  22.905  19.432  1.00   20.62  ? 232  LYS A CG  1 
ATOM   1680 C  CD  . LYS A 1 232 ? -1.090  24.450  19.313  1.00   21.83  ? 232  LYS A CD  1 
ATOM   1681 C  CE  . LYS A 1 232 ? 0.256   25.144  19.294  1.00   30.50  ? 232  LYS A CE  1 
ATOM   1682 N  NZ  . LYS A 1 232 ? 0.039   26.648  19.331  1.00   29.30  ? 232  LYS A NZ  1 
ATOM   1683 N  N   . PHE A 1 233 ? -4.020  20.089  21.442  1.00   12.64  ? 233  PHE A N   1 
ATOM   1684 C  CA  . PHE A 1 233 ? -5.307  19.745  22.057  1.00   12.39  ? 233  PHE A CA  1 
ATOM   1685 C  C   . PHE A 1 233 ? -5.154  19.872  23.568  1.00   15.05  ? 233  PHE A C   1 
ATOM   1686 O  O   . PHE A 1 233 ? -4.035  19.918  24.061  1.00   13.17  ? 233  PHE A O   1 
ATOM   1687 C  CB  . PHE A 1 233 ? -5.696  18.282  21.700  1.00   11.72  ? 233  PHE A CB  1 
ATOM   1688 C  CG  . PHE A 1 233 ? -4.543  17.317  21.740  1.00   14.10  ? 233  PHE A CG  1 
ATOM   1689 C  CD1 . PHE A 1 233 ? -4.163  16.696  22.941  1.00   13.44  ? 233  PHE A CD1 1 
ATOM   1690 C  CD2 . PHE A 1 233 ? -3.849  16.997  20.585  1.00   16.55  ? 233  PHE A CD2 1 
ATOM   1691 C  CE1 . PHE A 1 233 ? -3.089  15.772  22.976  1.00   12.39  ? 233  PHE A CE1 1 
ATOM   1692 C  CE2 . PHE A 1 233 ? -2.780  16.093  20.609  1.00   15.04  ? 233  PHE A CE2 1 
ATOM   1693 C  CZ  . PHE A 1 233 ? -2.385  15.498  21.822  1.00   9.88   ? 233  PHE A CZ  1 
ATOM   1694 N  N   . ARG A 1 234 ? -6.262  19.926  24.300  1.00   11.35  ? 234  ARG A N   1 
ATOM   1695 C  CA  . ARG A 1 234 ? -6.207  20.017  25.759  1.00   9.34   ? 234  ARG A CA  1 
ATOM   1696 C  C   . ARG A 1 234 ? -5.680  18.707  26.370  1.00   12.81  ? 234  ARG A C   1 
ATOM   1697 O  O   . ARG A 1 234 ? -5.814  17.633  25.769  1.00   9.84   ? 234  ARG A O   1 
ATOM   1698 C  CB  . ARG A 1 234 ? -7.596  20.335  26.305  1.00   10.66  ? 234  ARG A CB  1 
ATOM   1699 C  CG  . ARG A 1 234 ? -8.167  21.698  25.793  1.00   14.13  ? 234  ARG A CG  1 
ATOM   1700 C  CD  . ARG A 1 234 ? -9.399  22.076  26.590  1.00   20.21  ? 234  ARG A CD  1 
ATOM   1701 N  NE  . ARG A 1 234 ? -9.066  22.208  28.011  1.00   18.65  ? 234  ARG A NE  1 
ATOM   1702 C  CZ  . ARG A 1 234 ? -8.451  23.268  28.527  1.00   25.44  ? 234  ARG A CZ  1 
ATOM   1703 N  NH1 . ARG A 1 234 ? -8.106  24.262  27.733  1.00   18.09  ? 234  ARG A NH1 1 
ATOM   1704 N  NH2 . ARG A 1 234 ? -8.170  23.328  29.827  1.00   20.08  ? 234  ARG A NH2 1 
ATOM   1705 N  N   . ARG A 1 235 ? -5.070  18.775  27.550  1.00   10.20  ? 235  ARG A N   1 
ATOM   1706 C  CA  . ARG A 1 235 ? -4.756  17.529  28.254  1.00   7.93   ? 235  ARG A CA  1 
ATOM   1707 C  C   . ARG A 1 235 ? -6.094  16.855  28.570  1.00   8.22   ? 235  ARG A C   1 
ATOM   1708 O  O   . ARG A 1 235 ? -7.078  17.555  28.803  1.00   10.31  ? 235  ARG A O   1 
ATOM   1709 C  CB  . ARG A 1 235 ? -4.108  17.846  29.606  1.00   8.69   ? 235  ARG A CB  1 
ATOM   1710 C  CG  . ARG A 1 235 ? -3.518  16.570  30.276  1.00   10.66  ? 235  ARG A CG  1 
ATOM   1711 C  CD  . ARG A 1 235 ? -3.248  16.819  31.782  1.00   12.63  ? 235  ARG A CD  1 
ATOM   1712 N  NE  . ARG A 1 235 ? -2.566  15.680  32.435  1.00   11.18  ? 235  ARG A NE  1 
ATOM   1713 C  CZ  . ARG A 1 235 ? -3.196  14.621  32.933  1.00   17.54  ? 235  ARG A CZ  1 
ATOM   1714 N  NH1 . ARG A 1 235 ? -4.511  14.536  32.823  1.00   9.47   ? 235  ARG A NH1 1 
ATOM   1715 N  NH2 . ARG A 1 235 ? -2.513  13.641  33.528  1.00   14.89  ? 235  ARG A NH2 1 
ATOM   1716 N  N   . ILE A 1 236 ? -6.135  15.522  28.647  1.00   11.89  ? 236  ILE A N   1 
ATOM   1717 C  CA  . ILE A 1 236 ? -7.338  14.850  29.154  1.00   10.32  ? 236  ILE A CA  1 
ATOM   1718 C  C   . ILE A 1 236 ? -7.499  15.280  30.614  1.00   13.91  ? 236  ILE A C   1 
ATOM   1719 O  O   . ILE A 1 236 ? -6.547  15.799  31.213  1.00   11.92  ? 236  ILE A O   1 
ATOM   1720 C  CB  . ILE A 1 236 ? -7.247  13.298  29.008  1.00   11.31  ? 236  ILE A CB  1 
ATOM   1721 C  CG1 . ILE A 1 236 ? -6.086  12.718  29.822  1.00   7.02   ? 236  ILE A CG1 1 
ATOM   1722 C  CG2 . ILE A 1 236 ? -7.106  12.927  27.530  1.00   6.84   ? 236  ILE A CG2 1 
ATOM   1723 C  CD1 . ILE A 1 236 ? -6.015  11.145  29.744  1.00   11.97  ? 236  ILE A CD1 1 
ATOM   1724 N  N   . PRO A 1 237 ? -8.705  15.129  31.178  1.00   10.09  ? 237  PRO A N   1 
ATOM   1725 C  CA  . PRO A 1 237 ? -8.971  15.649  32.532  1.00   7.88   ? 237  PRO A CA  1 
ATOM   1726 C  C   . PRO A 1 237 ? -7.989  15.157  33.603  1.00   20.17  ? 237  PRO A C   1 
ATOM   1727 O  O   . PRO A 1 237 ? -7.454  14.043  33.468  1.00   16.04  ? 237  PRO A O   1 
ATOM   1728 C  CB  . PRO A 1 237 ? -10.383 15.123  32.834  1.00   12.35  ? 237  PRO A CB  1 
ATOM   1729 C  CG  . PRO A 1 237 ? -11.063 15.072  31.421  1.00   7.52   ? 237  PRO A CG  1 
ATOM   1730 C  CD  . PRO A 1 237 ? -9.932  14.669  30.483  1.00   8.34   ? 237  PRO A CD  1 
ATOM   1731 N  N   . TYR A 1 238 ? -7.776  15.957  34.658  1.00   8.13   ? 238  TYR A N   1 
ATOM   1732 C  CA  . TYR A 1 238 ? -6.777  15.621  35.685  1.00   10.96  ? 238  TYR A CA  1 
ATOM   1733 C  C   . TYR A 1 238 ? -7.044  14.378  36.527  1.00   18.21  ? 238  TYR A C   1 
ATOM   1734 O  O   . TYR A 1 238 ? -6.128  13.820  37.130  1.00   15.01  ? 238  TYR A O   1 
ATOM   1735 C  CB  . TYR A 1 238 ? -6.434  16.837  36.569  1.00   11.49  ? 238  TYR A CB  1 
ATOM   1736 C  CG  . TYR A 1 238 ? -5.764  17.898  35.748  1.00   11.42  ? 238  TYR A CG  1 
ATOM   1737 C  CD1 . TYR A 1 238 ? -6.462  19.019  35.332  1.00   17.15  ? 238  TYR A CD1 1 
ATOM   1738 C  CD2 . TYR A 1 238 ? -4.423  17.763  35.359  1.00   14.38  ? 238  TYR A CD2 1 
ATOM   1739 C  CE1 . TYR A 1 238 ? -5.849  19.996  34.553  1.00   14.73  ? 238  TYR A CE1 1 
ATOM   1740 C  CE2 . TYR A 1 238 ? -3.803  18.720  34.552  1.00   10.76  ? 238  TYR A CE2 1 
ATOM   1741 C  CZ  . TYR A 1 238 ? -4.520  19.847  34.165  1.00   15.02  ? 238  TYR A CZ  1 
ATOM   1742 O  OH  . TYR A 1 238 ? -3.930  20.821  33.380  1.00   12.81  ? 238  TYR A OH  1 
ATOM   1743 N  N   . ARG A 1 239 ? -8.284  13.917  36.550  1.00   15.66  ? 239  ARG A N   1 
ATOM   1744 C  CA  . ARG A 1 239 ? -8.558  12.623  37.166  1.00   23.45  ? 239  ARG A CA  1 
ATOM   1745 C  C   . ARG A 1 239 ? -7.783  11.446  36.532  1.00   22.73  ? 239  ARG A C   1 
ATOM   1746 O  O   . ARG A 1 239 ? -7.580  10.429  37.190  1.00   21.56  ? 239  ARG A O   1 
ATOM   1747 C  CB  . ARG A 1 239 ? -10.059 12.339  37.152  1.00   23.29  ? 239  ARG A CB  1 
ATOM   1748 C  CG  . ARG A 1 239 ? -10.531 11.602  35.913  1.00   29.81  ? 239  ARG A CG  1 
ATOM   1749 C  CD  . ARG A 1 239 ? -12.021 11.772  35.644  1.00   39.25  ? 239  ARG A CD  1 
ATOM   1750 N  NE  . ARG A 1 239 ? -12.920 11.605  36.792  1.00   43.09  ? 239  ARG A NE  1 
ATOM   1751 C  CZ  . ARG A 1 239 ? -13.378 10.439  37.245  1.00   43.21  ? 239  ARG A CZ  1 
ATOM   1752 N  NH1 . ARG A 1 239 ? -14.212 10.408  38.284  1.00   33.78  ? 239  ARG A NH1 1 
ATOM   1753 N  NH2 . ARG A 1 239 ? -12.994 9.302   36.680  1.00   39.60  ? 239  ARG A NH2 1 
ATOM   1754 N  N   . TYR A 1 240 ? -7.365  11.580  35.271  1.00   12.59  ? 240  TYR A N   1 
ATOM   1755 C  CA  . TYR A 1 240 ? -6.586  10.541  34.584  1.00   11.29  ? 240  TYR A CA  1 
ATOM   1756 C  C   . TYR A 1 240 ? -5.083  10.699  34.786  1.00   18.73  ? 240  TYR A C   1 
ATOM   1757 O  O   . TYR A 1 240 ? -4.553  11.815  34.720  1.00   11.36  ? 240  TYR A O   1 
ATOM   1758 C  CB  . TYR A 1 240 ? -6.918  10.530  33.079  1.00   5.14   ? 240  TYR A CB  1 
ATOM   1759 C  CG  . TYR A 1 240 ? -8.419  10.323  32.867  1.00   10.86  ? 240  TYR A CG  1 
ATOM   1760 C  CD1 . TYR A 1 240 ? -9.245  11.376  32.475  1.00   14.30  ? 240  TYR A CD1 1 
ATOM   1761 C  CD2 . TYR A 1 240 ? -9.006  9.101   33.145  1.00   15.59  ? 240  TYR A CD2 1 
ATOM   1762 C  CE1 . TYR A 1 240 ? -10.611 11.190  32.317  1.00   16.53  ? 240  TYR A CE1 1 
ATOM   1763 C  CE2 . TYR A 1 240 ? -10.383 8.899   32.995  1.00   13.52  ? 240  TYR A CE2 1 
ATOM   1764 C  CZ  . TYR A 1 240 ? -11.172 9.948   32.569  1.00   15.90  ? 240  TYR A CZ  1 
ATOM   1765 O  OH  . TYR A 1 240 ? -12.523 9.750   32.424  1.00   15.31  ? 240  TYR A OH  1 
ATOM   1766 N  N   . SER A 1 241 ? -4.396  9.576   35.013  1.00   15.97  ? 241  SER A N   1 
ATOM   1767 C  CA  . SER A 1 241 ? -2.957  9.577   35.329  1.00   15.85  ? 241  SER A CA  1 
ATOM   1768 C  C   . SER A 1 241 ? -2.112  10.168  34.208  1.00   10.09  ? 241  SER A C   1 
ATOM   1769 O  O   . SER A 1 241 ? -2.505  10.156  33.023  1.00   9.29   ? 241  SER A O   1 
ATOM   1770 C  CB  . SER A 1 241 ? -2.478  8.146   35.590  1.00   16.94  ? 241  SER A CB  1 
ATOM   1771 O  OG  . SER A 1 241 ? -2.617  7.384   34.404  1.00   17.39  ? 241  SER A OG  1 
ATOM   1772 N  N   . ASP A 1 242 ? -0.964  10.718  34.576  1.00   13.23  ? 242  ASP A N   1 
ATOM   1773 C  CA  . ASP A 1 242 ? -0.016  11.221  33.589  1.00   11.61  ? 242  ASP A CA  1 
ATOM   1774 C  C   . ASP A 1 242 ? 0.390   10.082  32.629  1.00   11.39  ? 242  ASP A C   1 
ATOM   1775 O  O   . ASP A 1 242 ? 0.665   10.298  31.457  1.00   11.84  ? 242  ASP A O   1 
ATOM   1776 C  CB  . ASP A 1 242 ? 1.250   11.730  34.297  1.00   11.42  ? 242  ASP A CB  1 
ATOM   1777 C  CG  . ASP A 1 242 ? 1.039   13.077  34.974  1.00   20.08  ? 242  ASP A CG  1 
ATOM   1778 O  OD1 . ASP A 1 242 ? 0.104   13.801  34.593  1.00   19.67  ? 242  ASP A OD1 1 
ATOM   1779 O  OD2 . ASP A 1 242 ? 1.835   13.423  35.870  1.00   21.24  ? 242  ASP A OD2 1 
ATOM   1780 N  N   . GLU A 1 243 ? 0.450   8.863   33.142  1.00   13.92  ? 243  GLU A N   1 
ATOM   1781 C  CA  . GLU A 1 243 ? 0.796   7.744   32.276  1.00   12.62  ? 243  GLU A CA  1 
ATOM   1782 C  C   . GLU A 1 243 ? -0.248  7.524   31.165  1.00   12.90  ? 243  GLU A C   1 
ATOM   1783 O  O   . GLU A 1 243 ? 0.103   7.309   30.010  1.00   11.03  ? 243  GLU A O   1 
ATOM   1784 C  CB  . GLU A 1 243 ? 0.986   6.461   33.098  1.00   14.10  ? 243  GLU A CB  1 
ATOM   1785 C  CG  . GLU A 1 243 ? 2.237   6.449   33.963  1.00   17.97  ? 243  GLU A CG  1 
ATOM   1786 C  CD  . GLU A 1 243 ? 2.089   7.227   35.273  1.00   28.81  ? 243  GLU A CD  1 
ATOM   1787 O  OE1 . GLU A 1 243 ? 0.976   7.699   35.611  1.00   21.42  ? 243  GLU A OE1 1 
ATOM   1788 O  OE2 . GLU A 1 243 ? 3.108   7.351   35.984  1.00   39.19  ? 243  GLU A OE2 1 
ATOM   1789 N  N   . LEU A 1 244 ? -1.528  7.555   31.514  1.00   12.76  ? 244  LEU A N   1 
ATOM   1790 C  CA  . LEU A 1 244 ? -2.578  7.427   30.491  1.00   9.53   ? 244  LEU A CA  1 
ATOM   1791 C  C   . LEU A 1 244 ? -2.577  8.645   29.551  1.00   11.26  ? 244  LEU A C   1 
ATOM   1792 O  O   . LEU A 1 244 ? -2.706  8.516   28.327  1.00   11.98  ? 244  LEU A O   1 
ATOM   1793 C  CB  . LEU A 1 244 ? -3.966  7.258   31.146  1.00   10.15  ? 244  LEU A CB  1 
ATOM   1794 C  CG  . LEU A 1 244 ? -5.205  7.162   30.222  1.00   14.56  ? 244  LEU A CG  1 
ATOM   1795 C  CD1 . LEU A 1 244 ? -5.003  6.022   29.240  1.00   12.16  ? 244  LEU A CD1 1 
ATOM   1796 C  CD2 . LEU A 1 244 ? -6.499  6.937   31.046  1.00   11.66  ? 244  LEU A CD2 1 
ATOM   1797 N  N   . ASN A 1 245 ? -2.474  9.844   30.104  1.00   8.25   ? 245  ASN A N   1 
ATOM   1798 C  CA  . ASN A 1 245 ? -2.395  10.996  29.217  1.00   5.07   ? 245  ASN A CA  1 
ATOM   1799 C  C   . ASN A 1 245 ? -1.227  10.835  28.213  1.00   13.75  ? 245  ASN A C   1 
ATOM   1800 O  O   . ASN A 1 245 ? -1.353  11.143  27.022  1.00   14.57  ? 245  ASN A O   1 
ATOM   1801 C  CB  . ASN A 1 245 ? -2.224  12.289  30.025  1.00   3.65   ? 245  ASN A CB  1 
ATOM   1802 C  CG  . ASN A 1 245 ? -2.099  13.500  29.120  1.00   15.62  ? 245  ASN A CG  1 
ATOM   1803 O  OD1 . ASN A 1 245 ? -3.054  13.874  28.443  1.00   17.63  ? 245  ASN A OD1 1 
ATOM   1804 N  ND2 . ASN A 1 245 ? -0.910  14.076  29.061  1.00   13.94  ? 245  ASN A ND2 1 
ATOM   1805 N  N   . GLU A 1 246 ? -0.097  10.327  28.701  1.00   12.78  ? 246  GLU A N   1 
ATOM   1806 C  CA  . GLU A 1 246 ? 1.104   10.203  27.868  1.00   13.70  ? 246  GLU A CA  1 
ATOM   1807 C  C   . GLU A 1 246 ? 0.873   9.288   26.683  1.00   12.65  ? 246  GLU A C   1 
ATOM   1808 O  O   . GLU A 1 246 ? 1.259   9.598   25.557  1.00   12.17  ? 246  GLU A O   1 
ATOM   1809 C  CB  . GLU A 1 246 ? 2.269   9.638   28.691  1.00   19.37  ? 246  GLU A CB  1 
ATOM   1810 C  CG  . GLU A 1 246 ? 3.630   9.689   28.022  1.00   21.11  ? 246  GLU A CG  1 
ATOM   1811 C  CD  . GLU A 1 246 ? 4.722   9.047   28.903  0.36   24.26  ? 246  GLU A CD  1 
ATOM   1812 O  OE1 . GLU A 1 246 ? 4.486   7.973   29.507  0.68   25.44  ? 246  GLU A OE1 1 
ATOM   1813 O  OE2 . GLU A 1 246 ? 5.821   9.618   29.002  0.50   27.68  ? 246  GLU A OE2 1 
ATOM   1814 N  N   . ILE A 1 247 ? 0.279   8.130   26.926  1.00   7.32   ? 247  ILE A N   1 
ATOM   1815 C  CA  . ILE A 1 247 ? 0.112   7.211   25.798  1.00   9.34   ? 247  ILE A CA  1 
ATOM   1816 C  C   . ILE A 1 247 ? -0.925  7.686   24.782  1.00   8.18   ? 247  ILE A C   1 
ATOM   1817 O  O   . ILE A 1 247 ? -0.763  7.529   23.561  1.00   11.08  ? 247  ILE A O   1 
ATOM   1818 C  CB  . ILE A 1 247 ? -0.185  5.759   26.255  1.00   13.96  ? 247  ILE A CB  1 
ATOM   1819 C  CG1 . ILE A 1 247 ? 0.048   4.802   25.076  1.00   20.99  ? 247  ILE A CG1 1 
ATOM   1820 C  CG2 . ILE A 1 247 ? -1.614  5.649   26.846  1.00   13.06  ? 247  ILE A CG2 1 
ATOM   1821 C  CD1 . ILE A 1 247 ? 0.034   3.339   25.470  1.00   32.81  ? 247  ILE A CD1 1 
ATOM   1822 N  N   . ILE A 1 248 ? -2.005  8.280   25.267  1.00   10.15  ? 248  ILE A N   1 
ATOM   1823 C  CA  . ILE A 1 248 ? -2.962  8.852   24.328  1.00   9.98   ? 248  ILE A CA  1 
ATOM   1824 C  C   . ILE A 1 248 ? -2.306  9.986   23.505  1.00   12.98  ? 248  ILE A C   1 
ATOM   1825 O  O   . ILE A 1 248 ? -2.483  10.100  22.282  1.00   8.91   ? 248  ILE A O   1 
ATOM   1826 C  CB  . ILE A 1 248 ? -4.239  9.341   25.060  1.00   11.89  ? 248  ILE A CB  1 
ATOM   1827 C  CG1 . ILE A 1 248 ? -4.985  8.131   25.638  1.00   11.20  ? 248  ILE A CG1 1 
ATOM   1828 C  CG2 . ILE A 1 248 ? -5.103  10.175  24.104  1.00   15.42  ? 248  ILE A CG2 1 
ATOM   1829 C  CD1 . ILE A 1 248 ? -6.174  8.482   26.515  1.00   12.13  ? 248  ILE A CD1 1 
ATOM   1830 N  N   . THR A 1 249 ? -1.557  10.837  24.184  1.00   9.96   ? 249  THR A N   1 
ATOM   1831 C  CA  . THR A 1 249 ? -0.846  11.905  23.500  1.00   13.91  ? 249  THR A CA  1 
ATOM   1832 C  C   . THR A 1 249 ? 0.101   11.374  22.432  1.00   14.51  ? 249  THR A C   1 
ATOM   1833 O  O   . THR A 1 249 ? 0.128   11.921  21.324  1.00   13.52  ? 249  THR A O   1 
ATOM   1834 C  CB  . THR A 1 249 ? -0.127  12.818  24.505  1.00   16.25  ? 249  THR A CB  1 
ATOM   1835 O  OG1 . THR A 1 249 ? -1.129  13.448  25.323  1.00   13.44  ? 249  THR A OG1 1 
ATOM   1836 C  CG2 . THR A 1 249 ? 0.689   13.887  23.768  1.00   11.74  ? 249  THR A CG2 1 
ATOM   1837 N  N   . ARG A 1 250 ? 0.851   10.302  22.738  1.00   12.07  ? 250  ARG A N   1 
ATOM   1838 C  CA  . ARG A 1 250 ? 1.724   9.667   21.723  1.00   12.58  ? 250  ARG A CA  1 
ATOM   1839 C  C   . ARG A 1 250 ? 0.955   9.137   20.500  1.00   11.52  ? 250  ARG A C   1 
ATOM   1840 O  O   . ARG A 1 250 ? 1.444   9.227   19.377  1.00   10.99  ? 250  ARG A O   1 
ATOM   1841 C  CB  . ARG A 1 250 ? 2.499   8.482   22.312  1.00   13.59  ? 250  ARG A CB  1 
ATOM   1842 C  CG  . ARG A 1 250 ? 3.905   8.756   22.808  1.00   38.17  ? 250  ARG A CG  1 
ATOM   1843 C  CD  . ARG A 1 250 ? 4.958   8.099   21.887  1.00   57.68  ? 250  ARG A CD  1 
ATOM   1844 N  NE  . ARG A 1 250 ? 5.036   6.637   22.012  1.00   57.90  ? 250  ARG A NE  1 
ATOM   1845 C  CZ  . ARG A 1 250 ? 5.943   5.868   21.401  1.00   62.35  ? 250  ARG A CZ  1 
ATOM   1846 N  NH1 . ARG A 1 250 ? 6.863   6.404   20.610  1.00   72.26  ? 250  ARG A NH1 1 
ATOM   1847 N  NH2 . ARG A 1 250 ? 5.939   4.555   21.582  1.00   56.53  ? 250  ARG A NH2 1 
ATOM   1848 N  N   . MET A 1 251 ? -0.213  8.532   20.715  1.00   7.60   ? 251  MET A N   1 
ATOM   1849 C  CA  . MET A 1 251 ? -1.008  8.071   19.581  1.00   6.98   ? 251  MET A CA  1 
ATOM   1850 C  C   . MET A 1 251 ? -1.414  9.239   18.699  1.00   13.30  ? 251  MET A C   1 
ATOM   1851 O  O   . MET A 1 251 ? -1.656  9.073   17.495  1.00   13.47  ? 251  MET A O   1 
ATOM   1852 C  CB  . MET A 1 251 ? -2.273  7.335   20.072  1.00   6.99   ? 251  MET A CB  1 
ATOM   1853 C  CG  . MET A 1 251 ? -1.940  6.060   20.842  1.00   8.43   ? 251  MET A CG  1 
ATOM   1854 S  SD  . MET A 1 251 ? -3.499  5.327   21.394  1.00   19.06  ? 251  MET A SD  1 
ATOM   1855 C  CE  . MET A 1 251 ? -3.017  4.301   22.776  1.00   21.43  ? 251  MET A CE  1 
ATOM   1856 N  N   . LEU A 1 252 ? -1.515  10.424  19.299  1.00   14.00  ? 252  LEU A N   1 
ATOM   1857 C  CA  . LEU A 1 252 ? -1.892  11.637  18.534  1.00   11.25  ? 252  LEU A CA  1 
ATOM   1858 C  C   . LEU A 1 252 ? -0.687  12.433  18.013  1.00   19.00  ? 252  LEU A C   1 
ATOM   1859 O  O   . LEU A 1 252 ? -0.800  13.627  17.717  1.00   15.47  ? 252  LEU A O   1 
ATOM   1860 C  CB  . LEU A 1 252 ? -2.841  12.547  19.348  1.00   6.84   ? 252  LEU A CB  1 
ATOM   1861 C  CG  . LEU A 1 252 ? -4.170  11.881  19.743  1.00   13.37  ? 252  LEU A CG  1 
ATOM   1862 C  CD1 . LEU A 1 252 ? -5.020  12.799  20.633  1.00   17.31  ? 252  LEU A CD1 1 
ATOM   1863 C  CD2 . LEU A 1 252 ? -4.972  11.519  18.492  1.00   12.50  ? 252  LEU A CD2 1 
ATOM   1864 N  N   . ASN A 1 253 ? 0.473   11.797  17.907  1.00   13.28  ? 253  ASN A N   1 
ATOM   1865 C  CA  . ASN A 1 253 ? 1.612   12.517  17.333  1.00   17.39  ? 253  ASN A CA  1 
ATOM   1866 C  C   . ASN A 1 253 ? 1.354   12.837  15.856  1.00   24.03  ? 253  ASN A C   1 
ATOM   1867 O  O   . ASN A 1 253 ? 0.788   12.020  15.156  1.00   16.50  ? 253  ASN A O   1 
ATOM   1868 C  CB  . ASN A 1 253 ? 2.902   11.721  17.475  1.00   18.74  ? 253  ASN A CB  1 
ATOM   1869 C  CG  . ASN A 1 253 ? 4.128   12.596  17.298  1.00   26.04  ? 253  ASN A CG  1 
ATOM   1870 O  OD1 . ASN A 1 253 ? 4.456   13.015  16.178  1.00   24.62  ? 253  ASN A OD1 1 
ATOM   1871 N  ND2 . ASN A 1 253 ? 4.791   12.909  18.398  1.00   23.44  ? 253  ASN A ND2 1 
ATOM   1872 N  N   . LEU A 1 254 ? 1.757   14.013  15.378  1.00   19.69  ? 254  LEU A N   1 
ATOM   1873 C  CA  . LEU A 1 254 ? 1.591   14.353  13.949  1.00   19.44  ? 254  LEU A CA  1 
ATOM   1874 C  C   . LEU A 1 254 ? 2.325   13.406  12.991  1.00   21.04  ? 254  LEU A C   1 
ATOM   1875 O  O   . LEU A 1 254 ? 1.848   13.139  11.884  1.00   26.10  ? 254  LEU A O   1 
ATOM   1876 C  CB  . LEU A 1 254 ? 2.082   15.787  13.685  1.00   18.88  ? 254  LEU A CB  1 
ATOM   1877 C  CG  . LEU A 1 254 ? 1.179   16.824  14.336  1.00   22.37  ? 254  LEU A CG  1 
ATOM   1878 C  CD1 . LEU A 1 254 ? 1.797   18.219  14.211  1.00   31.96  ? 254  LEU A CD1 1 
ATOM   1879 C  CD2 . LEU A 1 254 ? -0.178  16.754  13.682  1.00   17.30  ? 254  LEU A CD2 1 
ATOM   1880 N  N   . LYS A 1 255 ? 3.497   12.931  13.411  1.00   18.45  ? 255  LYS A N   1 
ATOM   1881 C  CA  . LYS A 1 255 ? 4.294   11.998  12.606  1.00   17.22  ? 255  LYS A CA  1 
ATOM   1882 C  C   . LYS A 1 255 ? 3.850   10.565  12.882  1.00   16.90  ? 255  LYS A C   1 
ATOM   1883 O  O   . LYS A 1 255 ? 3.899   10.125  14.020  1.00   19.63  ? 255  LYS A O   1 
ATOM   1884 C  CB  . LYS A 1 255 ? 5.768   12.122  12.994  1.00   26.16  ? 255  LYS A CB  1 
ATOM   1885 C  CG  . LYS A 1 255 ? 6.380   13.497  12.720  1.00   29.58  ? 255  LYS A CG  1 
ATOM   1886 C  CD  . LYS A 1 255 ? 6.317   13.794  11.236  1.00   39.98  ? 255  LYS A CD  1 
ATOM   1887 C  CE  . LYS A 1 255 ? 7.097   15.058  10.887  1.00   54.34  ? 255  LYS A CE  1 
ATOM   1888 N  NZ  . LYS A 1 255 ? 7.127   15.262  9.411   1.00   59.25  ? 255  LYS A NZ  1 
ATOM   1889 N  N   . ASP A 1 256 ? 3.445   9.829   11.849  1.00   18.04  ? 256  ASP A N   1 
ATOM   1890 C  CA  . ASP A 1 256 ? 3.027   8.444   12.055  1.00   21.24  ? 256  ASP A CA  1 
ATOM   1891 C  C   . ASP A 1 256 ? 4.097   7.584   12.707  1.00   23.53  ? 256  ASP A C   1 
ATOM   1892 O  O   . ASP A 1 256 ? 3.787   6.739   13.558  1.00   17.75  ? 256  ASP A O   1 
ATOM   1893 C  CB  . ASP A 1 256 ? 2.502   7.801   10.758  1.00   19.97  ? 256  ASP A CB  1 
ATOM   1894 C  CG  . ASP A 1 256 ? 3.494   7.870   9.596   1.00   29.29  ? 256  ASP A CG  1 
ATOM   1895 O  OD1 . ASP A 1 256 ? 3.156   7.348   8.519   1.00   43.66  ? 256  ASP A OD1 1 
ATOM   1896 O  OD2 . ASP A 1 256 ? 4.589   8.443   9.734   1.00   30.50  ? 256  ASP A OD2 1 
ATOM   1897 N  N   . TYR A 1 257 ? 5.362   7.803   12.334  1.00   19.29  ? 257  TYR A N   1 
ATOM   1898 C  CA  . TYR A 1 257 ? 6.448   7.003   12.893  1.00   23.13  ? 257  TYR A CA  1 
ATOM   1899 C  C   . TYR A 1 257 ? 6.796   7.309   14.362  1.00   22.91  ? 257  TYR A C   1 
ATOM   1900 O  O   . TYR A 1 257 ? 7.601   6.591   14.950  1.00   27.78  ? 257  TYR A O   1 
ATOM   1901 C  CB  . TYR A 1 257 ? 7.708   7.092   12.021  1.00   26.57  ? 257  TYR A CB  1 
ATOM   1902 C  CG  . TYR A 1 257 ? 8.154   8.515   11.747  1.00   25.19  ? 257  TYR A CG  1 
ATOM   1903 C  CD1 . TYR A 1 257 ? 7.958   9.102   10.502  1.00   27.91  ? 257  TYR A CD1 1 
ATOM   1904 C  CD2 . TYR A 1 257 ? 8.779   9.272   12.739  1.00   27.67  ? 257  TYR A CD2 1 
ATOM   1905 C  CE1 . TYR A 1 257 ? 8.373   10.414  10.253  1.00   29.84  ? 257  TYR A CE1 1 
ATOM   1906 C  CE2 . TYR A 1 257 ? 9.192   10.583  12.498  1.00   35.72  ? 257  TYR A CE2 1 
ATOM   1907 C  CZ  . TYR A 1 257 ? 8.987   11.143  11.258  1.00   34.97  ? 257  TYR A CZ  1 
ATOM   1908 O  OH  . TYR A 1 257 ? 9.404   12.435  11.019  1.00   40.09  ? 257  TYR A OH  1 
ATOM   1909 N  N   . HIS A 1 258 ? 6.220   8.361   14.957  1.00   21.06  ? 258  HIS A N   1 
ATOM   1910 C  CA  . HIS A 1 258 ? 6.361   8.557   16.415  1.00   14.55  ? 258  HIS A CA  1 
ATOM   1911 C  C   . HIS A 1 258 ? 5.201   7.960   17.226  1.00   18.97  ? 258  HIS A C   1 
ATOM   1912 O  O   . HIS A 1 258 ? 5.280   7.883   18.456  1.00   20.26  ? 258  HIS A O   1 
ATOM   1913 C  CB  . HIS A 1 258 ? 6.440   10.046  16.800  1.00   14.16  ? 258  HIS A CB  1 
ATOM   1914 C  CG  . HIS A 1 258 ? 7.699   10.721  16.366  1.00   17.33  ? 258  HIS A CG  1 
ATOM   1915 N  ND1 . HIS A 1 258 ? 8.918   10.080  16.334  1.00   18.03  ? 258  HIS A ND1 1 
ATOM   1916 C  CD2 . HIS A 1 258 ? 7.930   11.996  15.968  1.00   27.34  ? 258  HIS A CD2 1 
ATOM   1917 C  CE1 . HIS A 1 258 ? 9.847   10.931  15.929  1.00   23.54  ? 258  HIS A CE1 1 
ATOM   1918 N  NE2 . HIS A 1 258 ? 9.274   12.098  15.706  1.00   18.91  ? 258  HIS A NE2 1 
ATOM   1919 N  N   . ARG A 1 259 ? 4.119   7.564   16.561  1.00   15.05  ? 259  ARG A N   1 
ATOM   1920 C  CA  . ARG A 1 259 ? 3.027   6.889   17.273  1.00   12.38  ? 259  ARG A CA  1 
ATOM   1921 C  C   . ARG A 1 259 ? 3.476   5.477   17.632  1.00   16.35  ? 259  ARG A C   1 
ATOM   1922 O  O   . ARG A 1 259 ? 4.220   4.852   16.881  1.00   17.23  ? 259  ARG A O   1 
ATOM   1923 C  CB  . ARG A 1 259 ? 1.774   6.818   16.398  1.00   13.51  ? 259  ARG A CB  1 
ATOM   1924 C  CG  . ARG A 1 259 ? 1.304   8.182   15.916  1.00   15.05  ? 259  ARG A CG  1 
ATOM   1925 C  CD  . ARG A 1 259 ? 0.106   8.063   14.971  1.00   13.25  ? 259  ARG A CD  1 
ATOM   1926 N  NE  . ARG A 1 259 ? 0.030   9.314   14.202  1.00   20.00  ? 259  ARG A NE  1 
ATOM   1927 C  CZ  . ARG A 1 259 ? -0.379  9.415   12.943  1.00   19.57  ? 259  ARG A CZ  1 
ATOM   1928 N  NH1 . ARG A 1 259 ? -0.827  8.347   12.294  1.00   15.52  ? 259  ARG A NH1 1 
ATOM   1929 N  NH2 . ARG A 1 259 ? -0.348  10.603  12.344  1.00   24.99  ? 259  ARG A NH2 1 
ATOM   1930 N  N   . PRO A 1 260 ? 3.027   4.972   18.785  1.00   16.69  ? 260  PRO A N   1 
ATOM   1931 C  CA  . PRO A 1 260 ? 3.447   3.636   19.193  1.00   15.14  ? 260  PRO A CA  1 
ATOM   1932 C  C   . PRO A 1 260 ? 2.759   2.589   18.323  1.00   16.75  ? 260  PRO A C   1 
ATOM   1933 O  O   . PRO A 1 260 ? 1.660   2.823   17.833  1.00   15.29  ? 260  PRO A O   1 
ATOM   1934 C  CB  . PRO A 1 260 ? 2.941   3.548   20.634  1.00   14.83  ? 260  PRO A CB  1 
ATOM   1935 C  CG  . PRO A 1 260 ? 1.691   4.386   20.619  1.00   15.30  ? 260  PRO A CG  1 
ATOM   1936 C  CD  . PRO A 1 260 ? 2.106   5.580   19.762  1.00   16.67  ? 260  PRO A CD  1 
ATOM   1937 N  N   . SER A 1 261 ? 3.413   1.457   18.097  1.00   10.54  ? 261  SER A N   1 
ATOM   1938 C  CA  . SER A 1 261 ? 2.745   0.352   17.401  1.00   13.64  ? 261  SER A CA  1 
ATOM   1939 C  C   . SER A 1 261 ? 1.780   -0.336  18.376  1.00   14.88  ? 261  SER A C   1 
ATOM   1940 O  O   . SER A 1 261 ? 1.758   -0.035  19.582  1.00   12.79  ? 261  SER A O   1 
ATOM   1941 C  CB  . SER A 1 261 ? 3.799   -0.662  16.965  1.00   22.73  ? 261  SER A CB  1 
ATOM   1942 O  OG  . SER A 1 261 ? 4.540   -1.042  18.123  1.00   18.92  ? 261  SER A OG  1 
ATOM   1943 N  N   . VAL A 1 262 ? 1.001   -1.281  17.852  1.00   13.99  ? 262  VAL A N   1 
ATOM   1944 C  CA  . VAL A 1 262 ? 0.147   -2.125  18.676  1.00   14.63  ? 262  VAL A CA  1 
ATOM   1945 C  C   . VAL A 1 262 ? 0.991   -2.758  19.779  1.00   19.17  ? 262  VAL A C   1 
ATOM   1946 O  O   . VAL A 1 262 ? 0.598   -2.827  20.950  1.00   17.52  ? 262  VAL A O   1 
ATOM   1947 C  CB  . VAL A 1 262 ? -0.468  -3.252  17.793  1.00   17.27  ? 262  VAL A CB  1 
ATOM   1948 C  CG1 . VAL A 1 262 ? -0.769  -4.483  18.619  1.00   24.72  ? 262  VAL A CG1 1 
ATOM   1949 C  CG2 . VAL A 1 262 ? -1.702  -2.719  17.048  1.00   26.75  ? 262  VAL A CG2 1 
ATOM   1950 N  N   . GLU A 1 263 ? 2.164   -3.232  19.391  1.00   20.40  ? 263  GLU A N   1 
ATOM   1951 C  CA  . GLU A 1 263 ? 3.040   -3.928  20.318  1.00   18.43  ? 263  GLU A CA  1 
ATOM   1952 C  C   . GLU A 1 263 ? 3.539   -3.025  21.424  1.00   21.83  ? 263  GLU A C   1 
ATOM   1953 O  O   . GLU A 1 263 ? 3.577   -3.425  22.585  1.00   16.44  ? 263  GLU A O   1 
ATOM   1954 C  CB  . GLU A 1 263 ? 4.212   -4.553  19.566  1.00   19.92  ? 263  GLU A CB  1 
ATOM   1955 C  CG  . GLU A 1 263 ? 3.810   -5.750  18.669  1.00   29.52  ? 263  GLU A CG  1 
ATOM   1956 C  CD  . GLU A 1 263 ? 3.163   -5.355  17.326  1.00   35.91  ? 263  GLU A CD  1 
ATOM   1957 O  OE1 . GLU A 1 263 ? 2.558   -6.244  16.682  1.00   35.57  ? 263  GLU A OE1 1 
ATOM   1958 O  OE2 . GLU A 1 263 ? 3.245   -4.175  16.904  1.00   24.04  ? 263  GLU A OE2 1 
ATOM   1959 N  N   . GLU A 1 264 ? 3.937   -1.808  21.060  1.00   14.17  ? 264  GLU A N   1 
ATOM   1960 C  CA  . GLU A 1 264 ? 4.408   -0.847  22.036  1.00   11.72  ? 264  GLU A CA  1 
ATOM   1961 C  C   . GLU A 1 264 ? 3.305   -0.387  22.977  1.00   15.35  ? 264  GLU A C   1 
ATOM   1962 O  O   . GLU A 1 264 ? 3.566   -0.121  24.149  1.00   15.55  ? 264  GLU A O   1 
ATOM   1963 C  CB  . GLU A 1 264 ? 5.055   0.343   21.341  1.00   14.60  ? 264  GLU A CB  1 
ATOM   1964 C  CG  . GLU A 1 264 ? 6.427   0.011   20.758  1.00   22.43  ? 264  GLU A CG  1 
ATOM   1965 C  CD  . GLU A 1 264 ? 6.904   1.023   19.706  1.00   34.55  ? 264  GLU A CD  1 
ATOM   1966 O  OE1 . GLU A 1 264 ? 8.125   1.085   19.494  1.00   38.19  ? 264  GLU A OE1 1 
ATOM   1967 O  OE2 . GLU A 1 264 ? 6.080   1.740   19.078  1.00   28.10  ? 264  GLU A OE2 1 
ATOM   1968 N  N   . ILE A 1 265 ? 2.072   -0.305  22.481  1.00   12.20  ? 265  ILE A N   1 
ATOM   1969 C  CA  . ILE A 1 265 ? 0.943   0.042   23.350  1.00   8.86   ? 265  ILE A CA  1 
ATOM   1970 C  C   . ILE A 1 265 ? 0.741   -1.040  24.425  1.00   13.67  ? 265  ILE A C   1 
ATOM   1971 O  O   . ILE A 1 265 ? 0.621   -0.761  25.622  1.00   11.01  ? 265  ILE A O   1 
ATOM   1972 C  CB  . ILE A 1 265 ? -0.348  0.195   22.520  1.00   11.48  ? 265  ILE A CB  1 
ATOM   1973 C  CG1 . ILE A 1 265 ? -0.279  1.471   21.660  1.00   11.22  ? 265  ILE A CG1 1 
ATOM   1974 C  CG2 . ILE A 1 265 ? -1.564  0.308   23.412  1.00   7.15   ? 265  ILE A CG2 1 
ATOM   1975 C  CD1 . ILE A 1 265 ? -1.468  1.594   20.687  1.00   10.13  ? 265  ILE A CD1 1 
ATOM   1976 N  N   . LEU A 1 266 ? 0.746   -2.292  23.996  1.00   9.90   ? 266  LEU A N   1 
ATOM   1977 C  CA  . LEU A 1 266 ? 0.431   -3.387  24.920  1.00   14.48  ? 266  LEU A CA  1 
ATOM   1978 C  C   . LEU A 1 266 ? 1.556   -3.626  25.925  1.00   18.76  ? 266  LEU A C   1 
ATOM   1979 O  O   . LEU A 1 266 ? 1.327   -4.184  27.005  1.00   15.31  ? 266  LEU A O   1 
ATOM   1980 C  CB  . LEU A 1 266 ? 0.115   -4.674  24.151  1.00   12.65  ? 266  LEU A CB  1 
ATOM   1981 C  CG  . LEU A 1 266 ? -1.156  -4.578  23.290  1.00   18.57  ? 266  LEU A CG  1 
ATOM   1982 C  CD1 . LEU A 1 266 ? -1.271  -5.774  22.353  1.00   20.80  ? 266  LEU A CD1 1 
ATOM   1983 C  CD2 . LEU A 1 266 ? -2.409  -4.471  24.163  1.00   16.24  ? 266  LEU A CD2 1 
ATOM   1984 N  N   . GLU A 1 267 ? 2.770   -3.213  25.576  1.00   14.77  ? 267  GLU A N   1 
ATOM   1985 C  CA  . GLU A 1 267 ? 3.870   -3.255  26.548  1.00   15.81  ? 267  GLU A CA  1 
ATOM   1986 C  C   . GLU A 1 267 ? 3.745   -2.224  27.664  1.00   18.87  ? 267  GLU A C   1 
ATOM   1987 O  O   . GLU A 1 267 ? 4.461   -2.296  28.648  1.00   17.17  ? 267  GLU A O   1 
ATOM   1988 C  CB  . GLU A 1 267 ? 5.223   -3.029  25.867  1.00   25.74  ? 267  GLU A CB  1 
ATOM   1989 C  CG  . GLU A 1 267 ? 5.701   -4.188  25.047  1.00   36.92  ? 267  GLU A CG  1 
ATOM   1990 C  CD  . GLU A 1 267 ? 6.927   -3.820  24.237  1.00   53.21  ? 267  GLU A CD  1 
ATOM   1991 O  OE1 . GLU A 1 267 ? 7.414   -2.680  24.411  1.00   51.00  ? 267  GLU A OE1 1 
ATOM   1992 O  OE2 . GLU A 1 267 ? 7.395   -4.659  23.434  1.00   58.07  ? 267  GLU A OE2 1 
ATOM   1993 N  N   . ASN A 1 268 ? 2.858   -1.249  27.523  1.00   16.75  ? 268  ASN A N   1 
ATOM   1994 C  CA  . ASN A 1 268 ? 2.791   -0.194  28.542  1.00   15.84  ? 268  ASN A CA  1 
ATOM   1995 C  C   . ASN A 1 268 ? 2.501   -0.746  29.951  1.00   15.39  ? 268  ASN A C   1 
ATOM   1996 O  O   . ASN A 1 268 ? 1.621   -1.585  30.124  1.00   14.48  ? 268  ASN A O   1 
ATOM   1997 C  CB  . ASN A 1 268 ? 1.735   0.851   28.143  1.00   17.04  ? 268  ASN A CB  1 
ATOM   1998 C  CG  . ASN A 1 268 ? 1.832   2.118   28.973  1.00   18.25  ? 268  ASN A CG  1 
ATOM   1999 O  OD1 . ASN A 1 268 ? 1.490   2.116   30.147  1.00   17.30  ? 268  ASN A OD1 1 
ATOM   2000 N  ND2 . ASN A 1 268 ? 2.296   3.209   28.356  1.00   15.88  ? 268  ASN A ND2 1 
ATOM   2001 N  N   . PRO A 1 269 ? 3.211   -0.244  30.979  1.00   16.42  ? 269  PRO A N   1 
ATOM   2002 C  CA  . PRO A 1 269 ? 2.963   -0.737  32.344  1.00   17.28  ? 269  PRO A CA  1 
ATOM   2003 C  C   . PRO A 1 269 ? 1.518   -0.581  32.844  1.00   13.65  ? 269  PRO A C   1 
ATOM   2004 O  O   . PRO A 1 269 ? 1.126   -1.314  33.750  1.00   16.72  ? 269  PRO A O   1 
ATOM   2005 C  CB  . PRO A 1 269 ? 3.913   0.113   33.191  1.00   22.73  ? 269  PRO A CB  1 
ATOM   2006 C  CG  . PRO A 1 269 ? 5.058   0.409   32.248  1.00   24.26  ? 269  PRO A CG  1 
ATOM   2007 C  CD  . PRO A 1 269 ? 4.381   0.654   30.920  1.00   21.76  ? 269  PRO A CD  1 
ATOM   2008 N  N   . LEU A 1 270 ? 0.745   0.356   32.287  1.00   11.89  ? 270  LEU A N   1 
ATOM   2009 C  CA  . LEU A 1 270 ? -0.671  0.497   32.673  1.00   9.70   ? 270  LEU A CA  1 
ATOM   2010 C  C   . LEU A 1 270 ? -1.498  -0.764  32.407  1.00   17.96  ? 270  LEU A C   1 
ATOM   2011 O  O   . LEU A 1 270 ? -2.473  -1.042  33.111  1.00   12.80  ? 270  LEU A O   1 
ATOM   2012 C  CB  . LEU A 1 270 ? -1.332  1.629   31.879  1.00   13.64  ? 270  LEU A CB  1 
ATOM   2013 C  CG  . LEU A 1 270 ? -0.868  3.020   32.341  1.00   21.08  ? 270  LEU A CG  1 
ATOM   2014 C  CD1 . LEU A 1 270 ? -1.480  4.041   31.458  1.00   17.79  ? 270  LEU A CD1 1 
ATOM   2015 C  CD2 . LEU A 1 270 ? -1.227  3.255   33.791  1.00   25.28  ? 270  LEU A CD2 1 
ATOM   2016 N  N   . ILE A 1 271 ? -1.136  -1.491  31.362  1.00   12.86  ? 271  ILE A N   1 
ATOM   2017 C  CA  . ILE A 1 271 ? -1.994  -2.596  30.864  1.00   16.49  ? 271  ILE A CA  1 
ATOM   2018 C  C   . ILE A 1 271 ? -1.733  -3.923  31.552  1.00   12.88  ? 271  ILE A C   1 
ATOM   2019 O  O   . ILE A 1 271 ? -0.641  -4.477  31.438  1.00   11.46  ? 271  ILE A O   1 
ATOM   2020 C  CB  . ILE A 1 271 ? -1.858  -2.736  29.317  1.00   8.33   ? 271  ILE A CB  1 
ATOM   2021 C  CG1 . ILE A 1 271 ? -2.345  -1.440  28.666  1.00   19.88  ? 271  ILE A CG1 1 
ATOM   2022 C  CG2 . ILE A 1 271 ? -2.627  -4.000  28.765  1.00   10.29  ? 271  ILE A CG2 1 
ATOM   2023 C  CD1 . ILE A 1 271 ? -2.208  -1.406  27.146  1.00   18.78  ? 271  ILE A CD1 1 
ATOM   2024 N  N   . LEU A 1 272 ? -2.747  -4.429  32.251  1.00   13.28  ? 272  LEU A N   1 
ATOM   2025 C  CA  . LEU A 1 272 ? -2.667  -5.656  33.039  1.00   12.54  ? 272  LEU A CA  1 
ATOM   2026 C  C   . LEU A 1 272 ? -3.642  -6.749  32.572  1.00   11.71  ? 272  LEU A C   1 
ATOM   2027 O  O   . LEU A 1 272 ? -4.510  -6.519  31.737  1.00   10.98  ? 272  LEU A O   1 
ATOM   2028 C  CB  . LEU A 1 272 ? -2.932  -5.341  34.513  1.00   13.55  ? 272  LEU A CB  1 
ATOM   2029 C  CG  . LEU A 1 272 ? -2.033  -4.189  35.013  1.00   16.01  ? 272  LEU A CG  1 
ATOM   2030 C  CD1 . LEU A 1 272 ? -2.463  -3.717  36.389  1.00   15.67  ? 272  LEU A CD1 1 
ATOM   2031 C  CD2 . LEU A 1 272 ? -0.592  -4.692  35.052  1.00   20.56  ? 272  LEU A CD2 1 
ATOM   2032 N  N   . GLU A 1 273 ? -3.489  -7.946  33.125  1.00   11.66  ? 273  GLU A N   1 
ATOM   2033 C  CA  . GLU A 1 273 ? -4.272  -9.072  32.658  1.00   9.73   ? 273  GLU A CA  1 
ATOM   2034 C  C   . GLU A 1 273 ? -5.755  -8.766  32.776  1.00   14.84  ? 273  GLU A C   1 
ATOM   2035 O  O   . GLU A 1 273 ? -6.530  -9.107  31.878  1.00   11.80  ? 273  GLU A O   1 
ATOM   2036 C  CB  . GLU A 1 273 ? -3.972  -10.320 33.491  1.00   8.56   ? 273  GLU A CB  1 
ATOM   2037 C  CG  . GLU A 1 273 ? -4.388  -11.636 32.813  1.00   9.39   ? 273  GLU A CG  1 
ATOM   2038 C  CD  . GLU A 1 273 ? -5.877  -11.919 32.841  1.00   22.28  ? 273  GLU A CD  1 
ATOM   2039 O  OE1 . GLU A 1 273 ? -6.356  -12.691 31.958  1.00   19.08  ? 273  GLU A OE1 1 
ATOM   2040 O  OE2 . GLU A 1 273 ? -6.577  -11.402 33.745  1.00   19.00  ? 273  GLU A OE2 1 
ATOM   2041 N  N   . HIS A 1 274 ? -6.161  -8.171  33.903  1.00   12.87  ? 274  HIS A N   1 
ATOM   2042 C  CA  . HIS A 1 274 ? -7.595  -7.950  34.141  1.00   14.14  ? 274  HIS A CA  1 
ATOM   2043 C  C   . HIS A 1 274 ? -8.230  -6.980  33.142  1.00   15.81  ? 274  HIS A C   1 
ATOM   2044 O  O   . HIS A 1 274 ? -9.451  -6.920  33.048  1.00   14.19  ? 274  HIS A O   1 
ATOM   2045 C  CB  . HIS A 1 274 ? -7.893  -7.543  35.597  1.00   9.79   ? 274  HIS A CB  1 
ATOM   2046 C  CG  . HIS A 1 274 ? -7.550  -6.122  35.938  1.00   13.49  ? 274  HIS A CG  1 
ATOM   2047 N  ND1 . HIS A 1 274 ? -6.253  -5.697  36.155  1.00   11.70  ? 274  HIS A ND1 1 
ATOM   2048 C  CD2 . HIS A 1 274 ? -8.338  -5.038  36.139  1.00   13.73  ? 274  HIS A CD2 1 
ATOM   2049 C  CE1 . HIS A 1 274 ? -6.253  -4.407  36.442  1.00   16.15  ? 274  HIS A CE1 1 
ATOM   2050 N  NE2 . HIS A 1 274 ? -7.503  -3.983  36.451  1.00   15.09  ? 274  HIS A NE2 1 
ATOM   2051 N  N   . HIS A 1 275 ? -7.410  -6.223  32.407  1.00   7.52   ? 275  HIS A N   1 
ATOM   2052 C  CA  . HIS A 1 275 ? -7.947  -5.296  31.394  1.00   8.47   ? 275  HIS A CA  1 
ATOM   2053 C  C   . HIS A 1 275 ? -8.300  -6.011  30.082  1.00   9.72   ? 275  HIS A C   1 
ATOM   2054 O  O   . HIS A 1 275 ? -8.916  -5.405  29.190  1.00   13.76  ? 275  HIS A O   1 
ATOM   2055 C  CB  . HIS A 1 275 ? -6.972  -4.166  31.074  1.00   9.21   ? 275  HIS A CB  1 
ATOM   2056 C  CG  . HIS A 1 275 ? -6.686  -3.263  32.234  1.00   13.54  ? 275  HIS A CG  1 
ATOM   2057 N  ND1 . HIS A 1 275 ? -5.408  -3.021  32.680  1.00   13.71  ? 275  HIS A ND1 1 
ATOM   2058 C  CD2 . HIS A 1 275 ? -7.509  -2.534  33.026  1.00   11.90  ? 275  HIS A CD2 1 
ATOM   2059 C  CE1 . HIS A 1 275 ? -5.450  -2.181  33.702  1.00   14.83  ? 275  HIS A CE1 1 
ATOM   2060 N  NE2 . HIS A 1 275 ? -6.714  -1.880  33.940  1.00   12.55  ? 275  HIS A NE2 1 
ATOM   2061 N  N   . HIS A 1 276 ? -7.907  -7.281  29.966  1.00   7.88   ? 276  HIS A N   1 
ATOM   2062 C  CA  . HIS A 1 276 ? -8.134  -8.079  28.758  1.00   7.19   ? 276  HIS A CA  1 
ATOM   2063 C  C   . HIS A 1 276 ? -9.518  -8.720  28.830  1.00   12.99  ? 276  HIS A C   1 
ATOM   2064 O  O   . HIS A 1 276 ? -10.220 -8.626  29.842  1.00   9.58   ? 276  HIS A O   1 
ATOM   2065 C  CB  . HIS A 1 276 ? -7.053  -9.215  28.586  1.00   7.51   ? 276  HIS A CB  1 
ATOM   2066 C  CG  . HIS A 1 276 ? -5.667  -8.688  28.315  1.00   10.98  ? 276  HIS A CG  1 
ATOM   2067 N  ND1 . HIS A 1 276 ? -4.958  -7.951  29.241  1.00   7.30   ? 276  HIS A ND1 1 
ATOM   2068 C  CD2 . HIS A 1 276 ? -4.894  -8.731  27.203  1.00   6.48   ? 276  HIS A CD2 1 
ATOM   2069 C  CE1 . HIS A 1 276 ? -3.794  -7.594  28.724  1.00   15.07  ? 276  HIS A CE1 1 
ATOM   2070 N  NE2 . HIS A 1 276 ? -3.731  -8.051  27.484  1.00   11.11  ? 276  HIS A NE2 1 
ATOM   2071 N  N   . HIS A 1 277 ? -9.898  -9.442  27.777  1.00   8.93   ? 277  HIS A N   1 
ATOM   2072 C  CA  . HIS A 1 277 ? -11.215 -10.071 27.794  1.00   14.74  ? 277  HIS A CA  1 
ATOM   2073 C  C   . HIS A 1 277 ? -11.230 -11.271 28.743  1.00   16.09  ? 277  HIS A C   1 
ATOM   2074 O  O   . HIS A 1 277 ? -10.188 -11.917 28.943  1.00   12.77  ? 277  HIS A O   1 
ATOM   2075 C  CB  . HIS A 1 277 ? -11.578 -10.542 26.383  1.00   18.09  ? 277  HIS A CB  1 
ATOM   2076 C  CG  . HIS A 1 277 ? -11.006 -11.881 26.041  1.00   16.38  ? 277  HIS A CG  1 
ATOM   2077 N  ND1 . HIS A 1 277 ? -11.728 -13.056 26.166  1.00   21.04  ? 277  HIS A ND1 1 
ATOM   2078 C  CD2 . HIS A 1 277 ? -9.768  -12.242 25.624  1.00   17.41  ? 277  HIS A CD2 1 
ATOM   2079 C  CE1 . HIS A 1 277 ? -10.959 -14.084 25.828  1.00   20.59  ? 277  HIS A CE1 1 
ATOM   2080 N  NE2 . HIS A 1 277 ? -9.767  -13.619 25.490  1.00   26.28  ? 277  HIS A NE2 1 
ATOM   2081 N  N   . HIS A 1 278 ? -12.410 -11.583 29.285  1.00   8.82   ? 278  HIS A N   1 
ATOM   2082 C  CA  . HIS A 1 278 ? -12.657 -12.817 30.049  1.00   13.33  ? 278  HIS A CA  1 
ATOM   2083 C  C   . HIS A 1 278 ? -14.005 -13.406 29.668  1.00   23.77  ? 278  HIS A C   1 
ATOM   2084 O  O   . HIS A 1 278 ? -15.011 -12.696 29.578  1.00   24.19  ? 278  HIS A O   1 
ATOM   2085 C  CB  . HIS A 1 278 ? -12.641 -12.569 31.565  1.00   11.83  ? 278  HIS A CB  1 
ATOM   2086 C  CG  . HIS A 1 278 ? -11.357 -11.978 32.040  1.00   17.26  ? 278  HIS A CG  1 
ATOM   2087 N  ND1 . HIS A 1 278 ? -11.078 -10.635 31.913  1.00   20.23  ? 278  HIS A ND1 1 
ATOM   2088 C  CD2 . HIS A 1 278 ? -10.238 -12.556 32.541  1.00   17.48  ? 278  HIS A CD2 1 
ATOM   2089 C  CE1 . HIS A 1 278 ? -9.855  -10.403 32.361  1.00   16.90  ? 278  HIS A CE1 1 
ATOM   2090 N  NE2 . HIS A 1 278 ? -9.321  -11.553 32.739  1.00   19.22  ? 278  HIS A NE2 1 
ATOM   2091 N  N   . HIS A 1 279 ? -14.022 -14.716 29.481  1.00   17.99  ? 279  HIS A N   1 
ATOM   2092 C  CA  . HIS A 1 279 ? -15.263 -15.427 29.198  1.00   23.88  ? 279  HIS A CA  1 
ATOM   2093 C  C   . HIS A 1 279 ? -16.176 -15.511 30.418  1.00   36.81  ? 279  HIS A C   1 
ATOM   2094 O  O   . HIS A 1 279 ? -17.362 -15.817 30.288  1.00   38.32  ? 279  HIS A O   1 
ATOM   2095 C  CB  . HIS A 1 279 ? -14.946 -16.820 28.635  1.00   25.21  ? 279  HIS A CB  1 
ATOM   2096 C  CG  . HIS A 1 279 ? -14.344 -16.758 27.267  1.00   40.99  ? 279  HIS A CG  1 
ATOM   2097 N  ND1 . HIS A 1 279 ? -13.027 -17.075 27.011  1.00   51.33  ? 279  HIS A ND1 1 
ATOM   2098 C  CD2 . HIS A 1 279 ? -14.867 -16.348 26.087  1.00   49.60  ? 279  HIS A CD2 1 
ATOM   2099 C  CE1 . HIS A 1 279 ? -12.777 -16.905 25.724  1.00   53.59  ? 279  HIS A CE1 1 
ATOM   2100 N  NE2 . HIS A 1 279 ? -13.876 -16.460 25.141  1.00   51.13  ? 279  HIS A NE2 1 
ATOM   2101 O  OXT . HIS A 1 279 ? -15.762 -15.257 31.555  1.00   34.31  ? 279  HIS A OXT 1 
HETATM 2102 C  C01 . WCX B 2 .   ? -26.838 -1.251  13.649  1.00   29.43  ? 1280 WCX A C01 1 
HETATM 2103 C  C02 . WCX B 2 .   ? -26.311 -1.848  14.974  1.00   29.39  ? 1280 WCX A C02 1 
HETATM 2104 O  O03 . WCX B 2 .   ? -25.088 -2.487  14.688  1.00   23.48  ? 1280 WCX A O03 1 
HETATM 2105 C  C04 . WCX B 2 .   ? -24.563 -3.405  15.623  1.00   22.13  ? 1280 WCX A C04 1 
HETATM 2106 C  C05 . WCX B 2 .   ? -25.316 -3.706  16.875  1.00   14.71  ? 1280 WCX A C05 1 
HETATM 2107 C  C06 . WCX B 2 .   ? -24.699 -4.634  17.867  1.00   18.38  ? 1280 WCX A C06 1 
HETATM 2108 N  N09 . WCX B 2 .   ? -26.041 -6.028  20.839  1.00   13.14  ? 1280 WCX A N09 1 
HETATM 2109 C  C08 . WCX B 2 .   ? -25.347 -6.162  19.596  1.00   11.21  ? 1280 WCX A C08 1 
HETATM 2110 N  N07 . WCX B 2 .   ? -25.309 -4.902  19.031  1.00   15.59  ? 1280 WCX A N07 1 
HETATM 2111 C  C23 . WCX B 2 .   ? -25.962 -3.974  19.869  1.00   12.81  ? 1280 WCX A C23 1 
HETATM 2112 C  C22 . WCX B 2 .   ? -26.219 -2.510  19.745  1.00   17.13  ? 1280 WCX A C22 1 
HETATM 2113 C  C21 . WCX B 2 .   ? -26.936 -1.818  20.804  1.00   22.09  ? 1280 WCX A C21 1 
HETATM 2114 C  C12 . WCX B 2 .   ? -27.388 -2.592  21.942  1.00   14.96  ? 1280 WCX A C12 1 
HETATM 2115 O  O13 . WCX B 2 .   ? -28.081 -1.969  23.003  1.00   21.76  ? 1280 WCX A O13 1 
HETATM 2116 C  C14 . WCX B 2 .   ? -29.085 -2.844  23.523  1.00   27.74  ? 1280 WCX A C14 1 
HETATM 2117 C  C15 . WCX B 2 .   ? -30.422 -2.105  23.774  1.00   31.57  ? 1280 WCX A C15 1 
HETATM 2118 C  C16 . WCX B 2 .   ? -30.189 -0.755  24.493  1.00   39.54  ? 1280 WCX A C16 1 
HETATM 2119 N  N17 . WCX B 2 .   ? -29.336 -0.850  25.692  1.00   43.43  ? 1280 WCX A N17 1 
HETATM 2120 C  C18 . WCX B 2 .   ? -29.085 0.406   26.442  1.00   51.91  ? 1280 WCX A C18 1 
HETATM 2121 C  C19 . WCX B 2 .   ? -28.069 -1.613  25.485  1.00   38.98  ? 1280 WCX A C19 1 
HETATM 2122 C  C20 . WCX B 2 .   ? -28.315 -3.017  24.853  1.00   30.17  ? 1280 WCX A C20 1 
HETATM 2123 C  C11 . WCX B 2 .   ? -27.143 -4.020  22.061  1.00   11.93  ? 1280 WCX A C11 1 
HETATM 2124 C  C10 . WCX B 2 .   ? -26.427 -4.707  20.976  1.00   13.23  ? 1280 WCX A C10 1 
HETATM 2125 C  C24 . WCX B 2 .   ? -23.402 -5.264  17.624  1.00   19.20  ? 1280 WCX A C24 1 
HETATM 2126 C  C25 . WCX B 2 .   ? -22.672 -4.971  16.360  1.00   18.61  ? 1280 WCX A C25 1 
HETATM 2127 C  C26 . WCX B 2 .   ? -23.252 -4.038  15.366  1.00   18.62  ? 1280 WCX A C26 1 
HETATM 2128 C  C27 . WCX B 2 .   ? -22.435 -3.767  14.076  1.00   25.43  ? 1280 WCX A C27 1 
HETATM 2129 N  N28 . WCX B 2 .   ? -22.950 -2.895  13.017  1.00   37.43  ? 1280 WCX A N28 1 
HETATM 2130 O  O29 . WCX B 2 .   ? -21.393 -4.308  13.957  1.00   27.20  ? 1280 WCX A O29 1 
HETATM 2131 C  C30 . WCX B 2 .   ? -26.046 -0.724  16.012  1.00   20.75  ? 1280 WCX A C30 1 
HETATM 2132 C  C31 . WCX B 2 .   ? -24.743 -0.060  16.046  1.00   18.95  ? 1280 WCX A C31 1 
HETATM 2133 C  C32 . WCX B 2 .   ? -24.516 1.009   17.007  1.00   21.09  ? 1280 WCX A C32 1 
HETATM 2134 C  C33 . WCX B 2 .   ? -25.593 1.416   17.945  1.00   25.14  ? 1280 WCX A C33 1 
HETATM 2135 C  C34 . WCX B 2 .   ? -26.924 0.748   17.905  1.00   24.07  ? 1280 WCX A C34 1 
HETATM 2136 C  C35 . WCX B 2 .   ? -27.146 -0.294  16.954  1.00   19.94  ? 1280 WCX A C35 1 
HETATM 2137 C  C36 . WCX B 2 .   ? -28.536 -0.997  16.911  1.00   24.79  ? 1280 WCX A C36 1 
HETATM 2138 F  F39 . WCX B 2 .   ? -29.335 -0.383  17.809  1.00   26.16  ? 1280 WCX A F39 1 
HETATM 2139 F  F38 . WCX B 2 .   ? -28.399 -2.304  17.272  1.00   24.11  ? 1280 WCX A F38 1 
HETATM 2140 F  F37 . WCX B 2 .   ? -29.113 -0.909  15.658  1.00   26.00  ? 1280 WCX A F37 1 
HETATM 2141 CL CL  . CL  C 3 .   ? -18.032 16.754  32.947  1.00   59.67  ? 1281 CL  A CL  1 
HETATM 2142 CL CL  . CL  D 3 .   ? -14.663 -12.852 25.639  1.00   61.06  ? 1282 CL  A CL  1 
HETATM 2143 CL CL  . CL  E 3 .   ? -8.930  19.762  22.701  1.00   35.86  ? 1283 CL  A CL  1 
HETATM 2144 C  C1  . EDO F 4 .   ? -17.089 13.170  17.733  1.00   45.40  ? 1284 EDO A C1  1 
HETATM 2145 O  O1  . EDO F 4 .   ? -18.225 13.372  18.588  1.00   49.91  ? 1284 EDO A O1  1 
HETATM 2146 C  C2  . EDO F 4 .   ? -17.147 11.797  17.062  1.00   42.83  ? 1284 EDO A C2  1 
HETATM 2147 O  O2  . EDO F 4 .   ? -16.819 10.753  17.995  1.00   34.74  ? 1284 EDO A O2  1 
HETATM 2148 C  C1  . EDO G 4 .   ? 4.185   11.233  32.940  1.00   61.93  ? 1285 EDO A C1  1 
HETATM 2149 O  O1  . EDO G 4 .   ? 4.164   11.573  31.548  1.00   60.74  ? 1285 EDO A O1  1 
HETATM 2150 C  C2  . EDO G 4 .   ? 4.388   9.729   33.094  1.00   58.07  ? 1285 EDO A C2  1 
HETATM 2151 O  O2  . EDO G 4 .   ? 4.079   9.097   31.848  1.00   59.10  ? 1285 EDO A O2  1 
HETATM 2152 C  C1  . EDO H 4 .   ? -14.267 -9.959  34.614  1.00   30.69  ? 1286 EDO A C1  1 
HETATM 2153 O  O1  . EDO H 4 .   ? -14.054 -8.761  33.851  1.00   30.35  ? 1286 EDO A O1  1 
HETATM 2154 C  C2  . EDO H 4 .   ? -15.749 -10.345 34.567  1.00   24.13  ? 1286 EDO A C2  1 
HETATM 2155 O  O2  . EDO H 4 .   ? -16.048 -10.992 33.318  1.00   24.14  ? 1286 EDO A O2  1 
HETATM 2156 C  C1  . EDO I 4 .   ? 1.664   -0.291  13.096  1.00   40.70  ? 1287 EDO A C1  1 
HETATM 2157 O  O1  . EDO I 4 .   ? 3.010   -0.443  13.591  1.00   36.19  ? 1287 EDO A O1  1 
HETATM 2158 C  C2  . EDO I 4 .   ? 0.617   -0.436  14.209  1.00   28.76  ? 1287 EDO A C2  1 
HETATM 2159 O  O2  . EDO I 4 .   ? 0.944   -1.543  15.066  1.00   21.47  ? 1287 EDO A O2  1 
HETATM 2160 CL CL  . CL  J 3 .   ? 2.404   20.315  19.410  1.00   62.61  ? 1288 CL  A CL  1 
HETATM 2161 C  C1  . EDO K 4 .   ? 2.334   -8.854  28.070  1.00   24.24  ? 1289 EDO A C1  1 
HETATM 2162 O  O1  . EDO K 4 .   ? 2.448   -7.552  27.496  1.00   29.28  ? 1289 EDO A O1  1 
HETATM 2163 C  C2  . EDO K 4 .   ? 3.753   -9.253  28.431  1.00   28.48  ? 1289 EDO A C2  1 
HETATM 2164 O  O2  . EDO K 4 .   ? 4.145   -8.382  29.501  1.00   40.10  ? 1289 EDO A O2  1 
HETATM 2165 O  O   . HOH L 5 .   ? 9.574   -6.430  31.621  1.00   53.53  ? 2001 HOH A O   1 
HETATM 2166 O  O   . HOH L 5 .   ? 6.948   -5.968  34.329  1.00   41.49  ? 2002 HOH A O   1 
HETATM 2167 O  O   . HOH L 5 .   ? -30.785 -19.453 4.732   1.00   55.14  ? 2003 HOH A O   1 
HETATM 2168 O  O   . HOH L 5 .   ? -36.196 -18.288 6.930   1.00   45.28  ? 2004 HOH A O   1 
HETATM 2169 O  O   . HOH L 5 .   ? -38.890 -15.391 13.529  1.00   32.95  ? 2005 HOH A O   1 
HETATM 2170 O  O   . HOH L 5 .   ? -36.689 -20.293 24.340  1.00   55.88  ? 2006 HOH A O   1 
HETATM 2171 O  O   . HOH L 5 .   ? -39.970 -23.920 11.716  1.00   48.98  ? 2007 HOH A O   1 
HETATM 2172 O  O   . HOH L 5 .   ? -33.527 -22.826 17.377  1.00   38.79  ? 2008 HOH A O   1 
HETATM 2173 O  O   . HOH L 5 .   ? -38.605 -18.136 22.293  1.00   63.46  ? 2009 HOH A O   1 
HETATM 2174 O  O   . HOH L 5 .   ? -43.871 -18.284 21.281  1.00   51.84  ? 2010 HOH A O   1 
HETATM 2175 O  O   . HOH L 5 .   ? -40.945 -13.261 17.287  1.00   48.73  ? 2011 HOH A O   1 
HETATM 2176 O  O   . HOH L 5 .   ? -40.142 -3.996  18.966  1.00   44.26  ? 2012 HOH A O   1 
HETATM 2177 O  O   . HOH L 5 .   ? -28.612 3.809   19.599  1.00   53.26  ? 2013 HOH A O   1 
HETATM 2178 O  O   . HOH L 5 .   ? -32.249 0.403   21.824  1.00   47.40  ? 2014 HOH A O   1 
HETATM 2179 O  O   . HOH L 5 .   ? -32.810 3.391   16.185  1.00   51.12  ? 2015 HOH A O   1 
HETATM 2180 O  O   . HOH L 5 .   ? -39.314 -0.089  14.668  1.00   49.08  ? 2016 HOH A O   1 
HETATM 2181 O  O   . HOH L 5 .   ? -3.877  4.382   40.842  1.00   48.15  ? 2017 HOH A O   1 
HETATM 2182 O  O   . HOH L 5 .   ? -4.007  9.571   38.870  1.00   40.69  ? 2018 HOH A O   1 
HETATM 2183 O  O   . HOH L 5 .   ? -33.580 -2.489  4.823   1.00   45.11  ? 2019 HOH A O   1 
HETATM 2184 O  O   . HOH L 5 .   ? -29.778 2.009   14.162  1.00   46.93  ? 2020 HOH A O   1 
HETATM 2185 O  O   . HOH L 5 .   ? -39.741 -2.605  14.764  1.00   42.40  ? 2021 HOH A O   1 
HETATM 2186 O  O   . HOH L 5 .   ? -38.372 -9.457  12.354  1.00   38.11  ? 2022 HOH A O   1 
HETATM 2187 O  O   . HOH L 5 .   ? -34.351 -15.148 28.175  1.00   55.34  ? 2023 HOH A O   1 
HETATM 2188 O  O   . HOH L 5 .   ? -23.869 -21.183 17.964  1.00   44.28  ? 2024 HOH A O   1 
HETATM 2189 O  O   . HOH L 5 .   ? -27.145 -19.676 15.745  1.00   38.02  ? 2025 HOH A O   1 
HETATM 2190 O  O   . HOH L 5 .   ? -23.638 -20.996 20.387  1.00   50.18  ? 2026 HOH A O   1 
HETATM 2191 O  O   . HOH L 5 .   ? -32.598 -17.087 27.595  1.00   37.50  ? 2027 HOH A O   1 
HETATM 2192 O  O   . HOH L 5 .   ? -26.076 -14.274 25.058  1.00   40.22  ? 2028 HOH A O   1 
HETATM 2193 O  O   . HOH L 5 .   ? -28.716 -11.497 27.812  1.00   38.17  ? 2029 HOH A O   1 
HETATM 2194 O  O   . HOH L 5 .   ? -23.313 -12.204 30.756  1.00   34.46  ? 2030 HOH A O   1 
HETATM 2195 O  O   . HOH L 5 .   ? -25.105 -13.419 22.224  1.00   24.88  ? 2031 HOH A O   1 
HETATM 2196 O  O   . HOH L 5 .   ? -28.092 -16.099 26.334  1.00   23.69  ? 2032 HOH A O   1 
HETATM 2197 O  O   . HOH L 5 .   ? -26.664 1.793   24.954  1.00   27.43  ? 2033 HOH A O   1 
HETATM 2198 O  O   . HOH L 5 .   ? -24.146 2.749   30.079  1.00   47.80  ? 2034 HOH A O   1 
HETATM 2199 O  O   . HOH L 5 .   ? -21.804 -1.891  30.687  1.00   53.18  ? 2035 HOH A O   1 
HETATM 2200 O  O   . HOH L 5 .   ? -28.829 1.895   21.430  1.00   47.63  ? 2036 HOH A O   1 
HETATM 2201 O  O   . HOH L 5 .   ? 7.320   -1.592  34.776  1.00   39.85  ? 2037 HOH A O   1 
HETATM 2202 O  O   . HOH L 5 .   ? -27.397 4.984   27.609  1.00   34.41  ? 2038 HOH A O   1 
HETATM 2203 O  O   . HOH L 5 .   ? -27.551 8.288   23.502  1.00   47.41  ? 2039 HOH A O   1 
HETATM 2204 O  O   . HOH L 5 .   ? -22.264 4.294   31.222  1.00   50.97  ? 2040 HOH A O   1 
HETATM 2205 O  O   . HOH L 5 .   ? -24.946 -1.944  9.652   1.00   53.12  ? 2041 HOH A O   1 
HETATM 2206 O  O   . HOH L 5 .   ? -36.746 -4.056  7.782   1.00   60.39  ? 2042 HOH A O   1 
HETATM 2207 O  O   . HOH L 5 .   ? -19.247 6.227   35.085  1.00   51.53  ? 2043 HOH A O   1 
HETATM 2208 O  O   . HOH L 5 .   ? -33.765 -3.198  -1.232  1.00   45.94  ? 2044 HOH A O   1 
HETATM 2209 O  O   . HOH L 5 .   ? -38.847 -4.435  -1.328  1.00   51.48  ? 2045 HOH A O   1 
HETATM 2210 O  O   . HOH L 5 .   ? -4.059  2.347   36.403  1.00   36.79  ? 2046 HOH A O   1 
HETATM 2211 O  O   . HOH L 5 .   ? -3.901  6.120   38.920  1.00   39.26  ? 2047 HOH A O   1 
HETATM 2212 O  O   . HOH L 5 .   ? -7.841  3.803   38.610  1.00   28.34  ? 2048 HOH A O   1 
HETATM 2213 O  O   . HOH L 5 .   ? -11.720 1.992   39.716  1.00   37.84  ? 2049 HOH A O   1 
HETATM 2214 O  O   . HOH L 5 .   ? -33.565 -7.569  -5.708  1.00   35.79  ? 2050 HOH A O   1 
HETATM 2215 O  O   . HOH L 5 .   ? 4.411   -8.455  22.362  1.00   49.25  ? 2051 HOH A O   1 
HETATM 2216 O  O   . HOH L 5 .   ? -1.628  -11.608 16.062  1.00   47.39  ? 2052 HOH A O   1 
HETATM 2217 O  O   . HOH L 5 .   ? -31.997 -8.489  -8.824  1.00   42.64  ? 2053 HOH A O   1 
HETATM 2218 O  O   . HOH L 5 .   ? -16.927 -12.591 14.095  1.00   42.85  ? 2054 HOH A O   1 
HETATM 2219 O  O   . HOH L 5 .   ? -15.488 -14.813 18.560  1.00   37.62  ? 2055 HOH A O   1 
HETATM 2220 O  O   . HOH L 5 .   ? -12.727 -15.873 19.388  1.00   48.93  ? 2056 HOH A O   1 
HETATM 2221 O  O   . HOH L 5 .   ? -8.530  -9.045  25.158  1.00   17.18  ? 2057 HOH A O   1 
HETATM 2222 O  O   . HOH L 5 .   ? -15.353 -12.624 16.350  1.00   17.70  ? 2058 HOH A O   1 
HETATM 2223 O  O   . HOH L 5 .   ? -23.609 -19.415 8.519   1.00   56.97  ? 2059 HOH A O   1 
HETATM 2224 O  O   . HOH L 5 .   ? -17.739 -16.731 13.540  1.00   56.38  ? 2060 HOH A O   1 
HETATM 2225 O  O   . HOH L 5 .   ? -22.401 -14.673 22.452  1.00   48.69  ? 2061 HOH A O   1 
HETATM 2226 O  O   . HOH L 5 .   ? -21.637 -20.095 13.675  1.00   50.09  ? 2062 HOH A O   1 
HETATM 2227 O  O   . HOH L 5 .   ? -35.766 -19.365 1.816   1.00   54.90  ? 2063 HOH A O   1 
HETATM 2228 O  O   . HOH L 5 .   ? -4.998  24.622  17.187  1.00   33.07  ? 2064 HOH A O   1 
HETATM 2229 O  O   . HOH L 5 .   ? 1.476   21.398  7.933   1.00   45.91  ? 2065 HOH A O   1 
HETATM 2230 O  O   . HOH L 5 .   ? 1.917   15.229  20.488  1.00   36.08  ? 2066 HOH A O   1 
HETATM 2231 O  O   . HOH L 5 .   ? -37.647 -6.340  5.611   1.00   61.23  ? 2067 HOH A O   1 
HETATM 2232 O  O   . HOH L 5 .   ? -6.712  24.211  20.199  1.00   56.72  ? 2068 HOH A O   1 
HETATM 2233 O  O   . HOH L 5 .   ? -8.406  22.957  22.025  1.00   38.11  ? 2069 HOH A O   1 
HETATM 2234 O  O   . HOH L 5 .   ? -7.422  6.082   39.458  1.00   46.29  ? 2070 HOH A O   1 
HETATM 2235 O  O   . HOH L 5 .   ? 1.162   17.400  34.066  1.00   19.89  ? 2071 HOH A O   1 
HETATM 2236 O  O   . HOH L 5 .   ? -16.693 -11.822 20.283  1.00   20.02  ? 2072 HOH A O   1 
HETATM 2237 O  O   . HOH L 5 .   ? 4.400   12.921  22.815  1.00   28.27  ? 2073 HOH A O   1 
HETATM 2238 O  O   . HOH L 5 .   ? -21.975 -11.323 23.971  1.00   32.55  ? 2074 HOH A O   1 
HETATM 2239 O  O   . HOH L 5 .   ? -24.035 -9.162  26.133  1.00   16.82  ? 2075 HOH A O   1 
HETATM 2240 O  O   . HOH L 5 .   ? 4.153   5.787   26.081  1.00   45.15  ? 2076 HOH A O   1 
HETATM 2241 O  O   . HOH L 5 .   ? 5.379   17.531  12.943  1.00   56.64  ? 2077 HOH A O   1 
HETATM 2242 O  O   . HOH L 5 .   ? -25.124 -10.498 31.194  1.00   35.86  ? 2078 HOH A O   1 
HETATM 2243 O  O   . HOH L 5 .   ? -26.028 -10.416 28.121  1.00   33.41  ? 2079 HOH A O   1 
HETATM 2244 O  O   . HOH L 5 .   ? -28.234 -9.327  29.619  0.50   40.44  ? 2080 HOH A O   1 
HETATM 2245 O  O   . HOH L 5 .   ? -24.135 1.912   25.480  1.00   19.07  ? 2081 HOH A O   1 
HETATM 2246 O  O   . HOH L 5 .   ? -22.983 0.275   29.001  1.00   30.53  ? 2082 HOH A O   1 
HETATM 2247 O  O   . HOH L 5 .   ? -26.670 1.426   22.596  1.00   42.54  ? 2083 HOH A O   1 
HETATM 2248 O  O   . HOH L 5 .   ? -24.979 5.211   19.330  1.00   32.92  ? 2084 HOH A O   1 
HETATM 2249 O  O   . HOH L 5 .   ? 6.068   1.064   27.061  1.00   42.37  ? 2085 HOH A O   1 
HETATM 2250 O  O   . HOH L 5 .   ? 6.818   -5.771  28.808  1.00   54.47  ? 2086 HOH A O   1 
HETATM 2251 O  O   . HOH L 5 .   ? 5.550   -3.295  33.648  1.00   33.29  ? 2087 HOH A O   1 
HETATM 2252 O  O   . HOH L 5 .   ? 5.287   4.581   32.100  1.00   48.04  ? 2088 HOH A O   1 
HETATM 2253 O  O   . HOH L 5 .   ? 2.249   3.243   34.935  1.00   62.14  ? 2089 HOH A O   1 
HETATM 2254 O  O   . HOH L 5 .   ? -26.793 7.577   25.908  1.00   32.80  ? 2090 HOH A O   1 
HETATM 2255 O  O   . HOH L 5 .   ? -21.434 6.827   30.724  1.00   25.38  ? 2091 HOH A O   1 
HETATM 2256 O  O   . HOH L 5 .   ? -24.755 3.799   27.686  1.00   32.04  ? 2092 HOH A O   1 
HETATM 2257 O  O   . HOH L 5 .   ? -21.302 10.447  21.746  1.00   38.23  ? 2093 HOH A O   1 
HETATM 2258 O  O   . HOH L 5 .   ? -25.150 8.788   21.142  1.00   49.99  ? 2094 HOH A O   1 
HETATM 2259 O  O   . HOH L 5 .   ? -11.445 -12.964 36.008  1.00   41.26  ? 2095 HOH A O   1 
HETATM 2260 O  O   . HOH L 5 .   ? -20.185 17.139  30.484  1.00   52.72  ? 2096 HOH A O   1 
HETATM 2261 O  O   . HOH L 5 .   ? -20.471 8.426   32.791  1.00   35.08  ? 2097 HOH A O   1 
HETATM 2262 O  O   . HOH L 5 .   ? -13.784 17.366  29.427  1.00   19.57  ? 2098 HOH A O   1 
HETATM 2263 O  O   . HOH L 5 .   ? -12.181 18.570  33.123  1.00   42.06  ? 2099 HOH A O   1 
HETATM 2264 O  O   . HOH L 5 .   ? -16.996 13.378  36.836  1.00   40.25  ? 2100 HOH A O   1 
HETATM 2265 O  O   . HOH L 5 .   ? -16.617 4.254   34.710  1.00   34.45  ? 2101 HOH A O   1 
HETATM 2266 O  O   . HOH L 5 .   ? -14.629 0.604   36.049  1.00   48.08  ? 2102 HOH A O   1 
HETATM 2267 O  O   . HOH L 5 .   ? -10.685 7.305   37.448  1.00   28.13  ? 2103 HOH A O   1 
HETATM 2268 O  O   . HOH L 5 .   ? -3.253  4.632   36.258  1.00   41.82  ? 2104 HOH A O   1 
HETATM 2269 O  O   . HOH L 5 .   ? -5.105  -1.373  37.151  1.00   17.63  ? 2105 HOH A O   1 
HETATM 2270 O  O   . HOH L 5 .   ? -6.512  2.435   36.720  1.00   22.07  ? 2106 HOH A O   1 
HETATM 2271 O  O   . HOH L 5 .   ? -10.406 -2.685  38.424  1.00   46.63  ? 2107 HOH A O   1 
HETATM 2272 O  O   . HOH L 5 .   ? -10.733 3.675   37.714  1.00   25.67  ? 2108 HOH A O   1 
HETATM 2273 O  O   . HOH L 5 .   ? -11.802 -6.471  31.257  1.00   15.76  ? 2109 HOH A O   1 
HETATM 2274 O  O   . HOH L 5 .   ? -11.505 -6.895  37.169  1.00   41.42  ? 2110 HOH A O   1 
HETATM 2275 O  O   . HOH L 5 .   ? -5.120  -9.712  18.832  1.00   20.63  ? 2111 HOH A O   1 
HETATM 2276 O  O   . HOH L 5 .   ? -1.040  -7.967  13.693  1.00   33.23  ? 2112 HOH A O   1 
HETATM 2277 O  O   . HOH L 5 .   ? 1.697   -7.926  20.679  1.00   31.02  ? 2113 HOH A O   1 
HETATM 2278 O  O   . HOH L 5 .   ? -2.378  -11.098 20.369  1.00   39.35  ? 2114 HOH A O   1 
HETATM 2279 O  O   . HOH L 5 .   ? 1.902   -11.913 19.035  1.00   45.92  ? 2115 HOH A O   1 
HETATM 2280 O  O   . HOH L 5 .   ? -4.183  -11.020 16.580  1.00   37.76  ? 2116 HOH A O   1 
HETATM 2281 O  O   . HOH L 5 .   ? -0.200  -3.435  13.588  1.00   27.90  ? 2117 HOH A O   1 
HETATM 2282 O  O   . HOH L 5 .   ? -2.696  -7.243  2.078   1.00   60.46  ? 2118 HOH A O   1 
HETATM 2283 O  O   . HOH L 5 .   ? -9.149  -1.575  11.176  1.00   48.89  ? 2119 HOH A O   1 
HETATM 2284 O  O   . HOH L 5 .   ? -18.093 -8.259  13.336  1.00   27.34  ? 2120 HOH A O   1 
HETATM 2285 O  O   . HOH L 5 .   ? -11.771 6.223   12.415  1.00   36.07  ? 2121 HOH A O   1 
HETATM 2286 O  O   . HOH L 5 .   ? -11.105 4.078   11.491  1.00   32.79  ? 2122 HOH A O   1 
HETATM 2287 O  O   . HOH L 5 .   ? -19.126 7.216   16.452  1.00   19.51  ? 2123 HOH A O   1 
HETATM 2288 O  O   . HOH L 5 .   ? -19.891 -5.112  31.118  1.00   33.56  ? 2124 HOH A O   1 
HETATM 2289 O  O   . HOH L 5 .   ? -22.568 -4.270  30.203  1.00   46.13  ? 2125 HOH A O   1 
HETATM 2290 O  O   . HOH L 5 .   ? -20.645 -11.778 25.968  1.00   38.68  ? 2126 HOH A O   1 
HETATM 2291 O  O   . HOH L 5 .   ? -22.416 -11.089 28.022  1.00   27.78  ? 2127 HOH A O   1 
HETATM 2292 O  O   . HOH L 5 .   ? -17.611 -2.534  34.865  1.00   41.04  ? 2128 HOH A O   1 
HETATM 2293 O  O   . HOH L 5 .   ? -15.183 -3.565  37.841  1.00   43.05  ? 2129 HOH A O   1 
HETATM 2294 O  O   . HOH L 5 .   ? -17.940 -4.508  28.729  1.00   48.18  ? 2130 HOH A O   1 
HETATM 2295 O  O   . HOH L 5 .   ? -13.469 -8.938  31.056  1.00   20.04  ? 2131 HOH A O   1 
HETATM 2296 O  O   . HOH L 5 .   ? -17.355 -12.717 24.894  1.00   38.45  ? 2132 HOH A O   1 
HETATM 2297 O  O   . HOH L 5 .   ? -20.758 -7.474  13.271  1.00   42.93  ? 2133 HOH A O   1 
HETATM 2298 O  O   . HOH L 5 .   ? -22.572 -2.324  8.690   1.00   45.31  ? 2134 HOH A O   1 
HETATM 2299 O  O   . HOH L 5 .   ? -20.595 0.858   7.120   1.00   37.71  ? 2135 HOH A O   1 
HETATM 2300 O  O   . HOH L 5 .   ? -8.347  13.685  13.986  1.00   17.74  ? 2136 HOH A O   1 
HETATM 2301 O  O   . HOH L 5 .   ? -13.644 10.423  11.576  1.00   31.19  ? 2137 HOH A O   1 
HETATM 2302 O  O   . HOH L 5 .   ? -0.602  2.358   3.713   1.00   65.55  ? 2138 HOH A O   1 
HETATM 2303 O  O   . HOH L 5 .   ? -4.190  4.699   4.514   1.00   57.05  ? 2139 HOH A O   1 
HETATM 2304 O  O   . HOH L 5 .   ? -4.667  2.380   6.454   1.00   55.15  ? 2140 HOH A O   1 
HETATM 2305 O  O   . HOH L 5 .   ? 1.334   0.275   7.441   1.00   43.19  ? 2141 HOH A O   1 
HETATM 2306 O  O   . HOH L 5 .   ? 1.468   -4.873  11.492  1.00   50.57  ? 2142 HOH A O   1 
HETATM 2307 O  O   . HOH L 5 .   ? 6.616   2.091   15.438  1.00   54.30  ? 2143 HOH A O   1 
HETATM 2308 O  O   . HOH L 5 .   ? -6.464  3.422   7.984   1.00   52.51  ? 2144 HOH A O   1 
HETATM 2309 O  O   . HOH L 5 .   ? -9.379  0.688   9.880   1.00   57.20  ? 2145 HOH A O   1 
HETATM 2310 O  O   . HOH L 5 .   ? -4.464  0.092   7.392   1.00   51.68  ? 2146 HOH A O   1 
HETATM 2311 O  O   . HOH L 5 .   ? -18.277 13.880  22.376  1.00   28.12  ? 2147 HOH A O   1 
HETATM 2312 O  O   . HOH L 5 .   ? -19.067 9.721   20.780  1.00   26.12  ? 2148 HOH A O   1 
HETATM 2313 O  O   . HOH L 5 .   ? -14.687 10.319  30.689  1.00   15.36  ? 2149 HOH A O   1 
HETATM 2314 O  O   . HOH L 5 .   ? -11.116 15.255  16.858  1.00   23.69  ? 2150 HOH A O   1 
HETATM 2315 O  O   . HOH L 5 .   ? -10.173 21.684  18.658  1.00   26.81  ? 2151 HOH A O   1 
HETATM 2316 O  O   . HOH L 5 .   ? -21.021 21.990  11.661  1.00   43.42  ? 2152 HOH A O   1 
HETATM 2317 O  O   . HOH L 5 .   ? -7.558  23.923  6.239   1.00   33.90  ? 2153 HOH A O   1 
HETATM 2318 O  O   . HOH L 5 .   ? -14.451 25.988  16.686  1.00   55.63  ? 2154 HOH A O   1 
HETATM 2319 O  O   . HOH L 5 .   ? -8.515  25.772  11.758  1.00   37.37  ? 2155 HOH A O   1 
HETATM 2320 O  O   . HOH L 5 .   ? -2.960  24.621  10.624  1.00   41.26  ? 2156 HOH A O   1 
HETATM 2321 O  O   . HOH L 5 .   ? -4.672  21.986  17.096  1.00   18.42  ? 2157 HOH A O   1 
HETATM 2322 O  O   . HOH L 5 .   ? 1.160   19.377  10.234  1.00   44.04  ? 2158 HOH A O   1 
HETATM 2323 O  O   . HOH L 5 .   ? 0.321   23.865  10.644  1.00   45.43  ? 2159 HOH A O   1 
HETATM 2324 O  O   . HOH L 5 .   ? 0.295   18.868  21.090  1.00   24.34  ? 2160 HOH A O   1 
HETATM 2325 O  O   . HOH L 5 .   ? 0.358   16.281  18.266  1.00   22.73  ? 2161 HOH A O   1 
HETATM 2326 O  O   . HOH L 5 .   ? -7.647  20.917  19.446  1.00   20.64  ? 2162 HOH A O   1 
HETATM 2327 O  O   . HOH L 5 .   ? -0.836  26.824  16.962  1.00   39.36  ? 2163 HOH A O   1 
HETATM 2328 O  O   . HOH L 5 .   ? -9.501  17.181  27.596  1.00   19.56  ? 2164 HOH A O   1 
HETATM 2329 O  O   . HOH L 5 .   ? -3.463  14.282  37.280  1.00   31.96  ? 2165 HOH A O   1 
HETATM 2330 O  O   . HOH L 5 .   ? -5.556  21.936  31.485  1.00   15.64  ? 2166 HOH A O   1 
HETATM 2331 O  O   . HOH L 5 .   ? -9.888  18.065  34.876  1.00   15.07  ? 2167 HOH A O   1 
HETATM 2332 O  O   . HOH L 5 .   ? -10.687 15.756  36.466  1.00   18.17  ? 2168 HOH A O   1 
HETATM 2333 O  O   . HOH L 5 .   ? -7.430  7.953   37.459  1.00   28.19  ? 2169 HOH A O   1 
HETATM 2334 O  O   . HOH L 5 .   ? -8.697  10.159  40.243  1.00   34.98  ? 2170 HOH A O   1 
HETATM 2335 O  O   . HOH L 5 .   ? -9.714  16.239  38.880  1.00   37.12  ? 2171 HOH A O   1 
HETATM 2336 O  O   . HOH L 5 .   ? -13.026 14.321  37.688  1.00   47.72  ? 2172 HOH A O   1 
HETATM 2337 O  O   . HOH L 5 .   ? -16.350 9.781   40.171  1.00   55.24  ? 2173 HOH A O   1 
HETATM 2338 O  O   . HOH L 5 .   ? -0.501  10.704  37.432  1.00   25.82  ? 2174 HOH A O   1 
HETATM 2339 O  O   . HOH L 5 .   ? 3.805   11.962  36.808  1.00   37.01  ? 2175 HOH A O   1 
HETATM 2340 O  O   . HOH L 5 .   ? -1.266  16.108  36.398  1.00   44.01  ? 2176 HOH A O   1 
HETATM 2341 O  O   . HOH L 5 .   ? 1.167   16.342  36.617  1.00   36.97  ? 2177 HOH A O   1 
HETATM 2342 O  O   . HOH L 5 .   ? 0.351   15.569  32.288  1.00   19.54  ? 2178 HOH A O   1 
HETATM 2343 O  O   . HOH L 5 .   ? 2.444   5.890   29.358  1.00   18.35  ? 2179 HOH A O   1 
HETATM 2344 O  O   . HOH L 5 .   ? -0.428  5.188   36.778  1.00   40.64  ? 2180 HOH A O   1 
HETATM 2345 O  O   . HOH L 5 .   ? 2.181   9.422   37.908  1.00   65.24  ? 2181 HOH A O   1 
HETATM 2346 O  O   . HOH L 5 .   ? -4.009  14.063  25.920  1.00   43.10  ? 2182 HOH A O   1 
HETATM 2347 O  O   . HOH L 5 .   ? 1.265   13.125  30.752  1.00   15.89  ? 2183 HOH A O   1 
HETATM 2348 O  O   . HOH L 5 .   ? 5.995   12.254  29.054  1.00   22.35  ? 2184 HOH A O   1 
HETATM 2349 O  O   . HOH L 5 .   ? 6.309   12.012  26.294  1.00   44.58  ? 2185 HOH A O   1 
HETATM 2350 O  O   . HOH L 5 .   ? 3.266   11.897  25.161  1.00   28.10  ? 2186 HOH A O   1 
HETATM 2351 O  O   . HOH L 5 .   ? 4.016   4.700   24.070  1.00   54.67  ? 2187 HOH A O   1 
HETATM 2352 O  O   . HOH L 5 .   ? 7.119   4.827   18.286  1.00   54.78  ? 2188 HOH A O   1 
HETATM 2353 O  O   . HOH L 5 .   ? 2.977   13.004  20.740  1.00   26.20  ? 2189 HOH A O   1 
HETATM 2354 O  O   . HOH L 5 .   ? 6.032   15.575  15.827  1.00   44.50  ? 2190 HOH A O   1 
HETATM 2355 O  O   . HOH L 5 .   ? 7.152   14.630  18.811  1.00   40.47  ? 2191 HOH A O   1 
HETATM 2356 O  O   . HOH L 5 .   ? 2.696   15.941  17.237  1.00   24.16  ? 2192 HOH A O   1 
HETATM 2357 O  O   . HOH L 5 .   ? 1.871   15.432  9.920   1.00   35.82  ? 2193 HOH A O   1 
HETATM 2358 O  O   . HOH L 5 .   ? 9.301   16.952  9.338   1.00   46.26  ? 2194 HOH A O   1 
HETATM 2359 O  O   . HOH L 5 .   ? 2.641   11.100  9.303   1.00   43.02  ? 2195 HOH A O   1 
HETATM 2360 O  O   . HOH L 5 .   ? 4.966   11.535  8.441   1.00   43.48  ? 2196 HOH A O   1 
HETATM 2361 O  O   . HOH L 5 .   ? 8.745   4.217   14.446  1.00   43.16  ? 2197 HOH A O   1 
HETATM 2362 O  O   . HOH L 5 .   ? 10.697  14.623  15.056  1.00   32.18  ? 2198 HOH A O   1 
HETATM 2363 O  O   . HOH L 5 .   ? 6.769   -2.572  17.461  1.00   30.15  ? 2199 HOH A O   1 
HETATM 2364 O  O   . HOH L 5 .   ? 3.316   -3.280  14.188  1.00   47.57  ? 2200 HOH A O   1 
HETATM 2365 O  O   . HOH L 5 .   ? 0.601   -5.872  14.653  1.00   42.00  ? 2201 HOH A O   1 
HETATM 2366 O  O   . HOH L 5 .   ? 3.438   -6.165  23.154  1.00   24.13  ? 2202 HOH A O   1 
HETATM 2367 O  O   . HOH L 5 .   ? 3.471   2.188   25.514  1.00   24.52  ? 2203 HOH A O   1 
HETATM 2368 O  O   . HOH L 5 .   ? 6.017   -3.576  30.680  1.00   37.57  ? 2204 HOH A O   1 
HETATM 2369 O  O   . HOH L 5 .   ? 2.755   3.549   32.171  1.00   25.40  ? 2205 HOH A O   1 
HETATM 2370 O  O   . HOH L 5 .   ? 2.844   -3.730  34.558  1.00   26.50  ? 2206 HOH A O   1 
HETATM 2371 O  O   . HOH L 5 .   ? -0.257  -0.740  36.753  1.00   46.10  ? 2207 HOH A O   1 
HETATM 2372 O  O   . HOH L 5 .   ? -2.968  -0.050  35.508  1.00   17.77  ? 2208 HOH A O   1 
HETATM 2373 O  O   . HOH L 5 .   ? -0.691  -7.090  30.450  1.00   10.93  ? 2209 HOH A O   1 
HETATM 2374 O  O   . HOH L 5 .   ? -7.234  -12.399 29.351  1.00   19.02  ? 2210 HOH A O   1 
HETATM 2375 O  O   . HOH L 5 .   ? -7.357  -11.098 36.429  1.00   29.83  ? 2211 HOH A O   1 
HETATM 2376 O  O   . HOH L 5 .   ? -8.054  -14.766 32.082  1.00   19.65  ? 2212 HOH A O   1 
HETATM 2377 O  O   . HOH L 5 .   ? -4.393  -7.914  36.365  1.00   13.71  ? 2213 HOH A O   1 
HETATM 2378 O  O   . HOH L 5 .   ? -11.327 -8.285  34.535  1.00   23.74  ? 2214 HOH A O   1 
HETATM 2379 O  O   . HOH L 5 .   ? -10.147 -10.548 35.859  1.00   34.08  ? 2215 HOH A O   1 
HETATM 2380 O  O   . HOH L 5 .   ? -30.662 -2.492  27.295  1.00   41.78  ? 2216 HOH A O   1 
HETATM 2381 O  O   . HOH L 5 .   ? -19.182 9.503   18.272  1.00   41.01  ? 2217 HOH A O   1 
HETATM 2382 O  O   . HOH L 5 .   ? -15.931 9.539   14.851  1.00   43.26  ? 2218 HOH A O   1 
HETATM 2383 O  O   . HOH L 5 .   ? -18.431 15.708  19.502  1.00   51.29  ? 2219 HOH A O   1 
HETATM 2384 O  O   . HOH L 5 .   ? 3.707   13.776  29.773  1.00   20.11  ? 2220 HOH A O   1 
HETATM 2385 O  O   . HOH L 5 .   ? -16.026 -13.377 33.447  1.00   37.17  ? 2221 HOH A O   1 
HETATM 2386 O  O   . HOH L 5 .   ? 5.904   -9.773  30.770  1.00   29.03  ? 2222 HOH A O   1 
HETATM 2387 O  O   . HOH L 5 .   ? 6.944   -7.413  31.407  1.00   46.68  ? 2223 HOH A O   1 
HETATM 2388 O  O   . HOH L 5 .   ? 3.667   -7.514  25.242  1.00   36.13  ? 2224 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 3   ? 0.7120 0.8117 0.9807 0.0234  -0.1606 -0.2474 3    SER A N   
2    C CA  . SER A 3   ? 0.6639 0.7784 0.9126 0.0168  -0.1425 -0.2269 3    SER A CA  
3    C C   . SER A 3   ? 0.6308 0.7508 0.8942 0.0098  -0.1452 -0.2198 3    SER A C   
4    O O   . SER A 3   ? 0.6998 0.8433 0.9559 0.0142  -0.1535 -0.2321 3    SER A O   
5    C CB  . SER A 3   ? 0.5525 0.6994 0.7676 0.0243  -0.1380 -0.2356 3    SER A CB  
6    O OG  . SER A 3   ? 0.5518 0.6967 0.7549 0.0311  -0.1353 -0.2427 3    SER A OG  
7    N N   . ARG A 4   ? 0.5093 0.6092 0.7934 -0.0005 -0.1385 -0.2005 4    ARG A N   
8    C CA  . ARG A 4   ? 0.3932 0.4995 0.6924 -0.0072 -0.1395 -0.1922 4    ARG A CA  
9    C C   . ARG A 4   ? 0.3269 0.4268 0.6230 -0.0156 -0.1208 -0.1653 4    ARG A C   
10   O O   . ARG A 4   ? 0.3611 0.4433 0.6559 -0.0184 -0.1097 -0.1524 4    ARG A O   
11   C CB  . ARG A 4   ? 0.5948 0.6873 0.9326 -0.0110 -0.1556 -0.2002 4    ARG A CB  
12   C CG  . ARG A 4   ? 0.7691 0.8640 1.1123 -0.0012 -0.1770 -0.2288 4    ARG A CG  
13   C CD  . ARG A 4   ? 0.8855 0.9661 1.2686 -0.0059 -0.1952 -0.2362 4    ARG A CD  
14   N NE  . ARG A 4   ? 0.9868 1.0417 1.3956 -0.0186 -0.1882 -0.2154 4    ARG A NE  
15   C CZ  . ARG A 4   ? 1.0906 1.1210 1.5035 -0.0200 -0.1871 -0.2111 4    ARG A CZ  
16   N NH1 . ARG A 4   ? 1.1356 1.1634 1.5297 -0.0088 -0.1930 -0.2276 4    ARG A NH1 
17   N NH2 . ARG A 4   ? 1.1112 1.1210 1.5465 -0.0326 -0.1801 -0.1901 4    ARG A NH2 
18   N N   . ALA A 5   ? 0.3329 0.4471 0.6269 -0.0184 -0.1182 -0.1578 5    ALA A N   
19   C CA  . ALA A 5   ? 0.3769 0.4875 0.6669 -0.0241 -0.1020 -0.1345 5    ALA A CA  
20   C C   . ALA A 5   ? 0.3439 0.4359 0.6648 -0.0320 -0.0971 -0.1217 5    ALA A C   
21   O O   . ALA A 5   ? 0.3868 0.4703 0.7033 -0.0351 -0.0821 -0.1036 5    ALA A O   
22   C CB  . ALA A 5   ? 0.3748 0.5035 0.6598 -0.0245 -0.1038 -0.1314 5    ALA A CB  
23   N N   . GLU A 6   ? 0.2787 0.3651 0.6312 -0.0354 -0.1104 -0.1310 6    GLU A N   
24   C CA  . GLU A 6   ? 0.2764 0.3480 0.6611 -0.0451 -0.1067 -0.1175 6    GLU A CA  
25   C C   . GLU A 6   ? 0.3331 0.3818 0.7149 -0.0467 -0.0998 -0.1098 6    GLU A C   
26   O O   . GLU A 6   ? 0.3632 0.4000 0.7654 -0.0552 -0.0927 -0.0939 6    GLU A O   
27   C CB  . GLU A 6   ? 0.3859 0.4569 0.8068 -0.0495 -0.1253 -0.1295 6    GLU A CB  
28   C CG  . GLU A 6   ? 0.4992 0.5703 0.9155 -0.0412 -0.1447 -0.1554 6    GLU A CG  
29   C CD  . GLU A 6   ? 0.6352 0.7291 1.0476 -0.0357 -0.1563 -0.1705 6    GLU A CD  
30   O OE1 . GLU A 6   ? 0.7168 0.8273 1.0965 -0.0292 -0.1501 -0.1716 6    GLU A OE1 
31   O OE2 . GLU A 6   ? 0.5273 0.6221 0.9695 -0.0386 -0.1723 -0.1803 6    GLU A OE2 
32   N N   . ASP A 7   ? 0.2594 0.3037 0.6161 -0.0385 -0.1018 -0.1207 7    ASP A N   
33   C CA  . ASP A 7   ? 0.2655 0.2882 0.6147 -0.0383 -0.0951 -0.1139 7    ASP A CA  
34   C C   . ASP A 7   ? 0.2763 0.2975 0.6056 -0.0393 -0.0740 -0.0926 7    ASP A C   
35   O O   . ASP A 7   ? 0.2596 0.2627 0.5831 -0.0398 -0.0666 -0.0834 7    ASP A O   
36   C CB  . ASP A 7   ? 0.3627 0.3846 0.6913 -0.0278 -0.1038 -0.1336 7    ASP A CB  
37   C CG  . ASP A 7   ? 0.4680 0.4892 0.8151 -0.0243 -0.1263 -0.1570 7    ASP A CG  
38   O OD1 . ASP A 7   ? 0.4593 0.4692 0.8391 -0.0319 -0.1359 -0.1555 7    ASP A OD1 
39   O OD2 . ASP A 7   ? 0.4556 0.4886 0.7848 -0.0138 -0.1346 -0.1770 7    ASP A OD2 
40   N N   . TYR A 8   ? 0.2481 0.2872 0.5659 -0.0387 -0.0659 -0.0856 8    TYR A N   
41   C CA  . TYR A 8   ? 0.1783 0.2163 0.4762 -0.0380 -0.0482 -0.0676 8    TYR A CA  
42   C C   . TYR A 8   ? 0.2012 0.2497 0.5134 -0.0426 -0.0408 -0.0537 8    TYR A C   
43   O O   . TYR A 8   ? 0.1632 0.2252 0.4921 -0.0448 -0.0493 -0.0599 8    TYR A O   
44   C CB  . TYR A 8   ? 0.2275 0.2769 0.4903 -0.0306 -0.0456 -0.0724 8    TYR A CB  
45   C CG  . TYR A 8   ? 0.2661 0.3124 0.5131 -0.0247 -0.0520 -0.0875 8    TYR A CG  
46   C CD1 . TYR A 8   ? 0.2367 0.2944 0.4872 -0.0212 -0.0672 -0.1083 8    TYR A CD1 
47   C CD2 . TYR A 8   ? 0.1997 0.2333 0.4282 -0.0214 -0.0436 -0.0823 8    TYR A CD2 
48   C CE1 . TYR A 8   ? 0.2484 0.3071 0.4849 -0.0142 -0.0731 -0.1237 8    TYR A CE1 
49   C CE2 . TYR A 8   ? 0.2188 0.2523 0.4344 -0.0153 -0.0496 -0.0971 8    TYR A CE2 
50   C CZ  . TYR A 8   ? 0.2903 0.3377 0.5100 -0.0115 -0.0641 -0.1179 8    TYR A CZ  
51   O OH  . TYR A 8   ? 0.3057 0.3567 0.5126 -0.0038 -0.0700 -0.1341 8    TYR A OH  
52   N N   . GLU A 9   ? 0.1758 0.2192 0.4800 -0.0428 -0.0255 -0.0363 9    GLU A N   
53   C CA  . GLU A 9   ? 0.2388 0.2946 0.5523 -0.0445 -0.0173 -0.0239 9    GLU A CA  
54   C C   . GLU A 9   ? 0.1296 0.1895 0.4119 -0.0371 -0.0082 -0.0170 9    GLU A C   
55   O O   . GLU A 9   ? 0.1939 0.2417 0.4549 -0.0334 0.0000  -0.0110 9    GLU A O   
56   C CB  . GLU A 9   ? 0.2749 0.3240 0.6111 -0.0512 -0.0075 -0.0084 9    GLU A CB  
57   C CG  . GLU A 9   ? 0.5321 0.5987 0.8820 -0.0522 0.0010  0.0029  9    GLU A CG  
58   C CD  . GLU A 9   ? 0.7031 0.7729 1.0891 -0.0625 0.0049  0.0136  9    GLU A CD  
59   O OE1 . GLU A 9   ? 0.7695 0.8223 1.1634 -0.0685 0.0048  0.0177  9    GLU A OE1 
60   O OE2 . GLU A 9   ? 0.6885 0.7781 1.0952 -0.0648 0.0076  0.0183  9    GLU A OE2 
61   N N   . VAL A 10  ? 0.1560 0.2314 0.4358 -0.0347 -0.0112 -0.0180 10   VAL A N   
62   C CA  . VAL A 10  ? 0.2200 0.2970 0.4720 -0.0281 -0.0054 -0.0110 10   VAL A CA  
63   C C   . VAL A 10  ? 0.2898 0.3639 0.5449 -0.0259 0.0086  0.0044  10   VAL A C   
64   O O   . VAL A 10  ? 0.2441 0.3278 0.5249 -0.0288 0.0118  0.0095  10   VAL A O   
65   C CB  . VAL A 10  ? 0.2779 0.3704 0.5266 -0.0260 -0.0145 -0.0159 10   VAL A CB  
66   C CG1 . VAL A 10  ? 0.2575 0.3486 0.4804 -0.0195 -0.0101 -0.0070 10   VAL A CG1 
67   C CG2 . VAL A 10  ? 0.2781 0.3763 0.5183 -0.0269 -0.0277 -0.0308 10   VAL A CG2 
68   N N   . LEU A 11  ? 0.1700 0.2325 0.3994 -0.0205 0.0167  0.0113  11   LEU A N   
69   C CA  . LEU A 11  ? 0.2494 0.3108 0.4765 -0.0156 0.0290  0.0245  11   LEU A CA  
70   C C   . LEU A 11  ? 0.3761 0.4469 0.5922 -0.0085 0.0265  0.0261  11   LEU A C   
71   O O   . LEU A 11  ? 0.3769 0.4603 0.6089 -0.0060 0.0301  0.0308  11   LEU A O   
72   C CB  . LEU A 11  ? 0.1664 0.2099 0.3715 -0.0118 0.0374  0.0305  11   LEU A CB  
73   C CG  . LEU A 11  ? 0.2747 0.3057 0.4891 -0.0178 0.0387  0.0294  11   LEU A CG  
74   C CD1 . LEU A 11  ? 0.2035 0.2170 0.3974 -0.0131 0.0479  0.0370  11   LEU A CD1 
75   C CD2 . LEU A 11  ? 0.2867 0.3250 0.5348 -0.0253 0.0414  0.0343  11   LEU A CD2 
76   N N   . TYR A 12  ? 0.2353 0.3005 0.4245 -0.0052 0.0195  0.0225  12   TYR A N   
77   C CA  . TYR A 12  ? 0.2415 0.3126 0.4197 0.0004  0.0130  0.0234  12   TYR A CA  
78   C C   . TYR A 12  ? 0.1888 0.2543 0.3399 -0.0003 0.0034  0.0195  12   TYR A C   
79   O O   . TYR A 12  ? 0.1877 0.2457 0.3265 -0.0034 0.0044  0.0167  12   TYR A O   
80   C CB  . TYR A 12  ? 0.2752 0.3421 0.4452 0.0098  0.0210  0.0328  12   TYR A CB  
81   C CG  . TYR A 12  ? 0.2901 0.3400 0.4396 0.0131  0.0293  0.0383  12   TYR A CG  
82   C CD1 . TYR A 12  ? 0.3043 0.3417 0.4248 0.0164  0.0241  0.0389  12   TYR A CD1 
83   C CD2 . TYR A 12  ? 0.3521 0.3985 0.5116 0.0125  0.0416  0.0436  12   TYR A CD2 
84   C CE1 . TYR A 12  ? 0.3389 0.3607 0.4414 0.0199  0.0308  0.0433  12   TYR A CE1 
85   C CE2 . TYR A 12  ? 0.3443 0.3745 0.4842 0.0163  0.0484  0.0483  12   TYR A CE2 
86   C CZ  . TYR A 12  ? 0.3540 0.3721 0.4659 0.0205  0.0429  0.0474  12   TYR A CZ  
87   O OH  . TYR A 12  ? 0.4237 0.4260 0.5176 0.0246  0.0488  0.0513  12   TYR A OH  
88   N N   . THR A 13  ? 0.1742 0.2442 0.3163 0.0024  -0.0061 0.0198  13   THR A N   
89   C CA  . THR A 13  ? 0.1669 0.2337 0.2830 0.0003  -0.0159 0.0188  13   THR A CA  
90   C C   . THR A 13  ? 0.2715 0.3226 0.3629 0.0047  -0.0128 0.0270  13   THR A C   
91   O O   . THR A 13  ? 0.2072 0.2520 0.2981 0.0125  -0.0099 0.0329  13   THR A O   
92   C CB  . THR A 13  ? 0.1959 0.2709 0.3113 0.0015  -0.0288 0.0181  13   THR A CB  
93   O OG1 . THR A 13  ? 0.2185 0.3084 0.3564 -0.0026 -0.0332 0.0093  13   THR A OG1 
94   C CG2 . THR A 13  ? 0.2346 0.3057 0.3210 -0.0017 -0.0394 0.0206  13   THR A CG2 
95   N N   . ILE A 14  ? 0.1543 0.2005 0.2257 0.0004  -0.0142 0.0265  14   ILE A N   
96   C CA  A ILE A 14  ? 0.2538 0.2848 0.3030 0.0039  -0.0129 0.0343  14   ILE A CA  
97   C CA  B ILE A 14  ? 0.2493 0.2805 0.2978 0.0034  -0.0127 0.0339  14   ILE A CA  
98   C C   . ILE A 14  ? 0.3131 0.3420 0.3403 0.0010  -0.0254 0.0390  14   ILE A C   
99   O O   . ILE A 14  ? 0.3509 0.3656 0.3625 0.0049  -0.0281 0.0465  14   ILE A O   
100  C CB  A ILE A 14  ? 0.2662 0.2903 0.3086 0.0024  -0.0043 0.0329  14   ILE A CB  
101  C CB  B ILE A 14  ? 0.2574 0.2854 0.2976 -0.0004 -0.0065 0.0309  14   ILE A CB  
102  C CG1 A ILE A 14  ? 0.2847 0.3208 0.3255 -0.0055 -0.0072 0.0243  14   ILE A CG1 
103  C CG1 B ILE A 14  ? 0.2540 0.2798 0.3130 0.0013  0.0045  0.0273  14   ILE A CG1 
104  C CG2 A ILE A 14  ? 0.2723 0.2923 0.3327 0.0064  0.0076  0.0325  14   ILE A CG2 
105  C CG2 B ILE A 14  ? 0.2623 0.2755 0.2800 0.0022  -0.0063 0.0382  14   ILE A CG2 
106  C CD1 A ILE A 14  ? 0.3012 0.3314 0.3424 -0.0053 0.0014  0.0202  14   ILE A CD1 
107  C CD1 B ILE A 14  ? 0.2868 0.3001 0.3473 0.0093  0.0135  0.0348  14   ILE A CD1 
108  N N   . GLY A 15  ? 0.2491 0.2914 0.2748 -0.0058 -0.0340 0.0353  15   GLY A N   
109  C CA  . GLY A 15  ? 0.2925 0.3336 0.2970 -0.0102 -0.0466 0.0419  15   GLY A CA  
110  C C   . GLY A 15  ? 0.3789 0.4362 0.3874 -0.0149 -0.0561 0.0373  15   GLY A C   
111  O O   . GLY A 15  ? 0.3241 0.3953 0.3479 -0.0166 -0.0527 0.0273  15   GLY A O   
112  N N   . THR A 16  ? 0.3102 0.3641 0.3047 -0.0166 -0.0695 0.0447  16   THR A N   
113  C CA  . THR A 16  ? 0.4523 0.5204 0.4449 -0.0214 -0.0804 0.0420  16   THR A CA  
114  C C   . THR A 16  ? 0.6114 0.6782 0.5759 -0.0299 -0.0914 0.0529  16   THR A C   
115  O O   . THR A 16  ? 0.6223 0.6715 0.5732 -0.0297 -0.0959 0.0638  16   THR A O   
116  C CB  . THR A 16  ? 0.5083 0.5733 0.5153 -0.0140 -0.0883 0.0409  16   THR A CB  
117  O OG1 . THR A 16  ? 0.4589 0.5283 0.4938 -0.0078 -0.0774 0.0324  16   THR A OG1 
118  C CG2 . THR A 16  ? 0.5530 0.6314 0.5564 -0.0184 -0.1014 0.0384  16   THR A CG2 
119  N N   . GLY A 17  ? 0.6933 0.7793 0.6491 -0.0376 -0.0962 0.0503  17   GLY A N   
120  C CA  . GLY A 17  ? 0.7548 0.8441 0.6838 -0.0477 -0.1058 0.0621  17   GLY A CA  
121  C C   . GLY A 17  ? 0.8127 0.9218 0.7346 -0.0527 -0.1153 0.0596  17   GLY A C   
122  O O   . GLY A 17  ? 0.8660 0.9805 0.8042 -0.0468 -0.1182 0.0497  17   GLY A O   
123  N N   . TYR A 19  ? 0.8410 1.0084 0.7419 -0.0664 -0.1065 0.0473  19   TYR A N   
124  C CA  . TYR A 19  ? 0.8380 1.0288 0.7474 -0.0642 -0.0971 0.0301  19   TYR A CA  
125  C C   . TYR A 19  ? 0.7860 0.9747 0.7230 -0.0543 -0.0960 0.0133  19   TYR A C   
126  O O   . TYR A 19  ? 0.7311 0.9403 0.6741 -0.0520 -0.0963 -0.0018 19   TYR A O   
127  C CB  . TYR A 19  ? 0.7604 0.9493 0.6706 -0.0649 -0.0845 0.0294  19   TYR A CB  
128  C CG  . TYR A 19  ? 0.7868 0.9461 0.7125 -0.0585 -0.0786 0.0321  19   TYR A CG  
129  C CD1 . TYR A 19  ? 0.8040 0.9409 0.7197 -0.0608 -0.0821 0.0483  19   TYR A CD1 
130  C CD2 . TYR A 19  ? 0.8331 0.9868 0.7830 -0.0499 -0.0704 0.0186  19   TYR A CD2 
131  C CE1 . TYR A 19  ? 0.7635 0.8756 0.6918 -0.0533 -0.0768 0.0497  19   TYR A CE1 
132  C CE2 . TYR A 19  ? 0.7487 0.8780 0.7111 -0.0441 -0.0642 0.0220  19   TYR A CE2 
133  C CZ  . TYR A 19  ? 0.7071 0.8169 0.6580 -0.0450 -0.0670 0.0369  19   TYR A CZ  
134  O OH  . TYR A 19  ? 0.6060 0.6940 0.5678 -0.0377 -0.0610 0.0392  19   TYR A OH  
135  N N   . GLY A 20  ? 0.7456 0.9107 0.6998 -0.0485 -0.0956 0.0161  20   GLY A N   
136  C CA  . GLY A 20  ? 0.6607 0.8223 0.6445 -0.0406 -0.0927 0.0030  20   GLY A CA  
137  C C   . GLY A 20  ? 0.5969 0.7360 0.5940 -0.0361 -0.0831 0.0078  20   GLY A C   
138  O O   . GLY A 20  ? 0.5079 0.6308 0.4940 -0.0364 -0.0848 0.0210  20   GLY A O   
139  N N   . ARG A 21  ? 0.4324 0.5697 0.4523 -0.0318 -0.0739 -0.0024 21   ARG A N   
140  C CA  . ARG A 21  ? 0.4209 0.5385 0.4507 -0.0275 -0.0643 0.0035  21   ARG A CA  
141  C C   . ARG A 21  ? 0.3374 0.4526 0.3762 -0.0263 -0.0525 -0.0033 21   ARG A C   
142  O O   . ARG A 21  ? 0.2736 0.4010 0.3206 -0.0271 -0.0522 -0.0158 21   ARG A O   
143  C CB  . ARG A 21  ? 0.3561 0.4667 0.4085 -0.0218 -0.0659 0.0038  21   ARG A CB  
144  C CG  . ARG A 21  ? 0.3869 0.5055 0.4682 -0.0202 -0.0631 -0.0084 21   ARG A CG  
145  C CD  . ARG A 21  ? 0.3797 0.4982 0.4828 -0.0160 -0.0671 -0.0079 21   ARG A CD  
146  N NE  . ARG A 21  ? 0.4036 0.5326 0.5352 -0.0167 -0.0678 -0.0197 21   ARG A NE  
147  C CZ  . ARG A 21  ? 0.4365 0.5681 0.5959 -0.0142 -0.0675 -0.0209 21   ARG A CZ  
148  N NH1 . ARG A 21  ? 0.4340 0.5600 0.5959 -0.0091 -0.0657 -0.0122 21   ARG A NH1 
149  N NH2 . ARG A 21  ? 0.5144 0.6550 0.7002 -0.0164 -0.0696 -0.0313 21   ARG A NH2 
150  N N   . CYS A 22  ? 0.2271 0.3253 0.2639 -0.0236 -0.0442 0.0046  22   CYS A N   
151  C CA  A CYS A 22  ? 0.1709 0.2629 0.2134 -0.0220 -0.0336 0.0004  22   CYS A CA  
152  C CA  B CYS A 22  ? 0.1766 0.2691 0.2200 -0.0220 -0.0337 -0.0001 22   CYS A CA  
153  C C   . CYS A 22  ? 0.1980 0.2775 0.2629 -0.0168 -0.0262 0.0022  22   CYS A C   
154  O O   . CYS A 22  ? 0.1915 0.2613 0.2561 -0.0129 -0.0254 0.0112  22   CYS A O   
155  C CB  A CYS A 22  ? 0.2021 0.2852 0.2222 -0.0231 -0.0301 0.0092  22   CYS A CB  
156  C CB  B CYS A 22  ? 0.1884 0.2741 0.2098 -0.0234 -0.0298 0.0069  22   CYS A CB  
157  S SG  A CYS A 22  ? 0.2156 0.2922 0.2374 -0.0210 -0.0192 0.0037  22   CYS A SG  
158  S SG  B CYS A 22  ? 0.1927 0.3007 0.1922 -0.0309 -0.0355 0.0031  22   CYS A SG  
159  N N   . GLN A 23  ? 0.1480 0.2282 0.2320 -0.0166 -0.0214 -0.0062 23   GLN A N   
160  C CA  . GLN A 23  ? 0.1373 0.2087 0.2438 -0.0137 -0.0141 -0.0030 23   GLN A CA  
161  C C   . GLN A 23  ? 0.1496 0.2097 0.2603 -0.0129 -0.0052 -0.0040 23   GLN A C   
162  O O   . GLN A 23  ? 0.1396 0.2022 0.2473 -0.0147 -0.0070 -0.0131 23   GLN A O   
163  C CB  . GLN A 23  ? 0.0824 0.1650 0.2157 -0.0158 -0.0194 -0.0105 23   GLN A CB  
164  C CG  . GLN A 23  ? 0.1214 0.2162 0.2511 -0.0164 -0.0304 -0.0119 23   GLN A CG  
165  C CD  . GLN A 23  ? 0.1626 0.2675 0.3214 -0.0176 -0.0355 -0.0187 23   GLN A CD  
166  O OE1 . GLN A 23  ? 0.2170 0.3286 0.3877 -0.0204 -0.0403 -0.0300 23   GLN A OE1 
167  N NE2 . GLN A 23  ? 0.1404 0.2471 0.3114 -0.0148 -0.0355 -0.0128 23   GLN A NE2 
168  N N   . LYS A 24  ? 0.1751 0.2237 0.2927 -0.0095 0.0041  0.0050  24   LYS A N   
169  C CA  . LYS A 24  ? 0.1472 0.1835 0.2702 -0.0089 0.0123  0.0058  24   LYS A CA  
170  C C   . LYS A 24  ? 0.1551 0.1952 0.3077 -0.0132 0.0113  0.0007  24   LYS A C   
171  O O   . LYS A 24  ? 0.2106 0.2592 0.3822 -0.0145 0.0108  0.0032  24   LYS A O   
172  C CB  . LYS A 24  ? 0.1475 0.1716 0.2637 -0.0031 0.0224  0.0182  24   LYS A CB  
173  C CG  . LYS A 24  ? 0.1944 0.2050 0.3154 -0.0022 0.0315  0.0217  24   LYS A CG  
174  C CD  . LYS A 24  ? 0.2558 0.2561 0.3634 0.0054  0.0405  0.0332  24   LYS A CD  
175  C CE  . LYS A 24  ? 0.3187 0.3049 0.4277 0.0067  0.0496  0.0382  24   LYS A CE  
176  N NZ  . LYS A 24  ? 0.2885 0.2678 0.3863 0.0151  0.0587  0.0490  24   LYS A NZ  
177  N N   . ILE A 25  ? 0.1296 0.1637 0.2876 -0.0154 0.0096  -0.0071 25   ILE A N   
178  C CA  . ILE A 25  ? 0.2203 0.2563 0.4073 -0.0204 0.0050  -0.0134 25   ILE A CA  
179  C C   . ILE A 25  ? 0.1640 0.1826 0.3587 -0.0215 0.0092  -0.0114 25   ILE A C   
180  O O   . ILE A 25  ? 0.1682 0.1748 0.3441 -0.0177 0.0142  -0.0087 25   ILE A O   
181  C CB  . ILE A 25  ? 0.1140 0.1621 0.3042 -0.0220 -0.0085 -0.0302 25   ILE A CB  
182  C CG1 . ILE A 25  ? 0.1610 0.2041 0.3340 -0.0191 -0.0111 -0.0401 25   ILE A CG1 
183  C CG2 . ILE A 25  ? 0.1045 0.1693 0.2840 -0.0213 -0.0138 -0.0315 25   ILE A CG2 
184  C CD1 . ILE A 25  ? 0.1518 0.2099 0.3237 -0.0185 -0.0234 -0.0578 25   ILE A CD1 
185  N N   . ARG A 26  ? 0.1497 0.1661 0.3726 -0.0272 0.0058  -0.0126 26   ARG A N   
186  C CA  . ARG A 26  ? 0.1961 0.1939 0.4284 -0.0297 0.0077  -0.0093 26   ARG A CA  
187  C C   . ARG A 26  ? 0.2477 0.2425 0.5004 -0.0336 -0.0067 -0.0239 26   ARG A C   
188  O O   . ARG A 26  ? 0.2984 0.3030 0.5749 -0.0387 -0.0140 -0.0279 26   ARG A O   
189  C CB  . ARG A 26  ? 0.2253 0.2199 0.4737 -0.0340 0.0190  0.0086  26   ARG A CB  
190  C CG  . ARG A 26  ? 0.2394 0.2135 0.4968 -0.0380 0.0212  0.0156  26   ARG A CG  
191  C CD  . ARG A 26  ? 0.4116 0.3897 0.6976 -0.0469 0.0272  0.0301  26   ARG A CD  
192  N NE  . ARG A 26  ? 0.4406 0.4208 0.7152 -0.0437 0.0437  0.0472  26   ARG A NE  
193  C CZ  . ARG A 26  ? 0.4316 0.4290 0.7215 -0.0465 0.0530  0.0590  26   ARG A CZ  
194  N NH1 . ARG A 26  ? 0.4029 0.4027 0.6790 -0.0412 0.0675  0.0726  26   ARG A NH1 
195  N NH2 . ARG A 26  ? 0.4394 0.4532 0.7584 -0.0537 0.0475  0.0562  26   ARG A NH2 
196  N N   . ARG A 27  ? 0.2362 0.2175 0.4798 -0.0303 -0.0123 -0.0331 27   ARG A N   
197  C CA  . ARG A 27  ? 0.2753 0.2511 0.5364 -0.0318 -0.0278 -0.0488 27   ARG A CA  
198  C C   . ARG A 27  ? 0.3320 0.2922 0.6230 -0.0408 -0.0292 -0.0385 27   ARG A C   
199  O O   . ARG A 27  ? 0.3307 0.2747 0.6193 -0.0429 -0.0200 -0.0236 27   ARG A O   
200  C CB  . ARG A 27  ? 0.2439 0.2106 0.4864 -0.0240 -0.0335 -0.0621 27   ARG A CB  
201  C CG  . ARG A 27  ? 0.3119 0.2770 0.5694 -0.0222 -0.0523 -0.0835 27   ARG A CG  
202  C CD  . ARG A 27  ? 0.3078 0.2731 0.5452 -0.0122 -0.0582 -0.1003 27   ARG A CD  
203  N NE  . ARG A 27  ? 0.3162 0.2604 0.5415 -0.0096 -0.0514 -0.0918 27   ARG A NE  
204  C CZ  . ARG A 27  ? 0.4206 0.3663 0.6254 -0.0009 -0.0523 -0.1022 27   ARG A CZ  
205  N NH1 . ARG A 27  ? 0.4211 0.3909 0.6149 0.0054  -0.0583 -0.1203 27   ARG A NH1 
206  N NH2 . ARG A 27  ? 0.3728 0.2980 0.5675 0.0017  -0.0470 -0.0944 27   ARG A NH2 
207  N N   . LYS A 28  ? 0.2389 0.2052 0.5580 -0.0468 -0.0405 -0.0451 28   LYS A N   
208  C CA  . LYS A 28  ? 0.3208 0.2754 0.6718 -0.0579 -0.0424 -0.0335 28   LYS A CA  
209  C C   . LYS A 28  ? 0.4173 0.3431 0.7737 -0.0599 -0.0498 -0.0331 28   LYS A C   
210  O O   . LYS A 28  ? 0.3818 0.2940 0.7506 -0.0683 -0.0433 -0.0146 28   LYS A O   
211  C CB  . LYS A 28  ? 0.3464 0.3128 0.7279 -0.0637 -0.0560 -0.0430 28   LYS A CB  
212  C CG  . LYS A 28  ? 0.2965 0.2882 0.6838 -0.0658 -0.0478 -0.0362 28   LYS A CG  
213  C CD  . LYS A 28  ? 0.3281 0.3288 0.7508 -0.0731 -0.0619 -0.0437 28   LYS A CD  
214  C CE  . LYS A 28  ? 0.2812 0.3078 0.7078 -0.0730 -0.0561 -0.0404 28   LYS A CE  
215  N NZ  . LYS A 28  ? 0.2234 0.2604 0.6802 -0.0776 -0.0721 -0.0520 28   LYS A NZ  
216  N N   . SER A 29  ? 0.3678 0.2853 0.7147 -0.0519 -0.0638 -0.0534 29   SER A N   
217  C CA  . SER A 29  ? 0.5106 0.3991 0.8660 -0.0527 -0.0760 -0.0569 29   SER A CA  
218  C C   . SER A 29  ? 0.4787 0.3472 0.8180 -0.0529 -0.0634 -0.0389 29   SER A C   
219  O O   . SER A 29  ? 0.5569 0.4012 0.9111 -0.0602 -0.0684 -0.0287 29   SER A O   
220  C CB  . SER A 29  ? 0.3960 0.2835 0.7419 -0.0410 -0.0933 -0.0848 29   SER A CB  
221  O OG  . SER A 29  ? 0.3681 0.2672 0.6801 -0.0302 -0.0836 -0.0901 29   SER A OG  
222  N N   . ASP A 30  ? 0.3844 0.2623 0.6935 -0.0452 -0.0483 -0.0346 30   ASP A N   
223  C CA  . ASP A 30  ? 0.4106 0.2700 0.7004 -0.0428 -0.0377 -0.0208 30   ASP A CA  
224  C C   . ASP A 30  ? 0.3926 0.2653 0.6637 -0.0416 -0.0163 -0.0032 30   ASP A C   
225  O O   . ASP A 30  ? 0.3738 0.2336 0.6270 -0.0386 -0.0063 0.0087  30   ASP A O   
226  C CB  . ASP A 30  ? 0.4810 0.3307 0.7492 -0.0307 -0.0460 -0.0385 30   ASP A CB  
227  C CG  . ASP A 30  ? 0.5287 0.4043 0.7751 -0.0215 -0.0425 -0.0525 30   ASP A CG  
228  O OD1 . ASP A 30  ? 0.3856 0.2839 0.6348 -0.0242 -0.0372 -0.0507 30   ASP A OD1 
229  O OD2 . ASP A 30  ? 0.6286 0.5024 0.8556 -0.0118 -0.0456 -0.0647 30   ASP A OD2 
230  N N   . GLY A 31  ? 0.3564 0.2541 0.6313 -0.0430 -0.0105 -0.0025 31   GLY A N   
231  C CA  . GLY A 31  ? 0.2513 0.1616 0.5105 -0.0408 0.0073  0.0123  31   GLY A CA  
232  C C   . GLY A 31  ? 0.2782 0.1950 0.5048 -0.0300 0.0119  0.0055  31   GLY A C   
233  O O   . GLY A 31  ? 0.2756 0.1980 0.4863 -0.0265 0.0247  0.0168  31   GLY A O   
234  N N   . LYS A 32  ? 0.2533 0.1705 0.4702 -0.0244 0.0009  -0.0133 32   LYS A N   
235  C CA  . LYS A 32  ? 0.2329 0.1564 0.4201 -0.0157 0.0051  -0.0183 32   LYS A CA  
236  C C   . LYS A 32  ? 0.2392 0.1848 0.4180 -0.0152 0.0109  -0.0153 32   LYS A C   
237  O O   . LYS A 32  ? 0.2212 0.1825 0.4133 -0.0187 0.0049  -0.0218 32   LYS A O   
238  C CB  . LYS A 32  ? 0.2655 0.1912 0.4456 -0.0100 -0.0074 -0.0395 32   LYS A CB  
239  C CG  . LYS A 32  ? 0.2834 0.2183 0.4341 -0.0027 -0.0023 -0.0429 32   LYS A CG  
240  C CD  . LYS A 32  ? 0.4622 0.3849 0.6030 0.0042  -0.0081 -0.0539 32   LYS A CD  
241  C CE  . LYS A 32  ? 0.5431 0.4769 0.6576 0.0102  -0.0033 -0.0569 32   LYS A CE  
242  N NZ  . LYS A 32  ? 0.5071 0.4279 0.6057 0.0119  0.0088  -0.0397 32   LYS A NZ  
243  N N   . ILE A 33  ? 0.2390 0.1843 0.3953 -0.0104 0.0211  -0.0062 33   ILE A N   
244  C CA  . ILE A 33  ? 0.2209 0.1832 0.3669 -0.0093 0.0250  -0.0025 33   ILE A CA  
245  C C   . ILE A 33  ? 0.2371 0.2123 0.3651 -0.0063 0.0183  -0.0152 33   ILE A C   
246  O O   . ILE A 33  ? 0.2768 0.2463 0.3882 -0.0020 0.0182  -0.0194 33   ILE A O   
247  C CB  . ILE A 33  ? 0.2853 0.2402 0.4155 -0.0048 0.0371  0.0128  33   ILE A CB  
248  C CG1 . ILE A 33  ? 0.3186 0.2656 0.4652 -0.0077 0.0455  0.0267  33   ILE A CG1 
249  C CG2 . ILE A 33  ? 0.2179 0.1870 0.3364 -0.0025 0.0384  0.0157  33   ILE A CG2 
250  C CD1 . ILE A 33  ? 0.2174 0.1797 0.3905 -0.0144 0.0446  0.0291  33   ILE A CD1 
251  N N   . LEU A 34  ? 0.2146 0.2087 0.3462 -0.0088 0.0127  -0.0207 34   LEU A N   
252  C CA  . LEU A 34  ? 0.2219 0.2320 0.3373 -0.0075 0.0062  -0.0317 34   LEU A CA  
253  C C   . LEU A 34  ? 0.1533 0.1772 0.2615 -0.0093 0.0062  -0.0253 34   LEU A C   
254  O O   . LEU A 34  ? 0.1687 0.1886 0.2836 -0.0098 0.0113  -0.0141 34   LEU A O   
255  C CB  . LEU A 34  ? 0.1618 0.1822 0.2906 -0.0085 -0.0053 -0.0495 34   LEU A CB  
256  C CG  . LEU A 34  ? 0.1491 0.1544 0.2852 -0.0057 -0.0089 -0.0583 34   LEU A CG  
257  C CD1 . LEU A 34  ? 0.2151 0.2244 0.3727 -0.0067 -0.0217 -0.0742 34   LEU A CD1 
258  C CD2 . LEU A 34  ? 0.2033 0.2112 0.3173 -0.0002 -0.0082 -0.0649 34   LEU A CD2 
259  N N   . VAL A 35  ? 0.1154 0.1565 0.2099 -0.0101 0.0001  -0.0324 35   VAL A N   
260  C CA  . VAL A 35  ? 0.0817 0.1354 0.1727 -0.0127 -0.0033 -0.0279 35   VAL A CA  
261  C C   . VAL A 35  ? 0.1480 0.2225 0.2404 -0.0148 -0.0135 -0.0417 35   VAL A C   
262  O O   . VAL A 35  ? 0.2008 0.2817 0.2923 -0.0132 -0.0171 -0.0548 35   VAL A O   
263  C CB  . VAL A 35  ? 0.2227 0.2754 0.2891 -0.0122 -0.0007 -0.0166 35   VAL A CB  
264  C CG1 . VAL A 35  ? 0.1879 0.2202 0.2504 -0.0081 0.0085  -0.0053 35   VAL A CG1 
265  C CG2 . VAL A 35  ? 0.2409 0.3058 0.2882 -0.0137 -0.0038 -0.0226 35   VAL A CG2 
266  N N   . TRP A 36  ? 0.1047 0.1905 0.1994 -0.0172 -0.0189 -0.0401 36   TRP A N   
267  C CA  . TRP A 36  ? 0.1694 0.2771 0.2584 -0.0186 -0.0286 -0.0519 36   TRP A CA  
268  C C   . TRP A 36  ? 0.1767 0.2949 0.2482 -0.0215 -0.0323 -0.0433 36   TRP A C   
269  O O   . TRP A 36  ? 0.1691 0.2772 0.2414 -0.0217 -0.0302 -0.0310 36   TRP A O   
270  C CB  . TRP A 36  ? 0.1323 0.2460 0.2455 -0.0182 -0.0368 -0.0657 36   TRP A CB  
271  C CG  . TRP A 36  ? 0.1464 0.2577 0.2808 -0.0200 -0.0396 -0.0612 36   TRP A CG  
272  C CD1 . TRP A 36  ? 0.1333 0.2442 0.2643 -0.0211 -0.0383 -0.0489 36   TRP A CD1 
273  C CD2 . TRP A 36  ? 0.1504 0.2607 0.3141 -0.0208 -0.0457 -0.0704 36   TRP A CD2 
274  N NE1 . TRP A 36  ? 0.1615 0.2733 0.3186 -0.0221 -0.0419 -0.0501 36   TRP A NE1 
275  C CE2 . TRP A 36  ? 0.1418 0.2530 0.3198 -0.0228 -0.0461 -0.0623 36   TRP A CE2 
276  C CE3 . TRP A 36  ? 0.1993 0.3067 0.3799 -0.0199 -0.0518 -0.0846 36   TRP A CE3 
277  C CZ2 . TRP A 36  ? 0.1522 0.2643 0.3618 -0.0251 -0.0520 -0.0677 36   TRP A CZ2 
278  C CZ3 . TRP A 36  ? 0.2376 0.3424 0.4489 -0.0224 -0.0585 -0.0892 36   TRP A CZ3 
279  C CH2 . TRP A 36  ? 0.2128 0.3210 0.4388 -0.0256 -0.0580 -0.0803 36   TRP A CH2 
280  N N   . LYS A 37  ? 0.1692 0.3080 0.2239 -0.0233 -0.0380 -0.0496 37   LYS A N   
281  C CA  . LYS A 37  ? 0.1834 0.3347 0.2215 -0.0273 -0.0443 -0.0425 37   LYS A CA  
282  C C   . LYS A 37  ? 0.2693 0.4352 0.3189 -0.0266 -0.0543 -0.0538 37   LYS A C   
283  O O   . LYS A 37  ? 0.2593 0.4394 0.3140 -0.0242 -0.0584 -0.0700 37   LYS A O   
284  C CB  . LYS A 37  ? 0.2515 0.4203 0.2634 -0.0310 -0.0444 -0.0411 37   LYS A CB  
285  C CG  . LYS A 37  ? 0.5027 0.6577 0.5014 -0.0329 -0.0370 -0.0279 37   LYS A CG  
286  C CD  . LYS A 37  ? 0.7036 0.8764 0.6765 -0.0398 -0.0390 -0.0208 37   LYS A CD  
287  C CE  . LYS A 37  ? 0.7218 0.9205 0.6892 -0.0393 -0.0372 -0.0347 37   LYS A CE  
288  N NZ  . LYS A 37  ? 0.7447 0.9607 0.6887 -0.0471 -0.0364 -0.0250 37   LYS A NZ  
289  N N   . GLU A 38  ? 0.2009 0.3627 0.2548 -0.0276 -0.0592 -0.0462 38   GLU A N   
290  C CA  . GLU A 38  ? 0.2822 0.4552 0.3492 -0.0265 -0.0696 -0.0556 38   GLU A CA  
291  C C   . GLU A 38  ? 0.3178 0.5080 0.3602 -0.0297 -0.0782 -0.0521 38   GLU A C   
292  O O   . GLU A 38  ? 0.3653 0.5485 0.3927 -0.0327 -0.0794 -0.0370 38   GLU A O   
293  C CB  . GLU A 38  ? 0.3622 0.5211 0.4513 -0.0252 -0.0697 -0.0492 38   GLU A CB  
294  C CG  . GLU A 38  ? 0.5365 0.7043 0.6484 -0.0238 -0.0794 -0.0609 38   GLU A CG  
295  C CD  . GLU A 38  ? 0.6059 0.7649 0.7382 -0.0227 -0.0798 -0.0535 38   GLU A CD  
296  O OE1 . GLU A 38  ? 0.6582 0.8098 0.7776 -0.0223 -0.0782 -0.0403 38   GLU A OE1 
297  O OE2 . GLU A 38  ? 0.6559 0.8160 0.8176 -0.0222 -0.0823 -0.0612 38   GLU A OE2 
298  N N   . LEU A 39  ? 0.2886 0.5010 0.3256 -0.0288 -0.0852 -0.0659 39   LEU A N   
299  C CA  . LEU A 39  ? 0.2750 0.5071 0.2858 -0.0324 -0.0929 -0.0620 39   LEU A CA  
300  C C   . LEU A 39  ? 0.2740 0.5200 0.2928 -0.0291 -0.1056 -0.0747 39   LEU A C   
301  O O   . LEU A 39  ? 0.2258 0.4806 0.2600 -0.0240 -0.1087 -0.0931 39   LEU A O   
302  C CB  . LEU A 39  ? 0.3622 0.6155 0.3512 -0.0344 -0.0886 -0.0657 39   LEU A CB  
303  C CG  . LEU A 39  ? 0.4580 0.6991 0.4449 -0.0358 -0.0765 -0.0591 39   LEU A CG  
304  C CD1 . LEU A 39  ? 0.4793 0.7450 0.4532 -0.0353 -0.0728 -0.0693 39   LEU A CD1 
305  C CD2 . LEU A 39  ? 0.4846 0.7100 0.4562 -0.0422 -0.0738 -0.0367 39   LEU A CD2 
306  N N   . ASP A 40  ? 0.3480 0.5944 0.3571 -0.0313 -0.1143 -0.0653 40   ASP A N   
307  C CA  . ASP A 40  ? 0.4150 0.6750 0.4291 -0.0279 -0.1277 -0.0767 40   ASP A CA  
308  C C   . ASP A 40  ? 0.4256 0.7139 0.4092 -0.0297 -0.1327 -0.0796 40   ASP A C   
309  O O   . ASP A 40  ? 0.4571 0.7493 0.4134 -0.0363 -0.1333 -0.0634 40   ASP A O   
310  C CB  . ASP A 40  ? 0.3816 0.6283 0.4004 -0.0284 -0.1359 -0.0658 40   ASP A CB  
311  C CG  . ASP A 40  ? 0.5403 0.7993 0.5666 -0.0243 -0.1507 -0.0779 40   ASP A CG  
312  O OD1 . ASP A 40  ? 0.5219 0.8027 0.5394 -0.0219 -0.1562 -0.0918 40   ASP A OD1 
313  O OD2 . ASP A 40  ? 0.5755 0.8233 0.6167 -0.0225 -0.1575 -0.0742 40   ASP A OD2 
314  N N   . TYR A 41  ? 0.3991 0.7077 0.3869 -0.0240 -0.1367 -0.1002 41   TYR A N   
315  C CA  . TYR A 41  ? 0.4510 0.7919 0.4095 -0.0243 -0.1401 -0.1049 41   TYR A CA  
316  C C   . TYR A 41  ? 0.4451 0.8011 0.3975 -0.0206 -0.1554 -0.1129 41   TYR A C   
317  O O   . TYR A 41  ? 0.5085 0.8945 0.4390 -0.0186 -0.1597 -0.1208 41   TYR A O   
318  C CB  . TYR A 41  ? 0.5145 0.8730 0.4767 -0.0184 -0.1349 -0.1242 41   TYR A CB  
319  C CG  . TYR A 41  ? 0.4985 0.8527 0.4911 -0.0087 -0.1425 -0.1479 41   TYR A CG  
320  C CD1 . TYR A 41  ? 0.5012 0.8745 0.4931 -0.0018 -0.1564 -0.1652 41   TYR A CD1 
321  C CD2 . TYR A 41  ? 0.4768 0.8070 0.4987 -0.0068 -0.1370 -0.1525 41   TYR A CD2 
322  C CE1 . TYR A 41  ? 0.5454 0.9129 0.5668 0.0066  -0.1655 -0.1869 41   TYR A CE1 
323  C CE2 . TYR A 41  ? 0.4136 0.7379 0.4646 0.0003  -0.1456 -0.1725 41   TYR A CE2 
324  C CZ  . TYR A 41  ? 0.5355 0.8781 0.5870 0.0070  -0.1603 -0.1900 41   TYR A CZ  
325  O OH  . TYR A 41  ? 0.5704 0.9056 0.6523 0.0137  -0.1710 -0.2102 41   TYR A OH  
326  N N   . GLY A 42  ? 0.4638 0.8009 0.4356 -0.0191 -0.1636 -0.1113 42   GLY A N   
327  C CA  . GLY A 42  ? 0.4603 0.8087 0.4296 -0.0148 -0.1794 -0.1196 42   GLY A CA  
328  C C   . GLY A 42  ? 0.4967 0.8625 0.4275 -0.0195 -0.1861 -0.1067 42   GLY A C   
329  O O   . GLY A 42  ? 0.4859 0.8719 0.4058 -0.0146 -0.1979 -0.1176 42   GLY A O   
330  N N   . SER A 43  ? 0.3798 0.7374 0.2895 -0.0291 -0.1796 -0.0831 43   SER A N   
331  C CA  . SER A 43  ? 0.5543 0.9257 0.4267 -0.0361 -0.1863 -0.0666 43   SER A CA  
332  C C   . SER A 43  ? 0.5654 0.9688 0.4088 -0.0410 -0.1782 -0.0646 43   SER A C   
333  O O   . SER A 43  ? 0.6396 1.0575 0.4503 -0.0493 -0.1816 -0.0482 43   SER A O   
334  C CB  . SER A 43  ? 0.6967 1.0398 0.5620 -0.0445 -0.1875 -0.0409 43   SER A CB  
335  O OG  . SER A 43  ? 0.7638 1.0829 0.6532 -0.0391 -0.1966 -0.0429 43   SER A OG  
336  N N   . MET A 44  ? 0.4579 0.8731 0.3136 -0.0361 -0.1679 -0.0809 44   MET A N   
337  C CA  . MET A 44  ? 0.3709 0.8188 0.2036 -0.0394 -0.1586 -0.0813 44   MET A CA  
338  C C   . MET A 44  ? 0.4935 0.9819 0.3107 -0.0317 -0.1652 -0.1002 44   MET A C   
339  O O   . MET A 44  ? 0.4512 0.9407 0.2856 -0.0200 -0.1746 -0.1224 44   MET A O   
340  C CB  . MET A 44  ? 0.3415 0.7827 0.1943 -0.0366 -0.1453 -0.0905 44   MET A CB  
341  C CG  . MET A 44  ? 0.4079 0.8173 0.2670 -0.0453 -0.1365 -0.0697 44   MET A CG  
342  S SD  . MET A 44  ? 0.5491 0.9480 0.4319 -0.0409 -0.1220 -0.0808 44   MET A SD  
343  C CE  . MET A 44  ? 0.6361 0.9946 0.5233 -0.0500 -0.1161 -0.0546 44   MET A CE  
344  N N   . THR A 45  ? 0.5176 1.0407 0.3025 -0.0380 -0.1604 -0.0916 45   THR A N   
345  C CA  . THR A 45  ? 0.5885 1.1560 0.3553 -0.0298 -0.1650 -0.1098 45   THR A CA  
346  C C   . THR A 45  ? 0.5031 1.0891 0.2852 -0.0190 -0.1570 -0.1354 45   THR A C   
347  O O   . THR A 45  ? 0.4662 1.0315 0.2682 -0.0205 -0.1472 -0.1346 45   THR A O   
348  C CB  . THR A 45  ? 0.6728 1.2750 0.3988 -0.0415 -0.1621 -0.0894 45   THR A CB  
349  O OG1 . THR A 45  ? 0.6720 1.2805 0.3935 -0.0517 -0.1468 -0.0759 45   THR A OG1 
350  C CG2 . THR A 45  ? 0.6589 1.2396 0.3685 -0.0523 -0.1725 -0.0631 45   THR A CG2 
351  N N   . GLU A 46  ? 0.4939 1.1183 0.2663 -0.0072 -0.1622 -0.1588 46   GLU A N   
352  C CA  . GLU A 46  ? 0.5152 1.1583 0.3011 0.0047  -0.1567 -0.1851 46   GLU A CA  
353  C C   . GLU A 46  ? 0.5507 1.2117 0.3245 -0.0046 -0.1398 -0.1718 46   GLU A C   
354  O O   . GLU A 46  ? 0.4957 1.1442 0.2903 -0.0011 -0.1323 -0.1807 46   GLU A O   
355  C CB  . GLU A 46  ? 0.5404 1.2250 0.3148 0.0205  -0.1667 -0.2133 46   GLU A CB  
356  C CG  . GLU A 46  ? 0.6097 1.2749 0.3991 0.0301  -0.1850 -0.2279 46   GLU A CG  
357  C CD  . GLU A 46  ? 0.7625 1.4626 0.5480 0.0491  -0.1969 -0.2620 46   GLU A CD  
358  O OE1 . GLU A 46  ? 0.8840 1.6253 0.6548 0.0560  -0.1906 -0.2754 46   GLU A OE1 
359  O OE2 . GLU A 46  ? 0.7398 1.4269 0.5378 0.0579  -0.2133 -0.2763 46   GLU A OE2 
360  N N   . ALA A 47  ? 0.5945 1.2824 0.3352 -0.0175 -0.1349 -0.1489 47   ALA A N   
361  C CA  . ALA A 47  ? 0.6816 1.3905 0.4096 -0.0287 -0.1196 -0.1334 47   ALA A CA  
362  C C   . ALA A 47  ? 0.6871 1.3505 0.4362 -0.0373 -0.1118 -0.1180 47   ALA A C   
363  O O   . ALA A 47  ? 0.7782 1.4456 0.5387 -0.0354 -0.1016 -0.1249 47   ALA A O   
364  C CB  . ALA A 47  ? 0.7062 1.4443 0.3970 -0.0444 -0.1181 -0.1062 47   ALA A CB  
365  N N   . GLU A 48  ? 0.6473 1.2684 0.4014 -0.0457 -0.1174 -0.0980 48   GLU A N   
366  C CA  . GLU A 48  ? 0.5942 1.1713 0.3675 -0.0524 -0.1112 -0.0839 48   GLU A CA  
367  C C   . GLU A 48  ? 0.5732 1.1267 0.3808 -0.0392 -0.1097 -0.1071 48   GLU A C   
368  O O   . GLU A 48  ? 0.5663 1.1018 0.3871 -0.0413 -0.1003 -0.1036 48   GLU A O   
369  C CB  . GLU A 48  ? 0.6452 1.1837 0.4176 -0.0610 -0.1196 -0.0614 48   GLU A CB  
370  C CG  . GLU A 48  ? 0.7415 1.2957 0.4803 -0.0758 -0.1232 -0.0348 48   GLU A CG  
371  C CD  . GLU A 48  ? 0.8871 1.4003 0.6265 -0.0821 -0.1339 -0.0149 48   GLU A CD  
372  O OE1 . GLU A 48  ? 0.9434 1.4167 0.7089 -0.0780 -0.1340 -0.0168 48   GLU A OE1 
373  O OE2 . GLU A 48  ? 0.9625 1.4842 0.6760 -0.0908 -0.1426 0.0025  48   GLU A OE2 
374  N N   . LYS A 49  ? 0.5434 1.0953 0.3657 -0.0260 -0.1199 -0.1302 49   LYS A N   
375  C CA  . LYS A 49  ? 0.4588 0.9889 0.3140 -0.0144 -0.1203 -0.1520 49   LYS A CA  
376  C C   . LYS A 49  ? 0.4917 1.0495 0.3466 -0.0073 -0.1124 -0.1694 49   LYS A C   
377  O O   . LYS A 49  ? 0.4498 0.9864 0.3271 -0.0028 -0.1079 -0.1778 49   LYS A O   
378  C CB  . LYS A 49  ? 0.5220 1.0453 0.3940 -0.0027 -0.1350 -0.1729 49   LYS A CB  
379  C CG  . LYS A 49  ? 0.4697 0.9522 0.3593 -0.0070 -0.1415 -0.1604 49   LYS A CG  
380  C CD  . LYS A 49  ? 0.3985 0.8738 0.3110 0.0046  -0.1562 -0.1831 49   LYS A CD  
381  C CE  . LYS A 49  ? 0.3847 0.8931 0.2753 0.0100  -0.1680 -0.1931 49   LYS A CE  
382  N NZ  . LYS A 49  ? 0.4424 0.9376 0.3554 0.0186  -0.1844 -0.2093 49   LYS A NZ  
383  N N   . GLN A 50  ? 0.5893 1.1959 0.4183 -0.0064 -0.1108 -0.1741 50   GLN A N   
384  C CA  . GLN A 50  ? 0.6981 1.3390 0.5252 0.0016  -0.1039 -0.1924 50   GLN A CA  
385  C C   . GLN A 50  ? 0.7446 1.3813 0.5695 -0.0094 -0.0893 -0.1743 50   GLN A C   
386  O O   . GLN A 50  ? 0.6962 1.3328 0.5354 -0.0021 -0.0841 -0.1885 50   GLN A O   
387  C CB  . GLN A 50  ? 0.7997 1.4996 0.5987 0.0060  -0.1057 -0.2022 50   GLN A CB  
388  C CG  . GLN A 50  ? 0.9084 1.6508 0.7042 0.0151  -0.0982 -0.2217 50   GLN A CG  
389  C CD  . GLN A 50  ? 0.9519 1.6775 0.7771 0.0334  -0.1045 -0.2536 50   GLN A CD  
390  O OE1 . GLN A 50  ? 0.9521 1.6771 0.7867 0.0477  -0.1181 -0.2778 50   GLN A OE1 
391  N NE2 . GLN A 50  ? 0.9395 1.6506 0.7795 0.0329  -0.0958 -0.2538 50   GLN A NE2 
392  N N   . MET A 51  ? 0.7820 1.4143 0.5892 -0.0266 -0.0844 -0.1433 51   MET A N   
393  C CA  . MET A 51  ? 0.7407 1.3636 0.5463 -0.0386 -0.0726 -0.1233 51   MET A CA  
394  C C   . MET A 51  ? 0.6862 1.2549 0.5190 -0.0369 -0.0712 -0.1212 51   MET A C   
395  O O   . MET A 51  ? 0.6940 1.2516 0.5314 -0.0420 -0.0622 -0.1122 51   MET A O   
396  C CB  . MET A 51  ? 0.7952 1.4216 0.5761 -0.0577 -0.0713 -0.0901 51   MET A CB  
397  C CG  . MET A 51  ? 0.8716 1.5560 0.6227 -0.0638 -0.0687 -0.0855 51   MET A CG  
398  S SD  . MET A 51  ? 1.6986 2.4209 1.4411 -0.0738 -0.0534 -0.0766 51   MET A SD  
399  C CE  . MET A 51  ? 0.7594 1.4958 0.5255 -0.0516 -0.0497 -0.1161 51   MET A CE  
400  N N   . LEU A 52  ? 0.6053 1.1419 0.4563 -0.0301 -0.0801 -0.1290 52   LEU A N   
401  C CA  . LEU A 52  ? 0.5413 1.0297 0.4185 -0.0281 -0.0785 -0.1272 52   LEU A CA  
402  C C   . LEU A 52  ? 0.4960 0.9839 0.3937 -0.0146 -0.0776 -0.1533 52   LEU A C   
403  O O   . LEU A 52  ? 0.5687 1.0300 0.4813 -0.0142 -0.0715 -0.1510 52   LEU A O   
404  C CB  . LEU A 52  ? 0.5327 0.9903 0.4228 -0.0271 -0.0883 -0.1244 52   LEU A CB  
405  C CG  . LEU A 52  ? 0.4963 0.9069 0.4130 -0.0262 -0.0861 -0.1200 52   LEU A CG  
406  C CD1 . LEU A 52  ? 0.4698 0.8612 0.3786 -0.0371 -0.0770 -0.0950 52   LEU A CD1 
407  C CD2 . LEU A 52  ? 0.5259 0.9144 0.4574 -0.0243 -0.0960 -0.1200 52   LEU A CD2 
408  N N   . VAL A 53  ? 0.4825 0.9994 0.3803 -0.0028 -0.0850 -0.1784 53   VAL A N   
409  C CA  . VAL A 53  ? 0.5438 1.0634 0.4596 0.0116  -0.0874 -0.2060 53   VAL A CA  
410  C C   . VAL A 53  ? 0.5308 1.0698 0.4396 0.0112  -0.0764 -0.2066 53   VAL A C   
411  O O   . VAL A 53  ? 0.5728 1.0889 0.4992 0.0162  -0.0739 -0.2135 53   VAL A O   
412  C CB  . VAL A 53  ? 0.5444 1.0968 0.4576 0.0255  -0.0993 -0.2340 53   VAL A CB  
413  C CG1 . VAL A 53  ? 0.5377 1.0987 0.4655 0.0411  -0.1027 -0.2632 53   VAL A CG1 
414  C CG2 . VAL A 53  ? 0.5156 1.0439 0.4428 0.0279  -0.1121 -0.2377 53   VAL A CG2 
415  N N   . SER A 54  ? 0.5349 1.1169 0.4183 0.0047  -0.0702 -0.1984 54   SER A N   
416  C CA  . SER A 54  ? 0.5758 1.1842 0.4523 0.0037  -0.0599 -0.1992 54   SER A CA  
417  C C   . SER A 54  ? 0.5722 1.1432 0.4558 -0.0070 -0.0511 -0.1771 54   SER A C   
418  O O   . SER A 54  ? 0.5916 1.1551 0.4868 -0.0015 -0.0467 -0.1856 54   SER A O   
419  C CB  . SER A 54  ? 0.6190 1.2822 0.4667 -0.0044 -0.0548 -0.1902 54   SER A CB  
420  O OG  . SER A 54  ? 0.6297 1.2805 0.4622 -0.0224 -0.0524 -0.1582 54   SER A OG  
421  N N   . GLU A 55  ? 0.4970 1.0448 0.3729 -0.0211 -0.0497 -0.1496 55   GLU A N   
422  C CA  . GLU A 55  ? 0.5333 1.0392 0.4167 -0.0296 -0.0440 -0.1291 55   GLU A CA  
423  C C   . GLU A 55  ? 0.4980 0.9657 0.4075 -0.0189 -0.0449 -0.1424 55   GLU A C   
424  O O   . GLU A 55  ? 0.5183 0.9749 0.4336 -0.0185 -0.0383 -0.1410 55   GLU A O   
425  C CB  . GLU A 55  ? 0.6798 1.1586 0.5571 -0.0407 -0.0476 -0.1050 55   GLU A CB  
426  C CG  . GLU A 55  ? 0.8245 1.3019 0.6848 -0.0569 -0.0423 -0.0764 55   GLU A CG  
427  C CD  . GLU A 55  ? 0.9408 1.4118 0.7864 -0.0672 -0.0493 -0.0563 55   GLU A CD  
428  O OE1 . GLU A 55  ? 0.9648 1.3991 0.8214 -0.0651 -0.0549 -0.0522 55   GLU A OE1 
429  O OE2 . GLU A 55  ? 0.9512 1.4548 0.7742 -0.0774 -0.0494 -0.0444 55   GLU A OE2 
430  N N   . VAL A 56  ? 0.4340 0.8815 0.3594 -0.0110 -0.0535 -0.1544 56   VAL A N   
431  C CA  . VAL A 56  ? 0.4167 0.8266 0.3676 -0.0027 -0.0554 -0.1646 56   VAL A CA  
432  C C   . VAL A 56  ? 0.4417 0.8659 0.3995 0.0088  -0.0551 -0.1872 56   VAL A C   
433  O O   . VAL A 56  ? 0.3664 0.7623 0.3379 0.0120  -0.0522 -0.1883 56   VAL A O   
434  C CB  . VAL A 56  ? 0.5065 0.8983 0.4748 0.0030  -0.0662 -0.1749 56   VAL A CB  
435  C CG1 . VAL A 56  ? 0.5111 0.8705 0.5058 0.0115  -0.0693 -0.1877 56   VAL A CG1 
436  C CG2 . VAL A 56  ? 0.4418 0.8123 0.4081 -0.0070 -0.0666 -0.1527 56   VAL A CG2 
437  N N   . ASN A 57  ? 0.4435 0.9127 0.3908 0.0155  -0.0584 -0.2053 57   ASN A N   
438  C CA  . ASN A 57  ? 0.5683 1.0600 0.5194 0.0277  -0.0586 -0.2285 57   ASN A CA  
439  C C   . ASN A 57  ? 0.5619 1.0600 0.5058 0.0220  -0.0471 -0.2174 57   ASN A C   
440  O O   . ASN A 57  ? 0.5865 1.0795 0.5410 0.0313  -0.0472 -0.2316 57   ASN A O   
441  C CB  . ASN A 57  ? 0.6267 1.1720 0.5653 0.0363  -0.0639 -0.2496 57   ASN A CB  
442  C CG  . ASN A 57  ? 0.7167 1.2557 0.6677 0.0481  -0.0786 -0.2711 57   ASN A CG  
443  O OD1 . ASN A 57  ? 0.7912 1.2864 0.7610 0.0478  -0.0846 -0.2684 57   ASN A OD1 
444  N ND2 . ASN A 57  ? 0.7624 1.3466 0.7032 0.0586  -0.0849 -0.2930 57   ASN A ND2 
445  N N   . LEU A 58  ? 0.5819 1.0911 0.5082 0.0069  -0.0387 -0.1922 58   LEU A N   
446  C CA  . LEU A 58  ? 0.6107 1.1226 0.5310 -0.0008 -0.0286 -0.1783 58   LEU A CA  
447  C C   . LEU A 58  ? 0.5744 1.0322 0.5081 -0.0027 -0.0261 -0.1659 58   LEU A C   
448  O O   . LEU A 58  ? 0.6371 1.0895 0.5743 -0.0011 -0.0211 -0.1664 58   LEU A O   
449  C CB  . LEU A 58  ? 0.6563 1.1932 0.5547 -0.0177 -0.0227 -0.1535 58   LEU A CB  
450  C CG  . LEU A 58  ? 0.7720 1.3700 0.6539 -0.0172 -0.0226 -0.1632 58   LEU A CG  
451  C CD1 . LEU A 58  ? 0.8271 1.4479 0.6877 -0.0364 -0.0165 -0.1353 58   LEU A CD1 
452  C CD2 . LEU A 58  ? 0.8037 1.4365 0.6914 -0.0042 -0.0205 -0.1888 58   LEU A CD2 
453  N N   . LEU A 59  ? 0.5180 0.9378 0.4589 -0.0057 -0.0295 -0.1552 59   LEU A N   
454  C CA  . LEU A 59  ? 0.5069 0.8774 0.4602 -0.0065 -0.0270 -0.1441 59   LEU A CA  
455  C C   . LEU A 59  ? 0.4995 0.8521 0.4715 0.0069  -0.0304 -0.1645 59   LEU A C   
456  O O   . LEU A 59  ? 0.6567 0.9806 0.6351 0.0081  -0.0265 -0.1590 59   LEU A O   
457  C CB  . LEU A 59  ? 0.5850 0.9264 0.5434 -0.0113 -0.0305 -0.1311 59   LEU A CB  
458  C CG  . LEU A 59  ? 0.6887 0.9816 0.6614 -0.0112 -0.0285 -0.1203 59   LEU A CG  
459  C CD1 . LEU A 59  ? 0.6675 0.9444 0.6317 -0.0174 -0.0204 -0.1017 59   LEU A CD1 
460  C CD2 . LEU A 59  ? 0.6960 0.9732 0.6731 -0.0154 -0.0327 -0.1104 59   LEU A CD2 
461  N N   . ARG A 60  ? 0.5362 0.9051 0.5161 0.0175  -0.0391 -0.1884 60   ARG A N   
462  C CA  . ARG A 60  ? 0.7038 1.0516 0.7029 0.0303  -0.0460 -0.2082 60   ARG A CA  
463  C C   . ARG A 60  ? 0.6932 1.0607 0.6909 0.0393  -0.0449 -0.2243 60   ARG A C   
464  O O   . ARG A 60  ? 0.7341 1.0781 0.7460 0.0490  -0.0501 -0.2369 60   ARG A O   
465  C CB  . ARG A 60  ? 0.8289 1.1828 0.8390 0.0386  -0.0587 -0.2283 60   ARG A CB  
466  C CG  . ARG A 60  ? 0.9523 1.2758 0.9853 0.0497  -0.0689 -0.2458 60   ARG A CG  
467  C CD  . ARG A 60  ? 1.0749 1.4122 1.1171 0.0589  -0.0835 -0.2689 60   ARG A CD  
468  N NE  . ARG A 60  ? 1.1322 1.5225 1.1578 0.0649  -0.0846 -0.2848 60   ARG A NE  
469  C CZ  . ARG A 60  ? 1.1569 1.5707 1.1848 0.0754  -0.0970 -0.3083 60   ARG A CZ  
470  N NH1 . ARG A 60  ? 1.1635 1.5501 1.2115 0.0803  -0.1106 -0.3188 60   ARG A NH1 
471  N NH2 . ARG A 60  ? 1.1751 1.6408 1.1854 0.0808  -0.0962 -0.3212 60   ARG A NH2 
472  N N   . GLU A 61  ? 0.6334 1.0441 0.6143 0.0357  -0.0387 -0.2230 61   GLU A N   
473  C CA  . GLU A 61  ? 0.7104 1.1488 0.6901 0.0445  -0.0374 -0.2396 61   GLU A CA  
474  C C   . GLU A 61  ? 0.6154 1.0365 0.5937 0.0397  -0.0290 -0.2256 61   GLU A C   
475  O O   . GLU A 61  ? 0.6728 1.1095 0.6539 0.0484  -0.0292 -0.2403 61   GLU A O   
476  C CB  . GLU A 61  ? 0.8523 1.3531 0.8161 0.0435  -0.0347 -0.2469 61   GLU A CB  
477  C CG  . GLU A 61  ? 0.9756 1.5020 0.9406 0.0541  -0.0449 -0.2699 61   GLU A CG  
478  C CD  . GLU A 61  ? 1.0842 1.6767 1.0318 0.0541  -0.0411 -0.2775 61   GLU A CD  
479  O OE1 . GLU A 61  ? 1.0977 1.7174 1.0360 0.0473  -0.0311 -0.2684 61   GLU A OE1 
480  O OE2 . GLU A 61  ? 1.1250 1.7432 1.0682 0.0608  -0.0482 -0.2923 61   GLU A OE2 
481  N N   . LEU A 62  ? 0.5001 0.8903 0.4743 0.0271  -0.0226 -0.1985 62   LEU A N   
482  C CA  . LEU A 62  ? 0.5623 0.9349 0.5339 0.0226  -0.0156 -0.1845 62   LEU A CA  
483  C C   . LEU A 62  ? 0.5286 0.8458 0.5127 0.0271  -0.0175 -0.1802 62   LEU A C   
484  O O   . LEU A 62  ? 0.5572 0.8436 0.5431 0.0210  -0.0167 -0.1644 62   LEU A O   
485  C CB  . LEU A 62  ? 0.6163 0.9938 0.5728 0.0057  -0.0081 -0.1568 62   LEU A CB  
486  C CG  . LEU A 62  ? 0.6594 1.0698 0.6055 -0.0014 -0.0018 -0.1503 62   LEU A CG  
487  C CD1 . LEU A 62  ? 0.6411 1.0459 0.5741 -0.0188 0.0024  -0.1210 62   LEU A CD1 
488  C CD2 . LEU A 62  ? 0.5906 0.9840 0.5448 0.0064  -0.0007 -0.1571 62   LEU A CD2 
489  N N   . LYS A 63  ? 0.3526 0.6584 0.3451 0.0380  -0.0203 -0.1942 63   LYS A N   
490  C CA  . LYS A 63  ? 0.3863 0.6407 0.3884 0.0416  -0.0216 -0.1882 63   LYS A CA  
491  C C   . LYS A 63  ? 0.3565 0.6008 0.3533 0.0418  -0.0164 -0.1809 63   LYS A C   
492  O O   . LYS A 63  ? 0.3161 0.5831 0.3156 0.0493  -0.0184 -0.1954 63   LYS A O   
493  C CB  . LYS A 63  ? 0.4643 0.7029 0.4826 0.0548  -0.0329 -0.2103 63   LYS A CB  
494  C CG  . LYS A 63  ? 0.7332 0.9562 0.7613 0.0525  -0.0383 -0.2090 63   LYS A CG  
495  C CD  . LYS A 63  ? 0.8851 1.1052 0.9288 0.0652  -0.0524 -0.2349 63   LYS A CD  
496  C CE  . LYS A 63  ? 0.9502 1.2197 0.9897 0.0715  -0.0579 -0.2567 63   LYS A CE  
497  N NZ  . LYS A 63  ? 0.9627 1.2271 1.0181 0.0844  -0.0741 -0.2826 63   LYS A NZ  
498  N N   . HIS A 64  ? 0.2231 0.2636 0.2194 -0.0159 0.0101  -0.0560 64   HIS A N   
499  C CA  . HIS A 64  ? 0.1874 0.2199 0.1874 -0.0127 0.0089  -0.0502 64   HIS A CA  
500  C C   . HIS A 64  ? 0.1731 0.2002 0.1680 -0.0115 0.0050  -0.0415 64   HIS A C   
501  O O   . HIS A 64  ? 0.1871 0.2187 0.1742 -0.0122 0.0045  -0.0387 64   HIS A O   
502  C CB  . HIS A 64  ? 0.1787 0.2165 0.1727 -0.0122 0.0118  -0.0484 64   HIS A CB  
503  C CG  . HIS A 64  ? 0.2187 0.2491 0.2180 -0.0093 0.0112  -0.0443 64   HIS A CG  
504  N ND1 . HIS A 64  ? 0.2215 0.2466 0.2166 -0.0072 0.0084  -0.0356 64   HIS A ND1 
505  C CD2 . HIS A 64  ? 0.2407 0.2686 0.2504 -0.0085 0.0132  -0.0481 64   HIS A CD2 
506  C CE1 . HIS A 64  ? 0.2213 0.2407 0.2222 -0.0055 0.0081  -0.0337 64   HIS A CE1 
507  N NE2 . HIS A 64  ? 0.2101 0.2310 0.2205 -0.0060 0.0107  -0.0407 64   HIS A NE2 
508  N N   . PRO A 65  ? 0.1915 0.2092 0.1917 -0.0106 0.0023  -0.0375 65   PRO A N   
509  C CA  . PRO A 65  ? 0.1647 0.1777 0.1597 -0.0111 -0.0004 -0.0307 65   PRO A CA  
510  C C   . PRO A 65  ? 0.1443 0.1605 0.1304 -0.0096 0.0011  -0.0260 65   PRO A C   
511  O O   . PRO A 65  ? 0.1585 0.1741 0.1406 -0.0104 0.0006  -0.0227 65   PRO A O   
512  C CB  . PRO A 65  ? 0.2552 0.2588 0.2563 -0.0117 -0.0036 -0.0271 65   PRO A CB  
513  C CG  . PRO A 65  ? 0.3094 0.3121 0.3232 -0.0110 -0.0034 -0.0322 65   PRO A CG  
514  C CD  . PRO A 65  ? 0.1989 0.2107 0.2116 -0.0102 0.0014  -0.0396 65   PRO A CD  
515  N N   . ASN A 66  ? 0.1300 0.1497 0.1150 -0.0079 0.0032  -0.0257 66   ASN A N   
516  C CA  . ASN A 66  ? 0.1343 0.1571 0.1141 -0.0065 0.0041  -0.0206 66   ASN A CA  
517  C C   . ASN A 66  ? 0.1738 0.2069 0.1498 -0.0070 0.0051  -0.0203 66   ASN A C   
518  O O   . ASN A 66  ? 0.1250 0.1618 0.0995 -0.0060 0.0053  -0.0157 66   ASN A O   
519  C CB  . ASN A 66  ? 0.1620 0.1809 0.1433 -0.0046 0.0046  -0.0179 66   ASN A CB  
520  C CG  . ASN A 66  ? 0.1810 0.1901 0.1647 -0.0055 0.0024  -0.0161 66   ASN A CG  
521  O OD1 . ASN A 66  ? 0.1874 0.1920 0.1766 -0.0054 0.0012  -0.0170 66   ASN A OD1 
522  N ND2 . ASN A 66  ? 0.1173 0.1237 0.0974 -0.0073 0.0016  -0.0137 66   ASN A ND2 
523  N N   . ILE A 67  ? 0.1374 0.1754 0.1125 -0.0092 0.0050  -0.0250 67   ILE A N   
524  C CA  A ILE A 67  ? 0.1162 0.1646 0.0865 -0.0115 0.0047  -0.0241 67   ILE A CA  
525  C CA  B ILE A 67  ? 0.1146 0.1631 0.0849 -0.0116 0.0048  -0.0243 67   ILE A CA  
526  C C   . ILE A 67  ? 0.1854 0.2350 0.1557 -0.0130 0.0027  -0.0245 67   ILE A C   
527  O O   . ILE A 67  ? 0.1551 0.2008 0.1280 -0.0136 0.0026  -0.0292 67   ILE A O   
528  C CB  A ILE A 67  ? 0.1502 0.2054 0.1178 -0.0145 0.0071  -0.0304 67   ILE A CB  
529  C CB  B ILE A 67  ? 0.1359 0.1907 0.1040 -0.0146 0.0072  -0.0313 67   ILE A CB  
530  C CG1 A ILE A 67  ? 0.1894 0.2436 0.1583 -0.0131 0.0097  -0.0303 67   ILE A CG1 
531  C CG1 B ILE A 67  ? 0.1793 0.2339 0.1483 -0.0136 0.0099  -0.0317 67   ILE A CG1 
532  C CG2 A ILE A 67  ? 0.2096 0.2765 0.1699 -0.0188 0.0059  -0.0286 67   ILE A CG2 
533  C CG2 B ILE A 67  ? 0.1978 0.2642 0.1586 -0.0191 0.0060  -0.0304 67   ILE A CG2 
534  C CD1 A ILE A 67  ? 0.1404 0.2022 0.1074 -0.0168 0.0135  -0.0377 67   ILE A CD1 
535  C CD1 B ILE A 67  ? 0.1443 0.2047 0.1085 -0.0138 0.0092  -0.0240 67   ILE A CD1 
536  N N   . VAL A 68  ? 0.1602 0.2149 0.1298 -0.0135 0.0007  -0.0189 68   VAL A N   
537  C CA  . VAL A 68  ? 0.1524 0.2081 0.1239 -0.0147 -0.0012 -0.0189 68   VAL A CA  
538  C C   . VAL A 68  ? 0.1756 0.2356 0.1440 -0.0181 -0.0015 -0.0256 68   VAL A C   
539  O O   . VAL A 68  ? 0.1892 0.2570 0.1523 -0.0213 -0.0013 -0.0275 68   VAL A O   
540  C CB  . VAL A 68  ? 0.1477 0.2099 0.1222 -0.0153 -0.0040 -0.0117 68   VAL A CB  
541  C CG1 . VAL A 68  ? 0.2118 0.2762 0.1891 -0.0172 -0.0061 -0.0123 68   VAL A CG1 
542  C CG2 . VAL A 68  ? 0.0734 0.1308 0.0548 -0.0121 -0.0029 -0.0069 68   VAL A CG2 
543  N N   . ARG A 69  ? 0.1527 0.2078 0.1243 -0.0182 -0.0017 -0.0295 69   ARG A N   
544  C CA  . ARG A 69  ? 0.1888 0.2463 0.1602 -0.0210 -0.0014 -0.0373 69   ARG A CA  
545  C C   . ARG A 69  ? 0.2550 0.3208 0.2235 -0.0245 -0.0040 -0.0372 69   ARG A C   
546  O O   . ARG A 69  ? 0.2052 0.2706 0.1762 -0.0240 -0.0063 -0.0323 69   ARG A O   
547  C CB  . ARG A 69  ? 0.2708 0.3193 0.2491 -0.0199 -0.0015 -0.0408 69   ARG A CB  
548  C CG  . ARG A 69  ? 0.3992 0.4490 0.3817 -0.0223 -0.0006 -0.0501 69   ARG A CG  
549  C CD  . ARG A 69  ? 0.4735 0.5231 0.4593 -0.0239 -0.0028 -0.0521 69   ARG A CD  
550  N NE  . ARG A 69  ? 0.5534 0.5934 0.5474 -0.0228 -0.0042 -0.0512 69   ARG A NE  
551  C CZ  . ARG A 69  ? 0.5747 0.6107 0.5788 -0.0234 -0.0045 -0.0569 69   ARG A CZ  
552  N NH1 . ARG A 69  ? 0.5866 0.6143 0.5980 -0.0233 -0.0071 -0.0536 69   ARG A NH1 
553  N NH2 . ARG A 69  ? 0.5835 0.6241 0.5915 -0.0249 -0.0021 -0.0659 69   ARG A NH2 
554  N N   . TYR A 70  ? 0.2493 0.3227 0.2129 -0.0288 -0.0033 -0.0430 70   TYR A N   
555  C CA  . TYR A 70  ? 0.2624 0.3442 0.2220 -0.0336 -0.0060 -0.0441 70   TYR A CA  
556  C C   . TYR A 70  ? 0.3457 0.4236 0.3111 -0.0341 -0.0057 -0.0519 70   TYR A C   
557  O O   . TYR A 70  ? 0.3009 0.3740 0.2716 -0.0331 -0.0027 -0.0594 70   TYR A O   
558  C CB  . TYR A 70  ? 0.3259 0.4184 0.2760 -0.0396 -0.0048 -0.0477 70   TYR A CB  
559  C CG  . TYR A 70  ? 0.5481 0.6497 0.4926 -0.0466 -0.0064 -0.0530 70   TYR A CG  
560  C CD1 . TYR A 70  ? 0.6456 0.7472 0.5923 -0.0491 -0.0027 -0.0658 70   TYR A CD1 
561  C CD2 . TYR A 70  ? 0.5882 0.6986 0.5266 -0.0513 -0.0119 -0.0452 70   TYR A CD2 
562  C CE1 . TYR A 70  ? 0.6203 0.7306 0.5613 -0.0563 -0.0039 -0.0718 70   TYR A CE1 
563  C CE2 . TYR A 70  ? 0.5338 0.6531 0.4658 -0.0589 -0.0140 -0.0497 70   TYR A CE2 
564  C CZ  . TYR A 70  ? 0.6530 0.7724 0.5854 -0.0614 -0.0097 -0.0635 70   TYR A CZ  
565  O OH  . TYR A 70  ? 0.6979 0.8264 0.6236 -0.0695 -0.0115 -0.0687 70   TYR A OH  
566  N N   . TYR A 71  ? 0.3003 0.3803 0.2669 -0.0355 -0.0091 -0.0498 71   TYR A N   
567  C CA  . TYR A 71  ? 0.3239 0.4004 0.2968 -0.0361 -0.0094 -0.0562 71   TYR A CA  
568  C C   . TYR A 71  ? 0.3949 0.4804 0.3639 -0.0421 -0.0108 -0.0625 71   TYR A C   
569  O O   . TYR A 71  ? 0.4628 0.5470 0.4368 -0.0436 -0.0092 -0.0718 71   TYR A O   
570  C CB  . TYR A 71  ? 0.2436 0.3143 0.2226 -0.0332 -0.0117 -0.0500 71   TYR A CB  
571  C CG  . TYR A 71  ? 0.2664 0.3267 0.2507 -0.0290 -0.0098 -0.0480 71   TYR A CG  
572  C CD1 . TYR A 71  ? 0.2702 0.3279 0.2528 -0.0262 -0.0088 -0.0414 71   TYR A CD1 
573  C CD2 . TYR A 71  ? 0.4667 0.5200 0.4582 -0.0287 -0.0095 -0.0524 71   TYR A CD2 
574  C CE1 . TYR A 71  ? 0.2047 0.2536 0.1903 -0.0238 -0.0073 -0.0396 71   TYR A CE1 
575  C CE2 . TYR A 71  ? 0.4935 0.5379 0.4888 -0.0265 -0.0089 -0.0492 71   TYR A CE2 
576  C CZ  . TYR A 71  ? 0.4051 0.4475 0.3962 -0.0243 -0.0077 -0.0431 71   TYR A CZ  
577  O OH  . TYR A 71  ? 0.3941 0.4282 0.3873 -0.0234 -0.0074 -0.0400 71   TYR A OH  
578  N N   . ASP A 72  ? 0.3192 0.4140 0.2802 -0.0462 -0.0142 -0.0571 72   ASP A N   
579  C CA  . ASP A 72  ? 0.3334 0.4364 0.2907 -0.0526 -0.0170 -0.0611 72   ASP A CA  
580  C C   . ASP A 72  ? 0.3378 0.4514 0.2859 -0.0579 -0.0219 -0.0525 72   ASP A C   
581  O O   . ASP A 72  ? 0.3022 0.4153 0.2512 -0.0552 -0.0238 -0.0422 72   ASP A O   
582  C CB  . ASP A 72  ? 0.3213 0.4189 0.2880 -0.0501 -0.0197 -0.0600 72   ASP A CB  
583  C CG  . ASP A 72  ? 0.5015 0.6052 0.4670 -0.0561 -0.0216 -0.0673 72   ASP A CG  
584  O OD1 . ASP A 72  ? 0.4725 0.5840 0.4300 -0.0623 -0.0198 -0.0756 72   ASP A OD1 
585  O OD2 . ASP A 72  ? 0.5271 0.6281 0.4997 -0.0550 -0.0245 -0.0654 72   ASP A OD2 
586  N N   . ARG A 73  ? 0.3373 0.4610 0.2773 -0.0662 -0.0243 -0.0566 73   ARG A N   
587  C CA  . ARG A 73  ? 0.3567 0.4915 0.2884 -0.0731 -0.0310 -0.0469 73   ARG A CA  
588  C C   . ARG A 73  ? 0.4294 0.5688 0.3615 -0.0782 -0.0358 -0.0486 73   ARG A C   
589  O O   . ARG A 73  ? 0.4326 0.5726 0.3633 -0.0811 -0.0327 -0.0609 73   ARG A O   
590  C CB  . ARG A 73  ? 0.5165 0.6620 0.4329 -0.0816 -0.0291 -0.0503 73   ARG A CB  
591  C CG  . ARG A 73  ? 0.6295 0.7783 0.5403 -0.0871 -0.0229 -0.0675 73   ARG A CG  
592  C CD  . ARG A 73  ? 0.7372 0.9005 0.6304 -0.0996 -0.0223 -0.0710 73   ARG A CD  
593  N NE  . ARG A 73  ? 0.8266 0.9927 0.7171 -0.1045 -0.0142 -0.0898 73   ARG A NE  
594  C CZ  . ARG A 73  ? 0.8849 1.0534 0.7765 -0.1089 -0.0140 -0.1002 73   ARG A CZ  
595  N NH1 . ARG A 73  ? 0.9144 1.0827 0.8088 -0.1090 -0.0218 -0.0928 73   ARG A NH1 
596  N NH2 . ARG A 73  ? 0.9065 1.0776 0.7987 -0.1133 -0.0057 -0.1185 73   ARG A NH2 
597  N N   . ILE A 74  ? 0.3883 0.5309 0.3248 -0.0791 -0.0435 -0.0363 74   ILE A N   
598  C CA  . ILE A 74  ? 0.4110 0.5574 0.3502 -0.0833 -0.0491 -0.0361 74   ILE A CA  
599  C C   . ILE A 74  ? 0.4158 0.5747 0.3481 -0.0927 -0.0583 -0.0251 74   ILE A C   
600  O O   . ILE A 74  ? 0.3880 0.5485 0.3252 -0.0915 -0.0629 -0.0120 74   ILE A O   
601  C CB  . ILE A 74  ? 0.4080 0.5452 0.3646 -0.0751 -0.0505 -0.0309 74   ILE A CB  
602  C CG1 . ILE A 74  ? 0.4822 0.6071 0.4458 -0.0667 -0.0426 -0.0392 74   ILE A CG1 
603  C CG2 . ILE A 74  ? 0.4581 0.5997 0.4183 -0.0798 -0.0566 -0.0305 74   ILE A CG2 
604  C CD1 . ILE A 74  ? 0.4897 0.6061 0.4684 -0.0595 -0.0427 -0.0337 74   ILE A CD1 
605  N N   . ILE A 75  ? 0.5007 0.6688 0.4227 -0.1027 -0.0615 -0.0304 75   ILE A N   
606  C CA  . ILE A 75  ? 0.4897 0.6709 0.4033 -0.1140 -0.0717 -0.0195 75   ILE A CA  
607  C C   . ILE A 75  ? 0.4963 0.6780 0.4210 -0.1149 -0.0796 -0.0142 75   ILE A C   
608  O O   . ILE A 75  ? 0.6038 0.7840 0.5284 -0.1158 -0.0775 -0.0249 75   ILE A O   
609  C CB  . ILE A 75  ? 0.6078 0.8013 0.4991 -0.1276 -0.0701 -0.0290 75   ILE A CB  
610  C CG1 . ILE A 75  ? 0.6273 0.8203 0.5096 -0.1266 -0.0611 -0.0357 75   ILE A CG1 
611  C CG2 . ILE A 75  ? 0.5863 0.7945 0.4670 -0.1414 -0.0819 -0.0164 75   ILE A CG2 
612  C CD1 . ILE A 75  ? 0.6728 0.8797 0.5328 -0.1413 -0.0590 -0.0440 75   ILE A CD1 
613  N N   . ASP A 76  ? 0.5257 0.7089 0.4626 -0.1140 -0.0884 0.0023  76   ASP A N   
614  C CA  . ASP A 76  ? 0.6469 0.8330 0.5951 -0.1168 -0.0975 0.0095  76   ASP A CA  
615  C C   . ASP A 76  ? 0.7054 0.9067 0.6425 -0.1314 -0.1095 0.0207  76   ASP A C   
616  O O   . ASP A 76  ? 0.6389 0.8439 0.5870 -0.1329 -0.1187 0.0375  76   ASP A O   
617  C CB  . ASP A 76  ? 0.6677 0.8455 0.6418 -0.1063 -0.0993 0.0197  76   ASP A CB  
618  C CG  . ASP A 76  ? 0.7385 0.9178 0.7278 -0.1077 -0.1072 0.0254  76   ASP A CG  
619  O OD1 . ASP A 76  ? 0.7851 0.9739 0.7646 -0.1185 -0.1148 0.0263  76   ASP A OD1 
620  O OD2 . ASP A 76  ? 0.6956 0.8669 0.7067 -0.0987 -0.1057 0.0286  76   ASP A OD2 
621  N N   . ARG A 77  ? 0.8256 1.0359 0.7416 -0.1430 -0.1093 0.0112  77   ARG A N   
622  C CA  . ARG A 77  ? 0.9197 1.1459 0.8194 -0.1597 -0.1199 0.0203  77   ARG A CA  
623  C C   . ARG A 77  ? 1.0005 1.2315 0.9144 -0.1642 -0.1347 0.0368  77   ARG A C   
624  O O   . ARG A 77  ? 0.9868 1.2306 0.8922 -0.1776 -0.1464 0.0499  77   ARG A O   
625  C CB  . ARG A 77  ? 0.8931 1.1279 0.7683 -0.1718 -0.1154 0.0038  77   ARG A CB  
626  N N   . THR A 78  ? 1.0722 1.2935 1.0084 -0.1537 -0.1344 0.0366  78   THR A N   
627  C CA  . THR A 78  ? 1.1616 1.3861 1.1167 -0.1562 -0.1475 0.0517  78   THR A CA  
628  C C   . THR A 78  ? 1.0835 1.3084 1.0577 -0.1532 -0.1551 0.0710  78   THR A C   
629  O O   . THR A 78  ? 1.0875 1.3231 1.0633 -0.1641 -0.1691 0.0875  78   THR A O   
630  C CB  . THR A 78  ? 1.3009 1.5146 1.2763 -0.1453 -0.1436 0.0453  78   THR A CB  
631  O OG1 . THR A 78  ? 1.3582 1.5725 1.3187 -0.1493 -0.1388 0.0290  78   THR A OG1 
632  C CG2 . THR A 78  ? 1.3642 1.5808 1.3633 -0.1471 -0.1567 0.0614  78   THR A CG2 
633  N N   . ASN A 79  ? 0.9308 1.1440 0.9205 -0.1391 -0.1462 0.0691  79   ASN A N   
634  C CA  . ASN A 79  ? 0.7979 1.0104 0.8087 -0.1349 -0.1514 0.0850  79   ASN A CA  
635  C C   . ASN A 79  ? 0.6902 0.9077 0.6839 -0.1395 -0.1503 0.0885  79   ASN A C   
636  O O   . ASN A 79  ? 0.6484 0.8636 0.6574 -0.1345 -0.1516 0.0987  79   ASN A O   
637  C CB  . ASN A 79  ? 0.8085 1.0069 0.8440 -0.1187 -0.1418 0.0805  79   ASN A CB  
638  N N   . THR A 80  ? 0.5336 0.7584 0.4965 -0.1494 -0.1476 0.0794  80   THR A N   
639  C CA  . THR A 80  ? 0.3673 0.5965 0.3107 -0.1537 -0.1435 0.0785  80   THR A CA  
640  C C   . THR A 80  ? 0.2851 0.5021 0.2426 -0.1388 -0.1338 0.0766  80   THR A C   
641  O O   . THR A 80  ? 0.3171 0.5365 0.2792 -0.1391 -0.1371 0.0880  80   THR A O   
642  C CB  . THR A 80  ? 0.4715 0.7154 0.4087 -0.1685 -0.1579 0.0977  80   THR A CB  
643  O OG1 . THR A 80  ? 0.5480 0.7891 0.5148 -0.1626 -0.1661 0.1157  80   THR A OG1 
644  C CG2 . THR A 80  ? 0.5506 0.8067 0.4767 -0.1841 -0.1696 0.1022  80   THR A CG2 
645  N N   . THR A 81  ? 0.3385 0.5429 0.3029 -0.1265 -0.1225 0.0626  81   THR A N   
646  C CA  . THR A 81  ? 0.4095 0.6027 0.3840 -0.1137 -0.1128 0.0592  81   THR A CA  
647  C C   . THR A 81  ? 0.4027 0.5898 0.3594 -0.1098 -0.0995 0.0410  81   THR A C   
648  O O   . THR A 81  ? 0.4662 0.6515 0.4155 -0.1104 -0.0951 0.0283  81   THR A O   
649  C CB  . THR A 81  ? 0.4398 0.6225 0.4426 -0.1020 -0.1112 0.0609  81   THR A CB  
650  O OG1 . THR A 81  ? 0.5128 0.7008 0.5371 -0.1049 -0.1233 0.0784  81   THR A OG1 
651  C CG2 . THR A 81  ? 0.4407 0.6120 0.4506 -0.0901 -0.1004 0.0556  81   THR A CG2 
652  N N   . LEU A 82  ? 0.3432 0.5275 0.2954 -0.1060 -0.0936 0.0403  82   LEU A N   
653  C CA  . LEU A 82  ? 0.3549 0.5322 0.2958 -0.1009 -0.0811 0.0245  82   LEU A CA  
654  C C   . LEU A 82  ? 0.3418 0.5054 0.2993 -0.0871 -0.0742 0.0233  82   LEU A C   
655  O O   . LEU A 82  ? 0.3901 0.5524 0.3595 -0.0834 -0.0767 0.0339  82   LEU A O   
656  C CB  . LEU A 82  ? 0.3605 0.5457 0.2825 -0.1083 -0.0794 0.0241  82   LEU A CB  
657  C CG  . LEU A 82  ? 0.4880 0.6655 0.4038 -0.1017 -0.0672 0.0116  82   LEU A CG  
658  C CD1 . LEU A 82  ? 0.4527 0.6277 0.3598 -0.1024 -0.0594 -0.0066 82   LEU A CD1 
659  C CD2 . LEU A 82  ? 0.5170 0.7026 0.4191 -0.1083 -0.0668 0.0156  82   LEU A CD2 
660  N N   . TYR A 83  ? 0.2794 0.4332 0.2384 -0.0802 -0.0660 0.0106  83   TYR A N   
661  C CA  . TYR A 83  ? 0.3128 0.4541 0.2839 -0.0689 -0.0589 0.0081  83   TYR A CA  
662  C C   . TYR A 83  ? 0.3242 0.4603 0.2845 -0.0659 -0.0500 -0.0021 83   TYR A C   
663  O O   . TYR A 83  ? 0.3225 0.4585 0.2731 -0.0684 -0.0459 -0.0138 83   TYR A O   
664  C CB  . TYR A 83  ? 0.3008 0.4345 0.2832 -0.0638 -0.0566 0.0029  83   TYR A CB  
665  C CG  . TYR A 83  ? 0.3586 0.4964 0.3544 -0.0661 -0.0645 0.0114  83   TYR A CG  
666  C CD1 . TYR A 83  ? 0.3973 0.5431 0.3869 -0.0740 -0.0707 0.0108  83   TYR A CD1 
667  C CD2 . TYR A 83  ? 0.3598 0.4939 0.3761 -0.0607 -0.0657 0.0196  83   TYR A CD2 
668  C CE1 . TYR A 83  ? 0.4414 0.5910 0.4448 -0.0763 -0.0786 0.0193  83   TYR A CE1 
669  C CE2 . TYR A 83  ? 0.4817 0.6197 0.5138 -0.0627 -0.0728 0.0272  83   TYR A CE2 
670  C CZ  . TYR A 83  ? 0.5448 0.6904 0.5704 -0.0703 -0.0797 0.0276  83   TYR A CZ  
671  O OH  . TYR A 83  ? 0.6525 0.8020 0.6954 -0.0725 -0.0876 0.0359  83   TYR A OH  
672  N N   . ILE A 84  ? 0.2018 0.3332 0.1662 -0.0605 -0.0469 0.0017  84   ILE A N   
673  C CA  . ILE A 84  ? 0.1291 0.2540 0.0868 -0.0566 -0.0387 -0.0074 84   ILE A CA  
674  C C   . ILE A 84  ? 0.2313 0.3436 0.2008 -0.0475 -0.0338 -0.0099 84   ILE A C   
675  O O   . ILE A 84  ? 0.1909 0.2999 0.1716 -0.0433 -0.0346 -0.0026 84   ILE A O   
676  C CB  . ILE A 84  ? 0.3005 0.4290 0.2522 -0.0578 -0.0383 -0.0022 84   ILE A CB  
677  C CG1 . ILE A 84  ? 0.3082 0.4507 0.2472 -0.0687 -0.0439 0.0021  84   ILE A CG1 
678  C CG2 . ILE A 84  ? 0.2902 0.4121 0.2366 -0.0539 -0.0300 -0.0119 84   ILE A CG2 
679  C CD1 . ILE A 84  ? 0.3126 0.4606 0.2380 -0.0759 -0.0415 -0.0099 84   ILE A CD1 
680  N N   . VAL A 85  ? 0.1176 0.2235 0.0853 -0.0455 -0.0290 -0.0202 85   VAL A N   
681  C CA  . VAL A 85  ? 0.1341 0.2289 0.1106 -0.0391 -0.0251 -0.0225 85   VAL A CA  
682  C C   . VAL A 85  ? 0.2141 0.3023 0.1882 -0.0352 -0.0200 -0.0251 85   VAL A C   
683  O O   . VAL A 85  ? 0.1869 0.2762 0.1537 -0.0369 -0.0175 -0.0314 85   VAL A O   
684  C CB  . VAL A 85  ? 0.1962 0.2877 0.1740 -0.0398 -0.0240 -0.0309 85   VAL A CB  
685  C CG1 . VAL A 85  ? 0.1654 0.2463 0.1513 -0.0348 -0.0207 -0.0317 85   VAL A CG1 
686  C CG2 . VAL A 85  ? 0.2725 0.3710 0.2522 -0.0442 -0.0294 -0.0288 85   VAL A CG2 
687  N N   . MET A 86  ? 0.1853 0.2670 0.1665 -0.0305 -0.0181 -0.0207 86   MET A N   
688  C CA  . MET A 86  ? 0.1919 0.2671 0.1712 -0.0270 -0.0140 -0.0220 86   MET A CA  
689  C C   . MET A 86  ? 0.1745 0.2402 0.1602 -0.0234 -0.0111 -0.0220 86   MET A C   
690  O O   . MET A 86  ? 0.1829 0.2477 0.1749 -0.0236 -0.0116 -0.0209 86   MET A O   
691  C CB  . MET A 86  ? 0.1813 0.2609 0.1599 -0.0267 -0.0151 -0.0150 86   MET A CB  
692  C CG  . MET A 86  ? 0.2120 0.2951 0.2007 -0.0264 -0.0185 -0.0066 86   MET A CG  
693  S SD  . MET A 86  ? 0.7651 0.8534 0.7566 -0.0263 -0.0210 0.0028  86   MET A SD  
694  C CE  . MET A 86  ? 0.2351 0.3305 0.2103 -0.0314 -0.0216 -0.0001 86   MET A CE  
695  N N   . GLU A 87  ? 0.1415 0.2006 0.1253 -0.0210 -0.0080 -0.0231 87   GLU A N   
696  C CA  . GLU A 87  ? 0.1769 0.2277 0.1643 -0.0195 -0.0054 -0.0230 87   GLU A CA  
697  C C   . GLU A 87  ? 0.2216 0.2731 0.2157 -0.0184 -0.0042 -0.0182 87   GLU A C   
698  O O   . GLU A 87  ? 0.1480 0.2041 0.1449 -0.0173 -0.0052 -0.0139 87   GLU A O   
699  C CB  . GLU A 87  ? 0.2437 0.2874 0.2277 -0.0182 -0.0034 -0.0247 87   GLU A CB  
700  C CG  . GLU A 87  ? 0.3572 0.4017 0.3390 -0.0162 -0.0024 -0.0220 87   GLU A CG  
701  C CD  . GLU A 87  ? 0.2686 0.3057 0.2484 -0.0153 -0.0010 -0.0238 87   GLU A CD  
702  O OE1 . GLU A 87  ? 0.3342 0.3645 0.3147 -0.0157 -0.0003 -0.0229 87   GLU A OE1 
703  O OE2 . GLU A 87  ? 0.2359 0.2745 0.2139 -0.0148 -0.0009 -0.0261 87   GLU A OE2 
704  N N   . TYR A 88  ? 0.1235 0.1708 0.1215 -0.0192 -0.0019 -0.0192 88   TYR A N   
705  C CA  . TYR A 88  ? 0.1602 0.2077 0.1668 -0.0188 0.0010  -0.0172 88   TYR A CA  
706  C C   . TYR A 88  ? 0.1802 0.2219 0.1837 -0.0181 0.0047  -0.0175 88   TYR A C   
707  O O   . TYR A 88  ? 0.1929 0.2285 0.1891 -0.0197 0.0057  -0.0197 88   TYR A O   
708  C CB  . TYR A 88  ? 0.1383 0.1846 0.1496 -0.0212 0.0030  -0.0194 88   TYR A CB  
709  C CG  . TYR A 88  ? 0.1530 0.1995 0.1745 -0.0217 0.0078  -0.0197 88   TYR A CG  
710  C CD1 . TYR A 88  ? 0.1767 0.2288 0.2118 -0.0198 0.0072  -0.0166 88   TYR A CD1 
711  C CD2 . TYR A 88  ? 0.1800 0.2215 0.1988 -0.0250 0.0130  -0.0231 88   TYR A CD2 
712  C CE1 . TYR A 88  ? 0.2071 0.2596 0.2555 -0.0203 0.0123  -0.0183 88   TYR A CE1 
713  C CE2 . TYR A 88  ? 0.1815 0.2240 0.2102 -0.0264 0.0188  -0.0254 88   TYR A CE2 
714  C CZ  . TYR A 88  ? 0.2314 0.2793 0.2763 -0.0235 0.0188  -0.0236 88   TYR A CZ  
715  O OH  . TYR A 88  ? 0.2223 0.2714 0.2812 -0.0248 0.0253  -0.0271 88   TYR A OH  
716  N N   . CYS A 89  ? 0.1516 0.1954 0.1615 -0.0161 0.0059  -0.0149 89   CYS A N   
717  C CA  . CYS A 89  ? 0.1983 0.2371 0.2058 -0.0157 0.0094  -0.0156 89   CYS A CA  
718  C C   . CYS A 89  ? 0.2007 0.2394 0.2183 -0.0170 0.0146  -0.0176 89   CYS A C   
719  O O   . CYS A 89  ? 0.1341 0.1767 0.1646 -0.0151 0.0152  -0.0157 89   CYS A O   
720  C CB  . CYS A 89  ? 0.1691 0.2104 0.1771 -0.0126 0.0073  -0.0117 89   CYS A CB  
721  S SG  . CYS A 89  ? 0.2284 0.2710 0.2249 -0.0122 0.0030  -0.0115 89   CYS A SG  
722  N N   . GLU A 90  ? 0.1744 0.2088 0.1871 -0.0211 0.0184  -0.0216 90   GLU A N   
723  C CA  . GLU A 90  ? 0.1642 0.1997 0.1866 -0.0240 0.0247  -0.0257 90   GLU A CA  
724  C C   . GLU A 90  ? 0.1557 0.1913 0.1868 -0.0230 0.0291  -0.0273 90   GLU A C   
725  O O   . GLU A 90  ? 0.1922 0.2309 0.2385 -0.0240 0.0342  -0.0309 90   GLU A O   
726  C CB  . GLU A 90  ? 0.3142 0.3459 0.3267 -0.0304 0.0280  -0.0295 90   GLU A CB  
727  C CG  . GLU A 90  ? 0.5305 0.5610 0.5442 -0.0352 0.0358  -0.0348 90   GLU A CG  
728  C CD  . GLU A 90  ? 0.4255 0.4513 0.4228 -0.0429 0.0371  -0.0362 90   GLU A CD  
729  O OE1 . GLU A 90  ? 0.4683 0.4910 0.4583 -0.0460 0.0394  -0.0375 90   GLU A OE1 
730  O OE2 . GLU A 90  ? 0.5608 0.5861 0.5528 -0.0462 0.0352  -0.0353 90   GLU A OE2 
731  N N   . GLY A 91  ? 0.1855 0.2180 0.2094 -0.0212 0.0274  -0.0251 91   GLY A N   
732  C CA  . GLY A 91  ? 0.1444 0.1767 0.1767 -0.0203 0.0313  -0.0268 91   GLY A CA  
733  C C   . GLY A 91  ? 0.2461 0.2836 0.2946 -0.0150 0.0281  -0.0219 91   GLY A C   
734  O O   . GLY A 91  ? 0.2085 0.2466 0.2686 -0.0136 0.0305  -0.0224 91   GLY A O   
735  N N   . GLY A 92  ? 0.1648 0.2065 0.2147 -0.0128 0.0221  -0.0167 92   GLY A N   
736  C CA  . GLY A 92  ? 0.1675 0.2152 0.2326 -0.0094 0.0178  -0.0103 92   GLY A CA  
737  C C   . GLY A 92  ? 0.1744 0.2216 0.2341 -0.0068 0.0146  -0.0055 92   GLY A C   
738  O O   . GLY A 92  ? 0.1432 0.1860 0.1860 -0.0070 0.0144  -0.0066 92   GLY A O   
739  N N   . ASP A 93  ? 0.1217 0.1737 0.1973 -0.0046 0.0117  0.0003  93   ASP A N   
740  C CA  . ASP A 93  ? 0.1107 0.1636 0.1816 -0.0026 0.0080  0.0060  93   ASP A CA  
741  C C   . ASP A 93  ? 0.1491 0.1983 0.2283 -0.0012 0.0122  0.0039  93   ASP A C   
742  O O   . ASP A 93  ? 0.1743 0.2223 0.2680 -0.0017 0.0173  -0.0012 93   ASP A O   
743  C CB  . ASP A 93  ? 0.0964 0.1576 0.1787 -0.0023 0.0007  0.0158  93   ASP A CB  
744  C CG  . ASP A 93  ? 0.2905 0.3549 0.4015 -0.0013 0.0006  0.0185  93   ASP A CG  
745  O OD1 . ASP A 93  ? 0.3717 0.4367 0.4957 -0.0021 0.0031  0.0148  93   ASP A OD1 
746  O OD2 . ASP A 93  ? 0.3208 0.3871 0.4434 0.0002  -0.0017 0.0241  93   ASP A OD2 
747  N N   . LEU A 94  ? 0.1038 0.1518 0.1748 0.0004  0.0102  0.0073  94   LEU A N   
748  C CA  . LEU A 94  ? 0.0612 0.1051 0.1377 0.0016  0.0140  0.0050  94   LEU A CA  
749  C C   . LEU A 94  ? 0.1386 0.1867 0.2416 0.0033  0.0131  0.0090  94   LEU A C   
750  O O   . LEU A 94  ? 0.1551 0.2002 0.2696 0.0036  0.0181  0.0041  94   LEU A O   
751  C CB  . LEU A 94  ? 0.1441 0.1859 0.2060 0.0028  0.0116  0.0083  94   LEU A CB  
752  C CG  . LEU A 94  ? 0.4507 0.4846 0.4973 0.0020  0.0150  0.0029  94   LEU A CG  
753  C CD1 . LEU A 94  ? 0.3533 0.3869 0.3971 0.0043  0.0127  0.0076  94   LEU A CD1 
754  C CD2 . LEU A 94  ? 0.3896 0.4188 0.4414 -0.0001 0.0212  -0.0046 94   LEU A CD2 
755  N N   . ALA A 95  ? 0.1301 0.1855 0.2441 0.0038  0.0063  0.0181  95   ALA A N   
756  C CA  . ALA A 95  ? 0.1734 0.2329 0.3167 0.0052  0.0042  0.0234  95   ALA A CA  
757  C C   . ALA A 95  ? 0.2343 0.2924 0.3985 0.0048  0.0107  0.0149  95   ALA A C   
758  O O   . ALA A 95  ? 0.2027 0.2603 0.3899 0.0059  0.0139  0.0124  95   ALA A O   
759  C CB  . ALA A 95  ? 0.2205 0.2889 0.3727 0.0042  -0.0056 0.0361  95   ALA A CB  
760  N N   . SER A 96  ? 0.1851 0.2429 0.3427 0.0028  0.0132  0.0096  96   SER A N   
761  C CA  . SER A 96  ? 0.1709 0.2281 0.3479 0.0015  0.0204  0.0006  96   SER A CA  
762  C C   . SER A 96  ? 0.1910 0.2418 0.3607 -0.0003 0.0301  -0.0113 96   SER A C   
763  O O   . SER A 96  ? 0.1529 0.2037 0.3436 -0.0014 0.0372  -0.0193 96   SER A O   
764  C CB  . SER A 96  ? 0.2317 0.2906 0.4035 -0.0007 0.0206  -0.0017 96   SER A CB  
765  O OG  . SER A 96  ? 0.2499 0.3152 0.4292 -0.0001 0.0111  0.0094  96   SER A OG  
766  N N   . VAL A 97  ? 0.1743 0.2201 0.3151 -0.0012 0.0305  -0.0126 97   VAL A N   
767  C CA  . VAL A 97  ? 0.1813 0.2213 0.3131 -0.0039 0.0380  -0.0220 97   VAL A CA  
768  C C   . VAL A 97  ? 0.1717 0.2113 0.3213 -0.0019 0.0397  -0.0225 97   VAL A C   
769  O O   . VAL A 97  ? 0.2335 0.2713 0.3921 -0.0047 0.0477  -0.0325 97   VAL A O   
770  C CB  . VAL A 97  ? 0.2166 0.2512 0.3164 -0.0052 0.0359  -0.0209 97   VAL A CB  
771  C CG1 . VAL A 97  ? 0.2327 0.2619 0.3246 -0.0078 0.0409  -0.0271 97   VAL A CG1 
772  C CG2 . VAL A 97  ? 0.2402 0.2739 0.3240 -0.0086 0.0365  -0.0236 97   VAL A CG2 
773  N N   . ILE A 98  ? 0.1316 0.1733 0.2856 0.0021  0.0323  -0.0120 98   ILE A N   
774  C CA  . ILE A 98  ? 0.1186 0.1604 0.2914 0.0044  0.0325  -0.0107 98   ILE A CA  
775  C C   . ILE A 98  ? 0.2118 0.2576 0.4219 0.0049  0.0355  -0.0138 98   ILE A C   
776  O O   . ILE A 98  ? 0.1995 0.2438 0.4265 0.0040  0.0424  -0.0225 98   ILE A O   
777  C CB  . ILE A 98  ? 0.1692 0.2136 0.3379 0.0078  0.0231  0.0028  98   ILE A CB  
778  C CG1 . ILE A 98  ? 0.1004 0.1399 0.2366 0.0073  0.0224  0.0028  98   ILE A CG1 
779  C CG2 . ILE A 98  ? 0.1802 0.2263 0.3749 0.0103  0.0216  0.0069  98   ILE A CG2 
780  C CD1 . ILE A 98  ? 0.1789 0.2217 0.3052 0.0093  0.0145  0.0142  98   ILE A CD1 
781  N N   . THR A 99  ? 0.1579 0.2093 0.3825 0.0058  0.0305  -0.0072 99   THR A N   
782  C CA  . THR A 99  ? 0.2059 0.2615 0.4697 0.0062  0.0325  -0.0094 99   THR A CA  
783  C C   . THR A 99  ? 0.1881 0.2411 0.4585 0.0025  0.0453  -0.0266 99   THR A C   
784  O O   . THR A 99  ? 0.2485 0.3022 0.5481 0.0023  0.0515  -0.0343 99   THR A O   
785  C CB  . THR A 99  ? 0.2284 0.2900 0.5028 0.0066  0.0248  0.0000  99   THR A CB  
786  O OG1 . THR A 99  ? 0.3073 0.3729 0.5802 0.0085  0.0130  0.0160  99   THR A OG1 
787  C CG2 . THR A 99  ? 0.3153 0.3807 0.6323 0.0067  0.0276  -0.0036 99   THR A CG2 
788  N N   . LYS A 100 ? 0.2329 0.2835 0.4765 -0.0011 0.0496  -0.0330 100  LYS A N   
789  C CA  . LYS A 100 ? 0.2754 0.3242 0.5197 -0.0065 0.0620  -0.0492 100  LYS A CA  
790  C C   . LYS A 100 ? 0.3179 0.3630 0.5601 -0.0089 0.0692  -0.0584 100  LYS A C   
791  O O   . LYS A 100 ? 0.2895 0.3358 0.5537 -0.0120 0.0790  -0.0711 100  LYS A O   
792  C CB  . LYS A 100 ? 0.2655 0.3120 0.4773 -0.0107 0.0638  -0.0522 100  LYS A CB  
793  C CG  . LYS A 100 ? 0.2635 0.3087 0.4695 -0.0183 0.0763  -0.0680 100  LYS A CG  
794  C CD  . LYS A 100 ? 0.3655 0.4098 0.5452 -0.0224 0.0763  -0.0684 100  LYS A CD  
795  C CE  . LYS A 100 ? 0.4439 0.4848 0.5991 -0.0313 0.0847  -0.0791 100  LYS A CE  
796  N NZ  . LYS A 100 ? 0.5147 0.5579 0.6881 -0.0371 0.0974  -0.0942 100  LYS A NZ  
797  N N   . GLY A 101 ? 0.2647 0.3053 0.4814 -0.0079 0.0647  -0.0531 101  GLY A N   
798  C CA  . GLY A 101 ? 0.2258 0.2628 0.4399 -0.0103 0.0702  -0.0607 101  GLY A CA  
799  C C   . GLY A 101 ? 0.2231 0.2627 0.4757 -0.0069 0.0714  -0.0618 101  GLY A C   
800  O O   . GLY A 101 ? 0.2305 0.2693 0.4956 -0.0104 0.0806  -0.0745 101  GLY A O   
801  N N   . THR A 102 ? 0.1916 0.2346 0.4630 -0.0007 0.0617  -0.0481 102  THR A N   
802  C CA  . THR A 102 ? 0.2485 0.2942 0.5585 0.0030  0.0600  -0.0454 102  THR A CA  
803  C C   . THR A 102 ? 0.2500 0.2992 0.5976 0.0009  0.0691  -0.0578 102  THR A C   
804  O O   . THR A 102 ? 0.2805 0.3296 0.6534 -0.0001 0.0761  -0.0678 102  THR A O   
805  C CB  . THR A 102 ? 0.2775 0.3276 0.5992 0.0082  0.0465  -0.0264 102  THR A CB  
806  O OG1 . THR A 102 ? 0.3442 0.3920 0.6356 0.0100  0.0391  -0.0159 102  THR A OG1 
807  C CG2 . THR A 102 ? 0.2812 0.3351 0.6492 0.0112  0.0438  -0.0224 102  THR A CG2 
808  N N   . LYS A 103 ? 0.2375 0.2900 0.5896 -0.0001 0.0694  -0.0579 103  LYS A N   
809  C CA  . LYS A 103 ? 0.3672 0.4235 0.7564 -0.0023 0.0783  -0.0699 103  LYS A CA  
810  C C   . LYS A 103 ? 0.4176 0.4720 0.7971 -0.0099 0.0942  -0.0912 103  LYS A C   
811  O O   . LYS A 103 ? 0.3857 0.4423 0.7987 -0.0122 0.1042  -0.1048 103  LYS A O   
812  C CB  . LYS A 103 ? 0.4115 0.4718 0.8068 -0.0016 0.0738  -0.0636 103  LYS A CB  
813  C CG  . LYS A 103 ? 0.4397 0.5033 0.8444 0.0038  0.0580  -0.0427 103  LYS A CG  
814  C CD  . LYS A 103 ? 0.4589 0.5260 0.9125 0.0073  0.0538  -0.0374 103  LYS A CD  
815  C CE  . LYS A 103 ? 0.4807 0.5510 0.9362 0.0110  0.0370  -0.0148 103  LYS A CE  
816  N NZ  . LYS A 103 ? 0.5064 0.5802 0.9500 0.0104  0.0291  -0.0048 103  LYS A NZ  
817  N N   . GLU A 104 ? 0.3667 0.4172 0.7013 -0.0146 0.0965  -0.0941 104  GLU A N   
818  C CA  . GLU A 104 ? 0.4307 0.4800 0.7503 -0.0238 0.1104  -0.1128 104  GLU A CA  
819  C C   . GLU A 104 ? 0.4618 0.5076 0.7746 -0.0264 0.1146  -0.1197 104  GLU A C   
820  O O   . GLU A 104 ? 0.5551 0.6005 0.8566 -0.0354 0.1261  -0.1355 104  GLU A O   
821  C CB  . GLU A 104 ? 0.5422 0.5893 0.8178 -0.0289 0.1099  -0.1116 104  GLU A CB  
822  C CG  . GLU A 104 ? 0.7367 0.7877 1.0169 -0.0336 0.1169  -0.1193 104  GLU A CG  
823  C CD  . GLU A 104 ? 0.8785 0.9333 1.1852 -0.0266 0.1094  -0.1090 104  GLU A CD  
824  O OE1 . GLU A 104 ? 0.9708 1.0280 1.3130 -0.0204 0.1049  -0.1035 104  GLU A OE1 
825  O OE2 . GLU A 104 ? 0.8554 0.9114 1.1488 -0.0279 0.1076  -0.1060 104  GLU A OE2 
826  N N   . ARG A 105 ? 0.2789 0.3227 0.5976 -0.0195 0.1050  -0.1076 105  ARG A N   
827  C CA  . ARG A 105 ? 0.2821 0.3220 0.5923 -0.0212 0.1070  -0.1119 105  ARG A CA  
828  C C   . ARG A 105 ? 0.4086 0.4442 0.6725 -0.0291 0.1102  -0.1169 105  ARG A C   
829  O O   . ARG A 105 ? 0.3856 0.4203 0.6434 -0.0371 0.1198  -0.1312 105  ARG A O   
830  C CB  . ARG A 105 ? 0.4069 0.4495 0.7566 -0.0237 0.1182  -0.1279 105  ARG A CB  
831  C CG  . ARG A 105 ? 0.5999 0.6466 1.0001 -0.0159 0.1134  -0.1211 105  ARG A CG  
832  C CD  . ARG A 105 ? 0.7520 0.8008 1.1952 -0.0175 0.1234  -0.1363 105  ARG A CD  
833  N NE  . ARG A 105 ? 0.8945 0.9392 1.3272 -0.0182 0.1234  -0.1383 105  ARG A NE  
834  C CZ  . ARG A 105 ? 1.0009 1.0435 1.4380 -0.0109 0.1117  -0.1225 105  ARG A CZ  
835  N NH1 . ARG A 105 ? 1.0320 1.0766 1.4820 -0.0033 0.0989  -0.1035 105  ARG A NH1 
836  N NH2 . ARG A 105 ? 1.0092 1.0480 1.4369 -0.0121 0.1127  -0.1257 105  ARG A NH2 
837  N N   . GLN A 106 ? 0.3880 0.4211 0.6202 -0.0275 0.1014  -0.1047 106  GLN A N   
838  C CA  . GLN A 106 ? 0.2625 0.2912 0.4530 -0.0345 0.1018  -0.1063 106  GLN A CA  
839  C C   . GLN A 106 ? 0.2009 0.2254 0.3676 -0.0285 0.0889  -0.0893 106  GLN A C   
840  O O   . GLN A 106 ? 0.1954 0.2212 0.3604 -0.0231 0.0814  -0.0784 106  GLN A O   
841  C CB  . GLN A 106 ? 0.3736 0.4045 0.5497 -0.0419 0.1077  -0.1131 106  GLN A CB  
842  C CG  . GLN A 106 ? 0.4579 0.4845 0.5915 -0.0489 0.1050  -0.1106 106  GLN A CG  
843  C CD  . GLN A 106 ? 0.5235 0.5479 0.6416 -0.0586 0.1113  -0.1207 106  GLN A CD  
844  O OE1 . GLN A 106 ? 0.5869 0.6149 0.7163 -0.0665 0.1232  -0.1365 106  GLN A OE1 
845  N NE2 . GLN A 106 ? 0.5366 0.5556 0.6297 -0.0589 0.1034  -0.1123 106  GLN A NE2 
846  N N   . TYR A 107 ? 0.2261 0.2460 0.3762 -0.0299 0.0866  -0.0879 107  TYR A N   
847  C CA  . TYR A 107 ? 0.2721 0.2880 0.4011 -0.0251 0.0757  -0.0739 107  TYR A CA  
848  C C   . TYR A 107 ? 0.2221 0.2355 0.3192 -0.0296 0.0728  -0.0708 107  TYR A C   
849  O O   . TYR A 107 ? 0.2468 0.2603 0.3313 -0.0386 0.0792  -0.0799 107  TYR A O   
850  C CB  . TYR A 107 ? 0.1771 0.1887 0.2994 -0.0260 0.0747  -0.0742 107  TYR A CB  
851  C CG  . TYR A 107 ? 0.2575 0.2706 0.4097 -0.0198 0.0741  -0.0729 107  TYR A CG  
852  C CD1 . TYR A 107 ? 0.3009 0.3130 0.4635 -0.0238 0.0807  -0.0835 107  TYR A CD1 
853  C CD2 . TYR A 107 ? 0.2258 0.2417 0.3958 -0.0109 0.0667  -0.0607 107  TYR A CD2 
854  C CE1 . TYR A 107 ? 0.3020 0.3153 0.4945 -0.0180 0.0798  -0.0819 107  TYR A CE1 
855  C CE2 . TYR A 107 ? 0.1542 0.1718 0.3526 -0.0058 0.0652  -0.0578 107  TYR A CE2 
856  C CZ  . TYR A 107 ? 0.2764 0.2924 0.4872 -0.0090 0.0717  -0.0684 107  TYR A CZ  
857  O OH  . TYR A 107 ? 0.1935 0.2111 0.4348 -0.0038 0.0696  -0.0649 107  TYR A OH  
858  N N   . LEU A 108 ? 0.1721 0.1838 0.2570 -0.0240 0.0634  -0.0583 108  LEU A N   
859  C CA  A LEU A 108 ? 0.2171 0.2260 0.2750 -0.0277 0.0598  -0.0549 108  LEU A CA  
860  C CA  B LEU A 108 ? 0.2131 0.2219 0.2707 -0.0275 0.0595  -0.0544 108  LEU A CA  
861  C C   . LEU A 108 ? 0.2575 0.2605 0.2924 -0.0330 0.0573  -0.0540 108  LEU A C   
862  O O   . LEU A 108 ? 0.1716 0.1721 0.2087 -0.0306 0.0552  -0.0518 108  LEU A O   
863  C CB  A LEU A 108 ? 0.2275 0.2377 0.2840 -0.0204 0.0516  -0.0435 108  LEU A CB  
864  C CB  B LEU A 108 ? 0.1891 0.1988 0.2446 -0.0199 0.0508  -0.0425 108  LEU A CB  
865  C CG  A LEU A 108 ? 0.2550 0.2712 0.3309 -0.0170 0.0528  -0.0433 108  LEU A CG  
866  C CG  B LEU A 108 ? 0.2750 0.2902 0.3445 -0.0165 0.0506  -0.0408 108  LEU A CG  
867  C CD1 A LEU A 108 ? 0.2316 0.2503 0.3118 -0.0095 0.0445  -0.0317 108  LEU A CD1 
868  C CD1 B LEU A 108 ? 0.2826 0.2988 0.3460 -0.0232 0.0562  -0.0485 108  LEU A CD1 
869  C CD2 A LEU A 108 ? 0.2736 0.2906 0.3398 -0.0225 0.0562  -0.0482 108  LEU A CD2 
870  C CD2 B LEU A 108 ? 0.1968 0.2165 0.2963 -0.0121 0.0523  -0.0411 108  LEU A CD2 
871  N N   . ASP A 109 ? 0.1994 0.2003 0.2131 -0.0405 0.0570  -0.0550 109  ASP A N   
872  C CA  . ASP A 109 ? 0.2059 0.2012 0.1982 -0.0466 0.0530  -0.0525 109  ASP A CA  
873  C C   . ASP A 109 ? 0.2042 0.1957 0.1932 -0.0392 0.0437  -0.0415 109  ASP A C   
874  O O   . ASP A 109 ? 0.2277 0.2205 0.2200 -0.0322 0.0394  -0.0349 109  ASP A O   
875  C CB  . ASP A 109 ? 0.3523 0.3465 0.3248 -0.0553 0.0518  -0.0522 109  ASP A CB  
876  C CG  . ASP A 109 ? 0.5571 0.5548 0.5267 -0.0661 0.0612  -0.0636 109  ASP A CG  
877  O OD1 . ASP A 109 ? 0.6039 0.6037 0.5830 -0.0691 0.0687  -0.0731 109  ASP A OD1 
878  O OD2 . ASP A 109 ? 0.6832 0.6821 0.6418 -0.0721 0.0615  -0.0637 109  ASP A OD2 
879  N N   . GLU A 110 ? 0.1451 0.1322 0.1266 -0.0418 0.0410  -0.0399 110  GLU A N   
880  C CA  . GLU A 110 ? 0.1919 0.1752 0.1699 -0.0361 0.0328  -0.0302 110  GLU A CA  
881  C C   . GLU A 110 ? 0.2251 0.2066 0.1919 -0.0364 0.0268  -0.0239 110  GLU A C   
882  O O   . GLU A 110 ? 0.2022 0.1838 0.1731 -0.0290 0.0224  -0.0177 110  GLU A O   
883  C CB  . GLU A 110 ? 0.1653 0.1437 0.1363 -0.0404 0.0304  -0.0296 110  GLU A CB  
884  C CG  . GLU A 110 ? 0.1813 0.1555 0.1501 -0.0351 0.0221  -0.0200 110  GLU A CG  
885  C CD  . GLU A 110 ? 0.2845 0.2557 0.2567 -0.0343 0.0206  -0.0189 110  GLU A CD  
886  O OE1 . GLU A 110 ? 0.2105 0.1832 0.1900 -0.0359 0.0260  -0.0255 110  GLU A OE1 
887  O OE2 . GLU A 110 ? 0.2046 0.1720 0.1746 -0.0316 0.0140  -0.0117 110  GLU A OE2 
888  N N   . GLU A 111 ? 0.1770 0.1574 0.1304 -0.0455 0.0270  -0.0259 111  GLU A N   
889  C CA  . GLU A 111 ? 0.1883 0.1668 0.1336 -0.0461 0.0211  -0.0199 111  GLU A CA  
890  C C   . GLU A 111 ? 0.1785 0.1612 0.1338 -0.0376 0.0216  -0.0187 111  GLU A C   
891  O O   . GLU A 111 ? 0.1723 0.1538 0.1274 -0.0334 0.0162  -0.0132 111  GLU A O   
892  C CB  . GLU A 111 ? 0.1826 0.1606 0.1135 -0.0581 0.0218  -0.0221 111  GLU A CB  
893  C CG  . GLU A 111 ? 0.2199 0.1932 0.1371 -0.0683 0.0174  -0.0195 111  GLU A CG  
894  C CD  . GLU A 111 ? 0.3327 0.3006 0.2482 -0.0663 0.0068  -0.0091 111  GLU A CD  
895  O OE1 . GLU A 111 ? 0.2895 0.2547 0.2121 -0.0598 0.0035  -0.0056 111  GLU A OE1 
896  O OE2 . GLU A 111 ? 0.3151 0.2815 0.2239 -0.0716 0.0019  -0.0045 111  GLU A OE2 
897  N N   . PHE A 112 ? 0.1835 0.1714 0.1481 -0.0361 0.0280  -0.0243 112  PHE A N   
898  C CA  . PHE A 112 ? 0.1416 0.1340 0.1155 -0.0291 0.0278  -0.0226 112  PHE A CA  
899  C C   . PHE A 112 ? 0.1252 0.1188 0.1081 -0.0203 0.0244  -0.0173 112  PHE A C   
900  O O   . PHE A 112 ? 0.1233 0.1190 0.1074 -0.0157 0.0210  -0.0132 112  PHE A O   
901  C CB  . PHE A 112 ? 0.1996 0.1973 0.1851 -0.0296 0.0348  -0.0292 112  PHE A CB  
902  C CG  . PHE A 112 ? 0.2623 0.2650 0.2586 -0.0231 0.0336  -0.0265 112  PHE A CG  
903  C CD1 . PHE A 112 ? 0.3009 0.3042 0.2906 -0.0241 0.0314  -0.0250 112  PHE A CD1 
904  C CD2 . PHE A 112 ? 0.1630 0.1698 0.1760 -0.0167 0.0340  -0.0247 112  PHE A CD2 
905  C CE1 . PHE A 112 ? 0.3127 0.3210 0.3114 -0.0190 0.0299  -0.0225 112  PHE A CE1 
906  C CE2 . PHE A 112 ? 0.2098 0.2218 0.2318 -0.0121 0.0318  -0.0211 112  PHE A CE2 
907  C CZ  . PHE A 112 ? 0.2401 0.2529 0.2543 -0.0133 0.0299  -0.0203 112  PHE A CZ  
908  N N   . VAL A 113 ? 0.1448 0.1380 0.1346 -0.0184 0.0258  -0.0177 113  VAL A N   
909  C CA  . VAL A 113 ? 0.0927 0.0874 0.0901 -0.0110 0.0225  -0.0119 113  VAL A CA  
910  C C   . VAL A 113 ? 0.1532 0.1443 0.1415 -0.0097 0.0169  -0.0069 113  VAL A C   
911  O O   . VAL A 113 ? 0.1315 0.1256 0.1230 -0.0048 0.0145  -0.0030 113  VAL A O   
912  C CB  . VAL A 113 ? 0.1658 0.1602 0.1730 -0.0094 0.0245  -0.0127 113  VAL A CB  
913  C CG1 . VAL A 113 ? 0.1212 0.1174 0.1344 -0.0027 0.0206  -0.0057 113  VAL A CG1 
914  C CG2 . VAL A 113 ? 0.1114 0.1101 0.1342 -0.0095 0.0302  -0.0180 113  VAL A CG2 
915  N N   . LEU A 114 ? 0.1055 0.0907 0.0836 -0.0151 0.0148  -0.0070 114  LEU A N   
916  C CA  . LEU A 114 ? 0.1338 0.1151 0.1072 -0.0145 0.0091  -0.0025 114  LEU A CA  
917  C C   . LEU A 114 ? 0.1531 0.1361 0.1248 -0.0136 0.0072  -0.0017 114  LEU A C   
918  O O   . LEU A 114 ? 0.1551 0.1384 0.1296 -0.0099 0.0045  0.0007  114  LEU A O   
919  C CB  . LEU A 114 ? 0.1077 0.0822 0.0719 -0.0219 0.0060  -0.0017 114  LEU A CB  
920  C CG  . LEU A 114 ? 0.1794 0.1520 0.1448 -0.0233 0.0074  -0.0027 114  LEU A CG  
921  C CD1 . LEU A 114 ? 0.2243 0.1908 0.1789 -0.0323 0.0035  -0.0013 114  LEU A CD1 
922  C CD2 . LEU A 114 ? 0.2194 0.1923 0.1939 -0.0159 0.0058  0.0009  114  LEU A CD2 
923  N N   . ARG A 115 ? 0.1361 0.1204 0.1039 -0.0173 0.0091  -0.0046 115  ARG A N   
924  C CA  A ARG A 115 ? 0.1652 0.1516 0.1325 -0.0165 0.0075  -0.0043 115  ARG A CA  
925  C CA  B ARG A 115 ? 0.1837 0.1702 0.1510 -0.0165 0.0076  -0.0044 115  ARG A CA  
926  C C   . ARG A 115 ? 0.1911 0.1839 0.1658 -0.0098 0.0086  -0.0039 115  ARG A C   
927  O O   . ARG A 115 ? 0.1115 0.1056 0.0870 -0.0075 0.0063  -0.0030 115  ARG A O   
928  C CB  A ARG A 115 ? 0.2307 0.2180 0.1933 -0.0218 0.0098  -0.0075 115  ARG A CB  
929  C CB  B ARG A 115 ? 0.2285 0.2163 0.1916 -0.0216 0.0102  -0.0078 115  ARG A CB  
930  C CG  A ARG A 115 ? 0.2827 0.2645 0.2353 -0.0305 0.0075  -0.0067 115  ARG A CG  
931  C CG  B ARG A 115 ? 0.2865 0.2695 0.2397 -0.0307 0.0096  -0.0083 115  ARG A CG  
932  C CD  A ARG A 115 ? 0.2986 0.2822 0.2463 -0.0362 0.0096  -0.0094 115  ARG A CD  
933  C CD  B ARG A 115 ? 0.2772 0.2620 0.2256 -0.0363 0.0118  -0.0111 115  ARG A CD  
934  N NE  A ARG A 115 ? 0.2279 0.2068 0.1658 -0.0450 0.0052  -0.0064 115  ARG A NE  
935  N NE  B ARG A 115 ? 0.1969 0.1878 0.1534 -0.0315 0.0157  -0.0141 115  ARG A NE  
936  C CZ  A ARG A 115 ? 0.3171 0.2947 0.2454 -0.0542 0.0068  -0.0076 115  ARG A CZ  
937  C CZ  B ARG A 115 ? 0.1524 0.1467 0.1105 -0.0347 0.0213  -0.0190 115  ARG A CZ  
938  N NH1 A ARG A 115 ? 0.2039 0.1842 0.1326 -0.0552 0.0138  -0.0137 115  ARG A NH1 
939  N NH1 B ARG A 115 ? 0.1070 0.1000 0.0574 -0.0434 0.0246  -0.0225 115  ARG A NH1 
940  N NH2 A ARG A 115 ? 0.3098 0.2836 0.2288 -0.0633 0.0012  -0.0030 115  ARG A NH2 
941  N NH2 B ARG A 115 ? 0.0663 0.0660 0.0341 -0.0300 0.0236  -0.0205 115  ARG A NH2 
942  N N   . VAL A 116 ? 0.0943 0.0916 0.0753 -0.0074 0.0119  -0.0045 116  VAL A N   
943  C CA  . VAL A 116 ? 0.0841 0.0883 0.0718 -0.0026 0.0117  -0.0023 116  VAL A CA  
944  C C   . VAL A 116 ? 0.1057 0.1102 0.0939 0.0006  0.0096  0.0008  116  VAL A C   
945  O O   . VAL A 116 ? 0.1417 0.1503 0.1293 0.0021  0.0084  0.0015  116  VAL A O   
946  C CB  . VAL A 116 ? 0.1292 0.1379 0.1275 -0.0010 0.0145  -0.0021 116  VAL A CB  
947  C CG1 . VAL A 116 ? 0.1360 0.1521 0.1409 0.0028  0.0125  0.0026  116  VAL A CG1 
948  C CG2 . VAL A 116 ? 0.0899 0.0997 0.0903 -0.0040 0.0173  -0.0061 116  VAL A CG2 
949  N N   . MET A 117 ? 0.0667 0.0671 0.0560 0.0009  0.0096  0.0019  117  MET A N   
950  C CA  . MET A 117 ? 0.1100 0.1106 0.1009 0.0036  0.0081  0.0046  117  MET A CA  
951  C C   . MET A 117 ? 0.1213 0.1197 0.1087 0.0029  0.0060  0.0033  117  MET A C   
952  O O   . MET A 117 ? 0.1084 0.1112 0.0977 0.0048  0.0062  0.0033  117  MET A O   
953  C CB  . MET A 117 ? 0.1417 0.1370 0.1342 0.0035  0.0078  0.0058  117  MET A CB  
954  C CG  . MET A 117 ? 0.1391 0.1341 0.1345 0.0061  0.0064  0.0084  117  MET A CG  
955  S SD  . MET A 117 ? 0.2236 0.2131 0.2225 0.0063  0.0059  0.0104  117  MET A SD  
956  C CE  . MET A 117 ? 0.2495 0.2302 0.2408 0.0003  0.0034  0.0085  117  MET A CE  
957  N N   . THR A 118 ? 0.0833 0.0753 0.0670 -0.0007 0.0040  0.0021  118  THR A N   
958  C CA  . THR A 118 ? 0.0970 0.0858 0.0820 -0.0016 0.0011  0.0013  118  THR A CA  
959  C C   . THR A 118 ? 0.1319 0.1265 0.1174 -0.0007 0.0023  -0.0017 118  THR A C   
960  O O   . THR A 118 ? 0.1210 0.1182 0.1106 0.0009  0.0027  -0.0037 118  THR A O   
961  C CB  . THR A 118 ? 0.1513 0.1327 0.1324 -0.0070 -0.0024 0.0023  118  THR A CB  
962  O OG1 . THR A 118 ? 0.1351 0.1117 0.1144 -0.0091 -0.0037 0.0048  118  THR A OG1 
963  C CG2 . THR A 118 ? 0.1512 0.1290 0.1378 -0.0082 -0.0065 0.0024  118  THR A CG2 
964  N N   . GLN A 119 ? 0.1301 0.1271 0.1118 -0.0021 0.0032  -0.0028 119  GLN A N   
965  C CA  . GLN A 119 ? 0.0971 0.0990 0.0788 -0.0021 0.0036  -0.0056 119  GLN A CA  
966  C C   . GLN A 119 ? 0.1334 0.1443 0.1158 0.0003  0.0057  -0.0059 119  GLN A C   
967  O O   . GLN A 119 ? 0.1336 0.1488 0.1164 0.0000  0.0061  -0.0091 119  GLN A O   
968  C CB  . GLN A 119 ? 0.0497 0.0511 0.0278 -0.0049 0.0035  -0.0064 119  GLN A CB  
969  C CG  . GLN A 119 ? 0.1716 0.1649 0.1474 -0.0093 0.0006  -0.0057 119  GLN A CG  
970  C CD  . GLN A 119 ? 0.1770 0.1703 0.1487 -0.0132 0.0010  -0.0067 119  GLN A CD  
971  O OE1 . GLN A 119 ? 0.1292 0.1267 0.1018 -0.0126 0.0017  -0.0088 119  GLN A OE1 
972  N NE2 . GLN A 119 ? 0.1748 0.1635 0.1413 -0.0181 0.0007  -0.0054 119  GLN A NE2 
973  N N   . LEU A 120 ? 0.1358 0.1502 0.1190 0.0018  0.0067  -0.0024 120  LEU A N   
974  C CA  . LEU A 120 ? 0.1161 0.1395 0.0998 0.0028  0.0075  -0.0006 120  LEU A CA  
975  C C   . LEU A 120 ? 0.1221 0.1469 0.1065 0.0034  0.0085  -0.0015 120  LEU A C   
976  O O   . LEU A 120 ? 0.1668 0.1996 0.1492 0.0021  0.0097  -0.0025 120  LEU A O   
977  C CB  . LEU A 120 ? 0.0702 0.0972 0.0581 0.0040  0.0074  0.0046  120  LEU A CB  
978  C CG  . LEU A 120 ? 0.1100 0.1387 0.1007 0.0032  0.0071  0.0051  120  LEU A CG  
979  C CD1 . LEU A 120 ? 0.1722 0.2056 0.1722 0.0045  0.0065  0.0106  120  LEU A CD1 
980  C CD2 . LEU A 120 ? 0.2023 0.2365 0.1891 0.0012  0.0060  0.0033  120  LEU A CD2 
981  N N   . THR A 121 ? 0.0923 0.1103 0.0798 0.0047  0.0083  -0.0010 121  THR A N   
982  C CA  . THR A 121 ? 0.1022 0.1211 0.0928 0.0053  0.0098  -0.0025 121  THR A CA  
983  C C   . THR A 121 ? 0.1228 0.1421 0.1153 0.0037  0.0107  -0.0092 121  THR A C   
984  O O   . THR A 121 ? 0.1769 0.2020 0.1708 0.0028  0.0137  -0.0130 121  THR A O   
985  C CB  . THR A 121 ? 0.1466 0.1572 0.1417 0.0068  0.0085  -0.0003 121  THR A CB  
986  O OG1 . THR A 121 ? 0.1749 0.1859 0.1698 0.0082  0.0083  0.0046  121  THR A OG1 
987  C CG2 . THR A 121 ? 0.1684 0.1802 0.1691 0.0075  0.0103  -0.0023 121  THR A CG2 
988  N N   . LEU A 122 ? 0.1231 0.1366 0.1164 0.0027  0.0085  -0.0111 122  LEU A N   
989  C CA  . LEU A 122 ? 0.1334 0.1476 0.1311 0.0011  0.0092  -0.0176 122  LEU A CA  
990  C C   . LEU A 122 ? 0.1966 0.2207 0.1888 -0.0007 0.0116  -0.0213 122  LEU A C   
991  O O   . LEU A 122 ? 0.1739 0.2025 0.1693 -0.0024 0.0144  -0.0280 122  LEU A O   
992  C CB  . LEU A 122 ? 0.0912 0.0971 0.0920 -0.0001 0.0053  -0.0173 122  LEU A CB  
993  C CG  . LEU A 122 ? 0.1513 0.1484 0.1589 0.0001  0.0023  -0.0140 122  LEU A CG  
994  C CD1 . LEU A 122 ? 0.2224 0.2119 0.2285 -0.0027 -0.0026 -0.0103 122  LEU A CD1 
995  C CD2 . LEU A 122 ? 0.1873 0.1836 0.2087 0.0007  0.0031  -0.0187 122  LEU A CD2 
996  N N   . ALA A 123 ? 0.1714 0.1992 0.1564 -0.0011 0.0105  -0.0173 123  ALA A N   
997  C CA  . ALA A 123 ? 0.1830 0.2206 0.1625 -0.0037 0.0116  -0.0192 123  ALA A CA  
998  C C   . ALA A 123 ? 0.2055 0.2518 0.1824 -0.0053 0.0144  -0.0196 123  ALA A C   
999  O O   . ALA A 123 ? 0.1816 0.2357 0.1556 -0.0091 0.0171  -0.0254 123  ALA A O   
1000 C CB  . ALA A 123 ? 0.1433 0.1831 0.1190 -0.0036 0.0091  -0.0133 123  ALA A CB  
1001 N N   . LEU A 124 ? 0.1547 0.2003 0.1323 -0.0034 0.0142  -0.0136 124  LEU A N   
1002 C CA  . LEU A 124 ? 0.1426 0.1966 0.1179 -0.0055 0.0167  -0.0129 124  LEU A CA  
1003 C C   . LEU A 124 ? 0.1944 0.2490 0.1738 -0.0069 0.0214  -0.0217 124  LEU A C   
1004 O O   . LEU A 124 ? 0.2639 0.3282 0.2389 -0.0114 0.0250  -0.0260 124  LEU A O   
1005 C CB  . LEU A 124 ? 0.2040 0.2554 0.1820 -0.0026 0.0154  -0.0050 124  LEU A CB  
1006 C CG  . LEU A 124 ? 0.2573 0.3174 0.2330 -0.0048 0.0170  -0.0013 124  LEU A CG  
1007 C CD1 . LEU A 124 ? 0.3215 0.3938 0.2890 -0.0103 0.0158  0.0015  124  LEU A CD1 
1008 C CD2 . LEU A 124 ? 0.2879 0.3436 0.2689 -0.0011 0.0146  0.0070  124  LEU A CD2 
1009 N N   . LYS A 125 ? 0.1770 0.2216 0.1660 -0.0038 0.0212  -0.0246 125  LYS A N   
1010 C CA  . LYS A 125 ? 0.1919 0.2364 0.1901 -0.0048 0.0255  -0.0334 125  LYS A CA  
1011 C C   . LYS A 125 ? 0.2706 0.3217 0.2679 -0.0090 0.0288  -0.0431 125  LYS A C   
1012 O O   . LYS A 125 ? 0.2281 0.2865 0.2277 -0.0126 0.0346  -0.0513 125  LYS A O   
1013 C CB  . LYS A 125 ? 0.2077 0.2398 0.2182 -0.0014 0.0225  -0.0334 125  LYS A CB  
1014 C CG  . LYS A 125 ? 0.3557 0.3861 0.3820 -0.0017 0.0260  -0.0418 125  LYS A CG  
1015 C CD  . LYS A 125 ? 0.3956 0.4131 0.4341 0.0010  0.0204  -0.0383 125  LYS A CD  
1016 C CE  . LYS A 125 ? 0.4897 0.5036 0.5491 0.0011  0.0219  -0.0448 125  LYS A CE  
1017 N NZ  . LYS A 125 ? 0.3936 0.3953 0.4633 0.0024  0.0142  -0.0387 125  LYS A NZ  
1018 N N   . GLU A 126 ? 0.2197 0.2687 0.2142 -0.0091 0.0255  -0.0429 126  GLU A N   
1019 C CA  . GLU A 126 ? 0.2494 0.3044 0.2431 -0.0132 0.0281  -0.0519 126  GLU A CA  
1020 C C   . GLU A 126 ? 0.3011 0.3700 0.2810 -0.0190 0.0308  -0.0527 126  GLU A C   
1021 O O   . GLU A 126 ? 0.3507 0.4277 0.3301 -0.0242 0.0360  -0.0628 126  GLU A O   
1022 C CB  . GLU A 126 ? 0.3020 0.3514 0.2958 -0.0120 0.0234  -0.0502 126  GLU A CB  
1023 C CG  . GLU A 126 ? 0.3193 0.3752 0.3112 -0.0162 0.0252  -0.0586 126  GLU A CG  
1024 C CD  . GLU A 126 ? 0.3857 0.4406 0.3924 -0.0175 0.0297  -0.0709 126  GLU A CD  
1025 O OE1 . GLU A 126 ? 0.4020 0.4504 0.4222 -0.0148 0.0304  -0.0720 126  GLU A OE1 
1026 O OE2 . GLU A 126 ? 0.4515 0.5124 0.4582 -0.0216 0.0323  -0.0798 126  GLU A OE2 
1027 N N   . CYS A 127 ? 0.2398 0.3122 0.2096 -0.0190 0.0272  -0.0421 127  CYS A N   
1028 C CA  . CYS A 127 ? 0.2817 0.3678 0.2388 -0.0257 0.0282  -0.0402 127  CYS A CA  
1029 C C   . CYS A 127 ? 0.2521 0.3456 0.2084 -0.0298 0.0345  -0.0455 127  CYS A C   
1030 O O   . CYS A 127 ? 0.3621 0.4672 0.3102 -0.0377 0.0386  -0.0519 127  CYS A O   
1031 C CB  . CYS A 127 ? 0.2526 0.3410 0.2036 -0.0250 0.0222  -0.0265 127  CYS A CB  
1032 S SG  . CYS A 127 ? 0.3383 0.4216 0.2901 -0.0222 0.0159  -0.0212 127  CYS A SG  
1033 N N   . HIS A 128 ? 0.2647 0.3517 0.2293 -0.0253 0.0358  -0.0434 128  HIS A N   
1034 C CA  . HIS A 128 ? 0.3304 0.4243 0.2959 -0.0290 0.0423  -0.0484 128  HIS A CA  
1035 C C   . HIS A 128 ? 0.4489 0.5445 0.4229 -0.0320 0.0496  -0.0644 128  HIS A C   
1036 O O   . HIS A 128 ? 0.4619 0.5687 0.4315 -0.0393 0.0566  -0.0726 128  HIS A O   
1037 C CB  . HIS A 128 ? 0.2978 0.3834 0.2725 -0.0229 0.0414  -0.0426 128  HIS A CB  
1038 C CG  . HIS A 128 ? 0.3198 0.4058 0.2880 -0.0211 0.0359  -0.0285 128  HIS A CG  
1039 N ND1 . HIS A 128 ? 0.3270 0.4041 0.3027 -0.0150 0.0333  -0.0217 128  HIS A ND1 
1040 C CD2 . HIS A 128 ? 0.2724 0.3668 0.2293 -0.0250 0.0320  -0.0199 128  HIS A CD2 
1041 C CE1 . HIS A 128 ? 0.3487 0.4287 0.3190 -0.0148 0.0289  -0.0104 128  HIS A CE1 
1042 N NE2 . HIS A 128 ? 0.3577 0.4481 0.3177 -0.0207 0.0276  -0.0086 128  HIS A NE2 
1043 N N   . ARG A 129 ? 0.4174 0.5023 0.4049 -0.0270 0.0481  -0.0691 129  ARG A N   
1044 C CA  . ARG A 129 ? 0.4927 0.5779 0.4941 -0.0291 0.0545  -0.0843 129  ARG A CA  
1045 C C   . ARG A 129 ? 0.5463 0.6445 0.5368 -0.0378 0.0590  -0.0938 129  ARG A C   
1046 O O   . ARG A 129 ? 0.5518 0.6584 0.5455 -0.0439 0.0677  -0.1067 129  ARG A O   
1047 C CB  . ARG A 129 ? 0.4898 0.5617 0.5073 -0.0231 0.0500  -0.0853 129  ARG A CB  
1048 C CG  . ARG A 129 ? 0.6216 0.6923 0.6604 -0.0242 0.0557  -0.1001 129  ARG A CG  
1049 C CD  . ARG A 129 ? 0.6209 0.6795 0.6751 -0.0197 0.0498  -0.0993 129  ARG A CD  
1050 N NE  . ARG A 129 ? 0.7136 0.7737 0.7560 -0.0212 0.0460  -0.0976 129  ARG A NE  
1051 C CZ  . ARG A 129 ? 0.8311 0.8989 0.8725 -0.0264 0.0503  -0.1088 129  ARG A CZ  
1052 N NH1 . ARG A 129 ? 0.8558 0.9311 0.9070 -0.0310 0.0592  -0.1234 129  ARG A NH1 
1053 N NH2 . ARG A 129 ? 0.8627 0.9313 0.8939 -0.0274 0.0460  -0.1060 129  ARG A NH2 
1054 N N   . ARG A 130 ? 0.6990 0.7990 0.6765 -0.0391 0.0534  -0.0877 130  ARG A N   
1055 C CA  . ARG A 130 ? 0.7513 0.8635 0.7166 -0.0479 0.0561  -0.0951 130  ARG A CA  
1056 C C   . ARG A 130 ? 0.8581 0.9854 0.8089 -0.0575 0.0615  -0.0967 130  ARG A C   
1057 O O   . ARG A 130 ? 0.8510 0.9883 0.8004 -0.0657 0.0698  -0.1110 130  ARG A O   
1058 C CB  . ARG A 130 ? 0.7354 0.8470 0.6896 -0.0473 0.0477  -0.0850 130  ARG A CB  
1059 C CG  . ARG A 130 ? 0.7476 0.8457 0.7140 -0.0396 0.0427  -0.0836 130  ARG A CG  
1060 C CD  . ARG A 130 ? 0.7657 0.8619 0.7458 -0.0407 0.0472  -0.0987 130  ARG A CD  
1061 N N   . SER A 131 ? 0.8786 1.0080 0.8194 -0.0569 0.0570  -0.0824 131  SER A N   
1062 C CA  . SER A 131 ? 0.9455 1.0893 0.8720 -0.0664 0.0607  -0.0809 131  SER A CA  
1063 C C   . SER A 131 ? 0.9537 1.1000 0.8899 -0.0683 0.0711  -0.0929 131  SER A C   
1064 O O   . SER A 131 ? 0.9784 1.1374 0.9037 -0.0773 0.0762  -0.0942 131  SER A O   
1065 C CB  . SER A 131 ? 0.9762 1.1198 0.8953 -0.0641 0.0528  -0.0620 131  SER A CB  
1066 O OG  . SER A 131 ? 0.9908 1.1339 0.9029 -0.0635 0.0438  -0.0515 131  SER A OG  
1067 N N   . HIS A 139 ? 0.7707 0.9292 0.6660 -0.0709 -0.0024 0.0163  139  HIS A N   
1068 C CA  . HIS A 139 ? 0.7849 0.9295 0.6950 -0.0588 -0.0012 0.0179  139  HIS A CA  
1069 C C   . HIS A 139 ? 0.7011 0.8376 0.6240 -0.0516 -0.0076 0.0254  139  HIS A C   
1070 O O   . HIS A 139 ? 0.6783 0.8211 0.6032 -0.0554 -0.0154 0.0368  139  HIS A O   
1071 C CB  . HIS A 139 ? 0.7838 0.9314 0.6956 -0.0594 -0.0016 0.0268  139  HIS A CB  
1072 N N   . ARG A 140 ? 0.5956 0.7186 0.5279 -0.0422 -0.0044 0.0190  140  ARG A N   
1073 C CA  . ARG A 140 ? 0.4454 0.5604 0.3899 -0.0357 -0.0085 0.0237  140  ARG A CA  
1074 C C   . ARG A 140 ? 0.4038 0.5140 0.3605 -0.0303 -0.0106 0.0328  140  ARG A C   
1075 O O   . ARG A 140 ? 0.4459 0.5509 0.4041 -0.0266 -0.0065 0.0303  140  ARG A O   
1076 C CB  . ARG A 140 ? 0.2812 0.3848 0.2287 -0.0297 -0.0040 0.0127  140  ARG A CB  
1077 C CG  . ARG A 140 ? 0.3297 0.4366 0.2690 -0.0342 -0.0021 0.0030  140  ARG A CG  
1078 C CD  . ARG A 140 ? 0.3734 0.4689 0.3174 -0.0286 0.0024  -0.0073 140  ARG A CD  
1079 N NE  . ARG A 140 ? 0.4660 0.5644 0.4051 -0.0325 0.0041  -0.0168 140  ARG A NE  
1080 C CZ  . ARG A 140 ? 0.3748 0.4711 0.3161 -0.0320 0.0014  -0.0177 140  ARG A CZ  
1081 N NH1 . ARG A 140 ? 0.3527 0.4441 0.3011 -0.0279 -0.0023 -0.0103 140  ARG A NH1 
1082 N NH2 . ARG A 140 ? 0.3931 0.4922 0.3307 -0.0358 0.0031  -0.0269 140  ARG A NH2 
1083 N N   . ASP A 141 ? 0.3295 0.4415 0.2971 -0.0299 -0.0169 0.0429  141  ASP A N   
1084 C CA  . ASP A 141 ? 0.3247 0.4334 0.3068 -0.0256 -0.0192 0.0515  141  ASP A CA  
1085 C C   . ASP A 141 ? 0.3052 0.4005 0.2956 -0.0170 -0.0143 0.0449  141  ASP A C   
1086 O O   . ASP A 141 ? 0.2154 0.3045 0.2093 -0.0141 -0.0130 0.0396  141  ASP A O   
1087 C CB  . ASP A 141 ? 0.3692 0.4826 0.3656 -0.0270 -0.0270 0.0626  141  ASP A CB  
1088 C CG  . ASP A 141 ? 0.5342 0.6617 0.5250 -0.0366 -0.0342 0.0736  141  ASP A CG  
1089 O OD1 . ASP A 141 ? 0.5633 0.6963 0.5595 -0.0404 -0.0408 0.0801  141  ASP A OD1 
1090 O OD2 . ASP A 141 ? 0.5746 0.7081 0.5556 -0.0410 -0.0334 0.0762  141  ASP A OD2 
1091 N N   . LEU A 142 ? 0.3506 0.4420 0.3437 -0.0139 -0.0118 0.0456  142  LEU A N   
1092 C CA  . LEU A 142 ? 0.2826 0.3624 0.2845 -0.0072 -0.0084 0.0413  142  LEU A CA  
1093 C C   . LEU A 142 ? 0.2803 0.3597 0.3007 -0.0049 -0.0118 0.0489  142  LEU A C   
1094 O O   . LEU A 142 ? 0.3148 0.3952 0.3438 -0.0039 -0.0132 0.0552  142  LEU A O   
1095 C CB  . LEU A 142 ? 0.4083 0.4837 0.4061 -0.0051 -0.0045 0.0385  142  LEU A CB  
1096 C CG  . LEU A 142 ? 0.4780 0.5453 0.4677 -0.0032 0.0005  0.0277  142  LEU A CG  
1097 C CD1 . LEU A 142 ? 0.5239 0.5969 0.5020 -0.0076 0.0019  0.0222  142  LEU A CD1 
1098 C CD2 . LEU A 142 ? 0.4361 0.4984 0.4269 -0.0005 0.0032  0.0267  142  LEU A CD2 
1099 N N   . LYS A 143 ? 0.1697 0.2477 0.1983 -0.0042 -0.0130 0.0479  143  LYS A N   
1100 C CA  . LYS A 143 ? 0.1573 0.2350 0.2075 -0.0021 -0.0153 0.0531  143  LYS A CA  
1101 C C   . LYS A 143 ? 0.2256 0.2969 0.2807 0.0000  -0.0117 0.0451  143  LYS A C   
1102 O O   . LYS A 143 ? 0.2070 0.2775 0.2498 -0.0014 -0.0104 0.0395  143  LYS A O   
1103 C CB  . LYS A 143 ? 0.2593 0.3477 0.3192 -0.0064 -0.0233 0.0651  143  LYS A CB  
1104 C CG  . LYS A 143 ? 0.4156 0.5093 0.4686 -0.0105 -0.0262 0.0650  143  LYS A CG  
1105 C CD  . LYS A 143 ? 0.4545 0.5589 0.5196 -0.0155 -0.0356 0.0784  143  LYS A CD  
1106 C CE  . LYS A 143 ? 0.4779 0.5861 0.5384 -0.0191 -0.0384 0.0772  143  LYS A CE  
1107 N NZ  . LYS A 143 ? 0.6534 0.7716 0.7278 -0.0245 -0.0486 0.0910  143  LYS A NZ  
1108 N N   . PRO A 144 ? 0.1800 0.2471 0.2534 0.0029  -0.0097 0.0439  144  PRO A N   
1109 C CA  . PRO A 144 ? 0.2019 0.2630 0.2790 0.0040  -0.0047 0.0350  144  PRO A CA  
1110 C C   . PRO A 144 ? 0.2424 0.3076 0.3195 0.0017  -0.0070 0.0349  144  PRO A C   
1111 O O   . PRO A 144 ? 0.1875 0.2481 0.2553 0.0014  -0.0032 0.0271  144  PRO A O   
1112 C CB  . PRO A 144 ? 0.2078 0.2674 0.3095 0.0061  -0.0030 0.0352  144  PRO A CB  
1113 C CG  . PRO A 144 ? 0.1818 0.2418 0.2852 0.0075  -0.0047 0.0407  144  PRO A CG  
1114 C CD  . PRO A 144 ? 0.1905 0.2580 0.2816 0.0049  -0.0108 0.0493  144  PRO A CD  
1115 N N   . ALA A 145 ? 0.1243 0.1980 0.2120 -0.0004 -0.0138 0.0443  145  ALA A N   
1116 C CA  . ALA A 145 ? 0.1737 0.2516 0.2625 -0.0030 -0.0168 0.0451  145  ALA A CA  
1117 C C   . ALA A 145 ? 0.1847 0.2632 0.2485 -0.0055 -0.0165 0.0408  145  ALA A C   
1118 O O   . ALA A 145 ? 0.2309 0.3113 0.2927 -0.0074 -0.0178 0.0392  145  ALA A O   
1119 C CB  . ALA A 145 ? 0.2156 0.3033 0.3205 -0.0059 -0.0258 0.0580  145  ALA A CB  
1120 N N   . ASN A 146 ? 0.1594 0.2366 0.2064 -0.0057 -0.0149 0.0391  146  ASN A N   
1121 C CA  . ASN A 146 ? 0.1993 0.2775 0.2260 -0.0083 -0.0143 0.0342  146  ASN A CA  
1122 C C   . ASN A 146 ? 0.1398 0.2082 0.1564 -0.0057 -0.0079 0.0241  146  ASN A C   
1123 O O   . ASN A 146 ? 0.1722 0.2401 0.1746 -0.0071 -0.0066 0.0194  146  ASN A O   
1124 C CB  . ASN A 146 ? 0.2013 0.2871 0.2169 -0.0121 -0.0172 0.0391  146  ASN A CB  
1125 C CG  . ASN A 146 ? 0.2841 0.3734 0.2821 -0.0162 -0.0166 0.0335  146  ASN A CG  
1126 O OD1 . ASN A 146 ? 0.2362 0.3264 0.2333 -0.0177 -0.0177 0.0307  146  ASN A OD1 
1127 N ND2 . ASN A 146 ? 0.1855 0.2770 0.1712 -0.0182 -0.0145 0.0310  146  ASN A ND2 
1128 N N   . VAL A 147 ? 0.1243 0.1854 0.1493 -0.0027 -0.0042 0.0208  147  VAL A N   
1129 C CA  . VAL A 147 ? 0.0797 0.1317 0.0955 -0.0015 0.0006  0.0129  147  VAL A CA  
1130 C C   . VAL A 147 ? 0.1442 0.1923 0.1644 -0.0020 0.0033  0.0080  147  VAL A C   
1131 O O   . VAL A 147 ? 0.1168 0.1656 0.1515 -0.0015 0.0045  0.0088  147  VAL A O   
1132 C CB  . VAL A 147 ? 0.1528 0.1995 0.1706 0.0007  0.0031  0.0127  147  VAL A CB  
1133 C CG1 . VAL A 147 ? 0.0828 0.1201 0.0915 0.0005  0.0068  0.0057  147  VAL A CG1 
1134 C CG2 . VAL A 147 ? 0.1471 0.1979 0.1605 0.0010  0.0009  0.0174  147  VAL A CG2 
1135 N N   . PHE A 148 ? 0.1715 0.2157 0.1812 -0.0035 0.0046  0.0027  148  PHE A N   
1136 C CA  . PHE A 148 ? 0.1686 0.2108 0.1806 -0.0051 0.0064  -0.0012 148  PHE A CA  
1137 C C   . PHE A 148 ? 0.1589 0.1928 0.1628 -0.0066 0.0098  -0.0065 148  PHE A C   
1138 O O   . PHE A 148 ? 0.2098 0.2398 0.2049 -0.0064 0.0091  -0.0072 148  PHE A O   
1139 C CB  . PHE A 148 ? 0.1250 0.1722 0.1335 -0.0068 0.0031  -0.0011 148  PHE A CB  
1140 C CG  . PHE A 148 ? 0.1637 0.2199 0.1794 -0.0071 -0.0014 0.0054  148  PHE A CG  
1141 C CD1 . PHE A 148 ? 0.1445 0.2058 0.1530 -0.0079 -0.0044 0.0087  148  PHE A CD1 
1142 C CD2 . PHE A 148 ? 0.1366 0.1966 0.1678 -0.0071 -0.0025 0.0085  148  PHE A CD2 
1143 C CE1 . PHE A 148 ? 0.1785 0.2488 0.1925 -0.0098 -0.0095 0.0163  148  PHE A CE1 
1144 C CE2 . PHE A 148 ? 0.1814 0.2498 0.2211 -0.0082 -0.0082 0.0165  148  PHE A CE2 
1145 C CZ  . PHE A 148 ? 0.1886 0.2623 0.2186 -0.0099 -0.0121 0.0209  148  PHE A CZ  
1146 N N   . LEU A 149 ? 0.1169 0.1487 0.1246 -0.0088 0.0131  -0.0099 149  LEU A N   
1147 C CA  . LEU A 149 ? 0.1274 0.1524 0.1270 -0.0122 0.0160  -0.0140 149  LEU A CA  
1148 C C   . LEU A 149 ? 0.2055 0.2302 0.2019 -0.0154 0.0161  -0.0164 149  LEU A C   
1149 O O   . LEU A 149 ? 0.1523 0.1812 0.1574 -0.0157 0.0174  -0.0173 149  LEU A O   
1150 C CB  . LEU A 149 ? 0.1069 0.1307 0.1136 -0.0138 0.0213  -0.0169 149  LEU A CB  
1151 C CG  . LEU A 149 ? 0.2711 0.2953 0.2841 -0.0106 0.0214  -0.0145 149  LEU A CG  
1152 C CD1 . LEU A 149 ? 0.3888 0.4131 0.4135 -0.0121 0.0272  -0.0188 149  LEU A CD1 
1153 C CD2 . LEU A 149 ? 0.1599 0.1785 0.1608 -0.0107 0.0195  -0.0134 149  LEU A CD2 
1154 N N   . ASP A 150 ? 0.1601 0.1800 0.1463 -0.0179 0.0142  -0.0171 150  ASP A N   
1155 C CA  . ASP A 150 ? 0.1217 0.1412 0.1057 -0.0214 0.0139  -0.0189 150  ASP A CA  
1156 C C   . ASP A 150 ? 0.1855 0.2015 0.1655 -0.0275 0.0180  -0.0214 150  ASP A C   
1157 O O   . ASP A 150 ? 0.2028 0.2182 0.1842 -0.0286 0.0219  -0.0230 150  ASP A O   
1158 C CB  . ASP A 150 ? 0.1809 0.1979 0.1593 -0.0214 0.0092  -0.0181 150  ASP A CB  
1159 C CG  . ASP A 150 ? 0.2563 0.2662 0.2280 -0.0242 0.0075  -0.0169 150  ASP A CG  
1160 O OD1 . ASP A 150 ? 0.2277 0.2348 0.1963 -0.0267 0.0098  -0.0166 150  ASP A OD1 
1161 O OD2 . ASP A 150 ? 0.2543 0.2617 0.2254 -0.0243 0.0036  -0.0163 150  ASP A OD2 
1162 N N   . GLY A 151 ? 0.1672 0.1815 0.1425 -0.0322 0.0172  -0.0220 151  GLY A N   
1163 C CA  . GLY A 151 ? 0.2383 0.2508 0.2085 -0.0398 0.0215  -0.0244 151  GLY A CA  
1164 C C   . GLY A 151 ? 0.2276 0.2341 0.1861 -0.0456 0.0189  -0.0219 151  GLY A C   
1165 O O   . GLY A 151 ? 0.2157 0.2210 0.1667 -0.0541 0.0213  -0.0229 151  GLY A O   
1166 N N   . LYS A 152 ? 0.1823 0.1854 0.1396 -0.0417 0.0139  -0.0184 152  LYS A N   
1167 C CA  . LYS A 152 ? 0.1903 0.1873 0.1397 -0.0466 0.0094  -0.0144 152  LYS A CA  
1168 C C   . LYS A 152 ? 0.2464 0.2409 0.1952 -0.0437 0.0087  -0.0131 152  LYS A C   
1169 O O   . LYS A 152 ? 0.2417 0.2312 0.1879 -0.0452 0.0033  -0.0089 152  LYS A O   
1170 C CB  . LYS A 152 ? 0.2095 0.2039 0.1618 -0.0452 0.0026  -0.0109 152  LYS A CB  
1171 C CG  . LYS A 152 ? 0.3356 0.3319 0.2889 -0.0484 0.0022  -0.0115 152  LYS A CG  
1172 C CD  . LYS A 152 ? 0.4274 0.4211 0.3864 -0.0474 -0.0045 -0.0088 152  LYS A CD  
1173 C CE  . LYS A 152 ? 0.4868 0.4836 0.4540 -0.0388 -0.0047 -0.0120 152  LYS A CE  
1174 N NZ  . LYS A 152 ? 0.5528 0.5490 0.5272 -0.0386 -0.0090 -0.0123 152  LYS A NZ  
1175 N N   . GLN A 153 ? 0.1893 0.1872 0.1425 -0.0397 0.0137  -0.0163 153  GLN A N   
1176 C CA  . GLN A 153 ? 0.2452 0.2411 0.1989 -0.0369 0.0137  -0.0154 153  GLN A CA  
1177 C C   . GLN A 153 ? 0.2621 0.2579 0.2209 -0.0294 0.0097  -0.0126 153  GLN A C   
1178 O O   . GLN A 153 ? 0.3496 0.3424 0.3079 -0.0279 0.0079  -0.0105 153  GLN A O   
1179 C CB  . GLN A 153 ? 0.2688 0.2594 0.2126 -0.0446 0.0121  -0.0136 153  GLN A CB  
1180 C CG  . GLN A 153 ? 0.3157 0.3080 0.2532 -0.0532 0.0179  -0.0180 153  GLN A CG  
1181 C CD  . GLN A 153 ? 0.3308 0.3188 0.2566 -0.0623 0.0162  -0.0162 153  GLN A CD  
1182 O OE1 . GLN A 153 ? 0.3704 0.3539 0.2904 -0.0662 0.0089  -0.0098 153  GLN A OE1 
1183 N NE2 . GLN A 153 ? 0.2870 0.2769 0.2107 -0.0663 0.0228  -0.0219 153  GLN A NE2 
1184 N N   . ASN A 154 ? 0.1589 0.1585 0.1225 -0.0256 0.0086  -0.0130 154  ASN A N   
1185 C CA  . ASN A 154 ? 0.1190 0.1199 0.0865 -0.0200 0.0059  -0.0119 154  ASN A CA  
1186 C C   . ASN A 154 ? 0.2198 0.2272 0.1928 -0.0152 0.0084  -0.0122 154  ASN A C   
1187 O O   . ASN A 154 ? 0.2227 0.2340 0.1995 -0.0154 0.0111  -0.0134 154  ASN A O   
1188 C CB  . ASN A 154 ? 0.1504 0.1516 0.1194 -0.0201 0.0027  -0.0126 154  ASN A CB  
1189 C CG  . ASN A 154 ? 0.2748 0.2695 0.2414 -0.0253 -0.0012 -0.0106 154  ASN A CG  
1190 O OD1 . ASN A 154 ? 0.2145 0.2042 0.1795 -0.0272 -0.0035 -0.0078 154  ASN A OD1 
1191 N ND2 . ASN A 154 ? 0.1551 0.1500 0.1223 -0.0282 -0.0026 -0.0112 154  ASN A ND2 
1192 N N   . VAL A 155 ? 0.1381 0.1469 0.1128 -0.0113 0.0071  -0.0108 155  VAL A N   
1193 C CA  . VAL A 155 ? 0.1056 0.1208 0.0854 -0.0077 0.0082  -0.0092 155  VAL A CA  
1194 C C   . VAL A 155 ? 0.1294 0.1497 0.1089 -0.0059 0.0062  -0.0092 155  VAL A C   
1195 O O   . VAL A 155 ? 0.2285 0.2463 0.2060 -0.0057 0.0051  -0.0105 155  VAL A O   
1196 C CB  . VAL A 155 ? 0.1334 0.1464 0.1144 -0.0059 0.0089  -0.0071 155  VAL A CB  
1197 C CG1 . VAL A 155 ? 0.1242 0.1438 0.1120 -0.0028 0.0094  -0.0042 155  VAL A CG1 
1198 C CG2 . VAL A 155 ? 0.0751 0.0821 0.0541 -0.0092 0.0110  -0.0083 155  VAL A CG2 
1199 N N   . LYS A 156 ? 0.1339 0.1616 0.1162 -0.0053 0.0058  -0.0079 156  LYS A N   
1200 C CA  . LYS A 156 ? 0.1267 0.1605 0.1065 -0.0056 0.0042  -0.0089 156  LYS A CA  
1201 C C   . LYS A 156 ? 0.2304 0.2727 0.2125 -0.0051 0.0030  -0.0043 156  LYS A C   
1202 O O   . LYS A 156 ? 0.2094 0.2542 0.1982 -0.0046 0.0025  -0.0005 156  LYS A O   
1203 C CB  . LYS A 156 ? 0.1231 0.1584 0.1020 -0.0077 0.0032  -0.0119 156  LYS A CB  
1204 C CG  . LYS A 156 ? 0.2508 0.2790 0.2281 -0.0090 0.0031  -0.0158 156  LYS A CG  
1205 C CD  . LYS A 156 ? 0.3488 0.3745 0.3273 -0.0110 0.0034  -0.0159 156  LYS A CD  
1206 C CE  . LYS A 156 ? 0.3680 0.3864 0.3449 -0.0134 0.0024  -0.0177 156  LYS A CE  
1207 N NZ  . LYS A 156 ? 0.2482 0.2675 0.2267 -0.0140 0.0004  -0.0212 156  LYS A NZ  
1208 N N   . LEU A 157 ? 0.1626 0.2099 0.1403 -0.0060 0.0026  -0.0046 157  LEU A N   
1209 C CA  . LEU A 157 ? 0.1575 0.2139 0.1353 -0.0073 0.0007  0.0008  157  LEU A CA  
1210 C C   . LEU A 157 ? 0.1713 0.2357 0.1459 -0.0111 -0.0017 0.0005  157  LEU A C   
1211 O O   . LEU A 157 ? 0.1621 0.2266 0.1315 -0.0129 -0.0007 -0.0059 157  LEU A O   
1212 C CB  . LEU A 157 ? 0.1984 0.2567 0.1715 -0.0077 0.0024  -0.0003 157  LEU A CB  
1213 C CG  . LEU A 157 ? 0.3290 0.3964 0.3011 -0.0098 0.0007  0.0063  157  LEU A CG  
1214 C CD1 . LEU A 157 ? 0.2925 0.3581 0.2742 -0.0069 -0.0010 0.0139  157  LEU A CD1 
1215 C CD2 . LEU A 157 ? 0.2503 0.3192 0.2172 -0.0108 0.0038  0.0029  157  LEU A CD2 
1216 N N   . GLY A 158 ? 0.1465 0.2262 0.1477 -0.0412 0.0369  -0.0553 158  GLY A N   
1217 C CA  . GLY A 158 ? 0.1851 0.2775 0.1874 -0.0467 0.0362  -0.0608 158  GLY A CA  
1218 C C   . GLY A 158 ? 0.2639 0.3633 0.2583 -0.0521 0.0335  -0.0615 158  GLY A C   
1219 O O   . GLY A 158 ? 0.2119 0.3056 0.2007 -0.0526 0.0346  -0.0593 158  GLY A O   
1220 N N   . ASP A 159 ? 0.2855 0.3977 0.2794 -0.0567 0.0299  -0.0647 159  ASP A N   
1221 C CA  . ASP A 159 ? 0.2864 0.4056 0.2710 -0.0642 0.0285  -0.0670 159  ASP A CA  
1222 C C   . ASP A 159 ? 0.3945 0.5201 0.3714 -0.0634 0.0180  -0.0600 159  ASP A C   
1223 O O   . ASP A 159 ? 0.4332 0.5651 0.4003 -0.0705 0.0158  -0.0614 159  ASP A O   
1224 C CB  . ASP A 159 ? 0.2837 0.4129 0.2705 -0.0720 0.0317  -0.0761 159  ASP A CB  
1225 C CG  . ASP A 159 ? 0.4625 0.6040 0.4556 -0.0708 0.0244  -0.0758 159  ASP A CG  
1226 O OD1 . ASP A 159 ? 0.3715 0.5159 0.3649 -0.0653 0.0154  -0.0683 159  ASP A OD1 
1227 O OD2 . ASP A 159 ? 0.5698 0.7182 0.5688 -0.0754 0.0279  -0.0834 159  ASP A OD2 
1228 N N   . PHE A 160 ? 0.3212 0.4446 0.3019 -0.0555 0.0116  -0.0525 160  PHE A N   
1229 C CA  . PHE A 160 ? 0.3678 0.4949 0.3418 -0.0539 0.0016  -0.0445 160  PHE A CA  
1230 C C   . PHE A 160 ? 0.4671 0.5885 0.4277 -0.0581 0.0029  -0.0423 160  PHE A C   
1231 O O   . PHE A 160 ? 0.4118 0.5228 0.3720 -0.0570 0.0099  -0.0431 160  PHE A O   
1232 C CB  . PHE A 160 ? 0.2566 0.3789 0.2379 -0.0443 -0.0034 -0.0372 160  PHE A CB  
1233 C CG  . PHE A 160 ? 0.4912 0.6221 0.4854 -0.0407 -0.0071 -0.0384 160  PHE A CG  
1234 C CD1 . PHE A 160 ? 0.4618 0.5869 0.4663 -0.0339 -0.0044 -0.0380 160  PHE A CD1 
1235 C CD2 . PHE A 160 ? 0.5589 0.7040 0.5550 -0.0449 -0.0130 -0.0406 160  PHE A CD2 
1236 C CE1 . PHE A 160 ? 0.4281 0.5613 0.4457 -0.0312 -0.0067 -0.0401 160  PHE A CE1 
1237 C CE2 . PHE A 160 ? 0.5001 0.6541 0.5106 -0.0417 -0.0162 -0.0423 160  PHE A CE2 
1238 C CZ  . PHE A 160 ? 0.4311 0.5791 0.4528 -0.0347 -0.0126 -0.0423 160  PHE A CZ  
1239 N N   . GLY A 161 ? 0.4764 0.6047 0.4259 -0.0635 -0.0035 -0.0396 161  GLY A N   
1240 C CA  . GLY A 161 ? 0.5815 0.7050 0.5167 -0.0693 -0.0014 -0.0383 161  GLY A CA  
1241 C C   . GLY A 161 ? 0.7169 0.8421 0.6463 -0.0792 0.0076  -0.0481 161  GLY A C   
1242 O O   . GLY A 161 ? 0.7852 0.9101 0.7009 -0.0867 0.0088  -0.0485 161  GLY A O   
1243 N N   . LEU A 162 ? 0.6925 0.8192 0.6322 -0.0798 0.0146  -0.0562 162  LEU A N   
1244 C CA  . LEU A 162 ? 0.7953 0.9221 0.7327 -0.0885 0.0247  -0.0663 162  LEU A CA  
1245 C C   . LEU A 162 ? 0.8665 1.0063 0.8002 -0.0970 0.0229  -0.0727 162  LEU A C   
1246 O O   . LEU A 162 ? 0.9380 1.0862 0.8779 -0.0944 0.0161  -0.0715 162  LEU A O   
1247 C CB  . LEU A 162 ? 0.8291 0.9474 0.7801 -0.0843 0.0343  -0.0712 162  LEU A CB  
1248 C CG  . LEU A 162 ? 0.8676 0.9823 0.8204 -0.0912 0.0464  -0.0810 162  LEU A CG  
1249 C CD1 . LEU A 162 ? 0.8995 1.0216 0.8568 -0.0969 0.0503  -0.0901 162  LEU A CD1 
1250 C CD2 . LEU A 162 ? 0.9218 1.0366 0.8615 -0.0993 0.0489  -0.0828 162  LEU A CD2 
1251 N N   . PHE A 176 ? 0.8530 0.9767 0.7815 -0.0308 -0.1036 0.0578  176  PHE A N   
1252 C CA  . PHE A 176 ? 0.7611 0.8770 0.6791 -0.0303 -0.1130 0.0711  176  PHE A CA  
1253 C C   . PHE A 176 ? 0.7149 0.8238 0.6519 -0.0181 -0.1168 0.0779  176  PHE A C   
1254 O O   . PHE A 176 ? 0.7632 0.8582 0.6946 -0.0158 -0.1150 0.0842  176  PHE A O   
1255 C CB  . PHE A 176 ? 0.7584 0.8850 0.6666 -0.0360 -0.1272 0.0779  176  PHE A CB  
1256 C CG  . PHE A 176 ? 0.7207 0.8399 0.6231 -0.0332 -0.1395 0.0933  176  PHE A CG  
1257 C CD1 . PHE A 176 ? 0.7510 0.8582 0.6287 -0.0402 -0.1386 0.1000  176  PHE A CD1 
1258 C CD2 . PHE A 176 ? 0.7405 0.8645 0.6633 -0.0236 -0.1516 0.1010  176  PHE A CD2 
1259 C CE1 . PHE A 176 ? 0.7812 0.8802 0.6527 -0.0379 -0.1498 0.1148  176  PHE A CE1 
1260 C CE2 . PHE A 176 ? 0.7717 0.8878 0.6902 -0.0206 -0.1633 0.1159  176  PHE A CE2 
1261 C CZ  . PHE A 176 ? 0.7873 0.8905 0.6793 -0.0278 -0.1625 0.1232  176  PHE A CZ  
1262 N N   . VAL A 177 ? 0.6637 0.7825 0.6239 -0.0108 -0.1216 0.0761  177  VAL A N   
1263 C CA  . VAL A 177 ? 0.6931 0.8064 0.6744 0.0008  -0.1242 0.0809  177  VAL A CA  
1264 C C   . VAL A 177 ? 0.7154 0.8157 0.7006 0.0047  -0.1107 0.0754  177  VAL A C   
1265 O O   . VAL A 177 ? 0.7056 0.7945 0.6965 0.0110  -0.1110 0.0814  177  VAL A O   
1266 C CB  . VAL A 177 ? 0.7539 0.8815 0.7615 0.0072  -0.1295 0.0774  177  VAL A CB  
1267 C CG1 . VAL A 177 ? 0.8020 0.9232 0.8329 0.0188  -0.1297 0.0804  177  VAL A CG1 
1268 C CG2 . VAL A 177 ? 0.8124 0.9532 0.8181 0.0040  -0.1449 0.0841  177  VAL A CG2 
1269 N N   . GLY A 178 ? 0.6916 0.7933 0.6733 0.0006  -0.0993 0.0643  178  GLY A N   
1270 C CA  . GLY A 178 ? 0.6910 0.7822 0.6773 0.0041  -0.0874 0.0584  178  GLY A CA  
1271 C C   . GLY A 178 ? 0.7006 0.7768 0.6716 0.0019  -0.0829 0.0627  178  GLY A C   
1272 O O   . GLY A 178 ? 0.6954 0.7693 0.6473 -0.0053 -0.0848 0.0667  178  GLY A O   
1273 N N   . THR A 179 ? 0.7141 0.7800 0.6934 0.0076  -0.0765 0.0612  179  THR A N   
1274 C CA  . THR A 179 ? 0.7158 0.7681 0.6829 0.0055  -0.0707 0.0632  179  THR A CA  
1275 C C   . THR A 179 ? 0.5511 0.6038 0.5097 -0.0005 -0.0605 0.0538  179  THR A C   
1276 O O   . THR A 179 ? 0.5284 0.5856 0.4966 0.0011  -0.0551 0.0457  179  THR A O   
1277 C CB  . THR A 179 ? 0.7670 0.8088 0.7468 0.0133  -0.0676 0.0642  179  THR A CB  
1278 O OG1 . THR A 179 ? 0.7954 0.8388 0.7893 0.0202  -0.0762 0.0708  179  THR A OG1 
1279 C CG2 . THR A 179 ? 0.7542 0.7822 0.7219 0.0111  -0.0639 0.0682  179  THR A CG2 
1280 N N   . PRO A 180 ? 0.5484 0.5961 0.4897 -0.0077 -0.0574 0.0549  180  PRO A N   
1281 C CA  . PRO A 180 ? 0.5168 0.5651 0.4524 -0.0132 -0.0477 0.0460  180  PRO A CA  
1282 C C   . PRO A 180 ? 0.3558 0.3938 0.2962 -0.0100 -0.0399 0.0428  180  PRO A C   
1283 O O   . PRO A 180 ? 0.4312 0.4623 0.3623 -0.0141 -0.0351 0.0427  180  PRO A O   
1284 C CB  . PRO A 180 ? 0.5404 0.5873 0.4566 -0.0224 -0.0477 0.0486  180  PRO A CB  
1285 C CG  . PRO A 180 ? 0.5635 0.6081 0.4736 -0.0217 -0.0581 0.0600  180  PRO A CG  
1286 C CD  . PRO A 180 ? 0.5450 0.5860 0.4718 -0.0114 -0.0622 0.0642  180  PRO A CD  
1287 N N   . TYR A 181 ? 0.3954 0.4327 0.3501 -0.0031 -0.0386 0.0401  181  TYR A N   
1288 C CA  . TYR A 181 ? 0.4118 0.4396 0.3711 0.0001  -0.0324 0.0375  181  TYR A CA  
1289 C C   . TYR A 181 ? 0.3903 0.4150 0.3429 -0.0049 -0.0247 0.0321  181  TYR A C   
1290 O O   . TYR A 181 ? 0.3551 0.3709 0.3068 -0.0043 -0.0213 0.0325  181  TYR A O   
1291 C CB  . TYR A 181 ? 0.3562 0.3862 0.3298 0.0058  -0.0306 0.0328  181  TYR A CB  
1292 C CG  . TYR A 181 ? 0.4309 0.4615 0.4156 0.0121  -0.0365 0.0372  181  TYR A CG  
1293 C CD1 . TYR A 181 ? 0.4405 0.4819 0.4344 0.0140  -0.0408 0.0362  181  TYR A CD1 
1294 C CD2 . TYR A 181 ? 0.4033 0.4239 0.3907 0.0161  -0.0375 0.0422  181  TYR A CD2 
1295 C CE1 . TYR A 181 ? 0.4813 0.5236 0.4885 0.0203  -0.0462 0.0400  181  TYR A CE1 
1296 C CE2 . TYR A 181 ? 0.4796 0.5001 0.4793 0.0222  -0.0424 0.0460  181  TYR A CE2 
1297 C CZ  . TYR A 181 ? 0.5583 0.5899 0.5687 0.0246  -0.0468 0.0450  181  TYR A CZ  
1298 O OH  . TYR A 181 ? 0.5900 0.6219 0.6157 0.0312  -0.0516 0.0486  181  TYR A OH  
1299 N N   . TYR A 182 ? 0.3379 0.3702 0.2876 -0.0096 -0.0219 0.0266  182  TYR A N   
1300 C CA  . TYR A 182 ? 0.4318 0.4618 0.3790 -0.0135 -0.0143 0.0207  182  TYR A CA  
1301 C C   . TYR A 182 ? 0.4944 0.5238 0.4300 -0.0210 -0.0118 0.0208  182  TYR A C   
1302 O O   . TYR A 182 ? 0.5035 0.5327 0.4392 -0.0245 -0.0053 0.0151  182  TYR A O   
1303 C CB  . TYR A 182 ? 0.3409 0.3779 0.2936 -0.0145 -0.0108 0.0134  182  TYR A CB  
1304 C CG  . TYR A 182 ? 0.3260 0.3623 0.2895 -0.0087 -0.0101 0.0110  182  TYR A CG  
1305 C CD1 . TYR A 182 ? 0.3183 0.3503 0.2872 -0.0028 -0.0134 0.0150  182  TYR A CD1 
1306 C CD2 . TYR A 182 ? 0.2153 0.2545 0.1832 -0.0096 -0.0055 0.0046  182  TYR A CD2 
1307 C CE1 . TYR A 182 ? 0.3661 0.3974 0.3440 0.0014  -0.0117 0.0119  182  TYR A CE1 
1308 C CE2 . TYR A 182 ? 0.2407 0.2787 0.2166 -0.0054 -0.0043 0.0024  182  TYR A CE2 
1309 C CZ  . TYR A 182 ? 0.3057 0.3400 0.2862 -0.0002 -0.0072 0.0057  182  TYR A CZ  
1310 O OH  . TYR A 182 ? 0.2978 0.3304 0.2852 0.0029  -0.0048 0.0026  182  TYR A OH  
1311 N N   . MET A 183 ? 0.5078 0.5368 0.4336 -0.0238 -0.0165 0.0270  183  MET A N   
1312 C CA  . MET A 183 ? 0.4975 0.5254 0.4108 -0.0321 -0.0130 0.0265  183  MET A CA  
1313 C C   . MET A 183 ? 0.3961 0.4149 0.3101 -0.0325 -0.0072 0.0258  183  MET A C   
1314 O O   . MET A 183 ? 0.2596 0.2712 0.1772 -0.0276 -0.0093 0.0303  183  MET A O   
1315 C CB  . MET A 183 ? 0.4705 0.4989 0.3708 -0.0359 -0.0197 0.0342  183  MET A CB  
1316 C CG  . MET A 183 ? 0.4428 0.4617 0.3411 -0.0323 -0.0241 0.0432  183  MET A CG  
1317 S SD  . MET A 183 ? 0.6632 0.6802 0.5419 -0.0393 -0.0307 0.0527  183  MET A SD  
1318 C CE  . MET A 183 ? 0.5141 0.5184 0.3962 -0.0325 -0.0352 0.0628  183  MET A CE  
1319 N N   . SER A 184 ? 0.3489 0.3685 0.2607 -0.0385 0.0002  0.0196  184  SER A N   
1320 C CA  . SER A 184 ? 0.3890 0.4017 0.3035 -0.0395 0.0059  0.0179  184  SER A CA  
1321 C C   . SER A 184 ? 0.3638 0.3706 0.2661 -0.0446 0.0059  0.0231  184  SER A C   
1322 O O   . SER A 184 ? 0.4225 0.4313 0.3122 -0.0494 0.0027  0.0269  184  SER A O   
1323 C CB  . SER A 184 ? 0.4518 0.4679 0.3712 -0.0438 0.0140  0.0091  184  SER A CB  
1324 O OG  . SER A 184 ? 0.4833 0.5040 0.3920 -0.0524 0.0170  0.0064  184  SER A OG  
1325 N N   . PRO A 185 ? 0.3866 0.3862 0.2924 -0.0442 0.0093  0.0234  185  PRO A N   
1326 C CA  . PRO A 185 ? 0.4242 0.4169 0.3190 -0.0495 0.0105  0.0280  185  PRO A CA  
1327 C C   . PRO A 185 ? 0.4995 0.4953 0.3813 -0.0599 0.0154  0.0252  185  PRO A C   
1328 O O   . PRO A 185 ? 0.4869 0.4796 0.3535 -0.0649 0.0127  0.0313  185  PRO A O   
1329 C CB  . PRO A 185 ? 0.4790 0.4662 0.3835 -0.0483 0.0157  0.0249  185  PRO A CB  
1330 C CG  . PRO A 185 ? 0.3827 0.3717 0.3017 -0.0402 0.0138  0.0222  185  PRO A CG  
1331 C CD  . PRO A 185 ? 0.3454 0.3427 0.2654 -0.0390 0.0120  0.0194  185  PRO A CD  
1332 N N   . GLU A 186 ? 0.5679 0.5692 0.4554 -0.0636 0.0227  0.0160  186  GLU A N   
1333 C CA  . GLU A 186 ? 0.6155 0.6194 0.4917 -0.0744 0.0294  0.0115  186  GLU A CA  
1334 C C   . GLU A 186 ? 0.6280 0.6381 0.4913 -0.0783 0.0248  0.0131  186  GLU A C   
1335 O O   . GLU A 186 ? 0.6290 0.6400 0.4772 -0.0881 0.0280  0.0120  186  GLU A O   
1336 C CB  . GLU A 186 ? 0.5740 0.5816 0.4626 -0.0772 0.0394  0.0005  186  GLU A CB  
1337 C CG  . GLU A 186 ? 0.5165 0.5308 0.4179 -0.0721 0.0389  -0.0049 186  GLU A CG  
1338 C CD  . GLU A 186 ? 0.4668 0.4785 0.3848 -0.0621 0.0360  -0.0039 186  GLU A CD  
1339 O OE1 . GLU A 186 ? 0.4262 0.4316 0.3452 -0.0586 0.0332  0.0012  186  GLU A OE1 
1340 O OE2 . GLU A 186 ? 0.4627 0.4783 0.3920 -0.0583 0.0368  -0.0085 186  GLU A OE2 
1341 N N   . GLN A 187 ? 0.6175 0.6320 0.4867 -0.0710 0.0173  0.0156  187  GLN A N   
1342 C CA  . GLN A 187 ? 0.7248 0.7461 0.5835 -0.0739 0.0112  0.0179  187  GLN A CA  
1343 C C   . GLN A 187 ? 0.6790 0.6958 0.5249 -0.0735 0.0019  0.0295  187  GLN A C   
1344 O O   . GLN A 187 ? 0.6678 0.6882 0.4989 -0.0796 -0.0027 0.0328  187  GLN A O   
1345 C CB  . GLN A 187 ? 0.8465 0.8751 0.7179 -0.0669 0.0076  0.0150  187  GLN A CB  
1346 C CG  . GLN A 187 ? 1.0022 1.0366 0.8817 -0.0699 0.0160  0.0039  187  GLN A CG  
1347 C CD  . GLN A 187 ? 1.1241 1.1643 1.0161 -0.0631 0.0131  0.0013  187  GLN A CD  
1348 O OE1 . GLN A 187 ? 1.1424 1.1796 1.0448 -0.0543 0.0094  0.0045  187  GLN A OE1 
1349 N NE2 . GLN A 187 ? 1.1583 1.2064 1.0487 -0.0679 0.0153  -0.0050 187  GLN A NE2 
1350 N N   . MET A 188 ? 0.6495 0.6582 0.5013 -0.0666 -0.0012 0.0357  188  MET A N   
1351 C CA  . MET A 188 ? 0.7361 0.7383 0.5772 -0.0661 -0.0092 0.0472  188  MET A CA  
1352 C C   . MET A 188 ? 0.8271 0.8260 0.6464 -0.0778 -0.0072 0.0500  188  MET A C   
1353 O O   . MET A 188 ? 0.8360 0.8311 0.6424 -0.0794 -0.0151 0.0600  188  MET A O   
1354 C CB  . MET A 188 ? 0.7148 0.7068 0.5646 -0.0594 -0.0092 0.0515  188  MET A CB  
1355 C CG  . MET A 188 ? 0.7037 0.6966 0.5710 -0.0480 -0.0136 0.0520  188  MET A CG  
1356 S SD  . MET A 188 ? 1.1560 1.1355 1.0279 -0.0425 -0.0149 0.0590  188  MET A SD  
1357 C CE  . MET A 188 ? 0.8979 0.8724 0.7684 -0.0491 -0.0035 0.0523  188  MET A CE  
1358 N N   . ASN A 189 ? 0.8893 0.8892 0.7046 -0.0863 0.0035  0.0412  189  ASN A N   
1359 C CA  . ASN A 189 ? 0.9465 0.9423 0.7405 -0.0987 0.0078  0.0424  189  ASN A CA  
1360 C C   . ASN A 189 ? 1.0155 1.0182 0.8031 -0.1094 0.0173  0.0314  189  ASN A C   
1361 O O   . ASN A 189 ? 1.0859 1.0881 0.8524 -0.1207 0.0185  0.0324  189  ASN A O   
1362 C CB  . ASN A 189 ? 1.0122 0.9965 0.8053 -0.1002 0.0134  0.0448  189  ASN A CB  
1363 C CG  . ASN A 189 ? 1.0394 1.0207 0.8545 -0.0890 0.0138  0.0437  189  ASN A CG  
1364 O OD1 . ASN A 189 ? 1.0374 1.0105 0.8542 -0.0836 0.0089  0.0518  189  ASN A OD1 
1365 N ND2 . ASN A 189 ? 1.0738 1.0614 0.9054 -0.0859 0.0197  0.0337  189  ASN A ND2 
1366 N N   . ARG A 190 ? 1.0650 1.0736 0.8703 -0.1063 0.0241  0.0208  190  ARG A N   
1367 C CA  . ARG A 190 ? 1.0880 1.1023 0.8911 -0.1157 0.0347  0.0091  190  ARG A CA  
1368 C C   . ARG A 190 ? 1.0848 1.1075 0.9068 -0.1097 0.0364  0.0008  190  ARG A C   
1369 O O   . ARG A 190 ? 1.0904 1.1211 0.9082 -0.1128 0.0347  -0.0026 190  ARG A O   
1370 C CB  . ARG A 190 ? 1.1180 1.1266 0.9241 -0.1214 0.0470  0.0030  190  ARG A CB  
1371 C CG  . ARG A 190 ? 1.1428 1.1517 0.9748 -0.1126 0.0517  -0.0030 190  ARG A CG  
1372 C CD  . ARG A 190 ? 1.2054 1.2054 1.0429 -0.1074 0.0503  0.0031  190  ARG A CD  
1373 N NE  . ARG A 190 ? 1.3001 1.2967 1.1421 -0.1137 0.0619  -0.0037 190  ARG A NE  
1374 C CZ  . ARG A 190 ? 1.3471 1.3459 1.2108 -0.1099 0.0682  -0.0116 190  ARG A CZ  
1375 N NH1 . ARG A 190 ? 1.3077 1.3110 1.1886 -0.1001 0.0641  -0.0132 190  ARG A NH1 
1376 N NH2 . ARG A 190 ? 1.3946 1.3911 1.2633 -0.1162 0.0786  -0.0178 190  ARG A NH2 
1377 N N   . ASN A 194 ? 0.6967 0.7401 0.6186 -0.0922 0.0684  -0.0479 194  ASN A N   
1378 C CA  . ASN A 194 ? 0.5426 0.5807 0.4809 -0.0848 0.0691  -0.0464 194  ASN A CA  
1379 C C   . ASN A 194 ? 0.4130 0.4508 0.3644 -0.0746 0.0636  -0.0441 194  ASN A C   
1380 O O   . ASN A 194 ? 0.4531 0.4907 0.3993 -0.0692 0.0547  -0.0370 194  ASN A O   
1381 C CB  . ASN A 194 ? 0.5883 0.6212 0.5182 -0.0834 0.0641  -0.0381 194  ASN A CB  
1382 C CG  . ASN A 194 ? 0.5131 0.5411 0.4587 -0.0784 0.0661  -0.0380 194  ASN A CG  
1383 O OD1 . ASN A 194 ? 0.5701 0.5983 0.5334 -0.0736 0.0684  -0.0421 194  ASN A OD1 
1384 N ND2 . ASN A 194 ? 0.5019 0.5251 0.4408 -0.0796 0.0650  -0.0332 194  ASN A ND2 
1385 N N   . GLU A 195 ? 0.3890 0.4264 0.3579 -0.0724 0.0691  -0.0502 195  GLU A N   
1386 C CA  . GLU A 195 ? 0.3993 0.4353 0.3797 -0.0637 0.0647  -0.0483 195  GLU A CA  
1387 C C   . GLU A 195 ? 0.2415 0.2724 0.2244 -0.0556 0.0570  -0.0400 195  GLU A C   
1388 O O   . GLU A 195 ? 0.2477 0.2774 0.2328 -0.0491 0.0511  -0.0361 195  GLU A O   
1389 C CB  . GLU A 195 ? 0.3904 0.4256 0.3893 -0.0633 0.0722  -0.0557 195  GLU A CB  
1390 C CG  . GLU A 195 ? 0.4817 0.5216 0.4793 -0.0711 0.0804  -0.0648 195  GLU A CG  
1391 C CD  . GLU A 195 ? 0.6384 0.6767 0.6561 -0.0712 0.0891  -0.0727 195  GLU A CD  
1392 O OE1 . GLU A 195 ? 0.6744 0.7085 0.7074 -0.0653 0.0882  -0.0708 195  GLU A OE1 
1393 O OE2 . GLU A 195 ? 0.7077 0.7491 0.7266 -0.0773 0.0967  -0.0809 195  GLU A OE2 
1394 N N   . LYS A 196 ? 0.2445 0.2724 0.2267 -0.0566 0.0576  -0.0379 196  LYS A N   
1395 C CA  . LYS A 196 ? 0.2666 0.2895 0.2501 -0.0498 0.0505  -0.0307 196  LYS A CA  
1396 C C   . LYS A 196 ? 0.2898 0.3126 0.2592 -0.0477 0.0428  -0.0236 196  LYS A C   
1397 O O   . LYS A 196 ? 0.2455 0.2649 0.2165 -0.0413 0.0367  -0.0183 196  LYS A O   
1398 C CB  . LYS A 196 ? 0.3236 0.3435 0.3111 -0.0519 0.0535  -0.0308 196  LYS A CB  
1399 C CG  . LYS A 196 ? 0.2649 0.2847 0.2724 -0.0512 0.0592  -0.0368 196  LYS A CG  
1400 C CD  . LYS A 196 ? 0.2584 0.2759 0.2774 -0.0429 0.0535  -0.0342 196  LYS A CD  
1401 C CE  . LYS A 196 ? 0.2512 0.2682 0.2908 -0.0412 0.0567  -0.0382 196  LYS A CE  
1402 N NZ  . LYS A 196 ? 0.3074 0.3226 0.3517 -0.0412 0.0558  -0.0366 196  LYS A NZ  
1403 N N   . SER A 197 ? 0.2765 0.3033 0.2328 -0.0533 0.0429  -0.0236 197  SER A N   
1404 C CA  . SER A 197 ? 0.2874 0.3148 0.2327 -0.0508 0.0349  -0.0166 197  SER A CA  
1405 C C   . SER A 197 ? 0.2690 0.2988 0.2201 -0.0450 0.0310  -0.0165 197  SER A C   
1406 O O   . SER A 197 ? 0.2345 0.2631 0.1839 -0.0397 0.0243  -0.0109 197  SER A O   
1407 C CB  . SER A 197 ? 0.3710 0.4025 0.3004 -0.0586 0.0346  -0.0162 197  SER A CB  
1408 O OG  . SER A 197 ? 0.4785 0.5069 0.4006 -0.0650 0.0390  -0.0162 197  SER A OG  
1409 N N   . ASP A 198 ? 0.2066 0.2395 0.1652 -0.0462 0.0357  -0.0230 198  ASP A N   
1410 C CA  . ASP A 198 ? 0.1773 0.2116 0.1415 -0.0413 0.0330  -0.0232 198  ASP A CA  
1411 C C   . ASP A 198 ? 0.1867 0.2146 0.1591 -0.0339 0.0301  -0.0197 198  ASP A C   
1412 O O   . ASP A 198 ? 0.1850 0.2124 0.1584 -0.0291 0.0260  -0.0172 198  ASP A O   
1413 C CB  . ASP A 198 ? 0.1706 0.2081 0.1417 -0.0446 0.0396  -0.0311 198  ASP A CB  
1414 C CG  . ASP A 198 ? 0.3936 0.4381 0.3556 -0.0527 0.0426  -0.0356 198  ASP A CG  
1415 O OD1 . ASP A 198 ? 0.3668 0.4148 0.3171 -0.0545 0.0372  -0.0315 198  ASP A OD1 
1416 O OD2 . ASP A 198 ? 0.4310 0.4775 0.3978 -0.0575 0.0499  -0.0431 198  ASP A OD2 
1417 N N   . ILE A 199 ? 0.1672 0.1905 0.1456 -0.0334 0.0324  -0.0199 199  ILE A N   
1418 C CA  . ILE A 199 ? 0.1327 0.1500 0.1177 -0.0273 0.0291  -0.0167 199  ILE A CA  
1419 C C   . ILE A 199 ? 0.1982 0.2127 0.1760 -0.0240 0.0230  -0.0103 199  ILE A C   
1420 O O   . ILE A 199 ? 0.1658 0.1770 0.1452 -0.0191 0.0193  -0.0077 199  ILE A O   
1421 C CB  . ILE A 199 ? 0.1564 0.1705 0.1510 -0.0280 0.0324  -0.0186 199  ILE A CB  
1422 C CG1 . ILE A 199 ? 0.1818 0.1982 0.1867 -0.0305 0.0387  -0.0251 199  ILE A CG1 
1423 C CG2 . ILE A 199 ? 0.1161 0.1246 0.1164 -0.0224 0.0279  -0.0150 199  ILE A CG2 
1424 C CD1 . ILE A 199 ? 0.2246 0.2392 0.2355 -0.0265 0.0374  -0.0254 199  ILE A CD1 
1425 N N   . TRP A 200 ? 0.1477 0.1628 0.1173 -0.0271 0.0223  -0.0079 200  TRP A N   
1426 C CA  . TRP A 200 ? 0.1519 0.1640 0.1155 -0.0239 0.0167  -0.0016 200  TRP A CA  
1427 C C   . TRP A 200 ? 0.1592 0.1744 0.1214 -0.0206 0.0127  -0.0002 200  TRP A C   
1428 O O   . TRP A 200 ? 0.1775 0.1893 0.1417 -0.0156 0.0092  0.0027  200  TRP A O   
1429 C CB  . TRP A 200 ? 0.2538 0.2658 0.2076 -0.0286 0.0166  0.0012  200  TRP A CB  
1430 C CG  . TRP A 200 ? 0.2798 0.2888 0.2277 -0.0255 0.0105  0.0081  200  TRP A CG  
1431 C CD1 . TRP A 200 ? 0.2390 0.2516 0.1833 -0.0237 0.0057  0.0111  200  TRP A CD1 
1432 C CD2 . TRP A 200 ? 0.2519 0.2536 0.1985 -0.0238 0.0088  0.0127  200  TRP A CD2 
1433 N NE1 . TRP A 200 ? 0.3394 0.3470 0.2809 -0.0205 0.0009  0.0176  200  TRP A NE1 
1434 C CE2 . TRP A 200 ? 0.2711 0.2716 0.2135 -0.0207 0.0031  0.0186  200  TRP A CE2 
1435 C CE3 . TRP A 200 ? 0.2950 0.2913 0.2447 -0.0248 0.0116  0.0121  200  TRP A CE3 
1436 C CZ2 . TRP A 200 ? 0.2112 0.2042 0.1520 -0.0185 0.0005  0.0240  200  TRP A CZ2 
1437 C CZ3 . TRP A 200 ? 0.2972 0.2866 0.2444 -0.0232 0.0092  0.0171  200  TRP A CZ3 
1438 C CH2 . TRP A 200 ? 0.2637 0.2509 0.2062 -0.0201 0.0039  0.0230  200  TRP A CH2 
1439 N N   . SER A 201 ? 0.1824 0.2046 0.1419 -0.0238 0.0136  -0.0029 201  SER A N   
1440 C CA  . SER A 201 ? 0.1439 0.1705 0.1037 -0.0210 0.0098  -0.0021 201  SER A CA  
1441 C C   . SER A 201 ? 0.1850 0.2093 0.1527 -0.0167 0.0108  -0.0043 201  SER A C   
1442 O O   . SER A 201 ? 0.1654 0.1892 0.1349 -0.0126 0.0076  -0.0023 201  SER A O   
1443 C CB  . SER A 201 ? 0.2278 0.2630 0.1838 -0.0261 0.0108  -0.0055 201  SER A CB  
1444 O OG  . SER A 201 ? 0.3468 0.3833 0.2931 -0.0315 0.0104  -0.0037 201  SER A OG  
1445 N N   . LEU A 202 ? 0.1626 0.1849 0.1353 -0.0178 0.0153  -0.0083 202  LEU A N   
1446 C CA  . LEU A 202 ? 0.1506 0.1693 0.1290 -0.0143 0.0159  -0.0095 202  LEU A CA  
1447 C C   . LEU A 202 ? 0.1264 0.1380 0.1048 -0.0101 0.0127  -0.0055 202  LEU A C   
1448 O O   . LEU A 202 ? 0.1484 0.1573 0.1278 -0.0070 0.0116  -0.0050 202  LEU A O   
1449 C CB  . LEU A 202 ? 0.2136 0.2302 0.1980 -0.0160 0.0206  -0.0133 202  LEU A CB  
1450 C CG  . LEU A 202 ? 0.2176 0.2282 0.2064 -0.0128 0.0205  -0.0131 202  LEU A CG  
1451 C CD1 . LEU A 202 ? 0.1830 0.1957 0.1709 -0.0120 0.0208  -0.0146 202  LEU A CD1 
1452 C CD2 . LEU A 202 ? 0.2861 0.2942 0.2826 -0.0141 0.0241  -0.0158 202  LEU A CD2 
1453 N N   . GLY A 203 ? 0.1519 0.1603 0.1290 -0.0106 0.0120  -0.0031 203  GLY A N   
1454 C CA  . GLY A 203 ? 0.1247 0.1265 0.1015 -0.0073 0.0092  0.0002  203  GLY A CA  
1455 C C   . GLY A 203 ? 0.1854 0.1875 0.1594 -0.0045 0.0060  0.0029  203  GLY A C   
1456 O O   . GLY A 203 ? 0.1297 0.1273 0.1046 -0.0015 0.0049  0.0035  203  GLY A O   
1457 N N   . CYS A 204 ? 0.1138 0.1211 0.0847 -0.0057 0.0045  0.0044  204  CYS A N   
1458 C CA  . CYS A 204 ? 0.1693 0.1771 0.1402 -0.0024 0.0008  0.0075  204  CYS A CA  
1459 C C   . CYS A 204 ? 0.1539 0.1642 0.1295 -0.0001 0.0014  0.0046  204  CYS A C   
1460 O O   . CYS A 204 ? 0.1369 0.1448 0.1156 0.0035  0.0001  0.0055  204  CYS A O   
1461 C CB  . CYS A 204 ? 0.1734 0.1871 0.1402 -0.0044 -0.0022 0.0104  204  CYS A CB  
1462 S SG  . CYS A 204 ? 0.2090 0.2180 0.1682 -0.0074 -0.0033 0.0153  204  CYS A SG  
1463 N N   . LEU A 205 ? 0.1419 0.1570 0.1185 -0.0025 0.0041  0.0006  205  LEU A N   
1464 C CA  . LEU A 205 ? 0.1443 0.1626 0.1250 -0.0014 0.0055  -0.0027 205  LEU A CA  
1465 C C   . LEU A 205 ? 0.1359 0.1463 0.1174 0.0005  0.0074  -0.0037 205  LEU A C   
1466 O O   . LEU A 205 ? 0.1167 0.1264 0.1009 0.0027  0.0078  -0.0047 205  LEU A O   
1467 C CB  . LEU A 205 ? 0.1554 0.1792 0.1365 -0.0053 0.0087  -0.0071 205  LEU A CB  
1468 C CG  . LEU A 205 ? 0.2024 0.2299 0.1877 -0.0053 0.0110  -0.0111 205  LEU A CG  
1469 C CD1 . LEU A 205 ? 0.2347 0.2701 0.2205 -0.0097 0.0131  -0.0151 205  LEU A CD1 
1470 C CD2 . LEU A 205 ? 0.2473 0.2667 0.2330 -0.0045 0.0143  -0.0124 205  LEU A CD2 
1471 N N   . LEU A 206 ? 0.0745 0.0793 0.0542 -0.0007 0.0088  -0.0036 206  LEU A N   
1472 C CA  . LEU A 206 ? 0.1478 0.1448 0.1264 0.0003  0.0097  -0.0039 206  LEU A CA  
1473 C C   . LEU A 206 ? 0.1487 0.1407 0.1260 0.0028  0.0077  -0.0017 206  LEU A C   
1474 O O   . LEU A 206 ? 0.1468 0.1342 0.1228 0.0035  0.0088  -0.0029 206  LEU A O   
1475 C CB  . LEU A 206 ? 0.1519 0.1448 0.1304 -0.0013 0.0101  -0.0035 206  LEU A CB  
1476 C CG  . LEU A 206 ? 0.1943 0.1901 0.1758 -0.0036 0.0131  -0.0063 206  LEU A CG  
1477 C CD1 . LEU A 206 ? 0.1462 0.1380 0.1306 -0.0044 0.0130  -0.0055 206  LEU A CD1 
1478 C CD2 . LEU A 206 ? 0.1047 0.0988 0.0856 -0.0037 0.0154  -0.0084 206  LEU A CD2 
1479 N N   . TYR A 207 ? 0.1532 0.1452 0.1301 0.0033  0.0053  0.0013  207  TYR A N   
1480 C CA  . TYR A 207 ? 0.1583 0.1452 0.1349 0.0056  0.0038  0.0033  207  TYR A CA  
1481 C C   . TYR A 207 ? 0.2124 0.2016 0.1929 0.0082  0.0041  0.0021  207  TYR A C   
1482 O O   . TYR A 207 ? 0.2150 0.1990 0.1961 0.0095  0.0054  0.0008  207  TYR A O   
1483 C CB  . TYR A 207 ? 0.1042 0.0910 0.0799 0.0055  0.0014  0.0071  207  TYR A CB  
1484 C CG  . TYR A 207 ? 0.1167 0.0969 0.0927 0.0077  0.0002  0.0092  207  TYR A CG  
1485 C CD1 . TYR A 207 ? 0.1710 0.1516 0.1511 0.0108  -0.0006 0.0100  207  TYR A CD1 
1486 C CD2 . TYR A 207 ? 0.1285 0.1022 0.1023 0.0065  0.0002  0.0100  207  TYR A CD2 
1487 C CE1 . TYR A 207 ? 0.2051 0.1789 0.1869 0.0128  -0.0009 0.0115  207  TYR A CE1 
1488 C CE2 . TYR A 207 ? 0.1257 0.0929 0.0999 0.0079  -0.0002 0.0112  207  TYR A CE2 
1489 C CZ  . TYR A 207 ? 0.2019 0.1687 0.1800 0.0111  -0.0005 0.0119  207  TYR A CZ  
1490 O OH  . TYR A 207 ? 0.2198 0.1794 0.1996 0.0125  -0.0002 0.0127  207  TYR A OH  
1491 N N   . GLU A 208 ? 0.1730 0.1703 0.1569 0.0085  0.0031  0.0021  208  GLU A N   
1492 C CA  . GLU A 208 ? 0.1474 0.1485 0.1381 0.0113  0.0029  0.0010  208  GLU A CA  
1493 C C   . GLU A 208 ? 0.1454 0.1455 0.1375 0.0107  0.0073  -0.0041 208  GLU A C   
1494 O O   . GLU A 208 ? 0.1567 0.1554 0.1537 0.0126  0.0091  -0.0062 208  GLU A O   
1495 C CB  . GLU A 208 ? 0.1361 0.1473 0.1303 0.0114  -0.0003 0.0023  208  GLU A CB  
1496 C CG  . GLU A 208 ? 0.2458 0.2617 0.2500 0.0151  -0.0020 0.0021  208  GLU A CG  
1497 C CD  . GLU A 208 ? 0.2470 0.2737 0.2548 0.0149  -0.0066 0.0037  208  GLU A CD  
1498 O OE1 . GLU A 208 ? 0.3052 0.3348 0.3061 0.0119  -0.0090 0.0062  208  GLU A OE1 
1499 O OE2 . GLU A 208 ? 0.3389 0.3718 0.3570 0.0175  -0.0078 0.0023  208  GLU A OE2 
1500 N N   . LEU A 209 ? 0.1533 0.1534 0.1412 0.0077  0.0096  -0.0061 209  LEU A N   
1501 C CA  . LEU A 209 ? 0.2041 0.2016 0.1911 0.0062  0.0140  -0.0102 209  LEU A CA  
1502 C C   . LEU A 209 ? 0.2090 0.1968 0.1915 0.0062  0.0155  -0.0105 209  LEU A C   
1503 O O   . LEU A 209 ? 0.1849 0.1704 0.1680 0.0057  0.0192  -0.0140 209  LEU A O   
1504 C CB  . LEU A 209 ? 0.1770 0.1736 0.1596 0.0030  0.0156  -0.0111 209  LEU A CB  
1505 C CG  . LEU A 209 ? 0.4139 0.4145 0.3983 0.0007  0.0193  -0.0149 209  LEU A CG  
1506 C CD1 . LEU A 209 ? 0.1599 0.1542 0.1388 -0.0020 0.0211  -0.0147 209  LEU A CD1 
1507 C CD2 . LEU A 209 ? 0.3562 0.3567 0.3433 0.0009  0.0228  -0.0184 209  LEU A CD2 
1508 N N   . CYS A 210 ? 0.1198 0.1020 0.0977 0.0061  0.0130  -0.0074 210  CYS A N   
1509 C CA  . CYS A 210 ? 0.1269 0.0999 0.0995 0.0053  0.0139  -0.0079 210  CYS A CA  
1510 C C   . CYS A 210 ? 0.1913 0.1626 0.1684 0.0077  0.0146  -0.0087 210  CYS A C   
1511 O O   . CYS A 210 ? 0.1876 0.1537 0.1630 0.0067  0.0182  -0.0122 210  CYS A O   
1512 C CB  . CYS A 210 ? 0.1852 0.1537 0.1530 0.0042  0.0106  -0.0047 210  CYS A CB  
1513 S SG  . CYS A 210 ? 0.1821 0.1498 0.1459 0.0014  0.0098  -0.0039 210  CYS A SG  
1514 N N   . ALA A 211 ? 0.1964 0.1709 0.1787 0.0105  0.0113  -0.0054 211  ALA A N   
1515 C CA  . ALA A 211 ? 0.2345 0.2061 0.2225 0.0134  0.0113  -0.0050 211  ALA A CA  
1516 C C   . ALA A 211 ? 0.2448 0.2227 0.2438 0.0165  0.0124  -0.0068 211  ALA A C   
1517 O O   . ALA A 211 ? 0.1904 0.1656 0.1965 0.0190  0.0137  -0.0079 211  ALA A O   
1518 C CB  . ALA A 211 ? 0.1912 0.1619 0.1792 0.0146  0.0072  0.0002  211  ALA A CB  
1519 N N   . LEU A 212 ? 0.1719 0.1584 0.1736 0.0162  0.0119  -0.0075 212  LEU A N   
1520 C CA  . LEU A 212 ? 0.1976 0.1921 0.2113 0.0190  0.0119  -0.0092 212  LEU A CA  
1521 C C   . LEU A 212 ? 0.3436 0.3418 0.3641 0.0228  0.0061  -0.0038 212  LEU A C   
1522 O O   . LEU A 212 ? 0.3400 0.3441 0.3726 0.0260  0.0047  -0.0041 212  LEU A O   
1523 C CB  . LEU A 212 ? 0.1958 0.1872 0.2158 0.0195  0.0177  -0.0150 212  LEU A CB  
1524 C CG  . LEU A 212 ? 0.2301 0.2177 0.2420 0.0149  0.0237  -0.0202 212  LEU A CG  
1525 C CD1 . LEU A 212 ? 0.2405 0.2252 0.2582 0.0144  0.0306  -0.0268 212  LEU A CD1 
1526 C CD2 . LEU A 212 ? 0.2077 0.2026 0.2179 0.0127  0.0236  -0.0210 212  LEU A CD2 
1527 N N   . MET A 213 ? 0.2123 0.2073 0.2253 0.0220  0.0025  0.0013  213  MET A N   
1528 C CA  . MET A 213 ? 0.2309 0.2284 0.2471 0.0245  -0.0034 0.0075  213  MET A CA  
1529 C C   . MET A 213 ? 0.2282 0.2247 0.2331 0.0211  -0.0055 0.0111  213  MET A C   
1530 O O   . MET A 213 ? 0.2095 0.2009 0.2072 0.0183  -0.0027 0.0093  213  MET A O   
1531 C CB  . MET A 213 ? 0.2552 0.2446 0.2770 0.0280  -0.0036 0.0096  213  MET A CB  
1532 C CG  . MET A 213 ? 0.3456 0.3243 0.3592 0.0258  -0.0003 0.0085  213  MET A CG  
1533 S SD  . MET A 213 ? 0.6416 0.6102 0.6624 0.0293  0.0005  0.0101  213  MET A SD  
1534 C CE  . MET A 213 ? 1.1796 1.1515 1.2155 0.0327  0.0044  0.0041  213  MET A CE  
1535 N N   . PRO A 214 ? 0.2596 0.2612 0.2632 0.0209  -0.0106 0.0160  214  PRO A N   
1536 C CA  . PRO A 214 ? 0.2278 0.2289 0.2207 0.0167  -0.0113 0.0183  214  PRO A CA  
1537 C C   . PRO A 214 ? 0.1783 0.1694 0.1669 0.0164  -0.0108 0.0212  214  PRO A C   
1538 O O   . PRO A 214 ? 0.1823 0.1677 0.1760 0.0198  -0.0112 0.0228  214  PRO A O   
1539 C CB  . PRO A 214 ? 0.2937 0.3017 0.2856 0.0162  -0.0170 0.0233  214  PRO A CB  
1540 C CG  . PRO A 214 ? 0.3227 0.3359 0.3262 0.0207  -0.0202 0.0239  214  PRO A CG  
1541 C CD  . PRO A 214 ? 0.2899 0.2976 0.3018 0.0242  -0.0159 0.0198  214  PRO A CD  
1542 N N   . PRO A 215 ? 0.1721 0.1614 0.1526 0.0124  -0.0095 0.0216  215  PRO A N   
1543 C CA  . PRO A 215 ? 0.1435 0.1236 0.1210 0.0117  -0.0085 0.0234  215  PRO A CA  
1544 C C   . PRO A 215 ? 0.2805 0.2568 0.2566 0.0125  -0.0119 0.0299  215  PRO A C   
1545 O O   . PRO A 215 ? 0.1776 0.1454 0.1542 0.0134  -0.0111 0.0314  215  PRO A O   
1546 C CB  . PRO A 215 ? 0.1393 0.1204 0.1109 0.0070  -0.0062 0.0215  215  PRO A CB  
1547 C CG  . PRO A 215 ? 0.1893 0.1796 0.1591 0.0048  -0.0066 0.0204  215  PRO A CG  
1548 C CD  . PRO A 215 ? 0.1658 0.1611 0.1417 0.0082  -0.0080 0.0191  215  PRO A CD  
1549 N N   . PHE A 216 ? 0.2164 0.1986 0.1901 0.0118  -0.0157 0.0338  216  PHE A N   
1550 C CA  . PHE A 216 ? 0.2623 0.2406 0.2334 0.0123  -0.0199 0.0413  216  PHE A CA  
1551 C C   . PHE A 216 ? 0.3053 0.2894 0.2830 0.0163  -0.0256 0.0447  216  PHE A C   
1552 O O   . PHE A 216 ? 0.2597 0.2536 0.2373 0.0151  -0.0274 0.0430  216  PHE A O   
1553 C CB  . PHE A 216 ? 0.2491 0.2286 0.2084 0.0063  -0.0203 0.0441  216  PHE A CB  
1554 C CG  . PHE A 216 ? 0.3173 0.2940 0.2723 0.0019  -0.0147 0.0399  216  PHE A CG  
1555 C CD1 . PHE A 216 ? 0.2449 0.2124 0.1981 0.0009  -0.0127 0.0415  216  PHE A CD1 
1556 C CD2 . PHE A 216 ? 0.2489 0.2322 0.2028 -0.0012 -0.0115 0.0342  216  PHE A CD2 
1557 C CE1 . PHE A 216 ? 0.2421 0.2082 0.1934 -0.0030 -0.0080 0.0374  216  PHE A CE1 
1558 C CE2 . PHE A 216 ? 0.2482 0.2294 0.2007 -0.0046 -0.0069 0.0304  216  PHE A CE2 
1559 C CZ  . PHE A 216 ? 0.2339 0.2070 0.1854 -0.0056 -0.0054 0.0320  216  PHE A CZ  
1560 N N   . THR A 217 ? 0.3198 0.2982 0.3047 0.0209  -0.0284 0.0492  217  THR A N   
1561 C CA  . THR A 217 ? 0.3713 0.3555 0.3662 0.0256  -0.0342 0.0524  217  THR A CA  
1562 C C   . THR A 217 ? 0.3546 0.3324 0.3480 0.0270  -0.0402 0.0622  217  THR A C   
1563 O O   . THR A 217 ? 0.3105 0.2777 0.2984 0.0257  -0.0381 0.0650  217  THR A O   
1564 C CB  . THR A 217 ? 0.4369 0.4207 0.4471 0.0311  -0.0313 0.0471  217  THR A CB  
1565 O OG1 . THR A 217 ? 0.4668 0.4385 0.4802 0.0332  -0.0283 0.0479  217  THR A OG1 
1566 C CG2 . THR A 217 ? 0.5272 0.5154 0.5366 0.0289  -0.0252 0.0381  217  THR A CG2 
1567 N N   . ALA A 218 ? 0.3149 0.2992 0.3129 0.0294  -0.0479 0.0677  218  ALA A N   
1568 C CA  . ALA A 218 ? 0.3491 0.3270 0.3453 0.0309  -0.0549 0.0783  218  ALA A CA  
1569 C C   . ALA A 218 ? 0.4267 0.4147 0.4313 0.0342  -0.0642 0.0829  218  ALA A C   
1570 O O   . ALA A 218 ? 0.3575 0.3579 0.3663 0.0337  -0.0646 0.0774  218  ALA A O   
1571 C CB  . ALA A 218 ? 0.4230 0.3963 0.3990 0.0234  -0.0552 0.0832  218  ALA A CB  
1572 N N   . PHE A 219 ? 0.4194 0.4022 0.4271 0.0374  -0.0719 0.0932  219  PHE A N   
1573 C CA  . PHE A 219 ? 0.5318 0.5241 0.5497 0.0412  -0.0823 0.0987  219  PHE A CA  
1574 C C   . PHE A 219 ? 0.6122 0.6112 0.6124 0.0346  -0.0903 0.1052  219  PHE A C   
1575 O O   . PHE A 219 ? 0.7112 0.7225 0.7170 0.0354  -0.0981 0.1066  219  PHE A O   
1576 C CB  . PHE A 219 ? 0.5602 0.5442 0.5943 0.0492  -0.0876 0.1065  219  PHE A CB  
1577 C CG  . PHE A 219 ? 0.6369 0.6175 0.6917 0.0557  -0.0801 0.0986  219  PHE A CG  
1578 C CD1 . PHE A 219 ? 0.6999 0.6654 0.7584 0.0582  -0.0751 0.0998  219  PHE A CD1 
1579 C CD2 . PHE A 219 ? 0.7034 0.6957 0.7731 0.0584  -0.0772 0.0893  219  PHE A CD2 
1580 C CE1 . PHE A 219 ? 0.7108 0.6731 0.7871 0.0632  -0.0675 0.0916  219  PHE A CE1 
1581 C CE2 . PHE A 219 ? 0.7425 0.7313 0.8295 0.0633  -0.0695 0.0814  219  PHE A CE2 
1582 C CZ  . PHE A 219 ? 0.7129 0.6868 0.8029 0.0655  -0.0646 0.0824  219  PHE A CZ  
1583 N N   . SER A 220 ? 0.4883 0.4794 0.4671 0.0273  -0.0879 0.1084  220  SER A N   
1584 C CA  . SER A 220 ? 0.4801 0.4762 0.4392 0.0194  -0.0938 0.1136  220  SER A CA  
1585 C C   . SER A 220 ? 0.4937 0.4896 0.4351 0.0104  -0.0844 0.1062  220  SER A C   
1586 O O   . SER A 220 ? 0.4404 0.4299 0.3838 0.0107  -0.0747 0.0997  220  SER A O   
1587 C CB  . SER A 220 ? 0.4273 0.4127 0.3765 0.0185  -0.1017 0.1275  220  SER A CB  
1588 O OG  . SER A 220 ? 0.5601 0.5303 0.5014 0.0165  -0.0940 0.1282  220  SER A OG  
1589 N N   . GLN A 221 ? 0.4388 0.4417 0.3634 0.0022  -0.0871 0.1069  221  GLN A N   
1590 C CA  . GLN A 221 ? 0.4914 0.4943 0.4011 -0.0064 -0.0775 0.0994  221  GLN A CA  
1591 C C   . GLN A 221 ? 0.4443 0.4328 0.3414 -0.0105 -0.0723 0.1031  221  GLN A C   
1592 O O   . GLN A 221 ? 0.4404 0.4258 0.3337 -0.0142 -0.0623 0.0956  221  GLN A O   
1593 C CB  . GLN A 221 ? 0.5150 0.5286 0.4096 -0.0151 -0.0807 0.0983  221  GLN A CB  
1594 C CG  . GLN A 221 ? 0.5353 0.5490 0.4170 -0.0240 -0.0698 0.0894  221  GLN A CG  
1595 C CD  . GLN A 221 ? 0.5978 0.6225 0.4660 -0.0330 -0.0713 0.0863  221  GLN A CD  
1596 O OE1 . GLN A 221 ? 0.6015 0.6369 0.4739 -0.0318 -0.0795 0.0876  221  GLN A OE1 
1597 N NE2 . GLN A 221 ? 0.5437 0.5660 0.3965 -0.0424 -0.0630 0.0815  221  GLN A NE2 
1598 N N   . LYS A 222 ? 0.4770 0.4564 0.3683 -0.0098 -0.0794 0.1149  222  LYS A N   
1599 C CA  . LYS A 222 ? 0.4865 0.4513 0.3655 -0.0141 -0.0748 0.1193  222  LYS A CA  
1600 C C   . LYS A 222 ? 0.4782 0.4345 0.3713 -0.0083 -0.0669 0.1144  222  LYS A C   
1601 O O   . LYS A 222 ? 0.4809 0.4310 0.3673 -0.0130 -0.0580 0.1099  222  LYS A O   
1602 C CB  . LYS A 222 ? 0.5944 0.5507 0.4649 -0.0142 -0.0850 0.1341  222  LYS A CB  
1603 C CG  . LYS A 222 ? 0.7442 0.6834 0.6049 -0.0172 -0.0807 0.1399  222  LYS A CG  
1604 C CD  . LYS A 222 ? 0.9234 0.8525 0.7866 -0.0121 -0.0912 0.1544  222  LYS A CD  
1605 C CE  . LYS A 222 ? 0.9937 0.9052 0.8424 -0.0174 -0.0876 0.1617  222  LYS A CE  
1606 N NZ  . LYS A 222 ? 1.0503 0.9607 0.8708 -0.0299 -0.0880 0.1659  222  LYS A NZ  
1607 N N   . GLU A 223 ? 0.4574 0.4137 0.3703 0.0015  -0.0701 0.1149  223  GLU A N   
1608 C CA  . GLU A 223 ? 0.5351 0.4842 0.4617 0.0069  -0.0628 0.1093  223  GLU A CA  
1609 C C   . GLU A 223 ? 0.4052 0.3612 0.3333 0.0044  -0.0537 0.0966  223  GLU A C   
1610 O O   . GLU A 223 ? 0.3870 0.3365 0.3147 0.0028  -0.0458 0.0916  223  GLU A O   
1611 C CB  . GLU A 223 ? 0.6261 0.5761 0.5741 0.0171  -0.0675 0.1107  223  GLU A CB  
1612 C CG  . GLU A 223 ? 0.7497 0.6918 0.7113 0.0221  -0.0600 0.1047  223  GLU A CG  
1613 C CD  . GLU A 223 ? 0.8273 0.7718 0.8111 0.0315  -0.0628 0.1036  223  GLU A CD  
1614 O OE1 . GLU A 223 ? 0.8049 0.7595 0.7958 0.0345  -0.0701 0.1060  223  GLU A OE1 
1615 O OE2 . GLU A 223 ? 0.8283 0.7648 0.8230 0.0354  -0.0572 0.0997  223  GLU A OE2 
1616 N N   . LEU A 224 ? 0.3680 0.3373 0.2982 0.0040  -0.0552 0.0916  224  LEU A N   
1617 C CA  . LEU A 224 ? 0.3362 0.3120 0.2673 0.0014  -0.0474 0.0805  224  LEU A CA  
1618 C C   . LEU A 224 ? 0.3433 0.3153 0.2601 -0.0069 -0.0407 0.0779  224  LEU A C   
1619 O O   . LEU A 224 ? 0.3556 0.3255 0.2758 -0.0075 -0.0332 0.0708  224  LEU A O   
1620 C CB  . LEU A 224 ? 0.3295 0.3195 0.2622 0.0006  -0.0505 0.0767  224  LEU A CB  
1621 C CG  . LEU A 224 ? 0.3953 0.3916 0.3301 -0.0016 -0.0427 0.0656  224  LEU A CG  
1622 C CD1 . LEU A 224 ? 0.3414 0.3344 0.2909 0.0049  -0.0384 0.0604  224  LEU A CD1 
1623 C CD2 . LEU A 224 ? 0.4107 0.4204 0.3456 -0.0037 -0.0454 0.0622  224  LEU A CD2 
1624 N N   . ALA A 225 ? 0.3443 0.3160 0.2453 -0.0138 -0.0433 0.0833  225  ALA A N   
1625 C CA  . ALA A 225 ? 0.3703 0.3396 0.2579 -0.0227 -0.0361 0.0798  225  ALA A CA  
1626 C C   . ALA A 225 ? 0.4064 0.3633 0.2952 -0.0224 -0.0310 0.0808  225  ALA A C   
1627 O O   . ALA A 225 ? 0.3486 0.3044 0.2364 -0.0265 -0.0230 0.0743  225  ALA A O   
1628 C CB  . ALA A 225 ? 0.4464 0.4166 0.3148 -0.0310 -0.0399 0.0860  225  ALA A CB  
1629 N N   . GLY A 226 ? 0.3709 0.3189 0.2635 -0.0174 -0.0357 0.0888  226  GLY A N   
1630 C CA  . GLY A 226 ? 0.4268 0.3626 0.3226 -0.0165 -0.0311 0.0894  226  GLY A CA  
1631 C C   . GLY A 226 ? 0.4039 0.3414 0.3132 -0.0127 -0.0250 0.0797  226  GLY A C   
1632 O O   . GLY A 226 ? 0.3529 0.2864 0.2611 -0.0164 -0.0183 0.0752  226  GLY A O   
1633 N N   . LYS A 227 ? 0.3279 0.2713 0.2500 -0.0058 -0.0275 0.0765  227  LYS A N   
1634 C CA  . LYS A 227 ? 0.3357 0.2804 0.2688 -0.0028 -0.0223 0.0677  227  LYS A CA  
1635 C C   . LYS A 227 ? 0.3516 0.3034 0.2816 -0.0078 -0.0168 0.0598  227  LYS A C   
1636 O O   . LYS A 227 ? 0.3050 0.2543 0.2390 -0.0085 -0.0117 0.0543  227  LYS A O   
1637 C CB  . LYS A 227 ? 0.3773 0.3271 0.3232 0.0046  -0.0254 0.0657  227  LYS A CB  
1638 C CG  . LYS A 227 ? 0.4564 0.3986 0.4103 0.0106  -0.0295 0.0720  227  LYS A CG  
1639 C CD  . LYS A 227 ? 0.5717 0.5176 0.5406 0.0173  -0.0295 0.0671  227  LYS A CD  
1640 C CE  . LYS A 227 ? 0.7561 0.6951 0.7356 0.0235  -0.0333 0.0729  227  LYS A CE  
1641 N NZ  . LYS A 227 ? 0.8097 0.7519 0.8048 0.0294  -0.0318 0.0670  227  LYS A NZ  
1642 N N   . ILE A 228 ? 0.2595 0.2200 0.1830 -0.0114 -0.0180 0.0591  228  ILE A N   
1643 C CA  . ILE A 228 ? 0.2928 0.2601 0.2151 -0.0158 -0.0126 0.0513  228  ILE A CA  
1644 C C   . ILE A 228 ? 0.4078 0.3699 0.3243 -0.0221 -0.0068 0.0499  228  ILE A C   
1645 O O   . ILE A 228 ? 0.4567 0.4198 0.3794 -0.0229 -0.0018 0.0434  228  ILE A O   
1646 C CB  . ILE A 228 ? 0.3824 0.3598 0.2984 -0.0194 -0.0144 0.0503  228  ILE A CB  
1647 C CG1 . ILE A 228 ? 0.2809 0.2658 0.2062 -0.0136 -0.0180 0.0481  228  ILE A CG1 
1648 C CG2 . ILE A 228 ? 0.4010 0.3829 0.3146 -0.0256 -0.0074 0.0428  228  ILE A CG2 
1649 C CD1 . ILE A 228 ? 0.3085 0.3026 0.2281 -0.0160 -0.0228 0.0499  228  ILE A CD1 
1650 N N   . ARG A 229 ? 0.3685 0.3251 0.2738 -0.0267 -0.0076 0.0561  229  ARG A N   
1651 C CA  . ARG A 229 ? 0.4414 0.3919 0.3410 -0.0333 -0.0014 0.0551  229  ARG A CA  
1652 C C   . ARG A 229 ? 0.4364 0.3804 0.3458 -0.0307 0.0019  0.0524  229  ARG A C   
1653 O O   . ARG A 229 ? 0.5005 0.4446 0.4121 -0.0350 0.0080  0.0470  229  ARG A O   
1654 C CB  . ARG A 229 ? 0.4439 0.3868 0.3289 -0.0382 -0.0034 0.0638  229  ARG A CB  
1655 C CG  . ARG A 229 ? 0.6213 0.5701 0.4928 -0.0434 -0.0064 0.0666  229  ARG A CG  
1656 C CD  . ARG A 229 ? 0.7835 0.7241 0.6376 -0.0514 -0.0057 0.0735  229  ARG A CD  
1657 N NE  . ARG A 229 ? 0.9161 0.8564 0.7591 -0.0515 -0.0147 0.0831  229  ARG A NE  
1658 C CZ  . ARG A 229 ? 0.9623 0.9109 0.7947 -0.0565 -0.0171 0.0829  229  ARG A CZ  
1659 N NH1 . ARG A 229 ? 0.9541 0.9113 0.7861 -0.0617 -0.0103 0.0730  229  ARG A NH1 
1660 N NH2 . ARG A 229 ? 1.0050 0.9533 0.8280 -0.0563 -0.0267 0.0924  229  ARG A NH2 
1661 N N   . GLU A 230 ? 0.3531 0.2912 0.2687 -0.0242 -0.0019 0.0559  230  GLU A N   
1662 C CA  . GLU A 230 ? 0.3081 0.2401 0.2324 -0.0222 0.0009  0.0529  230  GLU A CA  
1663 C C   . GLU A 230 ? 0.3536 0.2928 0.2879 -0.0202 0.0030  0.0444  230  GLU A C   
1664 O O   . GLU A 230 ? 0.4026 0.3397 0.3421 -0.0216 0.0064  0.0401  230  GLU A O   
1665 C CB  . GLU A 230 ? 0.4239 0.3481 0.3531 -0.0159 -0.0030 0.0577  230  GLU A CB  
1666 C CG  . GLU A 230 ? 0.7038 0.6178 0.6251 -0.0175 -0.0049 0.0668  230  GLU A CG  
1667 C CD  . GLU A 230 ? 0.8674 0.7730 0.7850 -0.0234 0.0007  0.0663  230  GLU A CD  
1668 O OE1 . GLU A 230 ? 0.9314 0.8304 0.8381 -0.0282 0.0010  0.0727  230  GLU A OE1 
1669 O OE2 . GLU A 230 ? 0.9271 0.8327 0.8525 -0.0237 0.0047  0.0596  230  GLU A OE2 
1670 N N   . GLY A 231 ? 0.3295 0.2767 0.2663 -0.0170 0.0005  0.0424  231  GLY A N   
1671 C CA  . GLY A 231 ? 0.2531 0.2070 0.1974 -0.0159 0.0024  0.0352  231  GLY A CA  
1672 C C   . GLY A 231 ? 0.2725 0.2232 0.2250 -0.0112 0.0015  0.0326  231  GLY A C   
1673 O O   . GLY A 231 ? 0.2838 0.2375 0.2416 -0.0113 0.0030  0.0274  231  GLY A O   
1674 N N   . LYS A 232 ? 0.2362 0.1803 0.1896 -0.0074 -0.0008 0.0363  232  LYS A N   
1675 C CA  . LYS A 232 ? 0.1946 0.1349 0.1545 -0.0037 -0.0010 0.0335  232  LYS A CA  
1676 C C   . LYS A 232 ? 0.2821 0.2261 0.2456 0.0013  -0.0033 0.0328  232  LYS A C   
1677 O O   . LYS A 232 ? 0.2121 0.1589 0.1745 0.0031  -0.0061 0.0367  232  LYS A O   
1678 C CB  . LYS A 232 ? 0.2589 0.1886 0.2193 -0.0031 -0.0006 0.0367  232  LYS A CB  
1679 C CG  . LYS A 232 ? 0.3003 0.2249 0.2582 -0.0083 0.0024  0.0368  232  LYS A CG  
1680 C CD  . LYS A 232 ? 0.3196 0.2329 0.2770 -0.0075 0.0025  0.0416  232  LYS A CD  
1681 C CE  . LYS A 232 ? 0.4317 0.3387 0.3885 -0.0125 0.0062  0.0405  232  LYS A CE  
1682 N NZ  . LYS A 232 ? 0.4204 0.3152 0.3778 -0.0112 0.0066  0.0447  232  LYS A NZ  
1683 N N   . PHE A 233 ? 0.1894 0.1337 0.1570 0.0029  -0.0024 0.0279  233  PHE A N   
1684 C CA  . PHE A 233 ? 0.1840 0.1313 0.1554 0.0070  -0.0034 0.0262  233  PHE A CA  
1685 C C   . PHE A 233 ? 0.2184 0.1615 0.1921 0.0074  -0.0015 0.0213  233  PHE A C   
1686 O O   . PHE A 233 ? 0.1960 0.1362 0.1681 0.0045  -0.0005 0.0192  233  PHE A O   
1687 C CB  . PHE A 233 ? 0.1727 0.1296 0.1430 0.0063  -0.0038 0.0243  233  PHE A CB  
1688 C CG  . PHE A 233 ? 0.2025 0.1622 0.1709 0.0025  -0.0021 0.0213  233  PHE A CG  
1689 C CD1 . PHE A 233 ? 0.1938 0.1529 0.1639 0.0022  -0.0012 0.0171  233  PHE A CD1 
1690 C CD2 . PHE A 233 ? 0.2336 0.1963 0.1989 -0.0011 -0.0014 0.0227  233  PHE A CD2 
1691 C CE1 . PHE A 233 ? 0.1793 0.1412 0.1501 -0.0007 -0.0003 0.0148  233  PHE A CE1 
1692 C CE2 . PHE A 233 ? 0.2131 0.1786 0.1795 -0.0044 0.0007  0.0194  233  PHE A CE2 
1693 C CZ  . PHE A 233 ? 0.1467 0.1118 0.1170 -0.0037 0.0008  0.0157  233  PHE A CZ  
1694 N N   . ARG A 234 ? 0.1703 0.1133 0.1477 0.0106  -0.0009 0.0191  234  ARG A N   
1695 C CA  . ARG A 234 ? 0.1462 0.0849 0.1237 0.0100  0.0014  0.0141  234  ARG A CA  
1696 C C   . ARG A 234 ? 0.1902 0.1329 0.1636 0.0072  0.0013  0.0109  234  ARG A C   
1697 O O   . ARG A 234 ? 0.1505 0.1001 0.1234 0.0071  0.0004  0.0115  234  ARG A O   
1698 C CB  . ARG A 234 ? 0.1614 0.0994 0.1443 0.0135  0.0030  0.0120  234  ARG A CB  
1699 C CG  . ARG A 234 ? 0.2046 0.1378 0.1944 0.0170  0.0027  0.0154  234  ARG A CG  
1700 C CD  . ARG A 234 ? 0.2794 0.2112 0.2772 0.0201  0.0056  0.0116  234  ARG A CD  
1701 N NE  . ARG A 234 ? 0.2628 0.1887 0.2571 0.0171  0.0098  0.0052  234  ARG A NE  
1702 C CZ  . ARG A 234 ? 0.3519 0.2690 0.3458 0.0155  0.0120  0.0037  234  ARG A CZ  
1703 N NH1 . ARG A 234 ? 0.2592 0.1717 0.2563 0.0169  0.0106  0.0085  234  ARG A NH1 
1704 N NH2 . ARG A 234 ? 0.2871 0.1995 0.2763 0.0118  0.0155  -0.0024 234  ARG A NH2 
1705 N N   . ARG A 235 ? 0.1597 0.0978 0.1300 0.0048  0.0021  0.0075  235  ARG A N   
1706 C CA  . ARG A 235 ? 0.1312 0.0722 0.0978 0.0027  0.0014  0.0052  235  ARG A CA  
1707 C C   . ARG A 235 ? 0.1339 0.0778 0.1007 0.0046  0.0031  0.0033  235  ARG A C   
1708 O O   . ARG A 235 ? 0.1601 0.1018 0.1298 0.0066  0.0054  0.0020  235  ARG A O   
1709 C CB  . ARG A 235 ? 0.1445 0.0794 0.1064 -0.0004 0.0013  0.0021  235  ARG A CB  
1710 C CG  . ARG A 235 ? 0.1700 0.1072 0.1278 -0.0029 -0.0012 0.0014  235  ARG A CG  
1711 C CD  . ARG A 235 ? 0.1995 0.1304 0.1501 -0.0065 -0.0017 -0.0016 235  ARG A CD  
1712 N NE  . ARG A 235 ? 0.1821 0.1142 0.1286 -0.0089 -0.0054 -0.0010 235  ARG A NE  
1713 C CZ  . ARG A 235 ? 0.2639 0.1965 0.2060 -0.0091 -0.0051 -0.0012 235  ARG A CZ  
1714 N NH1 . ARG A 235 ? 0.1616 0.0947 0.1036 -0.0073 -0.0008 -0.0028 235  ARG A NH1 
1715 N NH2 . ARG A 235 ? 0.2315 0.1640 0.1702 -0.0112 -0.0092 0.0004  235  ARG A NH2 
1716 N N   . ILE A 236 ? 0.1794 0.1279 0.1444 0.0037  0.0026  0.0028  236  ILE A N   
1717 C CA  . ILE A 236 ? 0.1592 0.1094 0.1236 0.0044  0.0050  0.0002  236  ILE A CA  
1718 C C   . ILE A 236 ? 0.2087 0.1518 0.1679 0.0022  0.0072  -0.0034 236  ILE A C   
1719 O O   . ILE A 236 ? 0.1866 0.1245 0.1417 -0.0002 0.0058  -0.0036 236  ILE A O   
1720 C CB  . ILE A 236 ? 0.1706 0.1257 0.1336 0.0033  0.0043  0.0004  236  ILE A CB  
1721 C CG1 . ILE A 236 ? 0.1191 0.0705 0.0771 0.0003  0.0021  0.0007  236  ILE A CG1 
1722 C CG2 . ILE A 236 ? 0.1101 0.0722 0.0777 0.0045  0.0031  0.0029  236  ILE A CG2 
1723 C CD1 . ILE A 236 ? 0.1807 0.1355 0.1386 -0.0005 0.0017  0.0011  236  ILE A CD1 
1724 N N   . PRO A 237 ? 0.1603 0.1032 0.1197 0.0026  0.0109  -0.0067 237  PRO A N   
1725 C CA  . PRO A 237 ? 0.1366 0.0722 0.0904 -0.0003 0.0144  -0.0111 237  PRO A CA  
1726 C C   . PRO A 237 ? 0.2979 0.2283 0.2402 -0.0053 0.0123  -0.0114 237  PRO A C   
1727 O O   . PRO A 237 ? 0.2457 0.1787 0.1853 -0.0060 0.0091  -0.0087 237  PRO A O   
1728 C CB  . PRO A 237 ? 0.1917 0.1298 0.1477 0.0002  0.0191  -0.0147 237  PRO A CB  
1729 C CG  . PRO A 237 ? 0.1238 0.0706 0.0914 0.0051  0.0178  -0.0122 237  PRO A CG  
1730 C CD  . PRO A 237 ? 0.1336 0.0834 0.0999 0.0054  0.0126  -0.0071 237  PRO A CD  
1731 N N   . TYR A 238 ? 0.1499 0.0730 0.0858 -0.0087 0.0140  -0.0146 238  TYR A N   
1732 C CA  . TYR A 238 ? 0.1914 0.1096 0.1156 -0.0140 0.0107  -0.0144 238  TYR A CA  
1733 C C   . TYR A 238 ? 0.2871 0.2036 0.2013 -0.0174 0.0106  -0.0144 238  TYR A C   
1734 O O   . TYR A 238 ? 0.2501 0.1641 0.1561 -0.0207 0.0057  -0.0120 238  TYR A O   
1735 C CB  . TYR A 238 ? 0.2022 0.1131 0.1212 -0.0178 0.0123  -0.0182 238  TYR A CB  
1736 C CG  . TYR A 238 ? 0.1983 0.1099 0.1259 -0.0152 0.0107  -0.0167 238  TYR A CG  
1737 C CD1 . TYR A 238 ? 0.2685 0.1785 0.2045 -0.0122 0.0152  -0.0188 238  TYR A CD1 
1738 C CD2 . TYR A 238 ? 0.2347 0.1484 0.1631 -0.0156 0.0046  -0.0129 238  TYR A CD2 
1739 C CE1 . TYR A 238 ? 0.2356 0.1451 0.1788 -0.0101 0.0139  -0.0167 238  TYR A CE1 
1740 C CE2 . TYR A 238 ? 0.1862 0.1003 0.1222 -0.0138 0.0039  -0.0115 238  TYR A CE2 
1741 C CZ  . TYR A 238 ? 0.2390 0.1503 0.1813 -0.0113 0.0085  -0.0132 238  TYR A CZ  
1742 O OH  . TYR A 238 ? 0.2093 0.1194 0.1580 -0.0099 0.0080  -0.0112 238  TYR A OH  
1743 N N   . ARG A 239 ? 0.2539 0.1718 0.1693 -0.0166 0.0158  -0.0169 239  ARG A N   
1744 C CA  . ARG A 239 ? 0.3559 0.2724 0.2626 -0.0197 0.0161  -0.0162 239  ARG A CA  
1745 C C   . ARG A 239 ? 0.3446 0.2652 0.2538 -0.0178 0.0102  -0.0104 239  ARG A C   
1746 O O   . ARG A 239 ? 0.3338 0.2509 0.2344 -0.0209 0.0083  -0.0084 239  ARG A O   
1747 C CB  . ARG A 239 ? 0.3521 0.2706 0.2623 -0.0190 0.0233  -0.0203 239  ARG A CB  
1748 C CG  . ARG A 239 ? 0.4279 0.3553 0.3496 -0.0141 0.0229  -0.0181 239  ARG A CG  
1749 C CD  . ARG A 239 ? 0.5430 0.4747 0.4736 -0.0121 0.0294  -0.0228 239  ARG A CD  
1750 N NE  . ARG A 239 ? 0.5957 0.5223 0.5190 -0.0168 0.0363  -0.0282 239  ARG A NE  
1751 C CZ  . ARG A 239 ? 0.6000 0.5253 0.5166 -0.0202 0.0390  -0.0288 239  ARG A CZ  
1752 N NH1 . ARG A 239 ? 0.4846 0.4047 0.3942 -0.0252 0.0463  -0.0343 239  ARG A NH1 
1753 N NH2 . ARG A 239 ? 0.5530 0.4815 0.4699 -0.0190 0.0350  -0.0243 239  ARG A NH2 
1754 N N   . TYR A 240 ? 0.2102 0.1375 0.1309 -0.0132 0.0077  -0.0079 240  TYR A N   
1755 C CA  . TYR A 240 ? 0.1908 0.1223 0.1160 -0.0115 0.0032  -0.0036 240  TYR A CA  
1756 C C   . TYR A 240 ? 0.2859 0.2157 0.2102 -0.0127 -0.0032 -0.0005 240  TYR A C   
1757 O O   . TYR A 240 ? 0.1923 0.1213 0.1181 -0.0128 -0.0043 -0.0013 240  TYR A O   
1758 C CB  . TYR A 240 ? 0.1060 0.0459 0.0433 -0.0070 0.0044  -0.0031 240  TYR A CB  
1759 C CG  . TYR A 240 ? 0.1766 0.1196 0.1164 -0.0058 0.0098  -0.0062 240  TYR A CG  
1760 C CD1 . TYR A 240 ? 0.2176 0.1628 0.1631 -0.0034 0.0127  -0.0085 240  TYR A CD1 
1761 C CD2 . TYR A 240 ? 0.2373 0.1805 0.1744 -0.0072 0.0119  -0.0068 240  TYR A CD2 
1762 C CE1 . TYR A 240 ? 0.2430 0.1919 0.1930 -0.0023 0.0171  -0.0115 240  TYR A CE1 
1763 C CE2 . TYR A 240 ? 0.2089 0.1556 0.1494 -0.0066 0.0171  -0.0102 240  TYR A CE2 
1764 C CZ  . TYR A 240 ? 0.2354 0.1856 0.1830 -0.0040 0.0194  -0.0127 240  TYR A CZ  
1765 O OH  . TYR A 240 ? 0.2247 0.1794 0.1778 -0.0033 0.0239  -0.0163 240  TYR A OH  
1766 N N   . SER A 241 ? 0.2514 0.1807 0.1746 -0.0136 -0.0074 0.0029  241  SER A N   
1767 C CA  . SER A 241 ? 0.2500 0.1783 0.1739 -0.0149 -0.0144 0.0059  241  SER A CA  
1768 C C   . SER A 241 ? 0.1710 0.1053 0.1070 -0.0121 -0.0157 0.0063  241  SER A C   
1769 O O   . SER A 241 ? 0.1564 0.0962 0.1005 -0.0090 -0.0122 0.0055  241  SER A O   
1770 C CB  . SER A 241 ? 0.2639 0.1913 0.1883 -0.0151 -0.0186 0.0100  241  SER A CB  
1771 O OG  . SER A 241 ? 0.2638 0.1974 0.1997 -0.0115 -0.0162 0.0103  241  SER A OG  
1772 N N   . ASP A 242 ? 0.2109 0.1442 0.1476 -0.0138 -0.0206 0.0071  242  ASP A N   
1773 C CA  . ASP A 242 ? 0.1849 0.1233 0.1330 -0.0121 -0.0217 0.0073  242  ASP A CA  
1774 C C   . ASP A 242 ? 0.1763 0.1208 0.1357 -0.0095 -0.0220 0.0092  242  ASP A C   
1775 O O   . ASP A 242 ? 0.1774 0.1269 0.1456 -0.0078 -0.0196 0.0085  242  ASP A O   
1776 C CB  . ASP A 242 ? 0.1830 0.1200 0.1311 -0.0150 -0.0278 0.0079  242  ASP A CB  
1777 C CG  . ASP A 242 ? 0.2972 0.2291 0.2367 -0.0180 -0.0265 0.0049  242  ASP A CG  
1778 O OD1 . ASP A 242 ? 0.2930 0.2235 0.2309 -0.0168 -0.0205 0.0025  242  ASP A OD1 
1779 O OD2 . ASP A 242 ? 0.3141 0.2435 0.2493 -0.0217 -0.0315 0.0049  242  ASP A OD2 
1780 N N   . GLU A 243 ? 0.2091 0.1522 0.1677 -0.0096 -0.0247 0.0115  243  GLU A N   
1781 C CA  . GLU A 243 ? 0.1871 0.1351 0.1574 -0.0073 -0.0242 0.0125  243  GLU A CA  
1782 C C   . GLU A 243 ? 0.1887 0.1406 0.1609 -0.0054 -0.0172 0.0102  243  GLU A C   
1783 O O   . GLU A 243 ? 0.1599 0.1175 0.1419 -0.0042 -0.0149 0.0092  243  GLU A O   
1784 C CB  . GLU A 243 ? 0.2073 0.1517 0.1766 -0.0077 -0.0284 0.0158  243  GLU A CB  
1785 C CG  . GLU A 243 ? 0.2563 0.1988 0.2278 -0.0090 -0.0369 0.0190  243  GLU A CG  
1786 C CD  . GLU A 243 ? 0.4010 0.3371 0.3567 -0.0129 -0.0406 0.0196  243  GLU A CD  
1787 O OE1 . GLU A 243 ? 0.3128 0.2449 0.2559 -0.0145 -0.0359 0.0174  243  GLU A OE1 
1788 O OE2 . GLU A 243 ? 0.5325 0.4677 0.4889 -0.0147 -0.0483 0.0220  243  GLU A OE2 
1789 N N   . LEU A 244 ? 0.1909 0.1400 0.1539 -0.0057 -0.0139 0.0091  244  LEU A N   
1790 C CA  . LEU A 244 ? 0.1477 0.1014 0.1128 -0.0041 -0.0083 0.0069  244  LEU A CA  
1791 C C   . LEU A 244 ? 0.1676 0.1249 0.1355 -0.0032 -0.0066 0.0058  244  LEU A C   
1792 O O   . LEU A 244 ? 0.1729 0.1358 0.1463 -0.0023 -0.0040 0.0051  244  LEU A O   
1793 C CB  . LEU A 244 ? 0.1596 0.1101 0.1159 -0.0048 -0.0051 0.0055  244  LEU A CB  
1794 C CG  . LEU A 244 ? 0.2129 0.1688 0.1717 -0.0033 -0.0001 0.0031  244  LEU A CG  
1795 C CD1 . LEU A 244 ? 0.1780 0.1392 0.1446 -0.0027 0.0012  0.0029  244  LEU A CD1 
1796 C CD2 . LEU A 244 ? 0.1796 0.1323 0.1313 -0.0045 0.0033  0.0011  244  LEU A CD2 
1797 N N   . ASN A 245 ? 0.1322 0.0857 0.0955 -0.0039 -0.0078 0.0056  245  ASN A N   
1798 C CA  . ASN A 245 ? 0.0903 0.0458 0.0565 -0.0031 -0.0063 0.0053  245  ASN A CA  
1799 C C   . ASN A 245 ? 0.1959 0.1559 0.1705 -0.0034 -0.0071 0.0060  245  ASN A C   
1800 O O   . ASN A 245 ? 0.2041 0.1679 0.1815 -0.0029 -0.0046 0.0061  245  ASN A O   
1801 C CB  . ASN A 245 ? 0.0758 0.0256 0.0371 -0.0042 -0.0074 0.0047  245  ASN A CB  
1802 C CG  . ASN A 245 ? 0.2262 0.1767 0.1908 -0.0034 -0.0059 0.0050  245  ASN A CG  
1803 O OD1 . ASN A 245 ? 0.2510 0.2029 0.2161 -0.0014 -0.0033 0.0052  245  ASN A OD1 
1804 N ND2 . ASN A 245 ? 0.2043 0.1538 0.1716 -0.0050 -0.0078 0.0054  245  ASN A ND2 
1805 N N   . GLU A 246 ? 0.1825 0.1420 0.1612 -0.0045 -0.0105 0.0066  246  GLU A N   
1806 C CA  . GLU A 246 ? 0.1893 0.1532 0.1781 -0.0052 -0.0106 0.0064  246  GLU A CA  
1807 C C   . GLU A 246 ? 0.1723 0.1417 0.1665 -0.0047 -0.0067 0.0054  246  GLU A C   
1808 O O   . GLU A 246 ? 0.1638 0.1367 0.1620 -0.0057 -0.0038 0.0044  246  GLU A O   
1809 C CB  . GLU A 246 ? 0.2594 0.2226 0.2541 -0.0059 -0.0156 0.0073  246  GLU A CB  
1810 C CG  . GLU A 246 ? 0.2757 0.2434 0.2831 -0.0069 -0.0159 0.0063  246  GLU A CG  
1811 C CD  . GLU A 246 ? 0.3127 0.2806 0.3283 -0.0070 -0.0221 0.0075  246  GLU A CD  
1812 O OE1 . GLU A 246 ? 0.3282 0.2945 0.3437 -0.0058 -0.0247 0.0094  246  GLU A OE1 
1813 O OE2 . GLU A 246 ? 0.3531 0.3227 0.3758 -0.0084 -0.0248 0.0069  246  GLU A OE2 
1814 N N   . ILE A 247 ? 0.1048 0.0745 0.0987 -0.0038 -0.0061 0.0052  247  ILE A N   
1815 C CA  . ILE A 247 ? 0.1267 0.1017 0.1263 -0.0040 -0.0019 0.0034  247  ILE A CA  
1816 C C   . ILE A 247 ? 0.1128 0.0909 0.1069 -0.0043 0.0017  0.0025  247  ILE A C   
1817 O O   . ILE A 247 ? 0.1471 0.1299 0.1442 -0.0059 0.0050  0.0009  247  ILE A O   
1818 C CB  . ILE A 247 ? 0.1847 0.1589 0.1869 -0.0033 -0.0018 0.0032  247  ILE A CB  
1819 C CG1 . ILE A 247 ? 0.2689 0.2486 0.2801 -0.0043 0.0028  0.0003  247  ILE A CG1 
1820 C CG2 . ILE A 247 ? 0.1775 0.1490 0.1697 -0.0027 -0.0011 0.0035  247  ILE A CG2 
1821 C CD1 . ILE A 247 ? 0.4171 0.3953 0.4342 -0.0036 0.0033  0.0000  247  ILE A CD1 
1822 N N   . ILE A 248 ? 0.1413 0.1169 0.1275 -0.0030 0.0010  0.0035  248  ILE A N   
1823 C CA  . ILE A 248 ? 0.1393 0.1181 0.1218 -0.0028 0.0030  0.0035  248  ILE A CA  
1824 C C   . ILE A 248 ? 0.1772 0.1561 0.1596 -0.0039 0.0030  0.0048  248  ILE A C   
1825 O O   . ILE A 248 ? 0.1248 0.1076 0.1063 -0.0054 0.0048  0.0049  248  ILE A O   
1826 C CB  . ILE A 248 ? 0.1662 0.1425 0.1431 -0.0009 0.0024  0.0038  248  ILE A CB  
1827 C CG1 . ILE A 248 ? 0.1574 0.1342 0.1339 -0.0007 0.0037  0.0021  248  ILE A CG1 
1828 C CG2 . ILE A 248 ? 0.2105 0.1899 0.1857 0.0000  0.0029  0.0049  248  ILE A CG2 
1829 C CD1 . ILE A 248 ? 0.1717 0.1457 0.1435 0.0004  0.0042  0.0015  248  ILE A CD1 
1830 N N   . THR A 249 ? 0.1406 0.1147 0.1230 -0.0039 0.0009  0.0059  249  THR A N   
1831 C CA  . THR A 249 ? 0.1910 0.1641 0.1736 -0.0054 0.0013  0.0070  249  THR A CA  
1832 C C   . THR A 249 ? 0.1952 0.1728 0.1831 -0.0084 0.0040  0.0055  249  THR A C   
1833 O O   . THR A 249 ? 0.1833 0.1619 0.1683 -0.0104 0.0061  0.0064  249  THR A O   
1834 C CB  . THR A 249 ? 0.2224 0.1899 0.2051 -0.0055 -0.0012 0.0075  249  THR A CB  
1835 O OG1 . THR A 249 ? 0.1902 0.1533 0.1673 -0.0035 -0.0022 0.0081  249  THR A OG1 
1836 C CG2 . THR A 249 ? 0.1655 0.1315 0.1491 -0.0077 0.0000  0.0084  249  THR A CG2 
1837 N N   . ARG A 250 ? 0.1611 0.1408 0.1567 -0.0089 0.0043  0.0033  250  ARG A N   
1838 C CA  . ARG A 250 ? 0.1635 0.1478 0.1665 -0.0118 0.0082  0.0006  250  ARG A CA  
1839 C C   . ARG A 250 ? 0.1500 0.1388 0.1489 -0.0137 0.0121  -0.0007 250  ARG A C   
1840 O O   . ARG A 250 ? 0.1424 0.1337 0.1415 -0.0174 0.0160  -0.0023 250  ARG A O   
1841 C CB  . ARG A 250 ? 0.1721 0.1580 0.1864 -0.0111 0.0075  -0.0015 250  ARG A CB  
1842 C CG  . ARG A 250 ? 0.4803 0.4656 0.5044 -0.0117 0.0054  -0.0020 250  ARG A CG  
1843 C CD  . ARG A 250 ? 0.7214 0.7118 0.7585 -0.0144 0.0101  -0.0060 250  ARG A CD  
1844 N NE  . ARG A 250 ? 0.7201 0.7128 0.7670 -0.0131 0.0110  -0.0080 250  ARG A NE  
1845 C CZ  . ARG A 250 ? 0.7702 0.7671 0.8316 -0.0148 0.0153  -0.0121 250  ARG A CZ  
1846 N NH1 . ARG A 250 ? 0.8929 0.8925 0.9601 -0.0183 0.0195  -0.0151 250  ARG A NH1 
1847 N NH2 . ARG A 250 ? 0.6931 0.6909 0.7640 -0.0131 0.0160  -0.0136 250  ARG A NH2 
1848 N N   . MET A 251 ? 0.1013 0.0912 0.0964 -0.0118 0.0114  -0.0006 251  MET A N   
1849 C CA  . MET A 251 ? 0.0932 0.0880 0.0840 -0.0140 0.0144  -0.0020 251  MET A CA  
1850 C C   . MET A 251 ? 0.1763 0.1709 0.1581 -0.0155 0.0138  0.0010  251  MET A C   
1851 O O   . MET A 251 ? 0.1787 0.1772 0.1559 -0.0191 0.0163  0.0002  251  MET A O   
1852 C CB  . MET A 251 ? 0.0936 0.0897 0.0824 -0.0116 0.0134  -0.0024 251  MET A CB  
1853 C CG  . MET A 251 ? 0.1094 0.1048 0.1060 -0.0107 0.0143  -0.0047 251  MET A CG  
1854 S SD  . MET A 251 ? 0.2451 0.2411 0.2379 -0.0088 0.0140  -0.0052 251  MET A SD  
1855 C CE  . MET A 251 ? 0.2750 0.2657 0.2737 -0.0069 0.0128  -0.0051 251  MET A CE  
1856 N N   . LEU A 252 ? 0.1878 0.1774 0.1667 -0.0130 0.0104  0.0046  252  LEU A N   
1857 C CA  . LEU A 252 ? 0.1561 0.1439 0.1273 -0.0138 0.0092  0.0086  252  LEU A CA  
1858 C C   . LEU A 252 ? 0.2555 0.2401 0.2262 -0.0172 0.0112  0.0094  252  LEU A C   
1859 O O   . LEU A 252 ? 0.2141 0.1943 0.1793 -0.0173 0.0097  0.0134  252  LEU A O   
1860 C CB  . LEU A 252 ? 0.1025 0.0862 0.0714 -0.0093 0.0052  0.0119  252  LEU A CB  
1861 C CG  . LEU A 252 ? 0.1837 0.1710 0.1531 -0.0064 0.0039  0.0109  252  LEU A CG  
1862 C CD1 . LEU A 252 ? 0.2351 0.2181 0.2044 -0.0022 0.0012  0.0130  252  LEU A CD1 
1863 C CD2 . LEU A 252 ? 0.1720 0.1656 0.1372 -0.0084 0.0039  0.0114  252  LEU A CD2 
1864 N N   . ASN A 253 ? 0.1802 0.1666 0.1577 -0.0201 0.0147  0.0055  253  ASN A N   
1865 C CA  . ASN A 253 ? 0.2330 0.2171 0.2108 -0.0241 0.0176  0.0054  253  ASN A CA  
1866 C C   . ASN A 253 ? 0.3202 0.3051 0.2877 -0.0291 0.0203  0.0071  253  ASN A C   
1867 O O   . ASN A 253 ? 0.2243 0.2141 0.1883 -0.0310 0.0218  0.0054  253  ASN A O   
1868 C CB  . ASN A 253 ? 0.2450 0.2320 0.2350 -0.0262 0.0212  0.0003  253  ASN A CB  
1869 C CG  . ASN A 253 ? 0.3374 0.3215 0.3306 -0.0295 0.0234  -0.0002 253  ASN A CG  
1870 O OD1 . ASN A 253 ? 0.3213 0.3050 0.3090 -0.0347 0.0278  -0.0003 253  ASN A OD1 
1871 N ND2 . ASN A 253 ? 0.3025 0.2844 0.3036 -0.0271 0.0204  -0.0004 253  ASN A ND2 
1872 N N   . LEU A 254 ? 0.2689 0.2486 0.2305 -0.0317 0.0208  0.0104  254  LEU A N   
1873 C CA  . LEU A 254 ? 0.2699 0.2493 0.2194 -0.0374 0.0231  0.0127  254  LEU A CA  
1874 C C   . LEU A 254 ? 0.2882 0.2727 0.2386 -0.0442 0.0302  0.0068  254  LEU A C   
1875 O O   . LEU A 254 ? 0.3549 0.3419 0.2947 -0.0489 0.0318  0.0072  254  LEU A O   
1876 C CB  . LEU A 254 ? 0.2674 0.2387 0.2111 -0.0395 0.0232  0.0174  254  LEU A CB  
1877 C CG  . LEU A 254 ? 0.3145 0.2800 0.2556 -0.0335 0.0169  0.0236  254  LEU A CG  
1878 C CD1 . LEU A 254 ? 0.4400 0.3965 0.3778 -0.0355 0.0176  0.0275  254  LEU A CD1 
1879 C CD2 . LEU A 254 ? 0.2524 0.2202 0.1846 -0.0323 0.0127  0.0280  254  LEU A CD2 
1880 N N   . LYS A 255 ? 0.2505 0.2366 0.2138 -0.0451 0.0344  0.0013  255  LYS A N   
1881 C CA  . LYS A 255 ? 0.2318 0.2228 0.1998 -0.0513 0.0423  -0.0057 255  LYS A CA  
1882 C C   . LYS A 255 ? 0.2230 0.2202 0.1988 -0.0489 0.0427  -0.0101 255  LYS A C   
1883 O O   . LYS A 255 ? 0.2537 0.2515 0.2407 -0.0431 0.0393  -0.0108 255  LYS A O   
1884 C CB  . LYS A 255 ? 0.3404 0.3309 0.3226 -0.0527 0.0463  -0.0099 255  LYS A CB  
1885 C CG  . LYS A 255 ? 0.3878 0.3719 0.3641 -0.0561 0.0474  -0.0066 255  LYS A CG  
1886 C CD  . LYS A 255 ? 0.5253 0.5077 0.4861 -0.0645 0.0529  -0.0060 255  LYS A CD  
1887 C CE  . LYS A 255 ? 0.7111 0.6866 0.6670 -0.0692 0.0557  -0.0035 255  LYS A CE  
1888 N NZ  . LYS A 255 ? 0.7795 0.7529 0.7190 -0.0787 0.0618  -0.0031 255  LYS A NZ  
1889 N N   . ASP A 256 ? 0.2383 0.2397 0.2075 -0.0540 0.0469  -0.0133 256  ASP A N   
1890 C CA  . ASP A 256 ? 0.2745 0.2812 0.2512 -0.0523 0.0481  -0.0180 256  ASP A CA  
1891 C C   . ASP A 256 ? 0.2962 0.3047 0.2929 -0.0505 0.0518  -0.0239 256  ASP A C   
1892 O O   . ASP A 256 ? 0.2195 0.2294 0.2255 -0.0454 0.0492  -0.0248 256  ASP A O   
1893 C CB  . ASP A 256 ? 0.2606 0.2716 0.2268 -0.0594 0.0529  -0.0216 256  ASP A CB  
1894 C CG  . ASP A 256 ? 0.3795 0.3907 0.3426 -0.0688 0.0620  -0.0265 256  ASP A CG  
1895 O OD1 . ASP A 256 ? 0.5637 0.5781 0.5171 -0.0759 0.0666  -0.0302 256  ASP A OD1 
1896 O OD2 . ASP A 256 ? 0.3936 0.4019 0.3633 -0.0699 0.0648  -0.0272 256  ASP A OD2 
1897 N N   . TYR A 257 ? 0.2401 0.2484 0.2443 -0.0548 0.0577  -0.0277 257  TYR A N   
1898 C CA  . TYR A 257 ? 0.2806 0.2914 0.3067 -0.0531 0.0608  -0.0333 257  TYR A CA  
1899 C C   . TYR A 257 ? 0.2750 0.2835 0.3120 -0.0455 0.0531  -0.0294 257  TYR A C   
1900 O O   . TYR A 257 ? 0.3298 0.3404 0.3854 -0.0431 0.0536  -0.0328 257  TYR A O   
1901 C CB  . TYR A 257 ? 0.3212 0.3337 0.3545 -0.0604 0.0702  -0.0396 257  TYR A CB  
1902 C CG  . TYR A 257 ? 0.3083 0.3164 0.3323 -0.0636 0.0700  -0.0359 257  TYR A CG  
1903 C CD1 . TYR A 257 ? 0.3495 0.3555 0.3553 -0.0716 0.0748  -0.0354 257  TYR A CD1 
1904 C CD2 . TYR A 257 ? 0.3378 0.3434 0.3704 -0.0592 0.0649  -0.0328 257  TYR A CD2 
1905 C CE1 . TYR A 257 ? 0.3786 0.3794 0.3757 -0.0748 0.0749  -0.0315 257  TYR A CE1 
1906 C CE2 . TYR A 257 ? 0.4439 0.4449 0.4685 -0.0624 0.0652  -0.0298 257  TYR A CE2 
1907 C CZ  . TYR A 257 ? 0.4411 0.4393 0.4483 -0.0700 0.0704  -0.0289 257  TYR A CZ  
1908 O OH  . TYR A 257 ? 0.5105 0.5029 0.5097 -0.0734 0.0710  -0.0254 257  TYR A OH  
1909 N N   . HIS A 258 ? 0.2567 0.2606 0.2828 -0.0420 0.0460  -0.0226 258  HIS A N   
1910 C CA  . HIS A 258 ? 0.1725 0.1741 0.2063 -0.0354 0.0384  -0.0192 258  HIS A CA  
1911 C C   . HIS A 258 ? 0.2301 0.2309 0.2599 -0.0300 0.0329  -0.0163 258  HIS A C   
1912 O O   . HIS A 258 ? 0.2452 0.2440 0.2806 -0.0252 0.0272  -0.0141 258  HIS A O   
1913 C CB  . HIS A 258 ? 0.1720 0.1684 0.1978 -0.0347 0.0343  -0.0143 258  HIS A CB  
1914 C CG  . HIS A 258 ? 0.2101 0.2063 0.2421 -0.0393 0.0386  -0.0167 258  HIS A CG  
1915 N ND1 . HIS A 258 ? 0.2114 0.2121 0.2615 -0.0411 0.0427  -0.0226 258  HIS A ND1 
1916 C CD2 . HIS A 258 ? 0.3412 0.3330 0.3645 -0.0426 0.0396  -0.0143 258  HIS A CD2 
1917 C CE1 . HIS A 258 ? 0.2808 0.2805 0.3332 -0.0456 0.0464  -0.0241 258  HIS A CE1 
1918 N NE2 . HIS A 258 ? 0.2297 0.2236 0.2653 -0.0467 0.0447  -0.0190 258  HIS A NE2 
1919 N N   . ARG A 259 ? 0.1833 0.1857 0.2029 -0.0312 0.0345  -0.0163 259  ARG A N   
1920 C CA  . ARG A 259 ? 0.1503 0.1525 0.1676 -0.0268 0.0306  -0.0146 259  ARG A CA  
1921 C C   . ARG A 259 ? 0.1950 0.1994 0.2269 -0.0256 0.0328  -0.0188 259  ARG A C   
1922 O O   . ARG A 259 ? 0.2020 0.2096 0.2429 -0.0293 0.0391  -0.0241 259  ARG A O   
1923 C CB  . ARG A 259 ? 0.1682 0.1728 0.1724 -0.0289 0.0317  -0.0141 259  ARG A CB  
1924 C CG  . ARG A 259 ? 0.1930 0.1951 0.1836 -0.0300 0.0291  -0.0092 259  ARG A CG  
1925 C CD  . ARG A 259 ? 0.1731 0.1785 0.1518 -0.0325 0.0292  -0.0084 259  ARG A CD  
1926 N NE  . ARG A 259 ? 0.2633 0.2662 0.2304 -0.0352 0.0279  -0.0040 259  ARG A NE  
1927 C CZ  . ARG A 259 ? 0.2609 0.2661 0.2167 -0.0406 0.0295  -0.0035 259  ARG A CZ  
1928 N NH1 . ARG A 259 ? 0.2081 0.2192 0.1623 -0.0441 0.0326  -0.0079 259  ARG A NH1 
1929 N NH2 . ARG A 259 ? 0.3343 0.3356 0.2796 -0.0429 0.0278  0.0016  259  ARG A NH2 
1930 N N   . PRO A 260 ? 0.1991 0.2013 0.2336 -0.0207 0.0279  -0.0165 260  PRO A N   
1931 C CA  . PRO A 260 ? 0.1747 0.1775 0.2232 -0.0192 0.0292  -0.0192 260  PRO A CA  
1932 C C   . PRO A 260 ? 0.1944 0.2004 0.2417 -0.0219 0.0352  -0.0237 260  PRO A C   
1933 O O   . PRO A 260 ? 0.1798 0.1871 0.2140 -0.0234 0.0355  -0.0230 260  PRO A O   
1934 C CB  . PRO A 260 ? 0.1732 0.1712 0.2191 -0.0142 0.0220  -0.0144 260  PRO A CB  
1935 C CG  . PRO A 260 ? 0.1850 0.1819 0.2144 -0.0138 0.0200  -0.0114 260  PRO A CG  
1936 C CD  . PRO A 260 ? 0.2035 0.2017 0.2281 -0.0168 0.0215  -0.0113 260  PRO A CD  
1937 N N   . SER A 261 ? 0.1102 0.1179 0.1724 -0.0229 0.0400  -0.0285 261  SER A N   
1938 C CA  . SER A 261 ? 0.1487 0.1588 0.2108 -0.0256 0.0460  -0.0333 261  SER A CA  
1939 C C   . SER A 261 ? 0.1663 0.1730 0.2260 -0.0215 0.0419  -0.0302 261  SER A C   
1940 O O   . SER A 261 ? 0.1417 0.1439 0.2006 -0.0169 0.0350  -0.0247 261  SER A O   
1941 C CB  . SER A 261 ? 0.2569 0.2687 0.3381 -0.0275 0.0529  -0.0398 261  SER A CB  
1942 O OG  . SER A 261 ? 0.2048 0.2131 0.3010 -0.0220 0.0480  -0.0368 261  SER A OG  
1943 N N   . VAL A 262 ? 0.1550 0.1635 0.2132 -0.0239 0.0467  -0.0343 262  VAL A N   
1944 C CA  . VAL A 262 ? 0.1643 0.1694 0.2221 -0.0210 0.0448  -0.0326 262  VAL A CA  
1945 C C   . VAL A 262 ? 0.2189 0.2183 0.2910 -0.0165 0.0416  -0.0299 262  VAL A C   
1946 O O   . VAL A 262 ? 0.2010 0.1951 0.2695 -0.0128 0.0358  -0.0246 262  VAL A O   
1947 C CB  . VAL A 262 ? 0.1962 0.2045 0.2555 -0.0253 0.0524  -0.0393 262  VAL A CB  
1948 C CG1 . VAL A 262 ? 0.2896 0.2928 0.3569 -0.0226 0.0527  -0.0390 262  VAL A CG1 
1949 C CG2 . VAL A 262 ? 0.3201 0.3335 0.3627 -0.0288 0.0524  -0.0400 262  VAL A CG2 
1950 N N   . GLU A 263 ? 0.2286 0.2291 0.3172 -0.0172 0.0455  -0.0336 263  GLU A N   
1951 C CA  . GLU A 263 ? 0.1998 0.1956 0.3050 -0.0129 0.0422  -0.0311 263  GLU A CA  
1952 C C   . GLU A 263 ? 0.2445 0.2373 0.3474 -0.0091 0.0327  -0.0240 263  GLU A C   
1953 O O   . GLU A 263 ? 0.1775 0.1645 0.2827 -0.0053 0.0265  -0.0187 263  GLU A O   
1954 C CB  . GLU A 263 ? 0.2107 0.2095 0.3368 -0.0146 0.0490  -0.0375 263  GLU A CB  
1955 C CG  . GLU A 263 ? 0.3298 0.3300 0.4617 -0.0184 0.0589  -0.0452 263  GLU A CG  
1956 C CD  . GLU A 263 ? 0.4134 0.4197 0.5311 -0.0253 0.0660  -0.0512 263  GLU A CD  
1957 O OE1 . GLU A 263 ? 0.4090 0.4164 0.5263 -0.0290 0.0730  -0.0570 263  GLU A OE1 
1958 O OE2 . GLU A 263 ? 0.2658 0.2755 0.3723 -0.0275 0.0644  -0.0501 263  GLU A OE2 
1959 N N   . GLU A 264 ? 0.1482 0.1445 0.2458 -0.0106 0.0317  -0.0239 264  GLU A N   
1960 C CA  . GLU A 264 ? 0.1189 0.1128 0.2136 -0.0078 0.0233  -0.0182 264  GLU A CA  
1961 C C   . GLU A 264 ? 0.1723 0.1615 0.2492 -0.0060 0.0175  -0.0127 264  GLU A C   
1962 O O   . GLU A 264 ? 0.1769 0.1617 0.2523 -0.0033 0.0101  -0.0075 264  GLU A O   
1963 C CB  . GLU A 264 ? 0.1544 0.1526 0.2476 -0.0105 0.0248  -0.0200 264  GLU A CB  
1964 C CG  . GLU A 264 ? 0.2454 0.2476 0.3593 -0.0119 0.0292  -0.0249 264  GLU A CG  
1965 C CD  . GLU A 264 ? 0.3985 0.4051 0.5091 -0.0166 0.0343  -0.0286 264  GLU A CD  
1966 O OE1 . GLU A 264 ? 0.4382 0.4478 0.5650 -0.0176 0.0363  -0.0317 264  GLU A OE1 
1967 O OE2 . GLU A 264 ? 0.3226 0.3296 0.4154 -0.0196 0.0362  -0.0283 264  GLU A OE2 
1968 N N   . ILE A 265 ? 0.1365 0.1269 0.2001 -0.0078 0.0209  -0.0141 265  ILE A N   
1969 C CA  . ILE A 265 ? 0.1006 0.0869 0.1493 -0.0063 0.0168  -0.0100 265  ILE A CA  
1970 C C   . ILE A 265 ? 0.1627 0.1427 0.2141 -0.0041 0.0141  -0.0071 265  ILE A C   
1971 O O   . ILE A 265 ? 0.1331 0.1076 0.1777 -0.0023 0.0081  -0.0022 265  ILE A O   
1972 C CB  . ILE A 265 ? 0.1362 0.1263 0.1738 -0.0087 0.0211  -0.0126 265  ILE A CB  
1973 C CG1 . ILE A 265 ? 0.1336 0.1280 0.1647 -0.0106 0.0216  -0.0131 265  ILE A CG1 
1974 C CG2 . ILE A 265 ? 0.0864 0.0729 0.1125 -0.0072 0.0182  -0.0097 265  ILE A CG2 
1975 C CD1 . ILE A 265 ? 0.1215 0.1206 0.1430 -0.0132 0.0249  -0.0154 265  ILE A CD1 
1976 N N   . LEU A 266 ? 0.1116 0.0918 0.1728 -0.0047 0.0190  -0.0103 266  LEU A N   
1977 C CA  . LEU A 266 ? 0.1714 0.1446 0.2342 -0.0030 0.0173  -0.0073 266  LEU A CA  
1978 C C   . LEU A 266 ? 0.2241 0.1921 0.2967 0.0000  0.0102  -0.0021 266  LEU A C   
1979 O O   . LEU A 266 ? 0.1841 0.1445 0.2531 0.0014  0.0059  0.0029  266  LEU A O   
1980 C CB  . LEU A 266 ? 0.1450 0.1192 0.2165 -0.0047 0.0250  -0.0125 266  LEU A CB  
1981 C CG  . LEU A 266 ? 0.2219 0.2012 0.2825 -0.0082 0.0308  -0.0172 266  LEU A CG  
1982 C CD1 . LEU A 266 ? 0.2461 0.2277 0.3165 -0.0109 0.0391  -0.0238 266  LEU A CD1 
1983 C CD2 . LEU A 266 ? 0.1985 0.1738 0.2446 -0.0078 0.0284  -0.0140 266  LEU A CD2 
1984 N N   . GLU A 267 ? 0.1681 0.1402 0.2530 0.0007  0.0089  -0.0031 267  GLU A N   
1985 C CA  . GLU A 267 ? 0.1791 0.1478 0.2736 0.0035  0.0006  0.0021  267  GLU A CA  
1986 C C   . GLU A 267 ? 0.2242 0.1893 0.3035 0.0038  -0.0077 0.0077  267  GLU A C   
1987 O O   . GLU A 267 ? 0.2026 0.1640 0.2858 0.0056  -0.0159 0.0129  267  GLU A O   
1988 C CB  . GLU A 267 ? 0.2965 0.2716 0.4100 0.0038  0.0016  -0.0013 267  GLU A CB  
1989 C CG  . GLU A 267 ? 0.4306 0.4078 0.5644 0.0039  0.0086  -0.0065 267  GLU A CG  
1990 C CD  . GLU A 267 ? 0.6287 0.6132 0.7799 0.0030  0.0117  -0.0115 267  GLU A CD  
1991 O OE1 . GLU A 267 ? 0.6011 0.5885 0.7484 0.0025  0.0075  -0.0101 267  GLU A OE1 
1992 O OE2 . GLU A 267 ? 0.6833 0.6706 0.8524 0.0023  0.0191  -0.0174 267  GLU A OE2 
1993 N N   . ASN A 268 ? 0.2025 0.1689 0.2651 0.0020  -0.0059 0.0065  268  ASN A N   
1994 C CA  . ASN A 268 ? 0.1964 0.1596 0.2457 0.0018  -0.0126 0.0106  268  ASN A CA  
1995 C C   . ASN A 268 ? 0.1965 0.1508 0.2373 0.0022  -0.0187 0.0166  268  ASN A C   
1996 O O   . ASN A 268 ? 0.1883 0.1383 0.2237 0.0019  -0.0158 0.0170  268  ASN A O   
1997 C CB  . ASN A 268 ? 0.2160 0.1812 0.2502 0.0000  -0.0087 0.0082  268  ASN A CB  
1998 C CG  . ASN A 268 ? 0.2357 0.1985 0.2591 -0.0005 -0.0140 0.0107  268  ASN A CG  
1999 O OD1 . ASN A 268 ? 0.2292 0.1857 0.2423 -0.0009 -0.0183 0.0142  268  ASN A OD1 
2000 N ND2 . ASN A 268 ? 0.2036 0.1709 0.2288 -0.0012 -0.0132 0.0086  268  ASN A ND2 
2001 N N   . PRO A 269 ? 0.2115 0.1627 0.2495 0.0023  -0.0273 0.0211  269  PRO A N   
2002 C CA  . PRO A 269 ? 0.2292 0.1712 0.2563 0.0017  -0.0337 0.0272  269  PRO A CA  
2003 C C   . PRO A 269 ? 0.1919 0.1285 0.1984 -0.0008 -0.0300 0.0270  269  PRO A C   
2004 O O   . PRO A 269 ? 0.2363 0.1647 0.2343 -0.0019 -0.0324 0.0312  269  PRO A O   
2005 C CB  . PRO A 269 ? 0.2989 0.2405 0.3241 0.0010  -0.0429 0.0306  269  PRO A CB  
2006 C CG  . PRO A 269 ? 0.3086 0.2591 0.3539 0.0027  -0.0424 0.0272  269  PRO A CG  
2007 C CD  . PRO A 269 ? 0.2750 0.2309 0.3211 0.0025  -0.0318 0.0208  269  PRO A CD  
2008 N N   . LEU A 270 ? 0.1706 0.1114 0.1697 -0.0018 -0.0244 0.0223  270  LEU A N   
2009 C CA  . LEU A 270 ? 0.1494 0.0865 0.1325 -0.0039 -0.0200 0.0211  270  LEU A CA  
2010 C C   . LEU A 270 ? 0.2544 0.1893 0.2388 -0.0040 -0.0146 0.0202  270  LEU A C   
2011 O O   . LEU A 270 ? 0.1951 0.1242 0.1671 -0.0061 -0.0126 0.0209  270  LEU A O   
2012 C CB  . LEU A 270 ? 0.1984 0.1417 0.1784 -0.0041 -0.0148 0.0161  270  LEU A CB  
2013 C CG  . LEU A 270 ? 0.2945 0.2376 0.2687 -0.0049 -0.0188 0.0165  270  LEU A CG  
2014 C CD1 . LEU A 270 ? 0.2513 0.1998 0.2248 -0.0045 -0.0138 0.0124  270  LEU A CD1 
2015 C CD2 . LEU A 270 ? 0.3558 0.2906 0.3143 -0.0077 -0.0222 0.0190  270  LEU A CD2 
2016 N N   . ILE A 271 ? 0.1830 0.1229 0.1826 -0.0022 -0.0112 0.0179  271  ILE A N   
2017 C CA  . ILE A 271 ? 0.2283 0.1678 0.2303 -0.0027 -0.0045 0.0153  271  ILE A CA  
2018 C C   . ILE A 271 ? 0.1844 0.1153 0.1898 -0.0024 -0.0067 0.0198  271  ILE A C   
2019 O O   . ILE A 271 ? 0.1618 0.0923 0.1815 -0.0002 -0.0101 0.0220  271  ILE A O   
2020 C CB  . ILE A 271 ? 0.1175 0.0664 0.1326 -0.0020 0.0016  0.0094  271  ILE A CB  
2021 C CG1 . ILE A 271 ? 0.2636 0.2195 0.2723 -0.0027 0.0036  0.0060  271  ILE A CG1 
2022 C CG2 . ILE A 271 ? 0.1410 0.0896 0.1603 -0.0031 0.0086  0.0061  271  ILE A CG2 
2023 C CD1 . ILE A 271 ? 0.2437 0.2084 0.2615 -0.0031 0.0089  0.0008  271  ILE A CD1 
2024 N N   . LEU A 272 ? 0.1958 0.1196 0.1890 -0.0047 -0.0044 0.0211  272  LEU A N   
2025 C CA  . LEU A 272 ? 0.1901 0.1035 0.1828 -0.0052 -0.0064 0.0264  272  LEU A CA  
2026 C C   . LEU A 272 ? 0.1795 0.0913 0.1742 -0.0066 0.0021  0.0229  272  LEU A C   
2027 O O   . LEU A 272 ? 0.1678 0.0870 0.1624 -0.0077 0.0091  0.0163  272  LEU A O   
2028 C CB  . LEU A 272 ? 0.2126 0.1163 0.1860 -0.0081 -0.0118 0.0321  272  LEU A CB  
2029 C CG  . LEU A 272 ? 0.2442 0.1498 0.2142 -0.0076 -0.0200 0.0347  272  LEU A CG  
2030 C CD1 . LEU A 272 ? 0.2501 0.1470 0.1982 -0.0118 -0.0236 0.0384  272  LEU A CD1 
2031 C CD2 . LEU A 272 ? 0.2969 0.2018 0.2824 -0.0044 -0.0279 0.0398  272  LEU A CD2 
2032 N N   . GLU A 273 ? 0.1813 0.0833 0.1784 -0.0068 0.0010  0.0276  273  GLU A N   
2033 C CA  . GLU A 273 ? 0.1561 0.0560 0.1575 -0.0082 0.0092  0.0241  273  GLU A CA  
2034 C C   . GLU A 273 ? 0.2254 0.1264 0.2118 -0.0122 0.0157  0.0197  273  GLU A C   
2035 O O   . GLU A 273 ? 0.1833 0.0904 0.1747 -0.0134 0.0236  0.0129  273  GLU A O   
2036 C CB  . GLU A 273 ? 0.1455 0.0317 0.1481 -0.0083 0.0064  0.0313  273  GLU A CB  
2037 C CG  . GLU A 273 ? 0.1529 0.0369 0.1671 -0.0088 0.0148  0.0275  273  GLU A CG  
2038 C CD  . GLU A 273 ? 0.3206 0.2032 0.3227 -0.0135 0.0234  0.0230  273  GLU A CD  
2039 O OE1 . GLU A 273 ? 0.2758 0.1615 0.2877 -0.0146 0.0318  0.0166  273  GLU A OE1 
2040 O OE2 . GLU A 273 ? 0.2868 0.1651 0.2702 -0.0166 0.0223  0.0252  273  GLU A OE2 
2041 N N   . HIS A 274 ? 0.2085 0.1035 0.1771 -0.0146 0.0126  0.0233  274  HIS A N   
2042 C CA  . HIS A 274 ? 0.2288 0.1240 0.1846 -0.0187 0.0193  0.0189  274  HIS A CA  
2043 C C   . HIS A 274 ? 0.2441 0.1531 0.2034 -0.0179 0.0235  0.0111  274  HIS A C   
2044 O O   . HIS A 274 ? 0.2242 0.1362 0.1787 -0.0206 0.0299  0.0061  274  HIS A O   
2045 C CB  . HIS A 274 ? 0.1838 0.0689 0.1194 -0.0223 0.0162  0.0236  274  HIS A CB  
2046 C CG  . HIS A 274 ? 0.2317 0.1207 0.1602 -0.0218 0.0111  0.0238  274  HIS A CG  
2047 N ND1 . HIS A 274 ? 0.2080 0.0967 0.1398 -0.0192 0.0020  0.0289  274  HIS A ND1 
2048 C CD2 . HIS A 274 ? 0.2364 0.1295 0.1556 -0.0237 0.0140  0.0194  274  HIS A CD2 
2049 C CE1 . HIS A 274 ? 0.2658 0.1580 0.1898 -0.0198 -0.0001 0.0273  274  HIS A CE1 
2050 N NE2 . HIS A 274 ? 0.2542 0.1486 0.1705 -0.0224 0.0071  0.0218  274  HIS A NE2 
2051 N N   . HIS A 275 ? 0.1334 0.0508 0.1014 -0.0146 0.0199  0.0102  275  HIS A N   
2052 C CA  . HIS A 275 ? 0.1403 0.0701 0.1114 -0.0138 0.0230  0.0039  275  HIS A CA  
2053 C C   . HIS A 275 ? 0.1495 0.0872 0.1325 -0.0140 0.0291  -0.0019 275  HIS A C   
2054 O O   . HIS A 275 ? 0.1968 0.1446 0.1815 -0.0142 0.0318  -0.0070 275  HIS A O   
2055 C CB  . HIS A 275 ? 0.1468 0.0818 0.1213 -0.0110 0.0174  0.0052  275  HIS A CB  
2056 C CG  . HIS A 275 ? 0.2075 0.1367 0.1702 -0.0114 0.0118  0.0094  275  HIS A CG  
2057 N ND1 . HIS A 275 ? 0.2101 0.1360 0.1747 -0.0099 0.0044  0.0144  275  HIS A ND1 
2058 C CD2 . HIS A 275 ? 0.1920 0.1186 0.1416 -0.0137 0.0128  0.0087  275  HIS A CD2 
2059 C CE1 . HIS A 275 ? 0.2302 0.1514 0.1819 -0.0115 0.0008  0.0167  275  HIS A CE1 
2060 N NE2 . HIS A 275 ? 0.2045 0.1256 0.1467 -0.0139 0.0062  0.0131  275  HIS A NE2 
2061 N N   . HIS A 276 ? 0.1252 0.0580 0.1163 -0.0142 0.0310  -0.0011 276  HIS A N   
2062 C CA  . HIS A 276 ? 0.1105 0.0497 0.1131 -0.0152 0.0374  -0.0072 276  HIS A CA  
2063 C C   . HIS A 276 ? 0.1857 0.1243 0.1835 -0.0189 0.0441  -0.0113 276  HIS A C   
2064 O O   . HIS A 276 ? 0.1484 0.0808 0.1349 -0.0207 0.0443  -0.0091 276  HIS A O   
2065 C CB  . HIS A 276 ? 0.1119 0.0454 0.1280 -0.0138 0.0374  -0.0053 276  HIS A CB  
2066 C CG  . HIS A 276 ? 0.1520 0.0882 0.1770 -0.0104 0.0319  -0.0029 276  HIS A CG  
2067 N ND1 . HIS A 276 ? 0.1087 0.0406 0.1282 -0.0082 0.0238  0.0036  276  HIS A ND1 
2068 C CD2 . HIS A 276 ? 0.0882 0.0315 0.1267 -0.0095 0.0339  -0.0070 276  HIS A CD2 
2069 C CE1 . HIS A 276 ? 0.2018 0.1382 0.2325 -0.0057 0.0208  0.0036  276  HIS A CE1 
2070 N NE2 . HIS A 276 ? 0.1456 0.0888 0.1879 -0.0065 0.0272  -0.0028 276  HIS A NE2 
2071 N N   . HIS A 277 ? 0.1293 0.0741 0.1359 -0.0208 0.0503  -0.0176 277  HIS A N   
2072 C CA  . HIS A 277 ? 0.2037 0.1490 0.2073 -0.0248 0.0569  -0.0222 277  HIS A CA  
2073 C C   . HIS A 277 ? 0.2260 0.1572 0.2280 -0.0265 0.0593  -0.0186 277  HIS A C   
2074 O O   . HIS A 277 ? 0.1845 0.1076 0.1930 -0.0245 0.0571  -0.0142 277  HIS A O   
2075 C CB  . HIS A 277 ? 0.2394 0.1954 0.2524 -0.0272 0.0625  -0.0304 277  HIS A CB  
2076 C CG  . HIS A 277 ? 0.2160 0.1664 0.2399 -0.0283 0.0671  -0.0320 277  HIS A CG  
2077 N ND1 . HIS A 277 ? 0.2760 0.2214 0.3018 -0.0320 0.0739  -0.0352 277  HIS A ND1 
2078 C CD2 . HIS A 277 ? 0.2262 0.1745 0.2609 -0.0261 0.0662  -0.0310 277  HIS A CD2 
2079 C CE1 . HIS A 277 ? 0.2682 0.2083 0.3056 -0.0319 0.0770  -0.0360 277  HIS A CE1 
2080 N NE2 . HIS A 277 ? 0.3376 0.2796 0.3812 -0.0283 0.0725  -0.0336 277  HIS A NE2 
2081 N N   . HIS A 278 ? 0.1375 0.0658 0.1318 -0.0302 0.0640  -0.0205 278  HIS A N   
2082 C CA  . HIS A 278 ? 0.1999 0.1148 0.1919 -0.0331 0.0682  -0.0182 278  HIS A CA  
2083 C C   . HIS A 278 ? 0.3302 0.2497 0.3232 -0.0381 0.0770  -0.0260 278  HIS A C   
2084 O O   . HIS A 278 ? 0.3339 0.2624 0.3226 -0.0398 0.0786  -0.0305 278  HIS A O   
2085 C CB  . HIS A 278 ? 0.1902 0.0923 0.1670 -0.0338 0.0643  -0.0104 278  HIS A CB  
2086 C CG  . HIS A 278 ? 0.2611 0.1588 0.2360 -0.0296 0.0550  -0.0027 278  HIS A CG  
2087 N ND1 . HIS A 278 ? 0.2968 0.2029 0.2690 -0.0270 0.0498  -0.0027 278  HIS A ND1 
2088 C CD2 . HIS A 278 ? 0.2665 0.1535 0.2443 -0.0273 0.0496  0.0050  278  HIS A CD2 
2089 C CE1 . HIS A 278 ? 0.2563 0.1571 0.2287 -0.0238 0.0419  0.0042  278  HIS A CE1 
2090 N NE2 . HIS A 278 ? 0.2880 0.1777 0.2644 -0.0237 0.0413  0.0091  278  HIS A NE2 
2091 N N   . HIS A 279 ? 0.2568 0.1698 0.2568 -0.0405 0.0827  -0.0277 279  HIS A N   
2092 C CA  . HIS A 279 ? 0.3300 0.2459 0.3315 -0.0460 0.0915  -0.0352 279  HIS A CA  
2093 C C   . HIS A 279 ? 0.5011 0.4079 0.4895 -0.0498 0.0945  -0.0331 279  HIS A C   
2094 O O   . HIS A 279 ? 0.5187 0.4300 0.5073 -0.0545 0.1016  -0.0398 279  HIS A O   
2095 C CB  . HIS A 279 ? 0.3447 0.2552 0.3580 -0.0477 0.0974  -0.0380 279  HIS A CB  
2096 C CG  . HIS A 279 ? 0.5364 0.4585 0.5626 -0.0461 0.0973  -0.0434 279  HIS A CG  
2097 N ND1 . HIS A 279 ? 0.6657 0.5830 0.7015 -0.0423 0.0946  -0.0400 279  HIS A ND1 
2098 C CD2 . HIS A 279 ? 0.6386 0.5771 0.6689 -0.0480 0.0993  -0.0519 279  HIS A CD2 
2099 C CE1 . HIS A 279 ? 0.6872 0.6169 0.7319 -0.0426 0.0963  -0.0470 279  HIS A CE1 
2100 N NE2 . HIS A 279 ? 0.6532 0.5956 0.6937 -0.0462 0.0987  -0.0539 279  HIS A NE2 
2101 O OXT . HIS A 279 ? 0.4771 0.3722 0.4542 -0.0488 0.0901  -0.0249 279  HIS A OXT 
2102 C C01 . WCX B .   ? 0.2991 0.4462 0.3731 -0.0236 -0.0241 0.0898  1280 WCX A C01 
2103 C C02 . WCX B .   ? 0.3111 0.4255 0.3800 -0.0216 -0.0175 0.0767  1280 WCX A C02 
2104 O O03 . WCX B .   ? 0.2444 0.3429 0.3047 -0.0303 -0.0120 0.0742  1280 WCX A O03 
2105 C C04 . WCX B .   ? 0.2379 0.3143 0.2887 -0.0298 -0.0026 0.0635  1280 WCX A C04 
2106 C C05 . WCX B .   ? 0.1474 0.2154 0.1959 -0.0232 0.0011  0.0538  1280 WCX A C05 
2107 C C06 . WCX B .   ? 0.2063 0.2496 0.2423 -0.0199 0.0114  0.0454  1280 WCX A C06 
2108 N N09 . WCX B .   ? 0.1589 0.1685 0.1719 -0.0092 0.0299  0.0214  1280 WCX A N09 
2109 C C08 . WCX B .   ? 0.1324 0.1488 0.1447 -0.0165 0.0306  0.0278  1280 WCX A C08 
2110 N N07 . WCX B .   ? 0.1757 0.2091 0.2076 -0.0142 0.0151  0.0371  1280 WCX A N07 
2111 C C23 . WCX B .   ? 0.1362 0.1705 0.1799 -0.0044 0.0062  0.0368  1280 WCX A C23 
2112 C C22 . WCX B .   ? 0.1834 0.2239 0.2434 0.0037  -0.0069 0.0455  1280 WCX A C22 
2113 C C21 . WCX B .   ? 0.2467 0.2802 0.3124 0.0150  -0.0100 0.0423  1280 WCX A C21 
2114 C C12 . WCX B .   ? 0.1621 0.1875 0.2191 0.0163  -0.0022 0.0305  1280 WCX A C12 
2115 O O13 . WCX B .   ? 0.2490 0.2675 0.3103 0.0267  -0.0039 0.0263  1280 WCX A O13 
2116 C C14 . WCX B .   ? 0.3238 0.3520 0.3783 0.0235  0.0051  0.0161  1280 WCX A C14 
2117 C C15 . WCX B .   ? 0.3618 0.4095 0.4281 0.0330  0.0029  0.0162  1280 WCX A C15 
2118 C C16 . WCX B .   ? 0.4685 0.4925 0.5414 0.0486  -0.0035 0.0202  1280 WCX A C16 
2119 N N17 . WCX B .   ? 0.5319 0.5237 0.5945 0.0487  -0.0024 0.0126  1280 WCX A N17 
2120 C C18 . WCX B .   ? 0.6476 0.6136 0.7112 0.0581  -0.0061 0.0131  1280 WCX A C18 
2121 C C19 . WCX B .   ? 0.4816 0.4645 0.5350 0.0392  -0.0020 0.0130  1280 WCX A C19 
2122 C C20 . WCX B .   ? 0.3679 0.3658 0.4127 0.0286  0.0071  0.0101  1280 WCX A C20 
2123 C C11 . WCX B .   ? 0.1312 0.1505 0.1716 0.0077  0.0100  0.0228  1280 WCX A C11 
2124 C C10 . WCX B .   ? 0.1492 0.1713 0.1821 -0.0021 0.0150  0.0264  1280 WCX A C10 
2125 C C24 . WCX B .   ? 0.2239 0.2546 0.2510 -0.0204 0.0185  0.0474  1280 WCX A C24 
2126 C C25 . WCX B .   ? 0.2112 0.2532 0.2426 -0.0273 0.0152  0.0561  1280 WCX A C25 
2127 C C26 . WCX B .   ? 0.2005 0.2637 0.2431 -0.0334 0.0044  0.0636  1280 WCX A C26 
2128 C C27 . WCX B .   ? 0.2830 0.3558 0.3274 -0.0412 0.0020  0.0727  1280 WCX A C27 
2129 N N28 . WCX B .   ? 0.4255 0.5191 0.4776 -0.0460 -0.0075 0.0825  1280 WCX A N28 
2130 O O29 . WCX B .   ? 0.3101 0.3747 0.3486 -0.0419 0.0088  0.0726  1280 WCX A O29 
2131 C C30 . WCX B .   ? 0.2081 0.2953 0.2851 -0.0052 -0.0242 0.0801  1280 WCX A C30 
2132 C C31 . WCX B .   ? 0.1934 0.2555 0.2710 -0.0048 -0.0281 0.0853  1280 WCX A C31 
2133 C C32 . WCX B .   ? 0.2288 0.2636 0.3091 0.0052  -0.0321 0.0860  1280 WCX A C32 
2134 C C33 . WCX B .   ? 0.2809 0.3104 0.3639 0.0183  -0.0317 0.0824  1280 WCX A C33 
2135 C C34 . WCX B .   ? 0.2568 0.3154 0.3425 0.0211  -0.0285 0.0787  1280 WCX A C34 
2136 C C35 . WCX B .   ? 0.1955 0.2841 0.2781 0.0079  -0.0251 0.0772  1280 WCX A C35 
2137 C C36 . WCX B .   ? 0.2449 0.3690 0.3279 0.0048  -0.0207 0.0710  1280 WCX A C36 
2138 F F39 . WCX B .   ? 0.2606 0.3829 0.3505 0.0200  -0.0221 0.0704  1280 WCX A F39 
2139 F F38 . WCX B .   ? 0.2421 0.3610 0.3129 -0.0084 -0.0107 0.0570  1280 WCX A F38 
2140 F F37 . WCX B .   ? 0.2462 0.4092 0.3324 -0.0002 -0.0237 0.0801  1280 WCX A F37 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   TYR 8   8   8   TYR TYR A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  SER 18  18  ?   ?   ?   A . n 
A 1 19  TYR 19  19  19  TYR TYR A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 MET 117 117 117 MET MET A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 HIS 128 128 128 HIS HIS A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 ARG 130 130 130 ARG ARG A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 ASP 132 132 ?   ?   ?   A . n 
A 1 133 GLY 133 133 ?   ?   ?   A . n 
A 1 134 GLY 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 THR 136 136 ?   ?   ?   A . n 
A 1 137 VAL 137 137 ?   ?   ?   A . n 
A 1 138 LEU 138 138 ?   ?   ?   A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 LYS 152 152 152 LYS LYS A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ALA 163 163 ?   ?   ?   A . n 
A 1 164 ARG 164 164 ?   ?   ?   A . n 
A 1 165 ILE 165 165 ?   ?   ?   A . n 
A 1 166 LEU 166 166 ?   ?   ?   A . n 
A 1 167 ASN 167 167 ?   ?   ?   A . n 
A 1 168 HIS 168 168 ?   ?   ?   A . n 
A 1 169 ASP 169 169 ?   ?   ?   A . n 
A 1 170 THR 170 170 ?   ?   ?   A . n 
A 1 171 SER 171 171 ?   ?   ?   A . n 
A 1 172 PHE 172 172 ?   ?   ?   A . n 
A 1 173 ALA 173 173 ?   ?   ?   A . n 
A 1 174 LYS 174 174 ?   ?   ?   A . n 
A 1 175 THR 175 175 ?   ?   ?   A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 VAL 177 177 177 VAL VAL A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 PRO 180 180 180 PRO PRO A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 MET 188 188 188 MET MET A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 ARG 190 190 190 ARG ARG A . n 
A 1 191 MET 191 191 ?   ?   ?   A . n 
A 1 192 SER 192 192 ?   ?   ?   A . n 
A 1 193 TYR 193 193 ?   ?   ?   A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLU 195 195 195 GLU GLU A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 SER 201 201 201 SER SER A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 TYR 207 207 207 TYR TYR A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 CYS 210 210 210 CYS CYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 MET 213 213 213 MET MET A . n 
A 1 214 PRO 214 214 214 PRO PRO A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 ARG 235 235 235 ARG ARG A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 PRO 237 237 237 PRO PRO A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ARG 239 239 239 ARG ARG A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 MET 251 251 251 MET MET A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LYS 255 255 255 LYS LYS A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 HIS 275 275 275 HIS HIS A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 HIS 277 277 277 HIS HIS A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 HIS 279 279 279 HIS HIS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 WCX 1   1280 1280 WCX WCX A . 
C 3 CL  1   1281 1281 CL  CL  A . 
D 3 CL  1   1282 1282 CL  CL  A . 
E 3 CL  1   1283 1283 CL  CL  A . 
F 4 EDO 1   1284 1284 EDO EDO A . 
G 4 EDO 1   1285 1285 EDO EDO A . 
H 4 EDO 1   1286 1286 EDO EDO A . 
I 4 EDO 1   1287 1287 EDO EDO A . 
J 3 CL  1   1288 1288 CL  CL  A . 
K 4 EDO 1   1289 1289 EDO EDO A . 
L 5 HOH 1   2001 2001 HOH HOH A . 
L 5 HOH 2   2002 2002 HOH HOH A . 
L 5 HOH 3   2003 2003 HOH HOH A . 
L 5 HOH 4   2004 2004 HOH HOH A . 
L 5 HOH 5   2005 2005 HOH HOH A . 
L 5 HOH 6   2006 2006 HOH HOH A . 
L 5 HOH 7   2007 2007 HOH HOH A . 
L 5 HOH 8   2008 2008 HOH HOH A . 
L 5 HOH 9   2009 2009 HOH HOH A . 
L 5 HOH 10  2010 2010 HOH HOH A . 
L 5 HOH 11  2011 2011 HOH HOH A . 
L 5 HOH 12  2012 2012 HOH HOH A . 
L 5 HOH 13  2013 2013 HOH HOH A . 
L 5 HOH 14  2014 2014 HOH HOH A . 
L 5 HOH 15  2015 2015 HOH HOH A . 
L 5 HOH 16  2016 2016 HOH HOH A . 
L 5 HOH 17  2017 2017 HOH HOH A . 
L 5 HOH 18  2018 2018 HOH HOH A . 
L 5 HOH 19  2019 2019 HOH HOH A . 
L 5 HOH 20  2020 2020 HOH HOH A . 
L 5 HOH 21  2021 2021 HOH HOH A . 
L 5 HOH 22  2022 2022 HOH HOH A . 
L 5 HOH 23  2023 2023 HOH HOH A . 
L 5 HOH 24  2024 2024 HOH HOH A . 
L 5 HOH 25  2025 2025 HOH HOH A . 
L 5 HOH 26  2026 2026 HOH HOH A . 
L 5 HOH 27  2027 2027 HOH HOH A . 
L 5 HOH 28  2028 2028 HOH HOH A . 
L 5 HOH 29  2029 2029 HOH HOH A . 
L 5 HOH 30  2030 2030 HOH HOH A . 
L 5 HOH 31  2031 2031 HOH HOH A . 
L 5 HOH 32  2032 2032 HOH HOH A . 
L 5 HOH 33  2033 2033 HOH HOH A . 
L 5 HOH 34  2034 2034 HOH HOH A . 
L 5 HOH 35  2035 2035 HOH HOH A . 
L 5 HOH 36  2036 2036 HOH HOH A . 
L 5 HOH 37  2037 2037 HOH HOH A . 
L 5 HOH 38  2038 2038 HOH HOH A . 
L 5 HOH 39  2039 2039 HOH HOH A . 
L 5 HOH 40  2040 2040 HOH HOH A . 
L 5 HOH 41  2041 2041 HOH HOH A . 
L 5 HOH 42  2042 2042 HOH HOH A . 
L 5 HOH 43  2043 2043 HOH HOH A . 
L 5 HOH 44  2044 2044 HOH HOH A . 
L 5 HOH 45  2045 2045 HOH HOH A . 
L 5 HOH 46  2046 2046 HOH HOH A . 
L 5 HOH 47  2047 2047 HOH HOH A . 
L 5 HOH 48  2048 2048 HOH HOH A . 
L 5 HOH 49  2049 2049 HOH HOH A . 
L 5 HOH 50  2050 2050 HOH HOH A . 
L 5 HOH 51  2051 2051 HOH HOH A . 
L 5 HOH 52  2052 2052 HOH HOH A . 
L 5 HOH 53  2053 2053 HOH HOH A . 
L 5 HOH 54  2054 2054 HOH HOH A . 
L 5 HOH 55  2055 2055 HOH HOH A . 
L 5 HOH 56  2056 2056 HOH HOH A . 
L 5 HOH 57  2057 2057 HOH HOH A . 
L 5 HOH 58  2058 2058 HOH HOH A . 
L 5 HOH 59  2059 2059 HOH HOH A . 
L 5 HOH 60  2060 2060 HOH HOH A . 
L 5 HOH 61  2061 2061 HOH HOH A . 
L 5 HOH 62  2062 2062 HOH HOH A . 
L 5 HOH 63  2063 2063 HOH HOH A . 
L 5 HOH 64  2064 2064 HOH HOH A . 
L 5 HOH 65  2065 2065 HOH HOH A . 
L 5 HOH 66  2066 2066 HOH HOH A . 
L 5 HOH 67  2067 2067 HOH HOH A . 
L 5 HOH 68  2068 2068 HOH HOH A . 
L 5 HOH 69  2069 2069 HOH HOH A . 
L 5 HOH 70  2070 2070 HOH HOH A . 
L 5 HOH 71  2071 2071 HOH HOH A . 
L 5 HOH 72  2072 2072 HOH HOH A . 
L 5 HOH 73  2073 2073 HOH HOH A . 
L 5 HOH 74  2074 2074 HOH HOH A . 
L 5 HOH 75  2075 2075 HOH HOH A . 
L 5 HOH 76  2076 2076 HOH HOH A . 
L 5 HOH 77  2077 2077 HOH HOH A . 
L 5 HOH 78  2078 2078 HOH HOH A . 
L 5 HOH 79  2079 2079 HOH HOH A . 
L 5 HOH 80  2080 2080 HOH HOH A . 
L 5 HOH 81  2081 2081 HOH HOH A . 
L 5 HOH 82  2082 2082 HOH HOH A . 
L 5 HOH 83  2083 2083 HOH HOH A . 
L 5 HOH 84  2084 2084 HOH HOH A . 
L 5 HOH 85  2085 2085 HOH HOH A . 
L 5 HOH 86  2086 2086 HOH HOH A . 
L 5 HOH 87  2087 2087 HOH HOH A . 
L 5 HOH 88  2088 2088 HOH HOH A . 
L 5 HOH 89  2089 2089 HOH HOH A . 
L 5 HOH 90  2090 2090 HOH HOH A . 
L 5 HOH 91  2091 2091 HOH HOH A . 
L 5 HOH 92  2092 2092 HOH HOH A . 
L 5 HOH 93  2093 2093 HOH HOH A . 
L 5 HOH 94  2094 2094 HOH HOH A . 
L 5 HOH 95  2095 2095 HOH HOH A . 
L 5 HOH 96  2096 2096 HOH HOH A . 
L 5 HOH 97  2097 2097 HOH HOH A . 
L 5 HOH 98  2098 2098 HOH HOH A . 
L 5 HOH 99  2099 2099 HOH HOH A . 
L 5 HOH 100 2100 2100 HOH HOH A . 
L 5 HOH 101 2101 2101 HOH HOH A . 
L 5 HOH 102 2102 2102 HOH HOH A . 
L 5 HOH 103 2103 2103 HOH HOH A . 
L 5 HOH 104 2104 2104 HOH HOH A . 
L 5 HOH 105 2105 2105 HOH HOH A . 
L 5 HOH 106 2106 2106 HOH HOH A . 
L 5 HOH 107 2107 2107 HOH HOH A . 
L 5 HOH 108 2108 2108 HOH HOH A . 
L 5 HOH 109 2109 2109 HOH HOH A . 
L 5 HOH 110 2110 2110 HOH HOH A . 
L 5 HOH 111 2111 2111 HOH HOH A . 
L 5 HOH 112 2112 2112 HOH HOH A . 
L 5 HOH 113 2113 2113 HOH HOH A . 
L 5 HOH 114 2114 2114 HOH HOH A . 
L 5 HOH 115 2115 2115 HOH HOH A . 
L 5 HOH 116 2116 2116 HOH HOH A . 
L 5 HOH 117 2117 2117 HOH HOH A . 
L 5 HOH 118 2118 2118 HOH HOH A . 
L 5 HOH 119 2119 2119 HOH HOH A . 
L 5 HOH 120 2120 2120 HOH HOH A . 
L 5 HOH 121 2121 2121 HOH HOH A . 
L 5 HOH 122 2122 2122 HOH HOH A . 
L 5 HOH 123 2123 2123 HOH HOH A . 
L 5 HOH 124 2124 2124 HOH HOH A . 
L 5 HOH 125 2125 2125 HOH HOH A . 
L 5 HOH 126 2126 2126 HOH HOH A . 
L 5 HOH 127 2127 2127 HOH HOH A . 
L 5 HOH 128 2128 2128 HOH HOH A . 
L 5 HOH 129 2129 2129 HOH HOH A . 
L 5 HOH 130 2130 2130 HOH HOH A . 
L 5 HOH 131 2131 2131 HOH HOH A . 
L 5 HOH 132 2132 2132 HOH HOH A . 
L 5 HOH 133 2133 2133 HOH HOH A . 
L 5 HOH 134 2134 2134 HOH HOH A . 
L 5 HOH 135 2135 2135 HOH HOH A . 
L 5 HOH 136 2136 2136 HOH HOH A . 
L 5 HOH 137 2137 2137 HOH HOH A . 
L 5 HOH 138 2138 2138 HOH HOH A . 
L 5 HOH 139 2139 2139 HOH HOH A . 
L 5 HOH 140 2140 2140 HOH HOH A . 
L 5 HOH 141 2141 2141 HOH HOH A . 
L 5 HOH 142 2142 2142 HOH HOH A . 
L 5 HOH 143 2143 2143 HOH HOH A . 
L 5 HOH 144 2144 2144 HOH HOH A . 
L 5 HOH 145 2145 2145 HOH HOH A . 
L 5 HOH 146 2146 2146 HOH HOH A . 
L 5 HOH 147 2147 2147 HOH HOH A . 
L 5 HOH 148 2148 2148 HOH HOH A . 
L 5 HOH 149 2149 2149 HOH HOH A . 
L 5 HOH 150 2150 2150 HOH HOH A . 
L 5 HOH 151 2151 2151 HOH HOH A . 
L 5 HOH 152 2152 2152 HOH HOH A . 
L 5 HOH 153 2153 2153 HOH HOH A . 
L 5 HOH 154 2154 2154 HOH HOH A . 
L 5 HOH 155 2155 2155 HOH HOH A . 
L 5 HOH 156 2156 2156 HOH HOH A . 
L 5 HOH 157 2157 2157 HOH HOH A . 
L 5 HOH 158 2158 2158 HOH HOH A . 
L 5 HOH 159 2159 2159 HOH HOH A . 
L 5 HOH 160 2160 2160 HOH HOH A . 
L 5 HOH 161 2161 2161 HOH HOH A . 
L 5 HOH 162 2162 2162 HOH HOH A . 
L 5 HOH 163 2163 2163 HOH HOH A . 
L 5 HOH 164 2164 2164 HOH HOH A . 
L 5 HOH 165 2165 2165 HOH HOH A . 
L 5 HOH 166 2166 2166 HOH HOH A . 
L 5 HOH 167 2167 2167 HOH HOH A . 
L 5 HOH 168 2168 2168 HOH HOH A . 
L 5 HOH 169 2169 2169 HOH HOH A . 
L 5 HOH 170 2170 2170 HOH HOH A . 
L 5 HOH 171 2171 2171 HOH HOH A . 
L 5 HOH 172 2172 2172 HOH HOH A . 
L 5 HOH 173 2173 2173 HOH HOH A . 
L 5 HOH 174 2174 2174 HOH HOH A . 
L 5 HOH 175 2175 2175 HOH HOH A . 
L 5 HOH 176 2176 2176 HOH HOH A . 
L 5 HOH 177 2177 2177 HOH HOH A . 
L 5 HOH 178 2178 2178 HOH HOH A . 
L 5 HOH 179 2179 2179 HOH HOH A . 
L 5 HOH 180 2180 2180 HOH HOH A . 
L 5 HOH 181 2181 2181 HOH HOH A . 
L 5 HOH 182 2182 2182 HOH HOH A . 
L 5 HOH 183 2183 2183 HOH HOH A . 
L 5 HOH 184 2184 2184 HOH HOH A . 
L 5 HOH 185 2185 2185 HOH HOH A . 
L 5 HOH 186 2186 2186 HOH HOH A . 
L 5 HOH 187 2187 2187 HOH HOH A . 
L 5 HOH 188 2188 2188 HOH HOH A . 
L 5 HOH 189 2189 2189 HOH HOH A . 
L 5 HOH 190 2190 2190 HOH HOH A . 
L 5 HOH 191 2191 2191 HOH HOH A . 
L 5 HOH 192 2192 2192 HOH HOH A . 
L 5 HOH 193 2193 2193 HOH HOH A . 
L 5 HOH 194 2194 2194 HOH HOH A . 
L 5 HOH 195 2195 2195 HOH HOH A . 
L 5 HOH 196 2196 2196 HOH HOH A . 
L 5 HOH 197 2197 2197 HOH HOH A . 
L 5 HOH 198 2198 2198 HOH HOH A . 
L 5 HOH 199 2199 2199 HOH HOH A . 
L 5 HOH 200 2200 2200 HOH HOH A . 
L 5 HOH 201 2201 2201 HOH HOH A . 
L 5 HOH 202 2202 2202 HOH HOH A . 
L 5 HOH 203 2203 2203 HOH HOH A . 
L 5 HOH 204 2204 2204 HOH HOH A . 
L 5 HOH 205 2205 2205 HOH HOH A . 
L 5 HOH 206 2206 2206 HOH HOH A . 
L 5 HOH 207 2207 2207 HOH HOH A . 
L 5 HOH 208 2208 2208 HOH HOH A . 
L 5 HOH 209 2209 2209 HOH HOH A . 
L 5 HOH 210 2210 2210 HOH HOH A . 
L 5 HOH 211 2211 2211 HOH HOH A . 
L 5 HOH 212 2212 2212 HOH HOH A . 
L 5 HOH 213 2213 2213 HOH HOH A . 
L 5 HOH 214 2214 2214 HOH HOH A . 
L 5 HOH 215 2215 2215 HOH HOH A . 
L 5 HOH 216 2216 2216 HOH HOH A . 
L 5 HOH 217 2217 2217 HOH HOH A . 
L 5 HOH 218 2218 2218 HOH HOH A . 
L 5 HOH 219 2219 2219 HOH HOH A . 
L 5 HOH 220 2220 2220 HOH HOH A . 
L 5 HOH 221 2221 2221 HOH HOH A . 
L 5 HOH 222 2222 2222 HOH HOH A . 
L 5 HOH 223 2223 2223 HOH HOH A . 
L 5 HOH 224 2224 2224 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2080 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   L 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-30 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -29.4606 -10.8542 10.1849 0.1079 0.2812 0.1845 -0.0168 -0.0551 -0.0929 1.8964 1.0719 1.6145 
-0.4079 1.3599  0.2560  0.0589  0.6825 -0.4494 -0.1658 0.0379 0.3849  0.0500  0.1922  -0.0523 
'X-RAY DIFFRACTION' 2 ? refined -18.1899 -3.5685  20.2085 0.0420 0.0880 0.0378 -0.0053 0.0023  0.0001  1.6984 1.1304 0.0328 1.0032 
0.1542  0.0112  -0.0113 0.1989 0.1334  -0.0364 0.0209 0.1336  0.0430  -0.0656 0.0021  
'X-RAY DIFFRACTION' 3 ? refined -6.0602  9.0524   19.3764 0.0547 0.0560 0.0269 -0.0074 0.0068  0.0039  0.9834 1.2230 0.5304 0.5889 
-0.2228 0.2581  -0.0868 0.1713 0.0150  -0.0726 0.0519 -0.0260 -0.0771 -0.0708 0.0308  
'X-RAY DIFFRACTION' 4 ? refined -26.4379 -2.4046  18.7578 0.1081 0.1657 0.1712 -0.0013 -0.0086 0.0510  1.8860 0.8693 5.1072 0.5218 
-2.1642 -0.2244 -0.2707 0.3876 0.3113  0.0362  0.0819 0.0659  -0.0430 -0.4241 0.1546  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 3:63)'    
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 64:157)'  
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 158:279)' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(CHAIN A AND RESID 1280)'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 76  ? ? -103.40 79.12  
2 1 THR A 80  ? ? 38.21   52.00  
3 1 MET A 188 ? ? -49.96  -19.30 
4 1 ASN A 189 ? ? -142.50 -28.00 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2001 ? .    6.15 
2 1 O ? A HOH 2002 ? .    6.08 
3 1 O ? A HOH 2017 ? 6.74 .    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A SER 54  ? CA  ? A SER 54  CA  
2  1 Y 0 A ARG 69  ? CD  ? A ARG 69  CD  
3  1 Y 0 A ARG 69  ? NH2 ? A ARG 69  NH2 
4  1 Y 1 A ARG 77  ? CG  ? A ARG 77  CG  
5  1 Y 1 A ARG 77  ? CD  ? A ARG 77  CD  
6  1 Y 1 A ARG 77  ? NE  ? A ARG 77  NE  
7  1 Y 1 A ARG 77  ? CZ  ? A ARG 77  CZ  
8  1 Y 1 A ARG 77  ? NH1 ? A ARG 77  NH1 
9  1 Y 1 A ARG 77  ? NH2 ? A ARG 77  NH2 
10 1 Y 1 A ASN 79  ? CG  ? A ASN 79  CG  
11 1 Y 1 A ASN 79  ? OD1 ? A ASN 79  OD1 
12 1 Y 1 A ASN 79  ? ND2 ? A ASN 79  ND2 
13 1 Y 1 A ARG 130 ? NE  ? A ARG 130 NE  
14 1 Y 1 A ARG 130 ? CZ  ? A ARG 130 CZ  
15 1 Y 1 A ARG 130 ? NH1 ? A ARG 130 NH1 
16 1 Y 1 A ARG 130 ? NH2 ? A ARG 130 NH2 
17 1 Y 1 A HIS 139 ? CG  ? A HIS 139 CG  
18 1 Y 1 A HIS 139 ? ND1 ? A HIS 139 ND1 
19 1 Y 1 A HIS 139 ? CD2 ? A HIS 139 CD2 
20 1 Y 1 A HIS 139 ? CE1 ? A HIS 139 CE1 
21 1 Y 1 A HIS 139 ? NE2 ? A HIS 139 NE2 
22 1 Y 0 A MET 188 ? CG  ? A MET 188 CG  
23 1 Y 0 A GLN 221 ? OE1 ? A GLN 221 OE1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A SER 18  ? A SER 18  
4  1 Y 1 A ASP 132 ? A ASP 132 
5  1 Y 1 A GLY 133 ? A GLY 133 
6  1 Y 1 A GLY 134 ? A GLY 134 
7  1 Y 1 A HIS 135 ? A HIS 135 
8  1 Y 1 A THR 136 ? A THR 136 
9  1 Y 1 A VAL 137 ? A VAL 137 
10 1 Y 1 A LEU 138 ? A LEU 138 
11 1 Y 1 A ALA 163 ? A ALA 163 
12 1 Y 1 A ARG 164 ? A ARG 164 
13 1 Y 1 A ILE 165 ? A ILE 165 
14 1 Y 1 A LEU 166 ? A LEU 166 
15 1 Y 1 A ASN 167 ? A ASN 167 
16 1 Y 1 A HIS 168 ? A HIS 168 
17 1 Y 1 A ASP 169 ? A ASP 169 
18 1 Y 1 A THR 170 ? A THR 170 
19 1 Y 1 A SER 171 ? A SER 171 
20 1 Y 1 A PHE 172 ? A PHE 172 
21 1 Y 1 A ALA 173 ? A ALA 173 
22 1 Y 1 A LYS 174 ? A LYS 174 
23 1 Y 1 A THR 175 ? A THR 175 
24 1 Y 1 A MET 191 ? A MET 191 
25 1 Y 1 A SER 192 ? A SER 192 
26 1 Y 1 A TYR 193 ? A TYR 193 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-{5-[(1-METHYLPIPERIDIN-4-YL)OXY]-1H-BENZIMIDAZOL-1-YL}-2-{(1R)-1-[2-(TRIFLUOROMETHYL)PHENYL]ETHOXY}BENZAMIDE' WCX 
3 'CHLORIDE ION'                                                                                                   CL  
4 1,2-ETHANEDIOL                                                                                                   EDO 
5 water                                                                                                            HOH 
#