data_2XPG
# 
_entry.id   2XPG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XPG         
PDBE  EBI-45177    
WWPDB D_1290045177 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1UQS unspecified 'THE CRYSTAL STRUCTURE OF HUMAN CD1B WITH A BOUND BACTERIAL GLYCOLIPID' 
PDB 1BD2 unspecified 'COMPLEX BETWEEN HUMAN T-CELL RECEPTOR B7, VIRAL PEPTIDE (TAX) AND MHC CLASS I MOLECULE HLA-A 0201' 
PDB 2ESV unspecified 'STRUCTURE OF THE HLA-E-VMAPRTLIL/KK50.4 TCR COMPLEX' 
PDB 2XKS unspecified 'PRION-LIKE CONVERSION DURING AMYLOID FORMATION AT ATOMIC RESOLUTION' 
PDB 2AK4 unspecified 'CRYSTAL STRUCTURE OF SB27 TCR IN COMPLEX WITH HLA-B *3508-13MER PEPTIDE' 
PDB 1YPZ unspecified 'IMMUNE RECEPTOR' 
PDB 1IM3 unspecified 'CRYSTAL STRUCTURE OF THE HUMAN CYTOMEGALOVIRUS PROTEIN US2BOUND TO THE MHC CLASS I MOLECULE HLA-A2/TAX' 
PDB 1UXW unspecified 
'CRYSTAL STRUCTURE OF HLA-B*2709 COMPLEXED WITH THE LATENT MEMBRANE PROTEIN 2 PEPTIDE (LMP2) OF EPSTEIN- BARR VIRUS' 
PDB 1I7U unspecified 'CRYSTAL STRUCTURE OF CLASS I MHC A2 IN COMPLEX WITH PEPTIDEP1049-6V' 
PDB 1C16 unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE GAMMA/DELTA T CELL LIGAND T22' 
PDB 1HSA unspecified 'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN HLA-B(ASTERISK )2705' 
PDB 2AXF unspecified 'THE IMMUNOGENICITY OF A VIRAL CYTOTOXIC T CELL EPITOPE ISCONTROLLED BY ITS MHC-BOUND CONFORMATION' 
PDB 1GZP unspecified 'CD1B IN COMPLEX WITH GM2 GANGLIOSIDE' 
PDB 2BNQ unspecified 'STRUCTURAL AND KINETIC BASIS FOR HIGHTENED IMMUNOGENICITY OF T CELL VACCINES' 
PDB 1W72 unspecified 'CRYSTAL STRUCTURE OF HLA-A1:MAGE-A1 IN COMPLEX WITH FAB-HYB3' 
PDB 2JCC unspecified 'AH3 RECOGNITION OF MUTANT HLA-A2 W167A' 
PDB 2BCK unspecified 'CRYSTAL STRUCTURE OF HLA-A*2402 COMPLEXED WITH A TELOMERASEPEPTIDE' 
PDB 1DE4 unspecified 'HEMOCHROMATOSIS PROTEIN HFE COMPLEXED WITH TRANSFERRINRECEPTOR' 
PDB 2VLK unspecified 
'THE STRUCTURAL DYNAMICS AND ENERGETICS OF AN IMMUNODOMINANT T-CELL RECEPTOR ARE PROGRAMMED BY ITS VBETA DOMAIN' 
PDB 1EXU unspecified 'CRYSTAL STRUCTURE OF THE HUMAN MHC-RELATED FC RECEPTOR' 
PDB 1QRN unspecified 'CRYSTAL STRUCTURE OF HUMAN A6 TCR COMPLEXED WITH HLA- A2 BOUND TO ALTERED HTLV-1 TAX PEPTIDE P6A' 
PDB 2HLA unspecified 'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN AW 68.1 (HLA -AW 68.1, HUMAN LEUCOCYTE ANTIGEN)' 
PDB 1MHE unspecified 'THE HUMAN NON-CLASSICAL MAJOR HISTOCOMPATIBILITY COMPLEX MOLECULE HLA-E' 
PDB 1EEZ unspecified 'CRYSTAL STRUCTURE DETERMINATION OF HLA-A2.1 COMPLEXED TOGP2 PEPTIDE VARIANT(I2L/V5L)' 
PDB 1IM9 unspecified 
'CRYSTAL STRUCTURE OF THE HUMAN NATURAL KILLER CELLINHIBITORY RECEPTOR KIR2DL1 BOUND TO ITS MHC LIGAND HLA-CW4' 
PDB 1JHT unspecified 
'CRYSTAL STRUCTURE OF HLA-A2*0201 IN COMPLEX WITH ANONAMERIC ALTERED PEPTIDE LIGAND (ALGIGILTV) FROM THE MART-1/MELAN-A.' 
PDB 1QQD unspecified 'CRYSTAL STRUCTURE OF HLA-CW4, A LIGAND FOR THE KIR2D NATURAL KILLER CELL INHIBITORY RECEPTOR' 
PDB 1QR1 unspecified 
'POOR BINDING OF A HER-2/NEU EPITOPE (GP2) TO HLA- A2.1 IS DUE TO A LACK OF INTERACTIONS IN THE CENTER OF THE PEPTIDE' 
PDB 1ZS8 unspecified 'CRYSTAL STRUCTURE OF THE MURINE MHC CLASS IB MOLECULE M10.5' 
PDB 1HLA unspecified 'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN A2 (HLA-A2, HUMAN LEUCOCYTE ANTIGEN)' 
PDB 1JGD unspecified 'HLA-B*2709 BOUND TO DECA-PEPTIDE S10R' 
PDB 1I1Y unspecified 
'CRYSTAL STRUCTURE OF HUMAN CLASS I MHC (HLA-A2.1) COMPLEXED WITH BETA 2-MICROGLOBULIN AND HIV-RT VARIANT PEPTIDE I1Y' 
PDB 1VGK unspecified 'THE CRYSTAL STRUCTURE OF CLASS I MAJOR HISTOCOMPATIBILITYCOMPLEX, H-2KD AT 2.0 A RESOLUTION' 
PDB 1AGE unspecified 
'ANTAGONIST HIV-1 GAG PEPTIDES INDUCE STRUCTURAL CHANGES IN HLA B8 - HIV-1 GAG PEPTIDE (GGKKKYRL - 7R MUTATION)' 
PDB 1UR7 unspecified 
'MOLECULAR REFINEMENT OF ANTI-HLA-A2 USING LIGHT CHAIN SHUFFLING: A STRUCTURAL MODEL FOR HLA ANTIBODY BINDING' 
PDB 2X89 unspecified 'STRUCTURE OF THE BETA2_MICROGLOBULIN INVOLVED IN AMYLOIDOGENESIS' 
PDB 1S9X unspecified 'CRYSTAL STRUCTURE ANALYSIS OF NY-ESO-1 EPITOPE ANALOGUE,SLLMWITQA, IN COMPLEX WITH HLA-A2' 
PDB 1HHG unspecified . 
PDB 2X4U unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO HIV-1 PEPTIDE RT468-476' 
PDB 1DUZ unspecified 
'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A 0201) INCOMPLEX WITH A NONAMERIC PEPTIDE FROM HTLV-1 TAX PROTEIN' 
PDB 1A9E unspecified 
'DECAMER-LIKE CONFORMATION OF A NANO-PEPTIDE BOUND TO HLA-B 3501 DUE TO NONSTANDARD POSITIONING OF THE C- TERMINUS' 
PDB 2CLR unspecified 'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A 0201) COMPLEXED WITH A DECAMERIC PEPTIDE FROM CALRETICULIN' 
PDB 3HLA unspecified 'HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN A2.1 (HLA-A2 .1 HUMAN LEUCOCYTE ANTIGEN)' 
PDB 1M05 unspecified 'HLA B8 IN COMPLEX WITH AN EPSTEIN BARR VIRUS DETERMINANT' 
PDB 2X4O unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO HIV-1 ENVELOPE PEPTIDE ENV120-128' 
PDB 1TVB unspecified 'CRYSTAL STRUCTURE OF MELANOMA ANTIGEN GP100(209-217) BOUNDTO HUMAN CLASS I MHC HLA-A2' 
PDB 2V2W unspecified 'T CELL CROSS-REACTIVITY AND CONFORMATIONAL CHANGES DURING TCR ENGAGEMENT' 
PDB 1ONQ unspecified 'CRYSTAL STRUCTURE OF CD1A IN COMPLEX WITH A SULFATIDE' 
PDB 2X4P unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO A PHOTOCLEAVABLE PEPTIDE' 
PDB 2VLR unspecified 
'THE STRUCTURAL DYNAMICS AND ENERGETICS OF AN IMMUNODOMINANT T-CELL RECEPTOR ARE PROGRAMMED BY ITS VBETA DOMAIN' 
PDB 2BVO unspecified 
;STRUCTURES OF THREE HIV-1 HLA-B5703-PEPTIDE COMPLEXES AND IDENTIFICATION OF RELATED HLAS POTENTIALLY ASSOCIATED WITH LONG-TERM NON-PROGRESSION
;
PDB 1A1N unspecified 'MHC CLASS I MOLECULE B*3501 COMPLEXED WITH PEPTIDE VPLRPMTYFROM THE NEF PROTEIN (75-82) OF HIV1' 
PDB 1LP9 unspecified 'XENOREACTIVE COMPLEX AHIII 12.2 TCR BOUND TO P1049/ HLA-A2.1' 
PDB 1ZSD unspecified 'CRYSTAL STRUCTURE OF HLA-B*3501 PRESENTING AN 11-MER EBVANTIGEN EPLPQGQLTAY' 
PDB 1M6O unspecified 'CRYSTAL STRUCTURE OF HLA B*4402 IN COMPLEX WITH HLADPA*0201 PEPTIDE' 
PDB 1HHK unspecified . 
PDB 1ZT4 unspecified 'THE CRYSTAL STRUCTURE OF HUMAN CD1D WITH AND WITHOUT ALPHA-GALACTOSYLCERAMIDE' 
PDB 1HSB unspecified 'CLASS I HISTOCOMPATIBILITY ANTIGEN AW68.1 (LEUCOCYTE ANTIGEN)' 
PDB 1CE6 unspecified 'MHC CLASS I H-2DB COMPLEXED WITH A SENDAI VIRUSNUCLEOPROTEIN PEPTIDE' 
PDB 2XKU unspecified 'PRION-LIKE CONVERSION DURING AMYLOID FORMATION AT ATOMIC RESOLUTION' 
PDB 1X7Q unspecified 'CRYSTAL STRUCTURE OF HLA-A*1101 WITH SARS NUCLEOCAPSIDPEPTIDE' 
PDB 1PY4 unspecified 'BETA2 MICROGLOBULIN MUTANT H31Y DISPLAYS HINTS FOR AMYLOIDFORMATIONS' 
PDB 1SYV unspecified 'HLA-B*4405 COMPLEXED TO THE DOMINANT SELF LIGAND EEFGRAYGF' 
PDB 2J8U unspecified 'LARGE CDR3A LOOP ALTERATION AS A FUNCTION OF MHC MUTATION.' 
PDB 1SYS unspecified 'CRYSTAL STRUCTURE OF HLA, B*4403, AND PEPTIDE EEPTVIKKY' 
PDB 1OGT unspecified 
'CRYSTAL STRUCTURE OF HLA-B*2709 COMPLEXED WITH THE VASOACTIVE INTESTINAL PEPTIDE TYPE 1 RECEPTOR (VPAC1) PEPTIDE (RESIDUES 400-408)' 
PDB 2X4T unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO A PEIODATE-CLEAVABLE PEPTIDE' 
PDB 1CG9 unspecified 
'COMPLEX RECOGNITION OF THE SUPERTYPIC BW6-DETERMINANT ONHLA-B AND-C MOLECULES BY THE MONOCLONAL ANTIBODY SFR8-B6' 
PDB 1P7Q unspecified 'CRYSTAL STRUCTURE OF HLA-A2 BOUND TO LIR-1, A HOST ANDVIRAL MHC RECEPTOR' 
PDB 1Q94 unspecified 
;STRUCTURES OF HLA-A*1101 IN COMPLEX WITH IMMUNODOMINANTNONAMER AND DECAMER HIV-1 EPITOPES CLEARLY REVEAL THEPRESENCE OF A MIDDLE ANCHOR RESIDUE
;
PDB 1JNJ unspecified 'NMR SOLUTION STRUCTURE OF THE HUMAN BETA2-MICROGLOBULIN' 
PDB 1AGB unspecified 
'ANTAGONIST HIV-1 GAG PEPTIDES INDUCE STRUCTURAL CHANGES IN HLA B8 - HIV-1 GAG PEPTIDE (GGRKKYKL - 3R MUTATION)' 
PDB 2D31 unspecified 'CRYSTAL STRUCTURE OF DISULFIDE-LINKED HLA-G DIMER' 
PDB 1XZ0 unspecified 'CRYSTAL STRUCTURE OF CD1A IN COMPLEX WITH A SYNTHETICMYCOBACTIN LIPOPEPTIDE' 
PDB 1LDS unspecified 'CRYSTAL STRUCTURE OF MONOMERIC HUMAN BETA-2- MICROGLOBULIN' 
PDB 1HHH unspecified . 
PDB 1TVH unspecified 'CRYSTAL STRUCTURE OF MODIFIED MELANOMA ANTIGEN GP100(209 -T2M) BOUND TO HUMAN CLASS I MHC HLA-A2' 
PDB 1XR8 unspecified 'CRYSTAL STRUCTURES OF HLA-B*1501 IN COMPLEX WITH PEPTIDESFROM HUMAN UBCH6 AND EPSTEIN-BARR VIRUS EBNA-3' 
PDB 2BSS unspecified 'CRYSTAL STRUCTURES AND KIR3DL1 RECOGNITION OF THREE IMMUNODOMINANT VIRAL PEPTIDES COMPLEXED TO HLA-B2705' 
PDB 1A1M unspecified 'MHC CLASS I MOLECULE B*5301 COMPLEXED WITH PEPTIDETYPDINQML FROM GAG PROTEIN OF HIV2' 
PDB 1E28 unspecified 'NONSTANDARD PEPTIDE BINDING OF HLA-B*5101 COMPLEXED WITH HIV IMMUNODOMINANT EPITOPE KM2(TAFTIPSI)' 
PDB 2BVP unspecified 
;STRUCTURES OF THREE HIV-1 HLA-B5703-PEPTIDE COMPLEXES AND IDENTIFICATION OF RELATED HLAS POTENTIALLY ASSOCIATED WITH LONG-TERM NON-PROGRESSION
;
PDB 2V2X unspecified 'T CELL CROSS-REACTIVITY AND CONFORMATIONAL CHANGES DURING TCR ENGAGEMENT.' 
PDB 1XR9 unspecified 'CRYSTAL STRUCTURES OF HLA-B*1501 IN COMPLEX WITH PEPTIDESFROM HUMAN UBCH6 AND EPSTEIN-BARR VIRUS EBNA-3' 
PDB 2GJ6 unspecified 
'THE COMPLEX BETWEEN TCR A6 AND HUMAN CLASS I MHC HLA-A2WITH THE MODIFIED HTLV-1 TAX (Y5K-4-[3- INDOLYL]-BUTYRICACID) PEPTIDE' 
PDB 2X4R unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO CYTOMEGALOVIRUS (CMV) PP65 EPITOPE' 
PDB 1QLF unspecified 'MHC CLASS I H-2DB COMPLEXED WITH GLYCOPEPTIDE K3G' 
PDB 1EFX unspecified 
'STRUCTURE OF A COMPLEX BETWEEN THE HUMAN NATURAL KILLER CELL RECEPTOR KIR2DL2 AND A CLASS I MHC LIGAND HLA-CW3' 
PDB 1TMC unspecified 
'TRUNCATED HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN HLA- AW68 COMPLEXED WITH A DECAMERIC PEPTIDE (EVAPPEYHRK)' 
PDB 2AV1 unspecified 
'CRYSTAL STRUCTURE OF HTLV-1 TAX PEPTIDE BOUND TO HUMANCLASS I MHC HLA-A2 WITH THE E63Q AND K66A MUTATIONS IN THEHEAVY CHAIN.' 
PDB 1QSF unspecified 'STRUCTURE OF A6-TCR BOUND TO HLA-A2 COMPLEXED WITH ALTERED HTLV-1 TAX PEPTIDE Y8A' 
PDB 1JGE unspecified 'HLA-B*2705 BOUND TO NONA-PEPTIDE M9' 
PDB 1KPR unspecified 'THE HUMAN NON-CLASSICAL MAJOR HISTOCOMPATIBILITY COMPLEXMOLECULE HLA-E' 
PDB 1DUY unspecified 'CRYSTAL STRUCTURE OF HLA-A0201/OCTAMERIC TAX PEPTIDE COMPLEX' 
PDB 2HJL unspecified 'CRYSTAL STRUCTURE OF HLA-B5703 AND HIV-1 PEPTIDE' 
PDB 1QEW unspecified 
;HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A 0201) COMPLEX WITH A NONAMERIC PEPTIDE FROM MELANOMA- ASSOCIATEDANTIGEN 3 (RESIDUES 271-279)
;
PDB 1W0V unspecified 'CRYSTAL STRUCTURE OF HLA-B*2705 COMPLEXED WITH THE SELF-PEPTIDE TIS FROM EGF-RESPONSE FACTOR 1' 
PDB 1K5N unspecified 'HLA-B*2709 BOUND TO NONA-PEPTIDE M9' 
PDB 1AO7 unspecified 'COMPLEX BETWEEN HUMAN T-CELL RECEPTOR, VIRAL PEPTIDE ( TAX), AND HLA-A 0201' 
PDB 2BNR unspecified 'STRUCTURAL AND KINETIC BASIS FOR HIGHTENED IMMUNOGENICITY OF T CELL VACCINES' 
PDB 1XH3 unspecified 'CONFORMATIONAL RESTRAINTS AND FLEXIBILITY OF 14- MERICPEPTIDES IN COMPLEX WITH HLA-B*3501' 
PDB 2BST unspecified 'CRYSTAL STRUCTURES AND KIR3DL1 RECOGNITION OF THREE IMMUNODOMINANT VIRAL PEPTIDES COMPLEXED TO HLA-B2705' 
PDB 1MI5 unspecified 'THE CRYSTAL STRUCTURE OF LC13 TCR IN COMPLEX WITH HLAB8-EBVPEPTIDE COMPLEX' 
PDB 2H26 unspecified 'HUMAN CD1B IN COMPLEX WITH ENDOGENOUS PHOSPHATIDYLCHOLINEAND SPACER' 
PDB 1S9Y unspecified 'CRYSTAL STRUCTURE ANALYSIS OF NY-ESO-1 EPITOPE ANALOGUE,SLLMWITQS, IN COMPLEX WITH HLA-A2' 
PDB 1A1O unspecified 'MHC CLASS I MOLECULE B5301 COMPLEXED WITH PEPTIDE LS6 (KPIVQYDNF) FROM THE MALARIA PARASITE P. FALCIPARUM' 
PDB 2A83 unspecified 'CRYSTAL STRUCTURE OF HLA-B*2705 COMPLEXED WITH THE GLUCAGONRECEPTOR (GR) PEPTIDE (RESIDUES 412-420)' 
PDB 1AGF unspecified 
'ANTAGONIST HIV-1 GAG PEPTIDES INDUCE STRUCTURAL CHANGES IN HLA B8 - HIV-1 GAG PEPTIDE (GGKKRYKL - 5R MUTATION)' 
PDB 1OGA unspecified 'A STRUCTURAL BASIS FOR IMMUNODOMINANT HUMAN T-CELL RECEPTOR RECOGNITION.' 
PDB 2F8O unspecified 'A NATIVE TO AMYLOIDOGENIC TRANSITION REGULATED BY ABACKBONE TRIGGER' 
PDB 2X70 unspecified 'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO A PHOTOCLEAVABLE PEPTIDE' 
PDB 2CII unspecified 
'THE CRYSTAL STRUCTURE OF H-2DB COMPLEXED WITH A PARTIAL PEPTIDE EPITOPE SUGGESTS AN MHC CLASS I ASSEMBLY-INTERMEDIATE' 
PDB 1I7R unspecified 'CRYSTAL STRUCTURE OF CLASS I MHC A2 IN COMPLEX WITH PEPTIDEP1058' 
PDB 1JF1 unspecified 'CRYSTAL STRUCTURE OF HLA-A2*0201 IN COMPLEX WITH ADECAMERIC ALTERED PEPTIDE LIGAND FROM THE MART-1/ MELAN-A' 
PDB 2C7U unspecified 
'CONFLICTING SELECTIVE FORCES AFFECT CD8 T-CELL RECEPTOR CONTACT SITES IN AN HLA-A2 IMMUNODOMINANT HIV EPITOPE.' 
PDB 2F74 unspecified 
'MURINE MHC CLASS I H-2DB IN COMPLEX WITH HUMAN B2 -MICROGLOBULIN AND LCMV-DERIVED IMMUNODMINANT PEPTIDE GP33' 
PDB 1E27 unspecified 'NONSTANDARD PEPTIDE BINDING OF HLA-B*5101 COMPLEXED WITH HIV IMMUNODOMINANT EPITOPE KM1(LPPVVAKEI)' 
PDB 1W0W unspecified 'CRYSTAL STRUCTURE OF HLA-B*2709 COMPLEXED WITH THE SELF-PEPTIDE TIS FROM EGF-RESPONSE FACTOR 1' 
PDB 1GZQ unspecified 'CD1B IN COMPLEX WITH PHOPHATIDYLINOSITOL' 
PDB 1UXS unspecified 
'CRYSTAL STRUCTURE OF HLA-B*2705 COMPLEXED WITH THE LATENT MEMBRANE PROTEIN 2 PEPTIDE (LMP2)OF EPSTEIN- BARR VIRUS' 
PDB 1AKJ unspecified 'COMPLEX OF THE HUMAN MHC CLASS I GLYCOPROTEIN HLA-A2 ANDTHE T CELL CORECEPTOR CD8' 
PDB 2HJK unspecified 'CRYSTAL STRUCTURE OF HLA-B5703 AND HIV-1 PEPTIDE' 
PDB 2VB5 unspecified 'SOLUTION STRUCTURE OF W60G MUTANT OF HUMAN BETA2- MICROGLOBULIN' 
PDB 1AGD unspecified 
'ANTAGONIST HIV-1 GAG PEPTIDES INDUCE STRUCTURAL CHANGES IN HLA B8 - HIV-1 GAG PEPTIDE (GGKKKYKL - INDEX PEPTIDE)' 
PDB 2X4N unspecified 
;CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO RESIDUAL FRAGMENTS OF A PHOTOCLEAVABLE PEPTIDE THAT IS CLEAVED UPON UV-LIGHT TREATMENT
;
PDB 1R3H unspecified 'CRYSTAL STRUCTURE OF T10' 
PDB 1EEY unspecified 'CRYSTAL STRUCTURE DETERMINATION OF HLA A2 COMPLEXED TOPEPTIDE GP2 WITH THE SUBSTITUTION (I2L/V5L/L9V)' 
PDB 1I7T unspecified 'CRYSTAL STRUCTURE OF CLASS I MHC A2 IN COMPLEX WITH PEPTIDEP1049-5V' 
PDB 1YDP unspecified '1.9A CRYSTAL STRUCTURE OF HLA-G' 
PDB 1I4F unspecified 'CRYSTAL STRUCTURE OF HLA-A*0201/MAGE-A4-PEPTIDE COMPLEX' 
PDB 2VLL unspecified 
'THE STRUCTURAL DYNAMICS AND ENERGETICS OF AN IMMUNODOMINANT T-CELL RECEPTOR ARE PROGRAMMED BY ITS VBETA DOMAIN' 
PDB 2BSR unspecified 'CRYSTAL STRUCTURES AND KIR3DL1 RECOGNITION OF THREE IMMUNODOMINANT VIRAL PEPTIDES COMPLEXED TO HLA-B2705' 
PDB 1B0G unspecified 
'CRYSTAL STRUCTURE OF HUMAN CLASS I MHC (HLA-A2.1) COMPLEXED WITH BETA 2-MICROGLOBULIN AND HUMAN PEPTIDE P1049' 
PDB 2VLJ unspecified 
'THE STRUCTURAL DYNAMICS AND ENERGETICS OF AN IMMUNODOMINANT T-CELL RECEPTOR ARE PROGRAMMED BY ITS VBETA DOMAIN' 
PDB 2X4S unspecified 
'CRYSTAL STRUCTURE OF MHC CLASS I HLA-A2.1 BOUND TO A PEPTIDE REPRESENTING THE EPITOPE OF THE H5N1 ( AVIAN FLU) NUCLEOPROTEIN' 
PDB 1B0R unspecified 
'CRYSTAL STRUCTURE OF HLA-A0201 COMPLEXED WITH A PEPTIDE WITH THE CARBOXYL-TERMINAL GROUP SUBSTITUTED BY A METHYL GROUP' 
PDB 1OF2 unspecified 
'CRYSTAL STRUCTURE OF HLA-B*2709 COMPLEXED WITH THE VASOACTIVE INTESTINAL PEPTIDE TYPE 1 RECEPTOR (VPAC1) PEPTIDE (RESIDUES 400-408)' 
PDB 1HHI unspecified . 
PDB 1QSE unspecified 'STRUCTURE OF HUMAN A6-TCR BOUND TO HLA-A2 COMPLEXED WITH ALTERED HTLV-1 TAX PEPTIDE V7R' 
PDB 1A9B unspecified 
'DECAMER-LIKE CONFORMATION OF A NANO-PEPTIDE BOUND TO HLA-B 3501 DUE TO NONSTANDARD POSITIONING OF THE C- TERMINUS' 
PDB 2AXG unspecified 'THE IMMUNOGENICITY OF A VIRAL CYTOTOXIC T CELL EPITOPE ISCONTROLLED BY ITS MHC-BOUND CONFORMATION' 
PDB 2BVQ unspecified 
;STRUCTURES OF THREE HIV-1 HLA-B5703-PEPTIDE COMPLEXES AND IDENTIFICATION OF RELATED HLAS POTENTIALLY ASSOCIATED WITH LONG-TERM NON-PROGRESSION
;
PDB 1AGC unspecified 
'ANTAGONIST HIV-1 GAG PEPTIDES INDUCE STRUCTURAL CHANGES IN HLA B8 - HIV-1 GAG PEPTIDE (GGKKKYQL - 7Q MUTATION)' 
PDB 1QVO unspecified 
;STRUCTURES OF HLA-A*1101 IN COMPLEX WITH IMMUNODOMINANTNONAMER AND DECAMER HIV-1 EPITOPES CLEARLY REVEAL THEPRESENCE OF A MIDDLE ANCHOR RESIDUE
;
PDB 1HHJ unspecified 
;HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A 0201) COMPLEX WITH A NONAMERIC PEPTIDE FROM HIV-1 REVERSE TRANSCRIPTASE (RESIDUES 309-317)
;
PDB 1S9W unspecified 'CRYSTAL STRUCTURE ANALYSIS OF NY-ESO-1 EPITOPE, SLLMWITQC,IN COMPLEX WITH HLA-A2' 
PDB 1KTL unspecified 'THE HUMAN NON-CLASSICAL MAJOR HISTOCOMPATIBILITY COMPLEXMOLECULE HLA-E' 
PDB 1A6Z unspecified 'HFE (HUMAN) HEMOCHROMATOSIS PROTEIN' 
PDB 2CIK unspecified 
;INSIGHTS INTO CROSSREACTIVITY IN HUMAN ALLORECOGNITION: THE STRUCTURE OF HLA-B35011 PRESENTING AN EPITOPE DERIVED FROM CYTOCHROME P450.
;
PDB 1I1F unspecified 
'CRYSTAL STRUCTURE OF HUMAN CLASS I MHC (HLA-A2.1) COMPLEXED WITH BETA 2- MICROGLOBULIN AND HIV-RT VARIANT PEPTIDE I1Y' 
PDB 2UWE unspecified 'LARGE CDR3A LOOP ALTERATION AS A FUNCTION OF MHC MUTATION' 
PDB 2AV7 unspecified 
'CRYSTAL STRUCTURE OF HTLV-1 TAX PEPTIDE BOUND TO HUMANCLASS I MHC HLA-A2 WITH THE K66A MUTATION IN THE HEAVYCHAIN.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XPG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'McMahon, R.M.' 1 
'Friis, L.'     2 
'Siebold, C.'   3 
'Friese, M.A.'  4 
'Fugger, L.'    5 
'Jones, E.Y.'   6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of Hla-A0301 in Complex with a Peptide of Proteolipid Protein: Insights Into the Role of Hla-A Alleles in Susceptibility to Multiple Sclerosis
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            67 
_citation.page_first                447 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21543847 
_citation.pdbx_database_id_DOI      10.1107/S0907444911007888 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mcmahon, R.M.' 1 
primary 'Friis, L.'     2 
primary 'Siebold, C.'   3 
primary 'Friese, M.A.'  4 
primary 'Fugger, L.'    5 
primary 'Jones, E.Y.'   6 
# 
_cell.entry_id           2XPG 
_cell.length_a           62.140 
_cell.length_b           65.550 
_cell.length_c           107.210 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XPG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA CHAIN' 31628.838 1  ? ? 'HEAVY CHAIN, RESIDUES 25-298' ? 
2 polymer man BETA-2-MICROGLOBULIN                                      11574.885 1  ? ? 
'BETA2-MICROGLOBULIN FORM PI 5.3, RESIDUES 22-118' ? 
3 polymer syn 'MYELIN PROTEOLIPID PROTEIN'                              1130.333  1  ? ? 'RESIDUES 45-53' ? 
4 water   nat water                                                     18.015    16 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HLA-A3, MHC CLASS I ANTIGEN A*3' 
2 HLA-A3                            
3 'PLP PEPTIDE, PLP, LIPOPHILIN'    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYL
DGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
;
;GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYL
DGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGT
FQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
;
A ? 
2 'polypeptide(L)' no no 
;AQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYAC
RVNHVTLSQPKIVKWDRD
;
;AQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYAC
RVNHVTLSQPKIVKWDRD
;
B ? 
3 'polypeptide(L)' no no KLIETYFSK KLIETYFSK C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   SER n 
1 5   MET n 
1 6   ARG n 
1 7   TYR n 
1 8   PHE n 
1 9   PHE n 
1 10  THR n 
1 11  SER n 
1 12  VAL n 
1 13  SER n 
1 14  ARG n 
1 15  PRO n 
1 16  GLY n 
1 17  ARG n 
1 18  GLY n 
1 19  GLU n 
1 20  PRO n 
1 21  ARG n 
1 22  PHE n 
1 23  ILE n 
1 24  ALA n 
1 25  VAL n 
1 26  GLY n 
1 27  TYR n 
1 28  VAL n 
1 29  ASP n 
1 30  ASP n 
1 31  THR n 
1 32  GLN n 
1 33  PHE n 
1 34  VAL n 
1 35  ARG n 
1 36  PHE n 
1 37  ASP n 
1 38  SER n 
1 39  ASP n 
1 40  ALA n 
1 41  ALA n 
1 42  SER n 
1 43  GLN n 
1 44  ARG n 
1 45  MET n 
1 46  GLU n 
1 47  PRO n 
1 48  ARG n 
1 49  ALA n 
1 50  PRO n 
1 51  TRP n 
1 52  ILE n 
1 53  GLU n 
1 54  GLN n 
1 55  GLU n 
1 56  GLY n 
1 57  PRO n 
1 58  GLU n 
1 59  TYR n 
1 60  TRP n 
1 61  ASP n 
1 62  GLN n 
1 63  GLU n 
1 64  THR n 
1 65  ARG n 
1 66  ASN n 
1 67  VAL n 
1 68  LYS n 
1 69  ALA n 
1 70  GLN n 
1 71  SER n 
1 72  GLN n 
1 73  THR n 
1 74  ASP n 
1 75  ARG n 
1 76  VAL n 
1 77  ASP n 
1 78  LEU n 
1 79  GLY n 
1 80  THR n 
1 81  LEU n 
1 82  ARG n 
1 83  GLY n 
1 84  TYR n 
1 85  TYR n 
1 86  ASN n 
1 87  GLN n 
1 88  SER n 
1 89  GLU n 
1 90  ALA n 
1 91  GLY n 
1 92  SER n 
1 93  HIS n 
1 94  THR n 
1 95  ILE n 
1 96  GLN n 
1 97  ILE n 
1 98  MET n 
1 99  TYR n 
1 100 GLY n 
1 101 CYS n 
1 102 ASP n 
1 103 VAL n 
1 104 GLY n 
1 105 SER n 
1 106 ASP n 
1 107 GLY n 
1 108 ARG n 
1 109 PHE n 
1 110 LEU n 
1 111 ARG n 
1 112 GLY n 
1 113 TYR n 
1 114 ARG n 
1 115 GLN n 
1 116 ASP n 
1 117 ALA n 
1 118 TYR n 
1 119 ASP n 
1 120 GLY n 
1 121 LYS n 
1 122 ASP n 
1 123 TYR n 
1 124 ILE n 
1 125 ALA n 
1 126 LEU n 
1 127 ASN n 
1 128 GLU n 
1 129 ASP n 
1 130 LEU n 
1 131 ARG n 
1 132 SER n 
1 133 TRP n 
1 134 THR n 
1 135 ALA n 
1 136 ALA n 
1 137 ASP n 
1 138 MET n 
1 139 ALA n 
1 140 ALA n 
1 141 GLN n 
1 142 ILE n 
1 143 THR n 
1 144 LYS n 
1 145 ARG n 
1 146 LYS n 
1 147 TRP n 
1 148 GLU n 
1 149 ALA n 
1 150 ALA n 
1 151 HIS n 
1 152 GLU n 
1 153 ALA n 
1 154 GLU n 
1 155 GLN n 
1 156 LEU n 
1 157 ARG n 
1 158 ALA n 
1 159 TYR n 
1 160 LEU n 
1 161 ASP n 
1 162 GLY n 
1 163 THR n 
1 164 CYS n 
1 165 VAL n 
1 166 GLU n 
1 167 TRP n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 TYR n 
1 172 LEU n 
1 173 GLU n 
1 174 ASN n 
1 175 GLY n 
1 176 LYS n 
1 177 GLU n 
1 178 THR n 
1 179 LEU n 
1 180 GLN n 
1 181 ARG n 
1 182 THR n 
1 183 ASP n 
1 184 PRO n 
1 185 PRO n 
1 186 LYS n 
1 187 THR n 
1 188 HIS n 
1 189 MET n 
1 190 THR n 
1 191 HIS n 
1 192 HIS n 
1 193 PRO n 
1 194 ILE n 
1 195 SER n 
1 196 ASP n 
1 197 HIS n 
1 198 GLU n 
1 199 ALA n 
1 200 THR n 
1 201 LEU n 
1 202 ARG n 
1 203 CYS n 
1 204 TRP n 
1 205 ALA n 
1 206 LEU n 
1 207 GLY n 
1 208 PHE n 
1 209 TYR n 
1 210 PRO n 
1 211 ALA n 
1 212 GLU n 
1 213 ILE n 
1 214 THR n 
1 215 LEU n 
1 216 THR n 
1 217 TRP n 
1 218 GLN n 
1 219 ARG n 
1 220 ASP n 
1 221 GLY n 
1 222 GLU n 
1 223 ASP n 
1 224 GLN n 
1 225 THR n 
1 226 GLN n 
1 227 ASP n 
1 228 THR n 
1 229 GLU n 
1 230 LEU n 
1 231 VAL n 
1 232 GLU n 
1 233 THR n 
1 234 ARG n 
1 235 PRO n 
1 236 ALA n 
1 237 GLY n 
1 238 ASP n 
1 239 GLY n 
1 240 THR n 
1 241 PHE n 
1 242 GLN n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 ALA n 
1 247 VAL n 
1 248 VAL n 
1 249 VAL n 
1 250 PRO n 
1 251 SER n 
1 252 GLY n 
1 253 GLU n 
1 254 GLU n 
1 255 GLN n 
1 256 ARG n 
1 257 TYR n 
1 258 THR n 
1 259 CYS n 
1 260 HIS n 
1 261 VAL n 
1 262 GLN n 
1 263 HIS n 
1 264 GLU n 
1 265 GLY n 
1 266 LEU n 
1 267 PRO n 
1 268 LYS n 
1 269 PRO n 
1 270 LEU n 
1 271 THR n 
1 272 LEU n 
1 273 ARG n 
1 274 TRP n 
2 1   ALA n 
2 2   GLN n 
2 3   ARG n 
2 4   THR n 
2 5   PRO n 
2 6   LYS n 
2 7   ILE n 
2 8   GLN n 
2 9   VAL n 
2 10  TYR n 
2 11  SER n 
2 12  ARG n 
2 13  HIS n 
2 14  PRO n 
2 15  ALA n 
2 16  GLU n 
2 17  ASN n 
2 18  GLY n 
2 19  LYS n 
2 20  SER n 
2 21  ASN n 
2 22  PHE n 
2 23  LEU n 
2 24  ASN n 
2 25  CYS n 
2 26  TYR n 
2 27  VAL n 
2 28  SER n 
2 29  GLY n 
2 30  PHE n 
2 31  HIS n 
2 32  PRO n 
2 33  SER n 
2 34  ASP n 
2 35  ILE n 
2 36  GLU n 
2 37  VAL n 
2 38  ASP n 
2 39  LEU n 
2 40  LEU n 
2 41  LYS n 
2 42  ASN n 
2 43  GLY n 
2 44  GLU n 
2 45  ARG n 
2 46  ILE n 
2 47  GLU n 
2 48  LYS n 
2 49  VAL n 
2 50  GLU n 
2 51  HIS n 
2 52  SER n 
2 53  ASP n 
2 54  LEU n 
2 55  SER n 
2 56  PHE n 
2 57  SER n 
2 58  LYS n 
2 59  ASP n 
2 60  TRP n 
2 61  SER n 
2 62  PHE n 
2 63  TYR n 
2 64  LEU n 
2 65  LEU n 
2 66  TYR n 
2 67  TYR n 
2 68  THR n 
2 69  GLU n 
2 70  PHE n 
2 71  THR n 
2 72  PRO n 
2 73  THR n 
2 74  GLU n 
2 75  LYS n 
2 76  ASP n 
2 77  GLU n 
2 78  TYR n 
2 79  ALA n 
2 80  CYS n 
2 81  ARG n 
2 82  VAL n 
2 83  ASN n 
2 84  HIS n 
2 85  VAL n 
2 86  THR n 
2 87  LEU n 
2 88  SER n 
2 89  GLN n 
2 90  PRO n 
2 91  LYS n 
2 92  ILE n 
2 93  VAL n 
2 94  LYS n 
2 95  TRP n 
2 96  ASP n 
2 97  ARG n 
2 98  ASP n 
3 1   LYS n 
3 2   LEU n 
3 3   ILE n 
3 4   GLU n 
3 5   THR n 
3 6   TYR n 
3 7   PHE n 
3 8   SER n 
3 9   LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'BLR (DE3)' ? ? ? ? 
? ? ? PLASMID ? ? ? PET-22B ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? 'BLR (DE3)' ? ? ? ? 
? ? ? PLASMID ? ? ? PET-22B ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP 1A03_HUMAN 1 ? ? P04439 ? 
2 UNP B2MG_HUMAN 2 ? ? P61769 ? 
3 UNP MYPR_HUMAN 3 ? ? P60201 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XPG A 1 ? 274 ? P04439 25 ? 298 ? 1 274 
2 2 2XPG B 2 ? 98  ? P61769 22 ? 118 ? 2 98  
3 3 2XPG C 1 ? 9   ? P60201 45 ? 53  ? 1 9   
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             2XPG 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P61769 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XPG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   50.0 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BIS-TRIS-PROPANE, PH 8.0, 0.2 M NA/K PHOSPHATE, 20% (V/V) PEG3350' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2007-12-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9699 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9699 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XPG 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   14030 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.10 
_reflns.B_iso_Wilson_estimate        34.93 
_reflns.pdbx_redundancy              5.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.60 
_reflns_shell.pdbx_redundancy        5.60 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XPG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13957 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.75 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.190 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  694 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -6.86840 
_refine.aniso_B[2][2]                            8.95220 
_refine.aniso_B[3][3]                            -2.08380 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.41 
_refine.solvent_model_param_bsol                 41.30 
_refine.pdbx_solvent_vdw_probe_radii             0.60 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.27 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1DUZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.350 
_refine.pdbx_overall_phase_error                 25.680 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3108 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             16 
_refine_hist.number_atoms_total               3124 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        19.75 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 3195 'X-RAY DIFFRACTION' ? 
f_angle_d          0.718  ? ? 4330 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.052 ? ? 1170 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.053  ? ? 443  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 569  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.6000 2.8002  2622 0.2728 100.00 0.3677 . . 117 . . 
'X-RAY DIFFRACTION' . 2.8002 3.0811  2586 0.2342 100.00 0.3101 . . 146 . . 
'X-RAY DIFFRACTION' . 3.0811 3.5247  2614 0.1934 100.00 0.2749 . . 157 . . 
'X-RAY DIFFRACTION' . 3.5247 4.4325  2645 0.1638 100.00 0.2109 . . 150 . . 
'X-RAY DIFFRACTION' . 4.4325 19.7513 2796 0.1689 100.00 0.1987 . . 124 . . 
# 
_struct.entry_id                  2XPG 
_struct.title                     'Crystal structure of a MHC class I-peptide complex' 
_struct.pdbx_descriptor           
'HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA CHAIN, BETA-2-MICROGLOBULIN, MYELIN PROTEOLIPID PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XPG 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNE SYSTEM, AUTOIMMUNITY, MULTIPLE SCLEROSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 50  ? GLU A 55  ? PRO A 50  GLU A 55  5 ? 6  
HELX_P HELX_P2 2 GLY A 56  ? ASN A 86  ? GLY A 56  ASN A 86  1 ? 31 
HELX_P HELX_P3 3 ASP A 137 ? ALA A 150 ? ASP A 137 ALA A 150 1 ? 14 
HELX_P HELX_P4 4 HIS A 151 ? ASP A 161 ? HIS A 151 ASP A 161 1 ? 11 
HELX_P HELX_P5 5 GLY A 162 ? GLY A 175 ? GLY A 162 GLY A 175 1 ? 14 
HELX_P HELX_P6 6 GLY A 175 ? GLN A 180 ? GLY A 175 GLN A 180 1 ? 6  
HELX_P HELX_P7 7 GLU A 253 ? GLN A 255 ? GLU A 253 GLN A 255 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 164 SG ? ? A CYS 101 A CYS 164 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? A CYS 203 SG ? ? ? 1_555 A CYS 259 SG ? ? A CYS 203 A CYS 259 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf3 disulf ? ? B CYS 25  SG ? ? ? 1_555 B CYS 80  SG ? ? B CYS 25  B CYS 80  1_555 ? ? ? ? ? ? ? 2.040 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 15  A . ? PRO 15  A GLY 16  A ? GLY 16  A 1 -2.91 
2 TYR 209 A . ? TYR 209 A PRO 210 A ? PRO 210 A 1 0.61  
3 SER 251 A . ? SER 251 A GLY 252 A ? GLY 252 A 1 0.52  
4 HIS 31  B . ? HIS 31  B PRO 32  B ? PRO 32  B 1 7.70  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 2 ? 
AE ? 4 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 2 ? 
BD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? parallel      
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 46  ? PRO A 47  ? GLU A 46  PRO A 47  
AA 2 THR A 31  ? ASP A 37  ? THR A 31  ASP A 37  
AA 3 ARG A 21  ? VAL A 28  ? ARG A 21  VAL A 28  
AA 4 HIS A 3   ? VAL A 12  ? HIS A 3   VAL A 12  
AA 5 THR A 94  ? VAL A 103 ? THR A 94  VAL A 103 
AA 6 PHE A 109 ? TYR A 118 ? PHE A 109 TYR A 118 
AA 7 LYS A 121 ? LEU A 126 ? LYS A 121 LEU A 126 
AA 8 TRP A 133 ? ALA A 135 ? TRP A 133 ALA A 135 
AB 1 LYS A 186 ? PRO A 193 ? LYS A 186 PRO A 193 
AB 2 GLU A 198 ? PHE A 208 ? GLU A 198 PHE A 208 
AB 3 PHE A 241 ? PRO A 250 ? PHE A 241 PRO A 250 
AB 4 ARG A 234 ? PRO A 235 ? ARG A 234 PRO A 235 
AC 1 LYS A 186 ? PRO A 193 ? LYS A 186 PRO A 193 
AC 2 GLU A 198 ? PHE A 208 ? GLU A 198 PHE A 208 
AC 3 PHE A 241 ? PRO A 250 ? PHE A 241 PRO A 250 
AC 4 THR A 228 ? LEU A 230 ? THR A 228 LEU A 230 
AD 1 ARG A 234 ? PRO A 235 ? ARG A 234 PRO A 235 
AD 2 PHE A 241 ? PRO A 250 ? PHE A 241 PRO A 250 
AE 1 GLU A 222 ? ASP A 223 ? GLU A 222 ASP A 223 
AE 2 THR A 214 ? ARG A 219 ? THR A 214 ARG A 219 
AE 3 TYR A 257 ? GLN A 262 ? TYR A 257 GLN A 262 
AE 4 LEU A 270 ? ARG A 273 ? LEU A 270 ARG A 273 
BA 1 LYS B 6   ? SER B 11  ? LYS B 6   SER B 11  
BA 2 ASN B 21  ? PHE B 30  ? ASN B 21  PHE B 30  
BA 3 PHE B 62  ? PHE B 70  ? PHE B 62  PHE B 70  
BA 4 SER B 55  ? PHE B 56  ? SER B 55  PHE B 56  
BB 1 LYS B 6   ? SER B 11  ? LYS B 6   SER B 11  
BB 2 ASN B 21  ? PHE B 30  ? ASN B 21  PHE B 30  
BB 3 PHE B 62  ? PHE B 70  ? PHE B 62  PHE B 70  
BB 4 GLU B 50  ? HIS B 51  ? GLU B 50  HIS B 51  
BC 1 SER B 55  ? PHE B 56  ? SER B 55  PHE B 56  
BC 2 PHE B 62  ? PHE B 70  ? PHE B 62  PHE B 70  
BD 1 GLU B 44  ? ARG B 45  ? GLU B 44  ARG B 45  
BD 2 ILE B 35  ? LYS B 41  ? ILE B 35  LYS B 41  
BD 3 TYR B 78  ? HIS B 84  ? TYR B 78  HIS B 84  
BD 4 LYS B 91  ? LYS B 94  ? LYS B 91  LYS B 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 46  ? N GLU A 46  O ARG A 35  ? O ARG A 35  
AA 2 3 N PHE A 36  ? N PHE A 36  O ALA A 24  ? O ALA A 24  
AA 3 4 N TYR A 27  ? N TYR A 27  O ARG A 6   ? O ARG A 6   
AA 4 5 N SER A 11  ? N SER A 11  O ILE A 95  ? O ILE A 95  
AA 5 6 O ASP A 102 ? O ASP A 102 N LEU A 110 ? N LEU A 110 
AA 6 7 N TYR A 118 ? N TYR A 118 O LYS A 121 ? O LYS A 121 
AA 7 8 N ALA A 125 ? N ALA A 125 O THR A 134 ? O THR A 134 
AB 1 2 N HIS A 192 ? N HIS A 192 O THR A 200 ? O THR A 200 
AB 2 3 N PHE A 208 ? N PHE A 208 O PHE A 241 ? O PHE A 241 
AB 3 4 N GLN A 242 ? N GLN A 242 O ARG A 234 ? O ARG A 234 
AC 1 2 N HIS A 192 ? N HIS A 192 O THR A 200 ? O THR A 200 
AC 2 3 N PHE A 208 ? N PHE A 208 O PHE A 241 ? O PHE A 241 
AC 3 4 N ALA A 246 ? N ALA A 246 O GLU A 229 ? O GLU A 229 
AD 1 2 N ARG A 234 ? N ARG A 234 O GLN A 242 ? O GLN A 242 
AE 1 2 N GLU A 222 ? N GLU A 222 O ARG A 219 ? O ARG A 219 
AE 2 3 N GLN A 218 ? N GLN A 218 O THR A 258 ? O THR A 258 
AE 3 4 N VAL A 261 ? N VAL A 261 O LEU A 270 ? O LEU A 270 
BA 1 2 N TYR B 10  ? N TYR B 10  O ASN B 24  ? O ASN B 24  
BA 2 3 N PHE B 30  ? N PHE B 30  O PHE B 62  ? O PHE B 62  
BA 3 4 N TYR B 63  ? N TYR B 63  O SER B 55  ? O SER B 55  
BB 1 2 N TYR B 10  ? N TYR B 10  O ASN B 24  ? O ASN B 24  
BB 2 3 N PHE B 30  ? N PHE B 30  O PHE B 62  ? O PHE B 62  
BB 3 4 N TYR B 67  ? N TYR B 67  O GLU B 50  ? O GLU B 50  
BC 1 2 N SER B 55  ? N SER B 55  O TYR B 63  ? O TYR B 63  
BD 1 2 N GLU B 44  ? N GLU B 44  O LYS B 41  ? O LYS B 41  
BD 2 3 N LEU B 40  ? N LEU B 40  O ALA B 79  ? O ALA B 79  
BD 3 4 N VAL B 82  ? N VAL B 82  O LYS B 91  ? O LYS B 91  
# 
_database_PDB_matrix.entry_id          2XPG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XPG 
_atom_sites.fract_transf_matrix[1][1]   0.016093 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015256 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009327 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 31.600 -16.175 -2.745  1.00 57.75  ? 1    GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 31.073 -15.113 -3.583  1.00 54.89  ? 1    GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 29.623 -14.790 -3.270  1.00 57.06  ? 1    GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 28.919 -15.578 -2.637  1.00 56.51  ? 1    GLY A O   1 
ATOM   5    N N   . SER A 1 2   ? 29.174 -13.625 -3.722  1.00 54.09  ? 2    SER A N   1 
ATOM   6    C CA  . SER A 1 2   ? 27.809 -13.177 -3.472  1.00 42.15  ? 2    SER A CA  1 
ATOM   7    C C   . SER A 1 2   ? 26.895 -13.449 -4.667  1.00 35.78  ? 2    SER A C   1 
ATOM   8    O O   . SER A 1 2   ? 27.367 -13.720 -5.771  1.00 35.86  ? 2    SER A O   1 
ATOM   9    C CB  . SER A 1 2   ? 27.804 -11.687 -3.135  1.00 37.24  ? 2    SER A CB  1 
ATOM   10   O OG  . SER A 1 2   ? 28.465 -10.945 -4.144  1.00 33.13  ? 2    SER A OG  1 
ATOM   11   N N   . HIS A 1 3   ? 25.587 -13.375 -4.434  1.00 29.69  ? 3    HIS A N   1 
ATOM   12   C CA  . HIS A 1 3   ? 24.592 -13.585 -5.485  1.00 25.18  ? 3    HIS A CA  1 
ATOM   13   C C   . HIS A 1 3   ? 23.631 -12.409 -5.567  1.00 24.60  ? 3    HIS A C   1 
ATOM   14   O O   . HIS A 1 3   ? 23.625 -11.543 -4.693  1.00 29.19  ? 3    HIS A O   1 
ATOM   15   C CB  . HIS A 1 3   ? 23.810 -14.879 -5.246  1.00 28.28  ? 3    HIS A CB  1 
ATOM   16   C CG  . HIS A 1 3   ? 24.653 -16.114 -5.320  1.00 39.13  ? 3    HIS A CG  1 
ATOM   17   N ND1 . HIS A 1 3   ? 25.037 -16.681 -6.516  1.00 41.40  ? 3    HIS A ND1 1 
ATOM   18   C CD2 . HIS A 1 3   ? 25.192 -16.885 -4.348  1.00 34.15  ? 3    HIS A CD2 1 
ATOM   19   C CE1 . HIS A 1 3   ? 25.774 -17.750 -6.278  1.00 34.81  ? 3    HIS A CE1 1 
ATOM   20   N NE2 . HIS A 1 3   ? 25.883 -17.896 -4.969  1.00 34.32  ? 3    HIS A NE2 1 
ATOM   21   N N   . SER A 1 4   ? 22.816 -12.383 -6.617  1.00 22.67  ? 4    SER A N   1 
ATOM   22   C CA  . SER A 1 4   ? 21.883 -11.283 -6.821  1.00 21.49  ? 4    SER A CA  1 
ATOM   23   C C   . SER A 1 4   ? 20.659 -11.714 -7.614  1.00 29.42  ? 4    SER A C   1 
ATOM   24   O O   . SER A 1 4   ? 20.723 -12.637 -8.423  1.00 34.01  ? 4    SER A O   1 
ATOM   25   C CB  . SER A 1 4   ? 22.574 -10.127 -7.538  1.00 25.69  ? 4    SER A CB  1 
ATOM   26   O OG  . SER A 1 4   ? 23.119 -10.551 -8.777  1.00 36.50  ? 4    SER A OG  1 
ATOM   27   N N   . MET A 1 5   ? 19.542 -11.040 -7.364  1.00 30.65  ? 5    MET A N   1 
ATOM   28   C CA  . MET A 1 5   ? 18.326 -11.242 -8.137  1.00 31.50  ? 5    MET A CA  1 
ATOM   29   C C   . MET A 1 5   ? 17.882 -9.905  -8.719  1.00 29.38  ? 5    MET A C   1 
ATOM   30   O O   . MET A 1 5   ? 17.738 -8.919  -7.996  1.00 30.20  ? 5    MET A O   1 
ATOM   31   C CB  . MET A 1 5   ? 17.221 -11.847 -7.267  1.00 30.51  ? 5    MET A CB  1 
ATOM   32   C CG  . MET A 1 5   ? 15.958 -12.191 -8.040  1.00 27.92  ? 5    MET A CG  1 
ATOM   33   S SD  . MET A 1 5   ? 14.811 -13.235 -7.122  1.00 37.17  ? 5    MET A SD  1 
ATOM   34   C CE  . MET A 1 5   ? 14.267 -12.109 -5.840  1.00 37.89  ? 5    MET A CE  1 
ATOM   35   N N   . ARG A 1 6   ? 17.672 -9.869  -10.028 1.00 23.15  ? 6    ARG A N   1 
ATOM   36   C CA  . ARG A 1 6   ? 17.358 -8.616  -10.701 1.00 27.29  ? 6    ARG A CA  1 
ATOM   37   C C   . ARG A 1 6   ? 16.105 -8.711  -11.560 1.00 28.23  ? 6    ARG A C   1 
ATOM   38   O O   . ARG A 1 6   ? 15.908 -9.681  -12.294 1.00 26.04  ? 6    ARG A O   1 
ATOM   39   C CB  . ARG A 1 6   ? 18.531 -8.180  -11.582 1.00 27.91  ? 6    ARG A CB  1 
ATOM   40   C CG  . ARG A 1 6   ? 19.821 -7.921  -10.834 1.00 27.00  ? 6    ARG A CG  1 
ATOM   41   C CD  . ARG A 1 6   ? 19.806 -6.570  -10.157 1.00 31.22  ? 6    ARG A CD  1 
ATOM   42   N NE  . ARG A 1 6   ? 21.151 -6.156  -9.767  1.00 44.83  ? 6    ARG A NE  1 
ATOM   43   C CZ  . ARG A 1 6   ? 21.649 -6.278  -8.540  1.00 53.26  ? 6    ARG A CZ  1 
ATOM   44   N NH1 . ARG A 1 6   ? 20.910 -6.795  -7.566  1.00 52.01  ? 6    ARG A NH1 1 
ATOM   45   N NH2 . ARG A 1 6   ? 22.886 -5.872  -8.287  1.00 51.76  ? 6    ARG A NH2 1 
ATOM   46   N N   . TYR A 1 7   ? 15.263 -7.689  -11.470 1.00 23.14  ? 7    TYR A N   1 
ATOM   47   C CA  . TYR A 1 7   ? 14.152 -7.554  -12.397 1.00 22.78  ? 7    TYR A CA  1 
ATOM   48   C C   . TYR A 1 7   ? 14.315 -6.302  -13.258 1.00 20.01  ? 7    TYR A C   1 
ATOM   49   O O   . TYR A 1 7   ? 14.638 -5.226  -12.757 1.00 17.95  ? 7    TYR A O   1 
ATOM   50   C CB  . TYR A 1 7   ? 12.817 -7.554  -11.653 1.00 22.52  ? 7    TYR A CB  1 
ATOM   51   C CG  . TYR A 1 7   ? 12.392 -8.930  -11.180 1.00 25.89  ? 7    TYR A CG  1 
ATOM   52   C CD1 . TYR A 1 7   ? 11.966 -9.896  -12.087 1.00 22.20  ? 7    TYR A CD1 1 
ATOM   53   C CD2 . TYR A 1 7   ? 12.409 -9.261  -9.829  1.00 25.47  ? 7    TYR A CD2 1 
ATOM   54   C CE1 . TYR A 1 7   ? 11.573 -11.153 -11.662 1.00 26.27  ? 7    TYR A CE1 1 
ATOM   55   C CE2 . TYR A 1 7   ? 12.018 -10.514 -9.395  1.00 27.37  ? 7    TYR A CE2 1 
ATOM   56   C CZ  . TYR A 1 7   ? 11.599 -11.456 -10.315 1.00 31.40  ? 7    TYR A CZ  1 
ATOM   57   O OH  . TYR A 1 7   ? 11.210 -12.705 -9.886  1.00 25.54  ? 7    TYR A OH  1 
ATOM   58   N N   . PHE A 1 8   ? 14.113 -6.459  -14.561 1.00 16.30  ? 8    PHE A N   1 
ATOM   59   C CA  . PHE A 1 8   ? 14.244 -5.354  -15.504 1.00 16.44  ? 8    PHE A CA  1 
ATOM   60   C C   . PHE A 1 8   ? 12.944 -5.161  -16.269 1.00 23.35  ? 8    PHE A C   1 
ATOM   61   O O   . PHE A 1 8   ? 12.435 -6.091  -16.893 1.00 27.52  ? 8    PHE A O   1 
ATOM   62   C CB  . PHE A 1 8   ? 15.378 -5.622  -16.495 1.00 17.86  ? 8    PHE A CB  1 
ATOM   63   C CG  . PHE A 1 8   ? 16.722 -5.802  -15.848 1.00 24.55  ? 8    PHE A CG  1 
ATOM   64   C CD1 . PHE A 1 8   ? 17.566 -4.718  -15.659 1.00 25.44  ? 8    PHE A CD1 1 
ATOM   65   C CD2 . PHE A 1 8   ? 17.143 -7.053  -15.430 1.00 20.73  ? 8    PHE A CD2 1 
ATOM   66   C CE1 . PHE A 1 8   ? 18.804 -4.878  -15.062 1.00 16.31  ? 8    PHE A CE1 1 
ATOM   67   C CE2 . PHE A 1 8   ? 18.382 -7.217  -14.835 1.00 21.42  ? 8    PHE A CE2 1 
ATOM   68   C CZ  . PHE A 1 8   ? 19.212 -6.128  -14.653 1.00 12.58  ? 8    PHE A CZ  1 
ATOM   69   N N   . PHE A 1 9   ? 12.415 -3.946  -16.229 1.00 21.34  ? 9    PHE A N   1 
ATOM   70   C CA  . PHE A 1 9   ? 11.173 -3.642  -16.918 1.00 17.24  ? 9    PHE A CA  1 
ATOM   71   C C   . PHE A 1 9   ? 11.358 -2.512  -17.916 1.00 22.39  ? 9    PHE A C   1 
ATOM   72   O O   . PHE A 1 9   ? 11.990 -1.498  -17.613 1.00 22.47  ? 9    PHE A O   1 
ATOM   73   C CB  . PHE A 1 9   ? 10.096 -3.273  -15.906 1.00 18.32  ? 9    PHE A CB  1 
ATOM   74   C CG  . PHE A 1 9   ? 9.983  -4.243  -14.776 1.00 18.83  ? 9    PHE A CG  1 
ATOM   75   C CD1 . PHE A 1 9   ? 9.165  -5.355  -14.883 1.00 21.40  ? 9    PHE A CD1 1 
ATOM   76   C CD2 . PHE A 1 9   ? 10.703 -4.049  -13.607 1.00 22.79  ? 9    PHE A CD2 1 
ATOM   77   C CE1 . PHE A 1 9   ? 9.059  -6.257  -13.838 1.00 26.94  ? 9    PHE A CE1 1 
ATOM   78   C CE2 . PHE A 1 9   ? 10.601 -4.945  -12.559 1.00 25.25  ? 9    PHE A CE2 1 
ATOM   79   C CZ  . PHE A 1 9   ? 9.777  -6.052  -12.675 1.00 27.86  ? 9    PHE A CZ  1 
ATOM   80   N N   . THR A 1 10  ? 10.797 -2.691  -19.107 1.00 18.09  ? 10   THR A N   1 
ATOM   81   C CA  . THR A 1 10  ? 10.881 -1.679  -20.150 1.00 22.80  ? 10   THR A CA  1 
ATOM   82   C C   . THR A 1 10  ? 9.498  -1.421  -20.738 1.00 25.72  ? 10   THR A C   1 
ATOM   83   O O   . THR A 1 10  ? 8.799  -2.351  -21.142 1.00 28.27  ? 10   THR A O   1 
ATOM   84   C CB  . THR A 1 10  ? 11.855 -2.107  -21.280 1.00 26.39  ? 10   THR A CB  1 
ATOM   85   O OG1 . THR A 1 10  ? 13.128 -2.454  -20.720 1.00 20.48  ? 10   THR A OG1 1 
ATOM   86   C CG2 . THR A 1 10  ? 12.041 -0.988  -22.297 1.00 14.26  ? 10   THR A CG2 1 
ATOM   87   N N   . SER A 1 11  ? 9.103  -0.154  -20.773 1.00 26.60  ? 11   SER A N   1 
ATOM   88   C CA  . SER A 1 11  ? 7.851  0.241   -21.407 1.00 17.67  ? 11   SER A CA  1 
ATOM   89   C C   . SER A 1 11  ? 8.120  1.326   -22.438 1.00 20.21  ? 11   SER A C   1 
ATOM   90   O O   . SER A 1 11  ? 8.692  2.368   -22.120 1.00 24.95  ? 11   SER A O   1 
ATOM   91   C CB  . SER A 1 11  ? 6.851  0.747   -20.368 1.00 23.36  ? 11   SER A CB  1 
ATOM   92   O OG  . SER A 1 11  ? 6.481  -0.282  -19.467 1.00 32.68  ? 11   SER A OG  1 
ATOM   93   N N   . VAL A 1 12  ? 7.715  1.076   -23.678 1.00 22.14  ? 12   VAL A N   1 
ATOM   94   C CA  . VAL A 1 12  ? 7.883  2.059   -24.737 1.00 24.17  ? 12   VAL A CA  1 
ATOM   95   C C   . VAL A 1 12  ? 6.535  2.395   -25.360 1.00 26.96  ? 12   VAL A C   1 
ATOM   96   O O   . VAL A 1 12  ? 5.826  1.509   -25.833 1.00 30.90  ? 12   VAL A O   1 
ATOM   97   C CB  . VAL A 1 12  ? 8.842  1.551   -25.827 1.00 22.30  ? 12   VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 12  ? 9.146  2.661   -26.829 1.00 14.10  ? 12   VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 12  ? 10.123 1.025   -25.193 1.00 22.30  ? 12   VAL A CG2 1 
ATOM   100  N N   . SER A 1 13  ? 6.184  3.675   -25.357 1.00 28.10  ? 13   SER A N   1 
ATOM   101  C CA  . SER A 1 13  ? 4.900  4.114   -25.897 1.00 34.98  ? 13   SER A CA  1 
ATOM   102  C C   . SER A 1 13  ? 4.925  4.105   -27.422 1.00 41.81  ? 13   SER A C   1 
ATOM   103  O O   . SER A 1 13  ? 5.920  4.498   -28.028 1.00 35.44  ? 13   SER A O   1 
ATOM   104  C CB  . SER A 1 13  ? 4.554  5.515   -25.388 1.00 25.78  ? 13   SER A CB  1 
ATOM   105  O OG  . SER A 1 13  ? 5.451  6.478   -25.915 1.00 29.27  ? 13   SER A OG  1 
ATOM   106  N N   . ARG A 1 14  ? 3.830  3.654   -28.032 1.00 50.32  ? 14   ARG A N   1 
ATOM   107  C CA  . ARG A 1 14  ? 3.712  3.606   -29.488 1.00 59.05  ? 14   ARG A CA  1 
ATOM   108  C C   . ARG A 1 14  ? 2.660  4.588   -29.996 1.00 69.20  ? 14   ARG A C   1 
ATOM   109  O O   . ARG A 1 14  ? 1.484  4.238   -30.103 1.00 69.60  ? 14   ARG A O   1 
ATOM   110  C CB  . ARG A 1 14  ? 3.338  2.199   -29.963 1.00 59.09  ? 14   ARG A CB  1 
ATOM   111  C CG  . ARG A 1 14  ? 4.233  1.081   -29.461 1.00 61.85  ? 14   ARG A CG  1 
ATOM   112  C CD  . ARG A 1 14  ? 4.033  -0.170  -30.307 1.00 70.50  ? 14   ARG A CD  1 
ATOM   113  N NE  . ARG A 1 14  ? 4.238  -1.403  -29.551 1.00 74.60  ? 14   ARG A NE  1 
ATOM   114  C CZ  . ARG A 1 14  ? 3.252  -2.166  -29.088 1.00 75.55  ? 14   ARG A CZ  1 
ATOM   115  N NH1 . ARG A 1 14  ? 1.990  -1.823  -29.306 1.00 77.12  ? 14   ARG A NH1 1 
ATOM   116  N NH2 . ARG A 1 14  ? 3.527  -3.272  -28.409 1.00 73.50  ? 14   ARG A NH2 1 
ATOM   117  N N   . PRO A 1 15  ? 3.079  5.823   -30.309 1.00 76.83  ? 15   PRO A N   1 
ATOM   118  C CA  . PRO A 1 15  ? 2.178  6.828   -30.880 1.00 81.73  ? 15   PRO A CA  1 
ATOM   119  C C   . PRO A 1 15  ? 2.129  6.748   -32.408 1.00 82.90  ? 15   PRO A C   1 
ATOM   120  O O   . PRO A 1 15  ? 3.142  6.976   -33.070 1.00 81.74  ? 15   PRO A O   1 
ATOM   121  C CB  . PRO A 1 15  ? 2.822  8.142   -30.442 1.00 79.38  ? 15   PRO A CB  1 
ATOM   122  C CG  . PRO A 1 15  ? 4.283  7.832   -30.418 1.00 76.17  ? 15   PRO A CG  1 
ATOM   123  C CD  . PRO A 1 15  ? 4.409  6.384   -30.008 1.00 76.60  ? 15   PRO A CD  1 
ATOM   124  N N   . GLY A 1 16  ? 0.965  6.415   -32.957 1.00 80.90  ? 16   GLY A N   1 
ATOM   125  C CA  . GLY A 1 16  ? -0.194 6.078   -32.153 1.00 84.31  ? 16   GLY A CA  1 
ATOM   126  C C   . GLY A 1 16  ? -0.669 4.673   -32.462 1.00 90.61  ? 16   GLY A C   1 
ATOM   127  O O   . GLY A 1 16  ? -1.867 4.395   -32.449 1.00 95.65  ? 16   GLY A O   1 
ATOM   128  N N   . ARG A 1 17  ? 0.282  3.785   -32.741 1.00 91.45  ? 17   ARG A N   1 
ATOM   129  C CA  . ARG A 1 17  ? -0.020 2.406   -33.119 1.00 92.90  ? 17   ARG A CA  1 
ATOM   130  C C   . ARG A 1 17  ? -0.888 1.675   -32.094 1.00 90.27  ? 17   ARG A C   1 
ATOM   131  O O   . ARG A 1 17  ? -1.515 0.662   -32.408 1.00 89.82  ? 17   ARG A O   1 
ATOM   132  C CB  . ARG A 1 17  ? 1.271  1.619   -33.370 1.00 96.04  ? 17   ARG A CB  1 
ATOM   133  C CG  . ARG A 1 17  ? 1.955  1.947   -34.689 1.00 98.25  ? 17   ARG A CG  1 
ATOM   134  C CD  . ARG A 1 17  ? 2.619  3.314   -34.655 1.00 101.58 ? 17   ARG A CD  1 
ATOM   135  N NE  . ARG A 1 17  ? 3.879  3.298   -33.915 1.00 104.68 ? 17   ARG A NE  1 
ATOM   136  C CZ  . ARG A 1 17  ? 5.064  3.041   -34.463 1.00 104.67 ? 17   ARG A CZ  1 
ATOM   137  N NH1 . ARG A 1 17  ? 6.161  3.050   -33.717 1.00 100.66 ? 17   ARG A NH1 1 
ATOM   138  N NH2 . ARG A 1 17  ? 5.152  2.774   -35.759 1.00 104.53 ? 17   ARG A NH2 1 
ATOM   139  N N   . GLY A 1 18  ? -0.919 2.190   -30.871 1.00 85.80  ? 18   GLY A N   1 
ATOM   140  C CA  . GLY A 1 18  ? -1.724 1.592   -29.825 1.00 77.17  ? 18   GLY A CA  1 
ATOM   141  C C   . GLY A 1 18  ? -1.164 1.861   -28.446 1.00 70.78  ? 18   GLY A C   1 
ATOM   142  O O   . GLY A 1 18  ? -0.905 3.007   -28.079 1.00 73.63  ? 18   GLY A O   1 
ATOM   143  N N   . GLU A 1 19  ? -0.966 0.795   -27.682 1.00 65.27  ? 19   GLU A N   1 
ATOM   144  C CA  . GLU A 1 19  ? -0.484 0.916   -26.314 1.00 65.16  ? 19   GLU A CA  1 
ATOM   145  C C   . GLU A 1 19  ? 0.976  0.495   -26.178 1.00 51.71  ? 19   GLU A C   1 
ATOM   146  O O   . GLU A 1 19  ? 1.515  -0.191  -27.048 1.00 52.09  ? 19   GLU A O   1 
ATOM   147  C CB  . GLU A 1 19  ? -1.368 0.089   -25.388 1.00 78.95  ? 19   GLU A CB  1 
ATOM   148  C CG  . GLU A 1 19  ? -2.825 0.473   -25.479 1.00 92.66  ? 19   GLU A CG  1 
ATOM   149  C CD  . GLU A 1 19  ? -3.727 -0.544  -24.832 1.00 105.28 ? 19   GLU A CD  1 
ATOM   150  O OE1 . GLU A 1 19  ? -3.439 -0.947  -23.684 1.00 105.52 ? 19   GLU A OE1 1 
ATOM   151  O OE2 . GLU A 1 19  ? -4.718 -0.944  -25.479 1.00 112.84 ? 19   GLU A OE2 1 
ATOM   152  N N   . PRO A 1 20  ? 1.623  0.915   -25.081 1.00 35.44  ? 20   PRO A N   1 
ATOM   153  C CA  . PRO A 1 20  ? 3.035  0.628   -24.821 1.00 24.69  ? 20   PRO A CA  1 
ATOM   154  C C   . PRO A 1 20  ? 3.405  -0.838  -24.987 1.00 22.91  ? 20   PRO A C   1 
ATOM   155  O O   . PRO A 1 20  ? 2.652  -1.724  -24.588 1.00 34.25  ? 20   PRO A O   1 
ATOM   156  C CB  . PRO A 1 20  ? 3.199  1.035   -23.357 1.00 23.09  ? 20   PRO A CB  1 
ATOM   157  C CG  . PRO A 1 20  ? 2.225  2.135   -23.178 1.00 28.66  ? 20   PRO A CG  1 
ATOM   158  C CD  . PRO A 1 20  ? 1.041  1.780   -24.040 1.00 34.26  ? 20   PRO A CD  1 
ATOM   159  N N   . ARG A 1 21  ? 4.563  -1.080  -25.590 1.00 20.74  ? 21   ARG A N   1 
ATOM   160  C CA  . ARG A 1 21  ? 5.195  -2.390  -25.552 1.00 22.16  ? 21   ARG A CA  1 
ATOM   161  C C   . ARG A 1 21  ? 5.815  -2.568  -24.164 1.00 27.16  ? 21   ARG A C   1 
ATOM   162  O O   . ARG A 1 21  ? 6.525  -1.686  -23.670 1.00 24.30  ? 21   ARG A O   1 
ATOM   163  C CB  . ARG A 1 21  ? 6.280  -2.476  -26.627 1.00 22.86  ? 21   ARG A CB  1 
ATOM   164  C CG  . ARG A 1 21  ? 7.075  -3.773  -26.630 1.00 26.63  ? 21   ARG A CG  1 
ATOM   165  C CD  . ARG A 1 21  ? 6.313  -4.884  -27.327 1.00 35.08  ? 21   ARG A CD  1 
ATOM   166  N NE  . ARG A 1 21  ? 7.076  -6.127  -27.377 1.00 36.73  ? 21   ARG A NE  1 
ATOM   167  C CZ  . ARG A 1 21  ? 8.017  -6.388  -28.279 1.00 40.62  ? 21   ARG A CZ  1 
ATOM   168  N NH1 . ARG A 1 21  ? 8.317  -5.486  -29.205 1.00 41.04  ? 21   ARG A NH1 1 
ATOM   169  N NH2 . ARG A 1 21  ? 8.662  -7.547  -28.252 1.00 37.29  ? 21   ARG A NH2 1 
ATOM   170  N N   . PHE A 1 22  ? 5.538  -3.699  -23.528 1.00 25.74  ? 22   PHE A N   1 
ATOM   171  C CA  . PHE A 1 22  ? 6.058  -3.955  -22.190 1.00 20.48  ? 22   PHE A CA  1 
ATOM   172  C C   . PHE A 1 22  ? 6.831  -5.262  -22.132 1.00 17.45  ? 22   PHE A C   1 
ATOM   173  O O   . PHE A 1 22  ? 6.316  -6.319  -22.497 1.00 17.81  ? 22   PHE A O   1 
ATOM   174  C CB  . PHE A 1 22  ? 4.922  -3.971  -21.163 1.00 10.89  ? 22   PHE A CB  1 
ATOM   175  C CG  . PHE A 1 22  ? 5.368  -4.309  -19.768 1.00 14.01  ? 22   PHE A CG  1 
ATOM   176  C CD1 . PHE A 1 22  ? 5.964  -3.348  -18.963 1.00 16.28  ? 22   PHE A CD1 1 
ATOM   177  C CD2 . PHE A 1 22  ? 5.187  -5.588  -19.259 1.00 17.73  ? 22   PHE A CD2 1 
ATOM   178  C CE1 . PHE A 1 22  ? 6.374  -3.657  -17.673 1.00 23.45  ? 22   PHE A CE1 1 
ATOM   179  C CE2 . PHE A 1 22  ? 5.595  -5.905  -17.971 1.00 21.41  ? 22   PHE A CE2 1 
ATOM   180  C CZ  . PHE A 1 22  ? 6.189  -4.937  -17.178 1.00 24.55  ? 22   PHE A CZ  1 
ATOM   181  N N   . ILE A 1 23  ? 8.070  -5.186  -21.664 1.00 17.12  ? 23   ILE A N   1 
ATOM   182  C CA  . ILE A 1 23  ? 8.908  -6.374  -21.538 1.00 24.74  ? 23   ILE A CA  1 
ATOM   183  C C   . ILE A 1 23  ? 9.547  -6.454  -20.154 1.00 23.98  ? 23   ILE A C   1 
ATOM   184  O O   . ILE A 1 23  ? 10.074 -5.468  -19.637 1.00 27.65  ? 23   ILE A O   1 
ATOM   185  C CB  . ILE A 1 23  ? 10.000 -6.422  -22.629 1.00 22.25  ? 23   ILE A CB  1 
ATOM   186  C CG1 . ILE A 1 23  ? 9.360  -6.395  -24.020 1.00 21.93  ? 23   ILE A CG1 1 
ATOM   187  C CG2 . ILE A 1 23  ? 10.879 -7.659  -22.461 1.00 14.80  ? 23   ILE A CG2 1 
ATOM   188  C CD1 . ILE A 1 23  ? 10.368 -6.399  -25.148 1.00 31.70  ? 23   ILE A CD1 1 
ATOM   189  N N   . ALA A 1 24  ? 9.486  -7.637  -19.557 1.00 23.29  ? 24   ALA A N   1 
ATOM   190  C CA  . ALA A 1 24  ? 10.026 -7.849  -18.225 1.00 26.51  ? 24   ALA A CA  1 
ATOM   191  C C   . ALA A 1 24  ? 10.933 -9.065  -18.223 1.00 25.24  ? 24   ALA A C   1 
ATOM   192  O O   . ALA A 1 24  ? 10.575 -10.113 -18.758 1.00 25.46  ? 24   ALA A O   1 
ATOM   193  C CB  . ALA A 1 24  ? 8.898  -8.023  -17.213 1.00 28.49  ? 24   ALA A CB  1 
ATOM   194  N N   . VAL A 1 25  ? 12.111 -8.920  -17.626 1.00 23.62  ? 25   VAL A N   1 
ATOM   195  C CA  . VAL A 1 25  ? 13.035 -10.040 -17.502 1.00 25.44  ? 25   VAL A CA  1 
ATOM   196  C C   . VAL A 1 25  ? 13.549 -10.176 -16.076 1.00 24.86  ? 25   VAL A C   1 
ATOM   197  O O   . VAL A 1 25  ? 13.885 -9.189  -15.425 1.00 27.11  ? 25   VAL A O   1 
ATOM   198  C CB  . VAL A 1 25  ? 14.226 -9.914  -18.465 1.00 23.07  ? 25   VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 25  ? 13.734 -9.876  -19.896 1.00 21.67  ? 25   VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 25  ? 15.031 -8.672  -18.148 1.00 30.62  ? 25   VAL A CG2 1 
ATOM   201  N N   . GLY A 1 26  ? 13.588 -11.411 -15.593 1.00 22.77  ? 26   GLY A N   1 
ATOM   202  C CA  . GLY A 1 26  ? 14.126 -11.694 -14.281 1.00 20.28  ? 26   GLY A CA  1 
ATOM   203  C C   . GLY A 1 26  ? 15.439 -12.429 -14.412 1.00 25.13  ? 26   GLY A C   1 
ATOM   204  O O   . GLY A 1 26  ? 15.574 -13.343 -15.228 1.00 21.84  ? 26   GLY A O   1 
ATOM   205  N N   . TYR A 1 27  ? 16.413 -12.020 -13.609 1.00 25.50  ? 27   TYR A N   1 
ATOM   206  C CA  . TYR A 1 27  ? 17.731 -12.637 -13.615 1.00 24.00  ? 27   TYR A CA  1 
ATOM   207  C C   . TYR A 1 27  ? 18.088 -13.152 -12.230 1.00 22.95  ? 27   TYR A C   1 
ATOM   208  O O   . TYR A 1 27  ? 17.705 -12.564 -11.219 1.00 29.14  ? 27   TYR A O   1 
ATOM   209  C CB  . TYR A 1 27  ? 18.795 -11.620 -14.038 1.00 23.34  ? 27   TYR A CB  1 
ATOM   210  C CG  . TYR A 1 27  ? 18.951 -11.419 -15.531 1.00 27.12  ? 27   TYR A CG  1 
ATOM   211  C CD1 . TYR A 1 27  ? 18.360 -10.340 -16.175 1.00 30.08  ? 27   TYR A CD1 1 
ATOM   212  C CD2 . TYR A 1 27  ? 19.714 -12.295 -16.292 1.00 32.86  ? 27   TYR A CD2 1 
ATOM   213  C CE1 . TYR A 1 27  ? 18.518 -10.146 -17.542 1.00 33.28  ? 27   TYR A CE1 1 
ATOM   214  C CE2 . TYR A 1 27  ? 19.873 -12.113 -17.654 1.00 30.60  ? 27   TYR A CE2 1 
ATOM   215  C CZ  . TYR A 1 27  ? 19.276 -11.037 -18.275 1.00 31.70  ? 27   TYR A CZ  1 
ATOM   216  O OH  . TYR A 1 27  ? 19.438 -10.857 -19.632 1.00 36.10  ? 27   TYR A OH  1 
ATOM   217  N N   . VAL A 1 28  ? 18.818 -14.259 -12.194 1.00 21.44  ? 28   VAL A N   1 
ATOM   218  C CA  . VAL A 1 28  ? 19.523 -14.676 -10.990 1.00 23.37  ? 28   VAL A CA  1 
ATOM   219  C C   . VAL A 1 28  ? 20.995 -14.760 -11.366 1.00 22.79  ? 28   VAL A C   1 
ATOM   220  O O   . VAL A 1 28  ? 21.410 -15.669 -12.081 1.00 21.21  ? 28   VAL A O   1 
ATOM   221  C CB  . VAL A 1 28  ? 19.026 -16.029 -10.447 1.00 23.11  ? 28   VAL A CB  1 
ATOM   222  C CG1 . VAL A 1 28  ? 19.970 -16.550 -9.368  1.00 21.12  ? 28   VAL A CG1 1 
ATOM   223  C CG2 . VAL A 1 28  ? 17.612 -15.895 -9.898  1.00 18.50  ? 28   VAL A CG2 1 
ATOM   224  N N   . ASP A 1 29  ? 21.776 -13.795 -10.892 1.00 26.10  ? 29   ASP A N   1 
ATOM   225  C CA  . ASP A 1 29  ? 23.145 -13.623 -11.356 1.00 23.65  ? 29   ASP A CA  1 
ATOM   226  C C   . ASP A 1 29  ? 23.114 -13.306 -12.847 1.00 23.16  ? 29   ASP A C   1 
ATOM   227  O O   . ASP A 1 29  ? 22.515 -12.315 -13.267 1.00 27.32  ? 29   ASP A O   1 
ATOM   228  C CB  . ASP A 1 29  ? 23.982 -14.877 -11.089 1.00 29.35  ? 29   ASP A CB  1 
ATOM   229  C CG  . ASP A 1 29  ? 24.171 -15.152 -9.606  1.00 38.22  ? 29   ASP A CG  1 
ATOM   230  O OD1 . ASP A 1 29  ? 24.150 -14.188 -8.812  1.00 38.21  ? 29   ASP A OD1 1 
ATOM   231  O OD2 . ASP A 1 29  ? 24.343 -16.332 -9.234  1.00 42.28  ? 29   ASP A OD2 1 
ATOM   232  N N   . ASP A 1 30  ? 23.745 -14.154 -13.648 1.00 19.16  ? 30   ASP A N   1 
ATOM   233  C CA  . ASP A 1 30  ? 23.780 -13.931 -15.087 1.00 28.51  ? 30   ASP A CA  1 
ATOM   234  C C   . ASP A 1 30  ? 22.884 -14.907 -15.861 1.00 27.52  ? 30   ASP A C   1 
ATOM   235  O O   . ASP A 1 30  ? 23.062 -15.110 -17.063 1.00 27.73  ? 30   ASP A O   1 
ATOM   236  C CB  . ASP A 1 30  ? 25.225 -13.973 -15.588 1.00 31.36  ? 30   ASP A CB  1 
ATOM   237  C CG  . ASP A 1 30  ? 26.080 -12.869 -14.983 1.00 35.45  ? 30   ASP A CG  1 
ATOM   238  O OD1 . ASP A 1 30  ? 25.562 -11.745 -14.824 1.00 41.31  ? 30   ASP A OD1 1 
ATOM   239  O OD2 . ASP A 1 30  ? 27.262 -13.122 -14.662 1.00 30.18  ? 30   ASP A OD2 1 
ATOM   240  N N   . THR A 1 31  ? 21.913 -15.488 -15.161 1.00 18.73  ? 31   THR A N   1 
ATOM   241  C CA  . THR A 1 31  ? 21.010 -16.480 -15.736 1.00 18.69  ? 31   THR A CA  1 
ATOM   242  C C   . THR A 1 31  ? 19.556 -16.014 -15.692 1.00 28.53  ? 31   THR A C   1 
ATOM   243  O O   . THR A 1 31  ? 18.978 -15.875 -14.616 1.00 32.18  ? 31   THR A O   1 
ATOM   244  C CB  . THR A 1 31  ? 21.097 -17.819 -14.975 1.00 19.91  ? 31   THR A CB  1 
ATOM   245  O OG1 . THR A 1 31  ? 22.375 -18.429 -15.200 1.00 28.62  ? 31   THR A OG1 1 
ATOM   246  C CG2 . THR A 1 31  ? 20.004 -18.762 -15.433 1.00 12.06  ? 31   THR A CG2 1 
ATOM   247  N N   . GLN A 1 32  ? 18.964 -15.776 -16.859 1.00 30.72  ? 32   GLN A N   1 
ATOM   248  C CA  . GLN A 1 32  ? 17.555 -15.408 -16.925 1.00 29.32  ? 32   GLN A CA  1 
ATOM   249  C C   . GLN A 1 32  ? 16.677 -16.593 -16.520 1.00 30.77  ? 32   GLN A C   1 
ATOM   250  O O   . GLN A 1 32  ? 16.949 -17.730 -16.904 1.00 36.69  ? 32   GLN A O   1 
ATOM   251  C CB  . GLN A 1 32  ? 17.172 -14.926 -18.327 1.00 27.66  ? 32   GLN A CB  1 
ATOM   252  C CG  . GLN A 1 32  ? 15.726 -14.454 -18.414 1.00 41.67  ? 32   GLN A CG  1 
ATOM   253  C CD  . GLN A 1 32  ? 15.284 -14.113 -19.823 1.00 45.34  ? 32   GLN A CD  1 
ATOM   254  O OE1 . GLN A 1 32  ? 16.042 -14.258 -20.781 1.00 45.13  ? 32   GLN A OE1 1 
ATOM   255  N NE2 . GLN A 1 32  ? 14.044 -13.659 -19.955 1.00 44.73  ? 32   GLN A NE2 1 
ATOM   256  N N   . PHE A 1 33  ? 15.628 -16.330 -15.743 1.00 21.31  ? 33   PHE A N   1 
ATOM   257  C CA  . PHE A 1 33  ? 14.760 -17.406 -15.271 1.00 24.97  ? 33   PHE A CA  1 
ATOM   258  C C   . PHE A 1 33  ? 13.274 -17.178 -15.561 1.00 27.01  ? 33   PHE A C   1 
ATOM   259  O O   . PHE A 1 33  ? 12.498 -18.132 -15.599 1.00 25.47  ? 33   PHE A O   1 
ATOM   260  C CB  . PHE A 1 33  ? 14.999 -17.712 -13.781 1.00 22.08  ? 33   PHE A CB  1 
ATOM   261  C CG  . PHE A 1 33  ? 14.605 -16.598 -12.852 1.00 27.53  ? 33   PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 33  ? 15.451 -15.523 -12.637 1.00 30.39  ? 33   PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 33  ? 13.394 -16.635 -12.177 1.00 28.20  ? 33   PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 33  ? 15.089 -14.494 -11.777 1.00 25.81  ? 33   PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 33  ? 13.030 -15.614 -11.312 1.00 23.25  ? 33   PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 33  ? 13.878 -14.541 -11.115 1.00 21.26  ? 33   PHE A CZ  1 
ATOM   267  N N   . VAL A 1 34  ? 12.882 -15.923 -15.766 1.00 23.55  ? 34   VAL A N   1 
ATOM   268  C CA  . VAL A 1 34  ? 11.505 -15.611 -16.157 1.00 26.00  ? 34   VAL A CA  1 
ATOM   269  C C   . VAL A 1 34  ? 11.440 -14.477 -17.166 1.00 26.36  ? 34   VAL A C   1 
ATOM   270  O O   . VAL A 1 34  ? 12.411 -13.749 -17.372 1.00 23.33  ? 34   VAL A O   1 
ATOM   271  C CB  . VAL A 1 34  ? 10.594 -15.255 -14.954 1.00 21.35  ? 34   VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 34  ? 10.181 -16.510 -14.197 1.00 22.33  ? 34   VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 34  ? 11.273 -14.241 -14.041 1.00 15.94  ? 34   VAL A CG2 1 
ATOM   274  N N   . ARG A 1 35  ? 10.274 -14.327 -17.782 1.00 31.97  ? 35   ARG A N   1 
ATOM   275  C CA  . ARG A 1 35  ? 10.094 -13.343 -18.833 1.00 33.07  ? 35   ARG A CA  1 
ATOM   276  C C   . ARG A 1 35  ? 8.625  -13.075 -19.128 1.00 29.76  ? 35   ARG A C   1 
ATOM   277  O O   . ARG A 1 35  ? 7.787  -13.979 -19.073 1.00 26.27  ? 35   ARG A O   1 
ATOM   278  C CB  . ARG A 1 35  ? 10.806 -13.804 -20.106 1.00 35.35  ? 35   ARG A CB  1 
ATOM   279  C CG  . ARG A 1 35  ? 10.141 -13.353 -21.388 1.00 36.39  ? 35   ARG A CG  1 
ATOM   280  C CD  . ARG A 1 35  ? 9.317  -14.470 -22.003 1.00 37.12  ? 35   ARG A CD  1 
ATOM   281  N NE  . ARG A 1 35  ? 9.460  -14.477 -23.454 1.00 44.71  ? 35   ARG A NE  1 
ATOM   282  C CZ  . ARG A 1 35  ? 8.596  -13.925 -24.294 1.00 46.62  ? 35   ARG A CZ  1 
ATOM   283  N NH1 . ARG A 1 35  ? 8.816  -13.977 -25.600 1.00 44.43  ? 35   ARG A NH1 1 
ATOM   284  N NH2 . ARG A 1 35  ? 7.509  -13.330 -23.829 1.00 54.74  ? 35   ARG A NH2 1 
ATOM   285  N N   . PHE A 1 36  ? 8.325  -11.820 -19.438 1.00 26.03  ? 36   PHE A N   1 
ATOM   286  C CA  . PHE A 1 36  ? 6.996  -11.436 -19.877 1.00 21.12  ? 36   PHE A CA  1 
ATOM   287  C C   . PHE A 1 36  ? 7.085  -10.412 -21.000 1.00 25.16  ? 36   PHE A C   1 
ATOM   288  O O   . PHE A 1 36  ? 7.919  -9.504  -20.970 1.00 21.47  ? 36   PHE A O   1 
ATOM   289  C CB  . PHE A 1 36  ? 6.168  -10.873 -18.722 1.00 15.11  ? 36   PHE A CB  1 
ATOM   290  C CG  . PHE A 1 36  ? 4.787  -10.434 -19.132 1.00 22.91  ? 36   PHE A CG  1 
ATOM   291  C CD1 . PHE A 1 36  ? 3.721  -11.319 -19.086 1.00 24.23  ? 36   PHE A CD1 1 
ATOM   292  C CD2 . PHE A 1 36  ? 4.560  -9.142  -19.577 1.00 22.94  ? 36   PHE A CD2 1 
ATOM   293  C CE1 . PHE A 1 36  ? 2.459  -10.922 -19.464 1.00 29.94  ? 36   PHE A CE1 1 
ATOM   294  C CE2 . PHE A 1 36  ? 3.300  -8.737  -19.959 1.00 25.79  ? 36   PHE A CE2 1 
ATOM   295  C CZ  . PHE A 1 36  ? 2.245  -9.629  -19.903 1.00 36.18  ? 36   PHE A CZ  1 
ATOM   296  N N   . ASP A 1 37  ? 6.217  -10.571 -21.990 1.00 26.58  ? 37   ASP A N   1 
ATOM   297  C CA  . ASP A 1 37  ? 6.162  -9.665  -23.125 1.00 25.47  ? 37   ASP A CA  1 
ATOM   298  C C   . ASP A 1 37  ? 4.702  -9.416  -23.454 1.00 23.53  ? 37   ASP A C   1 
ATOM   299  O O   . ASP A 1 37  ? 3.939  -10.357 -23.666 1.00 32.57  ? 37   ASP A O   1 
ATOM   300  C CB  . ASP A 1 37  ? 6.884  -10.275 -24.328 1.00 28.09  ? 37   ASP A CB  1 
ATOM   301  C CG  . ASP A 1 37  ? 7.047  -9.294  -25.474 1.00 36.96  ? 37   ASP A CG  1 
ATOM   302  O OD1 . ASP A 1 37  ? 6.240  -8.345  -25.577 1.00 39.77  ? 37   ASP A OD1 1 
ATOM   303  O OD2 . ASP A 1 37  ? 7.986  -9.476  -26.276 1.00 40.28  ? 37   ASP A OD2 1 
ATOM   304  N N   . SER A 1 38  ? 4.319  -8.145  -23.488 1.00 21.49  ? 38   SER A N   1 
ATOM   305  C CA  . SER A 1 38  ? 2.930  -7.764  -23.706 1.00 29.65  ? 38   SER A CA  1 
ATOM   306  C C   . SER A 1 38  ? 2.434  -8.164  -25.095 1.00 36.67  ? 38   SER A C   1 
ATOM   307  O O   . SER A 1 38  ? 1.232  -8.256  -25.330 1.00 37.73  ? 38   SER A O   1 
ATOM   308  C CB  . SER A 1 38  ? 2.752  -6.258  -23.493 1.00 27.44  ? 38   SER A CB  1 
ATOM   309  O OG  . SER A 1 38  ? 3.492  -5.516  -24.448 1.00 32.27  ? 38   SER A OG  1 
ATOM   310  N N   . ASP A 1 39  ? 3.365  -8.405  -26.012 1.00 41.51  ? 39   ASP A N   1 
ATOM   311  C CA  . ASP A 1 39  ? 3.012  -8.748  -27.386 1.00 41.95  ? 39   ASP A CA  1 
ATOM   312  C C   . ASP A 1 39  ? 3.001  -10.252 -27.633 1.00 41.94  ? 39   ASP A C   1 
ATOM   313  O O   . ASP A 1 39  ? 2.499  -10.718 -28.658 1.00 46.68  ? 39   ASP A O   1 
ATOM   314  C CB  . ASP A 1 39  ? 3.958  -8.061  -28.373 1.00 36.85  ? 39   ASP A CB  1 
ATOM   315  C CG  . ASP A 1 39  ? 3.748  -6.560  -28.433 1.00 44.83  ? 39   ASP A CG  1 
ATOM   316  O OD1 . ASP A 1 39  ? 3.301  -5.974  -27.421 1.00 51.06  ? 39   ASP A OD1 1 
ATOM   317  O OD2 . ASP A 1 39  ? 4.032  -5.964  -29.493 1.00 44.95  ? 39   ASP A OD2 1 
ATOM   318  N N   . ALA A 1 40  ? 3.560  -11.008 -26.697 1.00 40.52  ? 40   ALA A N   1 
ATOM   319  C CA  . ALA A 1 40  ? 3.590  -12.457 -26.822 1.00 40.02  ? 40   ALA A CA  1 
ATOM   320  C C   . ALA A 1 40  ? 2.175  -13.023 -26.758 1.00 32.85  ? 40   ALA A C   1 
ATOM   321  O O   . ALA A 1 40  ? 1.286  -12.430 -26.149 1.00 32.79  ? 40   ALA A O   1 
ATOM   322  C CB  . ALA A 1 40  ? 4.472  -13.069 -25.737 1.00 38.08  ? 40   ALA A CB  1 
ATOM   323  N N   . ALA A 1 41  ? 1.970  -14.167 -27.399 1.00 30.50  ? 41   ALA A N   1 
ATOM   324  C CA  . ALA A 1 41  ? 0.666  -14.817 -27.422 1.00 31.94  ? 41   ALA A CA  1 
ATOM   325  C C   . ALA A 1 41  ? 0.297  -15.362 -26.045 1.00 41.97  ? 41   ALA A C   1 
ATOM   326  O O   . ALA A 1 41  ? -0.878 -15.468 -25.699 1.00 49.18  ? 41   ALA A O   1 
ATOM   327  C CB  . ALA A 1 41  ? 0.659  -15.938 -28.449 1.00 20.42  ? 41   ALA A CB  1 
ATOM   328  N N   . SER A 1 42  ? 1.317  -15.702 -25.265 1.00 37.78  ? 42   SER A N   1 
ATOM   329  C CA  . SER A 1 42  ? 1.134  -16.324 -23.960 1.00 32.75  ? 42   SER A CA  1 
ATOM   330  C C   . SER A 1 42  ? 0.355  -15.454 -22.977 1.00 34.33  ? 42   SER A C   1 
ATOM   331  O O   . SER A 1 42  ? -0.580 -15.922 -22.324 1.00 36.39  ? 42   SER A O   1 
ATOM   332  C CB  . SER A 1 42  ? 2.497  -16.675 -23.367 1.00 35.12  ? 42   SER A CB  1 
ATOM   333  O OG  . SER A 1 42  ? 2.365  -17.176 -22.053 1.00 42.52  ? 42   SER A OG  1 
ATOM   334  N N   . GLN A 1 43  ? 0.750  -14.190 -22.871 1.00 34.14  ? 43   GLN A N   1 
ATOM   335  C CA  . GLN A 1 43  ? 0.155  -13.278 -21.900 1.00 31.92  ? 43   GLN A CA  1 
ATOM   336  C C   . GLN A 1 43  ? 0.308  -13.825 -20.487 1.00 30.25  ? 43   GLN A C   1 
ATOM   337  O O   . GLN A 1 43  ? -0.511 -13.561 -19.612 1.00 29.41  ? 43   GLN A O   1 
ATOM   338  C CB  . GLN A 1 43  ? -1.317 -13.007 -22.225 1.00 27.89  ? 43   GLN A CB  1 
ATOM   339  C CG  . GLN A 1 43  ? -1.526 -12.201 -23.501 1.00 23.09  ? 43   GLN A CG  1 
ATOM   340  C CD  . GLN A 1 43  ? -0.798 -10.865 -23.478 1.00 21.83  ? 43   GLN A CD  1 
ATOM   341  O OE1 . GLN A 1 43  ? -1.096 -9.995  -22.662 1.00 28.33  ? 43   GLN A OE1 1 
ATOM   342  N NE2 . GLN A 1 43  ? 0.166  -10.703 -24.375 1.00 16.11  ? 43   GLN A NE2 1 
ATOM   343  N N   . ARG A 1 44  ? 1.376  -14.588 -20.282 1.00 36.68  ? 44   ARG A N   1 
ATOM   344  C CA  . ARG A 1 44  ? 1.697  -15.161 -18.983 1.00 33.49  ? 44   ARG A CA  1 
ATOM   345  C C   . ARG A 1 44  ? 3.161  -14.889 -18.639 1.00 39.02  ? 44   ARG A C   1 
ATOM   346  O O   . ARG A 1 44  ? 3.997  -14.717 -19.529 1.00 41.16  ? 44   ARG A O   1 
ATOM   347  C CB  . ARG A 1 44  ? 1.465  -16.675 -19.007 1.00 27.62  ? 44   ARG A CB  1 
ATOM   348  C CG  . ARG A 1 44  ? 0.032  -17.098 -19.260 1.00 33.00  ? 44   ARG A CG  1 
ATOM   349  C CD  . ARG A 1 44  ? -0.782 -17.074 -17.977 1.00 42.24  ? 44   ARG A CD  1 
ATOM   350  N NE  . ARG A 1 44  ? -0.265 -18.030 -17.003 1.00 52.04  ? 44   ARG A NE  1 
ATOM   351  C CZ  . ARG A 1 44  ? -0.714 -18.150 -15.758 1.00 54.98  ? 44   ARG A CZ  1 
ATOM   352  N NH1 . ARG A 1 44  ? -1.695 -17.368 -15.328 1.00 58.28  ? 44   ARG A NH1 1 
ATOM   353  N NH2 . ARG A 1 44  ? -0.178 -19.048 -14.941 1.00 52.90  ? 44   ARG A NH2 1 
ATOM   354  N N   . MET A 1 45  ? 3.469  -14.847 -17.347 1.00 37.30  ? 45   MET A N   1 
ATOM   355  C CA  . MET A 1 45  ? 4.854  -14.867 -16.905 1.00 34.83  ? 45   MET A CA  1 
ATOM   356  C C   . MET A 1 45  ? 5.408  -16.231 -17.306 1.00 35.60  ? 45   MET A C   1 
ATOM   357  O O   . MET A 1 45  ? 4.873  -17.260 -16.900 1.00 44.71  ? 45   MET A O   1 
ATOM   358  C CB  . MET A 1 45  ? 4.926  -14.677 -15.389 1.00 35.24  ? 45   MET A CB  1 
ATOM   359  C CG  . MET A 1 45  ? 6.330  -14.465 -14.824 1.00 36.24  ? 45   MET A CG  1 
ATOM   360  S SD  . MET A 1 45  ? 7.121  -12.950 -15.404 1.00 51.95  ? 45   MET A SD  1 
ATOM   361  C CE  . MET A 1 45  ? 8.030  -12.449 -13.946 1.00 47.40  ? 45   MET A CE  1 
ATOM   362  N N   . GLU A 1 46  ? 6.459  -16.245 -18.118 1.00 29.15  ? 46   GLU A N   1 
ATOM   363  C CA  . GLU A 1 46  ? 6.977  -17.500 -18.661 1.00 28.21  ? 46   GLU A CA  1 
ATOM   364  C C   . GLU A 1 46  ? 8.327  -17.872 -18.058 1.00 28.98  ? 46   GLU A C   1 
ATOM   365  O O   . GLU A 1 46  ? 9.136  -16.999 -17.755 1.00 30.99  ? 46   GLU A O   1 
ATOM   366  C CB  . GLU A 1 46  ? 7.103  -17.407 -20.184 1.00 39.46  ? 46   GLU A CB  1 
ATOM   367  C CG  . GLU A 1 46  ? 5.854  -16.901 -20.894 1.00 51.08  ? 46   GLU A CG  1 
ATOM   368  C CD  . GLU A 1 46  ? 6.073  -16.691 -22.383 1.00 56.98  ? 46   GLU A CD  1 
ATOM   369  O OE1 . GLU A 1 46  ? 6.781  -17.513 -23.002 1.00 53.17  ? 46   GLU A OE1 1 
ATOM   370  O OE2 . GLU A 1 46  ? 5.544  -15.699 -22.931 1.00 61.76  ? 46   GLU A OE2 1 
ATOM   371  N N   . PRO A 1 47  ? 8.583  -19.178 -17.894 1.00 33.88  ? 47   PRO A N   1 
ATOM   372  C CA  . PRO A 1 47  ? 9.862  -19.625 -17.336 1.00 28.20  ? 47   PRO A CA  1 
ATOM   373  C C   . PRO A 1 47  ? 10.948 -19.687 -18.405 1.00 36.22  ? 47   PRO A C   1 
ATOM   374  O O   . PRO A 1 47  ? 10.665 -19.990 -19.566 1.00 40.78  ? 47   PRO A O   1 
ATOM   375  C CB  . PRO A 1 47  ? 9.543  -21.031 -16.826 1.00 25.94  ? 47   PRO A CB  1 
ATOM   376  C CG  . PRO A 1 47  ? 8.372  -21.505 -17.666 1.00 25.90  ? 47   PRO A CG  1 
ATOM   377  C CD  . PRO A 1 47  ? 7.763  -20.307 -18.367 1.00 30.23  ? 47   PRO A CD  1 
ATOM   378  N N   . ARG A 1 48  ? 12.181 -19.394 -18.009 1.00 37.84  ? 48   ARG A N   1 
ATOM   379  C CA  . ARG A 1 48  ? 13.314 -19.428 -18.927 1.00 35.99  ? 48   ARG A CA  1 
ATOM   380  C C   . ARG A 1 48  ? 14.490 -20.183 -18.321 1.00 33.68  ? 48   ARG A C   1 
ATOM   381  O O   . ARG A 1 48  ? 15.624 -20.036 -18.765 1.00 38.70  ? 48   ARG A O   1 
ATOM   382  C CB  . ARG A 1 48  ? 13.739 -18.009 -19.305 1.00 35.20  ? 48   ARG A CB  1 
ATOM   383  C CG  . ARG A 1 48  ? 12.848 -17.351 -20.341 1.00 39.36  ? 48   ARG A CG  1 
ATOM   384  C CD  . ARG A 1 48  ? 13.020 -18.008 -21.702 1.00 41.98  ? 48   ARG A CD  1 
ATOM   385  N NE  . ARG A 1 48  ? 12.274 -17.313 -22.746 1.00 47.09  ? 48   ARG A NE  1 
ATOM   386  C CZ  . ARG A 1 48  ? 11.014 -17.587 -23.071 1.00 53.64  ? 48   ARG A CZ  1 
ATOM   387  N NH1 . ARG A 1 48  ? 10.353 -18.545 -22.432 1.00 55.57  ? 48   ARG A NH1 1 
ATOM   388  N NH2 . ARG A 1 48  ? 10.414 -16.904 -24.037 1.00 53.94  ? 48   ARG A NH2 1 
ATOM   389  N N   . ALA A 1 49  ? 14.208 -20.987 -17.302 1.00 36.54  ? 49   ALA A N   1 
ATOM   390  C CA  . ALA A 1 49  ? 15.221 -21.815 -16.656 1.00 35.84  ? 49   ALA A CA  1 
ATOM   391  C C   . ALA A 1 49  ? 14.555 -23.042 -16.043 1.00 42.34  ? 49   ALA A C   1 
ATOM   392  O O   . ALA A 1 49  ? 13.404 -22.976 -15.616 1.00 42.08  ? 49   ALA A O   1 
ATOM   393  C CB  . ALA A 1 49  ? 15.974 -21.017 -15.594 1.00 26.74  ? 49   ALA A CB  1 
ATOM   394  N N   . PRO A 1 50  ? 15.281 -24.169 -15.995 1.00 52.38  ? 50   PRO A N   1 
ATOM   395  C CA  . PRO A 1 50  ? 14.715 -25.453 -15.560 1.00 49.43  ? 50   PRO A CA  1 
ATOM   396  C C   . PRO A 1 50  ? 14.191 -25.439 -14.124 1.00 44.32  ? 50   PRO A C   1 
ATOM   397  O O   . PRO A 1 50  ? 13.133 -26.010 -13.853 1.00 41.99  ? 50   PRO A O   1 
ATOM   398  C CB  . PRO A 1 50  ? 15.903 -26.415 -15.679 1.00 52.55  ? 50   PRO A CB  1 
ATOM   399  C CG  . PRO A 1 50  ? 17.111 -25.540 -15.580 1.00 55.15  ? 50   PRO A CG  1 
ATOM   400  C CD  . PRO A 1 50  ? 16.725 -24.269 -16.270 1.00 56.77  ? 50   PRO A CD  1 
ATOM   401  N N   . TRP A 1 51  ? 14.921 -24.795 -13.219 1.00 38.40  ? 51   TRP A N   1 
ATOM   402  C CA  . TRP A 1 51  ? 14.582 -24.840 -11.798 1.00 37.11  ? 51   TRP A CA  1 
ATOM   403  C C   . TRP A 1 51  ? 13.317 -24.064 -11.438 1.00 40.40  ? 51   TRP A C   1 
ATOM   404  O O   . TRP A 1 51  ? 12.610 -24.423 -10.497 1.00 45.88  ? 51   TRP A O   1 
ATOM   405  C CB  . TRP A 1 51  ? 15.766 -24.376 -10.940 1.00 41.02  ? 51   TRP A CB  1 
ATOM   406  C CG  . TRP A 1 51  ? 16.497 -23.191 -11.496 1.00 40.84  ? 51   TRP A CG  1 
ATOM   407  C CD1 . TRP A 1 51  ? 17.504 -23.207 -12.416 1.00 41.55  ? 51   TRP A CD1 1 
ATOM   408  C CD2 . TRP A 1 51  ? 16.281 -21.813 -11.163 1.00 35.26  ? 51   TRP A CD2 1 
ATOM   409  N NE1 . TRP A 1 51  ? 17.928 -21.926 -12.680 1.00 40.72  ? 51   TRP A NE1 1 
ATOM   410  C CE2 . TRP A 1 51  ? 17.193 -21.051 -11.924 1.00 33.46  ? 51   TRP A CE2 1 
ATOM   411  C CE3 . TRP A 1 51  ? 15.405 -21.151 -10.298 1.00 29.83  ? 51   TRP A CE3 1 
ATOM   412  C CZ2 . TRP A 1 51  ? 17.254 -19.660 -11.846 1.00 20.06  ? 51   TRP A CZ2 1 
ATOM   413  C CZ3 . TRP A 1 51  ? 15.466 -19.769 -10.222 1.00 30.69  ? 51   TRP A CZ3 1 
ATOM   414  C CH2 . TRP A 1 51  ? 16.386 -19.039 -10.991 1.00 22.54  ? 51   TRP A CH2 1 
ATOM   415  N N   . ILE A 1 52  ? 13.023 -23.007 -12.185 1.00 38.21  ? 52   ILE A N   1 
ATOM   416  C CA  . ILE A 1 52  ? 11.853 -22.193 -11.881 1.00 40.31  ? 52   ILE A CA  1 
ATOM   417  C C   . ILE A 1 52  ? 10.565 -22.912 -12.286 1.00 46.37  ? 52   ILE A C   1 
ATOM   418  O O   . ILE A 1 52  ? 9.480  -22.583 -11.802 1.00 50.18  ? 52   ILE A O   1 
ATOM   419  C CB  . ILE A 1 52  ? 11.924 -20.802 -12.554 1.00 34.03  ? 52   ILE A CB  1 
ATOM   420  C CG1 . ILE A 1 52  ? 10.990 -19.815 -11.849 1.00 32.53  ? 52   ILE A CG1 1 
ATOM   421  C CG2 . ILE A 1 52  ? 11.594 -20.895 -14.035 1.00 28.34  ? 52   ILE A CG2 1 
ATOM   422  C CD1 . ILE A 1 52  ? 11.344 -19.570 -10.397 1.00 30.03  ? 52   ILE A CD1 1 
ATOM   423  N N   . GLU A 1 53  ? 10.691 -23.900 -13.168 1.00 43.50  ? 53   GLU A N   1 
ATOM   424  C CA  . GLU A 1 53  ? 9.531  -24.635 -13.661 1.00 45.14  ? 53   GLU A CA  1 
ATOM   425  C C   . GLU A 1 53  ? 8.913  -25.493 -12.562 1.00 47.74  ? 53   GLU A C   1 
ATOM   426  O O   . GLU A 1 53  ? 7.796  -25.988 -12.704 1.00 49.26  ? 53   GLU A O   1 
ATOM   427  C CB  . GLU A 1 53  ? 9.907  -25.499 -14.869 1.00 49.86  ? 53   GLU A CB  1 
ATOM   428  C CG  . GLU A 1 53  ? 10.203 -24.704 -16.137 1.00 59.98  ? 53   GLU A CG  1 
ATOM   429  C CD  . GLU A 1 53  ? 10.664 -25.580 -17.295 1.00 71.28  ? 53   GLU A CD  1 
ATOM   430  O OE1 . GLU A 1 53  ? 11.150 -26.705 -17.044 1.00 75.48  ? 53   GLU A OE1 1 
ATOM   431  O OE2 . GLU A 1 53  ? 10.541 -25.141 -18.459 1.00 73.66  ? 53   GLU A OE2 1 
ATOM   432  N N   . GLN A 1 54  ? 9.644  -25.656 -11.464 1.00 50.94  ? 54   GLN A N   1 
ATOM   433  C CA  . GLN A 1 54  ? 9.174  -26.460 -10.341 1.00 52.62  ? 54   GLN A CA  1 
ATOM   434  C C   . GLN A 1 54  ? 8.016  -25.787 -9.614  1.00 53.52  ? 54   GLN A C   1 
ATOM   435  O O   . GLN A 1 54  ? 7.112  -26.457 -9.116  1.00 55.61  ? 54   GLN A O   1 
ATOM   436  C CB  . GLN A 1 54  ? 10.312 -26.721 -9.355  1.00 51.95  ? 54   GLN A CB  1 
ATOM   437  C CG  . GLN A 1 54  ? 11.512 -27.430 -9.951  1.00 56.03  ? 54   GLN A CG  1 
ATOM   438  C CD  . GLN A 1 54  ? 12.606 -27.661 -8.928  1.00 59.55  ? 54   GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 54  ? 12.434 -27.369 -7.742  1.00 58.29  ? 54   GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 54  ? 13.739 -28.187 -9.379  1.00 60.91  ? 54   GLN A NE2 1 
ATOM   441  N N   . GLU A 1 55  ? 8.054  -24.460 -9.550  1.00 48.01  ? 55   GLU A N   1 
ATOM   442  C CA  . GLU A 1 55  ? 7.018  -23.697 -8.867  1.00 46.40  ? 55   GLU A CA  1 
ATOM   443  C C   . GLU A 1 55  ? 5.628  -24.088 -9.368  1.00 46.85  ? 55   GLU A C   1 
ATOM   444  O O   . GLU A 1 55  ? 5.409  -24.241 -10.572 1.00 44.06  ? 55   GLU A O   1 
ATOM   445  C CB  . GLU A 1 55  ? 7.248  -22.195 -9.053  1.00 46.03  ? 55   GLU A CB  1 
ATOM   446  C CG  . GLU A 1 55  ? 8.655  -21.726 -8.706  1.00 45.79  ? 55   GLU A CG  1 
ATOM   447  C CD  . GLU A 1 55  ? 9.015  -21.951 -7.246  1.00 52.23  ? 55   GLU A CD  1 
ATOM   448  O OE1 . GLU A 1 55  ? 8.099  -21.996 -6.398  1.00 53.04  ? 55   GLU A OE1 1 
ATOM   449  O OE2 . GLU A 1 55  ? 10.221 -22.086 -6.947  1.00 55.13  ? 55   GLU A OE2 1 
ATOM   450  N N   . GLY A 1 56  ? 4.696  -24.251 -8.434  1.00 44.49  ? 56   GLY A N   1 
ATOM   451  C CA  . GLY A 1 56  ? 3.341  -24.650 -8.766  1.00 45.53  ? 56   GLY A CA  1 
ATOM   452  C C   . GLY A 1 56  ? 2.585  -23.560 -9.499  1.00 48.68  ? 56   GLY A C   1 
ATOM   453  O O   . GLY A 1 56  ? 3.126  -22.480 -9.736  1.00 48.31  ? 56   GLY A O   1 
ATOM   454  N N   . PRO A 1 57  ? 1.321  -23.836 -9.859  1.00 45.01  ? 57   PRO A N   1 
ATOM   455  C CA  . PRO A 1 57  ? 0.497  -22.888 -10.618 1.00 43.41  ? 57   PRO A CA  1 
ATOM   456  C C   . PRO A 1 57  ? 0.163  -21.630 -9.821  1.00 42.25  ? 57   PRO A C   1 
ATOM   457  O O   . PRO A 1 57  ? 0.019  -20.562 -10.412 1.00 43.26  ? 57   PRO A O   1 
ATOM   458  C CB  . PRO A 1 57  ? -0.775 -23.690 -10.915 1.00 43.38  ? 57   PRO A CB  1 
ATOM   459  C CG  . PRO A 1 57  ? -0.830 -24.719 -9.843  1.00 44.54  ? 57   PRO A CG  1 
ATOM   460  C CD  . PRO A 1 57  ? 0.595  -25.082 -9.559  1.00 39.17  ? 57   PRO A CD  1 
ATOM   461  N N   . GLU A 1 58  ? 0.044  -21.750 -8.503  1.00 49.10  ? 58   GLU A N   1 
ATOM   462  C CA  . GLU A 1 58  ? -0.267 -20.590 -7.673  1.00 54.26  ? 58   GLU A CA  1 
ATOM   463  C C   . GLU A 1 58  ? 0.847  -19.547 -7.785  1.00 48.89  ? 58   GLU A C   1 
ATOM   464  O O   . GLU A 1 58  ? 0.602  -18.343 -7.694  1.00 48.26  ? 58   GLU A O   1 
ATOM   465  C CB  . GLU A 1 58  ? -0.495 -21.002 -6.213  1.00 60.16  ? 58   GLU A CB  1 
ATOM   466  C CG  . GLU A 1 58  ? -1.181 -19.928 -5.366  1.00 71.10  ? 58   GLU A CG  1 
ATOM   467  C CD  . GLU A 1 58  ? -1.665 -20.444 -4.014  1.00 73.21  ? 58   GLU A CD  1 
ATOM   468  O OE1 . GLU A 1 58  ? -1.219 -21.533 -3.589  1.00 74.65  ? 58   GLU A OE1 1 
ATOM   469  O OE2 . GLU A 1 58  ? -2.495 -19.759 -3.377  1.00 64.18  ? 58   GLU A OE2 1 
ATOM   470  N N   . TYR A 1 59  ? 2.071  -20.022 -7.992  1.00 38.74  ? 59   TYR A N   1 
ATOM   471  C CA  . TYR A 1 59  ? 3.219  -19.145 -8.173  1.00 38.14  ? 59   TYR A CA  1 
ATOM   472  C C   . TYR A 1 59  ? 3.132  -18.410 -9.506  1.00 38.55  ? 59   TYR A C   1 
ATOM   473  O O   . TYR A 1 59  ? 3.293  -17.188 -9.570  1.00 31.51  ? 59   TYR A O   1 
ATOM   474  C CB  . TYR A 1 59  ? 4.515  -19.953 -8.108  1.00 34.26  ? 59   TYR A CB  1 
ATOM   475  C CG  . TYR A 1 59  ? 5.754  -19.169 -8.477  1.00 35.18  ? 59   TYR A CG  1 
ATOM   476  C CD1 . TYR A 1 59  ? 6.538  -18.571 -7.497  1.00 39.49  ? 59   TYR A CD1 1 
ATOM   477  C CD2 . TYR A 1 59  ? 6.144  -19.030 -9.804  1.00 33.43  ? 59   TYR A CD2 1 
ATOM   478  C CE1 . TYR A 1 59  ? 7.674  -17.854 -7.827  1.00 32.03  ? 59   TYR A CE1 1 
ATOM   479  C CE2 . TYR A 1 59  ? 7.278  -18.315 -10.144 1.00 32.27  ? 59   TYR A CE2 1 
ATOM   480  C CZ  . TYR A 1 59  ? 8.040  -17.729 -9.150  1.00 29.59  ? 59   TYR A CZ  1 
ATOM   481  O OH  . TYR A 1 59  ? 9.171  -17.018 -9.483  1.00 25.82  ? 59   TYR A OH  1 
ATOM   482  N N   . TRP A 1 60  ? 2.877  -19.166 -10.570 1.00 33.21  ? 60   TRP A N   1 
ATOM   483  C CA  . TRP A 1 60  ? 2.787  -18.594 -11.906 1.00 33.33  ? 60   TRP A CA  1 
ATOM   484  C C   . TRP A 1 60  ? 1.620  -17.627 -12.017 1.00 40.49  ? 60   TRP A C   1 
ATOM   485  O O   . TRP A 1 60  ? 1.779  -16.511 -12.505 1.00 41.88  ? 60   TRP A O   1 
ATOM   486  C CB  . TRP A 1 60  ? 2.709  -19.697 -12.962 1.00 32.56  ? 60   TRP A CB  1 
ATOM   487  C CG  . TRP A 1 60  ? 3.958  -20.514 -12.979 1.00 37.48  ? 60   TRP A CG  1 
ATOM   488  C CD1 . TRP A 1 60  ? 4.107  -21.802 -12.556 1.00 39.54  ? 60   TRP A CD1 1 
ATOM   489  C CD2 . TRP A 1 60  ? 5.255  -20.077 -13.402 1.00 33.87  ? 60   TRP A CD2 1 
ATOM   490  N NE1 . TRP A 1 60  ? 5.414  -22.201 -12.705 1.00 44.00  ? 60   TRP A NE1 1 
ATOM   491  C CE2 . TRP A 1 60  ? 6.139  -21.159 -13.222 1.00 36.45  ? 60   TRP A CE2 1 
ATOM   492  C CE3 . TRP A 1 60  ? 5.753  -18.878 -13.923 1.00 28.16  ? 60   TRP A CE3 1 
ATOM   493  C CZ2 . TRP A 1 60  ? 7.491  -21.079 -13.545 1.00 37.91  ? 60   TRP A CZ2 1 
ATOM   494  C CZ3 . TRP A 1 60  ? 7.095  -18.800 -14.244 1.00 28.87  ? 60   TRP A CZ3 1 
ATOM   495  C CH2 . TRP A 1 60  ? 7.949  -19.893 -14.054 1.00 35.82  ? 60   TRP A CH2 1 
ATOM   496  N N   . ASP A 1 61  ? 0.454  -18.048 -11.540 1.00 39.13  ? 61   ASP A N   1 
ATOM   497  C CA  . ASP A 1 61  ? -0.708 -17.173 -11.515 1.00 34.85  ? 61   ASP A CA  1 
ATOM   498  C C   . ASP A 1 61  ? -0.384 -15.875 -10.783 1.00 29.31  ? 61   ASP A C   1 
ATOM   499  O O   . ASP A 1 61  ? -0.773 -14.790 -11.214 1.00 33.16  ? 61   ASP A O   1 
ATOM   500  C CB  . ASP A 1 61  ? -1.900 -17.872 -10.857 1.00 37.85  ? 61   ASP A CB  1 
ATOM   501  C CG  . ASP A 1 61  ? -2.412 -19.042 -11.674 1.00 47.24  ? 61   ASP A CG  1 
ATOM   502  O OD1 . ASP A 1 61  ? -2.046 -19.142 -12.863 1.00 50.61  ? 61   ASP A OD1 1 
ATOM   503  O OD2 . ASP A 1 61  ? -3.187 -19.860 -11.133 1.00 55.21  ? 61   ASP A OD2 1 
ATOM   504  N N   . GLN A 1 62  ? 0.343  -15.992 -9.680  1.00 33.61  ? 62   GLN A N   1 
ATOM   505  C CA  . GLN A 1 62  ? 0.671  -14.830 -8.868  1.00 38.11  ? 62   GLN A CA  1 
ATOM   506  C C   . GLN A 1 62  ? 1.625  -13.903 -9.610  1.00 33.77  ? 62   GLN A C   1 
ATOM   507  O O   . GLN A 1 62  ? 1.430  -12.689 -9.633  1.00 32.95  ? 62   GLN A O   1 
ATOM   508  C CB  . GLN A 1 62  ? 1.268  -15.266 -7.529  1.00 47.76  ? 62   GLN A CB  1 
ATOM   509  C CG  . GLN A 1 62  ? 1.370  -14.155 -6.498  1.00 58.10  ? 62   GLN A CG  1 
ATOM   510  C CD  . GLN A 1 62  ? 1.546  -14.687 -5.087  1.00 65.78  ? 62   GLN A CD  1 
ATOM   511  O OE1 . GLN A 1 62  ? 2.218  -14.073 -4.258  1.00 65.86  ? 62   GLN A OE1 1 
ATOM   512  N NE2 . GLN A 1 62  ? 0.933  -15.835 -4.805  1.00 64.06  ? 62   GLN A NE2 1 
ATOM   513  N N   . GLU A 1 63  ? 2.646  -14.484 -10.231 1.00 24.48  ? 63   GLU A N   1 
ATOM   514  C CA  . GLU A 1 63  ? 3.652  -13.699 -10.937 1.00 21.17  ? 63   GLU A CA  1 
ATOM   515  C C   . GLU A 1 63  ? 3.110  -12.969 -12.165 1.00 32.09  ? 63   GLU A C   1 
ATOM   516  O O   . GLU A 1 63  ? 3.479  -11.821 -12.406 1.00 35.14  ? 63   GLU A O   1 
ATOM   517  C CB  . GLU A 1 63  ? 4.852  -14.570 -11.319 1.00 27.96  ? 63   GLU A CB  1 
ATOM   518  C CG  . GLU A 1 63  ? 5.648  -15.079 -10.130 1.00 34.63  ? 63   GLU A CG  1 
ATOM   519  C CD  . GLU A 1 63  ? 6.127  -13.962 -9.220  1.00 46.11  ? 63   GLU A CD  1 
ATOM   520  O OE1 . GLU A 1 63  ? 7.286  -13.519 -9.375  1.00 48.00  ? 63   GLU A OE1 1 
ATOM   521  O OE2 . GLU A 1 63  ? 5.344  -13.527 -8.348  1.00 51.89  ? 63   GLU A OE2 1 
ATOM   522  N N   . THR A 1 64  ? 2.247  -13.620 -12.947 1.00 32.13  ? 64   THR A N   1 
ATOM   523  C CA  . THR A 1 64  ? 1.675  -12.944 -14.112 1.00 30.93  ? 64   THR A CA  1 
ATOM   524  C C   . THR A 1 64  ? 0.736  -11.841 -13.638 1.00 32.97  ? 64   THR A C   1 
ATOM   525  O O   . THR A 1 64  ? 0.643  -10.778 -14.252 1.00 35.70  ? 64   THR A O   1 
ATOM   526  C CB  . THR A 1 64  ? 0.939  -13.895 -15.100 1.00 30.80  ? 64   THR A CB  1 
ATOM   527  O OG1 . THR A 1 64  ? -0.477 -13.802 -14.912 1.00 39.71  ? 64   THR A OG1 1 
ATOM   528  C CG2 . THR A 1 64  ? 1.386  -15.332 -14.935 1.00 23.06  ? 64   THR A CG2 1 
ATOM   529  N N   . ARG A 1 65  ? 0.045  -12.099 -12.534 1.00 34.03  ? 65   ARG A N   1 
ATOM   530  C CA  . ARG A 1 65  ? -0.788 -11.088 -11.903 1.00 37.48  ? 65   ARG A CA  1 
ATOM   531  C C   . ARG A 1 65  ? 0.062  -9.859  -11.584 1.00 35.01  ? 65   ARG A C   1 
ATOM   532  O O   . ARG A 1 65  ? -0.261 -8.739  -11.985 1.00 32.18  ? 65   ARG A O   1 
ATOM   533  C CB  . ARG A 1 65  ? -1.418 -11.651 -10.627 1.00 42.56  ? 65   ARG A CB  1 
ATOM   534  C CG  . ARG A 1 65  ? -2.607 -10.862 -10.107 1.00 49.16  ? 65   ARG A CG  1 
ATOM   535  C CD  . ARG A 1 65  ? -3.224 -11.526 -8.877  1.00 61.75  ? 65   ARG A CD  1 
ATOM   536  N NE  . ARG A 1 65  ? -3.610 -12.915 -9.124  1.00 66.09  ? 65   ARG A NE  1 
ATOM   537  C CZ  . ARG A 1 65  ? -3.087 -13.965 -8.494  1.00 66.03  ? 65   ARG A CZ  1 
ATOM   538  N NH1 . ARG A 1 65  ? -2.154 -13.789 -7.563  1.00 65.83  ? 65   ARG A NH1 1 
ATOM   539  N NH2 . ARG A 1 65  ? -3.501 -15.192 -8.787  1.00 57.60  ? 65   ARG A NH2 1 
ATOM   540  N N   . ASN A 1 66  ? 1.164  -10.079 -10.877 1.00 30.38  ? 66   ASN A N   1 
ATOM   541  C CA  . ASN A 1 66  ? 2.037  -8.985  -10.467 1.00 36.25  ? 66   ASN A CA  1 
ATOM   542  C C   . ASN A 1 66  ? 2.740  -8.263  -11.618 1.00 33.33  ? 66   ASN A C   1 
ATOM   543  O O   . ASN A 1 66  ? 2.941  -7.051  -11.557 1.00 23.72  ? 66   ASN A O   1 
ATOM   544  C CB  . ASN A 1 66  ? 3.061  -9.467  -9.434  1.00 38.09  ? 66   ASN A CB  1 
ATOM   545  C CG  . ASN A 1 66  ? 2.443  -9.699  -8.065  1.00 37.69  ? 66   ASN A CG  1 
ATOM   546  O OD1 . ASN A 1 66  ? 1.417  -9.109  -7.729  1.00 37.18  ? 66   ASN A OD1 1 
ATOM   547  N ND2 . ASN A 1 66  ? 3.071  -10.555 -7.267  1.00 39.51  ? 66   ASN A ND2 1 
ATOM   548  N N   . VAL A 1 67  ? 3.110  -8.997  -12.665 1.00 34.67  ? 67   VAL A N   1 
ATOM   549  C CA  . VAL A 1 67  ? 3.833  -8.386  -13.780 1.00 37.59  ? 67   VAL A CA  1 
ATOM   550  C C   . VAL A 1 67  ? 2.916  -7.524  -14.655 1.00 35.12  ? 67   VAL A C   1 
ATOM   551  O O   . VAL A 1 67  ? 3.375  -6.591  -15.316 1.00 38.70  ? 67   VAL A O   1 
ATOM   552  C CB  . VAL A 1 67  ? 4.599  -9.425  -14.643 1.00 23.62  ? 67   VAL A CB  1 
ATOM   553  C CG1 . VAL A 1 67  ? 3.669  -10.088 -15.662 1.00 20.21  ? 67   VAL A CG1 1 
ATOM   554  C CG2 . VAL A 1 67  ? 5.770  -8.757  -15.352 1.00 11.79  ? 67   VAL A CG2 1 
ATOM   555  N N   . LYS A 1 68  ? 1.623  -7.833  -14.652 1.00 27.00  ? 68   LYS A N   1 
ATOM   556  C CA  . LYS A 1 68  ? 0.647  -7.008  -15.359 1.00 32.35  ? 68   LYS A CA  1 
ATOM   557  C C   . LYS A 1 68  ? 0.330  -5.749  -14.553 1.00 27.09  ? 68   LYS A C   1 
ATOM   558  O O   . LYS A 1 68  ? 0.106  -4.678  -15.115 1.00 24.16  ? 68   LYS A O   1 
ATOM   559  C CB  . LYS A 1 68  ? -0.626 -7.803  -15.668 1.00 32.78  ? 68   LYS A CB  1 
ATOM   560  C CG  . LYS A 1 68  ? -0.398 -8.915  -16.681 1.00 35.10  ? 68   LYS A CG  1 
ATOM   561  C CD  . LYS A 1 68  ? -1.686 -9.607  -17.095 1.00 31.22  ? 68   LYS A CD  1 
ATOM   562  C CE  . LYS A 1 68  ? -1.383 -10.713 -18.099 1.00 27.98  ? 68   LYS A CE  1 
ATOM   563  N NZ  . LYS A 1 68  ? -2.569 -11.538 -18.443 1.00 24.46  ? 68   LYS A NZ  1 
ATOM   564  N N   . ALA A 1 69  ? 0.321  -5.885  -13.233 1.00 21.15  ? 69   ALA A N   1 
ATOM   565  C CA  . ALA A 1 69  ? 0.161  -4.733  -12.361 1.00 21.62  ? 69   ALA A CA  1 
ATOM   566  C C   . ALA A 1 69  ? 1.341  -3.795  -12.569 1.00 24.56  ? 69   ALA A C   1 
ATOM   567  O O   . ALA A 1 69  ? 1.178  -2.580  -12.605 1.00 29.93  ? 69   ALA A O   1 
ATOM   568  C CB  . ALA A 1 69  ? 0.067  -5.166  -10.897 1.00 12.21  ? 69   ALA A CB  1 
ATOM   569  N N   . GLN A 1 70  ? 2.532  -4.367  -12.707 1.00 21.15  ? 70   GLN A N   1 
ATOM   570  C CA  . GLN A 1 70  ? 3.727  -3.575  -12.974 1.00 28.08  ? 70   GLN A CA  1 
ATOM   571  C C   . GLN A 1 70  ? 3.540  -2.746  -14.238 1.00 26.96  ? 70   GLN A C   1 
ATOM   572  O O   . GLN A 1 70  ? 3.757  -1.535  -14.230 1.00 29.07  ? 70   GLN A O   1 
ATOM   573  C CB  . GLN A 1 70  ? 4.956  -4.480  -13.122 1.00 25.88  ? 70   GLN A CB  1 
ATOM   574  C CG  . GLN A 1 70  ? 6.223  -3.757  -13.558 1.00 23.20  ? 70   GLN A CG  1 
ATOM   575  C CD  . GLN A 1 70  ? 6.745  -2.789  -12.508 1.00 30.18  ? 70   GLN A CD  1 
ATOM   576  O OE1 . GLN A 1 70  ? 7.267  -1.726  -12.835 1.00 38.75  ? 70   GLN A OE1 1 
ATOM   577  N NE2 . GLN A 1 70  ? 6.614  -3.160  -11.241 1.00 25.46  ? 70   GLN A NE2 1 
ATOM   578  N N   . SER A 1 71  ? 3.127  -3.406  -15.317 1.00 21.63  ? 71   SER A N   1 
ATOM   579  C CA  . SER A 1 71  ? 2.999  -2.754  -16.616 1.00 25.90  ? 71   SER A CA  1 
ATOM   580  C C   . SER A 1 71  ? 1.880  -1.727  -16.638 1.00 24.41  ? 71   SER A C   1 
ATOM   581  O O   . SER A 1 71  ? 1.961  -0.725  -17.347 1.00 23.26  ? 71   SER A O   1 
ATOM   582  C CB  . SER A 1 71  ? 2.775  -3.784  -17.723 1.00 24.07  ? 71   SER A CB  1 
ATOM   583  O OG  . SER A 1 71  ? 1.551  -4.468  -17.531 1.00 36.32  ? 71   SER A OG  1 
ATOM   584  N N   . GLN A 1 72  ? 0.829  -1.977  -15.869 1.00 24.04  ? 72   GLN A N   1 
ATOM   585  C CA  . GLN A 1 72  ? -0.294 -1.052  -15.845 1.00 33.73  ? 72   GLN A CA  1 
ATOM   586  C C   . GLN A 1 72  ? 0.043  0.236   -15.105 1.00 34.64  ? 72   GLN A C   1 
ATOM   587  O O   . GLN A 1 72  ? -0.588 1.266   -15.330 1.00 46.42  ? 72   GLN A O   1 
ATOM   588  C CB  . GLN A 1 72  ? -1.555 -1.712  -15.283 1.00 42.54  ? 72   GLN A CB  1 
ATOM   589  C CG  . GLN A 1 72  ? -2.157 -2.754  -16.223 1.00 56.17  ? 72   GLN A CG  1 
ATOM   590  C CD  . GLN A 1 72  ? -2.296 -2.246  -17.654 1.00 62.72  ? 72   GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 72  ? -1.382 -2.388  -18.472 1.00 57.70  ? 72   GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 72  ? -3.444 -1.652  -17.962 1.00 68.36  ? 72   GLN A NE2 1 
ATOM   593  N N   . THR A 1 73  ? 1.046  0.188   -14.234 1.00 21.99  ? 73   THR A N   1 
ATOM   594  C CA  . THR A 1 73  ? 1.497  1.411   -13.581 1.00 22.70  ? 73   THR A CA  1 
ATOM   595  C C   . THR A 1 73  ? 2.540  2.135   -14.430 1.00 24.38  ? 73   THR A C   1 
ATOM   596  O O   . THR A 1 73  ? 2.607  3.361   -14.423 1.00 25.59  ? 73   THR A O   1 
ATOM   597  C CB  . THR A 1 73  ? 2.009  1.181   -12.136 1.00 27.23  ? 73   THR A CB  1 
ATOM   598  O OG1 . THR A 1 73  ? 3.244  1.880   -11.945 1.00 35.51  ? 73   THR A OG1 1 
ATOM   599  C CG2 . THR A 1 73  ? 2.226  -0.280  -11.862 1.00 22.01  ? 73   THR A CG2 1 
ATOM   600  N N   . ASP A 1 74  ? 3.339  1.379   -15.178 1.00 27.38  ? 74   ASP A N   1 
ATOM   601  C CA  . ASP A 1 74  ? 4.292  1.989   -16.102 1.00 28.01  ? 74   ASP A CA  1 
ATOM   602  C C   . ASP A 1 74  ? 3.553  2.599   -17.287 1.00 33.07  ? 74   ASP A C   1 
ATOM   603  O O   . ASP A 1 74  ? 3.993  3.589   -17.870 1.00 34.15  ? 74   ASP A O   1 
ATOM   604  C CB  . ASP A 1 74  ? 5.329  0.969   -16.578 1.00 28.79  ? 74   ASP A CB  1 
ATOM   605  C CG  . ASP A 1 74  ? 6.260  0.517   -15.460 1.00 45.41  ? 74   ASP A CG  1 
ATOM   606  O OD1 . ASP A 1 74  ? 6.482  1.301   -14.508 1.00 44.68  ? 74   ASP A OD1 1 
ATOM   607  O OD2 . ASP A 1 74  ? 6.769  -0.624  -15.535 1.00 46.73  ? 74   ASP A OD2 1 
ATOM   608  N N   . ARG A 1 75  ? 2.419  1.997   -17.630 1.00 34.56  ? 75   ARG A N   1 
ATOM   609  C CA  . ARG A 1 75  ? 1.556  2.500   -18.685 1.00 33.06  ? 75   ARG A CA  1 
ATOM   610  C C   . ARG A 1 75  ? 0.941  3.836   -18.267 1.00 35.47  ? 75   ARG A C   1 
ATOM   611  O O   . ARG A 1 75  ? 0.841  4.762   -19.072 1.00 34.99  ? 75   ARG A O   1 
ATOM   612  C CB  . ARG A 1 75  ? 0.464  1.472   -18.991 1.00 42.31  ? 75   ARG A CB  1 
ATOM   613  C CG  . ARG A 1 75  ? -0.588 1.921   -19.993 1.00 45.62  ? 75   ARG A CG  1 
ATOM   614  C CD  . ARG A 1 75  ? -1.703 0.889   -20.094 1.00 52.84  ? 75   ARG A CD  1 
ATOM   615  N NE  . ARG A 1 75  ? -2.783 1.327   -20.973 1.00 64.15  ? 75   ARG A NE  1 
ATOM   616  C CZ  . ARG A 1 75  ? -3.827 2.048   -20.574 1.00 68.90  ? 75   ARG A CZ  1 
ATOM   617  N NH1 . ARG A 1 75  ? -4.760 2.401   -21.447 1.00 70.26  ? 75   ARG A NH1 1 
ATOM   618  N NH2 . ARG A 1 75  ? -3.937 2.418   -19.304 1.00 69.36  ? 75   ARG A NH2 1 
ATOM   619  N N   . VAL A 1 76  ? 0.535  3.931   -17.004 1.00 33.31  ? 76   VAL A N   1 
ATOM   620  C CA  . VAL A 1 76  ? -0.012 5.176   -16.466 1.00 35.93  ? 76   VAL A CA  1 
ATOM   621  C C   . VAL A 1 76  ? 1.101  6.194   -16.211 1.00 30.74  ? 76   VAL A C   1 
ATOM   622  O O   . VAL A 1 76  ? 0.899  7.398   -16.371 1.00 31.54  ? 76   VAL A O   1 
ATOM   623  C CB  . VAL A 1 76  ? -0.838 4.933   -15.167 1.00 29.44  ? 76   VAL A CB  1 
ATOM   624  C CG1 . VAL A 1 76  ? -1.139 6.244   -14.452 1.00 19.11  ? 76   VAL A CG1 1 
ATOM   625  C CG2 . VAL A 1 76  ? -2.127 4.203   -15.486 1.00 25.13  ? 76   VAL A CG2 1 
ATOM   626  N N   . ASP A 1 77  ? 2.276  5.703   -15.822 1.00 26.54  ? 77   ASP A N   1 
ATOM   627  C CA  . ASP A 1 77  ? 3.433  6.568   -15.590 1.00 31.29  ? 77   ASP A CA  1 
ATOM   628  C C   . ASP A 1 77  ? 3.868  7.328   -16.853 1.00 32.09  ? 77   ASP A C   1 
ATOM   629  O O   . ASP A 1 77  ? 4.259  8.495   -16.779 1.00 26.91  ? 77   ASP A O   1 
ATOM   630  C CB  . ASP A 1 77  ? 4.609  5.770   -15.012 1.00 34.07  ? 77   ASP A CB  1 
ATOM   631  C CG  . ASP A 1 77  ? 4.396  5.378   -13.551 1.00 43.13  ? 77   ASP A CG  1 
ATOM   632  O OD1 . ASP A 1 77  ? 3.420  5.854   -12.934 1.00 40.75  ? 77   ASP A OD1 1 
ATOM   633  O OD2 . ASP A 1 77  ? 5.216  4.600   -13.013 1.00 48.75  ? 77   ASP A OD2 1 
ATOM   634  N N   . LEU A 1 78  ? 3.800  6.666   -18.005 1.00 31.77  ? 78   LEU A N   1 
ATOM   635  C CA  . LEU A 1 78  ? 4.116  7.310   -19.279 1.00 32.04  ? 78   LEU A CA  1 
ATOM   636  C C   . LEU A 1 78  ? 3.220  8.521   -19.502 1.00 34.35  ? 78   LEU A C   1 
ATOM   637  O O   . LEU A 1 78  ? 3.679  9.575   -19.939 1.00 34.86  ? 78   LEU A O   1 
ATOM   638  C CB  . LEU A 1 78  ? 3.967  6.329   -20.443 1.00 26.47  ? 78   LEU A CB  1 
ATOM   639  C CG  . LEU A 1 78  ? 5.094  5.316   -20.671 1.00 30.53  ? 78   LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 78  ? 4.586  4.104   -21.433 1.00 24.82  ? 78   LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 78  ? 6.276  5.956   -21.393 1.00 30.75  ? 78   LEU A CD2 1 
ATOM   642  N N   . GLY A 1 79  ? 1.937  8.363   -19.195 1.00 34.01  ? 79   GLY A N   1 
ATOM   643  C CA  . GLY A 1 79  ? 0.990  9.454   -19.321 1.00 31.93  ? 79   GLY A CA  1 
ATOM   644  C C   . GLY A 1 79  ? 1.312  10.576  -18.357 1.00 28.82  ? 79   GLY A C   1 
ATOM   645  O O   . GLY A 1 79  ? 1.309  11.749  -18.732 1.00 26.17  ? 79   GLY A O   1 
ATOM   646  N N   . THR A 1 80  ? 1.602  10.207  -17.113 1.00 29.51  ? 80   THR A N   1 
ATOM   647  C CA  . THR A 1 80  ? 1.910  11.170  -16.061 1.00 26.63  ? 80   THR A CA  1 
ATOM   648  C C   . THR A 1 80  ? 3.172  11.970  -16.369 1.00 28.02  ? 80   THR A C   1 
ATOM   649  O O   . THR A 1 80  ? 3.186  13.193  -16.234 1.00 31.17  ? 80   THR A O   1 
ATOM   650  C CB  . THR A 1 80  ? 2.078  10.473  -14.698 1.00 29.50  ? 80   THR A CB  1 
ATOM   651  O OG1 . THR A 1 80  ? 0.890  9.736   -14.388 1.00 33.10  ? 80   THR A OG1 1 
ATOM   652  C CG2 . THR A 1 80  ? 2.349  11.492  -13.594 1.00 23.63  ? 80   THR A CG2 1 
ATOM   653  N N   . LEU A 1 81  ? 4.230  11.278  -16.782 1.00 24.65  ? 81   LEU A N   1 
ATOM   654  C CA  . LEU A 1 81  ? 5.493  11.943  -17.076 1.00 21.36  ? 81   LEU A CA  1 
ATOM   655  C C   . LEU A 1 81  ? 5.376  12.879  -18.275 1.00 25.18  ? 81   LEU A C   1 
ATOM   656  O O   . LEU A 1 81  ? 5.928  13.978  -18.270 1.00 28.39  ? 81   LEU A O   1 
ATOM   657  C CB  . LEU A 1 81  ? 6.616  10.925  -17.286 1.00 19.82  ? 81   LEU A CB  1 
ATOM   658  C CG  . LEU A 1 81  ? 6.943  10.068  -16.058 1.00 26.63  ? 81   LEU A CG  1 
ATOM   659  C CD1 . LEU A 1 81  ? 8.320  9.436   -16.182 1.00 22.18  ? 81   LEU A CD1 1 
ATOM   660  C CD2 . LEU A 1 81  ? 6.858  10.896  -14.791 1.00 24.35  ? 81   LEU A CD2 1 
ATOM   661  N N   . ARG A 1 82  ? 4.653  12.449  -19.301 1.00 26.26  ? 82   ARG A N   1 
ATOM   662  C CA  . ARG A 1 82  ? 4.458  13.293  -20.468 1.00 24.88  ? 82   ARG A CA  1 
ATOM   663  C C   . ARG A 1 82  ? 3.878  14.627  -20.009 1.00 25.68  ? 82   ARG A C   1 
ATOM   664  O O   . ARG A 1 82  ? 4.264  15.689  -20.504 1.00 23.32  ? 82   ARG A O   1 
ATOM   665  C CB  . ARG A 1 82  ? 3.533  12.618  -21.482 1.00 32.29  ? 82   ARG A CB  1 
ATOM   666  C CG  . ARG A 1 82  ? 3.497  13.308  -22.837 1.00 41.21  ? 82   ARG A CG  1 
ATOM   667  C CD  . ARG A 1 82  ? 2.271  12.911  -23.647 1.00 53.36  ? 82   ARG A CD  1 
ATOM   668  N NE  . ARG A 1 82  ? 1.021  13.152  -22.927 1.00 63.03  ? 82   ARG A NE  1 
ATOM   669  C CZ  . ARG A 1 82  ? 0.602  14.348  -22.518 1.00 63.96  ? 82   ARG A CZ  1 
ATOM   670  N NH1 . ARG A 1 82  ? 1.336  15.430  -22.743 1.00 63.25  ? 82   ARG A NH1 1 
ATOM   671  N NH2 . ARG A 1 82  ? -0.551 14.461  -21.873 1.00 63.16  ? 82   ARG A NH2 1 
ATOM   672  N N   . GLY A 1 83  ? 2.964  14.559  -19.043 1.00 21.80  ? 83   GLY A N   1 
ATOM   673  C CA  . GLY A 1 83  ? 2.357  15.745  -18.459 1.00 15.28  ? 83   GLY A CA  1 
ATOM   674  C C   . GLY A 1 83  ? 3.289  16.557  -17.571 1.00 24.11  ? 83   GLY A C   1 
ATOM   675  O O   . GLY A 1 83  ? 3.249  17.787  -17.589 1.00 28.39  ? 83   GLY A O   1 
ATOM   676  N N   . TYR A 1 84  ? 4.124  15.879  -16.785 1.00 16.22  ? 84   TYR A N   1 
ATOM   677  C CA  . TYR A 1 84  ? 5.097  16.573  -15.952 1.00 15.98  ? 84   TYR A CA  1 
ATOM   678  C C   . TYR A 1 84  ? 6.020  17.419  -16.823 1.00 26.88  ? 84   TYR A C   1 
ATOM   679  O O   . TYR A 1 84  ? 6.341  18.559  -16.486 1.00 24.80  ? 84   TYR A O   1 
ATOM   680  C CB  . TYR A 1 84  ? 5.940  15.581  -15.146 1.00 24.10  ? 84   TYR A CB  1 
ATOM   681  C CG  . TYR A 1 84  ? 5.250  14.961  -13.948 1.00 30.58  ? 84   TYR A CG  1 
ATOM   682  C CD1 . TYR A 1 84  ? 4.067  15.490  -13.441 1.00 38.13  ? 84   TYR A CD1 1 
ATOM   683  C CD2 . TYR A 1 84  ? 5.791  13.848  -13.317 1.00 27.55  ? 84   TYR A CD2 1 
ATOM   684  C CE1 . TYR A 1 84  ? 3.440  14.921  -12.341 1.00 40.21  ? 84   TYR A CE1 1 
ATOM   685  C CE2 . TYR A 1 84  ? 5.175  13.273  -12.221 1.00 36.48  ? 84   TYR A CE2 1 
ATOM   686  C CZ  . TYR A 1 84  ? 4.001  13.811  -11.735 1.00 43.62  ? 84   TYR A CZ  1 
ATOM   687  O OH  . TYR A 1 84  ? 3.394  13.233  -10.643 1.00 44.98  ? 84   TYR A OH  1 
ATOM   688  N N   . TYR A 1 85  ? 6.438  16.848  -17.951 1.00 33.54  ? 85   TYR A N   1 
ATOM   689  C CA  . TYR A 1 85  ? 7.439  17.471  -18.817 1.00 32.08  ? 85   TYR A CA  1 
ATOM   690  C C   . TYR A 1 85  ? 6.842  18.371  -19.892 1.00 30.42  ? 85   TYR A C   1 
ATOM   691  O O   . TYR A 1 85  ? 7.573  19.072  -20.587 1.00 19.06  ? 85   TYR A O   1 
ATOM   692  C CB  . TYR A 1 85  ? 8.315  16.403  -19.482 1.00 30.95  ? 85   TYR A CB  1 
ATOM   693  C CG  . TYR A 1 85  ? 9.287  15.732  -18.541 1.00 34.33  ? 85   TYR A CG  1 
ATOM   694  C CD1 . TYR A 1 85  ? 10.378 16.426  -18.028 1.00 36.45  ? 85   TYR A CD1 1 
ATOM   695  C CD2 . TYR A 1 85  ? 9.122  14.405  -18.172 1.00 29.61  ? 85   TYR A CD2 1 
ATOM   696  C CE1 . TYR A 1 85  ? 11.274 15.817  -17.170 1.00 30.89  ? 85   TYR A CE1 1 
ATOM   697  C CE2 . TYR A 1 85  ? 10.011 13.788  -17.315 1.00 32.97  ? 85   TYR A CE2 1 
ATOM   698  C CZ  . TYR A 1 85  ? 11.086 14.498  -16.817 1.00 31.98  ? 85   TYR A CZ  1 
ATOM   699  O OH  . TYR A 1 85  ? 11.975 13.886  -15.964 1.00 28.63  ? 85   TYR A OH  1 
ATOM   700  N N   . ASN A 1 86  ? 5.519  18.344  -20.030 1.00 32.62  ? 86   ASN A N   1 
ATOM   701  C CA  . ASN A 1 86  ? 4.846  19.137  -21.049 1.00 30.64  ? 86   ASN A CA  1 
ATOM   702  C C   . ASN A 1 86  ? 5.247  18.710  -22.453 1.00 26.32  ? 86   ASN A C   1 
ATOM   703  O O   . ASN A 1 86  ? 5.483  19.544  -23.325 1.00 32.98  ? 86   ASN A O   1 
ATOM   704  C CB  . ASN A 1 86  ? 5.141  20.620  -20.856 1.00 37.38  ? 86   ASN A CB  1 
ATOM   705  C CG  . ASN A 1 86  ? 3.919  21.402  -20.453 1.00 56.19  ? 86   ASN A CG  1 
ATOM   706  O OD1 . ASN A 1 86  ? 3.069  21.714  -21.289 1.00 69.28  ? 86   ASN A OD1 1 
ATOM   707  N ND2 . ASN A 1 86  ? 3.820  21.729  -19.168 1.00 52.26  ? 86   ASN A ND2 1 
ATOM   708  N N   . GLN A 1 87  ? 5.325  17.402  -22.661 1.00 20.87  ? 87   GLN A N   1 
ATOM   709  C CA  . GLN A 1 87  ? 5.709  16.852  -23.955 1.00 30.75  ? 87   GLN A CA  1 
ATOM   710  C C   . GLN A 1 87  ? 4.480  16.561  -24.812 1.00 29.37  ? 87   GLN A C   1 
ATOM   711  O O   . GLN A 1 87  ? 3.374  16.403  -24.294 1.00 25.64  ? 87   GLN A O   1 
ATOM   712  C CB  . GLN A 1 87  ? 6.545  15.583  -23.760 1.00 25.99  ? 87   GLN A CB  1 
ATOM   713  C CG  . GLN A 1 87  ? 7.797  15.814  -22.920 1.00 30.63  ? 87   GLN A CG  1 
ATOM   714  C CD  . GLN A 1 87  ? 8.579  14.545  -22.657 1.00 33.00  ? 87   GLN A CD  1 
ATOM   715  O OE1 . GLN A 1 87  ? 8.077  13.606  -22.037 1.00 32.97  ? 87   GLN A OE1 1 
ATOM   716  N NE2 . GLN A 1 87  ? 9.817  14.508  -23.131 1.00 35.47  ? 87   GLN A NE2 1 
ATOM   717  N N   . SER A 1 88  ? 4.678  16.500  -26.124 1.00 28.28  ? 88   SER A N   1 
ATOM   718  C CA  . SER A 1 88  ? 3.580  16.213  -27.038 1.00 40.39  ? 88   SER A CA  1 
ATOM   719  C C   . SER A 1 88  ? 3.330  14.714  -27.127 1.00 45.90  ? 88   SER A C   1 
ATOM   720  O O   . SER A 1 88  ? 4.222  13.910  -26.864 1.00 49.83  ? 88   SER A O   1 
ATOM   721  C CB  . SER A 1 88  ? 3.862  16.790  -28.430 1.00 44.66  ? 88   SER A CB  1 
ATOM   722  O OG  . SER A 1 88  ? 4.969  16.151  -29.037 1.00 46.79  ? 88   SER A OG  1 
ATOM   723  N N   . GLU A 1 89  ? 2.110  14.343  -27.495 1.00 54.48  ? 89   GLU A N   1 
ATOM   724  C CA  . GLU A 1 89  ? 1.770  12.938  -27.673 1.00 59.40  ? 89   GLU A CA  1 
ATOM   725  C C   . GLU A 1 89  ? 2.412  12.392  -28.941 1.00 60.40  ? 89   GLU A C   1 
ATOM   726  O O   . GLU A 1 89  ? 2.316  11.200  -29.237 1.00 58.63  ? 89   GLU A O   1 
ATOM   727  C CB  . GLU A 1 89  ? 0.253  12.752  -27.709 1.00 60.43  ? 89   GLU A CB  1 
ATOM   728  C CG  . GLU A 1 89  ? -0.319 12.203  -26.415 1.00 67.43  ? 89   GLU A CG  1 
ATOM   729  C CD  . GLU A 1 89  ? -1.757 12.618  -26.190 1.00 75.55  ? 89   GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 89  ? -2.203 13.583  -26.843 1.00 73.53  ? 89   GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 89  ? -2.437 11.981  -25.356 1.00 82.83  ? 89   GLU A OE2 1 
ATOM   732  N N   . ALA A 1 90  ? 3.075  13.275  -29.679 1.00 66.11  ? 90   ALA A N   1 
ATOM   733  C CA  . ALA A 1 90  ? 3.737  12.901  -30.922 1.00 74.79  ? 90   ALA A CA  1 
ATOM   734  C C   . ALA A 1 90  ? 4.851  11.886  -30.684 1.00 76.04  ? 90   ALA A C   1 
ATOM   735  O O   . ALA A 1 90  ? 4.764  10.741  -31.128 1.00 78.75  ? 90   ALA A O   1 
ATOM   736  C CB  . ALA A 1 90  ? 4.289  14.140  -31.619 1.00 76.17  ? 90   ALA A CB  1 
ATOM   737  N N   . GLY A 1 91  ? 5.891  12.317  -29.977 1.00 72.89  ? 91   GLY A N   1 
ATOM   738  C CA  . GLY A 1 91  ? 7.063  11.493  -29.743 1.00 67.74  ? 91   GLY A CA  1 
ATOM   739  C C   . GLY A 1 91  ? 6.807  10.208  -28.977 1.00 62.11  ? 91   GLY A C   1 
ATOM   740  O O   . GLY A 1 91  ? 5.793  10.064  -28.292 1.00 62.17  ? 91   GLY A O   1 
ATOM   741  N N   . SER A 1 92  ? 7.741  9.271   -29.104 1.00 56.52  ? 92   SER A N   1 
ATOM   742  C CA  . SER A 1 92  ? 7.680  8.000   -28.395 1.00 51.81  ? 92   SER A CA  1 
ATOM   743  C C   . SER A 1 92  ? 8.645  8.027   -27.214 1.00 43.84  ? 92   SER A C   1 
ATOM   744  O O   . SER A 1 92  ? 9.773  8.495   -27.343 1.00 40.07  ? 92   SER A O   1 
ATOM   745  C CB  . SER A 1 92  ? 8.040  6.853   -29.340 1.00 52.52  ? 92   SER A CB  1 
ATOM   746  O OG  . SER A 1 92  ? 8.166  5.629   -28.638 1.00 56.94  ? 92   SER A OG  1 
ATOM   747  N N   . HIS A 1 93  ? 8.204  7.528   -26.063 1.00 34.96  ? 93   HIS A N   1 
ATOM   748  C CA  . HIS A 1 93  ? 9.034  7.585   -24.864 1.00 23.60  ? 93   HIS A CA  1 
ATOM   749  C C   . HIS A 1 93  ? 9.239  6.235   -24.189 1.00 19.28  ? 93   HIS A C   1 
ATOM   750  O O   . HIS A 1 93  ? 8.534  5.264   -24.472 1.00 26.54  ? 93   HIS A O   1 
ATOM   751  C CB  . HIS A 1 93  ? 8.484  8.609   -23.872 1.00 23.59  ? 93   HIS A CB  1 
ATOM   752  C CG  . HIS A 1 93  ? 8.493  10.012  -24.396 1.00 32.24  ? 93   HIS A CG  1 
ATOM   753  N ND1 . HIS A 1 93  ? 7.462  10.530  -25.151 1.00 23.34  ? 93   HIS A ND1 1 
ATOM   754  C CD2 . HIS A 1 93  ? 9.415  10.997  -24.290 1.00 32.84  ? 93   HIS A CD2 1 
ATOM   755  C CE1 . HIS A 1 93  ? 7.744  11.779  -25.477 1.00 27.64  ? 93   HIS A CE1 1 
ATOM   756  N NE2 . HIS A 1 93  ? 8.924  12.086  -24.967 1.00 31.38  ? 93   HIS A NE2 1 
ATOM   757  N N   . THR A 1 94  ? 10.221 6.190   -23.297 1.00 13.64  ? 94   THR A N   1 
ATOM   758  C CA  . THR A 1 94  ? 10.624 4.951   -22.647 1.00 22.17  ? 94   THR A CA  1 
ATOM   759  C C   . THR A 1 94  ? 10.737 5.130   -21.141 1.00 25.42  ? 94   THR A C   1 
ATOM   760  O O   . THR A 1 94  ? 11.352 6.087   -20.662 1.00 21.55  ? 94   THR A O   1 
ATOM   761  C CB  . THR A 1 94  ? 12.002 4.467   -23.158 1.00 21.20  ? 94   THR A CB  1 
ATOM   762  O OG1 . THR A 1 94  ? 11.934 4.177   -24.562 1.00 25.01  ? 94   THR A OG1 1 
ATOM   763  C CG2 . THR A 1 94  ? 12.445 3.222   -22.402 1.00 13.13  ? 94   THR A CG2 1 
ATOM   764  N N   . ILE A 1 95  ? 10.138 4.207   -20.398 1.00 26.32  ? 95   ILE A N   1 
ATOM   765  C CA  . ILE A 1 95  ? 10.398 4.094   -18.970 1.00 21.96  ? 95   ILE A CA  1 
ATOM   766  C C   . ILE A 1 95  ? 11.097 2.769   -18.718 1.00 20.40  ? 95   ILE A C   1 
ATOM   767  O O   . ILE A 1 95  ? 10.728 1.746   -19.296 1.00 19.59  ? 95   ILE A O   1 
ATOM   768  C CB  . ILE A 1 95  ? 9.113  4.175   -18.126 1.00 19.52  ? 95   ILE A CB  1 
ATOM   769  C CG1 . ILE A 1 95  ? 8.549  5.596   -18.161 1.00 29.57  ? 95   ILE A CG1 1 
ATOM   770  C CG2 . ILE A 1 95  ? 9.398  3.775   -16.691 1.00 17.81  ? 95   ILE A CG2 1 
ATOM   771  C CD1 . ILE A 1 95  ? 7.312  5.792   -17.314 1.00 27.98  ? 95   ILE A CD1 1 
ATOM   772  N N   . GLN A 1 96  ? 12.120 2.800   -17.872 1.00 18.36  ? 96   GLN A N   1 
ATOM   773  C CA  . GLN A 1 96  ? 12.855 1.596   -17.512 1.00 16.35  ? 96   GLN A CA  1 
ATOM   774  C C   . GLN A 1 96  ? 12.992 1.503   -16.004 1.00 17.47  ? 96   GLN A C   1 
ATOM   775  O O   . GLN A 1 96  ? 13.372 2.465   -15.343 1.00 22.56  ? 96   GLN A O   1 
ATOM   776  C CB  . GLN A 1 96  ? 14.244 1.598   -18.148 1.00 12.88  ? 96   GLN A CB  1 
ATOM   777  C CG  . GLN A 1 96  ? 14.235 1.678   -19.655 1.00 15.88  ? 96   GLN A CG  1 
ATOM   778  C CD  . GLN A 1 96  ? 15.605 1.968   -20.220 1.00 20.41  ? 96   GLN A CD  1 
ATOM   779  O OE1 . GLN A 1 96  ? 15.851 3.057   -20.735 1.00 19.21  ? 96   GLN A OE1 1 
ATOM   780  N NE2 . GLN A 1 96  ? 16.510 0.994   -20.127 1.00 18.94  ? 96   GLN A NE2 1 
ATOM   781  N N   . ILE A 1 97  ? 12.685 0.334   -15.463 1.00 17.22  ? 97   ILE A N   1 
ATOM   782  C CA  . ILE A 1 97  ? 12.801 0.121   -14.035 1.00 17.04  ? 97   ILE A CA  1 
ATOM   783  C C   . ILE A 1 97  ? 13.633 -1.110  -13.733 1.00 20.46  ? 97   ILE A C   1 
ATOM   784  O O   . ILE A 1 97  ? 13.511 -2.138  -14.396 1.00 21.77  ? 97   ILE A O   1 
ATOM   785  C CB  . ILE A 1 97  ? 11.423 -0.034  -13.373 1.00 21.77  ? 97   ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 97  ? 10.545 1.180   -13.694 1.00 18.99  ? 97   ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 97  ? 11.577 -0.227  -11.866 1.00 21.55  ? 97   ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 97  ? 9.227  1.188   -12.972 1.00 24.65  ? 97   ILE A CD1 1 
ATOM   789  N N   . MET A 1 98  ? 14.490 -0.992  -12.730 1.00 19.11  ? 98   MET A N   1 
ATOM   790  C CA  . MET A 1 98  ? 15.215 -2.140  -12.222 1.00 18.30  ? 98   MET A CA  1 
ATOM   791  C C   . MET A 1 98  ? 15.075 -2.181  -10.706 1.00 16.67  ? 98   MET A C   1 
ATOM   792  O O   . MET A 1 98  ? 15.183 -1.155  -10.038 1.00 13.76  ? 98   MET A O   1 
ATOM   793  C CB  . MET A 1 98  ? 16.694 -2.070  -12.618 1.00 20.22  ? 98   MET A CB  1 
ATOM   794  C CG  . MET A 1 98  ? 17.508 -3.280  -12.170 1.00 26.38  ? 98   MET A CG  1 
ATOM   795  S SD  . MET A 1 98  ? 18.858 -2.902  -11.024 1.00 57.00  ? 98   MET A SD  1 
ATOM   796  C CE  . MET A 1 98  ? 18.004 -2.029  -9.722  1.00 38.77  ? 98   MET A CE  1 
ATOM   797  N N   . TYR A 1 99  ? 14.815 -3.363  -10.164 1.00 18.43  ? 99   TYR A N   1 
ATOM   798  C CA  . TYR A 1 99  ? 14.929 -3.558  -8.727  1.00 20.12  ? 99   TYR A CA  1 
ATOM   799  C C   . TYR A 1 99  ? 15.463 -4.949  -8.413  1.00 15.75  ? 99   TYR A C   1 
ATOM   800  O O   . TYR A 1 99  ? 15.385 -5.850  -9.250  1.00 14.80  ? 99   TYR A O   1 
ATOM   801  C CB  . TYR A 1 99  ? 13.610 -3.264  -8.008  1.00 18.22  ? 99   TYR A CB  1 
ATOM   802  C CG  . TYR A 1 99  ? 12.487 -4.245  -8.251  1.00 17.64  ? 99   TYR A CG  1 
ATOM   803  C CD1 . TYR A 1 99  ? 12.466 -5.474  -7.612  1.00 17.48  ? 99   TYR A CD1 1 
ATOM   804  C CD2 . TYR A 1 99  ? 11.422 -3.921  -9.084  1.00 20.56  ? 99   TYR A CD2 1 
ATOM   805  C CE1 . TYR A 1 99  ? 11.432 -6.367  -7.814  1.00 22.37  ? 99   TYR A CE1 1 
ATOM   806  C CE2 . TYR A 1 99  ? 10.382 -4.807  -9.291  1.00 17.88  ? 99   TYR A CE2 1 
ATOM   807  C CZ  . TYR A 1 99  ? 10.394 -6.030  -8.653  1.00 21.36  ? 99   TYR A CZ  1 
ATOM   808  O OH  . TYR A 1 99  ? 9.366  -6.923  -8.852  1.00 25.02  ? 99   TYR A OH  1 
ATOM   809  N N   . GLY A 1 100 ? 16.032 -5.112  -7.220  1.00 16.25  ? 100  GLY A N   1 
ATOM   810  C CA  . GLY A 1 100 ? 16.626 -6.381  -6.833  1.00 19.73  ? 100  GLY A CA  1 
ATOM   811  C C   . GLY A 1 100 ? 17.439 -6.318  -5.553  1.00 21.31  ? 100  GLY A C   1 
ATOM   812  O O   . GLY A 1 100 ? 17.377 -5.336  -4.816  1.00 26.75  ? 100  GLY A O   1 
ATOM   813  N N   . CYS A 1 101 ? 18.214 -7.367  -5.296  1.00 16.22  ? 101  CYS A N   1 
ATOM   814  C CA  . CYS A 1 101 ? 18.932 -7.495  -4.032  1.00 21.58  ? 101  CYS A CA  1 
ATOM   815  C C   . CYS A 1 101 ? 20.155 -8.406  -4.142  1.00 25.34  ? 101  CYS A C   1 
ATOM   816  O O   . CYS A 1 101 ? 20.181 -9.337  -4.948  1.00 22.77  ? 101  CYS A O   1 
ATOM   817  C CB  . CYS A 1 101 ? 17.993 -8.030  -2.940  1.00 27.88  ? 101  CYS A CB  1 
ATOM   818  S SG  . CYS A 1 101 ? 17.268 -9.669  -3.286  1.00 46.45  ? 101  CYS A SG  1 
ATOM   819  N N   . ASP A 1 102 ? 21.163 -8.131  -3.320  1.00 30.12  ? 102  ASP A N   1 
ATOM   820  C CA  . ASP A 1 102 ? 22.350 -8.977  -3.252  1.00 32.99  ? 102  ASP A CA  1 
ATOM   821  C C   . ASP A 1 102 ? 22.424 -9.690  -1.907  1.00 32.09  ? 102  ASP A C   1 
ATOM   822  O O   . ASP A 1 102 ? 22.093 -9.115  -0.872  1.00 35.01  ? 102  ASP A O   1 
ATOM   823  C CB  . ASP A 1 102 ? 23.622 -8.153  -3.468  1.00 30.95  ? 102  ASP A CB  1 
ATOM   824  C CG  . ASP A 1 102 ? 23.637 -7.441  -4.804  1.00 39.41  ? 102  ASP A CG  1 
ATOM   825  O OD1 . ASP A 1 102 ? 22.824 -7.805  -5.679  1.00 45.81  ? 102  ASP A OD1 1 
ATOM   826  O OD2 . ASP A 1 102 ? 24.465 -6.524  -4.983  1.00 41.01  ? 102  ASP A OD2 1 
ATOM   827  N N   . VAL A 1 103 ? 22.848 -10.947 -1.928  1.00 25.85  ? 103  VAL A N   1 
ATOM   828  C CA  . VAL A 1 103 ? 23.095 -11.678 -0.695  1.00 32.42  ? 103  VAL A CA  1 
ATOM   829  C C   . VAL A 1 103 ? 24.528 -12.183 -0.698  1.00 40.90  ? 103  VAL A C   1 
ATOM   830  O O   . VAL A 1 103 ? 25.145 -12.306 -1.757  1.00 38.61  ? 103  VAL A O   1 
ATOM   831  C CB  . VAL A 1 103 ? 22.128 -12.867 -0.515  1.00 26.15  ? 103  VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 103 ? 20.694 -12.376 -0.472  1.00 22.00  ? 103  VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 103 ? 22.320 -13.888 -1.629  1.00 19.82  ? 103  VAL A CG2 1 
ATOM   834  N N   . GLY A 1 104 ? 25.057 -12.463 0.487   1.00 44.44  ? 104  GLY A N   1 
ATOM   835  C CA  . GLY A 1 104 ? 26.410 -12.971 0.611   1.00 48.26  ? 104  GLY A CA  1 
ATOM   836  C C   . GLY A 1 104 ? 26.451 -14.474 0.431   1.00 52.42  ? 104  GLY A C   1 
ATOM   837  O O   . GLY A 1 104 ? 25.435 -15.097 0.115   1.00 50.63  ? 104  GLY A O   1 
ATOM   838  N N   . SER A 1 105 ? 27.627 -15.060 0.635   1.00 54.56  ? 105  SER A N   1 
ATOM   839  C CA  . SER A 1 105 ? 27.803 -16.499 0.478   1.00 54.14  ? 105  SER A CA  1 
ATOM   840  C C   . SER A 1 105 ? 26.991 -17.289 1.504   1.00 56.46  ? 105  SER A C   1 
ATOM   841  O O   . SER A 1 105 ? 26.639 -18.446 1.268   1.00 52.46  ? 105  SER A O   1 
ATOM   842  C CB  . SER A 1 105 ? 29.285 -16.870 0.562   1.00 54.93  ? 105  SER A CB  1 
ATOM   843  O OG  . SER A 1 105 ? 29.876 -16.325 1.728   1.00 59.59  ? 105  SER A OG  1 
ATOM   844  N N   . ASP A 1 106 ? 26.690 -16.663 2.637   1.00 59.76  ? 106  ASP A N   1 
ATOM   845  C CA  . ASP A 1 106 ? 25.889 -17.311 3.672   1.00 60.49  ? 106  ASP A CA  1 
ATOM   846  C C   . ASP A 1 106 ? 24.418 -16.911 3.576   1.00 54.12  ? 106  ASP A C   1 
ATOM   847  O O   . ASP A 1 106 ? 23.618 -17.236 4.454   1.00 53.35  ? 106  ASP A O   1 
ATOM   848  C CB  . ASP A 1 106 ? 26.435 -16.995 5.066   1.00 66.87  ? 106  ASP A CB  1 
ATOM   849  C CG  . ASP A 1 106 ? 26.110 -15.585 5.517   1.00 71.21  ? 106  ASP A CG  1 
ATOM   850  O OD1 . ASP A 1 106 ? 26.032 -14.682 4.655   1.00 72.90  ? 106  ASP A OD1 1 
ATOM   851  O OD2 . ASP A 1 106 ? 25.929 -15.381 6.736   1.00 71.04  ? 106  ASP A OD2 1 
ATOM   852  N N   . GLY A 1 107 ? 24.071 -16.199 2.508   1.00 49.03  ? 107  GLY A N   1 
ATOM   853  C CA  . GLY A 1 107 ? 22.691 -15.835 2.242   1.00 44.73  ? 107  GLY A CA  1 
ATOM   854  C C   . GLY A 1 107 ? 22.200 -14.650 3.046   1.00 48.64  ? 107  GLY A C   1 
ATOM   855  O O   . GLY A 1 107 ? 20.999 -14.451 3.195   1.00 49.24  ? 107  GLY A O   1 
ATOM   856  N N   . ARG A 1 108 ? 23.127 -13.855 3.566   1.00 54.57  ? 108  ARG A N   1 
ATOM   857  C CA  . ARG A 1 108 ? 22.755 -12.671 4.328   1.00 50.97  ? 108  ARG A CA  1 
ATOM   858  C C   . ARG A 1 108 ? 22.499 -11.495 3.395   1.00 49.14  ? 108  ARG A C   1 
ATOM   859  O O   . ARG A 1 108 ? 23.230 -11.293 2.423   1.00 46.36  ? 108  ARG A O   1 
ATOM   860  C CB  . ARG A 1 108 ? 23.852 -12.306 5.328   1.00 47.04  ? 108  ARG A CB  1 
ATOM   861  C CG  . ARG A 1 108 ? 25.080 -11.671 4.695   1.00 46.31  ? 108  ARG A CG  1 
ATOM   862  C CD  . ARG A 1 108 ? 26.078 -11.264 5.759   1.00 51.76  ? 108  ARG A CD  1 
ATOM   863  N NE  . ARG A 1 108 ? 26.466 -12.405 6.583   1.00 55.91  ? 108  ARG A NE  1 
ATOM   864  C CZ  . ARG A 1 108 ? 26.942 -12.311 7.820   1.00 45.92  ? 108  ARG A CZ  1 
ATOM   865  N NH1 . ARG A 1 108 ? 27.085 -11.122 8.391   1.00 44.30  ? 108  ARG A NH1 1 
ATOM   866  N NH2 . ARG A 1 108 ? 27.268 -13.409 8.488   1.00 35.51  ? 108  ARG A NH2 1 
ATOM   867  N N   . PHE A 1 109 ? 21.459 -10.724 3.694   1.00 45.18  ? 109  PHE A N   1 
ATOM   868  C CA  . PHE A 1 109 ? 21.157 -9.525  2.926   1.00 39.25  ? 109  PHE A CA  1 
ATOM   869  C C   . PHE A 1 109 ? 22.397 -8.651  2.804   1.00 34.40  ? 109  PHE A C   1 
ATOM   870  O O   . PHE A 1 109 ? 23.150 -8.495  3.761   1.00 43.92  ? 109  PHE A O   1 
ATOM   871  C CB  . PHE A 1 109 ? 20.024 -8.734  3.582   1.00 39.83  ? 109  PHE A CB  1 
ATOM   872  C CG  . PHE A 1 109 ? 19.760 -7.406  2.933   1.00 39.82  ? 109  PHE A CG  1 
ATOM   873  C CD1 . PHE A 1 109 ? 20.279 -6.240  3.474   1.00 39.08  ? 109  PHE A CD1 1 
ATOM   874  C CD2 . PHE A 1 109 ? 19.003 -7.325  1.774   1.00 38.32  ? 109  PHE A CD2 1 
ATOM   875  C CE1 . PHE A 1 109 ? 20.039 -5.014  2.875   1.00 42.72  ? 109  PHE A CE1 1 
ATOM   876  C CE2 . PHE A 1 109 ? 18.759 -6.104  1.170   1.00 40.35  ? 109  PHE A CE2 1 
ATOM   877  C CZ  . PHE A 1 109 ? 19.277 -4.947  1.721   1.00 42.96  ? 109  PHE A CZ  1 
ATOM   878  N N   . LEU A 1 110 ? 22.600 -8.081  1.622   1.00 31.31  ? 110  LEU A N   1 
ATOM   879  C CA  . LEU A 1 110 ? 23.763 -7.245  1.359   1.00 30.87  ? 110  LEU A CA  1 
ATOM   880  C C   . LEU A 1 110 ? 23.344 -5.856  0.883   1.00 35.86  ? 110  LEU A C   1 
ATOM   881  O O   . LEU A 1 110 ? 23.699 -4.848  1.497   1.00 39.49  ? 110  LEU A O   1 
ATOM   882  C CB  . LEU A 1 110 ? 24.668 -7.911  0.317   1.00 28.22  ? 110  LEU A CB  1 
ATOM   883  C CG  . LEU A 1 110 ? 26.079 -8.333  0.740   1.00 36.24  ? 110  LEU A CG  1 
ATOM   884  C CD1 . LEU A 1 110 ? 26.067 -9.063  2.077   1.00 32.52  ? 110  LEU A CD1 1 
ATOM   885  C CD2 . LEU A 1 110 ? 26.711 -9.204  -0.338  1.00 37.07  ? 110  LEU A CD2 1 
ATOM   886  N N   . ARG A 1 111 ? 22.588 -5.810  -0.211  1.00 34.61  ? 111  ARG A N   1 
ATOM   887  C CA  . ARG A 1 111 ? 22.162 -4.547  -0.805  1.00 28.46  ? 111  ARG A CA  1 
ATOM   888  C C   . ARG A 1 111 ? 20.792 -4.668  -1.449  1.00 30.88  ? 111  ARG A C   1 
ATOM   889  O O   . ARG A 1 111 ? 20.442 -5.711  -1.998  1.00 28.04  ? 111  ARG A O   1 
ATOM   890  C CB  . ARG A 1 111 ? 23.164 -4.077  -1.862  1.00 32.01  ? 111  ARG A CB  1 
ATOM   891  C CG  . ARG A 1 111 ? 24.493 -3.617  -1.307  1.00 50.86  ? 111  ARG A CG  1 
ATOM   892  C CD  . ARG A 1 111 ? 25.496 -3.378  -2.426  1.00 65.76  ? 111  ARG A CD  1 
ATOM   893  N NE  . ARG A 1 111 ? 25.867 -4.614  -3.116  1.00 71.28  ? 111  ARG A NE  1 
ATOM   894  C CZ  . ARG A 1 111 ? 26.918 -5.367  -2.797  1.00 68.10  ? 111  ARG A CZ  1 
ATOM   895  N NH1 . ARG A 1 111 ? 27.176 -6.473  -3.485  1.00 57.91  ? 111  ARG A NH1 1 
ATOM   896  N NH2 . ARG A 1 111 ? 27.712 -5.017  -1.793  1.00 70.73  ? 111  ARG A NH2 1 
ATOM   897  N N   . GLY A 1 112 ? 20.029 -3.582  -1.388  1.00 29.09  ? 112  GLY A N   1 
ATOM   898  C CA  . GLY A 1 112 ? 18.746 -3.502  -2.054  1.00 24.19  ? 112  GLY A CA  1 
ATOM   899  C C   . GLY A 1 112 ? 18.803 -2.431  -3.121  1.00 30.98  ? 112  GLY A C   1 
ATOM   900  O O   . GLY A 1 112 ? 19.495 -1.427  -2.955  1.00 32.83  ? 112  GLY A O   1 
ATOM   901  N N   . TYR A 1 113 ? 18.076 -2.642  -4.215  1.00 31.47  ? 113  TYR A N   1 
ATOM   902  C CA  . TYR A 1 113 ? 18.127 -1.738  -5.358  1.00 27.29  ? 113  TYR A CA  1 
ATOM   903  C C   . TYR A 1 113 ? 16.745 -1.385  -5.884  1.00 28.36  ? 113  TYR A C   1 
ATOM   904  O O   . TYR A 1 113 ? 15.847 -2.225  -5.911  1.00 31.70  ? 113  TYR A O   1 
ATOM   905  C CB  . TYR A 1 113 ? 18.897 -2.383  -6.514  1.00 32.99  ? 113  TYR A CB  1 
ATOM   906  C CG  . TYR A 1 113 ? 20.313 -2.792  -6.211  1.00 35.21  ? 113  TYR A CG  1 
ATOM   907  C CD1 . TYR A 1 113 ? 21.348 -1.871  -6.281  1.00 48.25  ? 113  TYR A CD1 1 
ATOM   908  C CD2 . TYR A 1 113 ? 20.622 -4.109  -5.888  1.00 28.18  ? 113  TYR A CD2 1 
ATOM   909  C CE1 . TYR A 1 113 ? 22.650 -2.242  -6.018  1.00 60.66  ? 113  TYR A CE1 1 
ATOM   910  C CE2 . TYR A 1 113 ? 21.919 -4.490  -5.623  1.00 41.15  ? 113  TYR A CE2 1 
ATOM   911  C CZ  . TYR A 1 113 ? 22.933 -3.552  -5.689  1.00 62.26  ? 113  TYR A CZ  1 
ATOM   912  O OH  . TYR A 1 113 ? 24.237 -3.918  -5.426  1.00 69.58  ? 113  TYR A OH  1 
ATOM   913  N N   . ARG A 1 114 ? 16.588 -0.142  -6.325  1.00 22.50  ? 114  ARG A N   1 
ATOM   914  C CA  . ARG A 1 114 ? 15.456 0.222   -7.164  1.00 19.93  ? 114  ARG A CA  1 
ATOM   915  C C   . ARG A 1 114 ? 15.694 1.560   -7.845  1.00 20.27  ? 114  ARG A C   1 
ATOM   916  O O   . ARG A 1 114 ? 15.735 2.600   -7.195  1.00 28.06  ? 114  ARG A O   1 
ATOM   917  C CB  . ARG A 1 114 ? 14.140 0.230   -6.390  1.00 17.07  ? 114  ARG A CB  1 
ATOM   918  C CG  . ARG A 1 114 ? 12.927 0.174   -7.308  1.00 25.93  ? 114  ARG A CG  1 
ATOM   919  C CD  . ARG A 1 114 ? 12.036 1.379   -7.105  1.00 38.92  ? 114  ARG A CD  1 
ATOM   920  N NE  . ARG A 1 114 ? 11.168 1.651   -8.249  1.00 40.18  ? 114  ARG A NE  1 
ATOM   921  C CZ  . ARG A 1 114 ? 9.950  1.143   -8.404  1.00 41.77  ? 114  ARG A CZ  1 
ATOM   922  N NH1 . ARG A 1 114 ? 9.227  1.460   -9.471  1.00 35.92  ? 114  ARG A NH1 1 
ATOM   923  N NH2 . ARG A 1 114 ? 9.455  0.315   -7.493  1.00 45.15  ? 114  ARG A NH2 1 
ATOM   924  N N   . GLN A 1 115 ? 15.857 1.514   -9.164  1.00 19.22  ? 115  GLN A N   1 
ATOM   925  C CA  . GLN A 1 115 ? 16.180 2.692   -9.955  1.00 17.08  ? 115  GLN A CA  1 
ATOM   926  C C   . GLN A 1 115 ? 15.232 2.807   -11.146 1.00 19.48  ? 115  GLN A C   1 
ATOM   927  O O   . GLN A 1 115 ? 14.867 1.802   -11.757 1.00 21.70  ? 115  GLN A O   1 
ATOM   928  C CB  . GLN A 1 115 ? 17.631 2.615   -10.431 1.00 19.99  ? 115  GLN A CB  1 
ATOM   929  C CG  . GLN A 1 115 ? 18.649 2.730   -9.302  1.00 40.07  ? 115  GLN A CG  1 
ATOM   930  C CD  . GLN A 1 115 ? 19.788 1.725   -9.414  1.00 43.27  ? 115  GLN A CD  1 
ATOM   931  O OE1 . GLN A 1 115 ? 20.053 1.181   -10.486 1.00 36.50  ? 115  GLN A OE1 1 
ATOM   932  N NE2 . GLN A 1 115 ? 20.465 1.472   -8.297  1.00 44.67  ? 115  GLN A NE2 1 
ATOM   933  N N   . ASP A 1 116 ? 14.825 4.032   -11.459 1.00 22.87  ? 116  ASP A N   1 
ATOM   934  C CA  . ASP A 1 116 ? 13.911 4.284   -12.571 1.00 24.38  ? 116  ASP A CA  1 
ATOM   935  C C   . ASP A 1 116 ? 14.573 5.241   -13.551 1.00 24.27  ? 116  ASP A C   1 
ATOM   936  O O   . ASP A 1 116 ? 15.366 6.094   -13.153 1.00 27.98  ? 116  ASP A O   1 
ATOM   937  C CB  . ASP A 1 116 ? 12.597 4.900   -12.075 1.00 26.36  ? 116  ASP A CB  1 
ATOM   938  C CG  . ASP A 1 116 ? 11.825 3.988   -11.125 1.00 36.83  ? 116  ASP A CG  1 
ATOM   939  O OD1 . ASP A 1 116 ? 12.442 3.283   -10.301 1.00 32.28  ? 116  ASP A OD1 1 
ATOM   940  O OD2 . ASP A 1 116 ? 10.579 3.989   -11.195 1.00 48.40  ? 116  ASP A OD2 1 
ATOM   941  N N   . ALA A 1 117 ? 14.245 5.100   -14.829 1.00 21.08  ? 117  ALA A N   1 
ATOM   942  C CA  . ALA A 1 117 ? 14.787 5.981   -15.854 1.00 19.90  ? 117  ALA A CA  1 
ATOM   943  C C   . ALA A 1 117 ? 13.690 6.436   -16.800 1.00 21.34  ? 117  ALA A C   1 
ATOM   944  O O   . ALA A 1 117 ? 12.701 5.737   -16.998 1.00 17.33  ? 117  ALA A O   1 
ATOM   945  C CB  . ALA A 1 117 ? 15.877 5.280   -16.627 1.00 17.93  ? 117  ALA A CB  1 
ATOM   946  N N   . TYR A 1 118 ? 13.870 7.615   -17.379 1.00 25.69  ? 118  TYR A N   1 
ATOM   947  C CA  . TYR A 1 118 ? 12.941 8.116   -18.382 1.00 28.13  ? 118  TYR A CA  1 
ATOM   948  C C   . TYR A 1 118 ? 13.706 8.604   -19.607 1.00 30.32  ? 118  TYR A C   1 
ATOM   949  O O   . TYR A 1 118 ? 14.533 9.514   -19.512 1.00 29.88  ? 118  TYR A O   1 
ATOM   950  C CB  . TYR A 1 118 ? 12.073 9.236   -17.809 1.00 14.85  ? 118  TYR A CB  1 
ATOM   951  C CG  . TYR A 1 118 ? 10.981 9.700   -18.745 1.00 13.52  ? 118  TYR A CG  1 
ATOM   952  C CD1 . TYR A 1 118 ? 10.044 8.806   -19.249 1.00 15.81  ? 118  TYR A CD1 1 
ATOM   953  C CD2 . TYR A 1 118 ? 10.874 11.036  -19.111 1.00 18.34  ? 118  TYR A CD2 1 
ATOM   954  C CE1 . TYR A 1 118 ? 9.032  9.230   -20.104 1.00 19.52  ? 118  TYR A CE1 1 
ATOM   955  C CE2 . TYR A 1 118 ? 9.868  11.471  -19.961 1.00 21.90  ? 118  TYR A CE2 1 
ATOM   956  C CZ  . TYR A 1 118 ? 8.949  10.566  -20.455 1.00 24.47  ? 118  TYR A CZ  1 
ATOM   957  O OH  . TYR A 1 118 ? 7.948  11.001  -21.302 1.00 22.47  ? 118  TYR A OH  1 
ATOM   958  N N   . ASP A 1 119 ? 13.430 7.988   -20.752 1.00 23.26  ? 119  ASP A N   1 
ATOM   959  C CA  . ASP A 1 119 ? 14.137 8.309   -21.984 1.00 25.72  ? 119  ASP A CA  1 
ATOM   960  C C   . ASP A 1 119 ? 15.641 8.078   -21.861 1.00 28.45  ? 119  ASP A C   1 
ATOM   961  O O   . ASP A 1 119 ? 16.434 8.786   -22.479 1.00 32.99  ? 119  ASP A O   1 
ATOM   962  C CB  . ASP A 1 119 ? 13.849 9.749   -22.410 1.00 27.74  ? 119  ASP A CB  1 
ATOM   963  C CG  . ASP A 1 119 ? 12.428 9.933   -22.891 1.00 31.56  ? 119  ASP A CG  1 
ATOM   964  O OD1 . ASP A 1 119 ? 11.860 8.940   -23.386 1.00 21.32  ? 119  ASP A OD1 1 
ATOM   965  O OD2 . ASP A 1 119 ? 11.882 11.056  -22.773 1.00 37.42  ? 119  ASP A OD2 1 
ATOM   966  N N   . GLY A 1 120 ? 16.025 7.086   -21.059 1.00 29.77  ? 120  GLY A N   1 
ATOM   967  C CA  . GLY A 1 120 ? 17.422 6.706   -20.918 1.00 21.74  ? 120  GLY A CA  1 
ATOM   968  C C   . GLY A 1 120 ? 18.213 7.592   -19.974 1.00 26.34  ? 120  GLY A C   1 
ATOM   969  O O   . GLY A 1 120 ? 19.444 7.582   -19.981 1.00 33.64  ? 120  GLY A O   1 
ATOM   970  N N   . LYS A 1 121 ? 17.507 8.367   -19.160 1.00 29.40  ? 121  LYS A N   1 
ATOM   971  C CA  . LYS A 1 121 ? 18.155 9.210   -18.165 1.00 33.07  ? 121  LYS A CA  1 
ATOM   972  C C   . LYS A 1 121 ? 17.599 8.919   -16.780 1.00 34.27  ? 121  LYS A C   1 
ATOM   973  O O   . LYS A 1 121 ? 16.396 8.696   -16.619 1.00 32.93  ? 121  LYS A O   1 
ATOM   974  C CB  . LYS A 1 121 ? 17.971 10.692  -18.497 1.00 38.33  ? 121  LYS A CB  1 
ATOM   975  C CG  . LYS A 1 121 ? 18.813 11.184  -19.662 1.00 50.09  ? 121  LYS A CG  1 
ATOM   976  C CD  . LYS A 1 121 ? 18.556 12.660  -19.938 1.00 60.66  ? 121  LYS A CD  1 
ATOM   977  C CE  . LYS A 1 121 ? 17.160 12.894  -20.507 1.00 66.63  ? 121  LYS A CE  1 
ATOM   978  N NZ  . LYS A 1 121 ? 17.026 12.382  -21.905 1.00 66.17  ? 121  LYS A NZ  1 
ATOM   979  N N   . ASP A 1 122 ? 18.483 8.915   -15.787 1.00 31.56  ? 122  ASP A N   1 
ATOM   980  C CA  . ASP A 1 122 ? 18.074 8.733   -14.401 1.00 29.02  ? 122  ASP A CA  1 
ATOM   981  C C   . ASP A 1 122 ? 16.825 9.552   -14.121 1.00 28.69  ? 122  ASP A C   1 
ATOM   982  O O   . ASP A 1 122 ? 16.731 10.707  -14.526 1.00 31.59  ? 122  ASP A O   1 
ATOM   983  C CB  . ASP A 1 122 ? 19.193 9.156   -13.446 1.00 30.90  ? 122  ASP A CB  1 
ATOM   984  C CG  . ASP A 1 122 ? 20.283 8.107   -13.315 1.00 38.10  ? 122  ASP A CG  1 
ATOM   985  O OD1 . ASP A 1 122 ? 20.330 7.177   -14.146 1.00 36.22  ? 122  ASP A OD1 1 
ATOM   986  O OD2 . ASP A 1 122 ? 21.101 8.216   -12.376 1.00 45.92  ? 122  ASP A OD2 1 
ATOM   987  N N   . TYR A 1 123 ? 15.858 8.944   -13.444 1.00 32.10  ? 123  TYR A N   1 
ATOM   988  C CA  . TYR A 1 123 ? 14.665 9.662   -13.017 1.00 29.27  ? 123  TYR A CA  1 
ATOM   989  C C   . TYR A 1 123 ? 14.625 9.723   -11.494 1.00 31.64  ? 123  TYR A C   1 
ATOM   990  O O   . TYR A 1 123 ? 14.814 10.784  -10.896 1.00 33.23  ? 123  TYR A O   1 
ATOM   991  C CB  . TYR A 1 123 ? 13.394 9.001   -13.563 1.00 23.22  ? 123  TYR A CB  1 
ATOM   992  C CG  . TYR A 1 123 ? 12.133 9.773   -13.245 1.00 22.86  ? 123  TYR A CG  1 
ATOM   993  C CD1 . TYR A 1 123 ? 11.761 10.873  -14.004 1.00 21.30  ? 123  TYR A CD1 1 
ATOM   994  C CD2 . TYR A 1 123 ? 11.318 9.406   -12.183 1.00 22.97  ? 123  TYR A CD2 1 
ATOM   995  C CE1 . TYR A 1 123 ? 10.613 11.588  -13.717 1.00 22.23  ? 123  TYR A CE1 1 
ATOM   996  C CE2 . TYR A 1 123 ? 10.167 10.116  -11.888 1.00 29.87  ? 123  TYR A CE2 1 
ATOM   997  C CZ  . TYR A 1 123 ? 9.819  11.207  -12.659 1.00 24.59  ? 123  TYR A CZ  1 
ATOM   998  O OH  . TYR A 1 123 ? 8.677  11.923  -12.370 1.00 18.93  ? 123  TYR A OH  1 
ATOM   999  N N   . ILE A 1 124 ? 14.386 8.573   -10.873 1.00 26.43  ? 124  ILE A N   1 
ATOM   1000 C CA  . ILE A 1 124 ? 14.367 8.481   -9.421  1.00 16.66  ? 124  ILE A CA  1 
ATOM   1001 C C   . ILE A 1 124 ? 14.940 7.139   -8.969  1.00 17.88  ? 124  ILE A C   1 
ATOM   1002 O O   . ILE A 1 124 ? 14.864 6.144   -9.692  1.00 19.75  ? 124  ILE A O   1 
ATOM   1003 C CB  . ILE A 1 124 ? 12.944 8.691   -8.856  1.00 22.85  ? 124  ILE A CB  1 
ATOM   1004 C CG1 . ILE A 1 124 ? 12.994 8.926   -7.344  1.00 27.29  ? 124  ILE A CG1 1 
ATOM   1005 C CG2 . ILE A 1 124 ? 12.042 7.513   -9.205  1.00 25.73  ? 124  ILE A CG2 1 
ATOM   1006 C CD1 . ILE A 1 124 ? 11.688 9.413   -6.759  1.00 18.87  ? 124  ILE A CD1 1 
ATOM   1007 N N   . ALA A 1 125 ? 15.530 7.125   -7.780  1.00 19.96  ? 125  ALA A N   1 
ATOM   1008 C CA  . ALA A 1 125 ? 16.148 5.917   -7.250  1.00 16.48  ? 125  ALA A CA  1 
ATOM   1009 C C   . ALA A 1 125 ? 16.060 5.871   -5.733  1.00 19.87  ? 125  ALA A C   1 
ATOM   1010 O O   . ALA A 1 125 ? 16.121 6.903   -5.066  1.00 27.35  ? 125  ALA A O   1 
ATOM   1011 C CB  . ALA A 1 125 ? 17.591 5.832   -7.691  1.00 14.22  ? 125  ALA A CB  1 
ATOM   1012 N N   . LEU A 1 126 ? 15.909 4.668   -5.195  1.00 24.61  ? 126  LEU A N   1 
ATOM   1013 C CA  . LEU A 1 126 ? 15.942 4.464   -3.755  1.00 29.55  ? 126  LEU A CA  1 
ATOM   1014 C C   . LEU A 1 126 ? 17.394 4.441   -3.296  1.00 33.77  ? 126  LEU A C   1 
ATOM   1015 O O   . LEU A 1 126 ? 18.215 3.725   -3.869  1.00 41.44  ? 126  LEU A O   1 
ATOM   1016 C CB  . LEU A 1 126 ? 15.263 3.143   -3.393  1.00 27.15  ? 126  LEU A CB  1 
ATOM   1017 C CG  . LEU A 1 126 ? 14.994 2.896   -1.907  1.00 27.89  ? 126  LEU A CG  1 
ATOM   1018 C CD1 . LEU A 1 126 ? 14.029 3.937   -1.364  1.00 24.98  ? 126  LEU A CD1 1 
ATOM   1019 C CD2 . LEU A 1 126 ? 14.446 1.497   -1.694  1.00 27.88  ? 126  LEU A CD2 1 
ATOM   1020 N N   . ASN A 1 127 ? 17.712 5.230   -2.274  1.00 31.41  ? 127  ASN A N   1 
ATOM   1021 C CA  . ASN A 1 127 ? 19.063 5.251   -1.721  1.00 29.75  ? 127  ASN A CA  1 
ATOM   1022 C C   . ASN A 1 127 ? 19.407 3.944   -1.012  1.00 39.84  ? 127  ASN A C   1 
ATOM   1023 O O   . ASN A 1 127 ? 18.548 3.082   -0.833  1.00 49.48  ? 127  ASN A O   1 
ATOM   1024 C CB  . ASN A 1 127 ? 19.246 6.439   -0.770  1.00 30.39  ? 127  ASN A CB  1 
ATOM   1025 C CG  . ASN A 1 127 ? 19.051 7.774   -1.461  1.00 36.10  ? 127  ASN A CG  1 
ATOM   1026 O OD1 . ASN A 1 127 ? 18.494 8.714   -0.886  1.00 36.58  ? 127  ASN A OD1 1 
ATOM   1027 N ND2 . ASN A 1 127 ? 19.499 7.861   -2.707  1.00 36.48  ? 127  ASN A ND2 1 
ATOM   1028 N N   . GLU A 1 128 ? 20.662 3.800   -0.604  1.00 44.77  ? 128  GLU A N   1 
ATOM   1029 C CA  . GLU A 1 128 ? 21.123 2.548   -0.015  1.00 43.21  ? 128  GLU A CA  1 
ATOM   1030 C C   . GLU A 1 128 ? 20.468 2.230   1.330   1.00 36.01  ? 128  GLU A C   1 
ATOM   1031 O O   . GLU A 1 128 ? 20.341 1.063   1.702   1.00 31.51  ? 128  GLU A O   1 
ATOM   1032 C CB  . GLU A 1 128 ? 22.646 2.532   0.113   1.00 52.95  ? 128  GLU A CB  1 
ATOM   1033 C CG  . GLU A 1 128 ? 23.193 1.184   0.547   1.00 69.06  ? 128  GLU A CG  1 
ATOM   1034 C CD  . GLU A 1 128 ? 24.688 1.058   0.349   1.00 74.12  ? 128  GLU A CD  1 
ATOM   1035 O OE1 . GLU A 1 128 ? 25.372 2.100   0.257   1.00 73.93  ? 128  GLU A OE1 1 
ATOM   1036 O OE2 . GLU A 1 128 ? 25.174 -0.092  0.280   1.00 76.01  ? 128  GLU A OE2 1 
ATOM   1037 N N   . ASP A 1 129 ? 20.046 3.262   2.055   1.00 31.60  ? 129  ASP A N   1 
ATOM   1038 C CA  . ASP A 1 129 ? 19.389 3.048   3.343   1.00 28.42  ? 129  ASP A CA  1 
ATOM   1039 C C   . ASP A 1 129 ? 17.996 2.439   3.187   1.00 34.86  ? 129  ASP A C   1 
ATOM   1040 O O   . ASP A 1 129 ? 17.410 1.961   4.160   1.00 38.92  ? 129  ASP A O   1 
ATOM   1041 C CB  . ASP A 1 129 ? 19.322 4.346   4.155   1.00 29.77  ? 129  ASP A CB  1 
ATOM   1042 C CG  . ASP A 1 129 ? 18.564 5.451   3.442   1.00 38.41  ? 129  ASP A CG  1 
ATOM   1043 O OD1 . ASP A 1 129 ? 17.802 5.150   2.498   1.00 44.74  ? 129  ASP A OD1 1 
ATOM   1044 O OD2 . ASP A 1 129 ? 18.726 6.627   3.834   1.00 38.87  ? 129  ASP A OD2 1 
ATOM   1045 N N   . LEU A 1 130 ? 17.478 2.456   1.959   1.00 35.77  ? 130  LEU A N   1 
ATOM   1046 C CA  . LEU A 1 130 ? 16.152 1.920   1.658   1.00 29.50  ? 130  LEU A CA  1 
ATOM   1047 C C   . LEU A 1 130 ? 15.058 2.683   2.400   1.00 30.50  ? 130  LEU A C   1 
ATOM   1048 O O   . LEU A 1 130 ? 14.026 2.119   2.758   1.00 33.82  ? 130  LEU A O   1 
ATOM   1049 C CB  . LEU A 1 130 ? 16.082 0.430   1.999   1.00 26.40  ? 130  LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 130 ? 17.182 -0.440  1.382   1.00 33.72  ? 130  LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 130 ? 17.075 -1.873  1.878   1.00 29.46  ? 130  LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 130 ? 17.143 -0.387  -0.143  1.00 33.23  ? 130  LEU A CD2 1 
ATOM   1053 N N   . ARG A 1 131 ? 15.288 3.972   2.622   1.00 33.86  ? 131  ARG A N   1 
ATOM   1054 C CA  . ARG A 1 131 ? 14.356 4.799   3.382   1.00 40.47  ? 131  ARG A CA  1 
ATOM   1055 C C   . ARG A 1 131 ? 14.161 6.182   2.759   1.00 43.21  ? 131  ARG A C   1 
ATOM   1056 O O   . ARG A 1 131 ? 13.240 6.912   3.126   1.00 42.00  ? 131  ARG A O   1 
ATOM   1057 C CB  . ARG A 1 131 ? 14.828 4.940   4.832   1.00 32.03  ? 131  ARG A CB  1 
ATOM   1058 C CG  . ARG A 1 131 ? 14.750 3.655   5.639   1.00 33.74  ? 131  ARG A CG  1 
ATOM   1059 C CD  . ARG A 1 131 ? 15.076 3.920   7.095   1.00 40.08  ? 131  ARG A CD  1 
ATOM   1060 N NE  . ARG A 1 131 ? 14.407 5.124   7.573   1.00 40.31  ? 131  ARG A NE  1 
ATOM   1061 C CZ  . ARG A 1 131 ? 14.576 5.644   8.784   1.00 42.67  ? 131  ARG A CZ  1 
ATOM   1062 N NH1 . ARG A 1 131 ? 13.924 6.747   9.131   1.00 43.69  ? 131  ARG A NH1 1 
ATOM   1063 N NH2 . ARG A 1 131 ? 15.394 5.060   9.647   1.00 40.66  ? 131  ARG A NH2 1 
ATOM   1064 N N   . SER A 1 132 ? 15.031 6.535   1.818   1.00 38.08  ? 132  SER A N   1 
ATOM   1065 C CA  . SER A 1 132 ? 14.960 7.834   1.159   1.00 39.63  ? 132  SER A CA  1 
ATOM   1066 C C   . SER A 1 132 ? 15.202 7.706   -0.346  1.00 36.36  ? 132  SER A C   1 
ATOM   1067 O O   . SER A 1 132 ? 15.727 6.693   -0.816  1.00 28.75  ? 132  SER A O   1 
ATOM   1068 C CB  . SER A 1 132 ? 15.964 8.810   1.782   1.00 37.58  ? 132  SER A CB  1 
ATOM   1069 O OG  . SER A 1 132 ? 17.283 8.295   1.733   1.00 42.12  ? 132  SER A OG  1 
ATOM   1070 N N   . TRP A 1 133 ? 14.813 8.733   -1.096  1.00 28.53  ? 133  TRP A N   1 
ATOM   1071 C CA  . TRP A 1 133 ? 14.952 8.708   -2.547  1.00 28.82  ? 133  TRP A CA  1 
ATOM   1072 C C   . TRP A 1 133 ? 15.848 9.829   -3.050  1.00 32.66  ? 133  TRP A C   1 
ATOM   1073 O O   . TRP A 1 133 ? 16.066 10.824  -2.361  1.00 35.35  ? 133  TRP A O   1 
ATOM   1074 C CB  . TRP A 1 133 ? 13.589 8.836   -3.228  1.00 22.26  ? 133  TRP A CB  1 
ATOM   1075 C CG  . TRP A 1 133 ? 12.532 7.920   -2.707  1.00 22.43  ? 133  TRP A CG  1 
ATOM   1076 C CD1 . TRP A 1 133 ? 11.752 8.114   -1.604  1.00 20.98  ? 133  TRP A CD1 1 
ATOM   1077 C CD2 . TRP A 1 133 ? 12.107 6.678   -3.286  1.00 26.28  ? 133  TRP A CD2 1 
ATOM   1078 N NE1 . TRP A 1 133 ? 10.876 7.067   -1.453  1.00 26.11  ? 133  TRP A NE1 1 
ATOM   1079 C CE2 . TRP A 1 133 ? 11.071 6.172   -2.472  1.00 24.89  ? 133  TRP A CE2 1 
ATOM   1080 C CE3 . TRP A 1 133 ? 12.504 5.942   -4.408  1.00 29.82  ? 133  TRP A CE3 1 
ATOM   1081 C CZ2 . TRP A 1 133 ? 10.432 4.962   -2.742  1.00 21.24  ? 133  TRP A CZ2 1 
ATOM   1082 C CZ3 . TRP A 1 133 ? 11.866 4.741   -4.675  1.00 28.62  ? 133  TRP A CZ3 1 
ATOM   1083 C CH2 . TRP A 1 133 ? 10.841 4.264   -3.846  1.00 26.10  ? 133  TRP A CH2 1 
ATOM   1084 N N   . THR A 1 134 ? 16.358 9.656   -4.264  1.00 34.05  ? 134  THR A N   1 
ATOM   1085 C CA  . THR A 1 134 ? 17.091 10.705  -4.959  1.00 30.31  ? 134  THR A CA  1 
ATOM   1086 C C   . THR A 1 134 ? 16.397 11.003  -6.282  1.00 32.05  ? 134  THR A C   1 
ATOM   1087 O O   . THR A 1 134 ? 16.207 10.106  -7.105  1.00 31.92  ? 134  THR A O   1 
ATOM   1088 C CB  . THR A 1 134 ? 18.552 10.287  -5.240  1.00 26.17  ? 134  THR A CB  1 
ATOM   1089 O OG1 . THR A 1 134 ? 19.253 10.139  -4.002  1.00 37.31  ? 134  THR A OG1 1 
ATOM   1090 C CG2 . THR A 1 134 ? 19.267 11.329  -6.101  1.00 15.23  ? 134  THR A CG2 1 
ATOM   1091 N N   . ALA A 1 135 ? 16.006 12.258  -6.477  1.00 29.45  ? 135  ALA A N   1 
ATOM   1092 C CA  . ALA A 1 135 ? 15.424 12.695  -7.742  1.00 27.36  ? 135  ALA A CA  1 
ATOM   1093 C C   . ALA A 1 135 ? 16.519 13.247  -8.659  1.00 35.36  ? 135  ALA A C   1 
ATOM   1094 O O   . ALA A 1 135 ? 17.484 13.852  -8.187  1.00 40.15  ? 135  ALA A O   1 
ATOM   1095 C CB  . ALA A 1 135 ? 14.346 13.746  -7.497  1.00 15.34  ? 135  ALA A CB  1 
ATOM   1096 N N   . ALA A 1 136 ? 16.371 13.034  -9.964  1.00 28.21  ? 136  ALA A N   1 
ATOM   1097 C CA  . ALA A 1 136 ? 17.377 13.477  -10.925 1.00 28.09  ? 136  ALA A CA  1 
ATOM   1098 C C   . ALA A 1 136 ? 17.068 14.864  -11.483 1.00 40.17  ? 136  ALA A C   1 
ATOM   1099 O O   . ALA A 1 136 ? 17.979 15.642  -11.772 1.00 48.70  ? 136  ALA A O   1 
ATOM   1100 C CB  . ALA A 1 136 ? 17.519 12.471  -12.048 1.00 27.03  ? 136  ALA A CB  1 
ATOM   1101 N N   . ASP A 1 137 ? 15.784 15.167  -11.641 1.00 38.27  ? 137  ASP A N   1 
ATOM   1102 C CA  . ASP A 1 137 ? 15.360 16.492  -12.087 1.00 36.93  ? 137  ASP A CA  1 
ATOM   1103 C C   . ASP A 1 137 ? 14.149 16.967  -11.293 1.00 34.07  ? 137  ASP A C   1 
ATOM   1104 O O   . ASP A 1 137 ? 13.690 16.274  -10.386 1.00 34.95  ? 137  ASP A O   1 
ATOM   1105 C CB  . ASP A 1 137 ? 15.070 16.512  -13.595 1.00 39.26  ? 137  ASP A CB  1 
ATOM   1106 C CG  . ASP A 1 137 ? 14.042 15.469  -14.019 1.00 45.37  ? 137  ASP A CG  1 
ATOM   1107 O OD1 . ASP A 1 137 ? 13.144 15.133  -13.215 1.00 43.69  ? 137  ASP A OD1 1 
ATOM   1108 O OD2 . ASP A 1 137 ? 14.134 14.989  -15.170 1.00 48.22  ? 137  ASP A OD2 1 
ATOM   1109 N N   . MET A 1 138 ? 13.630 18.142  -11.641 1.00 33.32  ? 138  MET A N   1 
ATOM   1110 C CA  . MET A 1 138 ? 12.521 18.734  -10.895 1.00 33.53  ? 138  MET A CA  1 
ATOM   1111 C C   . MET A 1 138 ? 11.192 18.014  -11.109 1.00 37.71  ? 138  MET A C   1 
ATOM   1112 O O   . MET A 1 138 ? 10.265 18.165  -10.312 1.00 44.73  ? 138  MET A O   1 
ATOM   1113 C CB  . MET A 1 138 ? 12.391 20.231  -11.194 1.00 31.49  ? 138  MET A CB  1 
ATOM   1114 C CG  . MET A 1 138 ? 13.232 21.114  -10.271 1.00 34.09  ? 138  MET A CG  1 
ATOM   1115 S SD  . MET A 1 138 ? 13.174 22.861  -10.714 1.00 100.77 ? 138  MET A SD  1 
ATOM   1116 C CE  . MET A 1 138 ? 14.212 22.877  -12.173 1.00 77.06  ? 138  MET A CE  1 
ATOM   1117 N N   . ALA A 1 139 ? 11.102 17.228  -12.177 1.00 38.85  ? 139  ALA A N   1 
ATOM   1118 C CA  . ALA A 1 139 ? 9.911  16.422  -12.420 1.00 35.27  ? 139  ALA A CA  1 
ATOM   1119 C C   . ALA A 1 139 ? 9.882  15.234  -11.468 1.00 36.44  ? 139  ALA A C   1 
ATOM   1120 O O   . ALA A 1 139 ? 8.858  14.943  -10.846 1.00 34.54  ? 139  ALA A O   1 
ATOM   1121 C CB  . ALA A 1 139 ? 9.875  15.948  -13.859 1.00 29.98  ? 139  ALA A CB  1 
ATOM   1122 N N   . ALA A 1 140 ? 11.019 14.553  -11.358 1.00 32.17  ? 140  ALA A N   1 
ATOM   1123 C CA  . ALA A 1 140 ? 11.152 13.417  -10.457 1.00 25.65  ? 140  ALA A CA  1 
ATOM   1124 C C   . ALA A 1 140 ? 10.935 13.825  -9.004  1.00 27.85  ? 140  ALA A C   1 
ATOM   1125 O O   . ALA A 1 140 ? 10.600 12.992  -8.168  1.00 31.29  ? 140  ALA A O   1 
ATOM   1126 C CB  . ALA A 1 140 ? 12.512 12.761  -10.631 1.00 20.18  ? 140  ALA A CB  1 
ATOM   1127 N N   . GLN A 1 141 ? 11.126 15.108  -8.709  1.00 38.60  ? 141  GLN A N   1 
ATOM   1128 C CA  . GLN A 1 141 ? 10.907 15.635  -7.361  1.00 47.84  ? 141  GLN A CA  1 
ATOM   1129 C C   . GLN A 1 141 ? 9.433  15.609  -6.973  1.00 44.42  ? 141  GLN A C   1 
ATOM   1130 O O   . GLN A 1 141 ? 9.094  15.441  -5.801  1.00 39.02  ? 141  GLN A O   1 
ATOM   1131 C CB  . GLN A 1 141 ? 11.440 17.063  -7.244  1.00 57.91  ? 141  GLN A CB  1 
ATOM   1132 C CG  . GLN A 1 141 ? 12.950 17.168  -7.263  1.00 70.57  ? 141  GLN A CG  1 
ATOM   1133 C CD  . GLN A 1 141 ? 13.429 18.600  -7.164  1.00 83.88  ? 141  GLN A CD  1 
ATOM   1134 O OE1 . GLN A 1 141 ? 12.634 19.522  -6.971  1.00 88.65  ? 141  GLN A OE1 1 
ATOM   1135 N NE2 . GLN A 1 141 ? 14.736 18.797  -7.301  1.00 88.51  ? 141  GLN A NE2 1 
ATOM   1136 N N   . ILE A 1 142 ? 8.564  15.796  -7.962  1.00 41.78  ? 142  ILE A N   1 
ATOM   1137 C CA  . ILE A 1 142 ? 7.126  15.685  -7.752  1.00 42.02  ? 142  ILE A CA  1 
ATOM   1138 C C   . ILE A 1 142 ? 6.789  14.257  -7.327  1.00 41.05  ? 142  ILE A C   1 
ATOM   1139 O O   . ILE A 1 142 ? 5.987  14.035  -6.416  1.00 39.93  ? 142  ILE A O   1 
ATOM   1140 C CB  . ILE A 1 142 ? 6.347  16.044  -9.037  1.00 37.78  ? 142  ILE A CB  1 
ATOM   1141 C CG1 . ILE A 1 142 ? 6.687  17.469  -9.484  1.00 36.58  ? 142  ILE A CG1 1 
ATOM   1142 C CG2 . ILE A 1 142 ? 4.849  15.887  -8.823  1.00 24.14  ? 142  ILE A CG2 1 
ATOM   1143 C CD1 . ILE A 1 142 ? 6.158  17.823  -10.859 1.00 28.52  ? 142  ILE A CD1 1 
ATOM   1144 N N   . THR A 1 143 ? 7.419  13.295  -7.995  1.00 35.07  ? 143  THR A N   1 
ATOM   1145 C CA  . THR A 1 143 ? 7.266  11.885  -7.667  1.00 31.54  ? 143  THR A CA  1 
ATOM   1146 C C   . THR A 1 143 ? 7.835  11.592  -6.284  1.00 29.56  ? 143  THR A C   1 
ATOM   1147 O O   . THR A 1 143 ? 7.251  10.839  -5.504  1.00 29.26  ? 143  THR A O   1 
ATOM   1148 C CB  . THR A 1 143 ? 7.986  10.996  -8.698  1.00 27.72  ? 143  THR A CB  1 
ATOM   1149 O OG1 . THR A 1 143 ? 7.399  11.192  -9.989  1.00 32.64  ? 143  THR A OG1 1 
ATOM   1150 C CG2 . THR A 1 143 ? 7.871  9.532   -8.315  1.00 23.15  ? 143  THR A CG2 1 
ATOM   1151 N N   . LYS A 1 144 ? 8.980  12.202  -5.990  1.00 23.46  ? 144  LYS A N   1 
ATOM   1152 C CA  . LYS A 1 144 ? 9.660  12.008  -4.719  1.00 21.78  ? 144  LYS A CA  1 
ATOM   1153 C C   . LYS A 1 144 ? 8.781  12.464  -3.566  1.00 26.34  ? 144  LYS A C   1 
ATOM   1154 O O   . LYS A 1 144 ? 8.619  11.748  -2.581  1.00 25.04  ? 144  LYS A O   1 
ATOM   1155 C CB  . LYS A 1 144 ? 10.986 12.769  -4.713  1.00 31.56  ? 144  LYS A CB  1 
ATOM   1156 C CG  . LYS A 1 144 ? 11.807 12.614  -3.444  1.00 36.61  ? 144  LYS A CG  1 
ATOM   1157 C CD  . LYS A 1 144 ? 13.256 12.998  -3.699  1.00 36.44  ? 144  LYS A CD  1 
ATOM   1158 C CE  . LYS A 1 144 ? 14.030 13.139  -2.406  1.00 31.91  ? 144  LYS A CE  1 
ATOM   1159 N NZ  . LYS A 1 144 ? 13.541 14.302  -1.629  1.00 35.42  ? 144  LYS A NZ  1 
ATOM   1160 N N   . ARG A 1 145 ? 8.208  13.657  -3.696  1.00 29.03  ? 145  ARG A N   1 
ATOM   1161 C CA  . ARG A 1 145 ? 7.311  14.177  -2.672  1.00 25.68  ? 145  ARG A CA  1 
ATOM   1162 C C   . ARG A 1 145 ? 6.096  13.270  -2.487  1.00 34.97  ? 145  ARG A C   1 
ATOM   1163 O O   . ARG A 1 145 ? 5.657  13.038  -1.359  1.00 30.44  ? 145  ARG A O   1 
ATOM   1164 C CB  . ARG A 1 145 ? 6.873  15.606  -2.999  1.00 31.26  ? 145  ARG A CB  1 
ATOM   1165 C CG  . ARG A 1 145 ? 7.847  16.673  -2.529  1.00 39.85  ? 145  ARG A CG  1 
ATOM   1166 C CD  . ARG A 1 145 ? 7.310  18.077  -2.778  1.00 55.18  ? 145  ARG A CD  1 
ATOM   1167 N NE  . ARG A 1 145 ? 8.149  18.809  -3.725  1.00 66.28  ? 145  ARG A NE  1 
ATOM   1168 C CZ  . ARG A 1 145 ? 7.810  19.075  -4.984  1.00 59.99  ? 145  ARG A CZ  1 
ATOM   1169 N NH1 . ARG A 1 145 ? 8.649  19.740  -5.767  1.00 54.71  ? 145  ARG A NH1 1 
ATOM   1170 N NH2 . ARG A 1 145 ? 6.634  18.685  -5.458  1.00 54.77  ? 145  ARG A NH2 1 
ATOM   1171 N N   . LYS A 1 146 ? 5.559  12.753  -3.589  1.00 37.51  ? 146  LYS A N   1 
ATOM   1172 C CA  . LYS A 1 146 ? 4.396  11.872  -3.512  1.00 36.76  ? 146  LYS A CA  1 
ATOM   1173 C C   . LYS A 1 146 ? 4.722  10.592  -2.746  1.00 39.68  ? 146  LYS A C   1 
ATOM   1174 O O   . LYS A 1 146 ? 3.965  10.171  -1.873  1.00 47.11  ? 146  LYS A O   1 
ATOM   1175 C CB  . LYS A 1 146 ? 3.858  11.525  -4.903  1.00 36.46  ? 146  LYS A CB  1 
ATOM   1176 C CG  . LYS A 1 146 ? 2.605  10.663  -4.852  1.00 42.73  ? 146  LYS A CG  1 
ATOM   1177 C CD  . LYS A 1 146 ? 2.342  9.917   -6.152  1.00 47.11  ? 146  LYS A CD  1 
ATOM   1178 C CE  . LYS A 1 146 ? 1.848  10.835  -7.249  1.00 51.01  ? 146  LYS A CE  1 
ATOM   1179 N NZ  . LYS A 1 146 ? 1.512  10.063  -8.482  1.00 57.86  ? 146  LYS A NZ  1 
ATOM   1180 N N   . TRP A 1 147 ? 5.855  9.982   -3.072  1.00 36.66  ? 147  TRP A N   1 
ATOM   1181 C CA  . TRP A 1 147 ? 6.251  8.724   -2.449  1.00 32.25  ? 147  TRP A CA  1 
ATOM   1182 C C   . TRP A 1 147 ? 6.657  8.899   -0.987  1.00 32.96  ? 147  TRP A C   1 
ATOM   1183 O O   . TRP A 1 147 ? 6.409  8.022   -0.162  1.00 35.07  ? 147  TRP A O   1 
ATOM   1184 C CB  . TRP A 1 147 ? 7.375  8.061   -3.246  1.00 24.77  ? 147  TRP A CB  1 
ATOM   1185 C CG  . TRP A 1 147 ? 6.948  7.645   -4.613  1.00 24.94  ? 147  TRP A CG  1 
ATOM   1186 C CD1 . TRP A 1 147 ? 5.700  7.770   -5.156  1.00 26.81  ? 147  TRP A CD1 1 
ATOM   1187 C CD2 . TRP A 1 147 ? 7.764  7.036   -5.621  1.00 29.35  ? 147  TRP A CD2 1 
ATOM   1188 N NE1 . TRP A 1 147 ? 5.688  7.275   -6.437  1.00 23.66  ? 147  TRP A NE1 1 
ATOM   1189 C CE2 . TRP A 1 147 ? 6.942  6.817   -6.748  1.00 28.63  ? 147  TRP A CE2 1 
ATOM   1190 C CE3 . TRP A 1 147 ? 9.108  6.652   -5.681  1.00 21.42  ? 147  TRP A CE3 1 
ATOM   1191 C CZ2 . TRP A 1 147 ? 7.421  6.234   -7.918  1.00 26.54  ? 147  TRP A CZ2 1 
ATOM   1192 C CZ3 . TRP A 1 147 ? 9.581  6.073   -6.843  1.00 16.74  ? 147  TRP A CZ3 1 
ATOM   1193 C CH2 . TRP A 1 147 ? 8.740  5.869   -7.946  1.00 26.01  ? 147  TRP A CH2 1 
ATOM   1194 N N   . GLU A 1 148 ? 7.283  10.028  -0.672  1.00 33.53  ? 148  GLU A N   1 
ATOM   1195 C CA  . GLU A 1 148 ? 7.647  10.330  0.709   1.00 35.25  ? 148  GLU A CA  1 
ATOM   1196 C C   . GLU A 1 148 ? 6.394  10.501  1.554   1.00 36.04  ? 148  GLU A C   1 
ATOM   1197 O O   . GLU A 1 148 ? 6.280  9.918   2.630   1.00 42.53  ? 148  GLU A O   1 
ATOM   1198 C CB  . GLU A 1 148 ? 8.506  11.593  0.784   1.00 38.86  ? 148  GLU A CB  1 
ATOM   1199 C CG  . GLU A 1 148 ? 9.900  11.428  0.211   1.00 42.71  ? 148  GLU A CG  1 
ATOM   1200 C CD  . GLU A 1 148 ? 10.639 12.746  0.083   1.00 50.24  ? 148  GLU A CD  1 
ATOM   1201 O OE1 . GLU A 1 148 ? 9.992  13.813  0.185   1.00 46.62  ? 148  GLU A OE1 1 
ATOM   1202 O OE2 . GLU A 1 148 ? 11.871 12.711  -0.120  1.00 56.96  ? 148  GLU A OE2 1 
ATOM   1203 N N   . ALA A 1 149 ? 5.455  11.298  1.052   1.00 32.27  ? 149  ALA A N   1 
ATOM   1204 C CA  . ALA A 1 149 ? 4.195  11.552  1.746   1.00 25.60  ? 149  ALA A CA  1 
ATOM   1205 C C   . ALA A 1 149 ? 3.439  10.262  2.053   1.00 25.75  ? 149  ALA A C   1 
ATOM   1206 O O   . ALA A 1 149 ? 2.815  10.134  3.107   1.00 26.86  ? 149  ALA A O   1 
ATOM   1207 C CB  . ALA A 1 149 ? 3.323  12.490  0.927   1.00 17.77  ? 149  ALA A CB  1 
ATOM   1208 N N   . ALA A 1 150 ? 3.503  9.310   1.129   1.00 26.94  ? 150  ALA A N   1 
ATOM   1209 C CA  . ALA A 1 150 ? 2.767  8.057   1.265   1.00 26.50  ? 150  ALA A CA  1 
ATOM   1210 C C   . ALA A 1 150 ? 3.588  6.972   1.948   1.00 28.55  ? 150  ALA A C   1 
ATOM   1211 O O   . ALA A 1 150 ? 3.109  5.855   2.127   1.00 34.52  ? 150  ALA A O   1 
ATOM   1212 C CB  . ALA A 1 150 ? 2.281  7.574   -0.099  1.00 25.82  ? 150  ALA A CB  1 
ATOM   1213 N N   . HIS A 1 151 ? 4.822  7.301   2.322   1.00 30.73  ? 151  HIS A N   1 
ATOM   1214 C CA  . HIS A 1 151 ? 5.711  6.345   2.983   1.00 28.38  ? 151  HIS A CA  1 
ATOM   1215 C C   . HIS A 1 151 ? 5.911  5.075   2.148   1.00 30.37  ? 151  HIS A C   1 
ATOM   1216 O O   . HIS A 1 151 ? 5.987  3.971   2.684   1.00 35.23  ? 151  HIS A O   1 
ATOM   1217 C CB  . HIS A 1 151 ? 5.167  5.991   4.368   1.00 24.42  ? 151  HIS A CB  1 
ATOM   1218 C CG  . HIS A 1 151 ? 4.832  7.187   5.206   1.00 33.12  ? 151  HIS A CG  1 
ATOM   1219 N ND1 . HIS A 1 151 ? 5.796  7.986   5.782   1.00 37.74  ? 151  HIS A ND1 1 
ATOM   1220 C CD2 . HIS A 1 151 ? 3.639  7.720   5.562   1.00 34.09  ? 151  HIS A CD2 1 
ATOM   1221 C CE1 . HIS A 1 151 ? 5.212  8.962   6.455   1.00 37.64  ? 151  HIS A CE1 1 
ATOM   1222 N NE2 . HIS A 1 151 ? 3.903  8.823   6.338   1.00 35.25  ? 151  HIS A NE2 1 
ATOM   1223 N N   . GLU A 1 152 ? 6.008  5.245   0.833   1.00 27.70  ? 152  GLU A N   1 
ATOM   1224 C CA  . GLU A 1 152 ? 6.083  4.118   -0.093  1.00 26.06  ? 152  GLU A CA  1 
ATOM   1225 C C   . GLU A 1 152 ? 7.359  3.288   0.045   1.00 27.89  ? 152  GLU A C   1 
ATOM   1226 O O   . GLU A 1 152 ? 7.397  2.133   -0.375  1.00 29.07  ? 152  GLU A O   1 
ATOM   1227 C CB  . GLU A 1 152 ? 5.937  4.604   -1.538  1.00 28.95  ? 152  GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 152 ? 4.630  5.334   -1.831  1.00 38.74  ? 152  GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 152 ? 3.441  4.396   -1.975  1.00 43.80  ? 152  GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 152 ? 3.568  3.209   -1.605  1.00 36.97  ? 152  GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 152 ? 2.379  4.847   -2.464  1.00 48.80  ? 152  GLU A OE2 1 
ATOM   1232 N N   . ALA A 1 153 ? 8.402  3.870   0.629   1.00 33.98  ? 153  ALA A N   1 
ATOM   1233 C CA  . ALA A 1 153 ? 9.681  3.171   0.754   1.00 24.70  ? 153  ALA A CA  1 
ATOM   1234 C C   . ALA A 1 153 ? 9.656  2.070   1.815   1.00 24.60  ? 153  ALA A C   1 
ATOM   1235 O O   . ALA A 1 153 ? 10.408 1.100   1.726   1.00 27.94  ? 153  ALA A O   1 
ATOM   1236 C CB  . ALA A 1 153 ? 10.814 4.156   1.024   1.00 11.51  ? 153  ALA A CB  1 
ATOM   1237 N N   . GLU A 1 154 ? 8.790  2.218   2.812   1.00 26.64  ? 154  GLU A N   1 
ATOM   1238 C CA  . GLU A 1 154 ? 8.679  1.224   3.881   1.00 32.99  ? 154  GLU A CA  1 
ATOM   1239 C C   . GLU A 1 154 ? 8.333  -0.159  3.336   1.00 34.57  ? 154  GLU A C   1 
ATOM   1240 O O   . GLU A 1 154 ? 9.032  -1.136  3.603   1.00 35.55  ? 154  GLU A O   1 
ATOM   1241 C CB  . GLU A 1 154 ? 7.638  1.656   4.920   1.00 30.17  ? 154  GLU A CB  1 
ATOM   1242 C CG  . GLU A 1 154 ? 8.035  2.891   5.714   1.00 40.50  ? 154  GLU A CG  1 
ATOM   1243 C CD  . GLU A 1 154 ? 9.274  2.669   6.573   1.00 50.91  ? 154  GLU A CD  1 
ATOM   1244 O OE1 . GLU A 1 154 ? 9.698  1.503   6.737   1.00 57.45  ? 154  GLU A OE1 1 
ATOM   1245 O OE2 . GLU A 1 154 ? 9.825  3.666   7.088   1.00 50.63  ? 154  GLU A OE2 1 
ATOM   1246 N N   . GLN A 1 155 ? 7.247  -0.230  2.575   1.00 36.33  ? 155  GLN A N   1 
ATOM   1247 C CA  . GLN A 1 155 ? 6.805  -1.478  1.969   1.00 39.56  ? 155  GLN A CA  1 
ATOM   1248 C C   . GLN A 1 155 ? 7.858  -2.003  1.003   1.00 35.81  ? 155  GLN A C   1 
ATOM   1249 O O   . GLN A 1 155 ? 8.062  -3.211  0.884   1.00 37.49  ? 155  GLN A O   1 
ATOM   1250 C CB  . GLN A 1 155 ? 5.480  -1.259  1.241   1.00 52.53  ? 155  GLN A CB  1 
ATOM   1251 C CG  . GLN A 1 155 ? 5.404  0.090   0.542   1.00 69.86  ? 155  GLN A CG  1 
ATOM   1252 C CD  . GLN A 1 155 ? 4.258  0.187   -0.446  1.00 80.19  ? 155  GLN A CD  1 
ATOM   1253 O OE1 . GLN A 1 155 ? 3.128  -0.204  -0.150  1.00 89.77  ? 155  GLN A OE1 1 
ATOM   1254 N NE2 . GLN A 1 155 ? 4.548  0.709   -1.633  1.00 75.49  ? 155  GLN A NE2 1 
ATOM   1255 N N   . LEU A 1 156 ? 8.532  -1.082  0.323   1.00 35.21  ? 156  LEU A N   1 
ATOM   1256 C CA  . LEU A 1 156 ? 9.586  -1.423  -0.626  1.00 29.78  ? 156  LEU A CA  1 
ATOM   1257 C C   . LEU A 1 156 ? 10.790 -2.042  0.087   1.00 33.54  ? 156  LEU A C   1 
ATOM   1258 O O   . LEU A 1 156 ? 11.338 -3.054  -0.357  1.00 33.34  ? 156  LEU A O   1 
ATOM   1259 C CB  . LEU A 1 156 ? 10.009 -0.174  -1.404  1.00 25.72  ? 156  LEU A CB  1 
ATOM   1260 C CG  . LEU A 1 156 ? 10.974 -0.343  -2.581  1.00 28.23  ? 156  LEU A CG  1 
ATOM   1261 C CD1 . LEU A 1 156 ? 10.375 -1.231  -3.661  1.00 24.27  ? 156  LEU A CD1 1 
ATOM   1262 C CD2 . LEU A 1 156 ? 11.337 1.010   -3.156  1.00 28.90  ? 156  LEU A CD2 1 
ATOM   1263 N N   . ARG A 1 157 ? 11.198 -1.430  1.194   1.00 27.76  ? 157  ARG A N   1 
ATOM   1264 C CA  . ARG A 1 157 ? 12.288 -1.962  1.996   1.00 24.66  ? 157  ARG A CA  1 
ATOM   1265 C C   . ARG A 1 157 ? 11.941 -3.357  2.510   1.00 32.90  ? 157  ARG A C   1 
ATOM   1266 O O   . ARG A 1 157 ? 12.776 -4.261  2.479   1.00 34.21  ? 157  ARG A O   1 
ATOM   1267 C CB  . ARG A 1 157 ? 12.601 -1.035  3.171   1.00 26.15  ? 157  ARG A CB  1 
ATOM   1268 C CG  . ARG A 1 157 ? 13.687 -1.571  4.102   1.00 29.05  ? 157  ARG A CG  1 
ATOM   1269 C CD  . ARG A 1 157 ? 13.609 -0.929  5.478   1.00 30.00  ? 157  ARG A CD  1 
ATOM   1270 N NE  . ARG A 1 157 ? 12.243 -0.950  5.990   1.00 43.42  ? 157  ARG A NE  1 
ATOM   1271 C CZ  . ARG A 1 157 ? 11.650 -2.024  6.505   1.00 50.88  ? 157  ARG A CZ  1 
ATOM   1272 N NH1 . ARG A 1 157 ? 10.399 -1.941  6.939   1.00 59.62  ? 157  ARG A NH1 1 
ATOM   1273 N NH2 . ARG A 1 157 ? 12.301 -3.180  6.584   1.00 42.76  ? 157  ARG A NH2 1 
ATOM   1274 N N   . ALA A 1 158 ? 10.707 -3.529  2.979   1.00 33.40  ? 158  ALA A N   1 
ATOM   1275 C CA  . ALA A 1 158 ? 10.266 -4.817  3.511   1.00 27.43  ? 158  ALA A CA  1 
ATOM   1276 C C   . ALA A 1 158 ? 10.394 -5.924  2.469   1.00 30.31  ? 158  ALA A C   1 
ATOM   1277 O O   . ALA A 1 158 ? 10.662 -7.075  2.807   1.00 37.59  ? 158  ALA A O   1 
ATOM   1278 C CB  . ALA A 1 158 ? 8.839  -4.728  4.029   1.00 18.78  ? 158  ALA A CB  1 
ATOM   1279 N N   . TYR A 1 159 ? 10.202 -5.570  1.202   1.00 30.46  ? 159  TYR A N   1 
ATOM   1280 C CA  . TYR A 1 159 ? 10.399 -6.519  0.110   1.00 27.36  ? 159  TYR A CA  1 
ATOM   1281 C C   . TYR A 1 159 ? 11.882 -6.765  -0.164  1.00 30.88  ? 159  TYR A C   1 
ATOM   1282 O O   . TYR A 1 159 ? 12.328 -7.908  -0.231  1.00 32.37  ? 159  TYR A O   1 
ATOM   1283 C CB  . TYR A 1 159 ? 9.713  -6.037  -1.174  1.00 14.92  ? 159  TYR A CB  1 
ATOM   1284 C CG  . TYR A 1 159 ? 10.143 -6.813  -2.397  1.00 19.04  ? 159  TYR A CG  1 
ATOM   1285 C CD1 . TYR A 1 159 ? 9.583  -8.049  -2.693  1.00 20.41  ? 159  TYR A CD1 1 
ATOM   1286 C CD2 . TYR A 1 159 ? 11.127 -6.319  -3.248  1.00 24.74  ? 159  TYR A CD2 1 
ATOM   1287 C CE1 . TYR A 1 159 ? 9.983  -8.769  -3.805  1.00 20.40  ? 159  TYR A CE1 1 
ATOM   1288 C CE2 . TYR A 1 159 ? 11.535 -7.033  -4.360  1.00 21.63  ? 159  TYR A CE2 1 
ATOM   1289 C CZ  . TYR A 1 159 ? 10.959 -8.256  -4.634  1.00 24.87  ? 159  TYR A CZ  1 
ATOM   1290 O OH  . TYR A 1 159 ? 11.360 -8.966  -5.743  1.00 21.93  ? 159  TYR A OH  1 
ATOM   1291 N N   . LEU A 1 160 ? 12.640 -5.685  -0.323  1.00 33.12  ? 160  LEU A N   1 
ATOM   1292 C CA  . LEU A 1 160 ? 14.046 -5.781  -0.709  1.00 30.47  ? 160  LEU A CA  1 
ATOM   1293 C C   . LEU A 1 160 ? 14.924 -6.537  0.288   1.00 37.43  ? 160  LEU A C   1 
ATOM   1294 O O   . LEU A 1 160 ? 15.775 -7.332  -0.112  1.00 45.94  ? 160  LEU A O   1 
ATOM   1295 C CB  . LEU A 1 160 ? 14.630 -4.393  -0.982  1.00 25.63  ? 160  LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 160 ? 14.126 -3.699  -2.248  1.00 25.28  ? 160  LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 160 ? 14.695 -2.286  -2.359  1.00 20.29  ? 160  LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 160 ? 14.452 -4.528  -3.489  1.00 18.42  ? 160  LEU A CD2 1 
ATOM   1299 N N   . ASP A 1 161 ? 14.735 -6.290  1.579   1.00 37.06  ? 161  ASP A N   1 
ATOM   1300 C CA  . ASP A 1 161 ? 15.566 -6.957  2.578   1.00 46.95  ? 161  ASP A CA  1 
ATOM   1301 C C   . ASP A 1 161 ? 14.879 -8.173  3.195   1.00 47.56  ? 161  ASP A C   1 
ATOM   1302 O O   . ASP A 1 161 ? 15.406 -8.791  4.119   1.00 53.39  ? 161  ASP A O   1 
ATOM   1303 C CB  . ASP A 1 161 ? 16.039 -5.981  3.666   1.00 52.65  ? 161  ASP A CB  1 
ATOM   1304 C CG  . ASP A 1 161 ? 14.918 -5.534  4.589   1.00 62.98  ? 161  ASP A CG  1 
ATOM   1305 O OD1 . ASP A 1 161 ? 13.809 -6.106  4.512   1.00 67.85  ? 161  ASP A OD1 1 
ATOM   1306 O OD2 . ASP A 1 161 ? 15.154 -4.615  5.405   1.00 64.70  ? 161  ASP A OD2 1 
ATOM   1307 N N   . GLY A 1 162 ? 13.705 -8.516  2.676   1.00 41.07  ? 162  GLY A N   1 
ATOM   1308 C CA  . GLY A 1 162 ? 12.950 -9.634  3.205   1.00 35.66  ? 162  GLY A CA  1 
ATOM   1309 C C   . GLY A 1 162 ? 12.546 -10.628 2.137   1.00 36.44  ? 162  GLY A C   1 
ATOM   1310 O O   . GLY A 1 162 ? 13.238 -11.618 1.901   1.00 40.72  ? 162  GLY A O   1 
ATOM   1311 N N   . THR A 1 163 ? 11.420 -10.355 1.488   1.00 36.67  ? 163  THR A N   1 
ATOM   1312 C CA  . THR A 1 163 ? 10.858 -11.255 0.484   1.00 38.32  ? 163  THR A CA  1 
ATOM   1313 C C   . THR A 1 163 ? 11.842 -11.590 -0.637  1.00 39.12  ? 163  THR A C   1 
ATOM   1314 O O   . THR A 1 163 ? 12.059 -12.760 -0.956  1.00 37.53  ? 163  THR A O   1 
ATOM   1315 C CB  . THR A 1 163 ? 9.583  -10.664 -0.128  1.00 34.62  ? 163  THR A CB  1 
ATOM   1316 O OG1 . THR A 1 163 ? 8.617  -10.445 0.907   1.00 27.52  ? 163  THR A OG1 1 
ATOM   1317 C CG2 . THR A 1 163 ? 9.009  -11.610 -1.172  1.00 38.97  ? 163  THR A CG2 1 
ATOM   1318 N N   . CYS A 1 164 ? 12.423 -10.556 -1.236  1.00 34.02  ? 164  CYS A N   1 
ATOM   1319 C CA  . CYS A 1 164 ? 13.423 -10.732 -2.281  1.00 31.27  ? 164  CYS A CA  1 
ATOM   1320 C C   . CYS A 1 164 ? 14.541 -11.662 -1.814  1.00 31.64  ? 164  CYS A C   1 
ATOM   1321 O O   . CYS A 1 164 ? 14.864 -12.644 -2.481  1.00 31.69  ? 164  CYS A O   1 
ATOM   1322 C CB  . CYS A 1 164 ? 13.999 -9.372  -2.696  1.00 31.23  ? 164  CYS A CB  1 
ATOM   1323 S SG  . CYS A 1 164 ? 15.341 -9.444  -3.911  1.00 49.06  ? 164  CYS A SG  1 
ATOM   1324 N N   . VAL A 1 165 ? 15.122 -11.350 -0.660  1.00 32.63  ? 165  VAL A N   1 
ATOM   1325 C CA  . VAL A 1 165 ? 16.234 -12.131 -0.124  1.00 36.09  ? 165  VAL A CA  1 
ATOM   1326 C C   . VAL A 1 165 ? 15.877 -13.597 0.121   1.00 37.29  ? 165  VAL A C   1 
ATOM   1327 O O   . VAL A 1 165 ? 16.659 -14.491 -0.209  1.00 35.65  ? 165  VAL A O   1 
ATOM   1328 C CB  . VAL A 1 165 ? 16.797 -11.516 1.177   1.00 35.91  ? 165  VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 165 ? 17.854 -12.425 1.778   1.00 40.23  ? 165  VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 165 ? 17.378 -10.144 0.905   1.00 32.03  ? 165  VAL A CG2 1 
ATOM   1331 N N   . GLU A 1 166 ? 14.703 -13.852 0.693   1.00 37.25  ? 166  GLU A N   1 
ATOM   1332 C CA  . GLU A 1 166 ? 14.324 -15.228 1.018   1.00 40.50  ? 166  GLU A CA  1 
ATOM   1333 C C   . GLU A 1 166 ? 14.043 -16.072 -0.227  1.00 34.94  ? 166  GLU A C   1 
ATOM   1334 O O   . GLU A 1 166 ? 14.341 -17.265 -0.250  1.00 35.44  ? 166  GLU A O   1 
ATOM   1335 C CB  . GLU A 1 166 ? 13.153 -15.279 2.011   1.00 46.38  ? 166  GLU A CB  1 
ATOM   1336 C CG  . GLU A 1 166 ? 11.839 -14.707 1.500   1.00 66.35  ? 166  GLU A CG  1 
ATOM   1337 C CD  . GLU A 1 166 ? 10.750 -14.691 2.568   1.00 75.79  ? 166  GLU A CD  1 
ATOM   1338 O OE1 . GLU A 1 166 ? 11.088 -14.730 3.772   1.00 77.22  ? 166  GLU A OE1 1 
ATOM   1339 O OE2 . GLU A 1 166 ? 9.554  -14.638 2.202   1.00 76.90  ? 166  GLU A OE2 1 
ATOM   1340 N N   . TRP A 1 167 ? 13.483 -15.449 -1.262  1.00 31.14  ? 167  TRP A N   1 
ATOM   1341 C CA  . TRP A 1 167 ? 13.220 -16.146 -2.521  1.00 33.53  ? 167  TRP A CA  1 
ATOM   1342 C C   . TRP A 1 167 ? 14.488 -16.355 -3.348  1.00 33.31  ? 167  TRP A C   1 
ATOM   1343 O O   . TRP A 1 167 ? 14.635 -17.375 -4.020  1.00 31.31  ? 167  TRP A O   1 
ATOM   1344 C CB  . TRP A 1 167 ? 12.143 -15.426 -3.341  1.00 33.21  ? 167  TRP A CB  1 
ATOM   1345 C CG  . TRP A 1 167 ? 10.758 -15.720 -2.854  1.00 33.58  ? 167  TRP A CG  1 
ATOM   1346 C CD1 . TRP A 1 167 ? 10.075 -15.061 -1.871  1.00 26.98  ? 167  TRP A CD1 1 
ATOM   1347 C CD2 . TRP A 1 167 ? 9.893  -16.768 -3.311  1.00 34.82  ? 167  TRP A CD2 1 
ATOM   1348 N NE1 . TRP A 1 167 ? 8.837  -15.631 -1.695  1.00 30.61  ? 167  TRP A NE1 1 
ATOM   1349 C CE2 . TRP A 1 167 ? 8.700  -16.680 -2.565  1.00 32.00  ? 167  TRP A CE2 1 
ATOM   1350 C CE3 . TRP A 1 167 ? 10.011 -17.771 -4.281  1.00 35.83  ? 167  TRP A CE3 1 
ATOM   1351 C CZ2 . TRP A 1 167 ? 7.632  -17.555 -2.759  1.00 31.49  ? 167  TRP A CZ2 1 
ATOM   1352 C CZ3 . TRP A 1 167 ? 8.947  -18.639 -4.473  1.00 34.57  ? 167  TRP A CZ3 1 
ATOM   1353 C CH2 . TRP A 1 167 ? 7.774  -18.525 -3.715  1.00 32.59  ? 167  TRP A CH2 1 
ATOM   1354 N N   . LEU A 1 168 ? 15.403 -15.392 -3.298  1.00 28.86  ? 168  LEU A N   1 
ATOM   1355 C CA  . LEU A 1 168 ? 16.700 -15.569 -3.934  1.00 27.22  ? 168  LEU A CA  1 
ATOM   1356 C C   . LEU A 1 168 ? 17.382 -16.819 -3.377  1.00 34.73  ? 168  LEU A C   1 
ATOM   1357 O O   . LEU A 1 168 ? 17.852 -17.664 -4.139  1.00 33.61  ? 168  LEU A O   1 
ATOM   1358 C CB  . LEU A 1 168 ? 17.587 -14.339 -3.731  1.00 17.11  ? 168  LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 168 ? 19.036 -14.508 -4.199  1.00 17.18  ? 168  LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 168 ? 19.087 -14.973 -5.650  1.00 16.18  ? 168  LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 168 ? 19.841 -13.224 -4.004  1.00 12.76  ? 168  LEU A CD2 1 
ATOM   1362 N N   . ARG A 1 169 ? 17.424 -16.931 -2.049  1.00 35.31  ? 169  ARG A N   1 
ATOM   1363 C CA  . ARG A 1 169 ? 17.992 -18.107 -1.390  1.00 35.44  ? 169  ARG A CA  1 
ATOM   1364 C C   . ARG A 1 169 ? 17.306 -19.370 -1.891  1.00 33.56  ? 169  ARG A C   1 
ATOM   1365 O O   . ARG A 1 169 ? 17.943 -20.401 -2.104  1.00 39.77  ? 169  ARG A O   1 
ATOM   1366 C CB  . ARG A 1 169 ? 17.810 -18.035 0.128   1.00 41.62  ? 169  ARG A CB  1 
ATOM   1367 C CG  . ARG A 1 169 ? 18.660 -17.020 0.874   1.00 45.64  ? 169  ARG A CG  1 
ATOM   1368 C CD  . ARG A 1 169 ? 18.513 -17.269 2.374   1.00 59.69  ? 169  ARG A CD  1 
ATOM   1369 N NE  . ARG A 1 169 ? 19.005 -16.173 3.204   1.00 75.02  ? 169  ARG A NE  1 
ATOM   1370 C CZ  . ARG A 1 169 ? 18.225 -15.360 3.913   1.00 82.41  ? 169  ARG A CZ  1 
ATOM   1371 N NH1 . ARG A 1 169 ? 18.764 -14.391 4.644   1.00 83.91  ? 169  ARG A NH1 1 
ATOM   1372 N NH2 . ARG A 1 169 ? 16.907 -15.516 3.898   1.00 81.10  ? 169  ARG A NH2 1 
ATOM   1373 N N   . ARG A 1 170 ? 15.994 -19.282 -2.064  1.00 28.67  ? 170  ARG A N   1 
ATOM   1374 C CA  . ARG A 1 170 ? 15.198 -20.418 -2.506  1.00 28.60  ? 170  ARG A CA  1 
ATOM   1375 C C   . ARG A 1 170 ? 15.621 -20.877 -3.903  1.00 30.35  ? 170  ARG A C   1 
ATOM   1376 O O   . ARG A 1 170 ? 15.816 -22.069 -4.140  1.00 30.62  ? 170  ARG A O   1 
ATOM   1377 C CB  . ARG A 1 170 ? 13.712 -20.056 -2.484  1.00 23.84  ? 170  ARG A CB  1 
ATOM   1378 C CG  . ARG A 1 170 ? 12.794 -21.198 -2.856  1.00 30.41  ? 170  ARG A CG  1 
ATOM   1379 C CD  . ARG A 1 170 ? 11.394 -20.698 -3.160  1.00 35.70  ? 170  ARG A CD  1 
ATOM   1380 N NE  . ARG A 1 170 ? 10.587 -21.731 -3.799  1.00 48.69  ? 170  ARG A NE  1 
ATOM   1381 C CZ  . ARG A 1 170 ? 9.827  -22.601 -3.142  1.00 63.55  ? 170  ARG A CZ  1 
ATOM   1382 N NH1 . ARG A 1 170 ? 9.765  -22.564 -1.817  1.00 63.28  ? 170  ARG A NH1 1 
ATOM   1383 N NH2 . ARG A 1 170 ? 9.127  -23.509 -3.810  1.00 68.96  ? 170  ARG A NH2 1 
ATOM   1384 N N   . TYR A 1 171 ? 15.765 -19.924 -4.819  1.00 22.69  ? 171  TYR A N   1 
ATOM   1385 C CA  . TYR A 1 171 ? 16.192 -20.220 -6.179  1.00 22.61  ? 171  TYR A CA  1 
ATOM   1386 C C   . TYR A 1 171 ? 17.587 -20.835 -6.196  1.00 26.98  ? 171  TYR A C   1 
ATOM   1387 O O   . TYR A 1 171 ? 17.816 -21.859 -6.838  1.00 32.60  ? 171  TYR A O   1 
ATOM   1388 C CB  . TYR A 1 171 ? 16.184 -18.950 -7.032  1.00 25.38  ? 171  TYR A CB  1 
ATOM   1389 C CG  . TYR A 1 171 ? 14.820 -18.325 -7.202  1.00 29.60  ? 171  TYR A CG  1 
ATOM   1390 C CD1 . TYR A 1 171 ? 13.670 -19.107 -7.224  1.00 33.51  ? 171  TYR A CD1 1 
ATOM   1391 C CD2 . TYR A 1 171 ? 14.680 -16.951 -7.332  1.00 30.39  ? 171  TYR A CD2 1 
ATOM   1392 C CE1 . TYR A 1 171 ? 12.418 -18.533 -7.376  1.00 35.64  ? 171  TYR A CE1 1 
ATOM   1393 C CE2 . TYR A 1 171 ? 13.434 -16.368 -7.484  1.00 35.93  ? 171  TYR A CE2 1 
ATOM   1394 C CZ  . TYR A 1 171 ? 12.308 -17.162 -7.506  1.00 37.32  ? 171  TYR A CZ  1 
ATOM   1395 O OH  . TYR A 1 171 ? 11.072 -16.575 -7.657  1.00 34.09  ? 171  TYR A OH  1 
ATOM   1396 N N   . LEU A 1 172 ? 18.516 -20.197 -5.492  1.00 26.74  ? 172  LEU A N   1 
ATOM   1397 C CA  . LEU A 1 172 ? 19.893 -20.669 -5.409  1.00 26.85  ? 172  LEU A CA  1 
ATOM   1398 C C   . LEU A 1 172 ? 19.971 -22.116 -4.944  1.00 30.03  ? 172  LEU A C   1 
ATOM   1399 O O   . LEU A 1 172 ? 20.929 -22.822 -5.250  1.00 31.02  ? 172  LEU A O   1 
ATOM   1400 C CB  . LEU A 1 172 ? 20.699 -19.788 -4.456  1.00 30.07  ? 172  LEU A CB  1 
ATOM   1401 C CG  . LEU A 1 172 ? 20.944 -18.356 -4.916  1.00 30.08  ? 172  LEU A CG  1 
ATOM   1402 C CD1 . LEU A 1 172 ? 21.732 -17.594 -3.869  1.00 26.14  ? 172  LEU A CD1 1 
ATOM   1403 C CD2 . LEU A 1 172 ? 21.672 -18.359 -6.252  1.00 34.33  ? 172  LEU A CD2 1 
ATOM   1404 N N   . GLU A 1 173 ? 18.962 -22.550 -4.196  1.00 38.47  ? 173  GLU A N   1 
ATOM   1405 C CA  . GLU A 1 173 ? 18.915 -23.919 -3.698  1.00 45.22  ? 173  GLU A CA  1 
ATOM   1406 C C   . GLU A 1 173 ? 18.283 -24.878 -4.710  1.00 39.36  ? 173  GLU A C   1 
ATOM   1407 O O   . GLU A 1 173 ? 18.825 -25.949 -4.984  1.00 47.81  ? 173  GLU A O   1 
ATOM   1408 C CB  . GLU A 1 173 ? 18.173 -23.980 -2.359  1.00 57.37  ? 173  GLU A CB  1 
ATOM   1409 C CG  . GLU A 1 173 ? 18.234 -25.340 -1.676  1.00 70.01  ? 173  GLU A CG  1 
ATOM   1410 C CD  . GLU A 1 173 ? 19.658 -25.843 -1.489  1.00 77.15  ? 173  GLU A CD  1 
ATOM   1411 O OE1 . GLU A 1 173 ? 20.594 -25.013 -1.479  1.00 76.25  ? 173  GLU A OE1 1 
ATOM   1412 O OE2 . GLU A 1 173 ? 19.842 -27.073 -1.356  1.00 79.25  ? 173  GLU A OE2 1 
ATOM   1413 N N   . ASN A 1 174 ? 17.140 -24.490 -5.263  1.00 33.87  ? 174  ASN A N   1 
ATOM   1414 C CA  . ASN A 1 174 ? 16.455 -25.319 -6.248  1.00 34.67  ? 174  ASN A CA  1 
ATOM   1415 C C   . ASN A 1 174 ? 17.234 -25.479 -7.548  1.00 33.96  ? 174  ASN A C   1 
ATOM   1416 O O   . ASN A 1 174 ? 17.122 -26.500 -8.222  1.00 43.69  ? 174  ASN A O   1 
ATOM   1417 C CB  . ASN A 1 174 ? 15.061 -24.767 -6.539  1.00 40.96  ? 174  ASN A CB  1 
ATOM   1418 C CG  . ASN A 1 174 ? 14.098 -25.001 -5.400  1.00 44.91  ? 174  ASN A CG  1 
ATOM   1419 O OD1 . ASN A 1 174 ? 13.430 -24.077 -4.937  1.00 47.80  ? 174  ASN A OD1 1 
ATOM   1420 N ND2 . ASN A 1 174 ? 14.023 -26.242 -4.936  1.00 49.72  ? 174  ASN A ND2 1 
ATOM   1421 N N   . GLY A 1 175 ? 18.018 -24.467 -7.901  1.00 26.34  ? 175  GLY A N   1 
ATOM   1422 C CA  . GLY A 1 175 ? 18.827 -24.527 -9.102  1.00 30.94  ? 175  GLY A CA  1 
ATOM   1423 C C   . GLY A 1 175 ? 20.309 -24.579 -8.792  1.00 37.66  ? 175  GLY A C   1 
ATOM   1424 O O   . GLY A 1 175 ? 21.129 -24.143 -9.599  1.00 36.37  ? 175  GLY A O   1 
ATOM   1425 N N   . LYS A 1 176 ? 20.649 -25.131 -7.630  1.00 41.85  ? 176  LYS A N   1 
ATOM   1426 C CA  . LYS A 1 176 ? 22.015 -25.081 -7.113  1.00 43.76  ? 176  LYS A CA  1 
ATOM   1427 C C   . LYS A 1 176 ? 23.079 -25.597 -8.079  1.00 42.86  ? 176  LYS A C   1 
ATOM   1428 O O   . LYS A 1 176 ? 24.188 -25.066 -8.124  1.00 43.81  ? 176  LYS A O   1 
ATOM   1429 C CB  . LYS A 1 176 ? 22.122 -25.823 -5.778  1.00 50.18  ? 176  LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 176 ? 21.932 -27.327 -5.868  1.00 58.30  ? 176  LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 176 ? 22.648 -28.032 -4.719  1.00 66.84  ? 176  LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 176 ? 22.225 -27.467 -3.367  1.00 70.86  ? 176  LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 176 ? 23.091 -27.950 -2.249  1.00 67.57  ? 176  LYS A NZ  1 
ATOM   1434 N N   . GLU A 1 177 ? 22.746 -26.629 -8.844  1.00 42.02  ? 177  GLU A N   1 
ATOM   1435 C CA  . GLU A 1 177 ? 23.711 -27.220 -9.765  1.00 49.73  ? 177  GLU A CA  1 
ATOM   1436 C C   . GLU A 1 177 ? 23.832 -26.415 -11.057 1.00 53.47  ? 177  GLU A C   1 
ATOM   1437 O O   . GLU A 1 177 ? 24.698 -26.684 -11.889 1.00 62.08  ? 177  GLU A O   1 
ATOM   1438 C CB  . GLU A 1 177 ? 23.352 -28.676 -10.068 1.00 58.63  ? 177  GLU A CB  1 
ATOM   1439 C CG  . GLU A 1 177 ? 22.014 -28.865 -10.757 1.00 69.21  ? 177  GLU A CG  1 
ATOM   1440 C CD  . GLU A 1 177 ? 21.746 -30.317 -11.117 1.00 81.92  ? 177  GLU A CD  1 
ATOM   1441 O OE1 . GLU A 1 177 ? 22.403 -31.208 -10.535 1.00 84.39  ? 177  GLU A OE1 1 
ATOM   1442 O OE2 . GLU A 1 177 ? 20.883 -30.566 -11.986 1.00 84.86  ? 177  GLU A OE2 1 
ATOM   1443 N N   . THR A 1 178 ? 22.965 -25.422 -11.216 1.00 46.68  ? 178  THR A N   1 
ATOM   1444 C CA  . THR A 1 178 ? 22.994 -24.558 -12.388 1.00 45.78  ? 178  THR A CA  1 
ATOM   1445 C C   . THR A 1 178 ? 23.517 -23.169 -12.028 1.00 46.78  ? 178  THR A C   1 
ATOM   1446 O O   . THR A 1 178 ? 24.329 -22.592 -12.752 1.00 51.30  ? 178  THR A O   1 
ATOM   1447 C CB  . THR A 1 178 ? 21.592 -24.415 -13.008 1.00 51.07  ? 178  THR A CB  1 
ATOM   1448 O OG1 . THR A 1 178 ? 21.102 -25.707 -13.388 1.00 58.74  ? 178  THR A OG1 1 
ATOM   1449 C CG2 . THR A 1 178 ? 21.633 -23.507 -14.229 1.00 48.49  ? 178  THR A CG2 1 
ATOM   1450 N N   . LEU A 1 179 ? 23.049 -22.644 -10.900 1.00 39.18  ? 179  LEU A N   1 
ATOM   1451 C CA  . LEU A 1 179 ? 23.373 -21.286 -10.480 1.00 31.61  ? 179  LEU A CA  1 
ATOM   1452 C C   . LEU A 1 179 ? 24.635 -21.197 -9.626  1.00 36.92  ? 179  LEU A C   1 
ATOM   1453 O O   . LEU A 1 179 ? 25.365 -20.211 -9.697  1.00 47.46  ? 179  LEU A O   1 
ATOM   1454 C CB  . LEU A 1 179 ? 22.199 -20.678 -9.715  1.00 31.37  ? 179  LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 179 ? 20.913 -20.449 -10.501 1.00 32.34  ? 179  LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 179 ? 19.761 -20.210 -9.551  1.00 35.99  ? 179  LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 179 ? 21.086 -19.280 -11.456 1.00 35.16  ? 179  LEU A CD2 1 
ATOM   1458 N N   . GLN A 1 180 ? 24.881 -22.211 -8.805  1.00 41.56  ? 180  GLN A N   1 
ATOM   1459 C CA  . GLN A 1 180 ? 26.071 -22.221 -7.959  1.00 41.66  ? 180  GLN A CA  1 
ATOM   1460 C C   . GLN A 1 180 ? 27.205 -22.970 -8.642  1.00 43.49  ? 180  GLN A C   1 
ATOM   1461 O O   . GLN A 1 180 ? 28.126 -23.464 -7.993  1.00 40.78  ? 180  GLN A O   1 
ATOM   1462 C CB  . GLN A 1 180 ? 25.769 -22.827 -6.588  1.00 35.12  ? 180  GLN A CB  1 
ATOM   1463 C CG  . GLN A 1 180 ? 24.828 -21.993 -5.743  1.00 38.04  ? 180  GLN A CG  1 
ATOM   1464 C CD  . GLN A 1 180 ? 24.595 -22.590 -4.370  1.00 51.63  ? 180  GLN A CD  1 
ATOM   1465 O OE1 . GLN A 1 180 ? 25.498 -23.181 -3.776  1.00 59.92  ? 180  GLN A OE1 1 
ATOM   1466 N NE2 . GLN A 1 180 ? 23.377 -22.445 -3.859  1.00 48.39  ? 180  GLN A NE2 1 
ATOM   1467 N N   . ARG A 1 181 ? 27.122 -23.053 -9.964  1.00 48.89  ? 181  ARG A N   1 
ATOM   1468 C CA  . ARG A 1 181 ? 28.196 -23.628 -10.756 1.00 48.25  ? 181  ARG A CA  1 
ATOM   1469 C C   . ARG A 1 181 ? 29.140 -22.518 -11.192 1.00 46.83  ? 181  ARG A C   1 
ATOM   1470 O O   . ARG A 1 181 ? 28.798 -21.334 -11.152 1.00 44.43  ? 181  ARG A O   1 
ATOM   1471 C CB  . ARG A 1 181 ? 27.642 -24.350 -11.987 1.00 49.77  ? 181  ARG A CB  1 
ATOM   1472 C CG  . ARG A 1 181 ? 27.569 -23.484 -13.240 1.00 54.26  ? 181  ARG A CG  1 
ATOM   1473 C CD  . ARG A 1 181 ? 27.043 -24.280 -14.424 1.00 62.89  ? 181  ARG A CD  1 
ATOM   1474 N NE  . ARG A 1 181 ? 27.212 -23.583 -15.697 1.00 65.80  ? 181  ARG A NE  1 
ATOM   1475 C CZ  . ARG A 1 181 ? 26.319 -22.748 -16.222 1.00 66.10  ? 181  ARG A CZ  1 
ATOM   1476 N NH1 . ARG A 1 181 ? 25.189 -22.489 -15.580 1.00 64.63  ? 181  ARG A NH1 1 
ATOM   1477 N NH2 . ARG A 1 181 ? 26.559 -22.167 -17.389 1.00 65.54  ? 181  ARG A NH2 1 
ATOM   1478 N N   . THR A 1 182 ? 30.334 -22.909 -11.609 1.00 47.46  ? 182  THR A N   1 
ATOM   1479 C CA  . THR A 1 182 ? 31.302 -21.958 -12.115 1.00 40.74  ? 182  THR A CA  1 
ATOM   1480 C C   . THR A 1 182 ? 31.969 -22.583 -13.331 1.00 40.68  ? 182  THR A C   1 
ATOM   1481 O O   . THR A 1 182 ? 32.324 -23.762 -13.318 1.00 48.30  ? 182  THR A O   1 
ATOM   1482 C CB  . THR A 1 182 ? 32.339 -21.572 -11.028 1.00 37.00  ? 182  THR A CB  1 
ATOM   1483 O OG1 . THR A 1 182 ? 32.630 -20.171 -11.110 1.00 40.85  ? 182  THR A OG1 1 
ATOM   1484 C CG2 . THR A 1 182 ? 33.626 -22.380 -11.169 1.00 27.27  ? 182  THR A CG2 1 
ATOM   1485 N N   . ASP A 1 183 ? 32.092 -21.805 -14.397 1.00 37.15  ? 183  ASP A N   1 
ATOM   1486 C CA  . ASP A 1 183 ? 32.736 -22.276 -15.614 1.00 37.18  ? 183  ASP A CA  1 
ATOM   1487 C C   . ASP A 1 183 ? 33.929 -21.394 -15.907 1.00 29.28  ? 183  ASP A C   1 
ATOM   1488 O O   . ASP A 1 183 ? 33.771 -20.210 -16.185 1.00 30.54  ? 183  ASP A O   1 
ATOM   1489 C CB  . ASP A 1 183 ? 31.761 -22.244 -16.793 1.00 49.98  ? 183  ASP A CB  1 
ATOM   1490 C CG  . ASP A 1 183 ? 31.193 -23.610 -17.120 1.00 60.67  ? 183  ASP A CG  1 
ATOM   1491 O OD1 . ASP A 1 183 ? 31.965 -24.594 -17.124 1.00 66.47  ? 183  ASP A OD1 1 
ATOM   1492 O OD2 . ASP A 1 183 ? 29.974 -23.700 -17.374 1.00 62.39  ? 183  ASP A OD2 1 
ATOM   1493 N N   . PRO A 1 184 ? 35.134 -21.968 -15.839 1.00 30.81  ? 184  PRO A N   1 
ATOM   1494 C CA  . PRO A 1 184 ? 36.340 -21.171 -16.072 1.00 24.95  ? 184  PRO A CA  1 
ATOM   1495 C C   . PRO A 1 184 ? 36.431 -20.791 -17.541 1.00 20.16  ? 184  PRO A C   1 
ATOM   1496 O O   . PRO A 1 184 ? 35.885 -21.502 -18.384 1.00 23.85  ? 184  PRO A O   1 
ATOM   1497 C CB  . PRO A 1 184 ? 37.465 -22.139 -15.704 1.00 19.96  ? 184  PRO A CB  1 
ATOM   1498 C CG  . PRO A 1 184 ? 36.900 -23.483 -16.021 1.00 23.62  ? 184  PRO A CG  1 
ATOM   1499 C CD  . PRO A 1 184 ? 35.438 -23.398 -15.659 1.00 27.80  ? 184  PRO A CD  1 
ATOM   1500 N N   . PRO A 1 185 ? 37.103 -19.674 -17.848 1.00 15.10  ? 185  PRO A N   1 
ATOM   1501 C CA  . PRO A 1 185 ? 37.322 -19.287 -19.244 1.00 25.01  ? 185  PRO A CA  1 
ATOM   1502 C C   . PRO A 1 185 ? 38.333 -20.190 -19.948 1.00 32.46  ? 185  PRO A C   1 
ATOM   1503 O O   . PRO A 1 185 ? 39.366 -20.527 -19.373 1.00 34.72  ? 185  PRO A O   1 
ATOM   1504 C CB  . PRO A 1 185 ? 37.901 -17.873 -19.122 1.00 24.66  ? 185  PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 185 ? 38.554 -17.852 -17.786 1.00 15.65  ? 185  PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 185 ? 37.664 -18.689 -16.908 1.00 14.19  ? 185  PRO A CD  1 
ATOM   1507 N N   . LYS A 1 186 ? 38.018 -20.582 -21.179 1.00 37.91  ? 186  LYS A N   1 
ATOM   1508 C CA  . LYS A 1 186 ? 38.982 -21.212 -22.073 1.00 29.01  ? 186  LYS A CA  1 
ATOM   1509 C C   . LYS A 1 186 ? 39.695 -20.102 -22.837 1.00 28.59  ? 186  LYS A C   1 
ATOM   1510 O O   . LYS A 1 186 ? 39.059 -19.336 -23.563 1.00 31.07  ? 186  LYS A O   1 
ATOM   1511 C CB  . LYS A 1 186 ? 38.269 -22.149 -23.049 1.00 28.65  ? 186  LYS A CB  1 
ATOM   1512 C CG  . LYS A 1 186 ? 38.073 -23.570 -22.535 1.00 32.46  ? 186  LYS A CG  1 
ATOM   1513 C CD  . LYS A 1 186 ? 37.272 -23.612 -21.238 1.00 36.20  ? 186  LYS A CD  1 
ATOM   1514 C CE  . LYS A 1 186 ? 35.798 -23.308 -21.472 1.00 36.32  ? 186  LYS A CE  1 
ATOM   1515 N NZ  . LYS A 1 186 ? 35.005 -23.430 -20.215 1.00 37.12  ? 186  LYS A NZ  1 
ATOM   1516 N N   . THR A 1 187 ? 41.010 -20.005 -22.670 1.00 27.10  ? 187  THR A N   1 
ATOM   1517 C CA  . THR A 1 187 ? 41.751 -18.871 -23.217 1.00 29.33  ? 187  THR A CA  1 
ATOM   1518 C C   . THR A 1 187 ? 42.749 -19.259 -24.307 1.00 33.20  ? 187  THR A C   1 
ATOM   1519 O O   . THR A 1 187 ? 43.347 -20.332 -24.268 1.00 38.64  ? 187  THR A O   1 
ATOM   1520 C CB  . THR A 1 187 ? 42.502 -18.094 -22.106 1.00 23.54  ? 187  THR A CB  1 
ATOM   1521 O OG1 . THR A 1 187 ? 43.591 -18.883 -21.618 1.00 28.69  ? 187  THR A OG1 1 
ATOM   1522 C CG2 . THR A 1 187 ? 41.576 -17.782 -20.954 1.00 26.87  ? 187  THR A CG2 1 
ATOM   1523 N N   . HIS A 1 188 ? 42.913 -18.371 -25.283 1.00 31.37  ? 188  HIS A N   1 
ATOM   1524 C CA  . HIS A 1 188 ? 43.982 -18.481 -26.268 1.00 26.15  ? 188  HIS A CA  1 
ATOM   1525 C C   . HIS A 1 188 ? 44.295 -17.098 -26.821 1.00 30.04  ? 188  HIS A C   1 
ATOM   1526 O O   . HIS A 1 188 ? 43.553 -16.147 -26.572 1.00 27.96  ? 188  HIS A O   1 
ATOM   1527 C CB  . HIS A 1 188 ? 43.609 -19.446 -27.396 1.00 22.89  ? 188  HIS A CB  1 
ATOM   1528 C CG  . HIS A 1 188 ? 42.611 -18.896 -28.367 1.00 29.73  ? 188  HIS A CG  1 
ATOM   1529 N ND1 . HIS A 1 188 ? 41.262 -18.822 -28.090 1.00 29.74  ? 188  HIS A ND1 1 
ATOM   1530 C CD2 . HIS A 1 188 ? 42.763 -18.407 -29.622 1.00 35.46  ? 188  HIS A CD2 1 
ATOM   1531 C CE1 . HIS A 1 188 ? 40.629 -18.305 -29.129 1.00 29.80  ? 188  HIS A CE1 1 
ATOM   1532 N NE2 . HIS A 1 188 ? 41.517 -18.042 -30.071 1.00 34.73  ? 188  HIS A NE2 1 
ATOM   1533 N N   . MET A 1 189 ? 45.392 -16.985 -27.565 1.00 29.86  ? 189  MET A N   1 
ATOM   1534 C CA  . MET A 1 189 ? 45.809 -15.704 -28.131 1.00 31.10  ? 189  MET A CA  1 
ATOM   1535 C C   . MET A 1 189 ? 45.929 -15.779 -29.652 1.00 37.38  ? 189  MET A C   1 
ATOM   1536 O O   . MET A 1 189 ? 46.256 -16.828 -30.203 1.00 40.38  ? 189  MET A O   1 
ATOM   1537 C CB  . MET A 1 189 ? 47.145 -15.265 -27.528 1.00 28.44  ? 189  MET A CB  1 
ATOM   1538 C CG  . MET A 1 189 ? 47.038 -14.736 -26.108 1.00 33.25  ? 189  MET A CG  1 
ATOM   1539 S SD  . MET A 1 189 ? 48.653 -14.374 -25.398 1.00 42.92  ? 189  MET A SD  1 
ATOM   1540 C CE  . MET A 1 189 ? 49.333 -16.030 -25.285 1.00 29.26  ? 189  MET A CE  1 
ATOM   1541 N N   . THR A 1 190 ? 45.658 -14.665 -30.327 1.00 41.41  ? 190  THR A N   1 
ATOM   1542 C CA  . THR A 1 190 ? 45.817 -14.594 -31.779 1.00 41.30  ? 190  THR A CA  1 
ATOM   1543 C C   . THR A 1 190 ? 46.638 -13.378 -32.192 1.00 32.76  ? 190  THR A C   1 
ATOM   1544 O O   . THR A 1 190 ? 46.653 -12.363 -31.494 1.00 22.95  ? 190  THR A O   1 
ATOM   1545 C CB  . THR A 1 190 ? 44.460 -14.610 -32.522 1.00 40.84  ? 190  THR A CB  1 
ATOM   1546 O OG1 . THR A 1 190 ? 43.735 -13.407 -32.241 1.00 49.02  ? 190  THR A OG1 1 
ATOM   1547 C CG2 . THR A 1 190 ? 43.642 -15.808 -32.086 1.00 41.46  ? 190  THR A CG2 1 
ATOM   1548 N N   . HIS A 1 191 ? 47.321 -13.500 -33.328 1.00 31.98  ? 191  HIS A N   1 
ATOM   1549 C CA  . HIS A 1 191 ? 48.231 -12.468 -33.820 1.00 24.03  ? 191  HIS A CA  1 
ATOM   1550 C C   . HIS A 1 191 ? 47.630 -11.831 -35.071 1.00 24.95  ? 191  HIS A C   1 
ATOM   1551 O O   . HIS A 1 191 ? 47.095 -12.539 -35.927 1.00 22.55  ? 191  HIS A O   1 
ATOM   1552 C CB  . HIS A 1 191 ? 49.570 -13.120 -34.162 1.00 28.88  ? 191  HIS A CB  1 
ATOM   1553 C CG  . HIS A 1 191 ? 50.695 -12.157 -34.373 1.00 41.99  ? 191  HIS A CG  1 
ATOM   1554 N ND1 . HIS A 1 191 ? 51.684 -12.376 -35.306 1.00 44.00  ? 191  HIS A ND1 1 
ATOM   1555 C CD2 . HIS A 1 191 ? 51.008 -10.995 -33.753 1.00 44.49  ? 191  HIS A CD2 1 
ATOM   1556 C CE1 . HIS A 1 191 ? 52.551 -11.381 -35.263 1.00 41.97  ? 191  HIS A CE1 1 
ATOM   1557 N NE2 . HIS A 1 191 ? 52.165 -10.530 -34.331 1.00 43.29  ? 191  HIS A NE2 1 
ATOM   1558 N N   . HIS A 1 192 ? 47.718 -10.505 -35.180 1.00 31.34  ? 192  HIS A N   1 
ATOM   1559 C CA  . HIS A 1 192 ? 47.191 -9.797  -36.348 1.00 38.84  ? 192  HIS A CA  1 
ATOM   1560 C C   . HIS A 1 192 ? 48.080 -8.632  -36.805 1.00 38.43  ? 192  HIS A C   1 
ATOM   1561 O O   . HIS A 1 192 ? 47.965 -7.515  -36.288 1.00 42.41  ? 192  HIS A O   1 
ATOM   1562 C CB  . HIS A 1 192 ? 45.782 -9.253  -36.070 1.00 48.77  ? 192  HIS A CB  1 
ATOM   1563 C CG  . HIS A 1 192 ? 44.784 -10.292 -35.659 1.00 54.17  ? 192  HIS A CG  1 
ATOM   1564 N ND1 . HIS A 1 192 ? 43.995 -10.968 -36.567 1.00 53.18  ? 192  HIS A ND1 1 
ATOM   1565 C CD2 . HIS A 1 192 ? 44.417 -10.741 -34.434 1.00 52.21  ? 192  HIS A CD2 1 
ATOM   1566 C CE1 . HIS A 1 192 ? 43.201 -11.803 -35.919 1.00 53.87  ? 192  HIS A CE1 1 
ATOM   1567 N NE2 . HIS A 1 192 ? 43.437 -11.685 -34.625 1.00 55.35  ? 192  HIS A NE2 1 
ATOM   1568 N N   . PRO A 1 193 ? 48.960 -8.885  -37.783 1.00 39.85  ? 193  PRO A N   1 
ATOM   1569 C CA  . PRO A 1 193 ? 49.786 -7.798  -38.322 1.00 46.25  ? 193  PRO A CA  1 
ATOM   1570 C C   . PRO A 1 193 ? 48.907 -6.697  -38.910 1.00 56.45  ? 193  PRO A C   1 
ATOM   1571 O O   . PRO A 1 193 ? 47.941 -7.012  -39.607 1.00 59.21  ? 193  PRO A O   1 
ATOM   1572 C CB  . PRO A 1 193 ? 50.593 -8.485  -39.429 1.00 38.99  ? 193  PRO A CB  1 
ATOM   1573 C CG  . PRO A 1 193 ? 50.678 -9.945  -38.994 1.00 40.64  ? 193  PRO A CG  1 
ATOM   1574 C CD  . PRO A 1 193 ? 49.336 -10.209 -38.319 1.00 42.30  ? 193  PRO A CD  1 
ATOM   1575 N N   . ILE A 1 194 ? 49.234 -5.441  -38.608 1.00 59.47  ? 194  ILE A N   1 
ATOM   1576 C CA  . ILE A 1 194 ? 48.568 -4.274  -39.186 1.00 61.61  ? 194  ILE A CA  1 
ATOM   1577 C C   . ILE A 1 194 ? 49.430 -3.743  -40.328 1.00 66.36  ? 194  ILE A C   1 
ATOM   1578 O O   . ILE A 1 194 ? 48.937 -3.452  -41.418 1.00 67.16  ? 194  ILE A O   1 
ATOM   1579 C CB  . ILE A 1 194 ? 48.409 -3.137  -38.152 1.00 59.10  ? 194  ILE A CB  1 
ATOM   1580 C CG1 . ILE A 1 194 ? 47.661 -3.616  -36.912 1.00 51.45  ? 194  ILE A CG1 1 
ATOM   1581 C CG2 . ILE A 1 194 ? 47.705 -1.924  -38.763 1.00 62.65  ? 194  ILE A CG2 1 
ATOM   1582 C CD1 . ILE A 1 194 ? 47.762 -2.658  -35.740 1.00 50.56  ? 194  ILE A CD1 1 
ATOM   1583 N N   . SER A 1 195 ? 50.724 -3.611  -40.053 1.00 64.43  ? 195  SER A N   1 
ATOM   1584 C CA  . SER A 1 195 ? 51.686 -3.116  -41.021 1.00 58.98  ? 195  SER A CA  1 
ATOM   1585 C C   . SER A 1 195 ? 53.010 -3.849  -40.840 1.00 63.57  ? 195  SER A C   1 
ATOM   1586 O O   . SER A 1 195 ? 53.039 -4.981  -40.358 1.00 64.52  ? 195  SER A O   1 
ATOM   1587 C CB  . SER A 1 195 ? 51.885 -1.617  -40.836 1.00 52.75  ? 195  SER A CB  1 
ATOM   1588 O OG  . SER A 1 195 ? 52.345 -1.323  -39.536 1.00 45.15  ? 195  SER A OG  1 
ATOM   1589 N N   . ASP A 1 196 ? 54.106 -3.202  -41.218 1.00 69.61  ? 196  ASP A N   1 
ATOM   1590 C CA  . ASP A 1 196 ? 55.428 -3.797  -41.041 1.00 75.99  ? 196  ASP A CA  1 
ATOM   1591 C C   . ASP A 1 196 ? 55.999 -3.493  -39.658 1.00 70.80  ? 196  ASP A C   1 
ATOM   1592 O O   . ASP A 1 196 ? 56.918 -4.166  -39.191 1.00 70.47  ? 196  ASP A O   1 
ATOM   1593 C CB  . ASP A 1 196 ? 56.391 -3.324  -42.133 1.00 86.40  ? 196  ASP A CB  1 
ATOM   1594 C CG  . ASP A 1 196 ? 56.107 -3.968  -43.481 1.00 93.16  ? 196  ASP A CG  1 
ATOM   1595 O OD1 . ASP A 1 196 ? 57.040 -4.064  -44.309 1.00 97.50  ? 196  ASP A OD1 1 
ATOM   1596 O OD2 . ASP A 1 196 ? 54.949 -4.381  -43.713 1.00 90.96  ? 196  ASP A OD2 1 
ATOM   1597 N N   . HIS A 1 197 ? 55.438 -2.486  -38.998 1.00 69.02  ? 197  HIS A N   1 
ATOM   1598 C CA  . HIS A 1 197 ? 55.955 -2.041  -37.709 1.00 69.46  ? 197  HIS A CA  1 
ATOM   1599 C C   . HIS A 1 197 ? 55.037 -2.382  -36.532 1.00 60.10  ? 197  HIS A C   1 
ATOM   1600 O O   . HIS A 1 197 ? 55.427 -2.233  -35.372 1.00 52.97  ? 197  HIS A O   1 
ATOM   1601 C CB  . HIS A 1 197 ? 56.219 -0.534  -37.741 1.00 79.44  ? 197  HIS A CB  1 
ATOM   1602 C CG  . HIS A 1 197 ? 57.086 -0.095  -38.879 1.00 90.57  ? 197  HIS A CG  1 
ATOM   1603 N ND1 . HIS A 1 197 ? 58.349 -0.606  -39.097 1.00 95.33  ? 197  HIS A ND1 1 
ATOM   1604 C CD2 . HIS A 1 197 ? 56.878 0.817   -39.858 1.00 94.36  ? 197  HIS A CD2 1 
ATOM   1605 C CE1 . HIS A 1 197 ? 58.877 -0.032  -40.162 1.00 96.91  ? 197  HIS A CE1 1 
ATOM   1606 N NE2 . HIS A 1 197 ? 58.004 0.836   -40.643 1.00 97.73  ? 197  HIS A NE2 1 
ATOM   1607 N N   . GLU A 1 198 ? 53.825 -2.842  -36.826 1.00 50.30  ? 198  GLU A N   1 
ATOM   1608 C CA  . GLU A 1 198 ? 52.852 -3.105  -35.772 1.00 45.98  ? 198  GLU A CA  1 
ATOM   1609 C C   . GLU A 1 198 ? 52.032 -4.374  -35.976 1.00 40.48  ? 198  GLU A C   1 
ATOM   1610 O O   . GLU A 1 198 ? 51.947 -4.911  -37.078 1.00 45.33  ? 198  GLU A O   1 
ATOM   1611 C CB  . GLU A 1 198 ? 51.912 -1.910  -35.596 1.00 44.54  ? 198  GLU A CB  1 
ATOM   1612 C CG  . GLU A 1 198 ? 52.516 -0.753  -34.831 1.00 49.64  ? 198  GLU A CG  1 
ATOM   1613 C CD  . GLU A 1 198 ? 51.526 0.370   -34.612 1.00 64.81  ? 198  GLU A CD  1 
ATOM   1614 O OE1 . GLU A 1 198 ? 50.579 0.494   -35.419 1.00 68.02  ? 198  GLU A OE1 1 
ATOM   1615 O OE2 . GLU A 1 198 ? 51.690 1.124   -33.629 1.00 70.88  ? 198  GLU A OE2 1 
ATOM   1616 N N   . ALA A 1 199 ? 51.429 -4.835  -34.887 1.00 32.32  ? 199  ALA A N   1 
ATOM   1617 C CA  . ALA A 1 199 ? 50.551 -5.993  -34.904 1.00 30.74  ? 199  ALA A CA  1 
ATOM   1618 C C   . ALA A 1 199 ? 49.660 -5.964  -33.668 1.00 36.81  ? 199  ALA A C   1 
ATOM   1619 O O   . ALA A 1 199 ? 50.029 -5.398  -32.638 1.00 36.12  ? 199  ALA A O   1 
ATOM   1620 C CB  . ALA A 1 199 ? 51.363 -7.274  -34.939 1.00 25.48  ? 199  ALA A CB  1 
ATOM   1621 N N   . THR A 1 200 ? 48.482 -6.565  -33.773 1.00 36.33  ? 200  THR A N   1 
ATOM   1622 C CA  . THR A 1 200 ? 47.585 -6.653  -32.633 1.00 42.58  ? 200  THR A CA  1 
ATOM   1623 C C   . THR A 1 200 ? 47.692 -8.023  -31.976 1.00 42.84  ? 200  THR A C   1 
ATOM   1624 O O   . THR A 1 200 ? 47.638 -9.052  -32.651 1.00 42.67  ? 200  THR A O   1 
ATOM   1625 C CB  . THR A 1 200 ? 46.115 -6.400  -33.035 1.00 41.74  ? 200  THR A CB  1 
ATOM   1626 O OG1 . THR A 1 200 ? 45.989 -5.090  -33.598 1.00 46.72  ? 200  THR A OG1 1 
ATOM   1627 C CG2 . THR A 1 200 ? 45.197 -6.512  -31.819 1.00 29.94  ? 200  THR A CG2 1 
ATOM   1628 N N   . LEU A 1 201 ? 47.868 -8.027  -30.660 1.00 34.33  ? 201  LEU A N   1 
ATOM   1629 C CA  . LEU A 1 201 ? 47.745 -9.248  -29.881 1.00 36.07  ? 201  LEU A CA  1 
ATOM   1630 C C   . LEU A 1 201 ? 46.353 -9.258  -29.274 1.00 39.13  ? 201  LEU A C   1 
ATOM   1631 O O   . LEU A 1 201 ? 45.919 -8.264  -28.690 1.00 40.23  ? 201  LEU A O   1 
ATOM   1632 C CB  . LEU A 1 201 ? 48.801 -9.305  -28.776 1.00 33.89  ? 201  LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 201 ? 50.256 -9.424  -29.234 1.00 31.41  ? 201  LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 201 ? 51.202 -9.407  -28.041 1.00 33.47  ? 201  LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 201 ? 50.449 -10.683 -30.053 1.00 23.26  ? 201  LEU A CD2 1 
ATOM   1636 N N   . ARG A 1 202 ? 45.645 -10.371 -29.425 1.00 33.57  ? 202  ARG A N   1 
ATOM   1637 C CA  . ARG A 1 202 ? 44.299 -10.469 -28.881 1.00 31.12  ? 202  ARG A CA  1 
ATOM   1638 C C   . ARG A 1 202 ? 44.166 -11.652 -27.928 1.00 31.63  ? 202  ARG A C   1 
ATOM   1639 O O   . ARG A 1 202 ? 44.512 -12.781 -28.270 1.00 36.84  ? 202  ARG A O   1 
ATOM   1640 C CB  . ARG A 1 202 ? 43.255 -10.543 -30.003 1.00 27.93  ? 202  ARG A CB  1 
ATOM   1641 C CG  . ARG A 1 202 ? 41.826 -10.593 -29.492 1.00 35.57  ? 202  ARG A CG  1 
ATOM   1642 C CD  . ARG A 1 202 ? 40.806 -10.426 -30.607 1.00 39.43  ? 202  ARG A CD  1 
ATOM   1643 N NE  . ARG A 1 202 ? 40.860 -9.095  -31.201 1.00 41.64  ? 202  ARG A NE  1 
ATOM   1644 C CZ  . ARG A 1 202 ? 41.292 -8.849  -32.432 1.00 44.36  ? 202  ARG A CZ  1 
ATOM   1645 N NH1 . ARG A 1 202 ? 41.698 -9.851  -33.200 1.00 49.76  ? 202  ARG A NH1 1 
ATOM   1646 N NH2 . ARG A 1 202 ? 41.310 -7.607  -32.899 1.00 35.89  ? 202  ARG A NH2 1 
ATOM   1647 N N   . CYS A 1 203 ? 43.667 -11.377 -26.728 1.00 33.90  ? 203  CYS A N   1 
ATOM   1648 C CA  . CYS A 1 203 ? 43.461 -12.407 -25.716 1.00 32.35  ? 203  CYS A CA  1 
ATOM   1649 C C   . CYS A 1 203 ? 41.989 -12.805 -25.649 1.00 24.88  ? 203  CYS A C   1 
ATOM   1650 O O   . CYS A 1 203 ? 41.127 -11.979 -25.358 1.00 29.39  ? 203  CYS A O   1 
ATOM   1651 C CB  . CYS A 1 203 ? 43.937 -11.906 -24.350 1.00 29.45  ? 203  CYS A CB  1 
ATOM   1652 S SG  . CYS A 1 203 ? 43.919 -13.144 -23.033 1.00 56.16  ? 203  CYS A SG  1 
ATOM   1653 N N   . TRP A 1 204 ? 41.708 -14.074 -25.922 1.00 23.33  ? 204  TRP A N   1 
ATOM   1654 C CA  . TRP A 1 204 ? 40.336 -14.574 -25.936 1.00 22.86  ? 204  TRP A CA  1 
ATOM   1655 C C   . TRP A 1 204 ? 39.980 -15.320 -24.665 1.00 20.39  ? 204  TRP A C   1 
ATOM   1656 O O   . TRP A 1 204 ? 40.757 -16.145 -24.186 1.00 27.89  ? 204  TRP A O   1 
ATOM   1657 C CB  . TRP A 1 204 ? 40.126 -15.527 -27.114 1.00 24.83  ? 204  TRP A CB  1 
ATOM   1658 C CG  . TRP A 1 204 ? 40.195 -14.884 -28.455 1.00 24.47  ? 204  TRP A CG  1 
ATOM   1659 C CD1 . TRP A 1 204 ? 41.318 -14.628 -29.183 1.00 29.75  ? 204  TRP A CD1 1 
ATOM   1660 C CD2 . TRP A 1 204 ? 39.092 -14.433 -29.244 1.00 25.27  ? 204  TRP A CD2 1 
ATOM   1661 N NE1 . TRP A 1 204 ? 40.983 -14.037 -30.375 1.00 31.37  ? 204  TRP A NE1 1 
ATOM   1662 C CE2 . TRP A 1 204 ? 39.621 -13.905 -30.438 1.00 28.99  ? 204  TRP A CE2 1 
ATOM   1663 C CE3 . TRP A 1 204 ? 37.706 -14.420 -29.057 1.00 31.87  ? 204  TRP A CE3 1 
ATOM   1664 C CZ2 . TRP A 1 204 ? 38.815 -13.368 -31.439 1.00 32.84  ? 204  TRP A CZ2 1 
ATOM   1665 C CZ3 . TRP A 1 204 ? 36.907 -13.888 -30.052 1.00 34.34  ? 204  TRP A CZ3 1 
ATOM   1666 C CH2 . TRP A 1 204 ? 37.464 -13.369 -31.228 1.00 34.94  ? 204  TRP A CH2 1 
ATOM   1667 N N   . ALA A 1 205 ? 38.797 -15.034 -24.132 1.00 21.61  ? 205  ALA A N   1 
ATOM   1668 C CA  . ALA A 1 205 ? 38.196 -15.862 -23.091 1.00 18.22  ? 205  ALA A CA  1 
ATOM   1669 C C   . ALA A 1 205 ? 36.862 -16.399 -23.602 1.00 20.43  ? 205  ALA A C   1 
ATOM   1670 O O   . ALA A 1 205 ? 36.011 -15.630 -24.046 1.00 23.00  ? 205  ALA A O   1 
ATOM   1671 C CB  . ALA A 1 205 ? 37.995 -15.067 -21.820 1.00 14.84  ? 205  ALA A CB  1 
ATOM   1672 N N   . LEU A 1 206 ? 36.692 -17.717 -23.547 1.00 17.99  ? 206  LEU A N   1 
ATOM   1673 C CA  . LEU A 1 206 ? 35.486 -18.361 -24.058 1.00 20.91  ? 206  LEU A CA  1 
ATOM   1674 C C   . LEU A 1 206 ? 34.837 -19.276 -23.021 1.00 23.46  ? 206  LEU A C   1 
ATOM   1675 O O   . LEU A 1 206 ? 35.501 -19.784 -22.120 1.00 21.14  ? 206  LEU A O   1 
ATOM   1676 C CB  . LEU A 1 206 ? 35.798 -19.182 -25.319 1.00 24.25  ? 206  LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 206 ? 36.317 -18.509 -26.598 1.00 28.87  ? 206  LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 206 ? 35.416 -17.366 -27.037 1.00 26.34  ? 206  LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 206 ? 37.747 -18.032 -26.432 1.00 36.80  ? 206  LEU A CD2 1 
ATOM   1680 N N   . GLY A 1 207 ? 33.531 -19.474 -23.163 1.00 26.97  ? 207  GLY A N   1 
ATOM   1681 C CA  . GLY A 1 207 ? 32.788 -20.436 -22.370 1.00 31.82  ? 207  GLY A CA  1 
ATOM   1682 C C   . GLY A 1 207 ? 32.881 -20.322 -20.859 1.00 30.97  ? 207  GLY A C   1 
ATOM   1683 O O   . GLY A 1 207 ? 33.036 -21.337 -20.181 1.00 36.58  ? 207  GLY A O   1 
ATOM   1684 N N   . PHE A 1 208 ? 32.766 -19.112 -20.319 1.00 22.11  ? 208  PHE A N   1 
ATOM   1685 C CA  . PHE A 1 208 ? 32.858 -18.934 -18.868 1.00 25.90  ? 208  PHE A CA  1 
ATOM   1686 C C   . PHE A 1 208 ? 31.546 -18.513 -18.199 1.00 27.53  ? 208  PHE A C   1 
ATOM   1687 O O   . PHE A 1 208 ? 30.674 -17.916 -18.831 1.00 28.17  ? 208  PHE A O   1 
ATOM   1688 C CB  . PHE A 1 208 ? 33.982 -17.955 -18.499 1.00 27.76  ? 208  PHE A CB  1 
ATOM   1689 C CG  . PHE A 1 208 ? 33.836 -16.593 -19.116 1.00 24.64  ? 208  PHE A CG  1 
ATOM   1690 C CD1 . PHE A 1 208 ? 33.005 -15.644 -18.541 1.00 22.38  ? 208  PHE A CD1 1 
ATOM   1691 C CD2 . PHE A 1 208 ? 34.541 -16.257 -20.265 1.00 21.93  ? 208  PHE A CD2 1 
ATOM   1692 C CE1 . PHE A 1 208 ? 32.869 -14.384 -19.100 1.00 21.59  ? 208  PHE A CE1 1 
ATOM   1693 C CE2 . PHE A 1 208 ? 34.408 -14.999 -20.834 1.00 19.83  ? 208  PHE A CE2 1 
ATOM   1694 C CZ  . PHE A 1 208 ? 33.572 -14.062 -20.248 1.00 27.20  ? 208  PHE A CZ  1 
ATOM   1695 N N   . TYR A 1 209 ? 31.421 -18.846 -16.915 1.00 28.96  ? 209  TYR A N   1 
ATOM   1696 C CA  . TYR A 1 209 ? 30.297 -18.416 -16.087 1.00 25.77  ? 209  TYR A CA  1 
ATOM   1697 C C   . TYR A 1 209 ? 30.749 -18.259 -14.640 1.00 30.60  ? 209  TYR A C   1 
ATOM   1698 O O   . TYR A 1 209 ? 31.459 -19.117 -14.117 1.00 32.64  ? 209  TYR A O   1 
ATOM   1699 C CB  . TYR A 1 209 ? 29.131 -19.406 -16.166 1.00 18.11  ? 209  TYR A CB  1 
ATOM   1700 C CG  . TYR A 1 209 ? 27.892 -18.900 -15.463 1.00 22.25  ? 209  TYR A CG  1 
ATOM   1701 C CD1 . TYR A 1 209 ? 26.969 -18.106 -16.130 1.00 18.78  ? 209  TYR A CD1 1 
ATOM   1702 C CD2 . TYR A 1 209 ? 27.655 -19.203 -14.130 1.00 22.79  ? 209  TYR A CD2 1 
ATOM   1703 C CE1 . TYR A 1 209 ? 25.842 -17.634 -15.494 1.00 20.06  ? 209  TYR A CE1 1 
ATOM   1704 C CE2 . TYR A 1 209 ? 26.532 -18.734 -13.478 1.00 21.05  ? 209  TYR A CE2 1 
ATOM   1705 C CZ  . TYR A 1 209 ? 25.628 -17.951 -14.167 1.00 23.09  ? 209  TYR A CZ  1 
ATOM   1706 O OH  . TYR A 1 209 ? 24.507 -17.484 -13.528 1.00 20.61  ? 209  TYR A OH  1 
ATOM   1707 N N   . PRO A 1 210 ? 30.328 -17.169 -13.978 1.00 34.73  ? 210  PRO A N   1 
ATOM   1708 C CA  . PRO A 1 210 ? 29.459 -16.097 -14.486 1.00 33.33  ? 210  PRO A CA  1 
ATOM   1709 C C   . PRO A 1 210 ? 30.177 -15.141 -15.440 1.00 35.37  ? 210  PRO A C   1 
ATOM   1710 O O   . PRO A 1 210 ? 31.317 -15.397 -15.824 1.00 35.49  ? 210  PRO A O   1 
ATOM   1711 C CB  . PRO A 1 210 ? 29.040 -15.356 -13.213 1.00 29.56  ? 210  PRO A CB  1 
ATOM   1712 C CG  . PRO A 1 210 ? 30.166 -15.605 -12.243 1.00 31.93  ? 210  PRO A CG  1 
ATOM   1713 C CD  . PRO A 1 210 ? 30.646 -17.000 -12.547 1.00 31.38  ? 210  PRO A CD  1 
ATOM   1714 N N   . ALA A 1 211 ? 29.510 -14.044 -15.790 1.00 31.51  ? 211  ALA A N   1 
ATOM   1715 C CA  . ALA A 1 211 ? 29.965 -13.142 -16.851 1.00 29.12  ? 211  ALA A CA  1 
ATOM   1716 C C   . ALA A 1 211 ? 31.039 -12.139 -16.439 1.00 32.30  ? 211  ALA A C   1 
ATOM   1717 O O   . ALA A 1 211 ? 31.625 -11.469 -17.293 1.00 38.10  ? 211  ALA A O   1 
ATOM   1718 C CB  . ALA A 1 211 ? 28.781 -12.421 -17.465 1.00 22.94  ? 211  ALA A CB  1 
ATOM   1719 N N   . GLU A 1 212 ? 31.280 -12.008 -15.140 1.00 32.52  ? 212  GLU A N   1 
ATOM   1720 C CA  . GLU A 1 212 ? 32.290 -11.069 -14.675 1.00 32.28  ? 212  GLU A CA  1 
ATOM   1721 C C   . GLU A 1 212 ? 33.691 -11.654 -14.838 1.00 34.52  ? 212  GLU A C   1 
ATOM   1722 O O   . GLU A 1 212 ? 33.994 -12.741 -14.330 1.00 38.87  ? 212  GLU A O   1 
ATOM   1723 C CB  . GLU A 1 212 ? 32.036 -10.653 -13.226 1.00 36.12  ? 212  GLU A CB  1 
ATOM   1724 C CG  . GLU A 1 212 ? 32.887 -9.465  -12.787 1.00 51.70  ? 212  GLU A CG  1 
ATOM   1725 C CD  . GLU A 1 212 ? 32.623 -9.031  -11.350 1.00 69.45  ? 212  GLU A CD  1 
ATOM   1726 O OE1 . GLU A 1 212 ? 33.606 -8.644  -10.663 1.00 74.22  ? 212  GLU A OE1 1 
ATOM   1727 O OE2 . GLU A 1 212 ? 31.440 -9.059  -10.914 1.00 74.99  ? 212  GLU A OE2 1 
ATOM   1728 N N   . ILE A 1 213 ? 34.535 -10.918 -15.555 1.00 24.93  ? 213  ILE A N   1 
ATOM   1729 C CA  . ILE A 1 213 ? 35.886 -11.358 -15.889 1.00 28.89  ? 213  ILE A CA  1 
ATOM   1730 C C   . ILE A 1 213 ? 36.778 -10.139 -16.108 1.00 32.55  ? 213  ILE A C   1 
ATOM   1731 O O   . ILE A 1 213 ? 36.300 -9.091  -16.547 1.00 30.63  ? 213  ILE A O   1 
ATOM   1732 C CB  . ILE A 1 213 ? 35.882 -12.241 -17.163 1.00 26.83  ? 213  ILE A CB  1 
ATOM   1733 C CG1 . ILE A 1 213 ? 37.238 -12.921 -17.356 1.00 21.33  ? 213  ILE A CG1 1 
ATOM   1734 C CG2 . ILE A 1 213 ? 35.495 -11.424 -18.398 1.00 17.57  ? 213  ILE A CG2 1 
ATOM   1735 C CD1 . ILE A 1 213 ? 37.256 -13.925 -18.491 1.00 13.69  ? 213  ILE A CD1 1 
ATOM   1736 N N   . THR A 1 214 ? 38.065 -10.277 -15.799 1.00 27.09  ? 214  THR A N   1 
ATOM   1737 C CA  . THR A 1 214 ? 39.020 -9.191  -15.998 1.00 29.16  ? 214  THR A CA  1 
ATOM   1738 C C   . THR A 1 214 ? 40.162 -9.644  -16.902 1.00 29.93  ? 214  THR A C   1 
ATOM   1739 O O   . THR A 1 214 ? 40.904 -10.570 -16.560 1.00 30.10  ? 214  THR A O   1 
ATOM   1740 C CB  . THR A 1 214 ? 39.598 -8.689  -14.666 1.00 35.51  ? 214  THR A CB  1 
ATOM   1741 O OG1 . THR A 1 214 ? 38.531 -8.346  -13.771 1.00 43.83  ? 214  THR A OG1 1 
ATOM   1742 C CG2 . THR A 1 214 ? 40.478 -7.468  -14.892 1.00 30.27  ? 214  THR A CG2 1 
ATOM   1743 N N   . LEU A 1 215 ? 40.286 -8.998  -18.061 1.00 30.10  ? 215  LEU A N   1 
ATOM   1744 C CA  . LEU A 1 215 ? 41.363 -9.295  -19.002 1.00 33.07  ? 215  LEU A CA  1 
ATOM   1745 C C   . LEU A 1 215 ? 42.342 -8.127  -19.079 1.00 39.77  ? 215  LEU A C   1 
ATOM   1746 O O   . LEU A 1 215 ? 41.996 -7.035  -19.540 1.00 38.14  ? 215  LEU A O   1 
ATOM   1747 C CB  . LEU A 1 215 ? 40.804 -9.611  -20.391 1.00 30.00  ? 215  LEU A CB  1 
ATOM   1748 C CG  . LEU A 1 215 ? 40.361 -11.048 -20.678 1.00 31.38  ? 215  LEU A CG  1 
ATOM   1749 C CD1 . LEU A 1 215 ? 39.425 -11.557 -19.600 1.00 37.15  ? 215  LEU A CD1 1 
ATOM   1750 C CD2 . LEU A 1 215 ? 39.702 -11.148 -22.049 1.00 25.98  ? 215  LEU A CD2 1 
ATOM   1751 N N   . THR A 1 216 ? 43.568 -8.366  -18.628 1.00 38.67  ? 216  THR A N   1 
ATOM   1752 C CA  . THR A 1 216 ? 44.584 -7.325  -18.609 1.00 38.72  ? 216  THR A CA  1 
ATOM   1753 C C   . THR A 1 216 ? 45.760 -7.689  -19.504 1.00 35.20  ? 216  THR A C   1 
ATOM   1754 O O   . THR A 1 216 ? 46.250 -8.816  -19.468 1.00 36.86  ? 216  THR A O   1 
ATOM   1755 C CB  . THR A 1 216 ? 45.107 -7.096  -17.181 1.00 46.16  ? 216  THR A CB  1 
ATOM   1756 O OG1 . THR A 1 216 ? 44.007 -6.800  -16.315 1.00 49.71  ? 216  THR A OG1 1 
ATOM   1757 C CG2 . THR A 1 216 ? 46.101 -5.943  -17.148 1.00 50.21  ? 216  THR A CG2 1 
ATOM   1758 N N   . TRP A 1 217 ? 46.204 -6.734  -20.312 1.00 33.81  ? 217  TRP A N   1 
ATOM   1759 C CA  . TRP A 1 217 ? 47.443 -6.903  -21.060 1.00 35.80  ? 217  TRP A CA  1 
ATOM   1760 C C   . TRP A 1 217 ? 48.614 -6.299  -20.298 1.00 39.70  ? 217  TRP A C   1 
ATOM   1761 O O   . TRP A 1 217 ? 48.540 -5.172  -19.810 1.00 35.18  ? 217  TRP A O   1 
ATOM   1762 C CB  . TRP A 1 217 ? 47.339 -6.294  -22.456 1.00 30.43  ? 217  TRP A CB  1 
ATOM   1763 C CG  . TRP A 1 217 ? 46.810 -7.255  -23.465 1.00 31.58  ? 217  TRP A CG  1 
ATOM   1764 C CD1 . TRP A 1 217 ? 45.585 -7.222  -24.070 1.00 33.84  ? 217  TRP A CD1 1 
ATOM   1765 C CD2 . TRP A 1 217 ? 47.483 -8.408  -23.980 1.00 26.72  ? 217  TRP A CD2 1 
ATOM   1766 N NE1 . TRP A 1 217 ? 45.459 -8.282  -24.936 1.00 32.08  ? 217  TRP A NE1 1 
ATOM   1767 C CE2 . TRP A 1 217 ? 46.610 -9.025  -24.901 1.00 27.57  ? 217  TRP A CE2 1 
ATOM   1768 C CE3 . TRP A 1 217 ? 48.741 -8.976  -23.758 1.00 30.27  ? 217  TRP A CE3 1 
ATOM   1769 C CZ2 . TRP A 1 217 ? 46.956 -10.182 -25.597 1.00 29.56  ? 217  TRP A CZ2 1 
ATOM   1770 C CZ3 . TRP A 1 217 ? 49.085 -10.125 -24.450 1.00 30.87  ? 217  TRP A CZ3 1 
ATOM   1771 C CH2 . TRP A 1 217 ? 48.195 -10.716 -25.358 1.00 38.04  ? 217  TRP A CH2 1 
ATOM   1772 N N   . GLN A 1 218 ? 49.692 -7.066  -20.189 1.00 46.13  ? 218  GLN A N   1 
ATOM   1773 C CA  . GLN A 1 218 ? 50.870 -6.627  -19.458 1.00 44.01  ? 218  GLN A CA  1 
ATOM   1774 C C   . GLN A 1 218 ? 52.078 -6.567  -20.375 1.00 43.75  ? 218  GLN A C   1 
ATOM   1775 O O   . GLN A 1 218 ? 52.203 -7.357  -21.310 1.00 42.77  ? 218  GLN A O   1 
ATOM   1776 C CB  . GLN A 1 218 ? 51.164 -7.571  -18.294 1.00 47.91  ? 218  GLN A CB  1 
ATOM   1777 C CG  . GLN A 1 218 ? 50.016 -7.747  -17.321 1.00 63.45  ? 218  GLN A CG  1 
ATOM   1778 C CD  . GLN A 1 218 ? 50.350 -8.721  -16.210 1.00 76.74  ? 218  GLN A CD  1 
ATOM   1779 O OE1 . GLN A 1 218 ? 51.512 -9.073  -16.006 1.00 80.54  ? 218  GLN A OE1 1 
ATOM   1780 N NE2 . GLN A 1 218 ? 49.330 -9.166  -15.489 1.00 81.42  ? 218  GLN A NE2 1 
ATOM   1781 N N   . ARG A 1 219 ? 52.966 -5.621  -20.099 1.00 45.08  ? 219  ARG A N   1 
ATOM   1782 C CA  . ARG A 1 219 ? 54.226 -5.519  -20.814 1.00 47.60  ? 219  ARG A CA  1 
ATOM   1783 C C   . ARG A 1 219 ? 55.395 -5.514  -19.835 1.00 51.99  ? 219  ARG A C   1 
ATOM   1784 O O   . ARG A 1 219 ? 55.580 -4.554  -19.087 1.00 53.82  ? 219  ARG A O   1 
ATOM   1785 C CB  . ARG A 1 219 ? 54.256 -4.252  -21.658 1.00 50.17  ? 219  ARG A CB  1 
ATOM   1786 C CG  . ARG A 1 219 ? 55.646 -3.887  -22.105 1.00 58.26  ? 219  ARG A CG  1 
ATOM   1787 C CD  . ARG A 1 219 ? 55.627 -2.873  -23.213 1.00 69.45  ? 219  ARG A CD  1 
ATOM   1788 N NE  . ARG A 1 219 ? 56.927 -2.810  -23.866 1.00 90.45  ? 219  ARG A NE  1 
ATOM   1789 C CZ  . ARG A 1 219 ? 57.334 -3.658  -24.805 1.00 103.54 ? 219  ARG A CZ  1 
ATOM   1790 N NH1 . ARG A 1 219 ? 58.537 -3.525  -25.349 1.00 104.06 ? 219  ARG A NH1 1 
ATOM   1791 N NH2 . ARG A 1 219 ? 56.540 -4.642  -25.200 1.00 110.36 ? 219  ARG A NH2 1 
ATOM   1792 N N   . ASP A 1 220 ? 56.179 -6.590  -19.842 1.00 54.16  ? 220  ASP A N   1 
ATOM   1793 C CA  . ASP A 1 220 ? 57.316 -6.727  -18.931 1.00 63.82  ? 220  ASP A CA  1 
ATOM   1794 C C   . ASP A 1 220 ? 56.881 -6.632  -17.471 1.00 64.81  ? 220  ASP A C   1 
ATOM   1795 O O   . ASP A 1 220 ? 57.703 -6.383  -16.585 1.00 61.94  ? 220  ASP A O   1 
ATOM   1796 C CB  . ASP A 1 220 ? 58.384 -5.666  -19.222 1.00 68.10  ? 220  ASP A CB  1 
ATOM   1797 C CG  . ASP A 1 220 ? 59.000 -5.815  -20.600 1.00 68.21  ? 220  ASP A CG  1 
ATOM   1798 O OD1 . ASP A 1 220 ? 59.117 -6.962  -21.083 1.00 67.48  ? 220  ASP A OD1 1 
ATOM   1799 O OD2 . ASP A 1 220 ? 59.368 -4.780  -21.198 1.00 67.32  ? 220  ASP A OD2 1 
ATOM   1800 N N   . GLY A 1 221 ? 55.588 -6.826  -17.228 1.00 64.40  ? 221  GLY A N   1 
ATOM   1801 C CA  . GLY A 1 221 ? 55.033 -6.714  -15.892 1.00 64.52  ? 221  GLY A CA  1 
ATOM   1802 C C   . GLY A 1 221 ? 54.001 -5.607  -15.764 1.00 67.26  ? 221  GLY A C   1 
ATOM   1803 O O   . GLY A 1 221 ? 52.938 -5.810  -15.176 1.00 71.90  ? 221  GLY A O   1 
ATOM   1804 N N   . GLU A 1 222 ? 54.314 -4.436  -16.313 1.00 65.44  ? 222  GLU A N   1 
ATOM   1805 C CA  . GLU A 1 222 ? 53.409 -3.291  -16.261 1.00 72.28  ? 222  GLU A CA  1 
ATOM   1806 C C   . GLU A 1 222 ? 52.070 -3.604  -16.912 1.00 73.19  ? 222  GLU A C   1 
ATOM   1807 O O   . GLU A 1 222 ? 51.974 -4.499  -17.746 1.00 76.36  ? 222  GLU A O   1 
ATOM   1808 C CB  . GLU A 1 222 ? 54.031 -2.084  -16.964 1.00 81.41  ? 222  GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 222 ? 55.283 -1.538  -16.309 1.00 90.63  ? 222  GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 222 ? 55.780 -0.278  -16.992 1.00 102.03 ? 222  GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 222 ? 55.253 0.058   -18.074 1.00 102.66 ? 222  GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 222 ? 56.691 0.378   -16.446 1.00 108.60 ? 222  GLU A OE2 1 
ATOM   1813 N N   . ASP A 1 223 ? 51.039 -2.855  -16.534 1.00 74.44  ? 223  ASP A N   1 
ATOM   1814 C CA  . ASP A 1 223 ? 49.721 -3.004  -17.145 1.00 74.55  ? 223  ASP A CA  1 
ATOM   1815 C C   . ASP A 1 223 ? 49.510 -1.979  -18.257 1.00 68.96  ? 223  ASP A C   1 
ATOM   1816 O O   . ASP A 1 223 ? 49.824 -0.800  -18.096 1.00 65.68  ? 223  ASP A O   1 
ATOM   1817 C CB  . ASP A 1 223 ? 48.615 -2.888  -16.092 1.00 79.54  ? 223  ASP A CB  1 
ATOM   1818 C CG  . ASP A 1 223 ? 48.561 -4.090  -15.167 1.00 85.51  ? 223  ASP A CG  1 
ATOM   1819 O OD1 . ASP A 1 223 ? 48.917 -5.202  -15.612 1.00 88.30  ? 223  ASP A OD1 1 
ATOM   1820 O OD2 . ASP A 1 223 ? 48.161 -3.927  -13.995 1.00 87.11  ? 223  ASP A OD2 1 
ATOM   1821 N N   . GLN A 1 224 ? 48.979 -2.440  -19.384 1.00 67.36  ? 224  GLN A N   1 
ATOM   1822 C CA  . GLN A 1 224 ? 48.749 -1.581  -20.540 1.00 68.58  ? 224  GLN A CA  1 
ATOM   1823 C C   . GLN A 1 224 ? 47.280 -1.197  -20.649 1.00 77.40  ? 224  GLN A C   1 
ATOM   1824 O O   . GLN A 1 224 ? 46.757 -1.020  -21.750 1.00 81.02  ? 224  GLN A O   1 
ATOM   1825 C CB  . GLN A 1 224 ? 49.191 -2.289  -21.821 1.00 65.51  ? 224  GLN A CB  1 
ATOM   1826 C CG  . GLN A 1 224 ? 50.634 -2.755  -21.806 1.00 64.41  ? 224  GLN A CG  1 
ATOM   1827 C CD  . GLN A 1 224 ? 51.614 -1.604  -21.731 1.00 66.53  ? 224  GLN A CD  1 
ATOM   1828 O OE1 . GLN A 1 224 ? 51.909 -0.961  -22.739 1.00 64.23  ? 224  GLN A OE1 1 
ATOM   1829 N NE2 . GLN A 1 224 ? 52.125 -1.336  -20.534 1.00 68.20  ? 224  GLN A NE2 1 
ATOM   1830 N N   . THR A 1 225 ? 46.625 -1.069  -19.500 1.00 82.85  ? 225  THR A N   1 
ATOM   1831 C CA  . THR A 1 225 ? 45.198 -0.763  -19.437 1.00 85.38  ? 225  THR A CA  1 
ATOM   1832 C C   . THR A 1 225 ? 44.818 0.461   -20.265 1.00 84.10  ? 225  THR A C   1 
ATOM   1833 O O   . THR A 1 225 ? 43.664 0.618   -20.666 1.00 81.85  ? 225  THR A O   1 
ATOM   1834 C CB  . THR A 1 225 ? 44.756 -0.515  -17.985 1.00 88.52  ? 225  THR A CB  1 
ATOM   1835 O OG1 . THR A 1 225 ? 45.472 0.607   -17.453 1.00 90.50  ? 225  THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 225 ? 45.035 -1.741  -17.126 1.00 88.94  ? 225  THR A CG2 1 
ATOM   1837 N N   . GLN A 1 226 ? 45.797 1.321   -20.522 1.00 86.53  ? 226  GLN A N   1 
ATOM   1838 C CA  . GLN A 1 226 ? 45.555 2.600   -21.177 1.00 86.74  ? 226  GLN A CA  1 
ATOM   1839 C C   . GLN A 1 226 ? 45.473 2.481   -22.701 1.00 82.70  ? 226  GLN A C   1 
ATOM   1840 O O   . GLN A 1 226 ? 44.954 3.375   -23.372 1.00 84.60  ? 226  GLN A O   1 
ATOM   1841 C CB  . GLN A 1 226 ? 46.652 3.592   -20.784 1.00 90.89  ? 226  GLN A CB  1 
ATOM   1842 C CG  . GLN A 1 226 ? 46.187 5.032   -20.641 1.00 95.02  ? 226  GLN A CG  1 
ATOM   1843 C CD  . GLN A 1 226 ? 47.276 5.938   -20.095 1.00 96.48  ? 226  GLN A CD  1 
ATOM   1844 O OE1 . GLN A 1 226 ? 48.421 5.518   -19.930 1.00 98.68  ? 226  GLN A OE1 1 
ATOM   1845 N NE2 . GLN A 1 226 ? 46.922 7.186   -19.809 1.00 94.41  ? 226  GLN A NE2 1 
ATOM   1846 N N   . ASP A 1 227 ? 45.978 1.376   -23.243 1.00 75.10  ? 227  ASP A N   1 
ATOM   1847 C CA  . ASP A 1 227 ? 46.068 1.209   -24.694 1.00 73.22  ? 227  ASP A CA  1 
ATOM   1848 C C   . ASP A 1 227 ? 45.409 -0.087  -25.173 1.00 68.20  ? 227  ASP A C   1 
ATOM   1849 O O   . ASP A 1 227 ? 45.689 -0.570  -26.274 1.00 60.91  ? 227  ASP A O   1 
ATOM   1850 C CB  . ASP A 1 227 ? 47.534 1.244   -25.128 1.00 74.82  ? 227  ASP A CB  1 
ATOM   1851 C CG  . ASP A 1 227 ? 48.348 2.257   -24.344 1.00 81.65  ? 227  ASP A CG  1 
ATOM   1852 O OD1 . ASP A 1 227 ? 48.496 3.405   -24.817 1.00 83.28  ? 227  ASP A OD1 1 
ATOM   1853 O OD2 . ASP A 1 227 ? 48.837 1.907   -23.247 1.00 83.49  ? 227  ASP A OD2 1 
ATOM   1854 N N   . THR A 1 228 ? 44.529 -0.638  -24.342 1.00 64.54  ? 228  THR A N   1 
ATOM   1855 C CA  . THR A 1 228 ? 43.877 -1.912  -24.626 1.00 57.58  ? 228  THR A CA  1 
ATOM   1856 C C   . THR A 1 228 ? 42.433 -1.735  -25.089 1.00 52.09  ? 228  THR A C   1 
ATOM   1857 O O   . THR A 1 228 ? 41.665 -0.985  -24.485 1.00 52.83  ? 228  THR A O   1 
ATOM   1858 C CB  . THR A 1 228 ? 43.872 -2.816  -23.378 1.00 53.84  ? 228  THR A CB  1 
ATOM   1859 O OG1 . THR A 1 228 ? 45.211 -2.973  -22.897 1.00 54.14  ? 228  THR A OG1 1 
ATOM   1860 C CG2 . THR A 1 228 ? 43.285 -4.185  -23.703 1.00 49.76  ? 228  THR A CG2 1 
ATOM   1861 N N   . GLU A 1 229 ? 42.068 -2.431  -26.161 1.00 44.68  ? 229  GLU A N   1 
ATOM   1862 C CA  . GLU A 1 229 ? 40.683 -2.457  -26.610 1.00 47.63  ? 229  GLU A CA  1 
ATOM   1863 C C   . GLU A 1 229 ? 39.953 -3.696  -26.095 1.00 45.57  ? 229  GLU A C   1 
ATOM   1864 O O   . GLU A 1 229 ? 40.335 -4.830  -26.397 1.00 45.69  ? 229  GLU A O   1 
ATOM   1865 C CB  . GLU A 1 229 ? 40.587 -2.392  -28.137 1.00 53.46  ? 229  GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 229 ? 39.179 -2.664  -28.663 1.00 63.10  ? 229  GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 229 ? 38.987 -2.251  -30.112 1.00 70.65  ? 229  GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 229 ? 39.486 -2.962  -31.012 1.00 69.75  ? 229  GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 229 ? 38.329 -1.215  -30.348 1.00 75.47  ? 229  GLU A OE2 1 
ATOM   1870 N N   . LEU A 1 230 ? 38.908 -3.467  -25.308 1.00 38.08  ? 230  LEU A N   1 
ATOM   1871 C CA  . LEU A 1 230 ? 38.032 -4.541  -24.860 1.00 42.05  ? 230  LEU A CA  1 
ATOM   1872 C C   . LEU A 1 230 ? 36.685 -4.436  -25.558 1.00 43.60  ? 230  LEU A C   1 
ATOM   1873 O O   . LEU A 1 230 ? 36.178 -3.336  -25.776 1.00 51.53  ? 230  LEU A O   1 
ATOM   1874 C CB  . LEU A 1 230 ? 37.809 -4.473  -23.348 1.00 40.41  ? 230  LEU A CB  1 
ATOM   1875 C CG  . LEU A 1 230 ? 38.940 -4.831  -22.386 1.00 34.82  ? 230  LEU A CG  1 
ATOM   1876 C CD1 . LEU A 1 230 ? 40.019 -3.766  -22.403 1.00 37.55  ? 230  LEU A CD1 1 
ATOM   1877 C CD2 . LEU A 1 230 ? 38.372 -4.987  -20.987 1.00 30.85  ? 230  LEU A CD2 1 
ATOM   1878 N N   . VAL A 1 231 ? 36.106 -5.577  -25.911 1.00 38.37  ? 231  VAL A N   1 
ATOM   1879 C CA  . VAL A 1 231 ? 34.722 -5.597  -26.369 1.00 35.59  ? 231  VAL A CA  1 
ATOM   1880 C C   . VAL A 1 231 ? 33.810 -5.954  -25.204 1.00 31.56  ? 231  VAL A C   1 
ATOM   1881 O O   . VAL A 1 231 ? 34.251 -6.547  -24.216 1.00 28.65  ? 231  VAL A O   1 
ATOM   1882 C CB  . VAL A 1 231 ? 34.492 -6.586  -27.529 1.00 29.53  ? 231  VAL A CB  1 
ATOM   1883 C CG1 . VAL A 1 231 ? 35.002 -6.003  -28.828 1.00 33.19  ? 231  VAL A CG1 1 
ATOM   1884 C CG2 . VAL A 1 231 ? 35.147 -7.928  -27.232 1.00 21.91  ? 231  VAL A CG2 1 
ATOM   1885 N N   . GLU A 1 232 ? 32.542 -5.580  -25.315 1.00 24.27  ? 232  GLU A N   1 
ATOM   1886 C CA  . GLU A 1 232 ? 31.584 -5.899  -24.275 1.00 24.08  ? 232  GLU A CA  1 
ATOM   1887 C C   . GLU A 1 232 ? 31.485 -7.413  -24.142 1.00 29.86  ? 232  GLU A C   1 
ATOM   1888 O O   . GLU A 1 232 ? 31.506 -8.133  -25.141 1.00 26.85  ? 232  GLU A O   1 
ATOM   1889 C CB  . GLU A 1 232 ? 30.218 -5.287  -24.591 1.00 22.57  ? 232  GLU A CB  1 
ATOM   1890 N N   . THR A 1 233 ? 31.406 -7.892  -22.905 1.00 29.42  ? 233  THR A N   1 
ATOM   1891 C CA  . THR A 1 233 ? 31.233 -9.316  -22.655 1.00 26.28  ? 233  THR A CA  1 
ATOM   1892 C C   . THR A 1 233 ? 29.949 -9.794  -23.324 1.00 19.70  ? 233  THR A C   1 
ATOM   1893 O O   . THR A 1 233 ? 28.884 -9.214  -23.122 1.00 27.31  ? 233  THR A O   1 
ATOM   1894 C CB  . THR A 1 233 ? 31.192 -9.614  -21.145 1.00 27.42  ? 233  THR A CB  1 
ATOM   1895 O OG1 . THR A 1 233 ? 32.473 -9.329  -20.568 1.00 30.65  ? 233  THR A OG1 1 
ATOM   1896 C CG2 . THR A 1 233 ? 30.841 -11.073 -20.890 1.00 17.67  ? 233  THR A CG2 1 
ATOM   1897 N N   . ARG A 1 234 ? 30.053 -10.851 -24.120 1.00 13.75  ? 234  ARG A N   1 
ATOM   1898 C CA  . ARG A 1 234 ? 28.919 -11.305 -24.921 1.00 25.37  ? 234  ARG A CA  1 
ATOM   1899 C C   . ARG A 1 234 ? 28.472 -12.720 -24.561 1.00 23.93  ? 234  ARG A C   1 
ATOM   1900 O O   . ARG A 1 234 ? 29.286 -13.556 -24.173 1.00 30.15  ? 234  ARG A O   1 
ATOM   1901 C CB  . ARG A 1 234 ? 29.263 -11.229 -26.410 1.00 21.46  ? 234  ARG A CB  1 
ATOM   1902 C CG  . ARG A 1 234 ? 30.206 -12.319 -26.877 1.00 17.69  ? 234  ARG A CG  1 
ATOM   1903 C CD  . ARG A 1 234 ? 31.001 -11.875 -28.085 1.00 20.40  ? 234  ARG A CD  1 
ATOM   1904 N NE  . ARG A 1 234 ? 31.759 -12.980 -28.665 1.00 24.99  ? 234  ARG A NE  1 
ATOM   1905 C CZ  . ARG A 1 234 ? 32.609 -12.850 -29.676 1.00 18.69  ? 234  ARG A CZ  1 
ATOM   1906 N NH1 . ARG A 1 234 ? 32.820 -11.660 -30.216 1.00 15.69  ? 234  ARG A NH1 1 
ATOM   1907 N NH2 . ARG A 1 234 ? 33.249 -13.911 -30.145 1.00 25.74  ? 234  ARG A NH2 1 
ATOM   1908 N N   . PRO A 1 235 ? 27.165 -12.988 -24.682 1.00 21.15  ? 235  PRO A N   1 
ATOM   1909 C CA  . PRO A 1 235 ? 26.612 -14.321 -24.419 1.00 24.07  ? 235  PRO A CA  1 
ATOM   1910 C C   . PRO A 1 235 ? 26.837 -15.267 -25.592 1.00 25.00  ? 235  PRO A C   1 
ATOM   1911 O O   . PRO A 1 235 ? 26.565 -14.905 -26.736 1.00 28.09  ? 235  PRO A O   1 
ATOM   1912 C CB  . PRO A 1 235 ? 25.112 -14.049 -24.255 1.00 12.76  ? 235  PRO A CB  1 
ATOM   1913 C CG  . PRO A 1 235 ? 24.865 -12.853 -25.100 1.00 19.24  ? 235  PRO A CG  1 
ATOM   1914 C CD  . PRO A 1 235 ? 26.114 -12.004 -24.992 1.00 20.47  ? 235  PRO A CD  1 
ATOM   1915 N N   . ALA A 1 236 ? 27.335 -16.463 -25.305 1.00 23.92  ? 236  ALA A N   1 
ATOM   1916 C CA  . ALA A 1 236 ? 27.480 -17.489 -26.325 1.00 22.08  ? 236  ALA A CA  1 
ATOM   1917 C C   . ALA A 1 236 ? 26.098 -18.005 -26.707 1.00 31.13  ? 236  ALA A C   1 
ATOM   1918 O O   . ALA A 1 236 ? 25.899 -18.529 -27.805 1.00 29.08  ? 236  ALA A O   1 
ATOM   1919 C CB  . ALA A 1 236 ? 28.350 -18.625 -25.814 1.00 13.35  ? 236  ALA A CB  1 
ATOM   1920 N N   . GLY A 1 237 ? 25.149 -17.848 -25.786 1.00 31.32  ? 237  GLY A N   1 
ATOM   1921 C CA  . GLY A 1 237 ? 23.779 -18.275 -26.005 1.00 31.07  ? 237  GLY A CA  1 
ATOM   1922 C C   . GLY A 1 237 ? 23.436 -19.596 -25.342 1.00 31.82  ? 237  GLY A C   1 
ATOM   1923 O O   . GLY A 1 237 ? 22.285 -20.028 -25.363 1.00 33.70  ? 237  GLY A O   1 
ATOM   1924 N N   . ASP A 1 238 ? 24.438 -20.240 -24.753 1.00 37.43  ? 238  ASP A N   1 
ATOM   1925 C CA  . ASP A 1 238 ? 24.248 -21.539 -24.113 1.00 38.92  ? 238  ASP A CA  1 
ATOM   1926 C C   . ASP A 1 238 ? 24.465 -21.455 -22.602 1.00 37.56  ? 238  ASP A C   1 
ATOM   1927 O O   . ASP A 1 238 ? 24.648 -22.470 -21.930 1.00 38.25  ? 238  ASP A O   1 
ATOM   1928 C CB  . ASP A 1 238 ? 25.187 -22.582 -24.728 1.00 42.52  ? 238  ASP A CB  1 
ATOM   1929 C CG  . ASP A 1 238 ? 26.647 -22.347 -24.372 1.00 42.75  ? 238  ASP A CG  1 
ATOM   1930 O OD1 . ASP A 1 238 ? 27.004 -21.217 -23.973 1.00 35.00  ? 238  ASP A OD1 1 
ATOM   1931 O OD2 . ASP A 1 238 ? 27.443 -23.301 -24.500 1.00 49.44  ? 238  ASP A OD2 1 
ATOM   1932 N N   . GLY A 1 239 ? 24.448 -20.237 -22.074 1.00 30.67  ? 239  GLY A N   1 
ATOM   1933 C CA  . GLY A 1 239 ? 24.614 -20.030 -20.651 1.00 28.20  ? 239  GLY A CA  1 
ATOM   1934 C C   . GLY A 1 239 ? 25.981 -19.503 -20.261 1.00 27.98  ? 239  GLY A C   1 
ATOM   1935 O O   . GLY A 1 239 ? 26.183 -19.074 -19.126 1.00 27.96  ? 239  GLY A O   1 
ATOM   1936 N N   . THR A 1 240 ? 26.923 -19.536 -21.198 1.00 21.47  ? 240  THR A N   1 
ATOM   1937 C CA  . THR A 1 240 ? 28.266 -19.035 -20.939 1.00 20.62  ? 240  THR A CA  1 
ATOM   1938 C C   . THR A 1 240 ? 28.526 -17.758 -21.732 1.00 23.54  ? 240  THR A C   1 
ATOM   1939 O O   . THR A 1 240 ? 27.752 -17.403 -22.621 1.00 25.49  ? 240  THR A O   1 
ATOM   1940 C CB  . THR A 1 240 ? 29.333 -20.084 -21.290 1.00 29.83  ? 240  THR A CB  1 
ATOM   1941 O OG1 . THR A 1 240 ? 29.257 -20.394 -22.686 1.00 35.11  ? 240  THR A OG1 1 
ATOM   1942 C CG2 . THR A 1 240 ? 29.117 -21.354 -20.478 1.00 23.05  ? 240  THR A CG2 1 
ATOM   1943 N N   . PHE A 1 241 ? 29.618 -17.070 -21.411 1.00 27.76  ? 241  PHE A N   1 
ATOM   1944 C CA  . PHE A 1 241 ? 29.944 -15.810 -22.076 1.00 27.18  ? 241  PHE A CA  1 
ATOM   1945 C C   . PHE A 1 241 ? 31.342 -15.807 -22.687 1.00 23.10  ? 241  PHE A C   1 
ATOM   1946 O O   . PHE A 1 241 ? 32.180 -16.644 -22.356 1.00 26.07  ? 241  PHE A O   1 
ATOM   1947 C CB  . PHE A 1 241 ? 29.782 -14.643 -21.104 1.00 24.92  ? 241  PHE A CB  1 
ATOM   1948 C CG  . PHE A 1 241 ? 28.456 -14.629 -20.407 1.00 24.32  ? 241  PHE A CG  1 
ATOM   1949 C CD1 . PHE A 1 241 ? 27.422 -13.837 -20.873 1.00 22.19  ? 241  PHE A CD1 1 
ATOM   1950 C CD2 . PHE A 1 241 ? 28.236 -15.432 -19.295 1.00 27.51  ? 241  PHE A CD2 1 
ATOM   1951 C CE1 . PHE A 1 241 ? 26.194 -13.837 -20.233 1.00 25.94  ? 241  PHE A CE1 1 
ATOM   1952 C CE2 . PHE A 1 241 ? 27.013 -15.436 -18.653 1.00 22.80  ? 241  PHE A CE2 1 
ATOM   1953 C CZ  . PHE A 1 241 ? 25.991 -14.640 -19.122 1.00 23.13  ? 241  PHE A CZ  1 
ATOM   1954 N N   . GLN A 1 242 ? 31.574 -14.864 -23.593 1.00 22.20  ? 242  GLN A N   1 
ATOM   1955 C CA  . GLN A 1 242 ? 32.860 -14.732 -24.265 1.00 20.97  ? 242  GLN A CA  1 
ATOM   1956 C C   . GLN A 1 242 ? 33.342 -13.292 -24.165 1.00 20.72  ? 242  GLN A C   1 
ATOM   1957 O O   . GLN A 1 242 ? 32.553 -12.385 -23.905 1.00 25.39  ? 242  GLN A O   1 
ATOM   1958 C CB  . GLN A 1 242 ? 32.729 -15.121 -25.737 1.00 23.46  ? 242  GLN A CB  1 
ATOM   1959 C CG  . GLN A 1 242 ? 32.078 -16.472 -25.983 1.00 21.29  ? 242  GLN A CG  1 
ATOM   1960 C CD  . GLN A 1 242 ? 31.712 -16.682 -27.443 1.00 21.58  ? 242  GLN A CD  1 
ATOM   1961 O OE1 . GLN A 1 242 ? 32.047 -15.868 -28.306 1.00 21.91  ? 242  GLN A OE1 1 
ATOM   1962 N NE2 . GLN A 1 242 ? 31.018 -17.776 -27.726 1.00 20.26  ? 242  GLN A NE2 1 
ATOM   1963 N N   . LYS A 1 243 ? 34.635 -13.083 -24.384 1.00 22.62  ? 243  LYS A N   1 
ATOM   1964 C CA  . LYS A 1 243 ? 35.210 -11.740 -24.351 1.00 23.48  ? 243  LYS A CA  1 
ATOM   1965 C C   . LYS A 1 243 ? 36.653 -11.769 -24.838 1.00 25.04  ? 243  LYS A C   1 
ATOM   1966 O O   . LYS A 1 243 ? 37.324 -12.798 -24.749 1.00 27.20  ? 243  LYS A O   1 
ATOM   1967 C CB  . LYS A 1 243 ? 35.158 -11.181 -22.927 1.00 22.39  ? 243  LYS A CB  1 
ATOM   1968 C CG  . LYS A 1 243 ? 35.603 -9.735  -22.782 1.00 23.06  ? 243  LYS A CG  1 
ATOM   1969 C CD  . LYS A 1 243 ? 35.901 -9.418  -21.321 1.00 30.18  ? 243  LYS A CD  1 
ATOM   1970 C CE  . LYS A 1 243 ? 35.948 -7.922  -21.055 1.00 31.16  ? 243  LYS A CE  1 
ATOM   1971 N NZ  . LYS A 1 243 ? 34.588 -7.326  -21.008 1.00 34.46  ? 243  LYS A NZ  1 
ATOM   1972 N N   . TRP A 1 244 ? 37.130 -10.644 -25.359 1.00 23.28  ? 244  TRP A N   1 
ATOM   1973 C CA  . TRP A 1 244 ? 38.545 -10.516 -25.686 1.00 23.49  ? 244  TRP A CA  1 
ATOM   1974 C C   . TRP A 1 244 ? 39.091 -9.122  -25.415 1.00 25.15  ? 244  TRP A C   1 
ATOM   1975 O O   . TRP A 1 244 ? 38.340 -8.156  -25.280 1.00 26.00  ? 244  TRP A O   1 
ATOM   1976 C CB  . TRP A 1 244 ? 38.840 -10.939 -27.130 1.00 25.07  ? 244  TRP A CB  1 
ATOM   1977 C CG  . TRP A 1 244 ? 38.096 -10.172 -28.199 1.00 31.82  ? 244  TRP A CG  1 
ATOM   1978 C CD1 . TRP A 1 244 ? 36.997 -10.595 -28.896 1.00 23.36  ? 244  TRP A CD1 1 
ATOM   1979 C CD2 . TRP A 1 244 ? 38.413 -8.869  -28.708 1.00 33.53  ? 244  TRP A CD2 1 
ATOM   1980 N NE1 . TRP A 1 244 ? 36.610 -9.636  -29.798 1.00 21.94  ? 244  TRP A NE1 1 
ATOM   1981 C CE2 . TRP A 1 244 ? 37.461 -8.566  -29.704 1.00 29.81  ? 244  TRP A CE2 1 
ATOM   1982 C CE3 . TRP A 1 244 ? 39.407 -7.927  -28.416 1.00 35.21  ? 244  TRP A CE3 1 
ATOM   1983 C CZ2 . TRP A 1 244 ? 37.473 -7.362  -30.409 1.00 32.41  ? 244  TRP A CZ2 1 
ATOM   1984 C CZ3 . TRP A 1 244 ? 39.416 -6.733  -29.116 1.00 36.75  ? 244  TRP A CZ3 1 
ATOM   1985 C CH2 . TRP A 1 244 ? 38.454 -6.460  -30.100 1.00 35.88  ? 244  TRP A CH2 1 
ATOM   1986 N N   . ALA A 1 245 ? 40.411 -9.039  -25.321 1.00 23.02  ? 245  ALA A N   1 
ATOM   1987 C CA  . ALA A 1 245 ? 41.100 -7.772  -25.149 1.00 24.93  ? 245  ALA A CA  1 
ATOM   1988 C C   . ALA A 1 245 ? 42.261 -7.727  -26.136 1.00 27.37  ? 245  ALA A C   1 
ATOM   1989 O O   . ALA A 1 245 ? 42.908 -8.744  -26.388 1.00 18.50  ? 245  ALA A O   1 
ATOM   1990 C CB  . ALA A 1 245 ? 41.601 -7.636  -23.721 1.00 22.51  ? 245  ALA A CB  1 
ATOM   1991 N N   . ALA A 1 246 ? 42.527 -6.551  -26.693 1.00 31.64  ? 246  ALA A N   1 
ATOM   1992 C CA  . ALA A 1 246 ? 43.555 -6.423  -27.718 1.00 29.61  ? 246  ALA A CA  1 
ATOM   1993 C C   . ALA A 1 246 ? 44.560 -5.312  -27.419 1.00 28.97  ? 246  ALA A C   1 
ATOM   1994 O O   . ALA A 1 246 ? 44.191 -4.249  -26.931 1.00 32.54  ? 246  ALA A O   1 
ATOM   1995 C CB  . ALA A 1 246 ? 42.907 -6.198  -29.074 1.00 29.06  ? 246  ALA A CB  1 
ATOM   1996 N N   . VAL A 1 247 ? 45.833 -5.572  -27.702 1.00 30.11  ? 247  VAL A N   1 
ATOM   1997 C CA  . VAL A 1 247 ? 46.846 -4.520  -27.702 1.00 32.73  ? 247  VAL A CA  1 
ATOM   1998 C C   . VAL A 1 247 ? 47.497 -4.412  -29.069 1.00 39.13  ? 247  VAL A C   1 
ATOM   1999 O O   . VAL A 1 247 ? 47.766 -5.418  -29.722 1.00 45.80  ? 247  VAL A O   1 
ATOM   2000 C CB  . VAL A 1 247 ? 47.963 -4.736  -26.641 1.00 26.73  ? 247  VAL A CB  1 
ATOM   2001 C CG1 . VAL A 1 247 ? 47.513 -4.242  -25.278 1.00 37.14  ? 247  VAL A CG1 1 
ATOM   2002 C CG2 . VAL A 1 247 ? 48.413 -6.196  -26.591 1.00 14.18  ? 247  VAL A CG2 1 
ATOM   2003 N N   . VAL A 1 248 ? 47.730 -3.180  -29.504 1.00 39.68  ? 248  VAL A N   1 
ATOM   2004 C CA  . VAL A 1 248 ? 48.538 -2.935  -30.684 1.00 39.62  ? 248  VAL A CA  1 
ATOM   2005 C C   . VAL A 1 248 ? 49.983 -2.857  -30.211 1.00 36.44  ? 248  VAL A C   1 
ATOM   2006 O O   . VAL A 1 248 ? 50.302 -2.097  -29.299 1.00 35.96  ? 248  VAL A O   1 
ATOM   2007 C CB  . VAL A 1 248 ? 48.135 -1.632  -31.385 1.00 39.09  ? 248  VAL A CB  1 
ATOM   2008 C CG1 . VAL A 1 248 ? 48.981 -1.417  -32.631 1.00 36.96  ? 248  VAL A CG1 1 
ATOM   2009 C CG2 . VAL A 1 248 ? 46.649 -1.658  -31.734 1.00 26.53  ? 248  VAL A CG2 1 
ATOM   2010 N N   . VAL A 1 249 ? 50.846 -3.658  -30.825 1.00 33.15  ? 249  VAL A N   1 
ATOM   2011 C CA  . VAL A 1 249 ? 52.206 -3.852  -30.343 1.00 31.93  ? 249  VAL A CA  1 
ATOM   2012 C C   . VAL A 1 249 ? 53.234 -3.624  -31.445 1.00 42.13  ? 249  VAL A C   1 
ATOM   2013 O O   . VAL A 1 249 ? 52.974 -3.915  -32.613 1.00 52.74  ? 249  VAL A O   1 
ATOM   2014 C CB  . VAL A 1 249 ? 52.375 -5.284  -29.791 1.00 39.14  ? 249  VAL A CB  1 
ATOM   2015 C CG1 . VAL A 1 249 ? 53.843 -5.673  -29.697 1.00 43.66  ? 249  VAL A CG1 1 
ATOM   2016 C CG2 . VAL A 1 249 ? 51.684 -5.417  -28.446 1.00 40.34  ? 249  VAL A CG2 1 
ATOM   2017 N N   . PRO A 1 250 ? 54.405 -3.085  -31.078 1.00 36.19  ? 250  PRO A N   1 
ATOM   2018 C CA  . PRO A 1 250 ? 55.527 -2.967  -32.014 1.00 38.35  ? 250  PRO A CA  1 
ATOM   2019 C C   . PRO A 1 250 ? 56.114 -4.337  -32.331 1.00 45.39  ? 250  PRO A C   1 
ATOM   2020 O O   . PRO A 1 250 ? 56.585 -5.016  -31.422 1.00 51.75  ? 250  PRO A O   1 
ATOM   2021 C CB  . PRO A 1 250 ? 56.562 -2.153  -31.224 1.00 34.63  ? 250  PRO A CB  1 
ATOM   2022 C CG  . PRO A 1 250 ? 55.800 -1.509  -30.111 1.00 35.97  ? 250  PRO A CG  1 
ATOM   2023 C CD  . PRO A 1 250 ? 54.699 -2.456  -29.779 1.00 36.57  ? 250  PRO A CD  1 
ATOM   2024 N N   . SER A 1 251 ? 56.084 -4.744  -33.594 1.00 45.16  ? 251  SER A N   1 
ATOM   2025 C CA  . SER A 1 251 ? 56.773 -5.964  -33.996 1.00 46.66  ? 251  SER A CA  1 
ATOM   2026 C C   . SER A 1 251 ? 58.242 -5.640  -34.254 1.00 39.02  ? 251  SER A C   1 
ATOM   2027 O O   . SER A 1 251 ? 58.554 -4.641  -34.900 1.00 55.60  ? 251  SER A O   1 
ATOM   2028 C CB  . SER A 1 251 ? 56.125 -6.574  -35.246 1.00 44.67  ? 251  SER A CB  1 
ATOM   2029 O OG  . SER A 1 251 ? 56.277 -5.737  -36.378 1.00 32.34  ? 251  SER A OG  1 
ATOM   2030 N N   . GLY A 1 252 ? 59.146 -6.469  -33.744 1.00 30.36  ? 252  GLY A N   1 
ATOM   2031 C CA  . GLY A 1 252 ? 58.783 -7.646  -32.980 1.00 40.92  ? 252  GLY A CA  1 
ATOM   2032 C C   . GLY A 1 252 ? 59.079 -7.506  -31.499 1.00 43.40  ? 252  GLY A C   1 
ATOM   2033 O O   . GLY A 1 252 ? 60.206 -7.717  -31.046 1.00 31.88  ? 252  GLY A O   1 
ATOM   2034 N N   . GLU A 1 253 ? 58.051 -7.146  -30.740 1.00 45.20  ? 253  GLU A N   1 
ATOM   2035 C CA  . GLU A 1 253 ? 58.161 -7.048  -29.294 1.00 42.71  ? 253  GLU A CA  1 
ATOM   2036 C C   . GLU A 1 253 ? 57.012 -7.807  -28.649 1.00 32.61  ? 253  GLU A C   1 
ATOM   2037 O O   . GLU A 1 253 ? 56.774 -7.698  -27.448 1.00 36.13  ? 253  GLU A O   1 
ATOM   2038 C CB  . GLU A 1 253 ? 58.152 -5.586  -28.853 1.00 48.50  ? 253  GLU A CB  1 
ATOM   2039 C CG  . GLU A 1 253 ? 59.265 -4.760  -29.470 1.00 58.48  ? 253  GLU A CG  1 
ATOM   2040 C CD  . GLU A 1 253 ? 59.387 -3.387  -28.843 1.00 71.40  ? 253  GLU A CD  1 
ATOM   2041 O OE1 . GLU A 1 253 ? 58.348 -2.717  -28.669 1.00 76.05  ? 253  GLU A OE1 1 
ATOM   2042 O OE2 . GLU A 1 253 ? 60.524 -2.982  -28.518 1.00 75.18  ? 253  GLU A OE2 1 
ATOM   2043 N N   . GLU A 1 254 ? 56.309 -8.586  -29.463 1.00 26.05  ? 254  GLU A N   1 
ATOM   2044 C CA  . GLU A 1 254 ? 55.150 -9.343  -29.003 1.00 30.17  ? 254  GLU A CA  1 
ATOM   2045 C C   . GLU A 1 254 ? 55.479 -10.272 -27.838 1.00 28.87  ? 254  GLU A C   1 
ATOM   2046 O O   . GLU A 1 254 ? 54.623 -10.543 -27.002 1.00 29.59  ? 254  GLU A O   1 
ATOM   2047 C CB  . GLU A 1 254 ? 54.543 -10.156 -30.151 1.00 32.89  ? 254  GLU A CB  1 
ATOM   2048 C CG  . GLU A 1 254 ? 54.025 -9.332  -31.319 1.00 38.44  ? 254  GLU A CG  1 
ATOM   2049 C CD  . GLU A 1 254 ? 55.054 -9.155  -32.429 1.00 43.18  ? 254  GLU A CD  1 
ATOM   2050 O OE1 . GLU A 1 254 ? 56.268 -9.100  -32.133 1.00 40.72  ? 254  GLU A OE1 1 
ATOM   2051 O OE2 . GLU A 1 254 ? 54.641 -9.075  -33.604 1.00 37.88  ? 254  GLU A OE2 1 
ATOM   2052 N N   . GLN A 1 255 ? 56.715 -10.759 -27.786 1.00 32.30  ? 255  GLN A N   1 
ATOM   2053 C CA  . GLN A 1 255 ? 57.101 -11.728 -26.762 1.00 37.10  ? 255  GLN A CA  1 
ATOM   2054 C C   . GLN A 1 255 ? 57.251 -11.118 -25.362 1.00 40.72  ? 255  GLN A C   1 
ATOM   2055 O O   . GLN A 1 255 ? 57.384 -11.845 -24.380 1.00 45.77  ? 255  GLN A O   1 
ATOM   2056 C CB  . GLN A 1 255 ? 58.374 -12.487 -27.165 1.00 37.79  ? 255  GLN A CB  1 
ATOM   2057 C CG  . GLN A 1 255 ? 59.685 -11.760 -26.885 1.00 43.42  ? 255  GLN A CG  1 
ATOM   2058 C CD  . GLN A 1 255 ? 59.995 -10.675 -27.898 1.00 43.64  ? 255  GLN A CD  1 
ATOM   2059 O OE1 . GLN A 1 255 ? 59.270 -10.493 -28.877 1.00 48.26  ? 255  GLN A OE1 1 
ATOM   2060 N NE2 . GLN A 1 255 ? 61.079 -9.946  -27.665 1.00 37.42  ? 255  GLN A NE2 1 
ATOM   2061 N N   . ARG A 1 256 ? 57.223 -9.791  -25.273 1.00 42.06  ? 256  ARG A N   1 
ATOM   2062 C CA  . ARG A 1 256 ? 57.313 -9.105  -23.983 1.00 35.62  ? 256  ARG A CA  1 
ATOM   2063 C C   . ARG A 1 256 ? 55.948 -8.969  -23.313 1.00 38.26  ? 256  ARG A C   1 
ATOM   2064 O O   . ARG A 1 256 ? 55.849 -8.493  -22.181 1.00 32.46  ? 256  ARG A O   1 
ATOM   2065 C CB  . ARG A 1 256 ? 57.907 -7.708  -24.158 1.00 30.29  ? 256  ARG A CB  1 
ATOM   2066 C CG  . ARG A 1 256 ? 59.323 -7.664  -24.696 1.00 43.58  ? 256  ARG A CG  1 
ATOM   2067 C CD  . ARG A 1 256 ? 59.491 -6.418  -25.545 1.00 54.59  ? 256  ARG A CD  1 
ATOM   2068 N NE  . ARG A 1 256 ? 60.868 -5.942  -25.633 1.00 61.14  ? 256  ARG A NE  1 
ATOM   2069 C CZ  . ARG A 1 256 ? 61.430 -5.121  -24.751 1.00 60.33  ? 256  ARG A CZ  1 
ATOM   2070 N NH1 . ARG A 1 256 ? 60.741 -4.699  -23.699 1.00 48.43  ? 256  ARG A NH1 1 
ATOM   2071 N NH2 . ARG A 1 256 ? 62.685 -4.729  -24.917 1.00 67.77  ? 256  ARG A NH2 1 
ATOM   2072 N N   . TYR A 1 257 ? 54.895 -9.377  -24.016 1.00 38.92  ? 257  TYR A N   1 
ATOM   2073 C CA  . TYR A 1 257 ? 53.532 -9.179  -23.532 1.00 33.16  ? 257  TYR A CA  1 
ATOM   2074 C C   . TYR A 1 257 ? 52.922 -10.425 -22.902 1.00 33.12  ? 257  TYR A C   1 
ATOM   2075 O O   . TYR A 1 257 ? 53.210 -11.546 -23.317 1.00 36.74  ? 257  TYR A O   1 
ATOM   2076 C CB  . TYR A 1 257 ? 52.634 -8.685  -24.663 1.00 32.59  ? 257  TYR A CB  1 
ATOM   2077 C CG  . TYR A 1 257 ? 52.873 -7.248  -25.050 1.00 31.53  ? 257  TYR A CG  1 
ATOM   2078 C CD1 . TYR A 1 257 ? 53.944 -6.896  -25.862 1.00 25.84  ? 257  TYR A CD1 1 
ATOM   2079 C CD2 . TYR A 1 257 ? 52.018 -6.242  -24.613 1.00 32.23  ? 257  TYR A CD2 1 
ATOM   2080 C CE1 . TYR A 1 257 ? 54.159 -5.580  -26.226 1.00 28.45  ? 257  TYR A CE1 1 
ATOM   2081 C CE2 . TYR A 1 257 ? 52.226 -4.923  -24.967 1.00 32.26  ? 257  TYR A CE2 1 
ATOM   2082 C CZ  . TYR A 1 257 ? 53.299 -4.596  -25.773 1.00 38.59  ? 257  TYR A CZ  1 
ATOM   2083 O OH  . TYR A 1 257 ? 53.510 -3.281  -26.131 1.00 42.72  ? 257  TYR A OH  1 
ATOM   2084 N N   . THR A 1 258 ? 52.074 -10.214 -21.899 1.00 31.07  ? 258  THR A N   1 
ATOM   2085 C CA  . THR A 1 258 ? 51.350 -11.303 -21.251 1.00 25.89  ? 258  THR A CA  1 
ATOM   2086 C C   . THR A 1 258 ? 49.906 -10.906 -21.010 1.00 25.64  ? 258  THR A C   1 
ATOM   2087 O O   . THR A 1 258 ? 49.607 -9.748  -20.724 1.00 21.33  ? 258  THR A O   1 
ATOM   2088 C CB  . THR A 1 258 ? 51.964 -11.689 -19.888 1.00 29.00  ? 258  THR A CB  1 
ATOM   2089 O OG1 . THR A 1 258 ? 51.903 -10.565 -19.001 1.00 29.94  ? 258  THR A OG1 1 
ATOM   2090 C CG2 . THR A 1 258 ? 53.410 -12.137 -20.045 1.00 28.20  ? 258  THR A CG2 1 
ATOM   2091 N N   . CYS A 1 259 ? 49.011 -11.876 -21.128 1.00 33.92  ? 259  CYS A N   1 
ATOM   2092 C CA  . CYS A 1 259 ? 47.610 -11.660 -20.819 1.00 33.46  ? 259  CYS A CA  1 
ATOM   2093 C C   . CYS A 1 259 ? 47.322 -12.206 -19.424 1.00 34.34  ? 259  CYS A C   1 
ATOM   2094 O O   . CYS A 1 259 ? 47.619 -13.363 -19.123 1.00 34.74  ? 259  CYS A O   1 
ATOM   2095 C CB  . CYS A 1 259 ? 46.725 -12.344 -21.861 1.00 36.99  ? 259  CYS A CB  1 
ATOM   2096 S SG  . CYS A 1 259 ? 44.959 -11.986 -21.719 1.00 65.21  ? 259  CYS A SG  1 
ATOM   2097 N N   . HIS A 1 260 ? 46.761 -11.359 -18.570 1.00 32.65  ? 260  HIS A N   1 
ATOM   2098 C CA  . HIS A 1 260 ? 46.406 -11.749 -17.214 1.00 27.56  ? 260  HIS A CA  1 
ATOM   2099 C C   . HIS A 1 260 ? 44.891 -11.904 -17.139 1.00 24.04  ? 260  HIS A C   1 
ATOM   2100 O O   . HIS A 1 260 ? 44.156 -10.974 -17.470 1.00 23.14  ? 260  HIS A O   1 
ATOM   2101 C CB  . HIS A 1 260 ? 46.881 -10.681 -16.231 1.00 33.25  ? 260  HIS A CB  1 
ATOM   2102 C CG  . HIS A 1 260 ? 46.927 -11.142 -14.807 1.00 51.45  ? 260  HIS A CG  1 
ATOM   2103 N ND1 . HIS A 1 260 ? 46.017 -10.725 -13.860 1.00 59.76  ? 260  HIS A ND1 1 
ATOM   2104 C CD2 . HIS A 1 260 ? 47.780 -11.979 -14.169 1.00 55.86  ? 260  HIS A CD2 1 
ATOM   2105 C CE1 . HIS A 1 260 ? 46.304 -11.288 -12.699 1.00 59.16  ? 260  HIS A CE1 1 
ATOM   2106 N NE2 . HIS A 1 260 ? 47.368 -12.053 -12.859 1.00 55.55  ? 260  HIS A NE2 1 
ATOM   2107 N N   . VAL A 1 261 ? 44.429 -13.079 -16.717 1.00 22.89  ? 261  VAL A N   1 
ATOM   2108 C CA  . VAL A 1 261 ? 42.996 -13.376 -16.664 1.00 27.61  ? 261  VAL A CA  1 
ATOM   2109 C C   . VAL A 1 261 ? 42.508 -13.706 -15.252 1.00 33.66  ? 261  VAL A C   1 
ATOM   2110 O O   . VAL A 1 261 ? 43.013 -14.626 -14.610 1.00 36.50  ? 261  VAL A O   1 
ATOM   2111 C CB  . VAL A 1 261 ? 42.639 -14.555 -17.595 1.00 25.52  ? 261  VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1 261 ? 41.157 -14.891 -17.495 1.00 14.04  ? 261  VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1 261 ? 43.026 -14.236 -19.025 1.00 24.04  ? 261  VAL A CG2 1 
ATOM   2114 N N   . GLN A 1 262 ? 41.518 -12.956 -14.777 1.00 36.80  ? 262  GLN A N   1 
ATOM   2115 C CA  . GLN A 1 262 ? 40.925 -13.206 -13.464 1.00 37.15  ? 262  GLN A CA  1 
ATOM   2116 C C   . GLN A 1 262 ? 39.446 -13.563 -13.588 1.00 39.78  ? 262  GLN A C   1 
ATOM   2117 O O   . GLN A 1 262 ? 38.695 -12.900 -14.305 1.00 40.81  ? 262  GLN A O   1 
ATOM   2118 C CB  . GLN A 1 262 ? 41.075 -11.980 -12.568 1.00 41.86  ? 262  GLN A CB  1 
ATOM   2119 C CG  . GLN A 1 262 ? 42.501 -11.497 -12.406 1.00 50.72  ? 262  GLN A CG  1 
ATOM   2120 C CD  . GLN A 1 262 ? 42.580 -10.228 -11.591 1.00 56.34  ? 262  GLN A CD  1 
ATOM   2121 O OE1 . GLN A 1 262 ? 42.484 -9.125  -12.129 1.00 55.77  ? 262  GLN A OE1 1 
ATOM   2122 N NE2 . GLN A 1 262 ? 42.743 -10.375 -10.281 1.00 60.84  ? 262  GLN A NE2 1 
ATOM   2123 N N   . HIS A 1 263 ? 39.029 -14.605 -12.877 1.00 37.58  ? 263  HIS A N   1 
ATOM   2124 C CA  . HIS A 1 263 ? 37.652 -15.074 -12.948 1.00 28.66  ? 263  HIS A CA  1 
ATOM   2125 C C   . HIS A 1 263 ? 37.336 -15.969 -11.752 1.00 35.58  ? 263  HIS A C   1 
ATOM   2126 O O   . HIS A 1 263 ? 38.166 -16.778 -11.340 1.00 33.07  ? 263  HIS A O   1 
ATOM   2127 C CB  . HIS A 1 263 ? 37.422 -15.831 -14.261 1.00 22.94  ? 263  HIS A CB  1 
ATOM   2128 C CG  . HIS A 1 263 ? 36.024 -16.333 -14.436 1.00 26.07  ? 263  HIS A CG  1 
ATOM   2129 N ND1 . HIS A 1 263 ? 34.975 -15.513 -14.796 1.00 29.70  ? 263  HIS A ND1 1 
ATOM   2130 C CD2 . HIS A 1 263 ? 35.499 -17.574 -14.299 1.00 22.87  ? 263  HIS A CD2 1 
ATOM   2131 C CE1 . HIS A 1 263 ? 33.867 -16.226 -14.875 1.00 24.60  ? 263  HIS A CE1 1 
ATOM   2132 N NE2 . HIS A 1 263 ? 34.157 -17.481 -14.578 1.00 24.55  ? 263  HIS A NE2 1 
ATOM   2133 N N   . GLU A 1 264 ? 36.135 -15.819 -11.197 1.00 42.17  ? 264  GLU A N   1 
ATOM   2134 C CA  . GLU A 1 264 ? 35.712 -16.608 -10.039 1.00 35.71  ? 264  GLU A CA  1 
ATOM   2135 C C   . GLU A 1 264 ? 35.828 -18.118 -10.270 1.00 42.18  ? 264  GLU A C   1 
ATOM   2136 O O   . GLU A 1 264 ? 35.913 -18.892 -9.317  1.00 43.92  ? 264  GLU A O   1 
ATOM   2137 C CB  . GLU A 1 264 ? 34.279 -16.252 -9.642  1.00 22.58  ? 264  GLU A CB  1 
ATOM   2138 N N   . GLY A 1 265 ? 35.832 -18.530 -11.534 1.00 39.22  ? 265  GLY A N   1 
ATOM   2139 C CA  . GLY A 1 265 ? 35.936 -19.936 -11.879 1.00 37.75  ? 265  GLY A CA  1 
ATOM   2140 C C   . GLY A 1 265 ? 37.355 -20.474 -11.830 1.00 39.63  ? 265  GLY A C   1 
ATOM   2141 O O   . GLY A 1 265 ? 37.564 -21.675 -11.681 1.00 39.88  ? 265  GLY A O   1 
ATOM   2142 N N   . LEU A 1 266 ? 38.333 -19.581 -11.960 1.00 43.20  ? 266  LEU A N   1 
ATOM   2143 C CA  . LEU A 1 266 ? 39.744 -19.956 -11.895 1.00 36.75  ? 266  LEU A CA  1 
ATOM   2144 C C   . LEU A 1 266 ? 40.233 -20.019 -10.450 1.00 43.71  ? 266  LEU A C   1 
ATOM   2145 O O   . LEU A 1 266 ? 40.018 -19.080 -9.680  1.00 42.80  ? 266  LEU A O   1 
ATOM   2146 C CB  . LEU A 1 266 ? 40.598 -18.947 -12.664 1.00 33.89  ? 266  LEU A CB  1 
ATOM   2147 C CG  . LEU A 1 266 ? 40.350 -18.781 -14.163 1.00 35.01  ? 266  LEU A CG  1 
ATOM   2148 C CD1 . LEU A 1 266 ? 41.063 -17.538 -14.678 1.00 35.41  ? 266  LEU A CD1 1 
ATOM   2149 C CD2 . LEU A 1 266 ? 40.791 -20.020 -14.928 1.00 25.10  ? 266  LEU A CD2 1 
ATOM   2150 N N   . PRO A 1 267 ? 40.905 -21.123 -10.083 1.00 50.79  ? 267  PRO A N   1 
ATOM   2151 C CA  . PRO A 1 267 ? 41.478 -21.304 -8.743  1.00 52.15  ? 267  PRO A CA  1 
ATOM   2152 C C   . PRO A 1 267 ? 42.592 -20.292 -8.507  1.00 50.35  ? 267  PRO A C   1 
ATOM   2153 O O   . PRO A 1 267 ? 42.686 -19.678 -7.442  1.00 45.58  ? 267  PRO A O   1 
ATOM   2154 C CB  . PRO A 1 267 ? 42.074 -22.715 -8.803  1.00 52.50  ? 267  PRO A CB  1 
ATOM   2155 C CG  . PRO A 1 267 ? 41.448 -23.367 -9.994  1.00 51.22  ? 267  PRO A CG  1 
ATOM   2156 C CD  . PRO A 1 267 ? 41.194 -22.266 -10.963 1.00 53.82  ? 267  PRO A CD  1 
ATOM   2157 N N   . LYS A 1 268 ? 43.434 -20.138 -9.522  1.00 53.93  ? 268  LYS A N   1 
ATOM   2158 C CA  . LYS A 1 268 ? 44.516 -19.166 -9.519  1.00 52.23  ? 268  LYS A CA  1 
ATOM   2159 C C   . LYS A 1 268 ? 44.415 -18.351 -10.804 1.00 47.34  ? 268  LYS A C   1 
ATOM   2160 O O   . LYS A 1 268 ? 44.171 -18.912 -11.875 1.00 47.14  ? 268  LYS A O   1 
ATOM   2161 C CB  . LYS A 1 268 ? 45.863 -19.892 -9.455  1.00 56.84  ? 268  LYS A CB  1 
ATOM   2162 C CG  . LYS A 1 268 ? 47.074 -19.040 -9.808  1.00 67.57  ? 268  LYS A CG  1 
ATOM   2163 C CD  . LYS A 1 268 ? 47.548 -18.198 -8.630  1.00 75.57  ? 268  LYS A CD  1 
ATOM   2164 C CE  . LYS A 1 268 ? 48.854 -17.482 -8.963  1.00 77.42  ? 268  LYS A CE  1 
ATOM   2165 N NZ  . LYS A 1 268 ? 49.405 -16.726 -7.803  1.00 76.07  ? 268  LYS A NZ  1 
ATOM   2166 N N   . PRO A 1 269 ? 44.576 -17.022 -10.699 1.00 43.25  ? 269  PRO A N   1 
ATOM   2167 C CA  . PRO A 1 269 ? 44.602 -16.149 -11.877 1.00 39.36  ? 269  PRO A CA  1 
ATOM   2168 C C   . PRO A 1 269 ? 45.561 -16.674 -12.942 1.00 35.36  ? 269  PRO A C   1 
ATOM   2169 O O   . PRO A 1 269 ? 46.574 -17.290 -12.602 1.00 30.38  ? 269  PRO A O   1 
ATOM   2170 C CB  . PRO A 1 269 ? 45.114 -14.825 -11.309 1.00 47.14  ? 269  PRO A CB  1 
ATOM   2171 C CG  . PRO A 1 269 ? 44.621 -14.819 -9.903  1.00 48.23  ? 269  PRO A CG  1 
ATOM   2172 C CD  . PRO A 1 269 ? 44.682 -16.258 -9.443  1.00 49.70  ? 269  PRO A CD  1 
ATOM   2173 N N   . LEU A 1 270 ? 45.240 -16.434 -14.211 1.00 38.01  ? 270  LEU A N   1 
ATOM   2174 C CA  . LEU A 1 270 ? 46.057 -16.921 -15.322 1.00 36.72  ? 270  LEU A CA  1 
ATOM   2175 C C   . LEU A 1 270 ? 47.048 -15.883 -15.838 1.00 32.58  ? 270  LEU A C   1 
ATOM   2176 O O   . LEU A 1 270 ? 46.738 -14.697 -15.925 1.00 29.05  ? 270  LEU A O   1 
ATOM   2177 C CB  . LEU A 1 270 ? 45.175 -17.395 -16.478 1.00 31.21  ? 270  LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 270 ? 44.567 -18.789 -16.344 1.00 37.65  ? 270  LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 270 ? 43.649 -19.085 -17.521 1.00 43.02  ? 270  LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 270 ? 45.662 -19.836 -16.236 1.00 38.70  ? 270  LEU A CD2 1 
ATOM   2181 N N   . THR A 1 271 ? 48.244 -16.346 -16.179 1.00 33.37  ? 271  THR A N   1 
ATOM   2182 C CA  . THR A 1 271 ? 49.227 -15.504 -16.843 1.00 38.83  ? 271  THR A CA  1 
ATOM   2183 C C   . THR A 1 271 ? 49.720 -16.211 -18.097 1.00 41.11  ? 271  THR A C   1 
ATOM   2184 O O   . THR A 1 271 ? 50.359 -17.261 -18.019 1.00 42.53  ? 271  THR A O   1 
ATOM   2185 C CB  . THR A 1 271 ? 50.418 -15.172 -15.924 1.00 42.73  ? 271  THR A CB  1 
ATOM   2186 O OG1 . THR A 1 271 ? 49.949 -14.486 -14.756 1.00 45.83  ? 271  THR A OG1 1 
ATOM   2187 C CG2 . THR A 1 271 ? 51.421 -14.292 -16.651 1.00 33.89  ? 271  THR A CG2 1 
ATOM   2188 N N   . LEU A 1 272 ? 49.409 -15.635 -19.253 1.00 44.96  ? 272  LEU A N   1 
ATOM   2189 C CA  . LEU A 1 272 ? 49.754 -16.247 -20.530 1.00 43.83  ? 272  LEU A CA  1 
ATOM   2190 C C   . LEU A 1 272 ? 50.721 -15.373 -21.319 1.00 38.96  ? 272  LEU A C   1 
ATOM   2191 O O   . LEU A 1 272 ? 50.403 -14.235 -21.657 1.00 28.38  ? 272  LEU A O   1 
ATOM   2192 C CB  . LEU A 1 272 ? 48.490 -16.481 -21.357 1.00 46.29  ? 272  LEU A CB  1 
ATOM   2193 C CG  . LEU A 1 272 ? 47.282 -17.048 -20.610 1.00 46.48  ? 272  LEU A CG  1 
ATOM   2194 C CD1 . LEU A 1 272 ? 46.090 -17.149 -21.542 1.00 44.27  ? 272  LEU A CD1 1 
ATOM   2195 C CD2 . LEU A 1 272 ? 47.606 -18.403 -19.999 1.00 49.24  ? 272  LEU A CD2 1 
ATOM   2196 N N   . ARG A 1 273 ? 51.905 -15.905 -21.606 1.00 47.42  ? 273  ARG A N   1 
ATOM   2197 C CA  . ARG A 1 273 ? 52.873 -15.188 -22.427 1.00 42.97  ? 273  ARG A CA  1 
ATOM   2198 C C   . ARG A 1 273 ? 52.695 -15.595 -23.878 1.00 38.39  ? 273  ARG A C   1 
ATOM   2199 O O   . ARG A 1 273 ? 52.443 -16.763 -24.172 1.00 35.53  ? 273  ARG A O   1 
ATOM   2200 C CB  . ARG A 1 273 ? 54.307 -15.460 -21.961 1.00 41.54  ? 273  ARG A CB  1 
ATOM   2201 C CG  . ARG A 1 273 ? 55.360 -14.683 -22.740 1.00 47.30  ? 273  ARG A CG  1 
ATOM   2202 C CD  . ARG A 1 273 ? 56.724 -14.732 -22.059 1.00 53.23  ? 273  ARG A CD  1 
ATOM   2203 N NE  . ARG A 1 273 ? 56.721 -14.048 -20.769 1.00 55.17  ? 273  ARG A NE  1 
ATOM   2204 C CZ  . ARG A 1 273 ? 56.890 -12.737 -20.615 1.00 57.93  ? 273  ARG A CZ  1 
ATOM   2205 N NH1 . ARG A 1 273 ? 57.075 -11.959 -21.672 1.00 57.88  ? 273  ARG A NH1 1 
ATOM   2206 N NH2 . ARG A 1 273 ? 56.870 -12.202 -19.401 1.00 60.82  ? 273  ARG A NH2 1 
ATOM   2207 N N   . TRP A 1 274 ? 52.815 -14.627 -24.781 1.00 43.25  ? 274  TRP A N   1 
ATOM   2208 C CA  . TRP A 1 274 ? 52.606 -14.874 -26.205 1.00 44.71  ? 274  TRP A CA  1 
ATOM   2209 C C   . TRP A 1 274 ? 53.688 -15.763 -26.818 1.00 47.45  ? 274  TRP A C   1 
ATOM   2210 O O   . TRP A 1 274 ? 54.709 -16.043 -26.192 1.00 51.60  ? 274  TRP A O   1 
ATOM   2211 C CB  . TRP A 1 274 ? 52.507 -13.552 -26.972 1.00 39.18  ? 274  TRP A CB  1 
ATOM   2212 C CG  . TRP A 1 274 ? 52.660 -13.717 -28.452 1.00 36.14  ? 274  TRP A CG  1 
ATOM   2213 C CD1 . TRP A 1 274 ? 53.727 -13.336 -29.209 1.00 34.92  ? 274  TRP A CD1 1 
ATOM   2214 C CD2 . TRP A 1 274 ? 51.725 -14.324 -29.352 1.00 40.59  ? 274  TRP A CD2 1 
ATOM   2215 N NE1 . TRP A 1 274 ? 53.512 -13.657 -30.526 1.00 37.60  ? 274  TRP A NE1 1 
ATOM   2216 C CE2 . TRP A 1 274 ? 52.290 -14.265 -30.642 1.00 41.47  ? 274  TRP A CE2 1 
ATOM   2217 C CE3 . TRP A 1 274 ? 50.463 -14.908 -29.194 1.00 43.51  ? 274  TRP A CE3 1 
ATOM   2218 C CZ2 . TRP A 1 274 ? 51.639 -14.767 -31.769 1.00 43.11  ? 274  TRP A CZ2 1 
ATOM   2219 C CZ3 . TRP A 1 274 ? 49.817 -15.407 -30.314 1.00 46.09  ? 274  TRP A CZ3 1 
ATOM   2220 C CH2 . TRP A 1 274 ? 50.407 -15.334 -31.584 1.00 48.33  ? 274  TRP A CH2 1 
ATOM   2221 N N   . ALA B 2 1   ? 21.163 10.440  -23.992 1.00 47.25  ? 1    ALA B N   1 
ATOM   2222 C CA  . ALA B 2 1   ? 20.012 9.563   -24.181 1.00 44.33  ? 1    ALA B CA  1 
ATOM   2223 C C   . ALA B 2 1   ? 20.207 8.635   -25.378 1.00 41.91  ? 1    ALA B C   1 
ATOM   2224 O O   . ALA B 2 1   ? 20.194 7.413   -25.228 1.00 49.20  ? 1    ALA B O   1 
ATOM   2225 C CB  . ALA B 2 1   ? 18.735 10.376  -24.335 1.00 34.93  ? 1    ALA B CB  1 
ATOM   2226 N N   . GLN B 2 2   ? 20.382 9.214   -26.563 1.00 34.99  ? 2    GLN B N   1 
ATOM   2227 C CA  . GLN B 2 2   ? 20.609 8.418   -27.768 1.00 29.91  ? 2    GLN B CA  1 
ATOM   2228 C C   . GLN B 2 2   ? 21.994 7.786   -27.788 1.00 22.96  ? 2    GLN B C   1 
ATOM   2229 O O   . GLN B 2 2   ? 23.002 8.464   -27.592 1.00 31.85  ? 2    GLN B O   1 
ATOM   2230 C CB  . GLN B 2 2   ? 20.408 9.254   -29.031 1.00 26.77  ? 2    GLN B CB  1 
ATOM   2231 C CG  . GLN B 2 2   ? 18.981 9.292   -29.528 1.00 29.80  ? 2    GLN B CG  1 
ATOM   2232 C CD  . GLN B 2 2   ? 18.891 9.647   -31.000 1.00 38.33  ? 2    GLN B CD  1 
ATOM   2233 O OE1 . GLN B 2 2   ? 19.897 9.961   -31.638 1.00 37.25  ? 2    GLN B OE1 1 
ATOM   2234 N NE2 . GLN B 2 2   ? 17.681 9.592   -31.548 1.00 42.64  ? 2    GLN B NE2 1 
ATOM   2235 N N   . ARG B 2 3   ? 22.039 6.484   -28.035 1.00 20.60  ? 3    ARG B N   1 
ATOM   2236 C CA  . ARG B 2 3   ? 23.304 5.762   -28.076 1.00 30.74  ? 3    ARG B CA  1 
ATOM   2237 C C   . ARG B 2 3   ? 23.383 4.775   -29.237 1.00 29.49  ? 3    ARG B C   1 
ATOM   2238 O O   . ARG B 2 3   ? 22.451 4.013   -29.485 1.00 31.45  ? 3    ARG B O   1 
ATOM   2239 C CB  . ARG B 2 3   ? 23.561 5.053   -26.746 1.00 32.93  ? 3    ARG B CB  1 
ATOM   2240 C CG  . ARG B 2 3   ? 24.282 5.920   -25.736 1.00 36.86  ? 3    ARG B CG  1 
ATOM   2241 C CD  . ARG B 2 3   ? 24.261 5.304   -24.353 1.00 45.64  ? 3    ARG B CD  1 
ATOM   2242 N NE  . ARG B 2 3   ? 22.948 5.429   -23.735 1.00 51.43  ? 3    ARG B NE  1 
ATOM   2243 C CZ  . ARG B 2 3   ? 22.752 5.576   -22.430 1.00 57.65  ? 3    ARG B CZ  1 
ATOM   2244 N NH1 . ARG B 2 3   ? 23.793 5.618   -21.608 1.00 62.05  ? 3    ARG B NH1 1 
ATOM   2245 N NH2 . ARG B 2 3   ? 21.520 5.689   -21.950 1.00 54.60  ? 3    ARG B NH2 1 
ATOM   2246 N N   . THR B 2 4   ? 24.510 4.813   -29.943 1.00 34.15  ? 4    THR B N   1 
ATOM   2247 C CA  . THR B 2 4   ? 24.778 3.928   -31.069 1.00 23.77  ? 4    THR B CA  1 
ATOM   2248 C C   . THR B 2 4   ? 24.996 2.505   -30.581 1.00 18.72  ? 4    THR B C   1 
ATOM   2249 O O   . THR B 2 4   ? 25.738 2.279   -29.624 1.00 25.83  ? 4    THR B O   1 
ATOM   2250 C CB  . THR B 2 4   ? 26.059 4.362   -31.813 1.00 27.10  ? 4    THR B CB  1 
ATOM   2251 O OG1 . THR B 2 4   ? 26.062 5.784   -31.988 1.00 38.60  ? 4    THR B OG1 1 
ATOM   2252 C CG2 . THR B 2 4   ? 26.162 3.678   -33.170 1.00 20.56  ? 4    THR B CG2 1 
ATOM   2253 N N   . PRO B 2 5   ? 24.362 1.533   -31.246 1.00 18.56  ? 5    PRO B N   1 
ATOM   2254 C CA  . PRO B 2 5   ? 24.613 0.131   -30.901 1.00 26.46  ? 5    PRO B CA  1 
ATOM   2255 C C   . PRO B 2 5   ? 26.054 -0.283  -31.197 1.00 34.26  ? 5    PRO B C   1 
ATOM   2256 O O   . PRO B 2 5   ? 26.686 0.243   -32.112 1.00 33.43  ? 5    PRO B O   1 
ATOM   2257 C CB  . PRO B 2 5   ? 23.655 -0.633  -31.823 1.00 16.39  ? 5    PRO B CB  1 
ATOM   2258 C CG  . PRO B 2 5   ? 23.422 0.281   -32.966 1.00 14.50  ? 5    PRO B CG  1 
ATOM   2259 C CD  . PRO B 2 5   ? 23.428 1.664   -32.376 1.00 20.38  ? 5    PRO B CD  1 
ATOM   2260 N N   . LYS B 2 6   ? 26.565 -1.218  -30.407 1.00 33.69  ? 6    LYS B N   1 
ATOM   2261 C CA  . LYS B 2 6   ? 27.823 -1.876  -30.711 1.00 29.87  ? 6    LYS B CA  1 
ATOM   2262 C C   . LYS B 2 6   ? 27.497 -3.302  -31.140 1.00 25.71  ? 6    LYS B C   1 
ATOM   2263 O O   . LYS B 2 6   ? 26.695 -3.986  -30.501 1.00 30.45  ? 6    LYS B O   1 
ATOM   2264 C CB  . LYS B 2 6   ? 28.756 -1.828  -29.502 1.00 32.78  ? 6    LYS B CB  1 
ATOM   2265 C CG  . LYS B 2 6   ? 29.177 -0.405  -29.155 1.00 43.61  ? 6    LYS B CG  1 
ATOM   2266 C CD  . LYS B 2 6   ? 29.664 -0.269  -27.722 1.00 57.87  ? 6    LYS B CD  1 
ATOM   2267 C CE  . LYS B 2 6   ? 30.006 1.184   -27.405 1.00 62.98  ? 6    LYS B CE  1 
ATOM   2268 N NZ  . LYS B 2 6   ? 30.546 1.361   -26.027 1.00 64.03  ? 6    LYS B NZ  1 
ATOM   2269 N N   . ILE B 2 7   ? 28.108 -3.740  -32.234 1.00 21.09  ? 7    ILE B N   1 
ATOM   2270 C CA  . ILE B 2 7   ? 27.663 -4.944  -32.925 1.00 19.49  ? 7    ILE B CA  1 
ATOM   2271 C C   . ILE B 2 7   ? 28.740 -6.018  -32.995 1.00 26.23  ? 7    ILE B C   1 
ATOM   2272 O O   . ILE B 2 7   ? 29.862 -5.755  -33.423 1.00 32.17  ? 7    ILE B O   1 
ATOM   2273 C CB  . ILE B 2 7   ? 27.215 -4.596  -34.361 1.00 24.81  ? 7    ILE B CB  1 
ATOM   2274 C CG1 . ILE B 2 7   ? 26.269 -3.390  -34.344 1.00 21.63  ? 7    ILE B CG1 1 
ATOM   2275 C CG2 . ILE B 2 7   ? 26.557 -5.796  -35.028 1.00 29.32  ? 7    ILE B CG2 1 
ATOM   2276 C CD1 . ILE B 2 7   ? 26.103 -2.710  -35.690 1.00 17.82  ? 7    ILE B CD1 1 
ATOM   2277 N N   . GLN B 2 8   ? 28.392 -7.234  -32.586 1.00 25.34  ? 8    GLN B N   1 
ATOM   2278 C CA  . GLN B 2 8   ? 29.322 -8.356  -32.660 1.00 17.41  ? 8    GLN B CA  1 
ATOM   2279 C C   . GLN B 2 8   ? 28.699 -9.563  -33.361 1.00 26.05  ? 8    GLN B C   1 
ATOM   2280 O O   . GLN B 2 8   ? 27.613 -10.017 -32.995 1.00 28.36  ? 8    GLN B O   1 
ATOM   2281 C CB  . GLN B 2 8   ? 29.801 -8.761  -31.263 1.00 14.40  ? 8    GLN B CB  1 
ATOM   2282 C CG  . GLN B 2 8   ? 30.539 -7.671  -30.502 1.00 14.64  ? 8    GLN B CG  1 
ATOM   2283 C CD  . GLN B 2 8   ? 31.247 -8.209  -29.274 1.00 22.37  ? 8    GLN B CD  1 
ATOM   2284 O OE1 . GLN B 2 8   ? 30.802 -8.001  -28.144 1.00 22.33  ? 8    GLN B OE1 1 
ATOM   2285 N NE2 . GLN B 2 8   ? 32.351 -8.916  -29.489 1.00 25.58  ? 8    GLN B NE2 1 
ATOM   2286 N N   . VAL B 2 9   ? 29.401 -10.077 -34.367 1.00 25.95  ? 9    VAL B N   1 
ATOM   2287 C CA  . VAL B 2 9   ? 28.977 -11.268 -35.090 1.00 20.73  ? 9    VAL B CA  1 
ATOM   2288 C C   . VAL B 2 9   ? 29.975 -12.392 -34.828 1.00 28.19  ? 9    VAL B C   1 
ATOM   2289 O O   . VAL B 2 9   ? 31.174 -12.237 -35.053 1.00 26.13  ? 9    VAL B O   1 
ATOM   2290 C CB  . VAL B 2 9   ? 28.881 -11.010 -36.607 1.00 23.01  ? 9    VAL B CB  1 
ATOM   2291 C CG1 . VAL B 2 9   ? 28.252 -12.201 -37.309 1.00 22.10  ? 9    VAL B CG1 1 
ATOM   2292 C CG2 . VAL B 2 9   ? 28.073 -9.752  -36.878 1.00 27.16  ? 9    VAL B CG2 1 
ATOM   2293 N N   . TYR B 2 10  ? 29.472 -13.524 -34.352 1.00 27.22  ? 10   TYR B N   1 
ATOM   2294 C CA  . TYR B 2 10  ? 30.326 -14.623 -33.933 1.00 18.12  ? 10   TYR B CA  1 
ATOM   2295 C C   . TYR B 2 10  ? 29.504 -15.896 -33.840 1.00 30.58  ? 10   TYR B C   1 
ATOM   2296 O O   . TYR B 2 10  ? 28.279 -15.861 -33.949 1.00 32.93  ? 10   TYR B O   1 
ATOM   2297 C CB  . TYR B 2 10  ? 30.947 -14.311 -32.570 1.00 16.97  ? 10   TYR B CB  1 
ATOM   2298 C CG  . TYR B 2 10  ? 29.926 -13.972 -31.498 1.00 14.91  ? 10   TYR B CG  1 
ATOM   2299 C CD1 . TYR B 2 10  ? 29.333 -12.720 -31.451 1.00 14.72  ? 10   TYR B CD1 1 
ATOM   2300 C CD2 . TYR B 2 10  ? 29.559 -14.906 -30.537 1.00 18.08  ? 10   TYR B CD2 1 
ATOM   2301 C CE1 . TYR B 2 10  ? 28.398 -12.403 -30.483 1.00 19.14  ? 10   TYR B CE1 1 
ATOM   2302 C CE2 . TYR B 2 10  ? 28.625 -14.598 -29.560 1.00 23.54  ? 10   TYR B CE2 1 
ATOM   2303 C CZ  . TYR B 2 10  ? 28.050 -13.342 -29.540 1.00 20.51  ? 10   TYR B CZ  1 
ATOM   2304 O OH  . TYR B 2 10  ? 27.125 -13.022 -28.577 1.00 18.68  ? 10   TYR B OH  1 
ATOM   2305 N N   . SER B 2 11  ? 30.179 -17.020 -33.633 1.00 32.17  ? 11   SER B N   1 
ATOM   2306 C CA  . SER B 2 11  ? 29.496 -18.293 -33.472 1.00 33.11  ? 11   SER B CA  1 
ATOM   2307 C C   . SER B 2 11  ? 29.551 -18.739 -32.016 1.00 34.53  ? 11   SER B C   1 
ATOM   2308 O O   . SER B 2 11  ? 30.415 -18.294 -31.256 1.00 34.12  ? 11   SER B O   1 
ATOM   2309 C CB  . SER B 2 11  ? 30.127 -19.349 -34.372 1.00 30.57  ? 11   SER B CB  1 
ATOM   2310 O OG  . SER B 2 11  ? 31.520 -19.423 -34.139 1.00 31.52  ? 11   SER B OG  1 
ATOM   2311 N N   . ARG B 2 12  ? 28.623 -19.610 -31.629 1.00 29.98  ? 12   ARG B N   1 
ATOM   2312 C CA  . ARG B 2 12  ? 28.582 -20.125 -30.267 1.00 32.69  ? 12   ARG B CA  1 
ATOM   2313 C C   . ARG B 2 12  ? 29.835 -20.945 -29.988 1.00 34.80  ? 12   ARG B C   1 
ATOM   2314 O O   . ARG B 2 12  ? 30.534 -20.718 -29.001 1.00 37.74  ? 12   ARG B O   1 
ATOM   2315 C CB  . ARG B 2 12  ? 27.327 -20.977 -30.041 1.00 33.90  ? 12   ARG B CB  1 
ATOM   2316 C CG  . ARG B 2 12  ? 27.208 -21.522 -28.630 1.00 28.00  ? 12   ARG B CG  1 
ATOM   2317 C CD  . ARG B 2 12  ? 25.958 -22.357 -28.443 1.00 28.88  ? 12   ARG B CD  1 
ATOM   2318 N NE  . ARG B 2 12  ? 24.744 -21.603 -28.735 1.00 40.54  ? 12   ARG B NE  1 
ATOM   2319 C CZ  . ARG B 2 12  ? 23.516 -22.030 -28.456 1.00 37.96  ? 12   ARG B CZ  1 
ATOM   2320 N NH1 . ARG B 2 12  ? 23.342 -23.203 -27.866 1.00 42.06  ? 12   ARG B NH1 1 
ATOM   2321 N NH2 . ARG B 2 12  ? 22.464 -21.283 -28.764 1.00 28.83  ? 12   ARG B NH2 1 
ATOM   2322 N N   . HIS B 2 13  ? 30.115 -21.898 -30.871 1.00 30.77  ? 13   HIS B N   1 
ATOM   2323 C CA  . HIS B 2 13  ? 31.315 -22.714 -30.764 1.00 31.99  ? 13   HIS B CA  1 
ATOM   2324 C C   . HIS B 2 13  ? 32.240 -22.392 -31.928 1.00 36.25  ? 13   HIS B C   1 
ATOM   2325 O O   . HIS B 2 13  ? 31.789 -21.870 -32.950 1.00 36.40  ? 13   HIS B O   1 
ATOM   2326 C CB  . HIS B 2 13  ? 30.949 -24.197 -30.785 1.00 28.50  ? 13   HIS B CB  1 
ATOM   2327 C CG  . HIS B 2 13  ? 29.865 -24.563 -29.820 1.00 39.91  ? 13   HIS B CG  1 
ATOM   2328 N ND1 . HIS B 2 13  ? 30.085 -24.688 -28.465 1.00 43.92  ? 13   HIS B ND1 1 
ATOM   2329 C CD2 . HIS B 2 13  ? 28.552 -24.829 -30.015 1.00 41.45  ? 13   HIS B CD2 1 
ATOM   2330 C CE1 . HIS B 2 13  ? 28.955 -25.017 -27.866 1.00 46.09  ? 13   HIS B CE1 1 
ATOM   2331 N NE2 . HIS B 2 13  ? 28.008 -25.109 -28.784 1.00 45.45  ? 13   HIS B NE2 1 
ATOM   2332 N N   . PRO B 2 14  ? 33.541 -22.688 -31.773 1.00 35.90  ? 14   PRO B N   1 
ATOM   2333 C CA  . PRO B 2 14  ? 34.495 -22.523 -32.874 1.00 40.22  ? 14   PRO B CA  1 
ATOM   2334 C C   . PRO B 2 14  ? 33.986 -23.207 -34.140 1.00 45.38  ? 14   PRO B C   1 
ATOM   2335 O O   . PRO B 2 14  ? 33.657 -24.393 -34.107 1.00 43.26  ? 14   PRO B O   1 
ATOM   2336 C CB  . PRO B 2 14  ? 35.745 -23.231 -32.354 1.00 34.77  ? 14   PRO B CB  1 
ATOM   2337 C CG  . PRO B 2 14  ? 35.658 -23.074 -30.872 1.00 34.71  ? 14   PRO B CG  1 
ATOM   2338 C CD  . PRO B 2 14  ? 34.194 -23.164 -30.541 1.00 35.36  ? 14   PRO B CD  1 
ATOM   2339 N N   . ALA B 2 15  ? 33.916 -22.458 -35.237 1.00 47.77  ? 15   ALA B N   1 
ATOM   2340 C CA  . ALA B 2 15  ? 33.330 -22.960 -36.477 1.00 49.33  ? 15   ALA B CA  1 
ATOM   2341 C C   . ALA B 2 15  ? 34.061 -24.178 -37.029 1.00 48.91  ? 15   ALA B C   1 
ATOM   2342 O O   . ALA B 2 15  ? 35.287 -24.269 -36.969 1.00 55.05  ? 15   ALA B O   1 
ATOM   2343 C CB  . ALA B 2 15  ? 33.267 -21.857 -37.524 1.00 51.98  ? 15   ALA B CB  1 
ATOM   2344 N N   . GLU B 2 16  ? 33.287 -25.112 -37.566 1.00 46.01  ? 16   GLU B N   1 
ATOM   2345 C CA  . GLU B 2 16  ? 33.821 -26.319 -38.177 1.00 40.36  ? 16   GLU B CA  1 
ATOM   2346 C C   . GLU B 2 16  ? 32.913 -26.705 -39.332 1.00 40.96  ? 16   GLU B C   1 
ATOM   2347 O O   . GLU B 2 16  ? 31.767 -27.108 -39.122 1.00 42.29  ? 16   GLU B O   1 
ATOM   2348 C CB  . GLU B 2 16  ? 33.887 -27.454 -37.156 1.00 36.27  ? 16   GLU B CB  1 
ATOM   2349 C CG  . GLU B 2 16  ? 34.254 -28.806 -37.743 1.00 46.37  ? 16   GLU B CG  1 
ATOM   2350 C CD  . GLU B 2 16  ? 34.024 -29.950 -36.767 1.00 65.39  ? 16   GLU B CD  1 
ATOM   2351 O OE1 . GLU B 2 16  ? 33.710 -29.680 -35.586 1.00 73.19  ? 16   GLU B OE1 1 
ATOM   2352 O OE2 . GLU B 2 16  ? 34.153 -31.122 -37.182 1.00 68.52  ? 16   GLU B OE2 1 
ATOM   2353 N N   . ASN B 2 17  ? 33.420 -26.564 -40.551 1.00 35.33  ? 17   ASN B N   1 
ATOM   2354 C CA  . ASN B 2 17  ? 32.629 -26.865 -41.736 1.00 34.19  ? 17   ASN B CA  1 
ATOM   2355 C C   . ASN B 2 17  ? 31.914 -28.207 -41.610 1.00 30.32  ? 17   ASN B C   1 
ATOM   2356 O O   . ASN B 2 17  ? 32.522 -29.216 -41.256 1.00 30.27  ? 17   ASN B O   1 
ATOM   2357 C CB  . ASN B 2 17  ? 33.502 -26.834 -42.994 1.00 35.75  ? 17   ASN B CB  1 
ATOM   2358 C CG  . ASN B 2 17  ? 34.155 -25.478 -43.222 1.00 39.08  ? 17   ASN B CG  1 
ATOM   2359 O OD1 . ASN B 2 17  ? 33.628 -24.443 -42.813 1.00 44.33  ? 17   ASN B OD1 1 
ATOM   2360 N ND2 . ASN B 2 17  ? 35.307 -25.481 -43.882 1.00 34.90  ? 17   ASN B ND2 1 
ATOM   2361 N N   . GLY B 2 18  ? 30.615 -28.205 -41.882 1.00 35.66  ? 18   GLY B N   1 
ATOM   2362 C CA  . GLY B 2 18  ? 29.835 -29.426 -41.867 1.00 38.06  ? 18   GLY B CA  1 
ATOM   2363 C C   . GLY B 2 18  ? 29.146 -29.697 -40.546 1.00 40.95  ? 18   GLY B C   1 
ATOM   2364 O O   . GLY B 2 18  ? 28.271 -30.560 -40.467 1.00 44.49  ? 18   GLY B O   1 
ATOM   2365 N N   . LYS B 2 19  ? 29.537 -28.965 -39.507 1.00 39.26  ? 19   LYS B N   1 
ATOM   2366 C CA  . LYS B 2 19  ? 28.944 -29.153 -38.184 1.00 37.39  ? 19   LYS B CA  1 
ATOM   2367 C C   . LYS B 2 19  ? 27.988 -28.033 -37.783 1.00 36.44  ? 19   LYS B C   1 
ATOM   2368 O O   . LYS B 2 19  ? 28.351 -26.857 -37.782 1.00 40.13  ? 19   LYS B O   1 
ATOM   2369 C CB  . LYS B 2 19  ? 30.025 -29.342 -37.118 1.00 40.05  ? 19   LYS B CB  1 
ATOM   2370 C CG  . LYS B 2 19  ? 30.442 -30.793 -36.940 1.00 61.36  ? 19   LYS B CG  1 
ATOM   2371 C CD  . LYS B 2 19  ? 29.218 -31.677 -36.718 1.00 75.40  ? 19   LYS B CD  1 
ATOM   2372 C CE  . LYS B 2 19  ? 29.553 -33.157 -36.840 1.00 79.37  ? 19   LYS B CE  1 
ATOM   2373 N NZ  . LYS B 2 19  ? 28.336 -34.009 -36.715 1.00 80.24  ? 19   LYS B NZ  1 
ATOM   2374 N N   . SER B 2 20  ? 26.761 -28.411 -37.439 1.00 33.61  ? 20   SER B N   1 
ATOM   2375 C CA  . SER B 2 20  ? 25.769 -27.439 -37.004 1.00 33.49  ? 20   SER B CA  1 
ATOM   2376 C C   . SER B 2 20  ? 26.290 -26.637 -35.815 1.00 33.98  ? 20   SER B C   1 
ATOM   2377 O O   . SER B 2 20  ? 27.060 -27.138 -34.990 1.00 22.68  ? 20   SER B O   1 
ATOM   2378 C CB  . SER B 2 20  ? 24.431 -28.109 -36.676 1.00 32.71  ? 20   SER B CB  1 
ATOM   2379 O OG  . SER B 2 20  ? 24.591 -29.164 -35.747 1.00 41.97  ? 20   SER B OG  1 
ATOM   2380 N N   . ASN B 2 21  ? 25.854 -25.386 -35.741 1.00 24.79  ? 21   ASN B N   1 
ATOM   2381 C CA  . ASN B 2 21  ? 26.392 -24.424 -34.803 1.00 22.99  ? 21   ASN B CA  1 
ATOM   2382 C C   . ASN B 2 21  ? 25.352 -23.329 -34.644 1.00 30.04  ? 21   ASN B C   1 
ATOM   2383 O O   . ASN B 2 21  ? 24.228 -23.463 -35.126 1.00 29.63  ? 21   ASN B O   1 
ATOM   2384 C CB  . ASN B 2 21  ? 27.687 -23.837 -35.369 1.00 25.21  ? 21   ASN B CB  1 
ATOM   2385 C CG  . ASN B 2 21  ? 28.608 -23.292 -34.296 1.00 28.84  ? 21   ASN B CG  1 
ATOM   2386 O OD1 . ASN B 2 21  ? 28.172 -22.949 -33.198 1.00 35.19  ? 21   ASN B OD1 1 
ATOM   2387 N ND2 . ASN B 2 21  ? 29.896 -23.204 -34.614 1.00 26.16  ? 21   ASN B ND2 1 
ATOM   2388 N N   . PHE B 2 22  ? 25.721 -22.242 -33.978 1.00 28.34  ? 22   PHE B N   1 
ATOM   2389 C CA  . PHE B 2 22  ? 24.819 -21.110 -33.836 1.00 27.62  ? 22   PHE B CA  1 
ATOM   2390 C C   . PHE B 2 22  ? 25.510 -19.817 -34.233 1.00 29.42  ? 22   PHE B C   1 
ATOM   2391 O O   . PHE B 2 22  ? 26.633 -19.540 -33.812 1.00 29.63  ? 22   PHE B O   1 
ATOM   2392 C CB  . PHE B 2 22  ? 24.275 -21.013 -32.407 1.00 27.69  ? 22   PHE B CB  1 
ATOM   2393 C CG  . PHE B 2 22  ? 23.124 -21.934 -32.135 1.00 31.47  ? 22   PHE B CG  1 
ATOM   2394 C CD1 . PHE B 2 22  ? 23.333 -23.183 -31.571 1.00 30.87  ? 22   PHE B CD1 1 
ATOM   2395 C CD2 . PHE B 2 22  ? 21.826 -21.551 -32.448 1.00 40.96  ? 22   PHE B CD2 1 
ATOM   2396 C CE1 . PHE B 2 22  ? 22.267 -24.034 -31.321 1.00 37.23  ? 22   PHE B CE1 1 
ATOM   2397 C CE2 . PHE B 2 22  ? 20.754 -22.396 -32.202 1.00 38.18  ? 22   PHE B CE2 1 
ATOM   2398 C CZ  . PHE B 2 22  ? 20.975 -23.639 -31.638 1.00 37.38  ? 22   PHE B CZ  1 
ATOM   2399 N N   . LEU B 2 23  ? 24.830 -19.036 -35.062 1.00 25.96  ? 23   LEU B N   1 
ATOM   2400 C CA  . LEU B 2 23  ? 25.339 -17.746 -35.484 1.00 22.81  ? 23   LEU B CA  1 
ATOM   2401 C C   . LEU B 2 23  ? 24.698 -16.653 -34.634 1.00 25.40  ? 23   LEU B C   1 
ATOM   2402 O O   . LEU B 2 23  ? 23.479 -16.503 -34.613 1.00 27.22  ? 23   LEU B O   1 
ATOM   2403 C CB  . LEU B 2 23  ? 25.038 -17.518 -36.964 1.00 19.78  ? 23   LEU B CB  1 
ATOM   2404 C CG  . LEU B 2 23  ? 25.556 -16.205 -37.543 1.00 23.75  ? 23   LEU B CG  1 
ATOM   2405 C CD1 . LEU B 2 23  ? 27.086 -16.186 -37.533 1.00 19.46  ? 23   LEU B CD1 1 
ATOM   2406 C CD2 . LEU B 2 23  ? 25.002 -15.986 -38.942 1.00 25.08  ? 23   LEU B CD2 1 
ATOM   2407 N N   . ASN B 2 24  ? 25.530 -15.896 -33.930 1.00 27.69  ? 24   ASN B N   1 
ATOM   2408 C CA  . ASN B 2 24  ? 25.045 -14.853 -33.040 1.00 22.53  ? 24   ASN B CA  1 
ATOM   2409 C C   . ASN B 2 24  ? 25.302 -13.464 -33.592 1.00 22.15  ? 24   ASN B C   1 
ATOM   2410 O O   . ASN B 2 24  ? 26.334 -13.206 -34.209 1.00 29.20  ? 24   ASN B O   1 
ATOM   2411 C CB  . ASN B 2 24  ? 25.709 -14.971 -31.665 1.00 23.69  ? 24   ASN B CB  1 
ATOM   2412 C CG  . ASN B 2 24  ? 25.430 -16.300 -30.990 1.00 32.00  ? 24   ASN B CG  1 
ATOM   2413 O OD1 . ASN B 2 24  ? 24.324 -16.838 -31.077 1.00 32.74  ? 24   ASN B OD1 1 
ATOM   2414 N ND2 . ASN B 2 24  ? 26.436 -16.837 -30.307 1.00 31.34  ? 24   ASN B ND2 1 
ATOM   2415 N N   . CYS B 2 25  ? 24.346 -12.575 -33.374 1.00 15.51  ? 25   CYS B N   1 
ATOM   2416 C CA  . CYS B 2 25  ? 24.573 -11.157 -33.552 1.00 19.26  ? 25   CYS B CA  1 
ATOM   2417 C C   . CYS B 2 25  ? 24.169 -10.468 -32.252 1.00 25.76  ? 25   CYS B C   1 
ATOM   2418 O O   . CYS B 2 25  ? 22.993 -10.409 -31.905 1.00 25.11  ? 25   CYS B O   1 
ATOM   2419 C CB  . CYS B 2 25  ? 23.770 -10.610 -34.726 1.00 23.18  ? 25   CYS B CB  1 
ATOM   2420 S SG  . CYS B 2 25  ? 24.143 -8.882  -35.118 1.00 34.80  ? 25   CYS B SG  1 
ATOM   2421 N N   . TYR B 2 26  ? 25.156 -9.970  -31.523 1.00 26.69  ? 26   TYR B N   1 
ATOM   2422 C CA  . TYR B 2 26  ? 24.902 -9.335  -30.244 1.00 17.23  ? 26   TYR B CA  1 
ATOM   2423 C C   . TYR B 2 26  ? 25.006 -7.829  -30.402 1.00 18.62  ? 26   TYR B C   1 
ATOM   2424 O O   . TYR B 2 26  ? 26.056 -7.303  -30.770 1.00 24.23  ? 26   TYR B O   1 
ATOM   2425 C CB  . TYR B 2 26  ? 25.908 -9.844  -29.216 1.00 18.50  ? 26   TYR B CB  1 
ATOM   2426 C CG  . TYR B 2 26  ? 25.732 -9.307  -27.818 1.00 18.35  ? 26   TYR B CG  1 
ATOM   2427 C CD1 . TYR B 2 26  ? 24.558 -9.530  -27.101 1.00 18.98  ? 26   TYR B CD1 1 
ATOM   2428 C CD2 . TYR B 2 26  ? 26.757 -8.611  -27.195 1.00 14.23  ? 26   TYR B CD2 1 
ATOM   2429 C CE1 . TYR B 2 26  ? 24.408 -9.054  -25.808 1.00 11.80  ? 26   TYR B CE1 1 
ATOM   2430 C CE2 . TYR B 2 26  ? 26.619 -8.134  -25.904 1.00 18.87  ? 26   TYR B CE2 1 
ATOM   2431 C CZ  . TYR B 2 26  ? 25.448 -8.355  -25.215 1.00 19.83  ? 26   TYR B CZ  1 
ATOM   2432 O OH  . TYR B 2 26  ? 25.328 -7.869  -23.932 1.00 23.70  ? 26   TYR B OH  1 
ATOM   2433 N N   . VAL B 2 27  ? 23.899 -7.138  -30.155 1.00 21.51  ? 27   VAL B N   1 
ATOM   2434 C CA  . VAL B 2 27  ? 23.891 -5.683  -30.191 1.00 20.42  ? 27   VAL B CA  1 
ATOM   2435 C C   . VAL B 2 27  ? 23.700 -5.139  -28.783 1.00 18.68  ? 27   VAL B C   1 
ATOM   2436 O O   . VAL B 2 27  ? 22.732 -5.481  -28.105 1.00 23.24  ? 27   VAL B O   1 
ATOM   2437 C CB  . VAL B 2 27  ? 22.796 -5.131  -31.132 1.00 20.53  ? 27   VAL B CB  1 
ATOM   2438 C CG1 . VAL B 2 27  ? 23.176 -5.367  -32.581 1.00 18.73  ? 27   VAL B CG1 1 
ATOM   2439 C CG2 . VAL B 2 27  ? 21.455 -5.770  -30.827 1.00 32.02  ? 27   VAL B CG2 1 
ATOM   2440 N N   . SER B 2 28  ? 24.632 -4.298  -28.342 1.00 7.57   ? 28   SER B N   1 
ATOM   2441 C CA  . SER B 2 28  ? 24.547 -3.724  -27.010 1.00 13.10  ? 28   SER B CA  1 
ATOM   2442 C C   . SER B 2 28  ? 24.905 -2.239  -26.986 1.00 17.75  ? 28   SER B C   1 
ATOM   2443 O O   . SER B 2 28  ? 25.461 -1.704  -27.944 1.00 18.60  ? 28   SER B O   1 
ATOM   2444 C CB  . SER B 2 28  ? 25.451 -4.494  -26.041 1.00 13.43  ? 28   SER B CB  1 
ATOM   2445 O OG  . SER B 2 28  ? 26.814 -4.208  -26.292 1.00 21.67  ? 28   SER B OG  1 
ATOM   2446 N N   . GLY B 2 29  ? 24.570 -1.580  -25.880 1.00 18.07  ? 29   GLY B N   1 
ATOM   2447 C CA  . GLY B 2 29  ? 24.954 -0.202  -25.655 1.00 14.31  ? 29   GLY B CA  1 
ATOM   2448 C C   . GLY B 2 29  ? 24.156 0.816   -26.443 1.00 21.90  ? 29   GLY B C   1 
ATOM   2449 O O   . GLY B 2 29  ? 24.604 1.948   -26.629 1.00 30.86  ? 29   GLY B O   1 
ATOM   2450 N N   . PHE B 2 30  ? 22.968 0.430   -26.897 1.00 14.72  ? 30   PHE B N   1 
ATOM   2451 C CA  . PHE B 2 30  ? 22.160 1.332   -27.709 1.00 14.62  ? 30   PHE B CA  1 
ATOM   2452 C C   . PHE B 2 30  ? 20.931 1.895   -26.992 1.00 22.97  ? 30   PHE B C   1 
ATOM   2453 O O   . PHE B 2 30  ? 20.505 1.393   -25.950 1.00 22.56  ? 30   PHE B O   1 
ATOM   2454 C CB  . PHE B 2 30  ? 21.756 0.667   -29.030 1.00 12.71  ? 30   PHE B CB  1 
ATOM   2455 C CG  . PHE B 2 30  ? 20.856 -0.526  -28.867 1.00 18.26  ? 30   PHE B CG  1 
ATOM   2456 C CD1 . PHE B 2 30  ? 21.386 -1.786  -28.649 1.00 20.08  ? 30   PHE B CD1 1 
ATOM   2457 C CD2 . PHE B 2 30  ? 19.479 -0.390  -28.957 1.00 20.05  ? 30   PHE B CD2 1 
ATOM   2458 C CE1 . PHE B 2 30  ? 20.561 -2.887  -28.511 1.00 20.58  ? 30   PHE B CE1 1 
ATOM   2459 C CE2 . PHE B 2 30  ? 18.649 -1.487  -28.819 1.00 21.61  ? 30   PHE B CE2 1 
ATOM   2460 C CZ  . PHE B 2 30  ? 19.191 -2.737  -28.597 1.00 20.80  ? 30   PHE B CZ  1 
ATOM   2461 N N   . HIS B 2 31  ? 20.378 2.953   -27.574 1.00 23.71  ? 31   HIS B N   1 
ATOM   2462 C CA  . HIS B 2 31  ? 19.187 3.607   -27.056 1.00 23.15  ? 31   HIS B CA  1 
ATOM   2463 C C   . HIS B 2 31  ? 18.668 4.555   -28.144 1.00 24.22  ? 31   HIS B C   1 
ATOM   2464 O O   . HIS B 2 31  ? 19.430 5.351   -28.689 1.00 22.92  ? 31   HIS B O   1 
ATOM   2465 C CB  . HIS B 2 31  ? 19.523 4.374   -25.773 1.00 18.85  ? 31   HIS B CB  1 
ATOM   2466 C CG  . HIS B 2 31  ? 18.395 4.433   -24.790 1.00 17.66  ? 31   HIS B CG  1 
ATOM   2467 N ND1 . HIS B 2 31  ? 17.334 5.301   -24.926 1.00 18.39  ? 31   HIS B ND1 1 
ATOM   2468 C CD2 . HIS B 2 31  ? 18.165 3.730   -23.656 1.00 20.97  ? 31   HIS B CD2 1 
ATOM   2469 C CE1 . HIS B 2 31  ? 16.495 5.128   -23.919 1.00 20.54  ? 31   HIS B CE1 1 
ATOM   2470 N NE2 . HIS B 2 31  ? 16.976 4.180   -23.135 1.00 22.56  ? 31   HIS B NE2 1 
ATOM   2471 N N   . PRO B 2 32  ? 17.367 4.486   -28.458 1.00 31.39  ? 32   PRO B N   1 
ATOM   2472 C CA  . PRO B 2 32  ? 16.342 3.705   -27.762 1.00 34.98  ? 32   PRO B CA  1 
ATOM   2473 C C   . PRO B 2 32  ? 16.279 2.247   -28.221 1.00 33.10  ? 32   PRO B C   1 
ATOM   2474 O O   . PRO B 2 32  ? 17.140 1.787   -28.972 1.00 31.28  ? 32   PRO B O   1 
ATOM   2475 C CB  . PRO B 2 32  ? 15.055 4.434   -28.149 1.00 27.60  ? 32   PRO B CB  1 
ATOM   2476 C CG  . PRO B 2 32  ? 15.326 4.890   -29.548 1.00 25.32  ? 32   PRO B CG  1 
ATOM   2477 C CD  . PRO B 2 32  ? 16.807 5.214   -29.612 1.00 30.59  ? 32   PRO B CD  1 
ATOM   2478 N N   . SER B 2 33  ? 15.244 1.541   -27.771 1.00 31.25  ? 33   SER B N   1 
ATOM   2479 C CA  . SER B 2 33  ? 15.120 0.101   -27.978 1.00 29.34  ? 33   SER B CA  1 
ATOM   2480 C C   . SER B 2 33  ? 14.753 -0.305  -29.404 1.00 26.36  ? 33   SER B C   1 
ATOM   2481 O O   . SER B 2 33  ? 15.166 -1.364  -29.871 1.00 30.72  ? 33   SER B O   1 
ATOM   2482 C CB  . SER B 2 33  ? 14.117 -0.493  -26.982 1.00 25.63  ? 33   SER B CB  1 
ATOM   2483 O OG  . SER B 2 33  ? 12.943 0.295   -26.919 1.00 33.25  ? 33   SER B OG  1 
ATOM   2484 N N   . ASP B 2 34  ? 13.973 0.525   -30.091 1.00 25.25  ? 34   ASP B N   1 
ATOM   2485 C CA  . ASP B 2 34  ? 13.588 0.232   -31.466 1.00 31.32  ? 34   ASP B CA  1 
ATOM   2486 C C   . ASP B 2 34  ? 14.829 0.002   -32.323 1.00 31.87  ? 34   ASP B C   1 
ATOM   2487 O O   . ASP B 2 34  ? 15.597 0.929   -32.580 1.00 30.76  ? 34   ASP B O   1 
ATOM   2488 C CB  . ASP B 2 34  ? 12.748 1.369   -32.048 1.00 54.47  ? 34   ASP B CB  1 
ATOM   2489 C CG  . ASP B 2 34  ? 11.482 1.627   -31.249 1.00 81.66  ? 34   ASP B CG  1 
ATOM   2490 O OD1 . ASP B 2 34  ? 10.821 0.647   -30.842 1.00 86.20  ? 34   ASP B OD1 1 
ATOM   2491 O OD2 . ASP B 2 34  ? 11.150 2.812   -31.022 1.00 91.28  ? 34   ASP B OD2 1 
ATOM   2492 N N   . ILE B 2 35  ? 15.020 -1.238  -32.761 1.00 28.41  ? 35   ILE B N   1 
ATOM   2493 C CA  . ILE B 2 35  ? 16.191 -1.599  -33.544 1.00 24.70  ? 35   ILE B CA  1 
ATOM   2494 C C   . ILE B 2 35  ? 15.857 -2.739  -34.497 1.00 26.08  ? 35   ILE B C   1 
ATOM   2495 O O   . ILE B 2 35  ? 15.107 -3.649  -34.146 1.00 29.06  ? 35   ILE B O   1 
ATOM   2496 C CB  . ILE B 2 35  ? 17.359 -2.027  -32.635 1.00 23.88  ? 35   ILE B CB  1 
ATOM   2497 C CG1 . ILE B 2 35  ? 18.677 -2.018  -33.415 1.00 23.64  ? 35   ILE B CG1 1 
ATOM   2498 C CG2 . ILE B 2 35  ? 17.084 -3.398  -32.022 1.00 9.57   ? 35   ILE B CG2 1 
ATOM   2499 C CD1 . ILE B 2 35  ? 19.906 -2.138  -32.537 1.00 21.59  ? 35   ILE B CD1 1 
ATOM   2500 N N   . GLU B 2 36  ? 16.411 -2.681  -35.705 1.00 24.30  ? 36   GLU B N   1 
ATOM   2501 C CA  . GLU B 2 36  ? 16.191 -3.725  -36.700 1.00 30.65  ? 36   GLU B CA  1 
ATOM   2502 C C   . GLU B 2 36  ? 17.465 -4.535  -36.928 1.00 25.55  ? 36   GLU B C   1 
ATOM   2503 O O   . GLU B 2 36  ? 18.536 -3.977  -37.165 1.00 25.24  ? 36   GLU B O   1 
ATOM   2504 C CB  . GLU B 2 36  ? 15.696 -3.126  -38.021 1.00 38.25  ? 36   GLU B CB  1 
ATOM   2505 C CG  . GLU B 2 36  ? 15.336 -4.169  -39.073 1.00 51.44  ? 36   GLU B CG  1 
ATOM   2506 C CD  . GLU B 2 36  ? 14.841 -3.562  -40.381 1.00 60.37  ? 36   GLU B CD  1 
ATOM   2507 O OE1 . GLU B 2 36  ? 15.157 -2.385  -40.664 1.00 64.18  ? 36   GLU B OE1 1 
ATOM   2508 O OE2 . GLU B 2 36  ? 14.131 -4.269  -41.129 1.00 59.48  ? 36   GLU B OE2 1 
ATOM   2509 N N   . VAL B 2 37  ? 17.344 -5.855  -36.858 1.00 21.06  ? 37   VAL B N   1 
ATOM   2510 C CA  . VAL B 2 37  ? 18.504 -6.729  -36.968 1.00 22.58  ? 37   VAL B CA  1 
ATOM   2511 C C   . VAL B 2 37  ? 18.200 -7.949  -37.825 1.00 25.81  ? 37   VAL B C   1 
ATOM   2512 O O   . VAL B 2 37  ? 17.222 -8.658  -37.580 1.00 30.19  ? 37   VAL B O   1 
ATOM   2513 C CB  . VAL B 2 37  ? 18.991 -7.188  -35.576 1.00 21.24  ? 37   VAL B CB  1 
ATOM   2514 C CG1 . VAL B 2 37  ? 20.152 -8.165  -35.707 1.00 14.95  ? 37   VAL B CG1 1 
ATOM   2515 C CG2 . VAL B 2 37  ? 19.388 -5.985  -34.732 1.00 20.62  ? 37   VAL B CG2 1 
ATOM   2516 N N   . ASP B 2 38  ? 19.038 -8.182  -38.834 1.00 24.16  ? 38   ASP B N   1 
ATOM   2517 C CA  . ASP B 2 38  ? 18.905 -9.347  -39.704 1.00 25.89  ? 38   ASP B CA  1 
ATOM   2518 C C   . ASP B 2 38  ? 20.218 -10.108 -39.829 1.00 31.48  ? 38   ASP B C   1 
ATOM   2519 O O   . ASP B 2 38  ? 21.294 -9.511  -39.868 1.00 38.92  ? 38   ASP B O   1 
ATOM   2520 C CB  . ASP B 2 38  ? 18.430 -8.936  -41.100 1.00 34.80  ? 38   ASP B CB  1 
ATOM   2521 C CG  . ASP B 2 38  ? 16.960 -8.587  -41.138 1.00 43.43  ? 38   ASP B CG  1 
ATOM   2522 O OD1 . ASP B 2 38  ? 16.132 -9.522  -41.162 1.00 54.95  ? 38   ASP B OD1 1 
ATOM   2523 O OD2 . ASP B 2 38  ? 16.633 -7.383  -41.153 1.00 38.69  ? 38   ASP B OD2 1 
ATOM   2524 N N   . LEU B 2 39  ? 20.123 -11.431 -39.891 1.00 28.83  ? 39   LEU B N   1 
ATOM   2525 C CA  . LEU B 2 39  ? 21.284 -12.261 -40.172 1.00 27.54  ? 39   LEU B CA  1 
ATOM   2526 C C   . LEU B 2 39  ? 21.265 -12.634 -41.648 1.00 31.07  ? 39   LEU B C   1 
ATOM   2527 O O   . LEU B 2 39  ? 20.237 -13.067 -42.172 1.00 34.08  ? 39   LEU B O   1 
ATOM   2528 C CB  . LEU B 2 39  ? 21.277 -13.516 -39.297 1.00 28.00  ? 39   LEU B CB  1 
ATOM   2529 C CG  . LEU B 2 39  ? 21.280 -13.267 -37.787 1.00 23.35  ? 39   LEU B CG  1 
ATOM   2530 C CD1 . LEU B 2 39  ? 21.143 -14.572 -37.021 1.00 19.80  ? 39   LEU B CD1 1 
ATOM   2531 C CD2 . LEU B 2 39  ? 22.550 -12.537 -37.385 1.00 27.64  ? 39   LEU B CD2 1 
ATOM   2532 N N   . LEU B 2 40  ? 22.398 -12.455 -42.318 1.00 28.49  ? 40   LEU B N   1 
ATOM   2533 C CA  . LEU B 2 40  ? 22.475 -12.684 -43.754 1.00 22.91  ? 40   LEU B CA  1 
ATOM   2534 C C   . LEU B 2 40  ? 23.318 -13.910 -44.107 1.00 28.75  ? 40   LEU B C   1 
ATOM   2535 O O   . LEU B 2 40  ? 24.393 -14.122 -43.545 1.00 34.07  ? 40   LEU B O   1 
ATOM   2536 C CB  . LEU B 2 40  ? 23.042 -11.446 -44.453 1.00 20.30  ? 40   LEU B CB  1 
ATOM   2537 C CG  . LEU B 2 40  ? 22.455 -10.084 -44.067 1.00 24.55  ? 40   LEU B CG  1 
ATOM   2538 C CD1 . LEU B 2 40  ? 23.222 -8.959  -44.749 1.00 23.36  ? 40   LEU B CD1 1 
ATOM   2539 C CD2 . LEU B 2 40  ? 20.971 -9.999  -44.398 1.00 21.41  ? 40   LEU B CD2 1 
ATOM   2540 N N   . LYS B 2 41  ? 22.821 -14.719 -45.036 1.00 27.14  ? 41   LYS B N   1 
ATOM   2541 C CA  . LYS B 2 41  ? 23.623 -15.784 -45.626 1.00 26.52  ? 41   LYS B CA  1 
ATOM   2542 C C   . LYS B 2 41  ? 23.898 -15.450 -47.087 1.00 31.78  ? 41   LYS B C   1 
ATOM   2543 O O   . LYS B 2 41  ? 22.991 -15.469 -47.919 1.00 32.72  ? 41   LYS B O   1 
ATOM   2544 C CB  . LYS B 2 41  ? 22.915 -17.133 -45.523 1.00 28.95  ? 41   LYS B CB  1 
ATOM   2545 C CG  . LYS B 2 41  ? 23.682 -18.268 -46.188 1.00 31.51  ? 41   LYS B CG  1 
ATOM   2546 C CD  . LYS B 2 41  ? 22.930 -19.582 -46.104 1.00 30.69  ? 41   LYS B CD  1 
ATOM   2547 C CE  . LYS B 2 41  ? 23.774 -20.718 -46.657 1.00 39.43  ? 41   LYS B CE  1 
ATOM   2548 N NZ  . LYS B 2 41  ? 23.054 -22.022 -46.629 1.00 44.52  ? 41   LYS B NZ  1 
ATOM   2549 N N   . ASN B 2 42  ? 25.150 -15.135 -47.392 1.00 34.53  ? 42   ASN B N   1 
ATOM   2550 C CA  . ASN B 2 42  ? 25.525 -14.721 -48.738 1.00 35.02  ? 42   ASN B CA  1 
ATOM   2551 C C   . ASN B 2 42  ? 24.666 -13.561 -49.231 1.00 35.00  ? 42   ASN B C   1 
ATOM   2552 O O   . ASN B 2 42  ? 24.373 -13.448 -50.420 1.00 38.29  ? 42   ASN B O   1 
ATOM   2553 C CB  . ASN B 2 42  ? 25.457 -15.903 -49.709 1.00 31.02  ? 42   ASN B CB  1 
ATOM   2554 C CG  . ASN B 2 42  ? 26.437 -17.006 -49.354 1.00 36.49  ? 42   ASN B CG  1 
ATOM   2555 O OD1 . ASN B 2 42  ? 27.588 -16.741 -49.011 1.00 38.13  ? 42   ASN B OD1 1 
ATOM   2556 N ND2 . ASN B 2 42  ? 25.980 -18.253 -49.426 1.00 35.21  ? 42   ASN B ND2 1 
ATOM   2557 N N   . GLY B 2 43  ? 24.265 -12.702 -48.300 1.00 32.96  ? 43   GLY B N   1 
ATOM   2558 C CA  . GLY B 2 43  ? 23.489 -11.526 -48.636 1.00 30.06  ? 43   GLY B CA  1 
ATOM   2559 C C   . GLY B 2 43  ? 21.997 -11.721 -48.465 1.00 29.82  ? 43   GLY B C   1 
ATOM   2560 O O   . GLY B 2 43  ? 21.265 -10.752 -48.290 1.00 26.46  ? 43   GLY B O   1 
ATOM   2561 N N   . GLU B 2 44  ? 21.543 -12.970 -48.524 1.00 40.63  ? 44   GLU B N   1 
ATOM   2562 C CA  . GLU B 2 44  ? 20.125 -13.280 -48.350 1.00 44.66  ? 44   GLU B CA  1 
ATOM   2563 C C   . GLU B 2 44  ? 19.714 -13.222 -46.883 1.00 43.02  ? 44   GLU B C   1 
ATOM   2564 O O   . GLU B 2 44  ? 20.408 -13.740 -46.007 1.00 42.68  ? 44   GLU B O   1 
ATOM   2565 C CB  . GLU B 2 44  ? 19.785 -14.660 -48.919 1.00 52.25  ? 44   GLU B CB  1 
ATOM   2566 C CG  . GLU B 2 44  ? 19.542 -14.696 -50.415 1.00 59.91  ? 44   GLU B CG  1 
ATOM   2567 C CD  . GLU B 2 44  ? 19.014 -16.042 -50.880 1.00 73.07  ? 44   GLU B CD  1 
ATOM   2568 O OE1 . GLU B 2 44  ? 19.778 -16.795 -51.520 1.00 78.47  ? 44   GLU B OE1 1 
ATOM   2569 O OE2 . GLU B 2 44  ? 17.833 -16.348 -50.605 1.00 76.31  ? 44   GLU B OE2 1 
ATOM   2570 N N   . ARG B 2 45  ? 18.575 -12.592 -46.627 1.00 34.80  ? 45   ARG B N   1 
ATOM   2571 C CA  . ARG B 2 45  ? 18.031 -12.499 -45.283 1.00 38.97  ? 45   ARG B CA  1 
ATOM   2572 C C   . ARG B 2 45  ? 17.597 -13.876 -44.787 1.00 39.32  ? 45   ARG B C   1 
ATOM   2573 O O   . ARG B 2 45  ? 16.923 -14.621 -45.499 1.00 39.43  ? 45   ARG B O   1 
ATOM   2574 C CB  . ARG B 2 45  ? 16.858 -11.517 -45.277 1.00 43.91  ? 45   ARG B CB  1 
ATOM   2575 C CG  . ARG B 2 45  ? 16.048 -11.453 -43.994 1.00 55.19  ? 45   ARG B CG  1 
ATOM   2576 C CD  . ARG B 2 45  ? 15.056 -10.296 -44.064 1.00 67.32  ? 45   ARG B CD  1 
ATOM   2577 N NE  . ARG B 2 45  ? 14.619 -10.054 -45.440 1.00 81.80  ? 45   ARG B NE  1 
ATOM   2578 C CZ  . ARG B 2 45  ? 13.860 -9.031  -45.825 1.00 86.07  ? 45   ARG B CZ  1 
ATOM   2579 N NH1 . ARG B 2 45  ? 13.441 -8.137  -44.938 1.00 84.89  ? 45   ARG B NH1 1 
ATOM   2580 N NH2 . ARG B 2 45  ? 13.520 -8.900  -47.101 1.00 84.92  ? 45   ARG B NH2 1 
ATOM   2581 N N   . ILE B 2 46  ? 18.002 -14.214 -43.568 1.00 39.94  ? 46   ILE B N   1 
ATOM   2582 C CA  . ILE B 2 46  ? 17.601 -15.472 -42.943 1.00 37.70  ? 46   ILE B CA  1 
ATOM   2583 C C   . ILE B 2 46  ? 16.292 -15.281 -42.172 1.00 40.27  ? 46   ILE B C   1 
ATOM   2584 O O   . ILE B 2 46  ? 16.146 -14.317 -41.416 1.00 33.88  ? 46   ILE B O   1 
ATOM   2585 C CB  . ILE B 2 46  ? 18.701 -16.002 -42.004 1.00 26.80  ? 46   ILE B CB  1 
ATOM   2586 C CG1 . ILE B 2 46  ? 19.998 -16.225 -42.783 1.00 28.34  ? 46   ILE B CG1 1 
ATOM   2587 C CG2 . ILE B 2 46  ? 18.259 -17.293 -41.327 1.00 22.03  ? 46   ILE B CG2 1 
ATOM   2588 C CD1 . ILE B 2 46  ? 21.159 -16.704 -41.922 1.00 30.48  ? 46   ILE B CD1 1 
ATOM   2589 N N   . GLU B 2 47  ? 15.344 -16.196 -42.365 1.00 45.40  ? 47   GLU B N   1 
ATOM   2590 C CA  . GLU B 2 47  ? 14.003 -16.030 -41.800 1.00 58.63  ? 47   GLU B CA  1 
ATOM   2591 C C   . GLU B 2 47  ? 13.803 -16.668 -40.422 1.00 62.46  ? 47   GLU B C   1 
ATOM   2592 O O   . GLU B 2 47  ? 13.158 -16.081 -39.551 1.00 62.74  ? 47   GLU B O   1 
ATOM   2593 C CB  . GLU B 2 47  ? 12.931 -16.524 -42.777 1.00 69.88  ? 47   GLU B CB  1 
ATOM   2594 C CG  . GLU B 2 47  ? 11.494 -16.332 -42.281 1.00 84.75  ? 47   GLU B CG  1 
ATOM   2595 C CD  . GLU B 2 47  ? 11.114 -14.868 -42.062 1.00 90.01  ? 47   GLU B CD  1 
ATOM   2596 O OE1 . GLU B 2 47  ? 11.852 -14.146 -41.356 1.00 89.81  ? 47   GLU B OE1 1 
ATOM   2597 O OE2 . GLU B 2 47  ? 10.066 -14.442 -42.595 1.00 88.91  ? 47   GLU B OE2 1 
ATOM   2598 N N   . LYS B 2 48  ? 14.344 -17.866 -40.228 1.00 65.07  ? 48   LYS B N   1 
ATOM   2599 C CA  . LYS B 2 48  ? 14.246 -18.538 -38.933 1.00 70.73  ? 48   LYS B CA  1 
ATOM   2600 C C   . LYS B 2 48  ? 15.270 -17.980 -37.939 1.00 59.83  ? 48   LYS B C   1 
ATOM   2601 O O   . LYS B 2 48  ? 16.284 -18.621 -37.659 1.00 63.88  ? 48   LYS B O   1 
ATOM   2602 C CB  . LYS B 2 48  ? 14.440 -20.049 -39.100 1.00 82.61  ? 48   LYS B CB  1 
ATOM   2603 C CG  . LYS B 2 48  ? 13.344 -20.741 -39.905 1.00 87.01  ? 48   LYS B CG  1 
ATOM   2604 C CD  . LYS B 2 48  ? 12.282 -21.362 -39.003 1.00 88.69  ? 48   LYS B CD  1 
ATOM   2605 C CE  . LYS B 2 48  ? 12.838 -22.546 -38.215 1.00 87.75  ? 48   LYS B CE  1 
ATOM   2606 N NZ  . LYS B 2 48  ? 11.789 -23.240 -37.412 1.00 84.35  ? 48   LYS B NZ  1 
ATOM   2607 N N   . VAL B 2 49  ? 14.997 -16.789 -37.408 1.00 40.50  ? 49   VAL B N   1 
ATOM   2608 C CA  . VAL B 2 49  ? 15.935 -16.107 -36.516 1.00 30.01  ? 49   VAL B CA  1 
ATOM   2609 C C   . VAL B 2 49  ? 15.327 -15.727 -35.164 1.00 32.71  ? 49   VAL B C   1 
ATOM   2610 O O   . VAL B 2 49  ? 14.345 -14.988 -35.093 1.00 31.31  ? 49   VAL B O   1 
ATOM   2611 C CB  . VAL B 2 49  ? 16.513 -14.835 -37.170 1.00 30.99  ? 49   VAL B CB  1 
ATOM   2612 C CG1 . VAL B 2 49  ? 17.340 -14.048 -36.165 1.00 27.56  ? 49   VAL B CG1 1 
ATOM   2613 C CG2 . VAL B 2 49  ? 17.350 -15.197 -38.384 1.00 35.76  ? 49   VAL B CG2 1 
ATOM   2614 N N   . GLU B 2 50  ? 15.930 -16.228 -34.091 1.00 34.98  ? 50   GLU B N   1 
ATOM   2615 C CA  . GLU B 2 50  ? 15.478 -15.929 -32.739 1.00 32.08  ? 50   GLU B CA  1 
ATOM   2616 C C   . GLU B 2 50  ? 16.188 -14.703 -32.174 1.00 34.11  ? 50   GLU B C   1 
ATOM   2617 O O   . GLU B 2 50  ? 17.261 -14.321 -32.638 1.00 33.79  ? 50   GLU B O   1 
ATOM   2618 C CB  . GLU B 2 50  ? 15.748 -17.120 -31.821 1.00 36.65  ? 50   GLU B CB  1 
ATOM   2619 C CG  . GLU B 2 50  ? 14.549 -17.571 -31.017 1.00 50.89  ? 50   GLU B CG  1 
ATOM   2620 C CD  . GLU B 2 50  ? 13.676 -18.537 -31.788 1.00 58.66  ? 50   GLU B CD  1 
ATOM   2621 O OE1 . GLU B 2 50  ? 14.042 -18.873 -32.934 1.00 57.94  ? 50   GLU B OE1 1 
ATOM   2622 O OE2 . GLU B 2 50  ? 12.633 -18.963 -31.245 1.00 56.19  ? 50   GLU B OE2 1 
ATOM   2623 N N   . HIS B 2 51  ? 15.584 -14.087 -31.165 1.00 33.37  ? 51   HIS B N   1 
ATOM   2624 C CA  . HIS B 2 51  ? 16.248 -13.021 -30.432 1.00 32.25  ? 51   HIS B CA  1 
ATOM   2625 C C   . HIS B 2 51  ? 15.923 -13.133 -28.947 1.00 31.96  ? 51   HIS B C   1 
ATOM   2626 O O   . HIS B 2 51  ? 14.907 -13.718 -28.571 1.00 28.85  ? 51   HIS B O   1 
ATOM   2627 C CB  . HIS B 2 51  ? 15.873 -11.644 -30.985 1.00 30.24  ? 51   HIS B CB  1 
ATOM   2628 C CG  . HIS B 2 51  ? 14.429 -11.295 -30.818 1.00 41.63  ? 51   HIS B CG  1 
ATOM   2629 N ND1 . HIS B 2 51  ? 13.961 -10.560 -29.750 1.00 45.80  ? 51   HIS B ND1 1 
ATOM   2630 C CD2 . HIS B 2 51  ? 13.349 -11.577 -31.582 1.00 53.63  ? 51   HIS B CD2 1 
ATOM   2631 C CE1 . HIS B 2 51  ? 12.654 -10.405 -29.864 1.00 54.13  ? 51   HIS B CE1 1 
ATOM   2632 N NE2 . HIS B 2 51  ? 12.258 -11.015 -30.967 1.00 56.92  ? 51   HIS B NE2 1 
ATOM   2633 N N   . SER B 2 52  ? 16.803 -12.593 -28.109 1.00 24.24  ? 52   SER B N   1 
ATOM   2634 C CA  . SER B 2 52  ? 16.619 -12.651 -26.666 1.00 20.42  ? 52   SER B CA  1 
ATOM   2635 C C   . SER B 2 52  ? 15.570 -11.637 -26.223 1.00 26.35  ? 52   SER B C   1 
ATOM   2636 O O   . SER B 2 52  ? 15.003 -10.917 -27.045 1.00 34.92  ? 52   SER B O   1 
ATOM   2637 C CB  . SER B 2 52  ? 17.940 -12.382 -25.947 1.00 19.37  ? 52   SER B CB  1 
ATOM   2638 O OG  . SER B 2 52  ? 18.290 -11.011 -26.024 1.00 23.65  ? 52   SER B OG  1 
ATOM   2639 N N   . ASP B 2 53  ? 15.308 -11.588 -24.923 1.00 21.60  ? 53   ASP B N   1 
ATOM   2640 C CA  . ASP B 2 53  ? 14.370 -10.615 -24.381 1.00 26.68  ? 53   ASP B CA  1 
ATOM   2641 C C   . ASP B 2 53  ? 15.089 -9.312  -24.060 1.00 30.84  ? 53   ASP B C   1 
ATOM   2642 O O   . ASP B 2 53  ? 16.207 -9.319  -23.539 1.00 33.41  ? 53   ASP B O   1 
ATOM   2643 C CB  . ASP B 2 53  ? 13.674 -11.171 -23.137 1.00 27.12  ? 53   ASP B CB  1 
ATOM   2644 C CG  . ASP B 2 53  ? 12.697 -12.280 -23.465 1.00 35.88  ? 53   ASP B CG  1 
ATOM   2645 O OD1 . ASP B 2 53  ? 11.834 -12.072 -24.347 1.00 44.56  ? 53   ASP B OD1 1 
ATOM   2646 O OD2 . ASP B 2 53  ? 12.800 -13.364 -22.852 1.00 32.76  ? 53   ASP B OD2 1 
ATOM   2647 N N   . LEU B 2 54  ? 14.447 -8.195  -24.381 1.00 26.24  ? 54   LEU B N   1 
ATOM   2648 C CA  . LEU B 2 54  ? 15.045 -6.887  -24.162 1.00 26.20  ? 54   LEU B CA  1 
ATOM   2649 C C   . LEU B 2 54  ? 15.485 -6.719  -22.710 1.00 25.22  ? 54   LEU B C   1 
ATOM   2650 O O   . LEU B 2 54  ? 14.744 -7.034  -21.781 1.00 26.08  ? 54   LEU B O   1 
ATOM   2651 C CB  . LEU B 2 54  ? 14.070 -5.772  -24.551 1.00 26.02  ? 54   LEU B CB  1 
ATOM   2652 C CG  . LEU B 2 54  ? 14.657 -4.361  -24.630 1.00 20.40  ? 54   LEU B CG  1 
ATOM   2653 C CD1 . LEU B 2 54  ? 15.686 -4.282  -25.754 1.00 11.44  ? 54   LEU B CD1 1 
ATOM   2654 C CD2 . LEU B 2 54  ? 13.555 -3.327  -24.827 1.00 17.97  ? 54   LEU B CD2 1 
ATOM   2655 N N   . SER B 2 55  ? 16.700 -6.222  -22.526 1.00 25.89  ? 55   SER B N   1 
ATOM   2656 C CA  . SER B 2 55  ? 17.226 -5.959  -21.197 1.00 25.10  ? 55   SER B CA  1 
ATOM   2657 C C   . SER B 2 55  ? 18.232 -4.817  -21.305 1.00 25.90  ? 55   SER B C   1 
ATOM   2658 O O   . SER B 2 55  ? 18.607 -4.426  -22.407 1.00 36.25  ? 55   SER B O   1 
ATOM   2659 C CB  . SER B 2 55  ? 17.878 -7.216  -20.620 1.00 24.99  ? 55   SER B CB  1 
ATOM   2660 O OG  . SER B 2 55  ? 17.840 -7.202  -19.206 1.00 28.95  ? 55   SER B OG  1 
ATOM   2661 N N   . PHE B 2 56  ? 18.662 -4.276  -20.172 1.00 23.07  ? 56   PHE B N   1 
ATOM   2662 C CA  . PHE B 2 56  ? 19.530 -3.104  -20.189 1.00 22.90  ? 56   PHE B CA  1 
ATOM   2663 C C   . PHE B 2 56  ? 20.600 -3.117  -19.099 1.00 24.72  ? 56   PHE B C   1 
ATOM   2664 O O   . PHE B 2 56  ? 20.500 -3.852  -18.117 1.00 20.97  ? 56   PHE B O   1 
ATOM   2665 C CB  . PHE B 2 56  ? 18.700 -1.817  -20.109 1.00 22.10  ? 56   PHE B CB  1 
ATOM   2666 C CG  . PHE B 2 56  ? 17.666 -1.823  -19.017 1.00 20.67  ? 56   PHE B CG  1 
ATOM   2667 C CD1 . PHE B 2 56  ? 17.968 -1.334  -17.752 1.00 24.46  ? 56   PHE B CD1 1 
ATOM   2668 C CD2 . PHE B 2 56  ? 16.388 -2.311  -19.258 1.00 15.05  ? 56   PHE B CD2 1 
ATOM   2669 C CE1 . PHE B 2 56  ? 17.012 -1.334  -16.742 1.00 27.28  ? 56   PHE B CE1 1 
ATOM   2670 C CE2 . PHE B 2 56  ? 15.426 -2.316  -18.257 1.00 22.50  ? 56   PHE B CE2 1 
ATOM   2671 C CZ  . PHE B 2 56  ? 15.738 -1.824  -16.996 1.00 28.97  ? 56   PHE B CZ  1 
ATOM   2672 N N   . SER B 2 57  ? 21.620 -2.287  -19.288 1.00 22.94  ? 57   SER B N   1 
ATOM   2673 C CA  . SER B 2 57  ? 22.743 -2.209  -18.364 1.00 14.85  ? 57   SER B CA  1 
ATOM   2674 C C   . SER B 2 57  ? 22.573 -1.079  -17.357 1.00 20.96  ? 57   SER B C   1 
ATOM   2675 O O   . SER B 2 57  ? 21.560 -0.377  -17.358 1.00 26.16  ? 57   SER B O   1 
ATOM   2676 C CB  . SER B 2 57  ? 24.045 -2.032  -19.141 1.00 12.80  ? 57   SER B CB  1 
ATOM   2677 O OG  . SER B 2 57  ? 24.308 -3.179  -19.929 1.00 21.93  ? 57   SER B OG  1 
ATOM   2678 N N   . LYS B 2 58  ? 23.576 -0.903  -16.505 1.00 24.15  ? 58   LYS B N   1 
ATOM   2679 C CA  . LYS B 2 58  ? 23.507 0.093   -15.440 1.00 32.95  ? 58   LYS B CA  1 
ATOM   2680 C C   . LYS B 2 58  ? 23.325 1.510   -15.977 1.00 31.48  ? 58   LYS B C   1 
ATOM   2681 O O   . LYS B 2 58  ? 22.836 2.385   -15.260 1.00 29.69  ? 58   LYS B O   1 
ATOM   2682 C CB  . LYS B 2 58  ? 24.747 0.019   -14.539 1.00 32.65  ? 58   LYS B CB  1 
ATOM   2683 N N   . ASP B 2 59  ? 23.717 1.734   -17.230 1.00 30.81  ? 59   ASP B N   1 
ATOM   2684 C CA  . ASP B 2 59  ? 23.594 3.056   -17.844 1.00 30.15  ? 59   ASP B CA  1 
ATOM   2685 C C   . ASP B 2 59  ? 22.301 3.200   -18.642 1.00 30.62  ? 59   ASP B C   1 
ATOM   2686 O O   . ASP B 2 59  ? 22.099 4.204   -19.332 1.00 27.16  ? 59   ASP B O   1 
ATOM   2687 C CB  . ASP B 2 59  ? 24.799 3.369   -18.736 1.00 34.02  ? 59   ASP B CB  1 
ATOM   2688 C CG  . ASP B 2 59  ? 24.939 2.400   -19.899 1.00 41.16  ? 59   ASP B CG  1 
ATOM   2689 O OD1 . ASP B 2 59  ? 24.025 1.574   -20.107 1.00 37.08  ? 59   ASP B OD1 1 
ATOM   2690 O OD2 . ASP B 2 59  ? 25.966 2.471   -20.612 1.00 45.18  ? 59   ASP B OD2 1 
ATOM   2691 N N   . TRP B 2 60  ? 21.445 2.182   -18.549 1.00 23.95  ? 60   TRP B N   1 
ATOM   2692 C CA  . TRP B 2 60  ? 20.131 2.176   -19.195 1.00 24.22  ? 60   TRP B CA  1 
ATOM   2693 C C   . TRP B 2 60  ? 20.148 1.797   -20.677 1.00 28.67  ? 60   TRP B C   1 
ATOM   2694 O O   . TRP B 2 60  ? 19.094 1.706   -21.304 1.00 37.24  ? 60   TRP B O   1 
ATOM   2695 C CB  . TRP B 2 60  ? 19.428 3.523   -19.031 1.00 22.13  ? 60   TRP B CB  1 
ATOM   2696 C CG  . TRP B 2 60  ? 19.335 4.006   -17.628 1.00 25.63  ? 60   TRP B CG  1 
ATOM   2697 C CD1 . TRP B 2 60  ? 19.964 5.091   -17.094 1.00 27.67  ? 60   TRP B CD1 1 
ATOM   2698 C CD2 . TRP B 2 60  ? 18.557 3.429   -16.569 1.00 26.37  ? 60   TRP B CD2 1 
ATOM   2699 N NE1 . TRP B 2 60  ? 19.627 5.228   -15.769 1.00 37.05  ? 60   TRP B NE1 1 
ATOM   2700 C CE2 . TRP B 2 60  ? 18.764 4.221   -15.422 1.00 32.47  ? 60   TRP B CE2 1 
ATOM   2701 C CE3 . TRP B 2 60  ? 17.706 2.322   -16.481 1.00 19.67  ? 60   TRP B CE3 1 
ATOM   2702 C CZ2 . TRP B 2 60  ? 18.150 3.941   -14.199 1.00 28.41  ? 60   TRP B CZ2 1 
ATOM   2703 C CZ3 . TRP B 2 60  ? 17.098 2.045   -15.261 1.00 15.98  ? 60   TRP B CZ3 1 
ATOM   2704 C CH2 . TRP B 2 60  ? 17.321 2.853   -14.141 1.00 18.18  ? 60   TRP B CH2 1 
ATOM   2705 N N   . SER B 2 61  ? 21.331 1.587   -21.243 1.00 23.11  ? 61   SER B N   1 
ATOM   2706 C CA  . SER B 2 61  ? 21.414 1.199   -22.644 1.00 22.50  ? 61   SER B CA  1 
ATOM   2707 C C   . SER B 2 61  ? 20.984 -0.258  -22.793 1.00 23.61  ? 61   SER B C   1 
ATOM   2708 O O   . SER B 2 61  ? 21.137 -1.055  -21.867 1.00 18.16  ? 61   SER B O   1 
ATOM   2709 C CB  . SER B 2 61  ? 22.827 1.409   -23.192 1.00 16.39  ? 61   SER B CB  1 
ATOM   2710 O OG  . SER B 2 61  ? 23.730 0.480   -22.623 1.00 19.72  ? 61   SER B OG  1 
ATOM   2711 N N   . PHE B 2 62  ? 20.440 -0.600  -23.957 1.00 25.12  ? 62   PHE B N   1 
ATOM   2712 C CA  . PHE B 2 62  ? 19.868 -1.925  -24.164 1.00 21.63  ? 62   PHE B CA  1 
ATOM   2713 C C   . PHE B 2 62  ? 20.848 -2.930  -24.761 1.00 24.85  ? 62   PHE B C   1 
ATOM   2714 O O   . PHE B 2 62  ? 21.896 -2.562  -25.305 1.00 25.71  ? 62   PHE B O   1 
ATOM   2715 C CB  . PHE B 2 62  ? 18.618 -1.839  -25.042 1.00 15.36  ? 62   PHE B CB  1 
ATOM   2716 C CG  . PHE B 2 62  ? 17.504 -1.048  -24.427 1.00 20.34  ? 62   PHE B CG  1 
ATOM   2717 C CD1 . PHE B 2 62  ? 16.755 -1.575  -23.385 1.00 21.05  ? 62   PHE B CD1 1 
ATOM   2718 C CD2 . PHE B 2 62  ? 17.198 0.221   -24.891 1.00 22.48  ? 62   PHE B CD2 1 
ATOM   2719 C CE1 . PHE B 2 62  ? 15.723 -0.849  -22.811 1.00 14.72  ? 62   PHE B CE1 1 
ATOM   2720 C CE2 . PHE B 2 62  ? 16.164 0.953   -24.320 1.00 22.85  ? 62   PHE B CE2 1 
ATOM   2721 C CZ  . PHE B 2 62  ? 15.428 0.414   -23.279 1.00 16.59  ? 62   PHE B CZ  1 
ATOM   2722 N N   . TYR B 2 63  ? 20.499 -4.207  -24.642 1.00 15.14  ? 63   TYR B N   1 
ATOM   2723 C CA  . TYR B 2 63  ? 21.231 -5.257  -25.334 1.00 24.12  ? 63   TYR B CA  1 
ATOM   2724 C C   . TYR B 2 63  ? 20.305 -6.382  -25.796 1.00 30.42  ? 63   TYR B C   1 
ATOM   2725 O O   . TYR B 2 63  ? 19.307 -6.699  -25.136 1.00 24.53  ? 63   TYR B O   1 
ATOM   2726 C CB  . TYR B 2 63  ? 22.385 -5.798  -24.480 1.00 18.87  ? 63   TYR B CB  1 
ATOM   2727 C CG  . TYR B 2 63  ? 21.976 -6.414  -23.162 1.00 17.93  ? 63   TYR B CG  1 
ATOM   2728 C CD1 . TYR B 2 63  ? 21.579 -7.739  -23.089 1.00 16.98  ? 63   TYR B CD1 1 
ATOM   2729 C CD2 . TYR B 2 63  ? 22.016 -5.678  -21.986 1.00 22.46  ? 63   TYR B CD2 1 
ATOM   2730 C CE1 . TYR B 2 63  ? 21.218 -8.311  -21.886 1.00 21.44  ? 63   TYR B CE1 1 
ATOM   2731 C CE2 . TYR B 2 63  ? 21.654 -6.241  -20.779 1.00 26.85  ? 63   TYR B CE2 1 
ATOM   2732 C CZ  . TYR B 2 63  ? 21.255 -7.560  -20.734 1.00 27.42  ? 63   TYR B CZ  1 
ATOM   2733 O OH  . TYR B 2 63  ? 20.895 -8.132  -19.533 1.00 33.22  ? 63   TYR B OH  1 
ATOM   2734 N N   . LEU B 2 64  ? 20.641 -6.965  -26.945 1.00 22.97  ? 64   LEU B N   1 
ATOM   2735 C CA  . LEU B 2 64  ? 19.874 -8.061  -27.517 1.00 20.34  ? 64   LEU B CA  1 
ATOM   2736 C C   . LEU B 2 64  ? 20.784 -9.082  -28.183 1.00 23.11  ? 64   LEU B C   1 
ATOM   2737 O O   . LEU B 2 64  ? 21.820 -8.736  -28.749 1.00 20.56  ? 64   LEU B O   1 
ATOM   2738 C CB  . LEU B 2 64  ? 18.867 -7.538  -28.544 1.00 22.80  ? 64   LEU B CB  1 
ATOM   2739 C CG  . LEU B 2 64  ? 17.581 -6.906  -28.010 1.00 31.86  ? 64   LEU B CG  1 
ATOM   2740 C CD1 . LEU B 2 64  ? 16.805 -6.229  -29.136 1.00 30.53  ? 64   LEU B CD1 1 
ATOM   2741 C CD2 . LEU B 2 64  ? 16.724 -7.953  -27.311 1.00 25.77  ? 64   LEU B CD2 1 
ATOM   2742 N N   . LEU B 2 65  ? 20.386 -10.345 -28.120 1.00 21.18  ? 65   LEU B N   1 
ATOM   2743 C CA  . LEU B 2 65  ? 21.069 -11.383 -28.866 1.00 18.00  ? 65   LEU B CA  1 
ATOM   2744 C C   . LEU B 2 65  ? 20.174 -11.946 -29.967 1.00 19.40  ? 65   LEU B C   1 
ATOM   2745 O O   . LEU B 2 65  ? 19.132 -12.534 -29.684 1.00 24.47  ? 65   LEU B O   1 
ATOM   2746 C CB  . LEU B 2 65  ? 21.494 -12.513 -27.935 1.00 16.51  ? 65   LEU B CB  1 
ATOM   2747 C CG  . LEU B 2 65  ? 22.065 -13.722 -28.677 1.00 24.19  ? 65   LEU B CG  1 
ATOM   2748 C CD1 . LEU B 2 65  ? 23.412 -13.369 -29.294 1.00 17.85  ? 65   LEU B CD1 1 
ATOM   2749 C CD2 . LEU B 2 65  ? 22.179 -14.920 -27.747 1.00 25.92  ? 65   LEU B CD2 1 
ATOM   2750 N N   . TYR B 2 66  ? 20.576 -11.761 -31.219 1.00 14.34  ? 66   TYR B N   1 
ATOM   2751 C CA  . TYR B 2 66  ? 19.924 -12.450 -32.330 1.00 16.92  ? 66   TYR B CA  1 
ATOM   2752 C C   . TYR B 2 66  ? 20.757 -13.660 -32.725 1.00 23.80  ? 66   TYR B C   1 
ATOM   2753 O O   . TYR B 2 66  ? 21.977 -13.570 -32.842 1.00 27.67  ? 66   TYR B O   1 
ATOM   2754 C CB  . TYR B 2 66  ? 19.737 -11.518 -33.526 1.00 18.71  ? 66   TYR B CB  1 
ATOM   2755 C CG  . TYR B 2 66  ? 18.678 -10.456 -33.320 1.00 22.78  ? 66   TYR B CG  1 
ATOM   2756 C CD1 . TYR B 2 66  ? 18.933 -9.337  -32.540 1.00 25.99  ? 66   TYR B CD1 1 
ATOM   2757 C CD2 . TYR B 2 66  ? 17.423 -10.571 -33.911 1.00 22.13  ? 66   TYR B CD2 1 
ATOM   2758 C CE1 . TYR B 2 66  ? 17.967 -8.362  -32.350 1.00 31.51  ? 66   TYR B CE1 1 
ATOM   2759 C CE2 . TYR B 2 66  ? 16.451 -9.600  -33.724 1.00 22.12  ? 66   TYR B CE2 1 
ATOM   2760 C CZ  . TYR B 2 66  ? 16.731 -8.499  -32.942 1.00 27.62  ? 66   TYR B CZ  1 
ATOM   2761 O OH  . TYR B 2 66  ? 15.778 -7.526  -32.748 1.00 30.95  ? 66   TYR B OH  1 
ATOM   2762 N N   . TYR B 2 67  ? 20.099 -14.795 -32.928 1.00 25.46  ? 67   TYR B N   1 
ATOM   2763 C CA  . TYR B 2 67  ? 20.808 -16.034 -33.209 1.00 23.89  ? 67   TYR B CA  1 
ATOM   2764 C C   . TYR B 2 67  ? 20.005 -16.990 -34.088 1.00 28.08  ? 67   TYR B C   1 
ATOM   2765 O O   . TYR B 2 67  ? 18.775 -16.921 -34.156 1.00 26.65  ? 67   TYR B O   1 
ATOM   2766 C CB  . TYR B 2 67  ? 21.208 -16.728 -31.901 1.00 21.99  ? 67   TYR B CB  1 
ATOM   2767 C CG  . TYR B 2 67  ? 20.041 -17.054 -30.992 1.00 24.76  ? 67   TYR B CG  1 
ATOM   2768 C CD1 . TYR B 2 67  ? 19.423 -16.061 -30.243 1.00 30.09  ? 67   TYR B CD1 1 
ATOM   2769 C CD2 . TYR B 2 67  ? 19.563 -18.354 -30.877 1.00 23.86  ? 67   TYR B CD2 1 
ATOM   2770 C CE1 . TYR B 2 67  ? 18.358 -16.348 -29.410 1.00 32.43  ? 67   TYR B CE1 1 
ATOM   2771 C CE2 . TYR B 2 67  ? 18.494 -18.654 -30.045 1.00 26.27  ? 67   TYR B CE2 1 
ATOM   2772 C CZ  . TYR B 2 67  ? 17.898 -17.645 -29.313 1.00 34.32  ? 67   TYR B CZ  1 
ATOM   2773 O OH  . TYR B 2 67  ? 16.837 -17.927 -28.484 1.00 35.51  ? 67   TYR B OH  1 
ATOM   2774 N N   . THR B 2 68  ? 20.720 -17.888 -34.757 1.00 21.80  ? 68   THR B N   1 
ATOM   2775 C CA  . THR B 2 68  ? 20.096 -18.901 -35.592 1.00 26.46  ? 68   THR B CA  1 
ATOM   2776 C C   . THR B 2 68  ? 21.030 -20.094 -35.751 1.00 32.43  ? 68   THR B C   1 
ATOM   2777 O O   . THR B 2 68  ? 22.244 -19.930 -35.879 1.00 35.09  ? 68   THR B O   1 
ATOM   2778 C CB  . THR B 2 68  ? 19.745 -18.347 -36.985 1.00 24.43  ? 68   THR B CB  1 
ATOM   2779 O OG1 . THR B 2 68  ? 19.049 -19.348 -37.736 1.00 33.28  ? 68   THR B OG1 1 
ATOM   2780 C CG2 . THR B 2 68  ? 21.006 -17.951 -37.733 1.00 18.81  ? 68   THR B CG2 1 
ATOM   2781 N N   . GLU B 2 69  ? 20.467 -21.296 -35.731 1.00 30.04  ? 69   GLU B N   1 
ATOM   2782 C CA  . GLU B 2 69  ? 21.260 -22.487 -35.986 1.00 36.59  ? 69   GLU B CA  1 
ATOM   2783 C C   . GLU B 2 69  ? 21.722 -22.466 -37.437 1.00 33.07  ? 69   GLU B C   1 
ATOM   2784 O O   . GLU B 2 69  ? 20.982 -22.054 -38.329 1.00 34.39  ? 69   GLU B O   1 
ATOM   2785 C CB  . GLU B 2 69  ? 20.456 -23.757 -35.695 1.00 39.46  ? 69   GLU B CB  1 
ATOM   2786 N N   . PHE B 2 70  ? 22.958 -22.886 -37.669 1.00 29.78  ? 70   PHE B N   1 
ATOM   2787 C CA  . PHE B 2 70  ? 23.477 -22.967 -39.026 1.00 29.22  ? 70   PHE B CA  1 
ATOM   2788 C C   . PHE B 2 70  ? 24.588 -24.000 -39.115 1.00 34.65  ? 70   PHE B C   1 
ATOM   2789 O O   . PHE B 2 70  ? 25.091 -24.471 -38.097 1.00 33.98  ? 70   PHE B O   1 
ATOM   2790 C CB  . PHE B 2 70  ? 23.973 -21.599 -39.512 1.00 26.06  ? 70   PHE B CB  1 
ATOM   2791 C CG  . PHE B 2 70  ? 25.291 -21.178 -38.921 1.00 25.63  ? 70   PHE B CG  1 
ATOM   2792 C CD1 . PHE B 2 70  ? 26.289 -20.658 -39.730 1.00 26.12  ? 70   PHE B CD1 1 
ATOM   2793 C CD2 . PHE B 2 70  ? 25.529 -21.284 -37.560 1.00 30.28  ? 70   PHE B CD2 1 
ATOM   2794 C CE1 . PHE B 2 70  ? 27.501 -20.262 -39.195 1.00 34.44  ? 70   PHE B CE1 1 
ATOM   2795 C CE2 . PHE B 2 70  ? 26.742 -20.892 -37.017 1.00 34.01  ? 70   PHE B CE2 1 
ATOM   2796 C CZ  . PHE B 2 70  ? 27.729 -20.378 -37.835 1.00 35.36  ? 70   PHE B CZ  1 
ATOM   2797 N N   . THR B 2 71  ? 24.953 -24.362 -40.338 1.00 39.75  ? 71   THR B N   1 
ATOM   2798 C CA  . THR B 2 71  ? 26.071 -25.262 -40.565 1.00 35.06  ? 71   THR B CA  1 
ATOM   2799 C C   . THR B 2 71  ? 27.067 -24.587 -41.493 1.00 37.39  ? 71   THR B C   1 
ATOM   2800 O O   . THR B 2 71  ? 26.862 -24.538 -42.708 1.00 40.37  ? 71   THR B O   1 
ATOM   2801 C CB  . THR B 2 71  ? 25.617 -26.601 -41.165 1.00 38.95  ? 71   THR B CB  1 
ATOM   2802 O OG1 . THR B 2 71  ? 24.816 -27.304 -40.209 1.00 36.99  ? 71   THR B OG1 1 
ATOM   2803 C CG2 . THR B 2 71  ? 26.821 -27.457 -41.530 1.00 45.80  ? 71   THR B CG2 1 
ATOM   2804 N N   . PRO B 2 72  ? 28.151 -24.055 -40.916 1.00 35.77  ? 72   PRO B N   1 
ATOM   2805 C CA  . PRO B 2 72  ? 29.149 -23.314 -41.691 1.00 32.43  ? 72   PRO B CA  1 
ATOM   2806 C C   . PRO B 2 72  ? 29.775 -24.179 -42.778 1.00 41.46  ? 72   PRO B C   1 
ATOM   2807 O O   . PRO B 2 72  ? 30.041 -25.360 -42.562 1.00 46.53  ? 72   PRO B O   1 
ATOM   2808 C CB  . PRO B 2 72  ? 30.199 -22.937 -40.638 1.00 26.37  ? 72   PRO B CB  1 
ATOM   2809 C CG  . PRO B 2 72  ? 30.016 -23.939 -39.539 1.00 25.27  ? 72   PRO B CG  1 
ATOM   2810 C CD  . PRO B 2 72  ? 28.547 -24.214 -39.506 1.00 25.14  ? 72   PRO B CD  1 
ATOM   2811 N N   . THR B 2 73  ? 29.986 -23.591 -43.948 1.00 44.59  ? 73   THR B N   1 
ATOM   2812 C CA  . THR B 2 73  ? 30.745 -24.244 -45.001 1.00 45.83  ? 73   THR B CA  1 
ATOM   2813 C C   . THR B 2 73  ? 31.876 -23.315 -45.412 1.00 53.79  ? 73   THR B C   1 
ATOM   2814 O O   . THR B 2 73  ? 31.818 -22.112 -45.160 1.00 58.43  ? 73   THR B O   1 
ATOM   2815 C CB  . THR B 2 73  ? 29.871 -24.581 -46.217 1.00 44.17  ? 73   THR B CB  1 
ATOM   2816 O OG1 . THR B 2 73  ? 29.319 -23.375 -46.760 1.00 54.25  ? 73   THR B OG1 1 
ATOM   2817 C CG2 . THR B 2 73  ? 28.741 -25.522 -45.818 1.00 30.17  ? 73   THR B CG2 1 
ATOM   2818 N N   . GLU B 2 74  ? 32.907 -23.869 -46.037 1.00 57.58  ? 74   GLU B N   1 
ATOM   2819 C CA  . GLU B 2 74  ? 34.079 -23.081 -46.389 1.00 58.69  ? 74   GLU B CA  1 
ATOM   2820 C C   . GLU B 2 74  ? 33.731 -21.884 -47.273 1.00 53.88  ? 74   GLU B C   1 
ATOM   2821 O O   . GLU B 2 74  ? 34.263 -20.790 -47.084 1.00 50.68  ? 74   GLU B O   1 
ATOM   2822 C CB  . GLU B 2 74  ? 35.135 -23.957 -47.068 1.00 62.23  ? 74   GLU B CB  1 
ATOM   2823 C CG  . GLU B 2 74  ? 36.468 -23.257 -47.283 1.00 70.68  ? 74   GLU B CG  1 
ATOM   2824 C CD  . GLU B 2 74  ? 37.087 -22.757 -45.986 1.00 84.62  ? 74   GLU B CD  1 
ATOM   2825 O OE1 . GLU B 2 74  ? 36.536 -23.047 -44.901 1.00 85.87  ? 74   GLU B OE1 1 
ATOM   2826 O OE2 . GLU B 2 74  ? 38.130 -22.070 -46.054 1.00 90.94  ? 74   GLU B OE2 1 
ATOM   2827 N N   . LYS B 2 75  ? 32.825 -22.092 -48.223 1.00 53.83  ? 75   LYS B N   1 
ATOM   2828 C CA  . LYS B 2 75  ? 32.508 -21.067 -49.216 1.00 59.73  ? 75   LYS B CA  1 
ATOM   2829 C C   . LYS B 2 75  ? 31.489 -20.016 -48.748 1.00 56.96  ? 75   LYS B C   1 
ATOM   2830 O O   . LYS B 2 75  ? 31.595 -18.843 -49.108 1.00 52.28  ? 75   LYS B O   1 
ATOM   2831 C CB  . LYS B 2 75  ? 32.041 -21.719 -50.521 1.00 67.70  ? 75   LYS B CB  1 
ATOM   2832 C CG  . LYS B 2 75  ? 30.738 -22.498 -50.406 1.00 76.50  ? 75   LYS B CG  1 
ATOM   2833 C CD  . LYS B 2 75  ? 30.397 -23.197 -51.716 1.00 83.18  ? 75   LYS B CD  1 
ATOM   2834 C CE  . LYS B 2 75  ? 28.938 -23.628 -51.757 1.00 86.70  ? 75   LYS B CE  1 
ATOM   2835 N NZ  . LYS B 2 75  ? 28.574 -24.492 -50.601 1.00 89.97  ? 75   LYS B NZ  1 
ATOM   2836 N N   . ASP B 2 76  ? 30.513 -20.435 -47.946 1.00 54.97  ? 76   ASP B N   1 
ATOM   2837 C CA  . ASP B 2 76  ? 29.425 -19.550 -47.521 1.00 48.06  ? 76   ASP B CA  1 
ATOM   2838 C C   . ASP B 2 76  ? 29.871 -18.418 -46.595 1.00 40.07  ? 76   ASP B C   1 
ATOM   2839 O O   . ASP B 2 76  ? 30.684 -18.622 -45.693 1.00 48.03  ? 76   ASP B O   1 
ATOM   2840 C CB  . ASP B 2 76  ? 28.306 -20.353 -46.852 1.00 52.42  ? 76   ASP B CB  1 
ATOM   2841 C CG  . ASP B 2 76  ? 27.444 -21.099 -47.852 1.00 60.01  ? 76   ASP B CG  1 
ATOM   2842 O OD1 . ASP B 2 76  ? 27.348 -20.644 -49.011 1.00 61.87  ? 76   ASP B OD1 1 
ATOM   2843 O OD2 . ASP B 2 76  ? 26.856 -22.137 -47.478 1.00 64.50  ? 76   ASP B OD2 1 
ATOM   2844 N N   . GLU B 2 77  ? 29.319 -17.228 -46.821 1.00 29.17  ? 77   GLU B N   1 
ATOM   2845 C CA  . GLU B 2 77  ? 29.610 -16.064 -45.990 1.00 34.59  ? 77   GLU B CA  1 
ATOM   2846 C C   . GLU B 2 77  ? 28.387 -15.644 -45.175 1.00 33.34  ? 77   GLU B C   1 
ATOM   2847 O O   . GLU B 2 77  ? 27.258 -15.694 -45.662 1.00 28.99  ? 77   GLU B O   1 
ATOM   2848 C CB  . GLU B 2 77  ? 30.071 -14.891 -46.854 1.00 39.91  ? 77   GLU B CB  1 
ATOM   2849 C CG  . GLU B 2 77  ? 31.258 -15.198 -47.746 1.00 51.55  ? 77   GLU B CG  1 
ATOM   2850 C CD  . GLU B 2 77  ? 31.578 -14.057 -48.695 1.00 64.87  ? 77   GLU B CD  1 
ATOM   2851 O OE1 . GLU B 2 77  ? 31.339 -14.212 -49.914 1.00 69.51  ? 77   GLU B OE1 1 
ATOM   2852 O OE2 . GLU B 2 77  ? 32.067 -13.008 -48.221 1.00 65.77  ? 77   GLU B OE2 1 
ATOM   2853 N N   . TYR B 2 78  ? 28.617 -15.230 -43.933 1.00 29.22  ? 78   TYR B N   1 
ATOM   2854 C CA  . TYR B 2 78  ? 27.534 -14.764 -43.075 1.00 24.67  ? 78   TYR B CA  1 
ATOM   2855 C C   . TYR B 2 78  ? 27.817 -13.362 -42.548 1.00 24.15  ? 78   TYR B C   1 
ATOM   2856 O O   . TYR B 2 78  ? 28.969 -12.974 -42.365 1.00 34.08  ? 78   TYR B O   1 
ATOM   2857 C CB  . TYR B 2 78  ? 27.298 -15.733 -41.912 1.00 25.40  ? 78   TYR B CB  1 
ATOM   2858 C CG  . TYR B 2 78  ? 26.784 -17.090 -42.341 1.00 28.27  ? 78   TYR B CG  1 
ATOM   2859 C CD1 . TYR B 2 78  ? 27.663 -18.124 -42.640 1.00 25.93  ? 78   TYR B CD1 1 
ATOM   2860 C CD2 . TYR B 2 78  ? 25.421 -17.337 -42.449 1.00 24.74  ? 78   TYR B CD2 1 
ATOM   2861 C CE1 . TYR B 2 78  ? 27.200 -19.365 -43.033 1.00 25.94  ? 78   TYR B CE1 1 
ATOM   2862 C CE2 . TYR B 2 78  ? 24.948 -18.577 -42.843 1.00 22.78  ? 78   TYR B CE2 1 
ATOM   2863 C CZ  . TYR B 2 78  ? 25.843 -19.588 -43.133 1.00 30.40  ? 78   TYR B CZ  1 
ATOM   2864 O OH  . TYR B 2 78  ? 25.380 -20.825 -43.526 1.00 35.36  ? 78   TYR B OH  1 
ATOM   2865 N N   . ALA B 2 79  ? 26.757 -12.601 -42.310 1.00 20.15  ? 79   ALA B N   1 
ATOM   2866 C CA  . ALA B 2 79  ? 26.895 -11.244 -41.808 1.00 21.89  ? 79   ALA B CA  1 
ATOM   2867 C C   . ALA B 2 79  ? 25.668 -10.844 -40.997 1.00 25.23  ? 79   ALA B C   1 
ATOM   2868 O O   . ALA B 2 79  ? 24.726 -11.621 -40.848 1.00 28.00  ? 79   ALA B O   1 
ATOM   2869 C CB  . ALA B 2 79  ? 27.124 -10.268 -42.959 1.00 11.31  ? 79   ALA B CB  1 
ATOM   2870 N N   . CYS B 2 80  ? 25.690 -9.628  -40.470 1.00 26.05  ? 80   CYS B N   1 
ATOM   2871 C CA  . CYS B 2 80  ? 24.588 -9.123  -39.666 1.00 30.11  ? 80   CYS B CA  1 
ATOM   2872 C C   . CYS B 2 80  ? 24.226 -7.701  -40.087 1.00 27.44  ? 80   CYS B C   1 
ATOM   2873 O O   . CYS B 2 80  ? 25.069 -6.806  -40.061 1.00 39.01  ? 80   CYS B O   1 
ATOM   2874 C CB  . CYS B 2 80  ? 24.970 -9.155  -38.186 1.00 29.77  ? 80   CYS B CB  1 
ATOM   2875 S SG  . CYS B 2 80  ? 23.744 -8.453  -37.072 1.00 59.58  ? 80   CYS B SG  1 
ATOM   2876 N N   . ARG B 2 81  ? 22.975 -7.498  -40.486 1.00 16.02  ? 81   ARG B N   1 
ATOM   2877 C CA  . ARG B 2 81  ? 22.506 -6.165  -40.847 1.00 23.04  ? 81   ARG B CA  1 
ATOM   2878 C C   . ARG B 2 81  ? 21.775 -5.533  -39.671 1.00 27.58  ? 81   ARG B C   1 
ATOM   2879 O O   . ARG B 2 81  ? 20.732 -6.030  -39.240 1.00 26.61  ? 81   ARG B O   1 
ATOM   2880 C CB  . ARG B 2 81  ? 21.578 -6.216  -42.063 1.00 19.39  ? 81   ARG B CB  1 
ATOM   2881 C CG  . ARG B 2 81  ? 21.548 -4.929  -42.870 1.00 17.17  ? 81   ARG B CG  1 
ATOM   2882 C CD  . ARG B 2 81  ? 20.363 -4.885  -43.824 1.00 20.91  ? 81   ARG B CD  1 
ATOM   2883 N NE  . ARG B 2 81  ? 19.211 -4.224  -43.216 1.00 37.38  ? 81   ARG B NE  1 
ATOM   2884 C CZ  . ARG B 2 81  ? 18.654 -3.109  -43.678 1.00 37.11  ? 81   ARG B CZ  1 
ATOM   2885 N NH1 . ARG B 2 81  ? 19.129 -2.527  -44.770 1.00 35.39  ? 81   ARG B NH1 1 
ATOM   2886 N NH2 . ARG B 2 81  ? 17.611 -2.581  -43.052 1.00 41.99  ? 81   ARG B NH2 1 
ATOM   2887 N N   . VAL B 2 82  ? 22.328 -4.442  -39.150 1.00 22.19  ? 82   VAL B N   1 
ATOM   2888 C CA  . VAL B 2 82  ? 21.681 -3.706  -38.073 1.00 22.49  ? 82   VAL B CA  1 
ATOM   2889 C C   . VAL B 2 82  ? 21.236 -2.321  -38.536 1.00 25.07  ? 82   VAL B C   1 
ATOM   2890 O O   . VAL B 2 82  ? 21.995 -1.588  -39.170 1.00 26.67  ? 82   VAL B O   1 
ATOM   2891 C CB  . VAL B 2 82  ? 22.591 -3.563  -36.835 1.00 19.04  ? 82   VAL B CB  1 
ATOM   2892 C CG1 . VAL B 2 82  ? 21.880 -2.768  -35.749 1.00 15.61  ? 82   VAL B CG1 1 
ATOM   2893 C CG2 . VAL B 2 82  ? 22.999 -4.929  -36.309 1.00 10.80  ? 82   VAL B CG2 1 
ATOM   2894 N N   . ASN B 2 83  ? 19.994 -1.976  -38.218 1.00 25.68  ? 83   ASN B N   1 
ATOM   2895 C CA  . ASN B 2 83  ? 19.466 -0.654  -38.515 1.00 31.01  ? 83   ASN B CA  1 
ATOM   2896 C C   . ASN B 2 83  ? 18.926 -0.017  -37.240 1.00 30.97  ? 83   ASN B C   1 
ATOM   2897 O O   . ASN B 2 83  ? 18.184 -0.646  -36.483 1.00 26.21  ? 83   ASN B O   1 
ATOM   2898 C CB  . ASN B 2 83  ? 18.373 -0.733  -39.580 1.00 34.56  ? 83   ASN B CB  1 
ATOM   2899 C CG  . ASN B 2 83  ? 18.020 0.624   -40.155 1.00 42.91  ? 83   ASN B CG  1 
ATOM   2900 O OD1 . ASN B 2 83  ? 18.790 1.581   -40.046 1.00 41.91  ? 83   ASN B OD1 1 
ATOM   2901 N ND2 . ASN B 2 83  ? 16.852 0.712   -40.779 1.00 50.33  ? 83   ASN B ND2 1 
ATOM   2902 N N   . HIS B 2 84  ? 19.316 1.229   -37.002 1.00 27.12  ? 84   HIS B N   1 
ATOM   2903 C CA  . HIS B 2 84  ? 18.960 1.917   -35.774 1.00 23.41  ? 84   HIS B CA  1 
ATOM   2904 C C   . HIS B 2 84  ? 18.911 3.416   -36.028 1.00 28.92  ? 84   HIS B C   1 
ATOM   2905 O O   . HIS B 2 84  ? 19.593 3.924   -36.919 1.00 34.53  ? 84   HIS B O   1 
ATOM   2906 C CB  . HIS B 2 84  ? 19.982 1.598   -34.682 1.00 28.64  ? 84   HIS B CB  1 
ATOM   2907 C CG  . HIS B 2 84  ? 19.624 2.147   -33.337 1.00 25.21  ? 84   HIS B CG  1 
ATOM   2908 N ND1 . HIS B 2 84  ? 20.086 3.364   -32.882 1.00 23.29  ? 84   HIS B ND1 1 
ATOM   2909 C CD2 . HIS B 2 84  ? 18.851 1.644   -32.346 1.00 17.64  ? 84   HIS B CD2 1 
ATOM   2910 C CE1 . HIS B 2 84  ? 19.615 3.585   -31.669 1.00 23.02  ? 84   HIS B CE1 1 
ATOM   2911 N NE2 . HIS B 2 84  ? 18.862 2.557   -31.320 1.00 16.47  ? 84   HIS B NE2 1 
ATOM   2912 N N   . VAL B 2 85  ? 18.111 4.121   -35.237 1.00 27.14  ? 85   VAL B N   1 
ATOM   2913 C CA  . VAL B 2 85  ? 17.913 5.554   -35.432 1.00 28.46  ? 85   VAL B CA  1 
ATOM   2914 C C   . VAL B 2 85  ? 19.213 6.371   -35.363 1.00 27.17  ? 85   VAL B C   1 
ATOM   2915 O O   . VAL B 2 85  ? 19.270 7.488   -35.871 1.00 29.02  ? 85   VAL B O   1 
ATOM   2916 C CB  . VAL B 2 85  ? 16.900 6.122   -34.416 1.00 28.64  ? 85   VAL B CB  1 
ATOM   2917 C CG1 . VAL B 2 85  ? 17.568 6.352   -33.067 1.00 27.59  ? 85   VAL B CG1 1 
ATOM   2918 C CG2 . VAL B 2 85  ? 16.289 7.404   -34.944 1.00 31.79  ? 85   VAL B CG2 1 
ATOM   2919 N N   . THR B 2 86  ? 20.253 5.820   -34.742 1.00 22.10  ? 86   THR B N   1 
ATOM   2920 C CA  . THR B 2 86  ? 21.519 6.540   -34.611 1.00 26.78  ? 86   THR B CA  1 
ATOM   2921 C C   . THR B 2 86  ? 22.448 6.343   -35.820 1.00 32.09  ? 86   THR B C   1 
ATOM   2922 O O   . THR B 2 86  ? 23.398 7.104   -36.016 1.00 27.12  ? 86   THR B O   1 
ATOM   2923 C CB  . THR B 2 86  ? 22.260 6.186   -33.294 1.00 25.01  ? 86   THR B CB  1 
ATOM   2924 O OG1 . THR B 2 86  ? 22.524 4.777   -33.240 1.00 29.19  ? 86   THR B OG1 1 
ATOM   2925 C CG2 . THR B 2 86  ? 21.429 6.591   -32.084 1.00 16.56  ? 86   THR B CG2 1 
ATOM   2926 N N   . LEU B 2 87  ? 22.163 5.329   -36.631 1.00 32.58  ? 87   LEU B N   1 
ATOM   2927 C CA  . LEU B 2 87  ? 22.944 5.080   -37.840 1.00 30.35  ? 87   LEU B CA  1 
ATOM   2928 C C   . LEU B 2 87  ? 22.385 5.845   -39.033 1.00 39.47  ? 87   LEU B C   1 
ATOM   2929 O O   . LEU B 2 87  ? 21.190 5.767   -39.328 1.00 46.52  ? 87   LEU B O   1 
ATOM   2930 C CB  . LEU B 2 87  ? 22.980 3.587   -38.166 1.00 18.71  ? 87   LEU B CB  1 
ATOM   2931 C CG  . LEU B 2 87  ? 23.451 2.667   -37.043 1.00 24.34  ? 87   LEU B CG  1 
ATOM   2932 C CD1 . LEU B 2 87  ? 23.398 1.222   -37.497 1.00 22.68  ? 87   LEU B CD1 1 
ATOM   2933 C CD2 . LEU B 2 87  ? 24.854 3.050   -36.592 1.00 24.01  ? 87   LEU B CD2 1 
ATOM   2934 N N   . SER B 2 88  ? 23.254 6.577   -39.723 1.00 45.87  ? 88   SER B N   1 
ATOM   2935 C CA  . SER B 2 88  ? 22.861 7.286   -40.936 1.00 45.80  ? 88   SER B CA  1 
ATOM   2936 C C   . SER B 2 88  ? 22.600 6.310   -42.084 1.00 42.55  ? 88   SER B C   1 
ATOM   2937 O O   . SER B 2 88  ? 22.084 6.690   -43.133 1.00 48.62  ? 88   SER B O   1 
ATOM   2938 C CB  . SER B 2 88  ? 23.919 8.325   -41.327 1.00 44.65  ? 88   SER B CB  1 
ATOM   2939 O OG  . SER B 2 88  ? 25.230 7.786   -41.279 1.00 46.62  ? 88   SER B OG  1 
ATOM   2940 N N   . GLN B 2 89  ? 22.948 5.046   -41.867 1.00 37.65  ? 89   GLN B N   1 
ATOM   2941 C CA  . GLN B 2 89  ? 22.742 3.999   -42.858 1.00 38.30  ? 89   GLN B CA  1 
ATOM   2942 C C   . GLN B 2 89  ? 22.859 2.649   -42.165 1.00 36.47  ? 89   GLN B C   1 
ATOM   2943 O O   . GLN B 2 89  ? 23.652 2.496   -41.237 1.00 43.26  ? 89   GLN B O   1 
ATOM   2944 C CB  . GLN B 2 89  ? 23.792 4.103   -43.967 1.00 44.70  ? 89   GLN B CB  1 
ATOM   2945 C CG  . GLN B 2 89  ? 23.252 3.864   -45.367 1.00 56.66  ? 89   GLN B CG  1 
ATOM   2946 C CD  . GLN B 2 89  ? 22.418 5.027   -45.875 1.00 60.35  ? 89   GLN B CD  1 
ATOM   2947 O OE1 . GLN B 2 89  ? 21.232 4.874   -46.172 1.00 62.36  ? 89   GLN B OE1 1 
ATOM   2948 N NE2 . GLN B 2 89  ? 23.038 6.197   -45.982 1.00 57.31  ? 89   GLN B NE2 1 
ATOM   2949 N N   . PRO B 2 90  ? 22.068 1.662   -42.605 1.00 29.48  ? 90   PRO B N   1 
ATOM   2950 C CA  . PRO B 2 90  ? 22.148 0.330   -41.993 1.00 26.87  ? 90   PRO B CA  1 
ATOM   2951 C C   . PRO B 2 90  ? 23.570 -0.217  -42.051 1.00 30.27  ? 90   PRO B C   1 
ATOM   2952 O O   . PRO B 2 90  ? 24.235 -0.108  -43.081 1.00 34.23  ? 90   PRO B O   1 
ATOM   2953 C CB  . PRO B 2 90  ? 21.212 -0.513  -42.862 1.00 26.42  ? 90   PRO B CB  1 
ATOM   2954 C CG  . PRO B 2 90  ? 20.250 0.474   -43.446 1.00 30.89  ? 90   PRO B CG  1 
ATOM   2955 C CD  . PRO B 2 90  ? 21.044 1.733   -43.661 1.00 27.95  ? 90   PRO B CD  1 
ATOM   2956 N N   . LYS B 2 91  ? 24.029 -0.798  -40.948 1.00 29.68  ? 91   LYS B N   1 
ATOM   2957 C CA  . LYS B 2 91  ? 25.401 -1.277  -40.850 1.00 30.65  ? 91   LYS B CA  1 
ATOM   2958 C C   . LYS B 2 91  ? 25.456 -2.787  -41.035 1.00 32.59  ? 91   LYS B C   1 
ATOM   2959 O O   . LYS B 2 91  ? 24.680 -3.531  -40.435 1.00 37.25  ? 91   LYS B O   1 
ATOM   2960 C CB  . LYS B 2 91  ? 26.009 -0.879  -39.499 1.00 38.56  ? 91   LYS B CB  1 
ATOM   2961 C CG  . LYS B 2 91  ? 27.503 -1.146  -39.368 1.00 48.66  ? 91   LYS B CG  1 
ATOM   2962 C CD  . LYS B 2 91  ? 28.310 -0.261  -40.306 1.00 63.97  ? 91   LYS B CD  1 
ATOM   2963 C CE  . LYS B 2 91  ? 29.806 -0.529  -40.183 1.00 68.92  ? 91   LYS B CE  1 
ATOM   2964 N NZ  . LYS B 2 91  ? 30.594 0.270   -41.168 1.00 68.73  ? 91   LYS B NZ  1 
ATOM   2965 N N   . ILE B 2 92  ? 26.375 -3.236  -41.879 1.00 30.96  ? 92   ILE B N   1 
ATOM   2966 C CA  . ILE B 2 92  ? 26.540 -4.656  -42.138 1.00 24.40  ? 92   ILE B CA  1 
ATOM   2967 C C   . ILE B 2 92  ? 27.895 -5.145  -41.641 1.00 27.43  ? 92   ILE B C   1 
ATOM   2968 O O   . ILE B 2 92  ? 28.940 -4.765  -42.170 1.00 30.88  ? 92   ILE B O   1 
ATOM   2969 C CB  . ILE B 2 92  ? 26.371 -4.968  -43.632 1.00 24.80  ? 92   ILE B CB  1 
ATOM   2970 C CG1 . ILE B 2 92  ? 24.890 -4.863  -44.017 1.00 24.83  ? 92   ILE B CG1 1 
ATOM   2971 C CG2 . ILE B 2 92  ? 26.929 -6.350  -43.956 1.00 18.67  ? 92   ILE B CG2 1 
ATOM   2972 C CD1 . ILE B 2 92  ? 24.631 -4.849  -45.508 1.00 21.85  ? 92   ILE B CD1 1 
ATOM   2973 N N   . VAL B 2 93  ? 27.869 -5.978  -40.607 1.00 27.11  ? 93   VAL B N   1 
ATOM   2974 C CA  . VAL B 2 93  ? 29.093 -6.511  -40.026 1.00 26.55  ? 93   VAL B CA  1 
ATOM   2975 C C   . VAL B 2 93  ? 29.276 -7.962  -40.447 1.00 23.23  ? 93   VAL B C   1 
ATOM   2976 O O   . VAL B 2 93  ? 28.420 -8.801  -40.177 1.00 21.39  ? 93   VAL B O   1 
ATOM   2977 C CB  . VAL B 2 93  ? 29.065 -6.426  -38.491 1.00 26.19  ? 93   VAL B CB  1 
ATOM   2978 C CG1 . VAL B 2 93  ? 30.332 -7.017  -37.907 1.00 20.89  ? 93   VAL B CG1 1 
ATOM   2979 C CG2 . VAL B 2 93  ? 28.885 -4.982  -38.042 1.00 20.78  ? 93   VAL B CG2 1 
ATOM   2980 N N   . LYS B 2 94  ? 30.388 -8.250  -41.116 1.00 25.73  ? 94   LYS B N   1 
ATOM   2981 C CA  . LYS B 2 94  ? 30.647 -9.592  -41.627 1.00 33.64  ? 94   LYS B CA  1 
ATOM   2982 C C   . LYS B 2 94  ? 31.196 -10.518 -40.550 1.00 29.64  ? 94   LYS B C   1 
ATOM   2983 O O   . LYS B 2 94  ? 32.024 -10.118 -39.731 1.00 31.19  ? 94   LYS B O   1 
ATOM   2984 C CB  . LYS B 2 94  ? 31.631 -9.548  -42.799 1.00 43.27  ? 94   LYS B CB  1 
ATOM   2985 C CG  . LYS B 2 94  ? 31.190 -8.697  -43.975 1.00 56.87  ? 94   LYS B CG  1 
ATOM   2986 C CD  . LYS B 2 94  ? 32.302 -8.605  -45.009 1.00 70.12  ? 94   LYS B CD  1 
ATOM   2987 C CE  . LYS B 2 94  ? 32.030 -7.513  -46.031 1.00 79.59  ? 94   LYS B CE  1 
ATOM   2988 N NZ  . LYS B 2 94  ? 33.201 -7.298  -46.931 1.00 83.84  ? 94   LYS B NZ  1 
ATOM   2989 N N   . TRP B 2 95  ? 30.735 -11.763 -40.563 1.00 25.60  ? 95   TRP B N   1 
ATOM   2990 C CA  . TRP B 2 95  ? 31.232 -12.766 -39.634 1.00 31.50  ? 95   TRP B CA  1 
ATOM   2991 C C   . TRP B 2 95  ? 32.652 -13.158 -40.008 1.00 35.86  ? 95   TRP B C   1 
ATOM   2992 O O   . TRP B 2 95  ? 32.903 -13.630 -41.116 1.00 36.96  ? 95   TRP B O   1 
ATOM   2993 C CB  . TRP B 2 95  ? 30.332 -14.003 -39.643 1.00 28.41  ? 95   TRP B CB  1 
ATOM   2994 C CG  . TRP B 2 95  ? 30.872 -15.132 -38.824 1.00 31.54  ? 95   TRP B CG  1 
ATOM   2995 C CD1 . TRP B 2 95  ? 31.441 -15.050 -37.586 1.00 30.01  ? 95   TRP B CD1 1 
ATOM   2996 C CD2 . TRP B 2 95  ? 30.912 -16.517 -39.193 1.00 36.46  ? 95   TRP B CD2 1 
ATOM   2997 N NE1 . TRP B 2 95  ? 31.824 -16.299 -37.157 1.00 26.10  ? 95   TRP B NE1 1 
ATOM   2998 C CE2 . TRP B 2 95  ? 31.511 -17.216 -38.125 1.00 32.10  ? 95   TRP B CE2 1 
ATOM   2999 C CE3 . TRP B 2 95  ? 30.499 -17.234 -40.321 1.00 33.09  ? 95   TRP B CE3 1 
ATOM   3000 C CZ2 . TRP B 2 95  ? 31.705 -18.595 -38.153 1.00 37.01  ? 95   TRP B CZ2 1 
ATOM   3001 C CZ3 . TRP B 2 95  ? 30.691 -18.601 -40.345 1.00 30.45  ? 95   TRP B CZ3 1 
ATOM   3002 C CH2 . TRP B 2 95  ? 31.289 -19.268 -39.270 1.00 36.28  ? 95   TRP B CH2 1 
ATOM   3003 N N   . ASP B 2 96  ? 33.580 -12.957 -39.080 1.00 45.23  ? 96   ASP B N   1 
ATOM   3004 C CA  . ASP B 2 96  ? 34.978 -13.299 -39.310 1.00 53.51  ? 96   ASP B CA  1 
ATOM   3005 C C   . ASP B 2 96  ? 35.448 -14.352 -38.311 1.00 58.06  ? 96   ASP B C   1 
ATOM   3006 O O   . ASP B 2 96  ? 35.604 -14.065 -37.125 1.00 65.80  ? 96   ASP B O   1 
ATOM   3007 C CB  . ASP B 2 96  ? 35.853 -12.046 -39.218 1.00 57.25  ? 96   ASP B CB  1 
ATOM   3008 C CG  . ASP B 2 96  ? 37.336 -12.362 -39.289 1.00 69.05  ? 96   ASP B CG  1 
ATOM   3009 O OD1 . ASP B 2 96  ? 37.704 -13.359 -39.946 1.00 70.19  ? 96   ASP B OD1 1 
ATOM   3010 O OD2 . ASP B 2 96  ? 38.134 -11.610 -38.686 1.00 75.71  ? 96   ASP B OD2 1 
ATOM   3011 N N   . ARG B 2 97  ? 35.675 -15.570 -38.796 1.00 58.99  ? 97   ARG B N   1 
ATOM   3012 C CA  . ARG B 2 97  ? 36.106 -16.674 -37.941 1.00 61.14  ? 97   ARG B CA  1 
ATOM   3013 C C   . ARG B 2 97  ? 37.354 -16.328 -37.127 1.00 60.63  ? 97   ARG B C   1 
ATOM   3014 O O   . ARG B 2 97  ? 37.541 -16.823 -36.017 1.00 51.02  ? 97   ARG B O   1 
ATOM   3015 C CB  . ARG B 2 97  ? 36.370 -17.923 -38.780 1.00 63.05  ? 97   ARG B CB  1 
ATOM   3016 C CG  . ARG B 2 97  ? 35.271 -18.251 -39.771 1.00 64.71  ? 97   ARG B CG  1 
ATOM   3017 C CD  . ARG B 2 97  ? 35.485 -19.630 -40.374 1.00 68.26  ? 97   ARG B CD  1 
ATOM   3018 N NE  . ARG B 2 97  ? 34.483 -19.951 -41.387 1.00 69.43  ? 97   ARG B NE  1 
ATOM   3019 C CZ  . ARG B 2 97  ? 34.239 -21.179 -41.835 1.00 66.51  ? 97   ARG B CZ  1 
ATOM   3020 N NH1 . ARG B 2 97  ? 34.920 -22.213 -41.356 1.00 60.31  ? 97   ARG B NH1 1 
ATOM   3021 N NH2 . ARG B 2 97  ? 33.306 -21.375 -42.759 1.00 67.39  ? 97   ARG B NH2 1 
ATOM   3022 N N   . ASP B 2 98  ? 38.203 -15.475 -37.693 1.00 71.52  ? 98   ASP B N   1 
ATOM   3023 C CA  . ASP B 2 98  ? 39.443 -15.059 -37.047 1.00 71.86  ? 98   ASP B CA  1 
ATOM   3024 C C   . ASP B 2 98  ? 39.181 -13.943 -36.037 1.00 72.03  ? 98   ASP B C   1 
ATOM   3025 O O   . ASP B 2 98  ? 39.619 -14.012 -34.887 1.00 71.83  ? 98   ASP B O   1 
ATOM   3026 C CB  . ASP B 2 98  ? 40.449 -14.582 -38.098 1.00 74.74  ? 98   ASP B CB  1 
ATOM   3027 C CG  . ASP B 2 98  ? 40.454 -15.458 -39.342 1.00 80.56  ? 98   ASP B CG  1 
ATOM   3028 O OD1 . ASP B 2 98  ? 40.376 -16.698 -39.202 1.00 81.68  ? 98   ASP B OD1 1 
ATOM   3029 O OD2 . ASP B 2 98  ? 40.526 -14.904 -40.462 1.00 78.89  ? 98   ASP B OD2 1 
ATOM   3030 N N   . LYS C 3 1   ? 10.738 -13.794 -7.336  1.00 34.74  ? 1    LYS C N   1 
ATOM   3031 C CA  . LYS C 3 1   ? 9.450  -13.350 -6.823  1.00 30.11  ? 1    LYS C CA  1 
ATOM   3032 C C   . LYS C 3 1   ? 9.301  -11.853 -7.030  1.00 22.81  ? 1    LYS C C   1 
ATOM   3033 O O   . LYS C 3 1   ? 10.073 -11.068 -6.488  1.00 29.21  ? 1    LYS C O   1 
ATOM   3034 C CB  . LYS C 3 1   ? 9.323  -13.684 -5.336  1.00 36.90  ? 1    LYS C CB  1 
ATOM   3035 C CG  . LYS C 3 1   ? 7.915  -13.550 -4.782  1.00 41.84  ? 1    LYS C CG  1 
ATOM   3036 C CD  . LYS C 3 1   ? 6.999  -14.603 -5.377  1.00 51.65  ? 1    LYS C CD  1 
ATOM   3037 C CE  . LYS C 3 1   ? 5.633  -14.601 -4.715  1.00 58.94  ? 1    LYS C CE  1 
ATOM   3038 N NZ  . LYS C 3 1   ? 4.778  -15.703 -5.243  1.00 65.91  ? 1    LYS C NZ  1 
ATOM   3039 N N   . LEU C 3 2   ? 8.309  -11.459 -7.821  1.00 20.79  ? 2    LEU C N   1 
ATOM   3040 C CA  . LEU C 3 2   ? 8.049  -10.046 -8.063  1.00 24.61  ? 2    LEU C CA  1 
ATOM   3041 C C   . LEU C 3 2   ? 7.475  -9.392  -6.816  1.00 33.73  ? 2    LEU C C   1 
ATOM   3042 O O   . LEU C 3 2   ? 6.797  -10.042 -6.019  1.00 40.32  ? 2    LEU C O   1 
ATOM   3043 C CB  . LEU C 3 2   ? 7.080  -9.869  -9.234  1.00 23.55  ? 2    LEU C CB  1 
ATOM   3044 C CG  . LEU C 3 2   ? 7.589  -10.185 -10.639 1.00 27.28  ? 2    LEU C CG  1 
ATOM   3045 C CD1 . LEU C 3 2   ? 6.445  -10.137 -11.629 1.00 29.29  ? 2    LEU C CD1 1 
ATOM   3046 C CD2 . LEU C 3 2   ? 8.690  -9.220  -11.050 1.00 24.35  ? 2    LEU C CD2 1 
ATOM   3047 N N   . ILE C 3 3   ? 7.749  -8.104  -6.648  1.00 36.98  ? 3    ILE C N   1 
ATOM   3048 C CA  . ILE C 3 3   ? 7.144  -7.341  -5.564  1.00 39.20  ? 3    ILE C CA  1 
ATOM   3049 C C   . ILE C 3 3   ? 5.622  -7.301  -5.739  1.00 39.23  ? 3    ILE C C   1 
ATOM   3050 O O   . ILE C 3 3   ? 5.111  -7.294  -6.859  1.00 41.89  ? 3    ILE C O   1 
ATOM   3051 C CB  . ILE C 3 3   ? 7.722  -5.911  -5.480  1.00 36.71  ? 3    ILE C CB  1 
ATOM   3052 C CG1 . ILE C 3 3   ? 7.314  -5.241  -4.164  1.00 30.56  ? 3    ILE C CG1 1 
ATOM   3053 C CG2 . ILE C 3 3   ? 7.291  -5.086  -6.686  1.00 35.13  ? 3    ILE C CG2 1 
ATOM   3054 C CD1 . ILE C 3 3   ? 8.105  -3.997  -3.852  1.00 28.88  ? 3    ILE C CD1 1 
ATOM   3055 N N   . GLU C 3 4   ? 4.904  -7.280  -4.624  1.00 41.94  ? 4    GLU C N   1 
ATOM   3056 C CA  . GLU C 3 4   ? 3.454  -7.425  -4.637  1.00 44.38  ? 4    GLU C CA  1 
ATOM   3057 C C   . GLU C 3 4   ? 2.748  -6.088  -4.439  1.00 45.89  ? 4    GLU C C   1 
ATOM   3058 O O   . GLU C 3 4   ? 1.522  -6.009  -4.512  1.00 39.25  ? 4    GLU C O   1 
ATOM   3059 C CB  . GLU C 3 4   ? 3.017  -8.402  -3.543  1.00 52.83  ? 4    GLU C CB  1 
ATOM   3060 C CG  . GLU C 3 4   ? 4.088  -9.412  -3.130  1.00 64.14  ? 4    GLU C CG  1 
ATOM   3061 C CD  . GLU C 3 4   ? 5.212  -8.796  -2.298  1.00 75.70  ? 4    GLU C CD  1 
ATOM   3062 O OE1 . GLU C 3 4   ? 5.150  -7.585  -1.991  1.00 73.88  ? 4    GLU C OE1 1 
ATOM   3063 O OE2 . GLU C 3 4   ? 6.162  -9.531  -1.950  1.00 81.64  ? 4    GLU C OE2 1 
ATOM   3064 N N   . THR C 3 5   ? 3.523  -5.039  -4.185  1.00 48.39  ? 5    THR C N   1 
ATOM   3065 C CA  . THR C 3 5   ? 2.956  -3.716  -3.948  1.00 44.40  ? 5    THR C CA  1 
ATOM   3066 C C   . THR C 3 5   ? 3.372  -2.723  -5.036  1.00 38.77  ? 5    THR C C   1 
ATOM   3067 O O   . THR C 3 5   ? 4.498  -2.770  -5.536  1.00 31.80  ? 5    THR C O   1 
ATOM   3068 C CB  . THR C 3 5   ? 3.339  -3.178  -2.555  1.00 41.60  ? 5    THR C CB  1 
ATOM   3069 O OG1 . THR C 3 5   ? 2.588  -1.991  -2.280  1.00 50.95  ? 5    THR C OG1 1 
ATOM   3070 C CG2 . THR C 3 5   ? 4.828  -2.867  -2.483  1.00 40.47  ? 5    THR C CG2 1 
ATOM   3071 N N   . TYR C 3 6   ? 2.451  -1.833  -5.402  1.00 33.79  ? 6    TYR C N   1 
ATOM   3072 C CA  . TYR C 3 6   ? 2.664  -0.914  -6.519  1.00 25.93  ? 6    TYR C CA  1 
ATOM   3073 C C   . TYR C 3 6   ? 2.125  0.479   -6.242  1.00 28.94  ? 6    TYR C C   1 
ATOM   3074 O O   . TYR C 3 6   ? 1.093  0.643   -5.595  1.00 42.02  ? 6    TYR C O   1 
ATOM   3075 C CB  . TYR C 3 6   ? 2.057  -1.485  -7.808  1.00 23.75  ? 6    TYR C CB  1 
ATOM   3076 C CG  . TYR C 3 6   ? 2.750  -2.755  -8.236  1.00 36.87  ? 6    TYR C CG  1 
ATOM   3077 C CD1 . TYR C 3 6   ? 2.235  -4.000  -7.901  1.00 34.19  ? 6    TYR C CD1 1 
ATOM   3078 C CD2 . TYR C 3 6   ? 3.950  -2.708  -8.934  1.00 38.73  ? 6    TYR C CD2 1 
ATOM   3079 C CE1 . TYR C 3 6   ? 2.887  -5.161  -8.270  1.00 36.77  ? 6    TYR C CE1 1 
ATOM   3080 C CE2 . TYR C 3 6   ? 4.605  -3.860  -9.307  1.00 34.60  ? 6    TYR C CE2 1 
ATOM   3081 C CZ  . TYR C 3 6   ? 4.073  -5.083  -8.974  1.00 34.90  ? 6    TYR C CZ  1 
ATOM   3082 O OH  . TYR C 3 6   ? 4.733  -6.229  -9.350  1.00 36.34  ? 6    TYR C OH  1 
ATOM   3083 N N   . PHE C 3 7   ? 2.841  1.481   -6.734  1.00 27.47  ? 7    PHE C N   1 
ATOM   3084 C CA  . PHE C 3 7   ? 2.464  2.870   -6.521  1.00 35.21  ? 7    PHE C CA  1 
ATOM   3085 C C   . PHE C 3 7   ? 2.772  3.712   -7.755  1.00 34.71  ? 7    PHE C C   1 
ATOM   3086 O O   . PHE C 3 7   ? 3.887  3.682   -8.276  1.00 27.81  ? 7    PHE C O   1 
ATOM   3087 C CB  . PHE C 3 7   ? 3.174  3.433   -5.288  1.00 41.21  ? 7    PHE C CB  1 
ATOM   3088 C CG  . PHE C 3 7   ? 4.616  3.029   -5.181  1.00 47.78  ? 7    PHE C CG  1 
ATOM   3089 C CD1 . PHE C 3 7   ? 4.978  1.881   -4.494  1.00 43.33  ? 7    PHE C CD1 1 
ATOM   3090 C CD2 . PHE C 3 7   ? 5.612  3.796   -5.765  1.00 53.43  ? 7    PHE C CD2 1 
ATOM   3091 C CE1 . PHE C 3 7   ? 6.301  1.506   -4.392  1.00 39.51  ? 7    PHE C CE1 1 
ATOM   3092 C CE2 . PHE C 3 7   ? 6.939  3.424   -5.667  1.00 48.01  ? 7    PHE C CE2 1 
ATOM   3093 C CZ  . PHE C 3 7   ? 7.283  2.279   -4.978  1.00 42.03  ? 7    PHE C CZ  1 
ATOM   3094 N N   . SER C 3 8   ? 1.771  4.455   -8.219  1.00 40.80  ? 8    SER C N   1 
ATOM   3095 C CA  . SER C 3 8   ? 1.907  5.263   -9.424  1.00 35.97  ? 8    SER C CA  1 
ATOM   3096 C C   . SER C 3 8   ? 2.929  6.377   -9.229  1.00 37.86  ? 8    SER C C   1 
ATOM   3097 O O   . SER C 3 8   ? 3.413  6.608   -8.125  1.00 36.84  ? 8    SER C O   1 
ATOM   3098 C CB  . SER C 3 8   ? 0.555  5.833   -9.861  1.00 38.24  ? 8    SER C CB  1 
ATOM   3099 O OG  . SER C 3 8   ? 0.006  6.680   -8.867  1.00 56.40  ? 8    SER C OG  1 
ATOM   3100 N N   . LYS C 3 9   ? 3.237  7.078   -10.311 1.00 47.48  ? 9    LYS C N   1 
ATOM   3101 C CA  . LYS C 3 9   ? 4.371  7.986   -10.337 1.00 45.19  ? 9    LYS C CA  1 
ATOM   3102 C C   . LYS C 3 9   ? 3.954  9.401   -10.725 1.00 47.53  ? 9    LYS C C   1 
ATOM   3103 O O   . LYS C 3 9   ? 3.963  10.312  -9.897  1.00 41.21  ? 9    LYS C O   1 
ATOM   3104 C CB  . LYS C 3 9   ? 5.401  7.441   -11.323 1.00 38.38  ? 9    LYS C CB  1 
ATOM   3105 C CG  . LYS C 3 9   ? 6.608  8.304   -11.549 1.00 36.85  ? 9    LYS C CG  1 
ATOM   3106 C CD  . LYS C 3 9   ? 7.594  7.569   -12.437 1.00 30.96  ? 9    LYS C CD  1 
ATOM   3107 C CE  . LYS C 3 9   ? 7.868  6.176   -11.899 1.00 28.80  ? 9    LYS C CE  1 
ATOM   3108 N NZ  . LYS C 3 9   ? 8.984  5.512   -12.624 1.00 27.51  ? 9    LYS C NZ  1 
HETATM 3109 O O   . HOH D 4 .   ? 13.262 -5.123  -20.073 1.00 15.41  ? 2001 HOH A O   1 
HETATM 3110 O O   . HOH D 4 .   ? 7.321  -5.717  -10.340 1.00 30.68  ? 2002 HOH A O   1 
HETATM 3111 O O   . HOH D 4 .   ? 8.620  -0.346  -17.437 1.00 17.58  ? 2003 HOH A O   1 
HETATM 3112 O O   . HOH D 4 .   ? 14.261 5.065   -19.996 1.00 21.30  ? 2004 HOH A O   1 
HETATM 3113 O O   . HOH D 4 .   ? 1.142  10.802  -1.865  1.00 25.05  ? 2005 HOH A O   1 
HETATM 3114 O O   . HOH D 4 .   ? 43.299 -9.304  -15.055 1.00 22.11  ? 2006 HOH A O   1 
HETATM 3115 O O   . HOH D 4 .   ? 24.890 -17.444 -22.926 1.00 21.92  ? 2007 HOH A O   1 
HETATM 3116 O O   . HOH E 4 .   ? 26.636 6.089   -28.492 1.00 28.41  ? 2001 HOH B O   1 
HETATM 3117 O O   . HOH E 4 .   ? 33.238 -16.325 -34.279 1.00 28.95  ? 2002 HOH B O   1 
HETATM 3118 O O   . HOH E 4 .   ? 22.959 -18.600 -29.370 1.00 22.21  ? 2003 HOH B O   1 
HETATM 3119 O O   . HOH E 4 .   ? 35.403 -32.517 -34.962 1.00 27.29  ? 2004 HOH B O   1 
HETATM 3120 O O   . HOH E 4 .   ? 25.952 -31.773 -37.107 1.00 39.59  ? 2005 HOH B O   1 
HETATM 3121 O O   . HOH E 4 .   ? 28.280 -5.719  -28.428 1.00 27.45  ? 2006 HOH B O   1 
HETATM 3122 O O   . HOH E 4 .   ? 31.382 -14.976 -43.035 1.00 22.26  ? 2007 HOH B O   1 
HETATM 3123 O O   . HOH F 4 .   ? 6.302  -0.942  -6.283  1.00 30.40  ? 2001 HOH C O   1 
HETATM 3124 O O   . HOH F 4 .   ? -2.665 6.564   -7.830  1.00 31.04  ? 2002 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 1   ? 0.7060 0.6503 0.8380 -0.0159 -0.0875 0.0237  1   GLY A N   
2    C CA  . GLY A 1   ? 0.6720 0.6197 0.7939 -0.0136 -0.0793 0.0200  1   GLY A CA  
3    C C   . GLY A 1   ? 0.7080 0.6534 0.8068 -0.0138 -0.0762 0.0197  1   GLY A C   
4    O O   . GLY A 1   ? 0.7039 0.6471 0.7963 -0.0157 -0.0780 0.0218  1   GLY A O   
5    N N   . SER A 2   ? 0.6742 0.6200 0.7612 -0.0119 -0.0712 0.0173  2   SER A N   
6    C CA  . SER A 2   ? 0.5308 0.4740 0.5967 -0.0113 -0.0676 0.0169  2   SER A CA  
7    C C   . SER A 2   ? 0.4473 0.3987 0.5135 -0.0098 -0.0581 0.0136  2   SER A C   
8    O O   . SER A 2   ? 0.4415 0.3997 0.5214 -0.0088 -0.0537 0.0109  2   SER A O   
9    C CB  . SER A 2   ? 0.4754 0.4127 0.5270 -0.0097 -0.0689 0.0165  2   SER A CB  
10   O OG  . SER A 2   ? 0.4187 0.3609 0.4791 -0.0080 -0.0655 0.0139  2   SER A OG  
11   N N   . HIS A 3   ? 0.3757 0.3257 0.4266 -0.0094 -0.0550 0.0140  3   HIS A N   
12   C CA  . HIS A 3   ? 0.3168 0.2734 0.3665 -0.0084 -0.0470 0.0112  3   HIS A CA  
13   C C   . HIS A 3   ? 0.3145 0.2732 0.3471 -0.0049 -0.0432 0.0104  3   HIS A C   
14   O O   . HIS A 3   ? 0.3788 0.3311 0.3993 -0.0035 -0.0464 0.0123  3   HIS A O   
15   C CB  . HIS A 3   ? 0.3539 0.3151 0.4054 -0.0105 -0.0467 0.0126  3   HIS A CB  
16   C CG  . HIS A 3   ? 0.4850 0.4473 0.5542 -0.0129 -0.0498 0.0130  3   HIS A CG  
17   N ND1 . HIS A 3   ? 0.5069 0.4761 0.5901 -0.0118 -0.0455 0.0096  3   HIS A ND1 
18   C CD2 . HIS A 3   ? 0.4214 0.3798 0.4962 -0.0151 -0.0568 0.0166  3   HIS A CD2 
19   C CE1 . HIS A 3   ? 0.4187 0.3879 0.5159 -0.0128 -0.0493 0.0111  3   HIS A CE1 
20   N NE2 . HIS A 3   ? 0.4159 0.3791 0.5088 -0.0149 -0.0566 0.0155  3   HIS A NE2 
21   N N   . SER A 4   ? 0.2877 0.2546 0.3192 -0.0035 -0.0365 0.0075  4   SER A N   
22   C CA  . SER A 4   ? 0.2764 0.2460 0.2940 -0.0002 -0.0328 0.0066  4   SER A CA  
23   C C   . SER A 4   ? 0.3743 0.3532 0.3903 0.0003  -0.0271 0.0051  4   SER A C   
24   O O   . SER A 4   ? 0.4274 0.4107 0.4540 -0.0016 -0.0251 0.0033  4   SER A O   
25   C CB  . SER A 4   ? 0.3301 0.2975 0.3483 0.0017  -0.0315 0.0043  4   SER A CB  
26   O OG  . SER A 4   ? 0.4616 0.4327 0.4926 0.0004  -0.0280 0.0014  4   SER A OG  
27   N N   . MET A 5   ? 0.3933 0.3748 0.3965 0.0028  -0.0249 0.0057  5   MET A N   
28   C CA  . MET A 5   ? 0.4017 0.3918 0.4033 0.0036  -0.0200 0.0045  5   MET A CA  
29   C C   . MET A 5   ? 0.3773 0.3687 0.3704 0.0070  -0.0170 0.0027  5   MET A C   
30   O O   . MET A 5   ? 0.3923 0.3798 0.3752 0.0095  -0.0181 0.0039  5   MET A O   
31   C CB  . MET A 5   ? 0.3899 0.3832 0.3862 0.0033  -0.0199 0.0077  5   MET A CB  
32   C CG  . MET A 5   ? 0.3537 0.3562 0.3509 0.0037  -0.0156 0.0070  5   MET A CG  
33   S SD  . MET A 5   ? 0.4697 0.4769 0.4658 0.0022  -0.0154 0.0112  5   MET A SD  
34   C CE  . MET A 5   ? 0.4854 0.4888 0.4655 0.0056  -0.0146 0.0138  5   MET A CE  
35   N N   . ARG A 6   ? 0.2955 0.2917 0.2925 0.0069  -0.0136 -0.0001 6   ARG A N   
36   C CA  . ARG A 6   ? 0.3500 0.3469 0.3400 0.0097  -0.0113 -0.0017 6   ARG A CA  
37   C C   . ARG A 6   ? 0.3600 0.3644 0.3481 0.0102  -0.0078 -0.0026 6   ARG A C   
38   O O   . ARG A 6   ? 0.3287 0.3371 0.3236 0.0079  -0.0066 -0.0037 6   ARG A O   
39   C CB  . ARG A 6   ? 0.3572 0.3507 0.3526 0.0090  -0.0109 -0.0042 6   ARG A CB  
40   C CG  . ARG A 6   ? 0.3471 0.3330 0.3457 0.0086  -0.0148 -0.0031 6   ARG A CG  
41   C CD  . ARG A 6   ? 0.4058 0.3867 0.3938 0.0116  -0.0169 -0.0020 6   ARG A CD  
42   N NE  . ARG A 6   ? 0.5793 0.5525 0.5715 0.0110  -0.0208 -0.0014 6   ARG A NE  
43   C CZ  . ARG A 6   ? 0.6887 0.6554 0.6796 0.0105  -0.0259 0.0009  6   ARG A CZ  
44   N NH1 . ARG A 6   ? 0.6750 0.6418 0.6594 0.0105  -0.0272 0.0030  6   ARG A NH1 
45   N NH2 . ARG A 6   ? 0.6704 0.6300 0.6664 0.0099  -0.0300 0.0016  6   ARG A NH2 
46   N N   . TYR A 7   ? 0.2980 0.3040 0.2773 0.0133  -0.0067 -0.0021 7   TYR A N   
47   C CA  . TYR A 7   ? 0.2917 0.3040 0.2697 0.0140  -0.0041 -0.0029 7   TYR A CA  
48   C C   . TYR A 7   ? 0.2588 0.2693 0.2322 0.0158  -0.0034 -0.0048 7   TYR A C   
49   O O   . TYR A 7   ? 0.2359 0.2421 0.2040 0.0182  -0.0044 -0.0044 7   TYR A O   
50   C CB  . TYR A 7   ? 0.2883 0.3054 0.2621 0.0158  -0.0032 -0.0003 7   TYR A CB  
51   C CG  . TYR A 7   ? 0.3277 0.3486 0.3074 0.0134  -0.0034 0.0018  7   TYR A CG  
52   C CD1 . TYR A 7   ? 0.2769 0.3028 0.2638 0.0109  -0.0028 0.0010  7   TYR A CD1 
53   C CD2 . TYR A 7   ? 0.3240 0.3427 0.3012 0.0135  -0.0044 0.0045  7   TYR A CD2 
54   C CE1 . TYR A 7   ? 0.3254 0.3546 0.3182 0.0085  -0.0034 0.0030  7   TYR A CE1 
55   C CE2 . TYR A 7   ? 0.3451 0.3672 0.3277 0.0110  -0.0047 0.0068  7   TYR A CE2 
56   C CZ  . TYR A 7   ? 0.3915 0.4191 0.3825 0.0086  -0.0042 0.0061  7   TYR A CZ  
57   O OH  . TYR A 7   ? 0.3141 0.3450 0.3112 0.0060  -0.0049 0.0085  7   TYR A OH  
58   N N   . PHE A 8   ? 0.2102 0.2234 0.1857 0.0143  -0.0018 -0.0067 8   PHE A N   
59   C CA  . PHE A 8   ? 0.2134 0.2250 0.1863 0.0154  -0.0012 -0.0078 8   PHE A CA  
60   C C   . PHE A 8   ? 0.2993 0.3162 0.2717 0.0159  -0.0007 -0.0073 8   PHE A C   
61   O O   . PHE A 8   ? 0.3504 0.3708 0.3245 0.0137  -0.0001 -0.0082 8   PHE A O   
62   C CB  . PHE A 8   ? 0.2316 0.2399 0.2072 0.0127  0.0001  -0.0107 8   PHE A CB  
63   C CG  . PHE A 8   ? 0.3164 0.3195 0.2968 0.0120  -0.0008 -0.0108 8   PHE A CG  
64   C CD1 . PHE A 8   ? 0.3302 0.3281 0.3084 0.0134  -0.0019 -0.0106 8   PHE A CD1 
65   C CD2 . PHE A 8   ? 0.2652 0.2686 0.2537 0.0098  -0.0013 -0.0107 8   PHE A CD2 
66   C CE1 . PHE A 8   ? 0.2142 0.2073 0.1984 0.0126  -0.0035 -0.0102 8   PHE A CE1 
67   C CE2 . PHE A 8   ? 0.2737 0.2721 0.2682 0.0090  -0.0029 -0.0104 8   PHE A CE2 
68   C CZ  . PHE A 8   ? 0.1640 0.1574 0.1566 0.0103  -0.0041 -0.0101 8   PHE A CZ  
69   N N   . PHE A 9   ? 0.2747 0.2915 0.2445 0.0189  -0.0012 -0.0062 9   PHE A N   
70   C CA  . PHE A 9   ? 0.2216 0.2430 0.1905 0.0197  -0.0011 -0.0058 9   PHE A CA  
71   C C   . PHE A 9   ? 0.2885 0.3070 0.2551 0.0202  -0.0016 -0.0065 9   PHE A C   
72   O O   . PHE A 9   ? 0.2915 0.3057 0.2564 0.0221  -0.0021 -0.0063 9   PHE A O   
73   C CB  . PHE A 9   ? 0.2344 0.2595 0.2022 0.0231  -0.0009 -0.0038 9   PHE A CB  
74   C CG  . PHE A 9   ? 0.2398 0.2669 0.2086 0.0227  -0.0002 -0.0025 9   PHE A CG  
75   C CD1 . PHE A 9   ? 0.2697 0.3026 0.2406 0.0208  0.0003  -0.0015 9   PHE A CD1 
76   C CD2 . PHE A 9   ? 0.2923 0.3147 0.2589 0.0240  -0.0004 -0.0020 9   PHE A CD2 
77   C CE1 . PHE A 9   ? 0.3391 0.3738 0.3105 0.0202  0.0010  0.0003  9   PHE A CE1 
78   C CE2 . PHE A 9   ? 0.3233 0.3467 0.2896 0.0233  0.0000  -0.0004 9   PHE A CE2 
79   C CZ  . PHE A 9   ? 0.3533 0.3831 0.3222 0.0214  0.0009  0.0009  9   PHE A CZ  
80   N N   . THR A 10  ? 0.2337 0.2541 0.1994 0.0183  -0.0018 -0.0072 10  THR A N   
81   C CA  . THR A 10  ? 0.2956 0.3130 0.2578 0.0182  -0.0023 -0.0076 10  THR A CA  
82   C C   . THR A 10  ? 0.3320 0.3532 0.2922 0.0187  -0.0037 -0.0069 10  THR A C   
83   O O   . THR A 10  ? 0.3630 0.3876 0.3237 0.0167  -0.0041 -0.0071 10  THR A O   
84   C CB  . THR A 10  ? 0.3429 0.3562 0.3037 0.0144  -0.0012 -0.0095 10  THR A CB  
85   O OG1 . THR A 10  ? 0.2681 0.2784 0.2315 0.0137  0.0000  -0.0102 10  THR A OG1 
86   C CG2 . THR A 10  ? 0.1921 0.2015 0.1480 0.0141  -0.0016 -0.0096 10  THR A CG2 
87   N N   . SER A 11  ? 0.3441 0.3645 0.3020 0.0214  -0.0047 -0.0061 11  SER A N   
88   C CA  . SER A 11  ? 0.2307 0.2540 0.1864 0.0219  -0.0066 -0.0052 11  SER A CA  
89   C C   . SER A 11  ? 0.2662 0.2845 0.2172 0.0213  -0.0080 -0.0055 11  SER A C   
90   O O   . SER A 11  ? 0.3277 0.3426 0.2776 0.0235  -0.0079 -0.0055 11  SER A O   
91   C CB  . SER A 11  ? 0.3009 0.3288 0.2580 0.0261  -0.0068 -0.0036 11  SER A CB  
92   O OG  . SER A 11  ? 0.4161 0.4490 0.3766 0.0264  -0.0055 -0.0028 11  SER A OG  
93   N N   . VAL A 12  ? 0.2921 0.3095 0.2395 0.0181  -0.0097 -0.0057 12  VAL A N   
94   C CA  . VAL A 12  ? 0.3216 0.3338 0.2631 0.0169  -0.0114 -0.0056 12  VAL A CA  
95   C C   . VAL A 12  ? 0.3569 0.3711 0.2962 0.0168  -0.0155 -0.0041 12  VAL A C   
96   O O   . VAL A 12  ? 0.4062 0.4226 0.3453 0.0145  -0.0173 -0.0038 12  VAL A O   
97   C CB  . VAL A 12  ? 0.3013 0.3080 0.2381 0.0125  -0.0100 -0.0072 12  VAL A CB  
98   C CG1 . VAL A 12  ? 0.2016 0.2025 0.1314 0.0113  -0.0112 -0.0067 12  VAL A CG1 
99   C CG2 . VAL A 12  ? 0.3004 0.3061 0.2410 0.0124  -0.0065 -0.0084 12  VAL A CG2 
100  N N   . SER A 13  ? 0.3723 0.3853 0.3102 0.0193  -0.0175 -0.0029 13  SER A N   
101  C CA  . SER A 13  ? 0.4591 0.4740 0.3961 0.0194  -0.0223 -0.0009 13  SER A CA  
102  C C   . SER A 13  ? 0.5500 0.5591 0.4794 0.0147  -0.0254 -0.0008 13  SER A C   
103  O O   . SER A 13  ? 0.4733 0.4761 0.3970 0.0128  -0.0239 -0.0017 13  SER A O   
104  C CB  . SER A 13  ? 0.3420 0.3572 0.2802 0.0237  -0.0238 0.0003  13  SER A CB  
105  O OG  . SER A 13  ? 0.3903 0.3985 0.3232 0.0229  -0.0238 -0.0003 13  SER A OG  
106  N N   . ARG A 14  ? 0.6573 0.6682 0.5864 0.0128  -0.0299 0.0007  14  ARG A N   
107  C CA  . ARG A 14  ? 0.7729 0.7774 0.6933 0.0080  -0.0338 0.0010  14  ARG A CA  
108  C C   . ARG A 14  ? 0.9019 0.9057 0.8218 0.0085  -0.0405 0.0040  14  ARG A C   
109  O O   . ARG A 14  ? 0.9040 0.9119 0.8285 0.0083  -0.0455 0.0060  14  ARG A O   
110  C CB  . ARG A 14  ? 0.7736 0.7786 0.6929 0.0045  -0.0351 0.0003  14  ARG A CB  
111  C CG  . ARG A 14  ? 0.8076 0.8138 0.7287 0.0039  -0.0294 -0.0025 14  ARG A CG  
112  C CD  . ARG A 14  ? 0.9195 0.9231 0.8360 -0.0006 -0.0312 -0.0038 14  ARG A CD  
113  N NE  . ARG A 14  ? 0.9679 0.9761 0.8905 -0.0003 -0.0281 -0.0053 14  ARG A NE  
114  C CZ  . ARG A 14  ? 0.9754 0.9902 0.9050 0.0001  -0.0312 -0.0039 14  ARG A CZ  
115  N NH1 . ARG A 14  ? 0.9933 1.0111 0.9258 0.0005  -0.0374 -0.0008 14  ARG A NH1 
116  N NH2 . ARG A 14  ? 0.9465 0.9651 0.8811 0.0001  -0.0284 -0.0052 14  ARG A NH2 
117  N N   . PRO A 15  ? 1.0015 1.0005 0.9171 0.0090  -0.0411 0.0045  15  PRO A N   
118  C CA  . PRO A 15  ? 1.0645 1.0617 0.9792 0.0091  -0.0480 0.0074  15  PRO A CA  
119  C C   . PRO A 15  ? 1.0860 1.0747 0.9892 0.0033  -0.0527 0.0082  15  PRO A C   
120  O O   . PRO A 15  ? 1.0770 1.0584 0.9704 0.0005  -0.0501 0.0070  15  PRO A O   
121  C CB  . PRO A 15  ? 1.0355 1.0306 0.9501 0.0122  -0.0461 0.0073  15  PRO A CB  
122  C CG  . PRO A 15  ? 0.9977 0.9889 0.9074 0.0108  -0.0396 0.0046  15  PRO A CG  
123  C CD  . PRO A 15  ? 1.0007 0.9961 0.9137 0.0101  -0.0358 0.0027  15  PRO A CD  
124  N N   . GLY A 16  ? 1.0600 1.0494 0.9644 0.0014  -0.0596 0.0105  16  GLY A N   
125  C CA  . GLY A 16  ? 1.0956 1.0945 1.0134 0.0047  -0.0623 0.0123  16  GLY A CA  
126  C C   . GLY A 16  ? 1.1746 1.1751 1.0930 0.0016  -0.0642 0.0120  16  GLY A C   
127  O O   . GLY A 16  ? 1.2339 1.2393 1.1609 0.0019  -0.0702 0.0148  16  GLY A O   
128  N N   . ARG A 17  ? 1.1894 1.1858 1.0996 -0.0014 -0.0593 0.0088  17  ARG A N   
129  C CA  . ARG A 17  ? 1.2081 1.2044 1.1171 -0.0048 -0.0609 0.0078  17  ARG A CA  
130  C C   . ARG A 17  ? 1.1662 1.1735 1.0900 -0.0018 -0.0615 0.0093  17  ARG A C   
131  O O   . ARG A 17  ? 1.1594 1.1679 1.0853 -0.0044 -0.0656 0.0098  17  ARG A O   
132  C CB  . ARG A 17  ? 1.2527 1.2437 1.1526 -0.0073 -0.0540 0.0037  17  ARG A CB  
133  C CG  . ARG A 17  ? 1.2900 1.2692 1.1738 -0.0118 -0.0544 0.0025  17  ARG A CG  
134  C CD  . ARG A 17  ? 1.3340 1.3105 1.2151 -0.0100 -0.0520 0.0032  17  ARG A CD  
135  N NE  . ARG A 17  ? 1.3717 1.3501 1.2555 -0.0077 -0.0434 0.0007  17  ARG A NE  
136  C CZ  . ARG A 17  ? 1.3766 1.3487 1.2517 -0.0104 -0.0382 -0.0018 17  ARG A CZ  
137  N NH1 . ARG A 17  ? 1.3234 1.2978 1.2034 -0.0081 -0.0313 -0.0036 17  ARG A NH1 
138  N NH2 . ARG A 17  ? 1.3825 1.3455 1.2438 -0.0154 -0.0401 -0.0025 17  ARG A NH2 
139  N N   . GLY A 18  ? 1.1037 1.1188 1.0375 0.0035  -0.0576 0.0100  18  GLY A N   
140  C CA  . GLY A 18  ? 0.9861 1.0118 0.9344 0.0066  -0.0571 0.0117  18  GLY A CA  
141  C C   . GLY A 18  ? 0.9017 0.9328 0.8551 0.0116  -0.0495 0.0106  18  GLY A C   
142  O O   . GLY A 18  ? 0.9383 0.9688 0.8907 0.0150  -0.0482 0.0107  18  GLY A O   
143  N N   . GLU A 19  ? 0.8287 0.8643 0.7872 0.0119  -0.0449 0.0094  19  GLU A N   
144  C CA  . GLU A 19  ? 0.8242 0.8645 0.7871 0.0163  -0.0383 0.0086  19  GLU A CA  
145  C C   . GLU A 19  ? 0.6584 0.6939 0.6124 0.0149  -0.0334 0.0050  19  GLU A C   
146  O O   . GLU A 19  ? 0.6673 0.6974 0.6146 0.0105  -0.0337 0.0029  19  GLU A O   
147  C CB  . GLU A 19  ? 0.9913 1.0407 0.9676 0.0180  -0.0365 0.0106  19  GLU A CB  
148  C CG  . GLU A 19  ? 1.1594 1.2143 1.1470 0.0195  -0.0409 0.0145  19  GLU A CG  
149  C CD  . GLU A 19  ? 1.3118 1.3752 1.3129 0.0198  -0.0397 0.0169  19  GLU A CD  
150  O OE1 . GLU A 19  ? 1.3124 1.3801 1.3168 0.0222  -0.0335 0.0164  19  GLU A OE1 
151  O OE2 . GLU A 19  ? 1.4046 1.4701 1.4129 0.0175  -0.0453 0.0196  19  GLU A OE2 
152  N N   . PRO A 20  ? 0.4516 0.4884 0.4066 0.0185  -0.0283 0.0040  20  PRO A N   
153  C CA  . PRO A 20  ? 0.3185 0.3505 0.2692 0.0176  -0.0229 0.0008  20  PRO A CA  
154  C C   . PRO A 20  ? 0.2958 0.3280 0.2467 0.0140  -0.0216 -0.0007 20  PRO A C   
155  O O   . PRO A 20  ? 0.4354 0.4736 0.3925 0.0139  -0.0228 0.0008  20  PRO A O   
156  C CB  . PRO A 20  ? 0.2956 0.3314 0.2504 0.0224  -0.0192 0.0012  20  PRO A CB  
157  C CG  . PRO A 20  ? 0.3643 0.4030 0.3215 0.0261  -0.0220 0.0036  20  PRO A CG  
158  C CD  . PRO A 20  ? 0.4328 0.4746 0.3943 0.0239  -0.0271 0.0059  20  PRO A CD  
159  N N   . ARG A 21  ? 0.2723 0.2979 0.2179 0.0113  -0.0191 -0.0035 21  ARG A N   
160  C CA  . ARG A 21  ? 0.2902 0.3153 0.2365 0.0087  -0.0168 -0.0055 21  ARG A CA  
161  C C   . ARG A 21  ? 0.3506 0.3787 0.3026 0.0115  -0.0128 -0.0057 21  ARG A C   
162  O O   . ARG A 21  ? 0.3151 0.3410 0.2672 0.0139  -0.0106 -0.0059 21  ARG A O   
163  C CB  . ARG A 21  ? 0.3041 0.3211 0.2433 0.0053  -0.0151 -0.0082 21  ARG A CB  
164  C CG  . ARG A 21  ? 0.3521 0.3677 0.2921 0.0028  -0.0122 -0.0108 21  ARG A CG  
165  C CD  . ARG A 21  ? 0.4598 0.4756 0.3976 -0.0005 -0.0156 -0.0116 21  ARG A CD  
166  N NE  . ARG A 21  ? 0.4812 0.4950 0.4195 -0.0029 -0.0129 -0.0147 21  ARG A NE  
167  C CZ  . ARG A 21  ? 0.5349 0.5416 0.4670 -0.0056 -0.0102 -0.0178 21  ARG A CZ  
168  N NH1 . ARG A 21  ? 0.5448 0.5457 0.4690 -0.0065 -0.0098 -0.0178 21  ARG A NH1 
169  N NH2 . ARG A 21  ? 0.4926 0.4979 0.4263 -0.0074 -0.0076 -0.0208 21  ARG A NH2 
170  N N   . PHE A 22  ? 0.3296 0.3623 0.2860 0.0110  -0.0125 -0.0054 22  PHE A N   
171  C CA  . PHE A 22  ? 0.2607 0.2958 0.2215 0.0132  -0.0092 -0.0051 22  PHE A CA  
172  C C   . PHE A 22  ? 0.2223 0.2560 0.1846 0.0103  -0.0077 -0.0071 22  PHE A C   
173  O O   . PHE A 22  ? 0.2251 0.2609 0.1906 0.0077  -0.0092 -0.0071 22  PHE A O   
174  C CB  . PHE A 22  ? 0.1350 0.1775 0.1015 0.0161  -0.0097 -0.0019 22  PHE A CB  
175  C CG  . PHE A 22  ? 0.1729 0.2170 0.1424 0.0180  -0.0065 -0.0014 22  PHE A CG  
176  C CD1 . PHE A 22  ? 0.2035 0.2449 0.1702 0.0212  -0.0046 -0.0017 22  PHE A CD1 
177  C CD2 . PHE A 22  ? 0.2167 0.2644 0.1926 0.0163  -0.0057 -0.0005 22  PHE A CD2 
178  C CE1 . PHE A 22  ? 0.2938 0.3354 0.2619 0.0227  -0.0023 -0.0010 22  PHE A CE1 
179  C CE2 . PHE A 22  ? 0.2625 0.3110 0.2402 0.0177  -0.0032 0.0003  22  PHE A CE2 
180  C CZ  . PHE A 22  ? 0.3050 0.3502 0.2777 0.0208  -0.0017 0.0000  22  PHE A CZ  
181  N N   . ILE A 23  ? 0.2190 0.2491 0.1824 0.0107  -0.0048 -0.0085 23  ILE A N   
182  C CA  . ILE A 23  ? 0.3152 0.3438 0.2808 0.0082  -0.0033 -0.0104 23  ILE A CA  
183  C C   . ILE A 23  ? 0.3041 0.3332 0.2736 0.0101  -0.0018 -0.0095 23  ILE A C   
184  O O   . ILE A 23  ? 0.3516 0.3782 0.3209 0.0125  -0.0013 -0.0087 23  ILE A O   
185  C CB  . ILE A 23  ? 0.2869 0.3089 0.2496 0.0055  -0.0018 -0.0134 23  ILE A CB  
186  C CG1 . ILE A 23  ? 0.2855 0.3056 0.2422 0.0032  -0.0035 -0.0144 23  ILE A CG1 
187  C CG2 . ILE A 23  ? 0.1920 0.2125 0.1579 0.0033  0.0002  -0.0160 23  ILE A CG2 
188  C CD1 . ILE A 23  ? 0.4132 0.4264 0.3651 0.0006  -0.0013 -0.0172 23  ILE A CD1 
189  N N   . ALA A 24  ? 0.2929 0.3246 0.2674 0.0088  -0.0017 -0.0091 24  ALA A N   
190  C CA  . ALA A 24  ? 0.3326 0.3643 0.3103 0.0101  -0.0008 -0.0078 24  ALA A CA  
191  C C   . ALA A 24  ? 0.3154 0.3448 0.2988 0.0071  -0.0003 -0.0095 24  ALA A C   
192  O O   . ALA A 24  ? 0.3163 0.3475 0.3037 0.0045  -0.0010 -0.0103 24  ALA A O   
193  C CB  . ALA A 24  ? 0.3548 0.3924 0.3353 0.0118  -0.0012 -0.0043 24  ALA A CB  
194  N N   . VAL A 25  ? 0.2960 0.3212 0.2803 0.0074  0.0003  -0.0101 25  VAL A N   
195  C CA  . VAL A 25  ? 0.3174 0.3403 0.3088 0.0049  0.0006  -0.0115 25  VAL A CA  
196  C C   . VAL A 25  ? 0.3096 0.3313 0.3039 0.0058  -0.0006 -0.0092 25  VAL A C   
197  O O   . VAL A 25  ? 0.3405 0.3595 0.3302 0.0081  -0.0010 -0.0082 25  VAL A O   
198  C CB  . VAL A 25  ? 0.2891 0.3067 0.2808 0.0035  0.0025  -0.0150 25  VAL A CB  
199  C CG1 . VAL A 25  ? 0.2729 0.2906 0.2600 0.0021  0.0036  -0.0173 25  VAL A CG1 
200  C CG2 . VAL A 25  ? 0.3872 0.4009 0.3752 0.0056  0.0029  -0.0147 25  VAL A CG2 
201  N N   . GLY A 26  ? 0.2803 0.3033 0.2816 0.0037  -0.0016 -0.0083 26  GLY A N   
202  C CA  . GLY A 26  ? 0.2486 0.2694 0.2525 0.0038  -0.0033 -0.0061 26  GLY A CA  
203  C C   . GLY A 26  ? 0.3086 0.3251 0.3209 0.0014  -0.0039 -0.0080 26  GLY A C   
204  O O   . GLY A 26  ? 0.2647 0.2819 0.2831 -0.0009 -0.0031 -0.0103 26  GLY A O   
205  N N   . TYR A 27  ? 0.3149 0.3264 0.3277 0.0021  -0.0055 -0.0070 27  TYR A N   
206  C CA  . TYR A 27  ? 0.2942 0.3013 0.3166 0.0001  -0.0064 -0.0084 27  TYR A CA  
207  C C   . TYR A 27  ? 0.2806 0.2851 0.3063 -0.0007 -0.0103 -0.0051 27  TYR A C   
208  O O   . TYR A 27  ? 0.3619 0.3653 0.3798 0.0009  -0.0121 -0.0022 27  TYR A O   
209  C CB  . TYR A 27  ? 0.2875 0.2899 0.3093 0.0012  -0.0053 -0.0101 27  TYR A CB  
210  C CG  . TYR A 27  ? 0.3352 0.3381 0.3570 0.0007  -0.0012 -0.0139 27  TYR A CG  
211  C CD1 . TYR A 27  ? 0.3755 0.3796 0.3876 0.0025  0.0006  -0.0144 27  TYR A CD1 
212  C CD2 . TYR A 27  ? 0.4051 0.4069 0.4364 -0.0015 0.0010  -0.0168 27  TYR A CD2 
213  C CE1 . TYR A 27  ? 0.4167 0.4204 0.4273 0.0018  0.0042  -0.0176 27  TYR A CE1 
214  C CE2 . TYR A 27  ? 0.3773 0.3786 0.4068 -0.0021 0.0052  -0.0203 27  TYR A CE2 
215  C CZ  . TYR A 27  ? 0.3946 0.3967 0.4132 -0.0006 0.0067  -0.0206 27  TYR A CZ  
216  O OH  . TYR A 27  ? 0.4518 0.4525 0.4672 -0.0015 0.0108  -0.0238 27  TYR A OH  
217  N N   . VAL A 28  ? 0.2582 0.2612 0.2952 -0.0034 -0.0118 -0.0056 28  VAL A N   
218  C CA  . VAL A 28  ? 0.2826 0.2811 0.3242 -0.0046 -0.0163 -0.0027 28  VAL A CA  
219  C C   . VAL A 28  ? 0.2733 0.2669 0.3259 -0.0056 -0.0168 -0.0048 28  VAL A C   
220  O O   . VAL A 28  ? 0.2493 0.2439 0.3128 -0.0074 -0.0153 -0.0073 28  VAL A O   
221  C CB  . VAL A 28  ? 0.2767 0.2776 0.3237 -0.0071 -0.0186 -0.0005 28  VAL A CB  
222  C CG1 . VAL A 28  ? 0.2513 0.2464 0.3048 -0.0089 -0.0238 0.0022  28  VAL A CG1 
223  C CG2 . VAL A 28  ? 0.2202 0.2257 0.2570 -0.0060 -0.0180 0.0024  28  VAL A CG2 
224  N N   . ASP A 29  ? 0.3176 0.3060 0.3680 -0.0044 -0.0188 -0.0038 29  ASP A N   
225  C CA  . ASP A 29  ? 0.2844 0.2687 0.3454 -0.0049 -0.0184 -0.0057 29  ASP A CA  
226  C C   . ASP A 29  ? 0.2771 0.2646 0.3383 -0.0042 -0.0121 -0.0098 29  ASP A C   
227  O O   . ASP A 29  ? 0.3330 0.3220 0.3831 -0.0022 -0.0098 -0.0104 29  ASP A O   
228  C CB  . ASP A 29  ? 0.3518 0.3353 0.4281 -0.0069 -0.0210 -0.0051 29  ASP A CB  
229  C CG  . ASP A 29  ? 0.4657 0.4450 0.5417 -0.0078 -0.0281 -0.0006 29  ASP A CG  
230  O OD1 . ASP A 29  ? 0.4705 0.4447 0.5366 -0.0071 -0.0312 0.0016  29  ASP A OD1 
231  O OD2 . ASP A 29  ? 0.5138 0.4939 0.5986 -0.0091 -0.0308 0.0008  29  ASP A OD2 
232  N N   . ASP A 30  ? 0.2223 0.2102 0.2955 -0.0059 -0.0094 -0.0128 30  ASP A N   
233  C CA  . ASP A 30  ? 0.3405 0.3301 0.4128 -0.0057 -0.0030 -0.0169 30  ASP A CA  
234  C C   . ASP A 30  ? 0.3269 0.3207 0.3979 -0.0068 -0.0004 -0.0195 30  ASP A C   
235  O O   . ASP A 30  ? 0.3291 0.3231 0.4016 -0.0074 0.0046  -0.0234 30  ASP A O   
236  C CB  . ASP A 30  ? 0.3728 0.3605 0.4583 -0.0058 -0.0004 -0.0186 30  ASP A CB  
237  C CG  . ASP A 30  ? 0.4251 0.4103 0.5116 -0.0043 -0.0031 -0.0158 30  ASP A CG  
238  O OD1 . ASP A 30  ? 0.5040 0.4875 0.5780 -0.0031 -0.0039 -0.0147 30  ASP A OD1 
239  O OD2 . ASP A 30  ? 0.3539 0.3386 0.4543 -0.0044 -0.0047 -0.0148 30  ASP A OD2 
240  N N   . THR A 31  ? 0.2157 0.2124 0.2834 -0.0073 -0.0037 -0.0171 31  THR A N   
241  C CA  . THR A 31  ? 0.2140 0.2145 0.2815 -0.0086 -0.0026 -0.0187 31  THR A CA  
242  C C   . THR A 31  ? 0.3415 0.3465 0.3961 -0.0074 -0.0030 -0.0169 31  THR A C   
243  O O   . THR A 31  ? 0.3885 0.3950 0.4391 -0.0068 -0.0062 -0.0130 31  THR A O   
244  C CB  . THR A 31  ? 0.2259 0.2265 0.3039 -0.0108 -0.0065 -0.0170 31  THR A CB  
245  O OG1 . THR A 31  ? 0.3329 0.3304 0.4242 -0.0109 -0.0056 -0.0190 31  THR A OG1 
246  C CG2 . THR A 31  ? 0.1256 0.1304 0.2024 -0.0121 -0.0063 -0.0179 31  THR A CG2 
247  N N   . GLN A 32  ? 0.3707 0.3775 0.4189 -0.0072 0.0004  -0.0197 32  GLN A N   
248  C CA  . GLN A 32  ? 0.3548 0.3661 0.3929 -0.0062 -0.0002 -0.0181 32  GLN A CA  
249  C C   . GLN A 32  ? 0.3706 0.3857 0.4128 -0.0079 -0.0028 -0.0163 32  GLN A C   
250  O O   . GLN A 32  ? 0.4431 0.4575 0.4934 -0.0101 -0.0029 -0.0183 32  GLN A O   
251  C CB  . GLN A 32  ? 0.3364 0.3477 0.3670 -0.0061 0.0032  -0.0213 32  GLN A CB  
252  C CG  . GLN A 32  ? 0.5153 0.5312 0.5369 -0.0050 0.0020  -0.0193 32  GLN A CG  
253  C CD  . GLN A 32  ? 0.5645 0.5796 0.5786 -0.0054 0.0041  -0.0222 32  GLN A CD  
254  O OE1 . GLN A 32  ? 0.5631 0.5741 0.5775 -0.0066 0.0071  -0.0260 32  GLN A OE1 
255  N NE2 . GLN A 32  ? 0.5578 0.5766 0.5653 -0.0045 0.0026  -0.0203 32  GLN A NE2 
256  N N   . PHE A 33  ? 0.2511 0.2703 0.2882 -0.0068 -0.0047 -0.0124 33  PHE A N   
257  C CA  . PHE A 33  ? 0.2947 0.3180 0.3360 -0.0085 -0.0071 -0.0098 33  PHE A CA  
258  C C   . PHE A 33  ? 0.3206 0.3496 0.3560 -0.0078 -0.0069 -0.0082 33  PHE A C   
259  O O   . PHE A 33  ? 0.2984 0.3310 0.3383 -0.0096 -0.0085 -0.0070 33  PHE A O   
260  C CB  . PHE A 33  ? 0.2572 0.2800 0.3017 -0.0088 -0.0100 -0.0057 33  PHE A CB  
261  C CG  . PHE A 33  ? 0.3292 0.3524 0.3644 -0.0061 -0.0100 -0.0024 33  PHE A CG  
262  C CD1 . PHE A 33  ? 0.3686 0.3871 0.3991 -0.0042 -0.0096 -0.0031 33  PHE A CD1 
263  C CD2 . PHE A 33  ? 0.3374 0.3655 0.3686 -0.0055 -0.0103 0.0014  33  PHE A CD2 
264  C CE1 . PHE A 33  ? 0.3138 0.3318 0.3350 -0.0016 -0.0097 -0.0005 33  PHE A CE1 
265  C CE2 . PHE A 33  ? 0.2778 0.3058 0.2999 -0.0028 -0.0096 0.0040  33  PHE A CE2 
266  C CZ  . PHE A 33  ? 0.2563 0.2788 0.2728 -0.0007 -0.0095 0.0028  33  PHE A CZ  
267  N N   . VAL A 34  ? 0.2795 0.3092 0.3060 -0.0052 -0.0053 -0.0081 34  VAL A N   
268  C CA  . VAL A 34  ? 0.3103 0.3452 0.3324 -0.0044 -0.0053 -0.0067 34  VAL A CA  
269  C C   . VAL A 34  ? 0.3180 0.3514 0.3320 -0.0028 -0.0036 -0.0091 34  VAL A C   
270  O O   . VAL A 34  ? 0.2824 0.3111 0.2931 -0.0019 -0.0021 -0.0112 34  VAL A O   
271  C CB  . VAL A 34  ? 0.2506 0.2901 0.2705 -0.0025 -0.0057 -0.0018 34  VAL A CB  
272  C CG1 . VAL A 34  ? 0.2594 0.3021 0.2869 -0.0047 -0.0075 0.0013  34  VAL A CG1 
273  C CG2 . VAL A 34  ? 0.1852 0.2211 0.1994 0.0001  -0.0049 -0.0009 34  VAL A CG2 
274  N N   . ARG A 35  ? 0.3888 0.4259 0.4001 -0.0027 -0.0043 -0.0084 35  ARG A N   
275  C CA  . ARG A 35  ? 0.4058 0.4412 0.4095 -0.0018 -0.0035 -0.0104 35  ARG A CA  
276  C C   . ARG A 35  ? 0.3628 0.4033 0.3648 -0.0012 -0.0052 -0.0081 35  ARG A C   
277  O O   . ARG A 35  ? 0.3152 0.3598 0.3230 -0.0028 -0.0071 -0.0063 35  ARG A O   
278  C CB  . ARG A 35  ? 0.4368 0.4670 0.4395 -0.0043 -0.0026 -0.0151 35  ARG A CB  
279  C CG  . ARG A 35  ? 0.4528 0.4819 0.4482 -0.0049 -0.0033 -0.0166 35  ARG A CG  
280  C CD  . ARG A 35  ? 0.4605 0.4909 0.4590 -0.0077 -0.0060 -0.0170 35  ARG A CD  
281  N NE  . ARG A 35  ? 0.5610 0.5857 0.5522 -0.0097 -0.0058 -0.0209 35  ARG A NE  
282  C CZ  . ARG A 35  ? 0.5877 0.6119 0.5719 -0.0100 -0.0081 -0.0205 35  ARG A CZ  
283  N NH1 . ARG A 35  ? 0.5649 0.5825 0.5408 -0.0122 -0.0079 -0.0242 35  ARG A NH1 
284  N NH2 . ARG A 35  ? 0.6882 0.7182 0.6735 -0.0082 -0.0105 -0.0164 35  ARG A NH2 
285  N N   . PHE A 36  ? 0.3179 0.3582 0.3131 0.0011  -0.0047 -0.0079 36  PHE A N   
286  C CA  . PHE A 36  ? 0.2545 0.2990 0.2488 0.0017  -0.0067 -0.0059 36  PHE A CA  
287  C C   . PHE A 36  ? 0.3099 0.3503 0.2957 0.0020  -0.0070 -0.0080 36  PHE A C   
288  O O   . PHE A 36  ? 0.2663 0.3029 0.2467 0.0036  -0.0051 -0.0093 36  PHE A O   
289  C CB  . PHE A 36  ? 0.1758 0.2262 0.1723 0.0049  -0.0060 -0.0017 36  PHE A CB  
290  C CG  . PHE A 36  ? 0.2726 0.3278 0.2702 0.0059  -0.0078 0.0006  36  PHE A CG  
291  C CD1 . PHE A 36  ? 0.2846 0.3455 0.2904 0.0044  -0.0097 0.0033  36  PHE A CD1 
292  C CD2 . PHE A 36  ? 0.2753 0.3293 0.2671 0.0081  -0.0081 0.0004  36  PHE A CD2 
293  C CE1 . PHE A 36  ? 0.3544 0.4199 0.3631 0.0052  -0.0118 0.0058  36  PHE A CE1 
294  C CE2 . PHE A 36  ? 0.3091 0.3674 0.3034 0.0090  -0.0103 0.0027  36  PHE A CE2 
295  C CZ  . PHE A 36  ? 0.4358 0.4999 0.4389 0.0075  -0.0121 0.0055  36  PHE A CZ  
296  N N   . ASP A 37  ? 0.3281 0.3691 0.3128 0.0003  -0.0099 -0.0080 37  ASP A N   
297  C CA  . ASP A 37  ? 0.3184 0.3551 0.2944 0.0000  -0.0111 -0.0095 37  ASP A CA  
298  C C   . ASP A 37  ? 0.2916 0.3327 0.2696 0.0003  -0.0150 -0.0065 37  ASP A C   
299  O O   . ASP A 37  ? 0.4035 0.4471 0.3869 -0.0019 -0.0178 -0.0054 37  ASP A O   
300  C CB  . ASP A 37  ? 0.3558 0.3854 0.3263 -0.0035 -0.0109 -0.0137 37  ASP A CB  
301  C CG  . ASP A 37  ? 0.4736 0.4975 0.4332 -0.0041 -0.0113 -0.0153 37  ASP A CG  
302  O OD1 . ASP A 37  ? 0.5093 0.5352 0.4666 -0.0025 -0.0138 -0.0129 37  ASP A OD1 
303  O OD2 . ASP A 37  ? 0.5199 0.5371 0.4733 -0.0061 -0.0091 -0.0190 37  ASP A OD2 
304  N N   . SER A 38  ? 0.2668 0.3085 0.2412 0.0028  -0.0155 -0.0050 38  SER A N   
305  C CA  . SER A 38  ? 0.3674 0.4136 0.3455 0.0036  -0.0193 -0.0017 38  SER A CA  
306  C C   . SER A 38  ? 0.4588 0.5011 0.4333 -0.0002 -0.0242 -0.0026 38  SER A C   
307  O O   . SER A 38  ? 0.4692 0.5153 0.4492 -0.0007 -0.0284 0.0003  38  SER A O   
308  C CB  . SER A 38  ? 0.3403 0.3869 0.3152 0.0073  -0.0189 -0.0004 38  SER A CB  
309  O OG  . SER A 38  ? 0.4076 0.4468 0.3719 0.0062  -0.0193 -0.0030 38  SER A OG  
310  N N   . ASP A 39  ? 0.5259 0.5603 0.4911 -0.0030 -0.0236 -0.0066 39  ASP A N   
311  C CA  . ASP A 39  ? 0.5357 0.5641 0.4941 -0.0069 -0.0281 -0.0080 39  ASP A CA  
312  C C   . ASP A 39  ? 0.5349 0.5621 0.4966 -0.0102 -0.0293 -0.0097 39  ASP A C   
313  O O   . ASP A 39  ? 0.5978 0.6205 0.5552 -0.0135 -0.0339 -0.0105 39  ASP A O   
314  C CB  . ASP A 39  ? 0.4786 0.4981 0.4232 -0.0081 -0.0265 -0.0113 39  ASP A CB  
315  C CG  . ASP A 39  ? 0.5812 0.6006 0.5217 -0.0057 -0.0274 -0.0093 39  ASP A CG  
316  O OD1 . ASP A 39  ? 0.6552 0.6815 0.6036 -0.0020 -0.0268 -0.0063 39  ASP A OD1 
317  O OD2 . ASP A 39  ? 0.5889 0.6011 0.5180 -0.0076 -0.0287 -0.0107 39  ASP A OD2 
318  N N   . ALA A 40  ? 0.5135 0.5439 0.4823 -0.0094 -0.0256 -0.0102 40  ALA A N   
319  C CA  . ALA A 40  ? 0.5059 0.5354 0.4791 -0.0123 -0.0267 -0.0118 40  ALA A CA  
320  C C   . ALA A 40  ? 0.4103 0.4454 0.3925 -0.0134 -0.0322 -0.0079 40  ALA A C   
321  O O   . ALA A 40  ? 0.4049 0.4471 0.3939 -0.0110 -0.0333 -0.0036 40  ALA A O   
322  C CB  . ALA A 40  ? 0.4782 0.5104 0.4583 -0.0112 -0.0220 -0.0125 40  ALA A CB  
323  N N   . ALA A 41  ? 0.3815 0.4131 0.3643 -0.0169 -0.0357 -0.0095 41  ALA A N   
324  C CA  . ALA A 41  ? 0.3951 0.4312 0.3872 -0.0185 -0.0417 -0.0058 41  ALA A CA  
325  C C   . ALA A 41  ? 0.5139 0.5600 0.5208 -0.0168 -0.0398 -0.0018 41  ALA A C   
326  O O   . ALA A 41  ? 0.5994 0.6525 0.6166 -0.0165 -0.0430 0.0030  41  ALA A O   
327  C CB  . ALA A 41  ? 0.2531 0.2816 0.2410 -0.0229 -0.0460 -0.0090 41  ALA A CB  
328  N N   . SER A 42  ? 0.4603 0.5067 0.4684 -0.0158 -0.0345 -0.0036 42  SER A N   
329  C CA  . SER A 42  ? 0.3900 0.4442 0.4101 -0.0147 -0.0326 -0.0001 42  SER A CA  
330  C C   . SER A 42  ? 0.4052 0.4680 0.4312 -0.0111 -0.0307 0.0049  42  SER A C   
331  O O   . SER A 42  ? 0.4251 0.4954 0.4623 -0.0111 -0.0318 0.0095  42  SER A O   
332  C CB  . SER A 42  ? 0.4215 0.4729 0.4400 -0.0143 -0.0277 -0.0032 42  SER A CB  
333  O OG  . SER A 42  ? 0.5096 0.5677 0.5381 -0.0133 -0.0259 0.0004  42  SER A OG  
334  N N   . GLN A 43  ? 0.4056 0.4672 0.4243 -0.0081 -0.0277 0.0041  43  GLN A N   
335  C CA  . GLN A 43  ? 0.3737 0.4423 0.3967 -0.0041 -0.0250 0.0080  43  GLN A CA  
336  C C   . GLN A 43  ? 0.3485 0.4223 0.3785 -0.0029 -0.0211 0.0104  43  GLN A C   
337  O O   . GLN A 43  ? 0.3332 0.4142 0.3700 -0.0006 -0.0194 0.0147  43  GLN A O   
338  C CB  . GLN A 43  ? 0.3185 0.3925 0.3486 -0.0039 -0.0291 0.0120  43  GLN A CB  
339  C CG  . GLN A 43  ? 0.2622 0.3308 0.2844 -0.0047 -0.0332 0.0104  43  GLN A CG  
340  C CD  . GLN A 43  ? 0.2507 0.3157 0.2629 -0.0017 -0.0299 0.0083  43  GLN A CD  
341  O OE1 . GLN A 43  ? 0.3305 0.4002 0.3455 0.0022  -0.0269 0.0105  43  GLN A OE1 
342  N NE2 . GLN A 43  ? 0.1852 0.2414 0.1856 -0.0034 -0.0301 0.0038  43  GLN A NE2 
343  N N   . ARG A 44  ? 0.4319 0.5017 0.4602 -0.0046 -0.0197 0.0077  44  ARG A N   
344  C CA  . ARG A 44  ? 0.3887 0.4617 0.4221 -0.0040 -0.0167 0.0098  44  ARG A CA  
345  C C   . ARG A 44  ? 0.4632 0.5301 0.4894 -0.0032 -0.0136 0.0063  44  ARG A C   
346  O O   . ARG A 44  ? 0.4947 0.5550 0.5143 -0.0042 -0.0139 0.0020  44  ARG A O   
347  C CB  . ARG A 44  ? 0.3109 0.3854 0.3530 -0.0077 -0.0195 0.0108  44  ARG A CB  
348  C CG  . ARG A 44  ? 0.3740 0.4547 0.4253 -0.0090 -0.0231 0.0149  44  ARG A CG  
349  C CD  . ARG A 44  ? 0.4852 0.5747 0.5450 -0.0070 -0.0202 0.0207  44  ARG A CD  
350  N NE  . ARG A 44  ? 0.6078 0.6980 0.6714 -0.0084 -0.0185 0.0220  44  ARG A NE  
351  C CZ  . ARG A 44  ? 0.6413 0.7375 0.7101 -0.0072 -0.0153 0.0267  44  ARG A CZ  
352  N NH1 . ARG A 44  ? 0.6801 0.7826 0.7516 -0.0042 -0.0126 0.0304  44  ARG A NH1 
353  N NH2 . ARG A 44  ? 0.6144 0.7100 0.6856 -0.0089 -0.0145 0.0279  44  ARG A NH2 
354  N N   . MET A 45  ? 0.4403 0.5092 0.4678 -0.0015 -0.0106 0.0085  45  MET A N   
355  C CA  . MET A 45  ? 0.4123 0.4754 0.4357 -0.0014 -0.0088 0.0059  45  MET A CA  
356  C C   . MET A 45  ? 0.4212 0.4816 0.4498 -0.0052 -0.0109 0.0039  45  MET A C   
357  O O   . MET A 45  ? 0.5327 0.5969 0.5692 -0.0071 -0.0124 0.0066  45  MET A O   
358  C CB  . MET A 45  ? 0.4168 0.4820 0.4403 0.0007  -0.0062 0.0092  45  MET A CB  
359  C CG  . MET A 45  ? 0.4332 0.4920 0.4520 0.0012  -0.0049 0.0071  45  MET A CG  
360  S SD  . MET A 45  ? 0.6373 0.6903 0.6461 0.0039  -0.0037 0.0034  45  MET A SD  
361  C CE  . MET A 45  ? 0.5826 0.6316 0.5869 0.0061  -0.0021 0.0046  45  MET A CE  
362  N N   . GLU A 46  ? 0.3431 0.3967 0.3676 -0.0063 -0.0108 -0.0009 46  GLU A N   
363  C CA  . GLU A 46  ? 0.3308 0.3811 0.3601 -0.0097 -0.0124 -0.0036 46  GLU A CA  
364  C C   . GLU A 46  ? 0.3411 0.3872 0.3726 -0.0100 -0.0109 -0.0053 46  GLU A C   
365  O O   . GLU A 46  ? 0.3693 0.4123 0.3960 -0.0080 -0.0086 -0.0063 46  GLU A O   
366  C CB  . GLU A 46  ? 0.4769 0.5220 0.5004 -0.0111 -0.0132 -0.0082 46  GLU A CB  
367  C CG  . GLU A 46  ? 0.6241 0.6720 0.6445 -0.0109 -0.0156 -0.0067 46  GLU A CG  
368  C CD  . GLU A 46  ? 0.7039 0.7452 0.7160 -0.0124 -0.0165 -0.0111 46  GLU A CD  
369  O OE1 . GLU A 46  ? 0.6576 0.6933 0.6692 -0.0148 -0.0164 -0.0151 46  GLU A OE1 
370  O OE2 . GLU A 46  ? 0.7666 0.8077 0.7721 -0.0113 -0.0173 -0.0106 46  GLU A OE2 
371  N N   . PRO A 47  ? 0.4007 0.4462 0.4403 -0.0127 -0.0127 -0.0055 47  PRO A N   
372  C CA  . PRO A 47  ? 0.3288 0.3701 0.3724 -0.0133 -0.0119 -0.0069 47  PRO A CA  
373  C C   . PRO A 47  ? 0.4331 0.4677 0.4753 -0.0141 -0.0103 -0.0127 47  PRO A C   
374  O O   . PRO A 47  ? 0.4923 0.5249 0.5323 -0.0155 -0.0106 -0.0159 47  PRO A O   
375  C CB  . PRO A 47  ? 0.2961 0.3398 0.3498 -0.0160 -0.0149 -0.0045 47  PRO A CB  
376  C CG  . PRO A 47  ? 0.2942 0.3409 0.3490 -0.0175 -0.0172 -0.0043 47  PRO A CG  
377  C CD  . PRO A 47  ? 0.3517 0.3994 0.3974 -0.0155 -0.0159 -0.0049 47  PRO A CD  
378  N N   . ARG A 48  ? 0.4546 0.4853 0.4978 -0.0133 -0.0084 -0.0141 48  ARG A N   
379  C CA  . ARG A 48  ? 0.4333 0.4578 0.4765 -0.0138 -0.0058 -0.0194 48  ARG A CA  
380  C C   . ARG A 48  ? 0.4016 0.4230 0.4551 -0.0148 -0.0061 -0.0200 48  ARG A C   
381  O O   . ARG A 48  ? 0.4662 0.4828 0.5216 -0.0147 -0.0033 -0.0236 48  ARG A O   
382  C CB  . ARG A 48  ? 0.4270 0.4492 0.4612 -0.0115 -0.0027 -0.0206 48  ARG A CB  
383  C CG  . ARG A 48  ? 0.4827 0.5056 0.5072 -0.0111 -0.0023 -0.0217 48  ARG A CG  
384  C CD  . ARG A 48  ? 0.5180 0.5363 0.5409 -0.0134 -0.0012 -0.0266 48  ARG A CD  
385  N NE  . ARG A 48  ? 0.5866 0.6040 0.5987 -0.0133 -0.0012 -0.0276 48  ARG A NE  
386  C CZ  . ARG A 48  ? 0.6692 0.6896 0.6794 -0.0143 -0.0048 -0.0260 48  ARG A CZ  
387  N NH1 . ARG A 48  ? 0.6894 0.7141 0.7078 -0.0154 -0.0080 -0.0233 48  ARG A NH1 
388  N NH2 . ARG A 48  ? 0.6769 0.6955 0.6772 -0.0144 -0.0054 -0.0268 48  ARG A NH2 
389  N N   . ALA A 49  ? 0.4345 0.4586 0.4951 -0.0159 -0.0094 -0.0163 49  ALA A N   
390  C CA  . ALA A 49  ? 0.4230 0.4443 0.4945 -0.0173 -0.0109 -0.0163 49  ALA A CA  
391  C C   . ALA A 49  ? 0.5018 0.5262 0.5807 -0.0196 -0.0149 -0.0130 49  ALA A C   
392  O O   . ALA A 49  ? 0.4979 0.5275 0.5733 -0.0195 -0.0164 -0.0091 49  ALA A O   
393  C CB  . ALA A 49  ? 0.3086 0.3282 0.3792 -0.0157 -0.0111 -0.0136 49  ALA A CB  
394  N N   . PRO A 50  ? 0.6272 0.6475 0.7155 -0.0204 -0.0161 -0.0143 50  PRO A N   
395  C CA  . PRO A 50  ? 0.5872 0.6087 0.6821 -0.0220 -0.0199 -0.0114 50  PRO A CA  
396  C C   . PRO A 50  ? 0.5219 0.5463 0.6157 -0.0221 -0.0227 -0.0045 50  PRO A C   
397  O O   . PRO A 50  ? 0.4907 0.5192 0.5854 -0.0235 -0.0248 -0.0010 50  PRO A O   
398  C CB  . PRO A 50  ? 0.6249 0.6409 0.7308 -0.0222 -0.0204 -0.0142 50  PRO A CB  
399  C CG  . PRO A 50  ? 0.6591 0.6717 0.7647 -0.0204 -0.0177 -0.0160 50  PRO A CG  
400  C CD  . PRO A 50  ? 0.6826 0.6972 0.7772 -0.0197 -0.0142 -0.0180 50  PRO A CD  
401  N N   . TRP A 51  ? 0.4482 0.4703 0.5403 -0.0210 -0.0228 -0.0024 51  TRP A N   
402  C CA  . TRP A 51  ? 0.4319 0.4556 0.5227 -0.0219 -0.0256 0.0038  51  TRP A CA  
403  C C   . TRP A 51  ? 0.4738 0.5048 0.5565 -0.0216 -0.0244 0.0071  51  TRP A C   
404  O O   . TRP A 51  ? 0.5417 0.5765 0.6248 -0.0231 -0.0263 0.0123  51  TRP A O   
405  C CB  . TRP A 51  ? 0.4829 0.5013 0.5742 -0.0212 -0.0270 0.0049  51  TRP A CB  
406  C CG  . TRP A 51  ? 0.4829 0.4991 0.5697 -0.0190 -0.0238 0.0010  51  TRP A CG  
407  C CD1 . TRP A 51  ? 0.4916 0.5038 0.5835 -0.0179 -0.0217 -0.0039 51  TRP A CD1 
408  C CD2 . TRP A 51  ? 0.4148 0.4329 0.4919 -0.0177 -0.0223 0.0019  51  TRP A CD2 
409  N NE1 . TRP A 51  ? 0.4834 0.4946 0.5692 -0.0163 -0.0190 -0.0058 51  TRP A NE1 
410  C CE2 . TRP A 51  ? 0.3934 0.4080 0.4700 -0.0161 -0.0197 -0.0024 51  TRP A CE2 
411  C CE3 . TRP A 51  ? 0.3486 0.3694 0.4155 -0.0165 -0.0222 0.0061  51  TRP A CE3 
412  C CZ2 . TRP A 51  ? 0.2273 0.2409 0.2939 -0.0135 -0.0177 -0.0024 51  TRP A CZ2 
413  C CZ3 . TRP A 51  ? 0.3634 0.3829 0.4199 -0.0134 -0.0200 0.0056  51  TRP A CZ3 
414  C CH2 . TRP A 51  ? 0.2613 0.2772 0.3179 -0.0120 -0.0181 0.0015  51  TRP A CH2 
415  N N   . ILE A 52  ? 0.4475 0.4810 0.5234 -0.0197 -0.0212 0.0043  52  ILE A N   
416  C CA  . ILE A 52  ? 0.4753 0.5139 0.5422 -0.0177 -0.0193 0.0075  52  ILE A CA  
417  C C   . ILE A 52  ? 0.5488 0.5936 0.6194 -0.0192 -0.0201 0.0092  52  ILE A C   
418  O O   . ILE A 52  ? 0.5964 0.6466 0.6635 -0.0182 -0.0191 0.0132  52  ILE A O   
419  C CB  . ILE A 52  ? 0.3992 0.4370 0.4567 -0.0145 -0.0159 0.0044  52  ILE A CB  
420  C CG1 . ILE A 52  ? 0.3821 0.4236 0.4305 -0.0119 -0.0141 0.0081  52  ILE A CG1 
421  C CG2 . ILE A 52  ? 0.3267 0.3653 0.3846 -0.0148 -0.0148 0.0001  52  ILE A CG2 
422  C CD1 . ILE A 52  ? 0.3524 0.3914 0.3970 -0.0113 -0.0148 0.0119  52  ILE A CD1 
423  N N   . GLU A 53  ? 0.5103 0.5540 0.5885 -0.0215 -0.0219 0.0062  53  GLU A N   
424  C CA  . GLU A 53  ? 0.5284 0.5765 0.6104 -0.0230 -0.0235 0.0075  53  GLU A CA  
425  C C   . GLU A 53  ? 0.5582 0.6098 0.6459 -0.0249 -0.0258 0.0138  53  GLU A C   
426  O O   . GLU A 53  ? 0.5745 0.6313 0.6658 -0.0262 -0.0271 0.0166  53  GLU A O   
427  C CB  . GLU A 53  ? 0.5882 0.6315 0.6746 -0.0244 -0.0248 0.0024  53  GLU A CB  
428  C CG  . GLU A 53  ? 0.7189 0.7603 0.7995 -0.0235 -0.0224 -0.0035 53  GLU A CG  
429  C CD  . GLU A 53  ? 0.8626 0.8988 0.9471 -0.0253 -0.0232 -0.0092 53  GLU A CD  
430  O OE1 . GLU A 53  ? 0.9142 0.9470 1.0067 -0.0264 -0.0251 -0.0093 53  GLU A OE1 
431  O OE2 . GLU A 53  ? 0.8956 0.9296 0.9735 -0.0250 -0.0217 -0.0133 53  GLU A OE2 
432  N N   . GLN A 54  ? 0.5993 0.6482 0.6880 -0.0254 -0.0267 0.0162  54  GLN A N   
433  C CA  . GLN A 54  ? 0.6179 0.6698 0.7116 -0.0279 -0.0291 0.0224  54  GLN A CA  
434  C C   . GLN A 54  ? 0.6288 0.6878 0.7168 -0.0266 -0.0264 0.0276  54  GLN A C   
435  O O   . GLN A 54  ? 0.6521 0.7162 0.7448 -0.0285 -0.0273 0.0327  54  GLN A O   
436  C CB  . GLN A 54  ? 0.6111 0.6570 0.7059 -0.0289 -0.0313 0.0238  54  GLN A CB  
437  C CG  . GLN A 54  ? 0.6636 0.7009 0.7642 -0.0289 -0.0333 0.0193  54  GLN A CG  
438  C CD  . GLN A 54  ? 0.7095 0.7409 0.8123 -0.0298 -0.0361 0.0213  54  GLN A CD  
439  O OE1 . GLN A 54  ? 0.6940 0.7273 0.7934 -0.0312 -0.0372 0.0262  54  GLN A OE1 
440  N NE2 . GLN A 54  ? 0.7268 0.7514 0.8362 -0.0291 -0.0376 0.0176  54  GLN A NE2 
441  N N   . GLU A 55  ? 0.5628 0.6212 0.6403 -0.0230 -0.0227 0.0264  55  GLU A N   
442  C CA  . GLU A 55  ? 0.5429 0.6065 0.6137 -0.0208 -0.0191 0.0306  55  GLU A CA  
443  C C   . GLU A 55  ? 0.5437 0.6154 0.6208 -0.0216 -0.0188 0.0330  55  GLU A C   
444  O O   . GLU A 55  ? 0.5069 0.5795 0.5878 -0.0220 -0.0202 0.0296  55  GLU A O   
445  C CB  . GLU A 55  ? 0.5425 0.6041 0.6023 -0.0167 -0.0156 0.0277  55  GLU A CB  
446  C CG  . GLU A 55  ? 0.5440 0.5972 0.5985 -0.0159 -0.0164 0.0250  55  GLU A CG  
447  C CD  . GLU A 55  ? 0.6279 0.6777 0.6790 -0.0169 -0.0175 0.0294  55  GLU A CD  
448  O OE1 . GLU A 55  ? 0.6378 0.6916 0.6859 -0.0169 -0.0156 0.0344  55  GLU A OE1 
449  O OE2 . GLU A 55  ? 0.6669 0.7096 0.7183 -0.0179 -0.0203 0.0280  55  GLU A OE2 
450  N N   . GLY A 56  ? 0.5119 0.5890 0.5897 -0.0219 -0.0171 0.0392  56  GLY A N   
451  C CA  . GLY A 56  ? 0.5196 0.6050 0.6054 -0.0228 -0.0168 0.0425  56  GLY A CA  
452  C C   . GLY A 56  ? 0.5594 0.6486 0.6417 -0.0194 -0.0140 0.0408  56  GLY A C   
453  O O   . GLY A 56  ? 0.5591 0.6444 0.6322 -0.0163 -0.0120 0.0369  56  GLY A O   
454  N N   . PRO A 57  ? 0.5077 0.6044 0.5981 -0.0200 -0.0142 0.0439  57  PRO A N   
455  C CA  . PRO A 57  ? 0.4864 0.5871 0.5757 -0.0172 -0.0125 0.0428  57  PRO A CA  
456  C C   . PRO A 57  ? 0.4738 0.5766 0.5549 -0.0129 -0.0065 0.0445  57  PRO A C   
457  O O   . PRO A 57  ? 0.4883 0.5908 0.5644 -0.0099 -0.0051 0.0417  57  PRO A O   
458  C CB  . PRO A 57  ? 0.4792 0.5876 0.5816 -0.0196 -0.0147 0.0472  57  PRO A CB  
459  C CG  . PRO A 57  ? 0.4913 0.6017 0.5993 -0.0224 -0.0147 0.0525  57  PRO A CG  
460  C CD  . PRO A 57  ? 0.4280 0.5299 0.5302 -0.0237 -0.0165 0.0491  57  PRO A CD  
461  N N   . GLU A 58  ? 0.5608 0.6650 0.6398 -0.0127 -0.0030 0.0491  58  GLU A N   
462  C CA  . GLU A 58  ? 0.6288 0.7340 0.6988 -0.0086 0.0032  0.0505  58  GLU A CA  
463  C C   . GLU A 58  ? 0.5678 0.6647 0.6250 -0.0058 0.0035  0.0450  58  GLU A C   
464  O O   . GLU A 58  ? 0.5621 0.6592 0.6123 -0.0018 0.0072  0.0439  58  GLU A O   
465  C CB  . GLU A 58  ? 0.7037 0.8103 0.7717 -0.0094 0.0068  0.0562  58  GLU A CB  
466  C CG  . GLU A 58  ? 0.8439 0.9531 0.9045 -0.0051 0.0142  0.0585  58  GLU A CG  
467  C CD  . GLU A 58  ? 0.8701 0.9818 0.9298 -0.0063 0.0186  0.0650  58  GLU A CD  
468  O OE1 . GLU A 58  ? 0.8883 0.9976 0.9502 -0.0104 0.0153  0.0674  58  GLU A OE1 
469  O OE2 . GLU A 58  ? 0.7553 0.8711 0.8121 -0.0031 0.0254  0.0676  58  GLU A OE2 
470  N N   . TYR A 59  ? 0.4423 0.5321 0.4975 -0.0080 -0.0005 0.0417  59  TYR A N   
471  C CA  . TYR A 59  ? 0.4406 0.5225 0.4859 -0.0059 -0.0008 0.0367  59  TYR A CA  
472  C C   . TYR A 59  ? 0.4459 0.5280 0.4909 -0.0042 -0.0016 0.0322  59  TYR A C   
473  O O   . TYR A 59  ? 0.3602 0.4401 0.3970 -0.0007 0.0007  0.0299  59  TYR A O   
474  C CB  . TYR A 59  ? 0.3935 0.4684 0.4397 -0.0090 -0.0049 0.0347  59  TYR A CB  
475  C CG  . TYR A 59  ? 0.4102 0.4773 0.4491 -0.0074 -0.0058 0.0294  59  TYR A CG  
476  C CD1 . TYR A 59  ? 0.4701 0.5309 0.4996 -0.0060 -0.0050 0.0297  59  TYR A CD1 
477  C CD2 . TYR A 59  ? 0.3879 0.4534 0.4290 -0.0076 -0.0075 0.0245  59  TYR A CD2 
478  C CE1 . TYR A 59  ? 0.3797 0.4335 0.4039 -0.0047 -0.0061 0.0253  59  TYR A CE1 
479  C CE2 . TYR A 59  ? 0.3773 0.4361 0.4126 -0.0062 -0.0077 0.0201  59  TYR A CE2 
480  C CZ  . TYR A 59  ? 0.3477 0.4010 0.3754 -0.0048 -0.0071 0.0207  59  TYR A CZ  
481  O OH  . TYR A 59  ? 0.3036 0.3504 0.3269 -0.0036 -0.0077 0.0167  59  TYR A OH  
482  N N   . TRP A 60  ? 0.3747 0.4590 0.4283 -0.0068 -0.0051 0.0309  60  TRP A N   
483  C CA  . TRP A 60  ? 0.3767 0.4602 0.4293 -0.0059 -0.0064 0.0267  60  TRP A CA  
484  C C   . TRP A 60  ? 0.4656 0.5550 0.5177 -0.0028 -0.0038 0.0287  60  TRP A C   
485  O O   . TRP A 60  ? 0.4863 0.5734 0.5317 -0.0001 -0.0029 0.0258  60  TRP A O   
486  C CB  . TRP A 60  ? 0.3643 0.4478 0.4251 -0.0097 -0.0110 0.0251  60  TRP A CB  
487  C CG  . TRP A 60  ? 0.4286 0.5056 0.4900 -0.0122 -0.0132 0.0222  60  TRP A CG  
488  C CD1 . TRP A 60  ? 0.4519 0.5292 0.5211 -0.0155 -0.0156 0.0242  60  TRP A CD1 
489  C CD2 . TRP A 60  ? 0.3875 0.4569 0.4425 -0.0116 -0.0130 0.0170  60  TRP A CD2 
490  N NE1 . TRP A 60  ? 0.5109 0.5811 0.5796 -0.0168 -0.0171 0.0204  60  TRP A NE1 
491  C CE2 . TRP A 60  ? 0.4197 0.4853 0.4800 -0.0144 -0.0153 0.0159  60  TRP A CE2 
492  C CE3 . TRP A 60  ? 0.3193 0.3850 0.3656 -0.0089 -0.0112 0.0133  60  TRP A CE3 
493  C CZ2 . TRP A 60  ? 0.4413 0.4997 0.4993 -0.0146 -0.0155 0.0113  60  TRP A CZ2 
494  C CZ3 . TRP A 60  ? 0.3316 0.3903 0.3751 -0.0092 -0.0113 0.0090  60  TRP A CZ3 
495  C CH2 . TRP A 60  ? 0.4187 0.4739 0.4683 -0.0119 -0.0132 0.0080  60  TRP A CH2 
496  N N   . ASP A 61  ? 0.4433 0.5403 0.5033 -0.0032 -0.0026 0.0338  61  ASP A N   
497  C CA  . ASP A 61  ? 0.3863 0.4896 0.4481 0.0000  0.0003  0.0363  61  ASP A CA  
498  C C   . ASP A 61  ? 0.3208 0.4213 0.3716 0.0045  0.0051  0.0353  61  ASP A C   
499  O O   . ASP A 61  ? 0.3702 0.4715 0.4183 0.0076  0.0062  0.0339  61  ASP A O   
500  C CB  . ASP A 61  ? 0.4178 0.5297 0.4905 -0.0010 0.0021  0.0426  61  ASP A CB  
501  C CG  . ASP A 61  ? 0.5317 0.6468 0.6164 -0.0052 -0.0032 0.0440  61  ASP A CG  
502  O OD1 . ASP A 61  ? 0.5761 0.6870 0.6600 -0.0067 -0.0079 0.0397  61  ASP A OD1 
503  O OD2 . ASP A 61  ? 0.6272 0.7486 0.7219 -0.0071 -0.0027 0.0493  61  ASP A OD2 
504  N N   . GLN A 62  ? 0.3789 0.4752 0.4229 0.0046  0.0072  0.0359  62  GLN A N   
505  C CA  . GLN A 62  ? 0.4409 0.5335 0.4736 0.0086  0.0113  0.0351  62  GLN A CA  
506  C C   . GLN A 62  ? 0.3909 0.4765 0.4155 0.0102  0.0093  0.0296  62  GLN A C   
507  O O   . GLN A 62  ? 0.3827 0.4677 0.4016 0.0140  0.0115  0.0283  62  GLN A O   
508  C CB  . GLN A 62  ? 0.5666 0.6550 0.5931 0.0077  0.0129  0.0372  62  GLN A CB  
509  C CG  . GLN A 62  ? 0.7028 0.7875 0.7171 0.0119  0.0175  0.0373  62  GLN A CG  
510  C CD  . GLN A 62  ? 0.8029 0.8849 0.8117 0.0107  0.0197  0.0409  62  GLN A CD  
511  O OE1 . GLN A 62  ? 0.8105 0.8849 0.8068 0.0125  0.0208  0.0399  62  GLN A OE1 
512  N NE2 . GLN A 62  ? 0.7762 0.8638 0.7938 0.0075  0.0200  0.0454  62  GLN A NE2 
513  N N   . GLU A 63  ? 0.2749 0.3554 0.2998 0.0072  0.0052  0.0264  63  GLU A N   
514  C CA  . GLU A 63  ? 0.2375 0.3113 0.2556 0.0082  0.0037  0.0215  63  GLU A CA  
515  C C   . GLU A 63  ? 0.3749 0.4507 0.3936 0.0095  0.0028  0.0194  63  GLU A C   
516  O O   . GLU A 63  ? 0.4172 0.4893 0.4286 0.0122  0.0034  0.0169  63  GLU A O   
517  C CB  . GLU A 63  ? 0.3248 0.3931 0.3446 0.0047  0.0003  0.0188  63  GLU A CB  
518  C CG  . GLU A 63  ? 0.4114 0.4754 0.4290 0.0036  0.0002  0.0203  63  GLU A CG  
519  C CD  . GLU A 63  ? 0.5621 0.6211 0.5689 0.0069  0.0023  0.0202  63  GLU A CD  
520  O OE1 . GLU A 63  ? 0.5898 0.6419 0.5920 0.0072  0.0008  0.0170  63  GLU A OE1 
521  O OE2 . GLU A 63  ? 0.6357 0.6974 0.6385 0.0093  0.0056  0.0232  63  GLU A OE2 
522  N N   . THR A 64  ? 0.3707 0.4518 0.3981 0.0074  0.0007  0.0206  64  THR A N   
523  C CA  . THR A 64  ? 0.3551 0.4374 0.3828 0.0083  -0.0010 0.0191  64  THR A CA  
524  C C   . THR A 64  ? 0.3796 0.4664 0.4066 0.0125  0.0022  0.0214  64  THR A C   
525  O O   . THR A 64  ? 0.4160 0.5012 0.4390 0.0147  0.0017  0.0196  64  THR A O   
526  C CB  . THR A 64  ? 0.3493 0.4351 0.3860 0.0048  -0.0050 0.0198  64  THR A CB  
527  O OG1 . THR A 64  ? 0.4566 0.5506 0.5015 0.0060  -0.0044 0.0242  64  THR A OG1 
528  C CG2 . THR A 64  ? 0.2497 0.3346 0.2916 0.0009  -0.0068 0.0200  64  THR A CG2 
529  N N   . ARG A 65  ? 0.3899 0.4819 0.4210 0.0137  0.0056  0.0256  65  ARG A N   
530  C CA  . ARG A 65  ? 0.4325 0.5284 0.4630 0.0181  0.0099  0.0277  65  ARG A CA  
531  C C   . ARG A 65  ? 0.4078 0.4966 0.4258 0.0215  0.0116  0.0244  65  ARG A C   
532  O O   . ARG A 65  ? 0.3727 0.4615 0.3885 0.0246  0.0119  0.0232  65  ARG A O   
533  C CB  . ARG A 65  ? 0.4938 0.5949 0.5283 0.0185  0.0144  0.0323  65  ARG A CB  
534  C CG  . ARG A 65  ? 0.5742 0.6816 0.6122 0.0227  0.0194  0.0353  65  ARG A CG  
535  C CD  . ARG A 65  ? 0.7305 0.8430 0.7725 0.0226  0.0245  0.0402  65  ARG A CD  
536  N NE  . ARG A 65  ? 0.7800 0.8975 0.8334 0.0179  0.0218  0.0434  65  ARG A NE  
537  C CZ  . ARG A 65  ? 0.7803 0.8959 0.8326 0.0147  0.0214  0.0450  65  ARG A CZ  
538  N NH1 . ARG A 65  ? 0.7842 0.8928 0.8242 0.0154  0.0234  0.0437  65  ARG A NH1 
539  N NH2 . ARG A 65  ? 0.6683 0.7885 0.7319 0.0106  0.0184  0.0479  65  ARG A NH2 
540  N N   . ASN A 66  ? 0.3538 0.4364 0.3643 0.0208  0.0120  0.0231  66  ASN A N   
541  C CA  . ASN A 66  ? 0.4345 0.5096 0.4334 0.0237  0.0130  0.0203  66  ASN A CA  
542  C C   . ASN A 66  ? 0.4003 0.4706 0.3955 0.0237  0.0097  0.0162  66  ASN A C   
543  O O   . ASN A 66  ? 0.2820 0.3488 0.2703 0.0271  0.0105  0.0145  66  ASN A O   
544  C CB  . ASN A 66  ? 0.4618 0.5309 0.4545 0.0225  0.0132  0.0204  66  ASN A CB  
545  C CG  . ASN A 66  ? 0.4564 0.5280 0.4475 0.0238  0.0176  0.0243  66  ASN A CG  
546  O OD1 . ASN A 66  ? 0.4483 0.5245 0.4400 0.0271  0.0216  0.0260  66  ASN A OD1 
547  N ND2 . ASN A 66  ? 0.4814 0.5495 0.4703 0.0212  0.0169  0.0257  66  ASN A ND2 
548  N N   . VAL A 67  ? 0.4161 0.4858 0.4154 0.0200  0.0062  0.0146  67  VAL A N   
549  C CA  . VAL A 67  ? 0.4562 0.5208 0.4511 0.0195  0.0036  0.0108  67  VAL A CA  
550  C C   . VAL A 67  ? 0.4236 0.4912 0.4196 0.0213  0.0027  0.0109  67  VAL A C   
551  O O   . VAL A 67  ? 0.4723 0.5355 0.4625 0.0223  0.0015  0.0084  67  VAL A O   
552  C CB  . VAL A 67  ? 0.2794 0.3412 0.2770 0.0150  0.0008  0.0085  67  VAL A CB  
553  C CG1 . VAL A 67  ? 0.2323 0.2987 0.2369 0.0126  -0.0016 0.0092  67  VAL A CG1 
554  C CG2 . VAL A 67  ? 0.1342 0.1888 0.1251 0.0149  -0.0001 0.0046  67  VAL A CG2 
555  N N   . LYS A 68  ? 0.3156 0.3906 0.3197 0.0215  0.0030  0.0140  68  LYS A N   
556  C CA  . LYS A 68  ? 0.3813 0.4596 0.3882 0.0233  0.0017  0.0147  68  LYS A CA  
557  C C   . LYS A 68  ? 0.3158 0.3944 0.3191 0.0285  0.0051  0.0154  68  LYS A C   
558  O O   . LYS A 68  ? 0.2798 0.3572 0.2810 0.0307  0.0038  0.0144  68  LYS A O   
559  C CB  . LYS A 68  ? 0.3802 0.4663 0.3989 0.0216  0.0002  0.0182  68  LYS A CB  
560  C CG  . LYS A 68  ? 0.4092 0.4939 0.4307 0.0166  -0.0042 0.0170  68  LYS A CG  
561  C CD  . LYS A 68  ? 0.3538 0.4453 0.3870 0.0147  -0.0069 0.0205  68  LYS A CD  
562  C CE  . LYS A 68  ? 0.3135 0.4020 0.3477 0.0098  -0.0116 0.0188  68  LYS A CE  
563  N NZ  . LYS A 68  ? 0.2630 0.3574 0.3090 0.0074  -0.0150 0.0223  68  LYS A NZ  
564  N N   . ALA A 69  ? 0.2407 0.3204 0.2427 0.0305  0.0094  0.0169  69  ALA A N   
565  C CA  . ALA A 69  ? 0.2490 0.3272 0.2455 0.0355  0.0131  0.0169  69  ALA A CA  
566  C C   . ALA A 69  ? 0.2927 0.3621 0.2784 0.0365  0.0113  0.0131  69  ALA A C   
567  O O   . ALA A 69  ? 0.3625 0.4300 0.3446 0.0401  0.0117  0.0121  69  ALA A O   
568  C CB  . ALA A 69  ? 0.1300 0.2092 0.1246 0.0367  0.0180  0.0190  69  ALA A CB  
569  N N   . GLN A 70  ? 0.2527 0.3166 0.2342 0.0334  0.0093  0.0112  70  GLN A N   
570  C CA  . GLN A 70  ? 0.3461 0.4019 0.3190 0.0338  0.0075  0.0080  70  GLN A CA  
571  C C   . GLN A 70  ? 0.3321 0.3873 0.3050 0.0340  0.0047  0.0066  70  GLN A C   
572  O O   . GLN A 70  ? 0.3620 0.4133 0.3293 0.0370  0.0044  0.0054  70  GLN A O   
573  C CB  . GLN A 70  ? 0.3201 0.3713 0.2919 0.0298  0.0057  0.0065  70  GLN A CB  
574  C CG  . GLN A 70  ? 0.2907 0.3340 0.2569 0.0296  0.0037  0.0035  70  GLN A CG  
575  C CD  . GLN A 70  ? 0.3825 0.4200 0.3442 0.0331  0.0042  0.0031  70  GLN A CD  
576  O OE1 . GLN A 70  ? 0.4933 0.5260 0.4530 0.0346  0.0027  0.0015  70  GLN A OE1 
577  N NE2 . GLN A 70  ? 0.3236 0.3610 0.2829 0.0341  0.0061  0.0048  70  GLN A NE2 
578  N N   . SER A 71  ? 0.2615 0.3201 0.2402 0.0307  0.0023  0.0069  71  SER A N   
579  C CA  . SER A 71  ? 0.3165 0.3736 0.2941 0.0300  -0.0010 0.0057  71  SER A CA  
580  C C   . SER A 71  ? 0.2955 0.3562 0.2757 0.0337  -0.0011 0.0074  71  SER A C   
581  O O   . SER A 71  ? 0.2832 0.3407 0.2597 0.0346  -0.0035 0.0063  71  SER A O   
582  C CB  . SER A 71  ? 0.2913 0.3501 0.2732 0.0254  -0.0039 0.0057  71  SER A CB  
583  O OG  . SER A 71  ? 0.4408 0.5071 0.4321 0.0251  -0.0038 0.0087  71  SER A OG  
584  N N   . GLN A 72  ? 0.2862 0.3536 0.2735 0.0358  0.0015  0.0101  72  GLN A N   
585  C CA  . GLN A 72  ? 0.4060 0.4775 0.3981 0.0396  0.0019  0.0118  72  GLN A CA  
586  C C   . GLN A 72  ? 0.4213 0.4884 0.4063 0.0444  0.0042  0.0104  72  GLN A C   
587  O O   . GLN A 72  ? 0.5696 0.6376 0.5566 0.0475  0.0034  0.0107  72  GLN A O   
588  C CB  . GLN A 72  ? 0.5108 0.5913 0.5142 0.0404  0.0046  0.0155  72  GLN A CB  
589  C CG  . GLN A 72  ? 0.6789 0.7640 0.6913 0.0359  0.0008  0.0173  72  GLN A CG  
590  C CD  . GLN A 72  ? 0.7630 0.8454 0.7747 0.0342  -0.0052 0.0165  72  GLN A CD  
591  O OE1 . GLN A 72  ? 0.7041 0.7802 0.7081 0.0310  -0.0082 0.0138  72  GLN A OE1 
592  N NE2 . GLN A 72  ? 0.8301 0.9171 0.8502 0.0361  -0.0069 0.0188  72  GLN A NE2 
593  N N   . THR A 73  ? 0.2657 0.3275 0.2425 0.0449  0.0064  0.0088  73  THR A N   
594  C CA  . THR A 73  ? 0.2794 0.3353 0.2479 0.0491  0.0076  0.0070  73  THR A CA  
595  C C   . THR A 73  ? 0.3054 0.3540 0.2672 0.0478  0.0035  0.0045  73  THR A C   
596  O O   . THR A 73  ? 0.3232 0.3681 0.2810 0.0510  0.0026  0.0035  73  THR A O   
597  C CB  . THR A 73  ? 0.3400 0.3925 0.3021 0.0507  0.0115  0.0068  73  THR A CB  
598  O OG1 . THR A 73  ? 0.4514 0.4946 0.4034 0.0513  0.0096  0.0042  73  THR A OG1 
599  C CG2 . THR A 73  ? 0.2721 0.3272 0.2371 0.0468  0.0123  0.0081  73  THR A CG2 
600  N N   . ASP A 74  ? 0.3442 0.3908 0.3052 0.0432  0.0012  0.0036  74  ASP A N   
601  C CA  . ASP A 74  ? 0.3559 0.3961 0.3121 0.0415  -0.0019 0.0016  74  ASP A CA  
602  C C   . ASP A 74  ? 0.4189 0.4609 0.3768 0.0412  -0.0052 0.0023  74  ASP A C   
603  O O   . ASP A 74  ? 0.4354 0.4724 0.3899 0.0415  -0.0072 0.0010  74  ASP A O   
604  C CB  . ASP A 74  ? 0.3658 0.4034 0.3246 0.0367  -0.0022 0.0002  74  ASP A CB  
605  C CG  . ASP A 74  ? 0.5775 0.6116 0.5363 0.0368  -0.0005 -0.0003 74  ASP A CG  
606  O OD1 . ASP A 74  ? 0.5706 0.6012 0.5261 0.0403  0.0001  -0.0004 74  ASP A OD1 
607  O OD2 . ASP A 74  ? 0.5931 0.6276 0.5547 0.0333  -0.0003 -0.0005 74  ASP A OD2 
608  N N   . ARG A 75  ? 0.4328 0.4817 0.3987 0.0403  -0.0057 0.0043  75  ARG A N   
609  C CA  . ARG A 75  ? 0.4120 0.4627 0.3814 0.0399  -0.0094 0.0055  75  ARG A CA  
610  C C   . ARG A 75  ? 0.4420 0.4932 0.4126 0.0450  -0.0093 0.0061  75  ARG A C   
611  O O   . ARG A 75  ? 0.4373 0.4857 0.4062 0.0453  -0.0130 0.0061  75  ARG A O   
612  C CB  . ARG A 75  ? 0.5235 0.5815 0.5026 0.0377  -0.0102 0.0079  75  ARG A CB  
613  C CG  . ARG A 75  ? 0.5628 0.6232 0.5473 0.0373  -0.0149 0.0098  75  ARG A CG  
614  C CD  . ARG A 75  ? 0.6481 0.7160 0.6438 0.0356  -0.0157 0.0126  75  ARG A CD  
615  N NE  . ARG A 75  ? 0.7883 0.8585 0.7907 0.0353  -0.0208 0.0149  75  ARG A NE  
616  C CZ  . ARG A 75  ? 0.8437 0.9190 0.8553 0.0393  -0.0204 0.0172  75  ARG A CZ  
617  N NH1 . ARG A 75  ? 0.8580 0.9349 0.8765 0.0386  -0.0260 0.0195  75  ARG A NH1 
618  N NH2 . ARG A 75  ? 0.8478 0.9261 0.8617 0.0442  -0.0144 0.0172  75  ARG A NH2 
619  N N   . VAL A 76  ? 0.4128 0.4669 0.3860 0.0491  -0.0049 0.0067  76  VAL A N   
620  C CA  . VAL A 76  ? 0.4458 0.4997 0.4197 0.0546  -0.0038 0.0067  76  VAL A CA  
621  C C   . VAL A 76  ? 0.3865 0.4316 0.3498 0.0564  -0.0046 0.0041  76  VAL A C   
622  O O   . VAL A 76  ? 0.3978 0.4403 0.3602 0.0594  -0.0065 0.0037  76  VAL A O   
623  C CB  . VAL A 76  ? 0.3599 0.4193 0.3391 0.0585  0.0021  0.0079  76  VAL A CB  
624  C CG1 . VAL A 76  ? 0.2306 0.2876 0.2078 0.0646  0.0042  0.0069  76  VAL A CG1 
625  C CG2 . VAL A 76  ? 0.2979 0.3666 0.2902 0.0575  0.0023  0.0111  76  VAL A CG2 
626  N N   . ASP A 77  ? 0.3374 0.3777 0.2935 0.0543  -0.0035 0.0026  77  ASP A N   
627  C CA  . ASP A 77  ? 0.4035 0.4351 0.3503 0.0554  -0.0048 0.0004  77  ASP A CA  
628  C C   . ASP A 77  ? 0.4155 0.4431 0.3605 0.0534  -0.0093 -0.0001 77  ASP A C   
629  O O   . ASP A 77  ? 0.3531 0.3750 0.2946 0.0557  -0.0106 -0.0013 77  ASP A O   
630  C CB  . ASP A 77  ? 0.4409 0.4686 0.3849 0.0530  -0.0031 -0.0008 77  ASP A CB  
631  C CG  . ASP A 77  ? 0.5562 0.5847 0.4978 0.0557  0.0008  -0.0004 77  ASP A CG  
632  O OD1 . ASP A 77  ? 0.5249 0.5562 0.4671 0.0599  0.0035  0.0001  77  ASP A OD1 
633  O OD2 . ASP A 77  ? 0.6279 0.6538 0.5704 0.0535  0.0014  -0.0006 77  ASP A OD2 
634  N N   . LEU A 78  ? 0.4096 0.4392 0.3581 0.0487  -0.0109 0.0004  78  LEU A N   
635  C CA  . LEU A 78  ? 0.4149 0.4402 0.3622 0.0460  -0.0141 -0.0002 78  LEU A CA  
636  C C   . LEU A 78  ? 0.4438 0.4697 0.3916 0.0495  -0.0176 0.0013  78  LEU A C   
637  O O   . LEU A 78  ? 0.4532 0.4734 0.3979 0.0496  -0.0195 0.0003  78  LEU A O   
638  C CB  . LEU A 78  ? 0.3430 0.3703 0.2923 0.0407  -0.0155 0.0004  78  LEU A CB  
639  C CG  . LEU A 78  ? 0.3954 0.4200 0.3444 0.0365  -0.0130 -0.0013 78  LEU A CG  
640  C CD1 . LEU A 78  ? 0.3212 0.3495 0.2722 0.0325  -0.0141 -0.0006 78  LEU A CD1 
641  C CD2 . LEU A 78  ? 0.4019 0.4188 0.3475 0.0345  -0.0135 -0.0027 78  LEU A CD2 
642  N N   . GLY A 79  ? 0.4348 0.4679 0.3895 0.0522  -0.0178 0.0035  79  GLY A N   
643  C CA  . GLY A 79  ? 0.4063 0.4408 0.3660 0.0559  -0.0202 0.0047  79  GLY A CA  
644  C C   . GLY A 79  ? 0.3697 0.3997 0.3255 0.0611  -0.0186 0.0031  79  GLY A C   
645  O O   . GLY A 79  ? 0.3380 0.3640 0.2924 0.0629  -0.0222 0.0030  79  GLY A O   
646  N N   . THR A 80  ? 0.3793 0.4092 0.3327 0.0635  -0.0137 0.0017  80  THR A N   
647  C CA  . THR A 80  ? 0.3464 0.3710 0.2946 0.0685  -0.0120 -0.0002 80  THR A CA  
648  C C   . THR A 80  ? 0.3699 0.3854 0.3092 0.0675  -0.0156 -0.0016 80  THR A C   
649  O O   . THR A 80  ? 0.4120 0.4229 0.3493 0.0709  -0.0178 -0.0024 80  THR A O   
650  C CB  . THR A 80  ? 0.3835 0.4085 0.3287 0.0703  -0.0063 -0.0012 80  THR A CB  
651  O OG1 . THR A 80  ? 0.4233 0.4571 0.3773 0.0712  -0.0025 0.0006  80  THR A OG1 
652  C CG2 . THR A 80  ? 0.3138 0.3320 0.2519 0.0756  -0.0048 -0.0033 80  THR A CG2 
653  N N   . LEU A 81  ? 0.3292 0.3420 0.2652 0.0624  -0.0155 -0.0024 81  LEU A N   
654  C CA  . LEU A 81  ? 0.2917 0.2959 0.2239 0.0604  -0.0166 -0.0045 81  LEU A CA  
655  C C   . LEU A 81  ? 0.3407 0.3425 0.2734 0.0589  -0.0207 -0.0039 81  LEU A C   
656  O O   . LEU A 81  ? 0.3846 0.3799 0.3141 0.0601  -0.0228 -0.0049 81  LEU A O   
657  C CB  . LEU A 81  ? 0.2724 0.2748 0.2060 0.0556  -0.0146 -0.0053 81  LEU A CB  
658  C CG  . LEU A 81  ? 0.3585 0.3614 0.2920 0.0567  -0.0114 -0.0057 81  LEU A CG  
659  C CD1 . LEU A 81  ? 0.3029 0.3016 0.2382 0.0527  -0.0109 -0.0063 81  LEU A CD1 
660  C CD2 . LEU A 81  ? 0.3330 0.3317 0.2606 0.0622  -0.0113 -0.0065 81  LEU A CD2 
661  N N   . ARG A 82  ? 0.3514 0.3581 0.2881 0.0560  -0.0224 -0.0021 82  ARG A N   
662  C CA  . ARG A 82  ? 0.3348 0.3390 0.2715 0.0542  -0.0268 -0.0010 82  ARG A CA  
663  C C   . ARG A 82  ? 0.3453 0.3479 0.2825 0.0596  -0.0296 -0.0007 82  ARG A C   
664  O O   . ARG A 82  ? 0.3183 0.3150 0.2530 0.0591  -0.0328 -0.0009 82  ARG A O   
665  C CB  . ARG A 82  ? 0.4256 0.4351 0.3664 0.0510  -0.0290 0.0013  82  ARG A CB  
666  C CG  . ARG A 82  ? 0.5404 0.5459 0.4795 0.0476  -0.0338 0.0026  82  ARG A CG  
667  C CD  . ARG A 82  ? 0.6911 0.7016 0.6348 0.0460  -0.0377 0.0053  82  ARG A CD  
668  N NE  . ARG A 82  ? 0.8084 0.8257 0.7607 0.0514  -0.0388 0.0070  82  ARG A NE  
669  C CZ  . ARG A 82  ? 0.8195 0.8359 0.7749 0.0563  -0.0409 0.0074  82  ARG A CZ  
670  N NH1 . ARG A 82  ? 0.8149 0.8236 0.7645 0.0561  -0.0427 0.0063  82  ARG A NH1 
671  N NH2 . ARG A 82  ? 0.8037 0.8268 0.7692 0.0616  -0.0410 0.0090  82  ARG A NH2 
672  N N   . GLY A 83  ? 0.2932 0.3009 0.2342 0.0650  -0.0282 -0.0001 83  GLY A N   
673  C CA  . GLY A 83  ? 0.2102 0.2168 0.1535 0.0713  -0.0299 0.0000  83  GLY A CA  
674  C C   . GLY A 83  ? 0.3274 0.3257 0.2629 0.0742  -0.0292 -0.0027 83  GLY A C   
675  O O   . GLY A 83  ? 0.3834 0.3770 0.3183 0.0770  -0.0324 -0.0032 83  GLY A O   
676  N N   . TYR A 84  ? 0.2300 0.2262 0.1600 0.0734  -0.0256 -0.0043 84  TYR A N   
677  C CA  . TYR A 84  ? 0.2325 0.2198 0.1548 0.0755  -0.0257 -0.0068 84  TYR A CA  
678  C C   . TYR A 84  ? 0.3735 0.3538 0.2938 0.0718  -0.0293 -0.0076 84  TYR A C   
679  O O   . TYR A 84  ? 0.3507 0.3242 0.2674 0.0745  -0.0320 -0.0088 84  TYR A O   
680  C CB  . TYR A 84  ? 0.3372 0.3230 0.2553 0.0738  -0.0220 -0.0080 84  TYR A CB  
681  C CG  . TYR A 84  ? 0.4185 0.4082 0.3353 0.0780  -0.0182 -0.0076 84  TYR A CG  
682  C CD1 . TYR A 84  ? 0.5119 0.5044 0.4325 0.0834  -0.0158 -0.0081 84  TYR A CD1 
683  C CD2 . TYR A 84  ? 0.3810 0.3710 0.2948 0.0758  -0.0150 -0.0080 84  TYR A CD2 
684  C CE1 . TYR A 84  ? 0.5373 0.5329 0.4578 0.0863  -0.0099 -0.0089 84  TYR A CE1 
685  C CE2 . TYR A 84  ? 0.4935 0.4863 0.4065 0.0785  -0.0099 -0.0084 84  TYR A CE2 
686  C CZ  . TYR A 84  ? 0.5819 0.5775 0.4981 0.0837  -0.0070 -0.0089 84  TYR A CZ  
687  O OH  . TYR A 84  ? 0.5986 0.5968 0.5137 0.0862  -0.0010 -0.0092 84  TYR A OH  
688  N N   . TYR A 85  ? 0.4567 0.4384 0.3794 0.0658  -0.0293 -0.0066 85  TYR A N   
689  C CA  . TYR A 85  ? 0.4408 0.4161 0.3619 0.0618  -0.0318 -0.0066 85  TYR A CA  
690  C C   . TYR A 85  ? 0.4194 0.3944 0.3422 0.0610  -0.0364 -0.0048 85  TYR A C   
691  O O   . TYR A 85  ? 0.2780 0.2473 0.1989 0.0582  -0.0391 -0.0043 85  TYR A O   
692  C CB  . TYR A 85  ? 0.4258 0.4018 0.3482 0.0561  -0.0292 -0.0062 85  TYR A CB  
693  C CG  . TYR A 85  ? 0.4697 0.4434 0.3912 0.0561  -0.0261 -0.0077 85  TYR A CG  
694  C CD1 . TYR A 85  ? 0.5002 0.4661 0.4186 0.0566  -0.0274 -0.0089 85  TYR A CD1 
695  C CD2 . TYR A 85  ? 0.4071 0.3863 0.3314 0.0552  -0.0224 -0.0077 85  TYR A CD2 
696  C CE1 . TYR A 85  ? 0.4309 0.3941 0.3489 0.0563  -0.0255 -0.0099 85  TYR A CE1 
697  C CE2 . TYR A 85  ? 0.4506 0.4273 0.3748 0.0550  -0.0203 -0.0086 85  TYR A CE2 
698  C CZ  . TYR A 85  ? 0.4418 0.4104 0.3628 0.0556  -0.0220 -0.0096 85  TYR A CZ  
699  O OH  . TYR A 85  ? 0.4004 0.3659 0.3213 0.0551  -0.0208 -0.0102 85  TYR A OH  
700  N N   . ASN A 86  ? 0.4437 0.4248 0.3708 0.0633  -0.0377 -0.0033 86  ASN A N   
701  C CA  . ASN A 86  ? 0.4178 0.3987 0.3477 0.0624  -0.0428 -0.0011 86  ASN A CA  
702  C C   . ASN A 86  ? 0.3638 0.3438 0.2924 0.0556  -0.0440 0.0006  86  ASN A C   
703  O O   . ASN A 86  ? 0.4505 0.4256 0.3772 0.0532  -0.0481 0.0020  86  ASN A O   
704  C CB  . ASN A 86  ? 0.5063 0.4800 0.4342 0.0652  -0.0467 -0.0018 86  ASN A CB  
705  C CG  . ASN A 86  ? 0.7418 0.7180 0.6751 0.0712  -0.0495 -0.0012 86  ASN A CG  
706  O OD1 . ASN A 86  ? 0.9049 0.8836 0.8437 0.0704  -0.0535 0.0012  86  ASN A OD1 
707  N ND2 . ASN A 86  ? 0.6928 0.6678 0.6252 0.0773  -0.0475 -0.0033 86  ASN A ND2 
708  N N   . GLN A 87  ? 0.2933 0.2775 0.2223 0.0524  -0.0405 0.0006  87  GLN A N   
709  C CA  . GLN A 87  ? 0.4195 0.4025 0.3461 0.0461  -0.0410 0.0020  87  GLN A CA  
710  C C   . GLN A 87  ? 0.3998 0.3871 0.3292 0.0445  -0.0446 0.0045  87  GLN A C   
711  O O   . GLN A 87  ? 0.3485 0.3419 0.2839 0.0481  -0.0453 0.0051  87  GLN A O   
712  C CB  . GLN A 87  ? 0.3591 0.3435 0.2849 0.0435  -0.0357 0.0006  87  GLN A CB  
713  C CG  . GLN A 87  ? 0.4200 0.3998 0.3441 0.0448  -0.0329 -0.0013 87  GLN A CG  
714  C CD  . GLN A 87  ? 0.4491 0.4305 0.3742 0.0425  -0.0282 -0.0024 87  GLN A CD  
715  O OE1 . GLN A 87  ? 0.4460 0.4327 0.3740 0.0438  -0.0257 -0.0030 87  GLN A OE1 
716  N NE2 . GLN A 87  ? 0.4826 0.4594 0.4057 0.0391  -0.0273 -0.0023 87  GLN A NE2 
717  N N   . SER A 88  ? 0.3884 0.3723 0.3138 0.0391  -0.0472 0.0062  88  SER A N   
718  C CA  . SER A 88  ? 0.5404 0.5269 0.4674 0.0368  -0.0517 0.0088  88  SER A CA  
719  C C   . SER A 88  ? 0.6082 0.5997 0.5362 0.0344  -0.0487 0.0083  88  SER A C   
720  O O   . SER A 88  ? 0.6588 0.6502 0.5845 0.0330  -0.0435 0.0063  88  SER A O   
721  C CB  . SER A 88  ? 0.5991 0.5786 0.5192 0.0317  -0.0563 0.0110  88  SER A CB  
722  O OG  . SER A 88  ? 0.6297 0.6054 0.5425 0.0269  -0.0527 0.0102  88  SER A OG  
723  N N   . GLU A 89  ? 0.7138 0.7098 0.6463 0.0340  -0.0526 0.0104  89  GLU A N   
724  C CA  . GLU A 89  ? 0.7743 0.7747 0.7080 0.0315  -0.0511 0.0104  89  GLU A CA  
725  C C   . GLU A 89  ? 0.7921 0.7864 0.7165 0.0248  -0.0515 0.0104  89  GLU A C   
726  O O   . GLU A 89  ? 0.7693 0.7655 0.6927 0.0219  -0.0502 0.0099  89  GLU A O   
727  C CB  . GLU A 89  ? 0.7821 0.7890 0.7248 0.0330  -0.0559 0.0132  89  GLU A CB  
728  C CG  . GLU A 89  ? 0.8647 0.8805 0.8169 0.0380  -0.0521 0.0128  89  GLU A CG  
729  C CD  . GLU A 89  ? 0.9612 0.9835 0.9258 0.0420  -0.0566 0.0159  89  GLU A CD  
730  O OE1 . GLU A 89  ? 0.9362 0.9553 0.9022 0.0419  -0.0625 0.0178  89  GLU A OE1 
731  O OE2 . GLU A 89  ? 1.0476 1.0781 1.0216 0.0454  -0.0540 0.0165  89  GLU A OE2 
732  N N   . ALA A 90  ? 0.8693 0.8562 0.7865 0.0225  -0.0534 0.0109  90  ALA A N   
733  C CA  . ALA A 90  ? 0.9849 0.9651 0.8917 0.0164  -0.0535 0.0111  90  ALA A CA  
734  C C   . ALA A 90  ? 1.0015 0.9818 0.9060 0.0149  -0.0463 0.0083  90  ALA A C   
735  O O   . ALA A 90  ? 1.0364 1.0173 0.9385 0.0118  -0.0452 0.0076  90  ALA A O   
736  C CB  . ALA A 90  ? 1.0072 0.9797 0.9072 0.0147  -0.0564 0.0127  90  ALA A CB  
737  N N   . GLY A 91  ? 0.9615 0.9408 0.8672 0.0172  -0.0420 0.0068  91  GLY A N   
738  C CA  . GLY A 91  ? 0.8967 0.8756 0.8015 0.0159  -0.0357 0.0046  91  GLY A CA  
739  C C   . GLY A 91  ? 0.8213 0.8066 0.7322 0.0172  -0.0323 0.0029  91  GLY A C   
740  O O   . GLY A 91  ? 0.8180 0.8091 0.7350 0.0203  -0.0337 0.0032  91  GLY A O   
741  N N   . SER A 92  ? 0.7513 0.7357 0.6607 0.0146  -0.0278 0.0012  92  SER A N   
742  C CA  . SER A 92  ? 0.6880 0.6777 0.6030 0.0154  -0.0245 -0.0004 92  SER A CA  
743  C C   . SER A 92  ? 0.5848 0.5757 0.5052 0.0184  -0.0204 -0.0017 92  SER A C   
744  O O   . SER A 92  ? 0.5394 0.5258 0.4574 0.0176  -0.0188 -0.0020 92  SER A O   
745  C CB  . SER A 92  ? 0.6994 0.6868 0.6093 0.0104  -0.0228 -0.0014 92  SER A CB  
746  O OG  . SER A 92  ? 0.7519 0.7439 0.6676 0.0109  -0.0196 -0.0030 92  SER A OG  
747  N N   . HIS A 93  ? 0.4683 0.4648 0.3954 0.0216  -0.0191 -0.0023 93  HIS A N   
748  C CA  . HIS A 93  ? 0.3228 0.3196 0.2541 0.0245  -0.0162 -0.0033 93  HIS A CA  
749  C C   . HIS A 93  ? 0.2652 0.2660 0.2013 0.0242  -0.0132 -0.0043 93  HIS A C   
750  O O   . HIS A 93  ? 0.3556 0.3601 0.2927 0.0225  -0.0134 -0.0043 93  HIS A O   
751  C CB  . HIS A 93  ? 0.3217 0.3197 0.2549 0.0297  -0.0176 -0.0029 93  HIS A CB  
752  C CG  . HIS A 93  ? 0.4342 0.4274 0.3633 0.0303  -0.0208 -0.0021 93  HIS A CG  
753  N ND1 . HIS A 93  ? 0.3220 0.3158 0.2490 0.0298  -0.0247 -0.0006 93  HIS A ND1 
754  C CD2 . HIS A 93  ? 0.4444 0.4321 0.3713 0.0310  -0.0211 -0.0022 93  HIS A CD2 
755  C CE1 . HIS A 93  ? 0.3792 0.3679 0.3029 0.0303  -0.0273 0.0001  93  HIS A CE1 
756  N NE2 . HIS A 93  ? 0.4279 0.4129 0.3513 0.0310  -0.0250 -0.0009 93  HIS A NE2 
757  N N   . THR A 94  ? 0.1934 0.1926 0.1322 0.0256  -0.0111 -0.0049 94  THR A N   
758  C CA  . THR A 94  ? 0.2991 0.3009 0.2423 0.0248  -0.0088 -0.0056 94  THR A CA  
759  C C   . THR A 94  ? 0.3390 0.3416 0.2854 0.0287  -0.0083 -0.0056 94  THR A C   
760  O O   . THR A 94  ? 0.2919 0.2902 0.2369 0.0309  -0.0089 -0.0056 94  THR A O   
761  C CB  . THR A 94  ? 0.2884 0.2862 0.2309 0.0213  -0.0069 -0.0063 94  THR A CB  
762  O OG1 . THR A 94  ? 0.3387 0.3350 0.2766 0.0174  -0.0067 -0.0067 94  THR A OG1 
763  C CG2 . THR A 94  ? 0.1837 0.1839 0.1312 0.0206  -0.0050 -0.0070 94  THR A CG2 
764  N N   . ILE A 95  ? 0.3475 0.3551 0.2972 0.0295  -0.0073 -0.0055 95  ILE A N   
765  C CA  . ILE A 95  ? 0.2918 0.2993 0.2433 0.0323  -0.0065 -0.0054 95  ILE A CA  
766  C C   . ILE A 95  ? 0.2708 0.2789 0.2256 0.0294  -0.0051 -0.0057 95  ILE A C   
767  O O   . ILE A 95  ? 0.2587 0.2705 0.2153 0.0266  -0.0045 -0.0058 95  ILE A O   
768  C CB  . ILE A 95  ? 0.2592 0.2716 0.2107 0.0359  -0.0062 -0.0047 95  ILE A CB  
769  C CG1 . ILE A 95  ? 0.3883 0.3992 0.3362 0.0394  -0.0077 -0.0047 95  ILE A CG1 
770  C CG2 . ILE A 95  ? 0.2376 0.2496 0.1897 0.0378  -0.0051 -0.0045 95  ILE A CG2 
771  C CD1 . ILE A 95  ? 0.3668 0.3824 0.3139 0.0435  -0.0071 -0.0039 95  ILE A CD1 
772  N N   . GLN A 96  ? 0.2462 0.2502 0.2013 0.0300  -0.0051 -0.0058 96  GLN A N   
773  C CA  . GLN A 96  ? 0.2197 0.2237 0.1778 0.0274  -0.0042 -0.0060 96  GLN A CA  
774  C C   . GLN A 96  ? 0.2346 0.2370 0.1922 0.0298  -0.0045 -0.0055 96  GLN A C   
775  O O   . GLN A 96  ? 0.3018 0.2993 0.2562 0.0324  -0.0056 -0.0055 96  GLN A O   
776  C CB  . GLN A 96  ? 0.1773 0.1766 0.1355 0.0246  -0.0041 -0.0066 96  GLN A CB  
777  C CG  . GLN A 96  ? 0.2157 0.2152 0.1725 0.0219  -0.0033 -0.0073 96  GLN A CG  
778  C CD  . GLN A 96  ? 0.2751 0.2696 0.2308 0.0198  -0.0025 -0.0078 96  GLN A CD  
779  O OE1 . GLN A 96  ? 0.2621 0.2533 0.2144 0.0203  -0.0030 -0.0075 96  GLN A OE1 
780  N NE2 . GLN A 96  ? 0.2557 0.2495 0.2143 0.0173  -0.0009 -0.0088 96  GLN A NE2 
781  N N   . ILE A 97  ? 0.2295 0.2355 0.1894 0.0286  -0.0037 -0.0051 97  ILE A N   
782  C CA  . ILE A 97  ? 0.2285 0.2325 0.1866 0.0303  -0.0038 -0.0045 97  ILE A CA  
783  C C   . ILE A 97  ? 0.2712 0.2742 0.2318 0.0270  -0.0039 -0.0046 97  ILE A C   
784  O O   . ILE A 97  ? 0.2853 0.2922 0.2495 0.0241  -0.0031 -0.0050 97  ILE A O   
785  C CB  . ILE A 97  ? 0.2870 0.2963 0.2438 0.0327  -0.0026 -0.0033 97  ILE A CB  
786  C CG1 . ILE A 97  ? 0.2521 0.2628 0.2065 0.0361  -0.0026 -0.0033 97  ILE A CG1 
787  C CG2 . ILE A 97  ? 0.2866 0.2927 0.2396 0.0342  -0.0025 -0.0026 97  ILE A CG2 
788  C CD1 . ILE A 97  ? 0.3228 0.3384 0.2752 0.0391  -0.0011 -0.0020 97  ILE A CD1 
789  N N   . MET A 98  ? 0.2571 0.2540 0.2152 0.0275  -0.0053 -0.0045 98  MET A N   
790  C CA  . MET A 98  ? 0.2467 0.2421 0.2064 0.0247  -0.0061 -0.0044 98  MET A CA  
791  C C   . MET A 98  ? 0.2289 0.2208 0.1838 0.0263  -0.0073 -0.0032 98  MET A C   
792  O O   . MET A 98  ? 0.1956 0.1821 0.1451 0.0290  -0.0083 -0.0033 98  MET A O   
793  C CB  . MET A 98  ? 0.2723 0.2624 0.2337 0.0226  -0.0079 -0.0054 98  MET A CB  
794  C CG  . MET A 98  ? 0.3496 0.3382 0.3147 0.0196  -0.0097 -0.0052 98  MET A CG  
795  S SD  . MET A 98  ? 0.7405 0.7194 0.7060 0.0196  -0.0146 -0.0039 98  MET A SD  
796  C CE  . MET A 98  ? 0.5145 0.4897 0.4689 0.0232  -0.0152 -0.0031 98  MET A CE  
797  N N   . TYR A 99  ? 0.2499 0.2445 0.2058 0.0244  -0.0071 -0.0019 99  TYR A N   
798  C CA  . TYR A 99  ? 0.2746 0.2644 0.2253 0.0249  -0.0088 -0.0003 99  TYR A CA  
799  C C   . TYR A 99  ? 0.2180 0.2080 0.1726 0.0211  -0.0109 0.0012  99  TYR A C   
800  O O   . TYR A 99  ? 0.2018 0.1973 0.1632 0.0187  -0.0101 0.0009  99  TYR A O   
801  C CB  . TYR A 99  ? 0.2513 0.2443 0.1967 0.0280  -0.0061 0.0008  99  TYR A CB  
802  C CG  . TYR A 99  ? 0.2397 0.2419 0.1887 0.0269  -0.0035 0.0023  99  TYR A CG  
803  C CD1 . TYR A 99  ? 0.2370 0.2405 0.1865 0.0243  -0.0040 0.0045  99  TYR A CD1 
804  C CD2 . TYR A 99  ? 0.2732 0.2827 0.2251 0.0285  -0.0010 0.0020  99  TYR A CD2 
805  C CE1 . TYR A 99  ? 0.2951 0.3069 0.2479 0.0232  -0.0017 0.0063  99  TYR A CE1 
806  C CE2 . TYR A 99  ? 0.2355 0.2532 0.1907 0.0274  0.0010  0.0036  99  TYR A CE2 
807  C CZ  . TYR A 99  ? 0.2790 0.2980 0.2346 0.0247  0.0009  0.0058  99  TYR A CZ  
808  O OH  . TYR A 99  ? 0.3214 0.3484 0.2809 0.0234  0.0028  0.0078  99  TYR A OH  
809  N N   . GLY A 100 ? 0.2279 0.2110 0.1786 0.0205  -0.0141 0.0028  100 GLY A N   
810  C CA  . GLY A 100 ? 0.2704 0.2525 0.2267 0.0171  -0.0172 0.0048  100 GLY A CA  
811  C C   . GLY A 100 ? 0.2953 0.2676 0.2467 0.0164  -0.0221 0.0066  100 GLY A C   
812  O O   . GLY A 100 ? 0.3695 0.3355 0.3113 0.0187  -0.0224 0.0061  100 GLY A O   
813  N N   . CYS A 101 ? 0.2289 0.1989 0.1885 0.0129  -0.0254 0.0080  101 CYS A N   
814  C CA  . CYS A 101 ? 0.3015 0.2618 0.2566 0.0116  -0.0311 0.0105  101 CYS A CA  
815  C C   . CYS A 101 ? 0.3454 0.3029 0.3144 0.0078  -0.0354 0.0110  101 CYS A C   
816  O O   . CYS A 101 ? 0.3067 0.2707 0.2879 0.0057  -0.0333 0.0101  101 CYS A O   
817  C CB  . CYS A 101 ? 0.3844 0.3449 0.3300 0.0115  -0.0303 0.0133  101 CYS A CB  
818  S SG  . CYS A 101 ? 0.6126 0.5833 0.5690 0.0082  -0.0273 0.0148  101 CYS A SG  
819  N N   . ASP A 102 ? 0.4100 0.3572 0.3772 0.0069  -0.0418 0.0126  102 ASP A N   
820  C CA  . ASP A 102 ? 0.4429 0.3865 0.4240 0.0032  -0.0468 0.0137  102 ASP A CA  
821  C C   . ASP A 102 ? 0.4355 0.3722 0.4114 0.0008  -0.0523 0.0175  102 ASP A C   
822  O O   . ASP A 102 ? 0.4800 0.4101 0.4402 0.0019  -0.0543 0.0188  102 ASP A O   
823  C CB  . ASP A 102 ? 0.4172 0.3546 0.4041 0.0031  -0.0505 0.0124  102 ASP A CB  
824  C CG  . ASP A 102 ? 0.5209 0.4642 0.5125 0.0051  -0.0452 0.0091  102 ASP A CG  
825  O OD1 . ASP A 102 ? 0.5983 0.5503 0.5918 0.0059  -0.0392 0.0076  102 ASP A OD1 
826  O OD2 . ASP A 102 ? 0.5414 0.4816 0.5350 0.0052  -0.0472 0.0077  102 ASP A OD2 
827  N N   . VAL A 103 ? 0.3517 0.2899 0.3406 -0.0028 -0.0546 0.0188  103 VAL A N   
828  C CA  . VAL A 103 ? 0.4384 0.3693 0.4243 -0.0058 -0.0610 0.0229  103 VAL A CA  
829  C C   . VAL A 103 ? 0.5421 0.4676 0.5444 -0.0090 -0.0677 0.0237  103 VAL A C   
830  O O   . VAL A 103 ? 0.5058 0.4370 0.5241 -0.0093 -0.0655 0.0207  103 VAL A O   
831  C CB  . VAL A 103 ? 0.3567 0.2942 0.3428 -0.0076 -0.0581 0.0247  103 VAL A CB  
832  C CG1 . VAL A 103 ? 0.3069 0.2503 0.2785 -0.0046 -0.0513 0.0242  103 VAL A CG1 
833  C CG2 . VAL A 103 ? 0.2672 0.2134 0.2727 -0.0095 -0.0555 0.0227  103 VAL A CG2 
834  N N   . GLY A 104 ? 0.5912 0.5075 0.5898 -0.0119 -0.0756 0.0268  104 GLY A N   
835  C CA  . GLY A 104 ? 0.6350 0.5485 0.6502 -0.0154 -0.0831 0.0274  104 GLY A CA  
836  C C   . GLY A 104 ? 0.6810 0.5995 0.7111 -0.0183 -0.0837 0.0289  104 GLY A C   
837  O O   . GLY A 104 ? 0.6574 0.5811 0.6854 -0.0179 -0.0780 0.0292  104 GLY A O   
838  N N   . SER A 105 ? 0.7031 0.6207 0.7492 -0.0209 -0.0910 0.0301  105 SER A N   
839  C CA  . SER A 105 ? 0.6907 0.6134 0.7528 -0.0230 -0.0925 0.0315  105 SER A CA  
840  C C   . SER A 105 ? 0.7258 0.6427 0.7765 -0.0262 -0.0951 0.0358  105 SER A C   
841  O O   . SER A 105 ? 0.6705 0.5927 0.7301 -0.0278 -0.0936 0.0366  105 SER A O   
842  C CB  . SER A 105 ? 0.6942 0.6166 0.7762 -0.0240 -0.1003 0.0328  105 SER A CB  
843  O OG  . SER A 105 ? 0.7599 0.6707 0.8334 -0.0262 -0.1100 0.0358  105 SER A OG  
844  N N   . ASP A 106 ? 0.7782 0.6839 0.8084 -0.0269 -0.0988 0.0387  106 ASP A N   
845  C CA  . ASP A 106 ? 0.7941 0.6940 0.8104 -0.0291 -0.1007 0.0437  106 ASP A CA  
846  C C   . ASP A 106 ? 0.7171 0.6232 0.7161 -0.0259 -0.0915 0.0430  106 ASP A C   
847  O O   . ASP A 106 ? 0.7127 0.6168 0.6974 -0.0271 -0.0913 0.0464  106 ASP A O   
848  C CB  . ASP A 106 ? 0.8840 0.7696 0.8870 -0.0317 -0.1106 0.0475  106 ASP A CB  
849  C CG  . ASP A 106 ? 0.9486 0.8276 0.9296 -0.0284 -0.1089 0.0463  106 ASP A CG  
850  O OD1 . ASP A 106 ? 0.9675 0.8522 0.9499 -0.0246 -0.1030 0.0419  106 ASP A OD1 
851  O OD2 . ASP A 106 ? 0.9566 0.8244 0.9182 -0.0298 -0.1136 0.0496  106 ASP A OD2 
852  N N   . GLY A 107 ? 0.6492 0.5637 0.6502 -0.0220 -0.0837 0.0384  107 GLY A N   
853  C CA  . GLY A 107 ? 0.5960 0.5188 0.5846 -0.0190 -0.0748 0.0369  107 GLY A CA  
854  C C   . GLY A 107 ? 0.6553 0.5716 0.6210 -0.0161 -0.0739 0.0374  107 GLY A C   
855  O O   . GLY A 107 ? 0.6654 0.5867 0.6188 -0.0141 -0.0675 0.0376  107 GLY A O   
856  N N   . ARG A 108 ? 0.7360 0.6409 0.6964 -0.0159 -0.0804 0.0378  108 ARG A N   
857  C CA  . ARG A 108 ? 0.7002 0.5975 0.6387 -0.0132 -0.0799 0.0373  108 ARG A CA  
858  C C   . ARG A 108 ? 0.6754 0.5785 0.6133 -0.0087 -0.0735 0.0324  108 ARG A C   
859  O O   . ARG A 108 ? 0.6340 0.5405 0.5869 -0.0083 -0.0737 0.0298  108 ARG A O   
860  C CB  . ARG A 108 ? 0.6575 0.5395 0.5903 -0.0158 -0.0900 0.0387  108 ARG A CB  
861  C CG  . ARG A 108 ? 0.6444 0.5243 0.5909 -0.0157 -0.0941 0.0357  108 ARG A CG  
862  C CD  . ARG A 108 ? 0.7208 0.5852 0.6605 -0.0182 -0.1049 0.0374  108 ARG A CD  
863  N NE  . ARG A 108 ? 0.7744 0.6327 0.7171 -0.0231 -0.1126 0.0421  108 ARG A NE  
864  C CZ  . ARG A 108 ? 0.6572 0.5004 0.5872 -0.0260 -0.1220 0.0452  108 ARG A CZ  
865  N NH1 . ARG A 108 ? 0.6459 0.4782 0.5590 -0.0242 -0.1247 0.0438  108 ARG A NH1 
866  N NH2 . ARG A 108 ? 0.5256 0.3640 0.4596 -0.0307 -0.1291 0.0498  108 ARG A NH2 
867  N N   . PHE A 109 ? 0.6306 0.5346 0.5514 -0.0053 -0.0677 0.0312  109 PHE A N   
868  C CA  . PHE A 109 ? 0.5548 0.4630 0.4734 -0.0009 -0.0622 0.0268  109 PHE A CA  
869  C C   . PHE A 109 ? 0.4948 0.3947 0.4173 -0.0009 -0.0680 0.0247  109 PHE A C   
870  O O   . PHE A 109 ? 0.6216 0.5091 0.5379 -0.0030 -0.0757 0.0263  109 PHE A O   
871  C CB  . PHE A 109 ? 0.5693 0.4759 0.4680 0.0026  -0.0567 0.0261  109 PHE A CB  
872  C CG  . PHE A 109 ? 0.5695 0.4784 0.4653 0.0072  -0.0522 0.0217  109 PHE A CG  
873  C CD1 . PHE A 109 ? 0.5675 0.4647 0.4525 0.0089  -0.0558 0.0200  109 PHE A CD1 
874  C CD2 . PHE A 109 ? 0.5434 0.4653 0.4472 0.0095  -0.0449 0.0196  109 PHE A CD2 
875  C CE1 . PHE A 109 ? 0.6137 0.5128 0.4968 0.0131  -0.0520 0.0162  109 PHE A CE1 
876  C CE2 . PHE A 109 ? 0.5693 0.4929 0.4710 0.0135  -0.0412 0.0159  109 PHE A CE2 
877  C CZ  . PHE A 109 ? 0.6094 0.5218 0.5010 0.0154  -0.0447 0.0143  109 PHE A CZ  
878  N N   . LEU A 110 ? 0.4502 0.3567 0.3828 0.0011  -0.0645 0.0213  110 LEU A N   
879  C CA  . LEU A 110 ? 0.4445 0.3452 0.3831 0.0010  -0.0693 0.0194  110 LEU A CA  
880  C C   . LEU A 110 ? 0.5100 0.4118 0.4406 0.0053  -0.0646 0.0158  110 LEU A C   
881  O O   . LEU A 110 ? 0.5628 0.4544 0.4831 0.0064  -0.0685 0.0149  110 LEU A O   
882  C CB  . LEU A 110 ? 0.4011 0.3085 0.3625 -0.0014 -0.0701 0.0188  110 LEU A CB  
883  C CG  . LEU A 110 ? 0.5009 0.4016 0.4744 -0.0055 -0.0793 0.0205  110 LEU A CG  
884  C CD1 . LEU A 110 ? 0.4597 0.3513 0.4248 -0.0084 -0.0858 0.0245  110 LEU A CD1 
885  C CD2 . LEU A 110 ? 0.5004 0.4109 0.4972 -0.0073 -0.0777 0.0197  110 LEU A CD2 
886  N N   . ARG A 111 ? 0.4887 0.4021 0.4241 0.0076  -0.0569 0.0138  111 ARG A N   
887  C CA  . ARG A 111 ? 0.4119 0.3275 0.3420 0.0115  -0.0524 0.0106  111 ARG A CA  
888  C C   . ARG A 111 ? 0.4393 0.3662 0.3675 0.0141  -0.0440 0.0096  111 ARG A C   
889  O O   . ARG A 111 ? 0.3976 0.3333 0.3346 0.0126  -0.0413 0.0106  111 ARG A O   
890  C CB  . ARG A 111 ? 0.4518 0.3692 0.3951 0.0108  -0.0536 0.0087  111 ARG A CB  
891  C CG  . ARG A 111 ? 0.6932 0.6003 0.6389 0.0087  -0.0619 0.0091  111 ARG A CG  
892  C CD  . ARG A 111 ? 0.8747 0.7868 0.8369 0.0073  -0.0622 0.0077  111 ARG A CD  
893  N NE  . ARG A 111 ? 0.9363 0.8565 0.9156 0.0047  -0.0606 0.0086  111 ARG A NE  
894  C CZ  . ARG A 111 ? 0.8924 0.8108 0.8844 0.0012  -0.0664 0.0104  111 ARG A CZ  
895  N NH1 . ARG A 111 ? 0.7554 0.6817 0.7633 -0.0006 -0.0640 0.0107  111 ARG A NH1 
896  N NH2 . ARG A 111 ? 0.9300 0.8385 0.9191 -0.0005 -0.0750 0.0120  111 ARG A NH2 
897  N N   . GLY A 112 ? 0.4204 0.3469 0.3381 0.0181  -0.0402 0.0076  112 GLY A N   
898  C CA  . GLY A 112 ? 0.3549 0.2921 0.2723 0.0208  -0.0326 0.0065  112 GLY A CA  
899  C C   . GLY A 112 ? 0.4387 0.3786 0.3597 0.0233  -0.0304 0.0035  112 GLY A C   
900  O O   . GLY A 112 ? 0.4661 0.3979 0.3835 0.0243  -0.0338 0.0023  112 GLY A O   
901  N N   . TYR A 113 ? 0.4391 0.3898 0.3667 0.0239  -0.0252 0.0027  113 TYR A N   
902  C CA  . TYR A 113 ? 0.3838 0.3376 0.3154 0.0256  -0.0232 0.0003  113 TYR A CA  
903  C C   . TYR A 113 ? 0.3950 0.3571 0.3253 0.0288  -0.0175 -0.0004 113 TYR A C   
904  O O   . TYR A 113 ? 0.4342 0.4037 0.3664 0.0283  -0.0145 0.0007  113 TYR A O   
905  C CB  . TYR A 113 ? 0.4505 0.4089 0.3943 0.0225  -0.0237 0.0001  113 TYR A CB  
906  C CG  . TYR A 113 ? 0.4787 0.4306 0.4287 0.0194  -0.0293 0.0012  113 TYR A CG  
907  C CD1 . TYR A 113 ? 0.6456 0.5909 0.5967 0.0192  -0.0328 0.0003  113 TYR A CD1 
908  C CD2 . TYR A 113 ? 0.3871 0.3400 0.3438 0.0164  -0.0314 0.0034  113 TYR A CD2 
909  C CE1 . TYR A 113 ? 0.8016 0.7420 0.7611 0.0161  -0.0380 0.0014  113 TYR A CE1 
910  C CE2 . TYR A 113 ? 0.5504 0.4975 0.5156 0.0136  -0.0365 0.0044  113 TYR A CE2 
911  C CZ  . TYR A 113 ? 0.8191 0.7603 0.7861 0.0133  -0.0398 0.0034  113 TYR A CZ  
912  O OH  . TYR A 113 ? 0.9097 0.8467 0.8872 0.0101  -0.0451 0.0043  113 TYR A OH  
913  N N   . ARG A 114 ? 0.3219 0.2828 0.2502 0.0318  -0.0166 -0.0021 114 ARG A N   
914  C CA  . ARG A 114 ? 0.2856 0.2550 0.2165 0.0342  -0.0124 -0.0026 114 ARG A CA  
915  C C   . ARG A 114 ? 0.2910 0.2577 0.2215 0.0364  -0.0130 -0.0042 114 ARG A C   
916  O O   . ARG A 114 ? 0.3944 0.3542 0.3175 0.0395  -0.0146 -0.0048 114 ARG A O   
917  C CB  . ARG A 114 ? 0.2503 0.2229 0.1753 0.0372  -0.0095 -0.0015 114 ARG A CB  
918  C CG  . ARG A 114 ? 0.3572 0.3405 0.2877 0.0384  -0.0058 -0.0013 114 ARG A CG  
919  C CD  . ARG A 114 ? 0.5235 0.5066 0.4485 0.0433  -0.0043 -0.0016 114 ARG A CD  
920  N NE  . ARG A 114 ? 0.5348 0.5263 0.4657 0.0442  -0.0026 -0.0017 114 ARG A NE  
921  C CZ  . ARG A 114 ? 0.5512 0.5513 0.4845 0.0446  0.0003  -0.0004 114 ARG A CZ  
922  N NH1 . ARG A 114 ? 0.4734 0.4799 0.4114 0.0452  0.0009  -0.0005 114 ARG A NH1 
923  N NH2 . ARG A 114 ? 0.5942 0.5964 0.5250 0.0443  0.0024  0.0013  114 ARG A NH2 
924  N N   . GLN A 115 ? 0.2736 0.2453 0.2114 0.0348  -0.0119 -0.0047 115 GLN A N   
925  C CA  . GLN A 115 ? 0.2472 0.2167 0.1853 0.0361  -0.0127 -0.0058 115 GLN A CA  
926  C C   . GLN A 115 ? 0.2732 0.2511 0.2156 0.0366  -0.0099 -0.0057 115 GLN A C   
927  O O   . GLN A 115 ? 0.2974 0.2821 0.2449 0.0342  -0.0081 -0.0052 115 GLN A O   
928  C CB  . GLN A 115 ? 0.2843 0.2495 0.2259 0.0328  -0.0151 -0.0064 115 GLN A CB  
929  C CG  . GLN A 115 ? 0.5431 0.4988 0.4806 0.0320  -0.0195 -0.0064 115 GLN A CG  
930  C CD  . GLN A 115 ? 0.5816 0.5367 0.5257 0.0276  -0.0218 -0.0057 115 GLN A CD  
931  O OE1 . GLN A 115 ? 0.4917 0.4522 0.4428 0.0255  -0.0202 -0.0055 115 GLN A OE1 
932  N NE2 . GLN A 115 ? 0.6023 0.5506 0.5445 0.0264  -0.0261 -0.0049 115 GLN A NE2 
933  N N   . ASP A 116 ? 0.3174 0.2943 0.2572 0.0395  -0.0102 -0.0062 116 ASP A N   
934  C CA  . ASP A 116 ? 0.3333 0.3169 0.2761 0.0400  -0.0086 -0.0060 116 ASP A CA  
935  C C   . ASP A 116 ? 0.3330 0.3132 0.2760 0.0393  -0.0099 -0.0066 116 ASP A C   
936  O O   . ASP A 116 ? 0.3837 0.3565 0.3231 0.0403  -0.0120 -0.0073 116 ASP A O   
937  C CB  . ASP A 116 ? 0.3588 0.3450 0.2977 0.0443  -0.0077 -0.0057 116 ASP A CB  
938  C CG  . ASP A 116 ? 0.4905 0.4807 0.4284 0.0449  -0.0059 -0.0046 116 ASP A CG  
939  O OD1 . ASP A 116 ? 0.4343 0.4212 0.3709 0.0434  -0.0062 -0.0044 116 ASP A OD1 
940  O OD2 . ASP A 116 ? 0.6348 0.6314 0.5729 0.0468  -0.0041 -0.0039 116 ASP A OD2 
941  N N   . ALA A 117 ? 0.2898 0.2750 0.2363 0.0374  -0.0088 -0.0064 117 ALA A N   
942  C CA  . ALA A 117 ? 0.2760 0.2583 0.2217 0.0364  -0.0097 -0.0066 117 ALA A CA  
943  C C   . ALA A 117 ? 0.2929 0.2796 0.2383 0.0370  -0.0093 -0.0065 117 ALA A C   
944  O O   . ALA A 117 ? 0.2393 0.2323 0.1867 0.0367  -0.0081 -0.0061 117 ALA A O   
945  C CB  . ALA A 117 ? 0.2502 0.2321 0.1990 0.0321  -0.0091 -0.0064 117 ALA A CB  
946  N N   . TYR A 118 ? 0.3501 0.3332 0.2926 0.0377  -0.0107 -0.0067 118 TYR A N   
947  C CA  . TYR A 118 ? 0.3804 0.3665 0.3218 0.0377  -0.0110 -0.0064 118 TYR A CA  
948  C C   . TYR A 118 ? 0.4098 0.3926 0.3496 0.0346  -0.0116 -0.0060 118 TYR A C   
949  O O   . TYR A 118 ? 0.4069 0.3839 0.3444 0.0351  -0.0131 -0.0061 118 TYR A O   
950  C CB  . TYR A 118 ? 0.2138 0.1989 0.1517 0.0423  -0.0124 -0.0068 118 TYR A CB  
951  C CG  . TYR A 118 ? 0.1960 0.1847 0.1329 0.0425  -0.0133 -0.0064 118 TYR A CG  
952  C CD1 . TYR A 118 ? 0.2220 0.2174 0.1614 0.0409  -0.0123 -0.0058 118 TYR A CD1 
953  C CD2 . TYR A 118 ? 0.2595 0.2444 0.1929 0.0439  -0.0158 -0.0065 118 TYR A CD2 
954  C CE1 . TYR A 118 ? 0.2685 0.2664 0.2067 0.0408  -0.0140 -0.0051 118 TYR A CE1 
955  C CE2 . TYR A 118 ? 0.3040 0.2916 0.2365 0.0439  -0.0175 -0.0057 118 TYR A CE2 
956  C CZ  . TYR A 118 ? 0.3336 0.3276 0.2684 0.0422  -0.0167 -0.0049 118 TYR A CZ  
957  O OH  . TYR A 118 ? 0.3080 0.3041 0.2418 0.0419  -0.0193 -0.0038 118 TYR A OH  
958  N N   . ASP A 119 ? 0.3192 0.3052 0.2593 0.0312  -0.0106 -0.0056 119 ASP A N   
959  C CA  . ASP A 119 ? 0.3524 0.3352 0.2895 0.0278  -0.0106 -0.0051 119 ASP A CA  
960  C C   . ASP A 119 ? 0.3880 0.3670 0.3259 0.0258  -0.0094 -0.0052 119 ASP A C   
961  O O   . ASP A 119 ? 0.4479 0.4227 0.3826 0.0243  -0.0097 -0.0046 119 ASP A O   
962  C CB  . ASP A 119 ? 0.3806 0.3600 0.3134 0.0291  -0.0132 -0.0045 119 ASP A CB  
963  C CG  . ASP A 119 ? 0.4282 0.4111 0.3597 0.0299  -0.0147 -0.0042 119 ASP A CG  
964  O OD1 . ASP A 119 ? 0.2969 0.2839 0.2294 0.0278  -0.0136 -0.0042 119 ASP A OD1 
965  O OD2 . ASP A 119 ? 0.5037 0.4851 0.4332 0.0325  -0.0172 -0.0039 119 ASP A OD2 
966  N N   . GLY A 120 ? 0.4029 0.3835 0.3448 0.0258  -0.0082 -0.0057 120 GLY A N   
967  C CA  . GLY A 120 ? 0.3018 0.2793 0.2450 0.0237  -0.0072 -0.0059 120 GLY A CA  
968  C C   . GLY A 120 ? 0.3621 0.3341 0.3045 0.0260  -0.0098 -0.0056 120 GLY A C   
969  O O   . GLY A 120 ? 0.4557 0.4243 0.3983 0.0243  -0.0098 -0.0055 120 GLY A O   
970  N N   . LYS A 121 ? 0.4017 0.3725 0.3428 0.0298  -0.0120 -0.0058 121 LYS A N   
971  C CA  . LYS A 121 ? 0.4510 0.4154 0.3903 0.0320  -0.0148 -0.0062 121 LYS A CA  
972  C C   . LYS A 121 ? 0.4663 0.4305 0.4054 0.0351  -0.0153 -0.0073 121 LYS A C   
973  O O   . LYS A 121 ? 0.4478 0.4166 0.3869 0.0371  -0.0141 -0.0074 121 LYS A O   
974  C CB  . LYS A 121 ? 0.5201 0.4808 0.4555 0.0335  -0.0171 -0.0062 121 LYS A CB  
975  C CG  . LYS A 121 ? 0.6701 0.6288 0.6044 0.0304  -0.0174 -0.0047 121 LYS A CG  
976  C CD  . LYS A 121 ? 0.8064 0.7613 0.7369 0.0318  -0.0203 -0.0043 121 LYS A CD  
977  C CE  . LYS A 121 ? 0.8813 0.8401 0.8101 0.0331  -0.0198 -0.0045 121 LYS A CE  
978  N NZ  . LYS A 121 ? 0.8747 0.8370 0.8026 0.0294  -0.0176 -0.0032 121 LYS A NZ  
979  N N   . ASP A 122 ? 0.4341 0.3927 0.3723 0.0351  -0.0173 -0.0079 122 ASP A N   
980  C CA  . ASP A 122 ? 0.4035 0.3600 0.3392 0.0378  -0.0181 -0.0088 122 ASP A CA  
981  C C   . ASP A 122 ? 0.4003 0.3577 0.3319 0.0421  -0.0180 -0.0093 122 ASP A C   
982  O O   . ASP A 122 ? 0.4389 0.3936 0.3678 0.0434  -0.0196 -0.0098 122 ASP A O   
983  C CB  . ASP A 122 ? 0.4312 0.3791 0.3638 0.0372  -0.0221 -0.0097 122 ASP A CB  
984  C CG  . ASP A 122 ? 0.5209 0.4688 0.4580 0.0333  -0.0228 -0.0091 122 ASP A CG  
985  O OD1 . ASP A 122 ? 0.4934 0.4472 0.4356 0.0311  -0.0200 -0.0081 122 ASP A OD1 
986  O OD2 . ASP A 122 ? 0.6224 0.5642 0.5582 0.0324  -0.0268 -0.0093 122 ASP A OD2 
987  N N   . TYR A 123 ? 0.4423 0.4037 0.3736 0.0443  -0.0163 -0.0091 123 TYR A N   
988  C CA  . TYR A 123 ? 0.4075 0.3699 0.3345 0.0488  -0.0162 -0.0095 123 TYR A CA  
989  C C   . TYR A 123 ? 0.4415 0.3984 0.3623 0.0519  -0.0172 -0.0100 123 TYR A C   
990  O O   . TYR A 123 ? 0.4664 0.4157 0.3806 0.0547  -0.0199 -0.0112 123 TYR A O   
991  C CB  . TYR A 123 ? 0.3264 0.2986 0.2572 0.0489  -0.0134 -0.0085 123 TYR A CB  
992  C CG  . TYR A 123 ? 0.3226 0.2967 0.2495 0.0536  -0.0132 -0.0087 123 TYR A CG  
993  C CD1 . TYR A 123 ? 0.3033 0.2770 0.2288 0.0549  -0.0146 -0.0092 123 TYR A CD1 
994  C CD2 . TYR A 123 ? 0.3241 0.3005 0.2482 0.0566  -0.0118 -0.0082 123 TYR A CD2 
995  C CE1 . TYR A 123 ? 0.3157 0.2912 0.2377 0.0593  -0.0147 -0.0095 123 TYR A CE1 
996  C CE2 . TYR A 123 ? 0.4121 0.3906 0.3323 0.0612  -0.0113 -0.0083 123 TYR A CE2 
997  C CZ  . TYR A 123 ? 0.3456 0.3238 0.2650 0.0627  -0.0129 -0.0090 123 TYR A CZ  
998  O OH  . TYR A 123 ? 0.2745 0.2548 0.1899 0.0674  -0.0126 -0.0092 123 TYR A OH  
999  N N   . ILE A 124 ? 0.3740 0.3343 0.2960 0.0511  -0.0155 -0.0091 124 ILE A N   
1000 C CA  . ILE A 124 ? 0.2545 0.2091 0.1693 0.0534  -0.0163 -0.0092 124 ILE A CA  
1001 C C   . ILE A 124 ? 0.2690 0.2241 0.1863 0.0498  -0.0159 -0.0084 124 ILE A C   
1002 O O   . ILE A 124 ? 0.2878 0.2502 0.2125 0.0466  -0.0139 -0.0075 124 ILE A O   
1003 C CB  . ILE A 124 ? 0.3332 0.2918 0.2434 0.0579  -0.0140 -0.0086 124 ILE A CB  
1004 C CG1 . ILE A 124 ? 0.3957 0.3459 0.2952 0.0609  -0.0151 -0.0090 124 ILE A CG1 
1005 C CG2 . ILE A 124 ? 0.3639 0.3335 0.2803 0.0563  -0.0104 -0.0071 124 ILE A CG2 
1006 C CD1 . ILE A 124 ? 0.2906 0.2429 0.1834 0.0660  -0.0127 -0.0088 124 ILE A CD1 
1007 N N   . ALA A 125 ? 0.3005 0.2470 0.2110 0.0501  -0.0184 -0.0086 125 ALA A N   
1008 C CA  . ALA A 125 ? 0.2563 0.2017 0.1682 0.0465  -0.0191 -0.0078 125 ALA A CA  
1009 C C   . ALA A 125 ? 0.3052 0.2430 0.2066 0.0483  -0.0206 -0.0075 125 ALA A C   
1010 O O   . ALA A 125 ? 0.4059 0.3351 0.2982 0.0515  -0.0231 -0.0084 125 ALA A O   
1011 C CB  . ALA A 125 ? 0.2276 0.1687 0.1441 0.0424  -0.0224 -0.0084 125 ALA A CB  
1012 N N   . LEU A 126 ? 0.3643 0.3047 0.2661 0.0462  -0.0194 -0.0061 126 LEU A N   
1013 C CA  . LEU A 126 ? 0.4332 0.3655 0.3241 0.0469  -0.0212 -0.0054 126 LEU A CA  
1014 C C   . LEU A 126 ? 0.4909 0.4124 0.3800 0.0437  -0.0274 -0.0056 126 LEU A C   
1015 O O   . LEU A 126 ? 0.5840 0.5081 0.4825 0.0394  -0.0290 -0.0052 126 LEU A O   
1016 C CB  . LEU A 126 ? 0.4001 0.3392 0.2923 0.0451  -0.0178 -0.0035 126 LEU A CB  
1017 C CG  . LEU A 126 ? 0.4162 0.3482 0.2954 0.0461  -0.0182 -0.0024 126 LEU A CG  
1018 C CD1 . LEU A 126 ? 0.3837 0.3132 0.2522 0.0517  -0.0154 -0.0032 126 LEU A CD1 
1019 C CD2 . LEU A 126 ? 0.4124 0.3520 0.2948 0.0434  -0.0151 -0.0002 126 LEU A CD2 
1020 N N   . ASN A 127 ? 0.4690 0.3783 0.3462 0.0458  -0.0315 -0.0062 127 ASN A N   
1021 C CA  . ASN A 127 ? 0.4525 0.3504 0.3275 0.0426  -0.0387 -0.0061 127 ASN A CA  
1022 C C   . ASN A 127 ? 0.5808 0.4773 0.4557 0.0387  -0.0406 -0.0039 127 ASN A C   
1023 O O   . ASN A 127 ? 0.7006 0.6041 0.5752 0.0387  -0.0361 -0.0026 127 ASN A O   
1024 C CB  . ASN A 127 ? 0.4700 0.3540 0.3307 0.0459  -0.0432 -0.0072 127 ASN A CB  
1025 C CG  . ASN A 127 ? 0.5421 0.4262 0.4034 0.0495  -0.0426 -0.0092 127 ASN A CG  
1026 O OD1 . ASN A 127 ? 0.5541 0.4320 0.4039 0.0542  -0.0427 -0.0102 127 ASN A OD1 
1027 N ND2 . ASN A 127 ? 0.5402 0.4315 0.4143 0.0472  -0.0420 -0.0097 127 ASN A ND2 
1028 N N   . GLU A 128 ? 0.6458 0.5335 0.5218 0.0351  -0.0479 -0.0032 128 GLU A N   
1029 C CA  . GLU A 128 ? 0.6258 0.5120 0.5038 0.0309  -0.0509 -0.0008 128 GLU A CA  
1030 C C   . GLU A 128 ? 0.5421 0.4215 0.4045 0.0321  -0.0508 0.0007  128 GLU A C   
1031 O O   . GLU A 128 ? 0.4838 0.3659 0.3475 0.0293  -0.0505 0.0029  128 GLU A O   
1032 C CB  . GLU A 128 ? 0.7498 0.6279 0.6341 0.0267  -0.0596 -0.0001 128 GLU A CB  
1033 C CG  . GLU A 128 ? 0.9519 0.8298 0.8421 0.0220  -0.0632 0.0027  128 GLU A CG  
1034 C CD  . GLU A 128 ? 1.0130 0.8875 0.9159 0.0177  -0.0708 0.0036  128 GLU A CD  
1035 O OE1 . GLU A 128 ? 1.0125 0.8812 0.9154 0.0180  -0.0751 0.0023  128 GLU A OE1 
1036 O OE2 . GLU A 128 ? 1.0319 0.9102 0.9459 0.0138  -0.0727 0.0057  128 GLU A OE2 
1037 N N   . ASP A 129 ? 0.4943 0.3648 0.3415 0.0362  -0.0511 -0.0006 129 ASP A N   
1038 C CA  . ASP A 129 ? 0.4622 0.3255 0.2923 0.0376  -0.0502 0.0006  129 ASP A CA  
1039 C C   . ASP A 129 ? 0.5393 0.4153 0.3700 0.0395  -0.0410 0.0013  129 ASP A C   
1040 O O   . ASP A 129 ? 0.5956 0.4686 0.4144 0.0396  -0.0390 0.0028  129 ASP A O   
1041 C CB  . ASP A 129 ? 0.4897 0.3392 0.3022 0.0419  -0.0528 -0.0012 129 ASP A CB  
1042 C CG  . ASP A 129 ? 0.5967 0.4522 0.4106 0.0472  -0.0476 -0.0037 129 ASP A CG  
1043 O OD1 . ASP A 129 ? 0.6681 0.5384 0.4934 0.0480  -0.0408 -0.0039 129 ASP A OD1 
1044 O OD2 . ASP A 129 ? 0.6097 0.4543 0.4129 0.0505  -0.0508 -0.0055 129 ASP A OD2 
1045 N N   . LEU A 130 ? 0.5417 0.4315 0.3858 0.0406  -0.0356 0.0003  130 LEU A N   
1046 C CA  . LEU A 130 ? 0.4570 0.3598 0.3043 0.0422  -0.0275 0.0010  130 LEU A CA  
1047 C C   . LEU A 130 ? 0.4755 0.3753 0.3082 0.0474  -0.0230 0.0002  130 LEU A C   
1048 O O   . LEU A 130 ? 0.5164 0.4225 0.3460 0.0483  -0.0172 0.0016  130 LEU A O   
1049 C CB  . LEU A 130 ? 0.4153 0.3223 0.2654 0.0379  -0.0270 0.0039  130 LEU A CB  
1050 C CG  . LEU A 130 ? 0.5027 0.4118 0.3668 0.0327  -0.0317 0.0048  130 LEU A CG  
1051 C CD1 . LEU A 130 ? 0.4474 0.3592 0.3127 0.0287  -0.0320 0.0081  130 LEU A CD1 
1052 C CD2 . LEU A 130 ? 0.4873 0.4081 0.3672 0.0327  -0.0288 0.0033  130 LEU A CD2 
1053 N N   . ARG A 131 ? 0.5239 0.4144 0.3481 0.0510  -0.0255 -0.0019 131 ARG A N   
1054 C CA  . ARG A 131 ? 0.6142 0.5001 0.4232 0.0563  -0.0215 -0.0031 131 ARG A CA  
1055 C C   . ARG A 131 ? 0.6485 0.5343 0.4589 0.0610  -0.0214 -0.0057 131 ARG A C   
1056 O O   . ARG A 131 ? 0.6366 0.5215 0.4376 0.0660  -0.0171 -0.0069 131 ARG A O   
1057 C CB  . ARG A 131 ? 0.5198 0.3885 0.3088 0.0561  -0.0259 -0.0029 131 ARG A CB  
1058 C CG  . ARG A 131 ? 0.5434 0.4113 0.3272 0.0522  -0.0251 0.0000  131 ARG A CG  
1059 C CD  . ARG A 131 ? 0.6374 0.4871 0.3984 0.0524  -0.0290 0.0002  131 ARG A CD  
1060 N NE  . ARG A 131 ? 0.6476 0.4906 0.3935 0.0585  -0.0255 -0.0025 131 ARG A NE  
1061 C CZ  . ARG A 131 ? 0.6907 0.5166 0.4141 0.0600  -0.0282 -0.0034 131 ARG A CZ  
1062 N NH1 . ARG A 131 ? 0.7096 0.5302 0.4202 0.0659  -0.0244 -0.0064 131 ARG A NH1 
1063 N NH2 . ARG A 131 ? 0.6727 0.4863 0.3861 0.0556  -0.0350 -0.0015 131 ARG A NH2 
1064 N N   . SER A 132 ? 0.5795 0.4662 0.4013 0.0593  -0.0258 -0.0064 132 SER A N   
1065 C CA  . SER A 132 ? 0.5986 0.4848 0.4224 0.0631  -0.0266 -0.0085 132 SER A CA  
1066 C C   . SER A 132 ? 0.5471 0.4448 0.3895 0.0608  -0.0261 -0.0084 132 SER A C   
1067 O O   . SER A 132 ? 0.4456 0.3486 0.2984 0.0561  -0.0266 -0.0072 132 SER A O   
1068 C CB  . SER A 132 ? 0.5818 0.4514 0.3947 0.0639  -0.0342 -0.0100 132 SER A CB  
1069 O OG  . SER A 132 ? 0.6391 0.5036 0.4577 0.0586  -0.0406 -0.0091 132 SER A OG  
1070 N N   . TRP A 133 ? 0.4458 0.3467 0.2915 0.0641  -0.0252 -0.0098 133 TRP A N   
1071 C CA  . TRP A 133 ? 0.4410 0.3519 0.3020 0.0622  -0.0244 -0.0097 133 TRP A CA  
1072 C C   . TRP A 133 ? 0.4916 0.3955 0.3538 0.0624  -0.0294 -0.0113 133 TRP A C   
1073 O O   . TRP A 133 ? 0.5330 0.4258 0.3844 0.0653  -0.0331 -0.0126 133 TRP A O   
1074 C CB  . TRP A 133 ? 0.3523 0.2753 0.2182 0.0651  -0.0188 -0.0094 133 TRP A CB  
1075 C CG  . TRP A 133 ? 0.3527 0.2827 0.2167 0.0655  -0.0134 -0.0080 133 TRP A CG  
1076 C CD1 . TRP A 133 ? 0.3397 0.2661 0.1913 0.0692  -0.0105 -0.0081 133 TRP A CD1 
1077 C CD2 . TRP A 133 ? 0.3940 0.3358 0.2687 0.0622  -0.0100 -0.0062 133 TRP A CD2 
1078 N NE1 . TRP A 133 ? 0.4008 0.3363 0.2552 0.0681  -0.0052 -0.0064 133 TRP A NE1 
1079 C CE2 . TRP A 133 ? 0.3774 0.3224 0.2461 0.0639  -0.0053 -0.0051 133 TRP A CE2 
1080 C CE3 . TRP A 133 ? 0.4319 0.3814 0.3199 0.0579  -0.0104 -0.0057 133 TRP A CE3 
1081 C CZ2 . TRP A 133 ? 0.3249 0.2808 0.2013 0.0613  -0.0015 -0.0032 133 TRP A CZ2 
1082 C CZ3 . TRP A 133 ? 0.4111 0.3706 0.3058 0.0556  -0.0069 -0.0040 133 TRP A CZ3 
1083 C CH2 . TRP A 133 ? 0.3798 0.3426 0.2691 0.0572  -0.0028 -0.0027 133 TRP A CH2 
1084 N N   . THR A 134 ? 0.5029 0.4133 0.3777 0.0590  -0.0294 -0.0114 134 THR A N   
1085 C CA  . THR A 134 ? 0.4561 0.3623 0.3335 0.0586  -0.0330 -0.0128 134 THR A CA  
1086 C C   . THR A 134 ? 0.4717 0.3886 0.3576 0.0593  -0.0293 -0.0128 134 THR A C   
1087 O O   . THR A 134 ? 0.4637 0.3904 0.3589 0.0564  -0.0259 -0.0118 134 THR A O   
1088 C CB  . THR A 134 ? 0.4026 0.3054 0.2862 0.0528  -0.0370 -0.0128 134 THR A CB  
1089 O OG1 . THR A 134 ? 0.5503 0.4417 0.4257 0.0520  -0.0420 -0.0127 134 THR A OG1 
1090 C CG2 . THR A 134 ? 0.2635 0.1642 0.1508 0.0516  -0.0400 -0.0141 134 THR A CG2 
1091 N N   . ALA A 135 ? 0.4410 0.3552 0.3229 0.0630  -0.0304 -0.0140 135 ALA A N   
1092 C CA  . ALA A 135 ? 0.4093 0.3319 0.2982 0.0633  -0.0281 -0.0141 135 ALA A CA  
1093 C C   . ALA A 135 ? 0.5101 0.4299 0.4036 0.0595  -0.0312 -0.0149 135 ALA A C   
1094 O O   . ALA A 135 ? 0.5755 0.4855 0.4645 0.0586  -0.0360 -0.0160 135 ALA A O   
1095 C CB  . ALA A 135 ? 0.2596 0.1815 0.1418 0.0692  -0.0279 -0.0148 135 ALA A CB  
1096 N N   . ALA A 136 ? 0.4140 0.3422 0.3157 0.0569  -0.0286 -0.0142 136 ALA A N   
1097 C CA  . ALA A 136 ? 0.4115 0.3383 0.3174 0.0528  -0.0308 -0.0143 136 ALA A CA  
1098 C C   . ALA A 136 ? 0.5660 0.4908 0.4695 0.0548  -0.0328 -0.0151 136 ALA A C   
1099 O O   . ALA A 136 ? 0.6758 0.5953 0.5791 0.0526  -0.0366 -0.0152 136 ALA A O   
1100 C CB  . ALA A 136 ? 0.3922 0.3278 0.3070 0.0486  -0.0273 -0.0128 136 ALA A CB  
1101 N N   . ASP A 137 ? 0.5409 0.4703 0.4430 0.0586  -0.0307 -0.0151 137 ASP A N   
1102 C CA  . ASP A 137 ? 0.5255 0.4529 0.4248 0.0609  -0.0330 -0.0159 137 ASP A CA  
1103 C C   . ASP A 137 ? 0.4915 0.4186 0.3844 0.0672  -0.0326 -0.0168 137 ASP A C   
1104 O O   . ASP A 137 ? 0.5032 0.4313 0.3934 0.0697  -0.0304 -0.0166 137 ASP A O   
1105 C CB  . ASP A 137 ? 0.5504 0.4851 0.4561 0.0580  -0.0314 -0.0144 137 ASP A CB  
1106 C CG  . ASP A 137 ? 0.6229 0.5678 0.5332 0.0580  -0.0269 -0.0132 137 ASP A CG  
1107 O OD1 . ASP A 137 ? 0.6015 0.5489 0.5095 0.0617  -0.0252 -0.0135 137 ASP A OD1 
1108 O OD2 . ASP A 137 ? 0.6555 0.6055 0.5711 0.0542  -0.0254 -0.0118 137 ASP A OD2 
1109 N N   . MET A 138 ? 0.4834 0.4090 0.3737 0.0698  -0.0350 -0.0175 138 MET A N   
1110 C CA  . MET A 138 ? 0.4885 0.4134 0.3722 0.0764  -0.0351 -0.0185 138 MET A CA  
1111 C C   . MET A 138 ? 0.5366 0.4724 0.4237 0.0782  -0.0305 -0.0172 138 MET A C   
1112 O O   . MET A 138 ? 0.6271 0.5636 0.5087 0.0837  -0.0293 -0.0174 138 MET A O   
1113 C CB  . MET A 138 ? 0.4653 0.3852 0.3459 0.0786  -0.0397 -0.0196 138 MET A CB  
1114 C CG  . MET A 138 ? 0.5053 0.4123 0.3776 0.0805  -0.0448 -0.0214 138 MET A CG  
1115 S SD  . MET A 138 ? 1.3524 1.2536 1.2229 0.0824  -0.0510 -0.0223 138 MET A SD  
1116 C CE  . MET A 138 ? 1.0480 0.9517 0.9283 0.0744  -0.0523 -0.0202 138 MET A CE  
1117 N N   . ALA A 139 ? 0.5455 0.4896 0.4411 0.0737  -0.0281 -0.0156 139 ALA A N   
1118 C CA  . ALA A 139 ? 0.4953 0.4500 0.3949 0.0745  -0.0243 -0.0142 139 ALA A CA  
1119 C C   . ALA A 139 ? 0.5095 0.4663 0.4086 0.0748  -0.0210 -0.0134 139 ALA A C   
1120 O O   . ALA A 139 ? 0.4848 0.4461 0.3814 0.0783  -0.0184 -0.0128 139 ALA A O   
1121 C CB  . ALA A 139 ? 0.4233 0.3847 0.3309 0.0693  -0.0236 -0.0127 139 ALA A CB  
1122 N N   . ALA A 140 ? 0.4558 0.4094 0.3571 0.0708  -0.0211 -0.0133 140 ALA A N   
1123 C CA  . ALA A 140 ? 0.3731 0.3276 0.2740 0.0701  -0.0188 -0.0123 140 ALA A CA  
1124 C C   . ALA A 140 ? 0.4067 0.3543 0.2973 0.0750  -0.0194 -0.0129 140 ALA A C   
1125 O O   . ALA A 140 ? 0.4504 0.3999 0.3385 0.0754  -0.0167 -0.0120 140 ALA A O   
1126 C CB  . ALA A 140 ? 0.3037 0.2547 0.2084 0.0650  -0.0198 -0.0122 140 ALA A CB  
1127 N N   . GLN A 141 ? 0.5481 0.4872 0.4315 0.0784  -0.0228 -0.0146 141 GLN A N   
1128 C CA  . GLN A 141 ? 0.6718 0.6028 0.5431 0.0834  -0.0235 -0.0157 141 GLN A CA  
1129 C C   . GLN A 141 ? 0.6275 0.5651 0.4952 0.0876  -0.0188 -0.0158 141 GLN A C   
1130 O O   . GLN A 141 ? 0.5632 0.4972 0.4223 0.0903  -0.0160 -0.0165 141 GLN A O   
1131 C CB  . GLN A 141 ? 0.8051 0.7253 0.6699 0.0861  -0.0288 -0.0178 141 GLN A CB  
1132 C CG  . GLN A 141 ? 0.9682 0.8793 0.8337 0.0820  -0.0332 -0.0185 141 GLN A CG  
1133 C CD  . GLN A 141 ? 1.1425 1.0430 1.0016 0.0842  -0.0388 -0.0207 141 GLN A CD  
1134 O OE1 . GLN A 141 ? 1.2054 1.1043 1.0586 0.0894  -0.0396 -0.0218 141 GLN A OE1 
1135 N NE2 . GLN A 141 ? 1.2030 1.0966 1.0635 0.0798  -0.0430 -0.0214 141 GLN A NE2 
1136 N N   . ILE A 142 ? 0.5888 0.5354 0.4631 0.0881  -0.0174 -0.0155 142 ILE A N   
1137 C CA  . ILE A 142 ? 0.5894 0.5436 0.4637 0.0916  -0.0116 -0.0163 142 ILE A CA  
1138 C C   . ILE A 142 ? 0.5737 0.5348 0.4513 0.0891  -0.0067 -0.0142 142 ILE A C   
1139 O O   . ILE A 142 ? 0.5605 0.5228 0.4341 0.0923  -0.0013 -0.0149 142 ILE A O   
1140 C CB  . ILE A 142 ? 0.5294 0.4921 0.4138 0.0916  -0.0120 -0.0157 142 ILE A CB  
1141 C CG1 . ILE A 142 ? 0.5169 0.4727 0.4002 0.0936  -0.0177 -0.0167 142 ILE A CG1 
1142 C CG2 . ILE A 142 ? 0.3518 0.3229 0.2424 0.0953  -0.0060 -0.0156 142 ILE A CG2 
1143 C CD1 . ILE A 142 ? 0.4091 0.3718 0.3028 0.0922  -0.0201 -0.0148 142 ILE A CD1 
1144 N N   . THR A 143 ? 0.4940 0.4592 0.3793 0.0835  -0.0083 -0.0120 143 THR A N   
1145 C CA  . THR A 143 ? 0.4461 0.4170 0.3351 0.0805  -0.0047 -0.0101 143 THR A CA  
1146 C C   . THR A 143 ? 0.4270 0.3894 0.3069 0.0810  -0.0042 -0.0104 143 THR A C   
1147 O O   . THR A 143 ? 0.4231 0.3882 0.3004 0.0815  0.0003  -0.0096 143 THR A O   
1148 C CB  . THR A 143 ? 0.3930 0.3682 0.2921 0.0745  -0.0067 -0.0086 143 THR A CB  
1149 O OG1 . THR A 143 ? 0.4505 0.4330 0.3566 0.0736  -0.0070 -0.0083 143 THR A OG1 
1150 C CG2 . THR A 143 ? 0.3322 0.3126 0.2348 0.0714  -0.0036 -0.0069 143 THR A CG2 
1151 N N   . LYS A 144 ? 0.3552 0.3065 0.2298 0.0809  -0.0090 -0.0115 144 LYS A N   
1152 C CA  . LYS A 144 ? 0.3406 0.2816 0.2052 0.0811  -0.0100 -0.0119 144 LYS A CA  
1153 C C   . LYS A 144 ? 0.4038 0.3409 0.2561 0.0863  -0.0061 -0.0134 144 LYS A C   
1154 O O   . LYS A 144 ? 0.3902 0.3253 0.2361 0.0861  -0.0029 -0.0129 144 LYS A O   
1155 C CB  . LYS A 144 ? 0.4694 0.3989 0.3309 0.0802  -0.0164 -0.0131 144 LYS A CB  
1156 C CG  . LYS A 144 ? 0.5411 0.4582 0.3915 0.0799  -0.0189 -0.0137 144 LYS A CG  
1157 C CD  . LYS A 144 ? 0.5414 0.4496 0.3936 0.0770  -0.0253 -0.0143 144 LYS A CD  
1158 C CE  . LYS A 144 ? 0.4932 0.3868 0.3324 0.0774  -0.0294 -0.0151 144 LYS A CE  
1159 N NZ  . LYS A 144 ? 0.5454 0.4300 0.3703 0.0832  -0.0303 -0.0171 144 LYS A NZ  
1160 N N   . ARG A 145 ? 0.4396 0.3751 0.2883 0.0911  -0.0059 -0.0155 145 ARG A N   
1161 C CA  . ARG A 145 ? 0.4020 0.3338 0.2399 0.0967  -0.0009 -0.0177 145 ARG A CA  
1162 C C   . ARG A 145 ? 0.5145 0.4573 0.3569 0.0971  0.0073  -0.0164 145 ARG A C   
1163 O O   . ARG A 145 ? 0.4613 0.4007 0.2944 0.0995  0.0125  -0.0170 145 ARG A O   
1164 C CB  . ARG A 145 ? 0.4741 0.4032 0.3104 0.1018  -0.0019 -0.0207 145 ARG A CB  
1165 C CG  . ARG A 145 ? 0.5916 0.5057 0.4169 0.1035  -0.0084 -0.0230 145 ARG A CG  
1166 C CD  . ARG A 145 ? 0.7872 0.6984 0.6110 0.1090  -0.0090 -0.0263 145 ARG A CD  
1167 N NE  . ARG A 145 ? 0.9272 0.8355 0.7555 0.1071  -0.0168 -0.0262 145 ARG A NE  
1168 C CZ  . ARG A 145 ? 0.8409 0.7578 0.6808 0.1062  -0.0177 -0.0256 145 ARG A CZ  
1169 N NH1 . ARG A 145 ? 0.7745 0.6874 0.6167 0.1042  -0.0247 -0.0253 145 ARG A NH1 
1170 N NH2 . ARG A 145 ? 0.7676 0.6964 0.6168 0.1073  -0.0118 -0.0251 145 ARG A NH2 
1171 N N   . LYS A 146 ? 0.5377 0.4934 0.3941 0.0948  0.0086  -0.0146 146 LYS A N   
1172 C CA  . LYS A 146 ? 0.5223 0.4892 0.3851 0.0949  0.0160  -0.0131 146 LYS A CA  
1173 C C   . LYS A 146 ? 0.5605 0.5270 0.4200 0.0913  0.0177  -0.0108 146 LYS A C   
1174 O O   . LYS A 146 ? 0.6554 0.6236 0.5107 0.0932  0.0244  -0.0105 146 LYS A O   
1175 C CB  . LYS A 146 ? 0.5093 0.4889 0.3873 0.0925  0.0157  -0.0115 146 LYS A CB  
1176 C CG  . LYS A 146 ? 0.5820 0.5733 0.4682 0.0929  0.0231  -0.0098 146 LYS A CG  
1177 C CD  . LYS A 146 ? 0.6291 0.6316 0.5291 0.0887  0.0216  -0.0076 146 LYS A CD  
1178 C CE  . LYS A 146 ? 0.6743 0.6805 0.5831 0.0905  0.0190  -0.0082 146 LYS A CE  
1179 N NZ  . LYS A 146 ? 0.7536 0.7697 0.6752 0.0860  0.0169  -0.0055 146 LYS A NZ  
1180 N N   . TRP A 147 ? 0.5223 0.4862 0.3843 0.0861  0.0120  -0.0094 147 TRP A N   
1181 C CA  . TRP A 147 ? 0.4671 0.4306 0.3278 0.0822  0.0129  -0.0075 147 TRP A CA  
1182 C C   . TRP A 147 ? 0.4858 0.4365 0.3302 0.0840  0.0133  -0.0085 147 TRP A C   
1183 O O   . TRP A 147 ? 0.5140 0.4649 0.3536 0.0828  0.0171  -0.0071 147 TRP A O   
1184 C CB  . TRP A 147 ? 0.3692 0.3333 0.2386 0.0765  0.0071  -0.0063 147 TRP A CB  
1185 C CG  . TRP A 147 ? 0.3625 0.3387 0.2461 0.0740  0.0072  -0.0051 147 TRP A CG  
1186 C CD1 . TRP A 147 ? 0.3812 0.3672 0.2704 0.0761  0.0112  -0.0047 147 TRP A CD1 
1187 C CD2 . TRP A 147 ? 0.4143 0.3933 0.3078 0.0690  0.0034  -0.0044 147 TRP A CD2 
1188 N NE1 . TRP A 147 ? 0.3348 0.3288 0.2353 0.0724  0.0093  -0.0037 147 TRP A NE1 
1189 C CE2 . TRP A 147 ? 0.3983 0.3882 0.3015 0.0681  0.0048  -0.0035 147 TRP A CE2 
1190 C CE3 . TRP A 147 ? 0.3152 0.2883 0.2104 0.0652  -0.0007 -0.0046 147 TRP A CE3 
1191 C CZ2 . TRP A 147 ? 0.3670 0.3613 0.2800 0.0636  0.0024  -0.0031 147 TRP A CZ2 
1192 C CZ3 . TRP A 147 ? 0.2505 0.2288 0.1566 0.0609  -0.0023 -0.0042 147 TRP A CZ3 
1193 C CH2 . TRP A 147 ? 0.3618 0.3502 0.2760 0.0602  -0.0007 -0.0035 147 TRP A CH2 
1194 N N   . GLU A 148 ? 0.5001 0.4391 0.3350 0.0866  0.0091  -0.0110 148 GLU A N   
1195 C CA  . GLU A 148 ? 0.5324 0.4573 0.3496 0.0887  0.0090  -0.0124 148 GLU A CA  
1196 C C   . GLU A 148 ? 0.5450 0.4710 0.3535 0.0935  0.0177  -0.0135 148 GLU A C   
1197 O O   . GLU A 148 ? 0.6323 0.5536 0.4300 0.0932  0.0213  -0.0128 148 GLU A O   
1198 C CB  . GLU A 148 ? 0.5850 0.4972 0.3944 0.0908  0.0023  -0.0150 148 GLU A CB  
1199 C CG  . GLU A 148 ? 0.6328 0.5412 0.4487 0.0861  -0.0058 -0.0141 148 GLU A CG  
1200 C CD  . GLU A 148 ? 0.7334 0.6312 0.5445 0.0883  -0.0122 -0.0163 148 GLU A CD  
1201 O OE1 . GLU A 148 ? 0.6903 0.5858 0.4954 0.0934  -0.0107 -0.0186 148 GLU A OE1 
1202 O OE2 . GLU A 148 ? 0.8196 0.7112 0.6334 0.0848  -0.0187 -0.0158 148 GLU A OE2 
1203 N N   . ALA A 149 ? 0.4934 0.4257 0.3070 0.0979  0.0214  -0.0151 149 ALA A N   
1204 C CA  . ALA A 149 ? 0.4100 0.3445 0.2183 0.1031  0.0309  -0.0164 149 ALA A CA  
1205 C C   . ALA A 149 ? 0.4070 0.3514 0.2200 0.1009  0.0381  -0.0133 149 ALA A C   
1206 O O   . ALA A 149 ? 0.4255 0.3669 0.2282 0.1036  0.0456  -0.0136 149 ALA A O   
1207 C CB  . ALA A 149 ? 0.3049 0.2469 0.1233 0.1076  0.0332  -0.0182 149 ALA A CB  
1208 N N   . ALA A 150 ? 0.4134 0.3690 0.2413 0.0960  0.0360  -0.0102 150 ALA A N   
1209 C CA  . ALA A 150 ? 0.4021 0.3681 0.2366 0.0936  0.0422  -0.0070 150 ALA A CA  
1210 C C   . ALA A 150 ? 0.4322 0.3928 0.2597 0.0885  0.0396  -0.0048 150 ALA A C   
1211 O O   . ALA A 150 ? 0.5037 0.4719 0.3358 0.0859  0.0439  -0.0018 150 ALA A O   
1212 C CB  . ALA A 150 ? 0.3820 0.3630 0.2361 0.0911  0.0415  -0.0050 150 ALA A CB  
1213 N N   . HIS A 151 ? 0.4677 0.4150 0.2850 0.0872  0.0325  -0.0062 151 HIS A N   
1214 C CA  . HIS A 151 ? 0.4423 0.3829 0.2531 0.0823  0.0290  -0.0044 151 HIS A CA  
1215 C C   . HIS A 151 ? 0.4586 0.4102 0.2852 0.0766  0.0269  -0.0013 151 HIS A C   
1216 O O   . HIS A 151 ? 0.5206 0.4729 0.3453 0.0730  0.0281  0.0011  151 HIS A O   
1217 C CB  . HIS A 151 ? 0.3991 0.3343 0.1944 0.0837  0.0358  -0.0037 151 HIS A CB  
1218 C CG  . HIS A 151 ? 0.5183 0.4428 0.2972 0.0898  0.0393  -0.0071 151 HIS A CG  
1219 N ND1 . HIS A 151 ? 0.5873 0.4953 0.3512 0.0908  0.0330  -0.0097 151 HIS A ND1 
1220 C CD2 . HIS A 151 ? 0.5306 0.4583 0.3062 0.0953  0.0486  -0.0085 151 HIS A CD2 
1221 C CE1 . HIS A 151 ? 0.5929 0.4937 0.3437 0.0967  0.0381  -0.0128 151 HIS A CE1 
1222 N NE2 . HIS A 151 ? 0.5563 0.4690 0.3142 0.0996  0.0479  -0.0122 151 HIS A NE2 
1223 N N   . GLU A 152 ? 0.4172 0.3768 0.2586 0.0756  0.0237  -0.0016 152 GLU A N   
1224 C CA  . GLU A 152 ? 0.3878 0.3582 0.2443 0.0706  0.0223  0.0007  152 GLU A CA  
1225 C C   . GLU A 152 ? 0.4128 0.3774 0.2694 0.0653  0.0164  0.0015  152 GLU A C   
1226 O O   . GLU A 152 ? 0.4222 0.3942 0.2881 0.0610  0.0162  0.0036  152 GLU A O   
1227 C CB  . GLU A 152 ? 0.4174 0.3956 0.2870 0.0708  0.0200  -0.0001 152 GLU A CB  
1228 C CG  . GLU A 152 ? 0.5380 0.5234 0.4104 0.0756  0.0254  -0.0007 152 GLU A CG  
1229 C CD  . GLU A 152 ? 0.5950 0.5931 0.4761 0.0748  0.0318  0.0019  152 GLU A CD  
1230 O OE1 . GLU A 152 ? 0.5075 0.5078 0.3895 0.0710  0.0327  0.0042  152 GLU A OE1 
1231 O OE2 . GLU A 152 ? 0.6533 0.6595 0.5413 0.0779  0.0358  0.0017  152 GLU A OE2 
1232 N N   . ALA A 153 ? 0.4978 0.4490 0.3442 0.0655  0.0114  -0.0001 153 ALA A N   
1233 C CA  . ALA A 153 ? 0.3821 0.3271 0.2294 0.0605  0.0054  0.0005  153 ALA A CA  
1234 C C   . ALA A 153 ? 0.3843 0.3266 0.2240 0.0577  0.0069  0.0029  153 ALA A C   
1235 O O   . ALA A 153 ? 0.4248 0.3671 0.2697 0.0528  0.0032  0.0044  153 ALA A O   
1236 C CB  . ALA A 153 ? 0.2222 0.1535 0.0617 0.0614  -0.0010 -0.0017 153 ALA A CB  
1237 N N   . GLU A 154 ? 0.4150 0.3549 0.2421 0.0607  0.0125  0.0035  154 GLU A N   
1238 C CA  . GLU A 154 ? 0.4995 0.4364 0.3175 0.0580  0.0145  0.0061  154 GLU A CA  
1239 C C   . GLU A 154 ? 0.5106 0.4603 0.3424 0.0537  0.0163  0.0093  154 GLU A C   
1240 O O   . GLU A 154 ? 0.5238 0.4708 0.3562 0.0489  0.0124  0.0112  154 GLU A O   
1241 C CB  . GLU A 154 ? 0.4699 0.4036 0.2729 0.0624  0.0222  0.0061  154 GLU A CB  
1242 C CG  . GLU A 154 ? 0.6118 0.5299 0.3970 0.0664  0.0201  0.0030  154 GLU A CG  
1243 C CD  . GLU A 154 ? 0.7532 0.6557 0.5256 0.0629  0.0125  0.0034  154 GLU A CD  
1244 O OE1 . GLU A 154 ? 0.8346 0.7382 0.6101 0.0576  0.0100  0.0063  154 GLU A OE1 
1245 O OE2 . GLU A 154 ? 0.7586 0.6472 0.5177 0.0653  0.0086  0.0008  154 GLU A OE2 
1246 N N   . GLN A 155 ? 0.5248 0.4879 0.3676 0.0554  0.0218  0.0098  155 GLN A N   
1247 C CA  . GLN A 155 ? 0.5571 0.5327 0.4134 0.0517  0.0235  0.0127  155 GLN A CA  
1248 C C   . GLN A 155 ? 0.5052 0.4822 0.3733 0.0473  0.0166  0.0122  155 GLN A C   
1249 O O   . GLN A 155 ? 0.5230 0.5040 0.3973 0.0428  0.0152  0.0145  155 GLN A O   
1250 C CB  . GLN A 155 ? 0.7138 0.7024 0.5798 0.0546  0.0297  0.0131  155 GLN A CB  
1251 C CG  . GLN A 155 ? 0.9328 0.9208 0.8009 0.0590  0.0287  0.0097  155 GLN A CG  
1252 C CD  . GLN A 155 ? 1.0549 1.0563 0.9358 0.0607  0.0328  0.0102  155 GLN A CD  
1253 O OE1 . GLN A 155 ? 1.1728 1.1820 1.0560 0.0618  0.0397  0.0125  155 GLN A OE1 
1254 N NE2 . GLN A 155 ? 0.9916 0.9955 0.8811 0.0607  0.0286  0.0084  155 GLN A NE2 
1255 N N   . LEU A 156 ? 0.4979 0.4711 0.3689 0.0487  0.0124  0.0091  156 LEU A N   
1256 C CA  . LEU A 156 ? 0.4253 0.3991 0.3070 0.0450  0.0067  0.0081  156 LEU A CA  
1257 C C   . LEU A 156 ? 0.4778 0.4418 0.3546 0.0410  0.0014  0.0090  156 LEU A C   
1258 O O   . LEU A 156 ? 0.4713 0.4385 0.3570 0.0366  -0.0012 0.0101  156 LEU A O   
1259 C CB  . LEU A 156 ? 0.3740 0.3450 0.2583 0.0476  0.0042  0.0051  156 LEU A CB  
1260 C CG  . LEU A 156 ? 0.4013 0.3740 0.2973 0.0444  0.0000  0.0038  156 LEU A CG  
1261 C CD1 . LEU A 156 ? 0.3427 0.3280 0.2514 0.0421  0.0022  0.0048  156 LEU A CD1 
1262 C CD2 . LEU A 156 ? 0.4111 0.3798 0.3071 0.0473  -0.0020 0.0013  156 LEU A CD2 
1263 N N   . ARG A 157 ? 0.4137 0.3652 0.2760 0.0426  -0.0005 0.0085  157 ARG A N   
1264 C CA  . ARG A 157 ? 0.3800 0.3209 0.2361 0.0388  -0.0063 0.0097  157 ARG A CA  
1265 C C   . ARG A 157 ? 0.4829 0.4278 0.3392 0.0350  -0.0048 0.0134  157 ARG A C   
1266 O O   . ARG A 157 ? 0.4983 0.4416 0.3600 0.0304  -0.0097 0.0150  157 ARG A O   
1267 C CB  . ARG A 157 ? 0.4099 0.3358 0.2477 0.0414  -0.0085 0.0087  157 ARG A CB  
1268 C CG  . ARG A 157 ? 0.4535 0.3670 0.2833 0.0372  -0.0154 0.0103  157 ARG A CG  
1269 C CD  . ARG A 157 ? 0.4776 0.3768 0.2856 0.0395  -0.0159 0.0102  157 ARG A CD  
1270 N NE  . ARG A 157 ? 0.6487 0.5527 0.4481 0.0426  -0.0073 0.0111  157 ARG A NE  
1271 C CZ  . ARG A 157 ? 0.7426 0.6510 0.5398 0.0402  -0.0035 0.0145  157 ARG A CZ  
1272 N NH1 . ARG A 157 ? 0.8540 0.7671 0.6441 0.0434  0.0051  0.0153  157 ARG A NH1 
1273 N NH2 . ARG A 157 ? 0.6379 0.5462 0.4405 0.0346  -0.0083 0.0174  157 ARG A NH2 
1274 N N   . ALA A 158 ? 0.4893 0.4395 0.3402 0.0370  0.0020  0.0152  158 ALA A N   
1275 C CA  . ALA A 158 ? 0.4124 0.3667 0.2629 0.0336  0.0041  0.0193  158 ALA A CA  
1276 C C   . ALA A 158 ? 0.4395 0.4046 0.3076 0.0296  0.0025  0.0207  158 ALA A C   
1277 O O   . ALA A 158 ? 0.5311 0.4962 0.4010 0.0252  0.0002  0.0240  158 ALA A O   
1278 C CB  . ALA A 158 ? 0.3031 0.2631 0.1472 0.0367  0.0129  0.0209  158 ALA A CB  
1279 N N   . TYR A 159 ? 0.4345 0.4081 0.3148 0.0310  0.0035  0.0183  159 TYR A N   
1280 C CA  . TYR A 159 ? 0.3872 0.3696 0.2828 0.0275  0.0018  0.0189  159 TYR A CA  
1281 C C   . TYR A 159 ? 0.4326 0.4080 0.3327 0.0241  -0.0055 0.0178  159 TYR A C   
1282 O O   . TYR A 159 ? 0.4489 0.4255 0.3554 0.0199  -0.0085 0.0201  159 TYR A O   
1283 C CB  . TYR A 159 ? 0.2230 0.2154 0.1286 0.0299  0.0050  0.0167  159 TYR A CB  
1284 C CG  . TYR A 159 ? 0.2686 0.2671 0.1877 0.0264  0.0024  0.0162  159 TYR A CG  
1285 C CD1 . TYR A 159 ? 0.2806 0.2875 0.2075 0.0234  0.0037  0.0191  159 TYR A CD1 
1286 C CD2 . TYR A 159 ? 0.3402 0.3355 0.2644 0.0261  -0.0013 0.0130  159 TYR A CD2 
1287 C CE1 . TYR A 159 ? 0.2746 0.2860 0.2145 0.0203  0.0013  0.0179  159 TYR A CE1 
1288 C CE2 . TYR A 159 ? 0.2956 0.2957 0.2307 0.0230  -0.0031 0.0124  159 TYR A CE2 
1289 C CZ  . TYR A 159 ? 0.3316 0.3393 0.2742 0.0202  -0.0019 0.0146  159 TYR A CZ  
1290 O OH  . TYR A 159 ? 0.2891 0.3007 0.2436 0.0173  -0.0034 0.0132  159 TYR A OH  
1291 N N   . LEU A 160 ? 0.4643 0.4325 0.3618 0.0261  -0.0082 0.0146  160 LEU A N   
1292 C CA  . LEU A 160 ? 0.4305 0.3930 0.3342 0.0233  -0.0145 0.0134  160 LEU A CA  
1293 C C   . LEU A 160 ? 0.5230 0.4764 0.4226 0.0195  -0.0203 0.0161  160 LEU A C   
1294 O O   . LEU A 160 ? 0.6275 0.5810 0.5372 0.0159  -0.0246 0.0170  160 LEU A O   
1295 C CB  . LEU A 160 ? 0.3723 0.3283 0.2731 0.0262  -0.0162 0.0100  160 LEU A CB  
1296 C CG  . LEU A 160 ? 0.3627 0.3269 0.2710 0.0289  -0.0125 0.0074  160 LEU A CG  
1297 C CD1 . LEU A 160 ? 0.3034 0.2601 0.2076 0.0318  -0.0145 0.0047  160 LEU A CD1 
1298 C CD2 . LEU A 160 ? 0.2686 0.2406 0.1908 0.0257  -0.0128 0.0072  160 LEU A CD2 
1299 N N   . ASP A 161 ? 0.5262 0.4711 0.4111 0.0204  -0.0207 0.0176  161 ASP A N   
1300 C CA  . ASP A 161 ? 0.6564 0.5913 0.5362 0.0166  -0.0271 0.0205  161 ASP A CA  
1301 C C   . ASP A 161 ? 0.6636 0.6023 0.5413 0.0139  -0.0252 0.0249  161 ASP A C   
1302 O O   . ASP A 161 ? 0.7421 0.6724 0.6142 0.0105  -0.0303 0.0279  161 ASP A O   
1303 C CB  . ASP A 161 ? 0.7391 0.6590 0.6024 0.0182  -0.0307 0.0196  161 ASP A CB  
1304 C CG  . ASP A 161 ? 0.8762 0.7940 0.7227 0.0215  -0.0249 0.0201  161 ASP A CG  
1305 O OD1 . ASP A 161 ? 0.9340 0.8618 0.7821 0.0220  -0.0184 0.0219  161 ASP A OD1 
1306 O OD2 . ASP A 161 ? 0.9071 0.8126 0.7385 0.0237  -0.0269 0.0189  161 ASP A OD2 
1307 N N   . GLY A 162 ? 0.5756 0.5266 0.4581 0.0151  -0.0183 0.0255  162 GLY A N   
1308 C CA  . GLY A 162 ? 0.5060 0.4616 0.3873 0.0127  -0.0158 0.0301  162 GLY A CA  
1309 C C   . GLY A 162 ? 0.5056 0.4743 0.4048 0.0106  -0.0139 0.0307  162 GLY A C   
1310 O O   . GLY A 162 ? 0.5560 0.5248 0.4662 0.0065  -0.0186 0.0318  162 GLY A O   
1311 N N   . THR A 163 ? 0.5037 0.4829 0.4067 0.0134  -0.0072 0.0297  163 THR A N   
1312 C CA  . THR A 163 ? 0.5150 0.5066 0.4344 0.0116  -0.0051 0.0300  163 THR A CA  
1313 C C   . THR A 163 ? 0.5203 0.5128 0.4534 0.0095  -0.0098 0.0272  163 THR A C   
1314 O O   . THR A 163 ? 0.4952 0.4910 0.4398 0.0057  -0.0120 0.0285  163 THR A O   
1315 C CB  . THR A 163 ? 0.4643 0.4657 0.3855 0.0154  0.0018  0.0289  163 THR A CB  
1316 O OG1 . THR A 163 ? 0.3780 0.3795 0.2882 0.0175  0.0072  0.0316  163 THR A OG1 
1317 C CG2 . THR A 163 ? 0.5100 0.5230 0.4476 0.0132  0.0029  0.0293  163 THR A CG2 
1318 N N   . CYS A 164 ? 0.4571 0.4465 0.3890 0.0119  -0.0109 0.0235  164 CYS A N   
1319 C CA  . CYS A 164 ? 0.4184 0.4077 0.3621 0.0102  -0.0145 0.0207  164 CYS A CA  
1320 C C   . CYS A 164 ? 0.4234 0.4063 0.3725 0.0060  -0.0206 0.0224  164 CYS A C   
1321 O O   . CYS A 164 ? 0.4182 0.4052 0.3808 0.0030  -0.0220 0.0220  164 CYS A O   
1322 C CB  . CYS A 164 ? 0.4211 0.4056 0.3601 0.0133  -0.0153 0.0174  164 CYS A CB  
1323 S SG  . CYS A 164 ? 0.6427 0.6261 0.5952 0.0114  -0.0189 0.0141  164 CYS A SG  
1324 N N   . VAL A 165 ? 0.4430 0.4154 0.3813 0.0058  -0.0245 0.0242  165 VAL A N   
1325 C CA  . VAL A 165 ? 0.4878 0.4527 0.4308 0.0018  -0.0314 0.0261  165 VAL A CA  
1326 C C   . VAL A 165 ? 0.4989 0.4682 0.4496 -0.0021 -0.0318 0.0294  165 VAL A C   
1327 O O   . VAL A 165 ? 0.4739 0.4429 0.4377 -0.0054 -0.0359 0.0295  165 VAL A O   
1328 C CB  . VAL A 165 ? 0.4950 0.4466 0.4228 0.0021  -0.0361 0.0279  165 VAL A CB  
1329 C CG1 . VAL A 165 ? 0.5504 0.4944 0.4839 -0.0025 -0.0439 0.0307  165 VAL A CG1 
1330 C CG2 . VAL A 165 ? 0.4494 0.3955 0.3722 0.0053  -0.0373 0.0247  165 VAL A CG2 
1331 N N   . GLU A 166 ? 0.4995 0.4730 0.4427 -0.0017 -0.0275 0.0322  166 GLU A N   
1332 C CA  . GLU A 166 ? 0.5372 0.5145 0.4870 -0.0056 -0.0282 0.0360  166 GLU A CA  
1333 C C   . GLU A 166 ? 0.4574 0.4454 0.4247 -0.0070 -0.0265 0.0343  166 GLU A C   
1334 O O   . GLU A 166 ? 0.4598 0.4488 0.4378 -0.0108 -0.0299 0.0361  166 GLU A O   
1335 C CB  . GLU A 166 ? 0.6154 0.5942 0.5527 -0.0050 -0.0236 0.0399  166 GLU A CB  
1336 C CG  . GLU A 166 ? 0.8655 0.8542 0.8012 -0.0012 -0.0155 0.0387  166 GLU A CG  
1337 C CD  . GLU A 166 ? 0.9889 0.9784 0.9123 -0.0003 -0.0102 0.0426  166 GLU A CD  
1338 O OE1 . GLU A 166 ? 1.0146 0.9943 0.9251 -0.0017 -0.0126 0.0454  166 GLU A OE1 
1339 O OE2 . GLU A 166 ? 0.9986 0.9981 0.9252 0.0017  -0.0037 0.0431  166 GLU A OE2 
1340 N N   . TRP A 167 ? 0.4060 0.4012 0.3759 -0.0039 -0.0218 0.0309  167 TRP A N   
1341 C CA  . TRP A 167 ? 0.4284 0.4325 0.4131 -0.0051 -0.0204 0.0288  167 TRP A CA  
1342 C C   . TRP A 167 ? 0.4231 0.4239 0.4186 -0.0065 -0.0242 0.0253  167 TRP A C   
1343 O O   . TRP A 167 ? 0.3923 0.3969 0.4007 -0.0091 -0.0253 0.0245  167 TRP A O   
1344 C CB  . TRP A 167 ? 0.4221 0.4344 0.4053 -0.0016 -0.0146 0.0268  167 TRP A CB  
1345 C CG  . TRP A 167 ? 0.4255 0.4445 0.4058 -0.0013 -0.0103 0.0305  167 TRP A CG  
1346 C CD1 . TRP A 167 ? 0.3465 0.3643 0.3142 0.0012  -0.0068 0.0329  167 TRP A CD1 
1347 C CD2 . TRP A 167 ? 0.4347 0.4626 0.4256 -0.0035 -0.0090 0.0323  167 TRP A CD2 
1348 N NE1 . TRP A 167 ? 0.3888 0.4148 0.3594 0.0007  -0.0029 0.0363  167 TRP A NE1 
1349 C CE2 . TRP A 167 ? 0.3995 0.4319 0.3846 -0.0022 -0.0045 0.0362  167 TRP A CE2 
1350 C CE3 . TRP A 167 ? 0.4415 0.4737 0.4462 -0.0063 -0.0112 0.0310  167 TRP A CE3 
1351 C CZ2 . TRP A 167 ? 0.3870 0.4284 0.3809 -0.0039 -0.0025 0.0392  167 TRP A CZ2 
1352 C CZ3 . TRP A 167 ? 0.4203 0.4607 0.4326 -0.0080 -0.0097 0.0337  167 TRP A CZ3 
1353 C CH2 . TRP A 167 ? 0.3952 0.4404 0.4027 -0.0069 -0.0056 0.0380  167 TRP A CH2 
1354 N N   . LEU A 168 ? 0.3706 0.3644 0.3615 -0.0048 -0.0260 0.0232  168 LEU A N   
1355 C CA  . LEU A 168 ? 0.3475 0.3376 0.3493 -0.0062 -0.0295 0.0205  168 LEU A CA  
1356 C C   . LEU A 168 ? 0.4407 0.4271 0.4517 -0.0104 -0.0348 0.0230  168 LEU A C   
1357 O O   . LEU A 168 ? 0.4211 0.4098 0.4462 -0.0125 -0.0357 0.0212  168 LEU A O   
1358 C CB  . LEU A 168 ? 0.2242 0.2064 0.2193 -0.0040 -0.0314 0.0190  168 LEU A CB  
1359 C CG  . LEU A 168 ? 0.2227 0.2001 0.2299 -0.0057 -0.0352 0.0170  168 LEU A CG  
1360 C CD1 . LEU A 168 ? 0.2035 0.1879 0.2235 -0.0062 -0.0317 0.0132  168 LEU A CD1 
1361 C CD2 . LEU A 168 ? 0.1713 0.1412 0.1722 -0.0035 -0.0373 0.0159  168 LEU A CD2 
1362 N N   . ARG A 169 ? 0.4530 0.4331 0.4554 -0.0117 -0.0384 0.0272  169 ARG A N   
1363 C CA  . ARG A 169 ? 0.4536 0.4295 0.4635 -0.0159 -0.0442 0.0305  169 ARG A CA  
1364 C C   . ARG A 169 ? 0.4233 0.4077 0.4441 -0.0183 -0.0425 0.0311  169 ARG A C   
1365 O O   . ARG A 169 ? 0.4975 0.4812 0.5322 -0.0213 -0.0462 0.0312  169 ARG A O   
1366 C CB  . ARG A 169 ? 0.5391 0.5076 0.5346 -0.0170 -0.0474 0.0354  169 ARG A CB  
1367 C CG  . ARG A 169 ? 0.5974 0.5545 0.5820 -0.0158 -0.0516 0.0356  169 ARG A CG  
1368 C CD  . ARG A 169 ? 0.7827 0.7315 0.7537 -0.0180 -0.0556 0.0409  169 ARG A CD  
1369 N NE  . ARG A 169 ? 0.9860 0.9233 0.9413 -0.0164 -0.0588 0.0412  169 ARG A NE  
1370 C CZ  . ARG A 169 ? 1.0869 1.0215 1.0229 -0.0137 -0.0552 0.0420  169 ARG A CZ  
1371 N NH1 . ARG A 169 ? 1.1145 1.0374 1.0364 -0.0124 -0.0590 0.0419  169 ARG A NH1 
1372 N NH2 . ARG A 169 ? 1.0691 1.0123 1.0001 -0.0124 -0.0478 0.0429  169 ARG A NH2 
1373 N N   . ARG A 170 ? 0.3606 0.3528 0.3759 -0.0168 -0.0370 0.0318  170 ARG A N   
1374 C CA  . ARG A 170 ? 0.3539 0.3542 0.3787 -0.0189 -0.0355 0.0329  170 ARG A CA  
1375 C C   . ARG A 170 ? 0.3698 0.3740 0.4093 -0.0193 -0.0351 0.0281  170 ARG A C   
1376 O O   . ARG A 170 ? 0.3688 0.3743 0.4206 -0.0224 -0.0377 0.0284  170 ARG A O   
1377 C CB  . ARG A 170 ? 0.2937 0.3018 0.3104 -0.0167 -0.0296 0.0344  170 ARG A CB  
1378 C CG  . ARG A 170 ? 0.3708 0.3873 0.3972 -0.0190 -0.0284 0.0362  170 ARG A CG  
1379 C CD  . ARG A 170 ? 0.4366 0.4615 0.4582 -0.0164 -0.0223 0.0367  170 ARG A CD  
1380 N NE  . ARG A 170 ? 0.5947 0.6278 0.6277 -0.0185 -0.0218 0.0376  170 ARG A NE  
1381 C CZ  . ARG A 170 ? 0.7808 0.8176 0.8162 -0.0210 -0.0219 0.0428  170 ARG A CZ  
1382 N NH1 . ARG A 170 ? 0.7819 0.8146 0.8079 -0.0218 -0.0220 0.0475  170 ARG A NH1 
1383 N NH2 . ARG A 170 ? 0.8432 0.8871 0.8899 -0.0230 -0.0221 0.0434  170 ARG A NH2 
1384 N N   . TYR A 171 ? 0.2731 0.2785 0.3107 -0.0163 -0.0317 0.0236  171 TYR A N   
1385 C CA  . TYR A 171 ? 0.2674 0.2753 0.3163 -0.0165 -0.0305 0.0187  171 TYR A CA  
1386 C C   . TYR A 171 ? 0.3209 0.3227 0.3817 -0.0187 -0.0349 0.0175  171 TYR A C   
1387 O O   . TYR A 171 ? 0.3872 0.3908 0.4606 -0.0208 -0.0356 0.0156  171 TYR A O   
1388 C CB  . TYR A 171 ? 0.3042 0.3130 0.3469 -0.0129 -0.0264 0.0148  171 TYR A CB  
1389 C CG  . TYR A 171 ? 0.3587 0.3739 0.3920 -0.0105 -0.0220 0.0154  171 TYR A CG  
1390 C CD1 . TYR A 171 ? 0.4052 0.4272 0.4410 -0.0117 -0.0209 0.0177  171 TYR A CD1 
1391 C CD2 . TYR A 171 ? 0.3723 0.3868 0.3955 -0.0069 -0.0194 0.0140  171 TYR A CD2 
1392 C CE1 . TYR A 171 ? 0.4322 0.4603 0.4614 -0.0094 -0.0171 0.0186  171 TYR A CE1 
1393 C CE2 . TYR A 171 ? 0.4429 0.4631 0.4590 -0.0045 -0.0156 0.0147  171 TYR A CE2 
1394 C CZ  . TYR A 171 ? 0.4571 0.4843 0.4766 -0.0058 -0.0144 0.0171  171 TYR A CZ  
1395 O OH  . TYR A 171 ? 0.4159 0.4491 0.4302 -0.0034 -0.0107 0.0180  171 TYR A OH  
1396 N N   . LEU A 172 ? 0.3214 0.3158 0.3787 -0.0183 -0.0380 0.0184  172 LEU A N   
1397 C CA  . LEU A 172 ? 0.3208 0.3089 0.3903 -0.0203 -0.0427 0.0178  172 LEU A CA  
1398 C C   . LEU A 172 ? 0.3577 0.3454 0.4378 -0.0241 -0.0472 0.0206  172 LEU A C   
1399 O O   . LEU A 172 ? 0.3669 0.3519 0.4597 -0.0239 -0.0494 0.0195  172 LEU A O   
1400 C CB  . LEU A 172 ? 0.3669 0.3463 0.4292 -0.0196 -0.0467 0.0199  172 LEU A CB  
1401 C CG  . LEU A 172 ? 0.3700 0.3482 0.4248 -0.0160 -0.0436 0.0170  172 LEU A CG  
1402 C CD1 . LEU A 172 ? 0.3255 0.2942 0.3735 -0.0158 -0.0488 0.0194  172 LEU A CD1 
1403 C CD2 . LEU A 172 ? 0.4189 0.3992 0.4863 -0.0155 -0.0405 0.0120  172 LEU A CD2 
1404 N N   . GLU A 173 ? 0.4661 0.4564 0.5391 -0.0254 -0.0477 0.0249  173 GLU A N   
1405 C CA  . GLU A 173 ? 0.5487 0.5387 0.6307 -0.0293 -0.0522 0.0283  173 GLU A CA  
1406 C C   . GLU A 173 ? 0.4687 0.4662 0.5607 -0.0299 -0.0494 0.0260  173 GLU A C   
1407 O O   . GLU A 173 ? 0.5727 0.5679 0.6761 -0.0298 -0.0518 0.0257  173 GLU A O   
1408 C CB  . GLU A 173 ? 0.7073 0.6958 0.7768 -0.0306 -0.0541 0.0346  173 GLU A CB  
1409 C CG  . GLU A 173 ? 0.8652 0.8520 0.9430 -0.0351 -0.0598 0.0390  173 GLU A CG  
1410 C CD  . GLU A 173 ? 0.9539 0.9330 1.0445 -0.0375 -0.0667 0.0388  173 GLU A CD  
1411 O OE1 . GLU A 173 ? 0.9449 0.9181 1.0343 -0.0359 -0.0680 0.0369  173 GLU A OE1 
1412 O OE2 . GLU A 173 ? 0.9769 0.9556 1.0788 -0.0399 -0.0709 0.0410  173 GLU A OE2 
1413 N N   . ASN A 174 ? 0.3990 0.4037 0.4842 -0.0282 -0.0441 0.0249  174 ASN A N   
1414 C CA  . ASN A 174 ? 0.4047 0.4154 0.4972 -0.0285 -0.0419 0.0228  174 ASN A CA  
1415 C C   . ASN A 174 ? 0.3943 0.4022 0.4938 -0.0257 -0.0396 0.0169  174 ASN A C   
1416 O O   . ASN A 174 ? 0.5146 0.5233 0.6223 -0.0258 -0.0396 0.0152  174 ASN A O   
1417 C CB  . ASN A 174 ? 0.4847 0.5033 0.5682 -0.0270 -0.0372 0.0233  174 ASN A CB  
1418 C CG  . ASN A 174 ? 0.5361 0.5571 0.6130 -0.0282 -0.0378 0.0297  174 ASN A CG  
1419 O OD1 . ASN A 174 ? 0.5763 0.5990 0.6409 -0.0259 -0.0345 0.0316  174 ASN A OD1 
1420 N ND2 . ASN A 174 ? 0.5943 0.6154 0.6796 -0.0319 -0.0418 0.0332  174 ASN A ND2 
1421 N N   . GLY A 175 ? 0.2997 0.3047 0.3965 -0.0233 -0.0375 0.0136  175 GLY A N   
1422 C CA  . GLY A 175 ? 0.3563 0.3593 0.4600 -0.0210 -0.0347 0.0080  175 GLY A CA  
1423 C C   . GLY A 175 ? 0.4406 0.4374 0.5530 -0.0201 -0.0375 0.0077  175 GLY A C   
1424 O O   . GLY A 175 ? 0.4234 0.4189 0.5398 -0.0179 -0.0345 0.0034  175 GLY A O   
1425 N N   . LYS A 176 ? 0.4936 0.4869 0.6096 -0.0219 -0.0435 0.0125  176 LYS A N   
1426 C CA  . LYS A 176 ? 0.5170 0.5046 0.6410 -0.0213 -0.0477 0.0134  176 LYS A CA  
1427 C C   . LYS A 176 ? 0.5006 0.4877 0.6402 -0.0191 -0.0460 0.0088  176 LYS A C   
1428 O O   . LYS A 176 ? 0.5115 0.4961 0.6569 -0.0175 -0.0464 0.0077  176 LYS A O   
1429 C CB  . LYS A 176 ? 0.5988 0.5826 0.7251 -0.0243 -0.0552 0.0195  176 LYS A CB  
1430 C CG  . LYS A 176 ? 0.6976 0.6826 0.8349 -0.0257 -0.0576 0.0205  176 LYS A CG  
1431 C CD  . LYS A 176 ? 0.8051 0.7847 0.9498 -0.0280 -0.0660 0.0256  176 LYS A CD  
1432 C CE  . LYS A 176 ? 0.8617 0.8381 0.9925 -0.0313 -0.0701 0.0313  176 LYS A CE  
1433 N NZ  . LYS A 176 ? 0.8205 0.7900 0.9570 -0.0337 -0.0790 0.0362  176 LYS A NZ  
1434 N N   . GLU A 177 ? 0.4868 0.4764 0.6335 -0.0193 -0.0440 0.0062  177 GLU A N   
1435 C CA  . GLU A 177 ? 0.5794 0.5686 0.7415 -0.0178 -0.0419 0.0013  177 GLU A CA  
1436 C C   . GLU A 177 ? 0.6271 0.6185 0.7862 -0.0159 -0.0343 -0.0048 177 GLU A C   
1437 O O   . GLU A 177 ? 0.7322 0.7234 0.9031 -0.0149 -0.0311 -0.0095 177 GLU A O   
1438 C CB  . GLU A 177 ? 0.6887 0.6788 0.8601 -0.0191 -0.0433 0.0005  177 GLU A CB  
1439 C CG  . GLU A 177 ? 0.8244 0.8185 0.9866 -0.0200 -0.0398 -0.0013 177 GLU A CG  
1440 C CD  . GLU A 177 ? 0.9819 0.9764 1.1543 -0.0213 -0.0417 -0.0025 177 GLU A CD  
1441 O OE1 . GLU A 177 ? 1.0099 1.0017 1.1949 -0.0219 -0.0467 -0.0003 177 GLU A OE1 
1442 O OE2 . GLU A 177 ? 1.0197 1.0169 1.1879 -0.0219 -0.0386 -0.0055 177 GLU A OE2 
1443 N N   . THR A 178 ? 0.5455 0.5390 0.6891 -0.0159 -0.0313 -0.0048 178 THR A N   
1444 C CA  . THR A 178 ? 0.5353 0.5304 0.6739 -0.0146 -0.0246 -0.0099 178 THR A CA  
1445 C C   . THR A 178 ? 0.5505 0.5440 0.6828 -0.0133 -0.0242 -0.0087 178 THR A C   
1446 O O   . THR A 178 ? 0.6066 0.5996 0.7430 -0.0120 -0.0203 -0.0121 178 THR A O   
1447 C CB  . THR A 178 ? 0.6050 0.6040 0.7314 -0.0155 -0.0218 -0.0112 178 THR A CB  
1448 O OG1 . THR A 178 ? 0.6997 0.6999 0.8320 -0.0169 -0.0226 -0.0124 178 THR A OG1 
1449 C CG2 . THR A 178 ? 0.5740 0.5739 0.6945 -0.0147 -0.0155 -0.0162 178 THR A CG2 
1450 N N   . LEU A 179 ? 0.4577 0.4503 0.5806 -0.0138 -0.0283 -0.0037 179 LEU A N   
1451 C CA  . LEU A 179 ? 0.3652 0.3557 0.4802 -0.0128 -0.0286 -0.0024 179 LEU A CA  
1452 C C   . LEU A 179 ? 0.4309 0.4170 0.5547 -0.0124 -0.0338 0.0003  179 LEU A C   
1453 O O   . LEU A 179 ? 0.5651 0.5495 0.6888 -0.0111 -0.0332 -0.0003 179 LEU A O   
1454 C CB  . LEU A 179 ? 0.3670 0.3584 0.4666 -0.0140 -0.0300 0.0009  179 LEU A CB  
1455 C CG  . LEU A 179 ? 0.3803 0.3774 0.4710 -0.0142 -0.0254 -0.0012 179 LEU A CG  
1456 C CD1 . LEU A 179 ? 0.4290 0.4289 0.5094 -0.0158 -0.0276 0.0029  179 LEU A CD1 
1457 C CD2 . LEU A 179 ? 0.4176 0.4152 0.5031 -0.0126 -0.0207 -0.0050 179 LEU A CD2 
1458 N N   . GLN A 180 ? 0.4878 0.4719 0.6195 -0.0138 -0.0395 0.0036  180 GLN A N   
1459 C CA  . GLN A 180 ? 0.4873 0.4671 0.6285 -0.0139 -0.0458 0.0067  180 GLN A CA  
1460 C C   . GLN A 180 ? 0.5035 0.4841 0.6649 -0.0127 -0.0447 0.0037  180 GLN A C   
1461 O O   . GLN A 180 ? 0.4658 0.4438 0.6400 -0.0132 -0.0507 0.0063  180 GLN A O   
1462 C CB  . GLN A 180 ? 0.4067 0.3828 0.5448 -0.0165 -0.0535 0.0125  180 GLN A CB  
1463 C CG  . GLN A 180 ? 0.4508 0.4249 0.5696 -0.0181 -0.0547 0.0155  180 GLN A CG  
1464 C CD  . GLN A 180 ? 0.6256 0.5953 0.7408 -0.0216 -0.0621 0.0213  180 GLN A CD  
1465 O OE1 . GLN A 180 ? 0.7285 0.6943 0.8541 -0.0225 -0.0687 0.0239  180 GLN A OE1 
1466 N NE2 . GLN A 180 ? 0.5891 0.5595 0.6902 -0.0238 -0.0611 0.0233  180 GLN A NE2 
1467 N N   . ARG A 181 ? 0.5696 0.5538 0.7342 -0.0116 -0.0371 -0.0018 181 ARG A N   
1468 C CA  . ARG A 181 ? 0.5550 0.5400 0.7385 -0.0108 -0.0342 -0.0057 181 ARG A CA  
1469 C C   . ARG A 181 ? 0.5358 0.5208 0.7228 -0.0094 -0.0309 -0.0075 181 ARG A C   
1470 O O   . ARG A 181 ? 0.5100 0.4949 0.6834 -0.0089 -0.0296 -0.0068 181 ARG A O   
1471 C CB  . ARG A 181 ? 0.5728 0.5607 0.7574 -0.0110 -0.0276 -0.0112 181 ARG A CB  
1472 C CG  . ARG A 181 ? 0.6313 0.6210 0.8094 -0.0104 -0.0191 -0.0163 181 ARG A CG  
1473 C CD  . ARG A 181 ? 0.7397 0.7311 0.9185 -0.0113 -0.0136 -0.0218 181 ARG A CD  
1474 N NE  . ARG A 181 ? 0.7777 0.7696 0.9527 -0.0113 -0.0054 -0.0270 181 ARG A NE  
1475 C CZ  . ARG A 181 ? 0.7868 0.7796 0.9449 -0.0116 -0.0023 -0.0281 181 ARG A CZ  
1476 N NH1 . ARG A 181 ? 0.7723 0.7664 0.9170 -0.0118 -0.0062 -0.0244 181 ARG A NH1 
1477 N NH2 . ARG A 181 ? 0.7810 0.7731 0.9360 -0.0120 0.0049  -0.0327 181 ARG A NH2 
1478 N N   . THR A 182 ? 0.5828 0.6359 0.5844 -0.0223 0.0104  -0.0324 182 THR A N   
1479 C CA  . THR A 182 ? 0.4970 0.5469 0.5041 -0.0208 0.0100  -0.0329 182 THR A CA  
1480 C C   . THR A 182 ? 0.4987 0.5423 0.5045 -0.0211 0.0113  -0.0293 182 THR A C   
1481 O O   . THR A 182 ? 0.5974 0.6390 0.5987 -0.0220 0.0120  -0.0269 182 THR A O   
1482 C CB  . THR A 182 ? 0.4479 0.5000 0.4579 -0.0200 0.0087  -0.0349 182 THR A CB  
1483 O OG1 . THR A 182 ? 0.4946 0.5466 0.5110 -0.0186 0.0077  -0.0375 182 THR A OG1 
1484 C CG2 . THR A 182 ? 0.3262 0.3749 0.3350 -0.0202 0.0092  -0.0321 182 THR A CG2 
1485 N N   . ASP A 183 ? 0.4538 0.4943 0.4634 -0.0201 0.0117  -0.0288 183 ASP A N   
1486 C CA  . ASP A 183 ? 0.4563 0.4913 0.4651 -0.0200 0.0129  -0.0254 183 ASP A CA  
1487 C C   . ASP A 183 ? 0.3549 0.3879 0.3697 -0.0185 0.0126  -0.0252 183 ASP A C   
1488 O O   . ASP A 183 ? 0.3690 0.4023 0.3890 -0.0176 0.0122  -0.0267 183 ASP A O   
1489 C CB  . ASP A 183 ? 0.6195 0.6528 0.6269 -0.0201 0.0138  -0.0243 183 ASP A CB  
1490 C CG  . ASP A 183 ? 0.7577 0.7893 0.7580 -0.0218 0.0147  -0.0222 183 ASP A CG  
1491 O OD1 . ASP A 183 ? 0.8334 0.8618 0.8303 -0.0222 0.0152  -0.0201 183 ASP A OD1 
1492 O OD2 . ASP A 183 ? 0.7796 0.8132 0.7778 -0.0228 0.0148  -0.0227 183 ASP A OD2 
1493 N N   . PRO A 184 ? 0.3752 0.4061 0.3895 -0.0183 0.0128  -0.0232 184 PRO A N   
1494 C CA  . PRO A 184 ? 0.2993 0.3290 0.3197 -0.0172 0.0125  -0.0228 184 PRO A CA  
1495 C C   . PRO A 184 ? 0.2392 0.2649 0.2618 -0.0162 0.0136  -0.0203 184 PRO A C   
1496 O O   . PRO A 184 ? 0.2883 0.3116 0.3063 -0.0163 0.0149  -0.0183 184 PRO A O   
1497 C CB  . PRO A 184 ? 0.2372 0.2662 0.2550 -0.0172 0.0127  -0.0206 184 PRO A CB  
1498 C CG  . PRO A 184 ? 0.2869 0.3136 0.2971 -0.0179 0.0139  -0.0186 184 PRO A CG  
1499 C CD  . PRO A 184 ? 0.3396 0.3690 0.3476 -0.0191 0.0135  -0.0210 184 PRO A CD  
1500 N N   . PRO A 185 ? 0.1730 0.1982 0.2024 -0.0153 0.0133  -0.0204 185 PRO A N   
1501 C CA  . PRO A 185 ? 0.2989 0.3206 0.3308 -0.0141 0.0145  -0.0176 185 PRO A CA  
1502 C C   . PRO A 185 ? 0.3951 0.4138 0.4246 -0.0134 0.0158  -0.0136 185 PRO A C   
1503 O O   . PRO A 185 ? 0.4232 0.4426 0.4532 -0.0135 0.0153  -0.0130 185 PRO A O   
1504 C CB  . PRO A 185 ? 0.2915 0.3138 0.3318 -0.0136 0.0136  -0.0189 185 PRO A CB  
1505 C CG  . PRO A 185 ? 0.1759 0.2011 0.2175 -0.0145 0.0119  -0.0212 185 PRO A CG  
1506 C CD  . PRO A 185 ? 0.1588 0.1865 0.1941 -0.0154 0.0116  -0.0232 185 PRO A CD  
1507 N N   . LYS A 186 ? 0.4660 0.4817 0.4927 -0.0126 0.0172  -0.0111 186 LYS A N   
1508 C CA  . LYS A 186 ? 0.3549 0.3674 0.3800 -0.0113 0.0186  -0.0071 186 LYS A CA  
1509 C C   . LYS A 186 ? 0.3472 0.3593 0.3798 -0.0099 0.0189  -0.0054 186 LYS A C   
1510 O O   . LYS A 186 ? 0.3778 0.3895 0.4131 -0.0093 0.0193  -0.0054 186 LYS A O   
1511 C CB  . LYS A 186 ? 0.3536 0.3630 0.3719 -0.0109 0.0199  -0.0054 186 LYS A CB  
1512 C CG  . LYS A 186 ? 0.4049 0.4131 0.4153 -0.0120 0.0200  -0.0054 186 LYS A CG  
1513 C CD  . LYS A 186 ? 0.4516 0.4632 0.4608 -0.0141 0.0187  -0.0088 186 LYS A CD  
1514 C CE  . LYS A 186 ? 0.4530 0.4660 0.4612 -0.0150 0.0185  -0.0107 186 LYS A CE  
1515 N NZ  . LYS A 186 ? 0.4624 0.4791 0.4689 -0.0168 0.0174  -0.0137 186 LYS A NZ  
1516 N N   . THR A 187 ? 0.3270 0.3395 0.3632 -0.0094 0.0188  -0.0037 187 THR A N   
1517 C CA  . THR A 187 ? 0.3526 0.3652 0.3967 -0.0085 0.0189  -0.0021 187 THR A CA  
1518 C C   . THR A 187 ? 0.4021 0.4129 0.4463 -0.0065 0.0206  0.0027  187 THR A C   
1519 O O   . THR A 187 ? 0.4729 0.4830 0.5123 -0.0059 0.0212  0.0045  187 THR A O   
1520 C CB  . THR A 187 ? 0.2762 0.2918 0.3267 -0.0097 0.0171  -0.0042 187 THR A CB  
1521 O OG1 . THR A 187 ? 0.3414 0.3582 0.3903 -0.0097 0.0170  -0.0027 187 THR A OG1 
1522 C CG2 . THR A 187 ? 0.3178 0.3354 0.3676 -0.0113 0.0155  -0.0090 187 THR A CG2 
1523 N N   . HIS A 188 ? 0.3774 0.3876 0.4270 -0.0053 0.0213  0.0048  188 HIS A N   
1524 C CA  . HIS A 188 ? 0.3110 0.3204 0.3624 -0.0034 0.0228  0.0095  188 HIS A CA  
1525 C C   . HIS A 188 ? 0.3570 0.3671 0.4174 -0.0030 0.0229  0.0109  188 HIS A C   
1526 O O   . HIS A 188 ? 0.3293 0.3396 0.3935 -0.0039 0.0221  0.0082  188 HIS A O   
1527 C CB  . HIS A 188 ? 0.2730 0.2797 0.3172 -0.0014 0.0246  0.0120  188 HIS A CB  
1528 C CG  . HIS A 188 ? 0.3598 0.3654 0.4045 -0.0005 0.0254  0.0121  188 HIS A CG  
1529 N ND1 . HIS A 188 ? 0.3608 0.3663 0.4027 -0.0018 0.0247  0.0087  188 HIS A ND1 
1530 C CD2 . HIS A 188 ? 0.4317 0.4367 0.4791 0.0016  0.0268  0.0154  188 HIS A CD2 
1531 C CE1 . HIS A 188 ? 0.3615 0.3664 0.4045 -0.0004 0.0257  0.0099  188 HIS A CE1 
1532 N NE2 . HIS A 188 ? 0.4229 0.4275 0.4692 0.0017  0.0270  0.0139  188 HIS A NE2 
1533 N N   . MET A 189 ? 0.3534 0.3639 0.4174 -0.0014 0.0241  0.0152  189 MET A N   
1534 C CA  . MET A 189 ? 0.3659 0.3770 0.4389 -0.0011 0.0243  0.0172  189 MET A CA  
1535 C C   . MET A 189 ? 0.4459 0.4559 0.5184 0.0018  0.0266  0.0220  189 MET A C   
1536 O O   . MET A 189 ? 0.4861 0.4955 0.5526 0.0037  0.0279  0.0245  189 MET A O   
1537 C CB  . MET A 189 ? 0.3290 0.3427 0.4089 -0.0023 0.0233  0.0183  189 MET A CB  
1538 C CG  . MET A 189 ? 0.3884 0.4035 0.4713 -0.0051 0.0209  0.0135  189 MET A CG  
1539 S SD  . MET A 189 ? 0.5072 0.5260 0.5975 -0.0066 0.0195  0.0148  189 MET A SD  
1540 C CE  . MET A 189 ? 0.3365 0.3567 0.4186 -0.0051 0.0205  0.0170  189 MET A CE  
1541 N N   . THR A 190 ? 0.4950 0.5047 0.5736 0.0024  0.0272  0.0232  190 THR A N   
1542 C CA  . THR A 190 ? 0.4936 0.5029 0.5726 0.0053  0.0294  0.0279  190 THR A CA  
1543 C C   . THR A 190 ? 0.3816 0.3923 0.4708 0.0054  0.0298  0.0313  190 THR A C   
1544 O O   . THR A 190 ? 0.2551 0.2659 0.3511 0.0032  0.0283  0.0291  190 THR A O   
1545 C CB  . THR A 190 ? 0.4899 0.4976 0.5644 0.0066  0.0302  0.0270  190 THR A CB  
1546 O OG1 . THR A 190 ? 0.5917 0.5992 0.6718 0.0054  0.0294  0.0246  190 THR A OG1 
1547 C CG2 . THR A 190 ? 0.5013 0.5078 0.5661 0.0059  0.0297  0.0237  190 THR A CG2 
1548 N N   . HIS A 191 ? 0.3711 0.3827 0.4614 0.0081  0.0317  0.0366  191 HIS A N   
1549 C CA  . HIS A 191 ? 0.2666 0.2799 0.3666 0.0084  0.0324  0.0408  191 HIS A CA  
1550 C C   . HIS A 191 ? 0.2778 0.2904 0.3796 0.0108  0.0342  0.0436  191 HIS A C   
1551 O O   . HIS A 191 ? 0.2500 0.2620 0.3449 0.0135  0.0357  0.0447  191 HIS A O   
1552 C CB  . HIS A 191 ? 0.3271 0.3431 0.4270 0.0099  0.0334  0.0453  191 HIS A CB  
1553 C CG  . HIS A 191 ? 0.4888 0.5074 0.5991 0.0094  0.0337  0.0494  191 HIS A CG  
1554 N ND1 . HIS A 191 ? 0.5128 0.5342 0.6248 0.0120  0.0356  0.0554  191 HIS A ND1 
1555 C CD2 . HIS A 191 ? 0.5172 0.5362 0.6369 0.0064  0.0322  0.0484  191 HIS A CD2 
1556 C CE1 . HIS A 191 ? 0.4829 0.5066 0.6051 0.0105  0.0353  0.0582  191 HIS A CE1 
1557 N NE2 . HIS A 191 ? 0.4986 0.5206 0.6255 0.0070  0.0332  0.0540  191 HIS A NE2 
1558 N N   . HIS A 192 ? 0.3558 0.3683 0.4667 0.0100  0.0341  0.0447  192 HIS A N   
1559 C CA  . HIS A 192 ? 0.4501 0.4621 0.5635 0.0124  0.0360  0.0477  192 HIS A CA  
1560 C C   . HIS A 192 ? 0.4408 0.4540 0.5652 0.0123  0.0368  0.0524  192 HIS A C   
1561 O O   . HIS A 192 ? 0.4894 0.5010 0.6210 0.0101  0.0356  0.0507  192 HIS A O   
1562 C CB  . HIS A 192 ? 0.5770 0.5866 0.6893 0.0117  0.0352  0.0433  192 HIS A CB  
1563 C CG  . HIS A 192 ? 0.6491 0.6579 0.7513 0.0115  0.0345  0.0389  192 HIS A CG  
1564 N ND1 . HIS A 192 ? 0.6389 0.6477 0.7339 0.0141  0.0359  0.0397  192 HIS A ND1 
1565 C CD2 . HIS A 192 ? 0.6258 0.6338 0.7243 0.0090  0.0325  0.0337  192 HIS A CD2 
1566 C CE1 . HIS A 192 ? 0.6505 0.6584 0.7378 0.0129  0.0347  0.0353  192 HIS A CE1 
1567 N NE2 . HIS A 192 ? 0.6687 0.6762 0.7580 0.0099  0.0328  0.0317  192 HIS A NE2 
1568 N N   . PRO A 193 ? 0.4575 0.4734 0.5831 0.0149  0.0387  0.0584  193 PRO A N   
1569 C CA  . PRO A 193 ? 0.5345 0.5520 0.6706 0.0149  0.0397  0.0635  193 PRO A CA  
1570 C C   . PRO A 193 ? 0.6632 0.6785 0.8033 0.0158  0.0406  0.0641  193 PRO A C   
1571 O O   . PRO A 193 ? 0.7003 0.7150 0.8344 0.0185  0.0418  0.0638  193 PRO A O   
1572 C CB  . PRO A 193 ? 0.4422 0.4632 0.5761 0.0185  0.0420  0.0697  193 PRO A CB  
1573 C CG  . PRO A 193 ? 0.4662 0.4875 0.5902 0.0190  0.0414  0.0671  193 PRO A CG  
1574 C CD  . PRO A 193 ? 0.4907 0.5084 0.6082 0.0176  0.0399  0.0605  193 PRO A CD  
1575 N N   . ILE A 194 ? 0.6985 0.7126 0.8487 0.0135  0.0399  0.0648  194 ILE A N   
1576 C CA  . ILE A 194 ? 0.7246 0.7365 0.8800 0.0145  0.0409  0.0661  194 ILE A CA  
1577 C C   . ILE A 194 ? 0.7815 0.7960 0.9439 0.0165  0.0433  0.0739  194 ILE A C   
1578 O O   . ILE A 194 ? 0.7915 0.8065 0.9538 0.0199  0.0455  0.0774  194 ILE A O   
1579 C CB  . ILE A 194 ? 0.6917 0.6998 0.8542 0.0107  0.0388  0.0621  194 ILE A CB  
1580 C CG1 . ILE A 194 ? 0.5975 0.6036 0.7537 0.0086  0.0363  0.0545  194 ILE A CG1 
1581 C CG2 . ILE A 194 ? 0.7358 0.7410 0.9034 0.0120  0.0400  0.0637  194 ILE A CG2 
1582 C CD1 . ILE A 194 ? 0.5852 0.5881 0.7478 0.0047  0.0338  0.0502  194 ILE A CD1 
1583 N N   . SER A 195 ? 0.7541 0.7709 0.9229 0.0145  0.0428  0.0767  195 SER A N   
1584 C CA  . SER A 195 ? 0.6815 0.7015 0.8578 0.0160  0.0449  0.0844  195 SER A CA  
1585 C C   . SER A 195 ? 0.7380 0.7625 0.9148 0.0153  0.0446  0.0871  195 SER A C   
1586 O O   . SER A 195 ? 0.7524 0.7779 0.9212 0.0155  0.0438  0.0841  195 SER A O   
1587 C CB  . SER A 195 ? 0.5997 0.6170 0.7876 0.0132  0.0444  0.0857  195 SER A CB  
1588 O OG  . SER A 195 ? 0.5027 0.5182 0.6947 0.0084  0.0414  0.0813  195 SER A OG  
1589 N N   . ASP A 196 ? 0.8104 0.8379 0.9966 0.0146  0.0455  0.0930  196 ASP A N   
1590 C CA  . ASP A 196 ? 0.8889 0.9215 1.0767 0.0140  0.0453  0.0961  196 ASP A CA  
1591 C C   . ASP A 196 ? 0.8218 0.8536 1.0146 0.0086  0.0421  0.0920  196 ASP A C   
1592 O O   . ASP A 196 ? 0.8166 0.8523 1.0086 0.0077  0.0413  0.0924  196 ASP A O   
1593 C CB  . ASP A 196 ? 1.0167 1.0540 1.2122 0.0159  0.0478  0.1049  196 ASP A CB  
1594 C CG  . ASP A 196 ? 1.1036 1.1436 1.2926 0.0218  0.0509  0.1093  196 ASP A CG  
1595 O OD1 . ASP A 196 ? 1.1556 1.2011 1.3478 0.0243  0.0529  0.1163  196 ASP A OD1 
1596 O OD2 . ASP A 196 ? 1.0796 1.1165 1.2601 0.0241  0.0512  0.1058  196 ASP A OD2 
1597 N N   . HIS A 197 ? 0.7993 0.8262 0.9970 0.0053  0.0403  0.0878  197 HIS A N   
1598 C CA  . HIS A 197 ? 0.8033 0.8292 1.0065 0.0001  0.0372  0.0838  197 HIS A CA  
1599 C C   . HIS A 197 ? 0.6884 0.7103 0.8847 -0.0016 0.0347  0.0751  197 HIS A C   
1600 O O   . HIS A 197 ? 0.5973 0.6189 0.7962 -0.0055 0.0319  0.0710  197 HIS A O   
1601 C CB  . HIS A 197 ? 0.9266 0.9499 1.1420 -0.0028 0.0367  0.0858  197 HIS A CB  
1602 C CG  . HIS A 197 ? 1.0636 1.0909 1.2866 -0.0014 0.0392  0.0946  197 HIS A CG  
1603 N ND1 . HIS A 197 ? 1.1209 1.1549 1.3463 -0.0013 0.0398  0.0997  197 HIS A ND1 
1604 C CD2 . HIS A 197 ? 1.1102 1.1359 1.3391 0.0002  0.0414  0.0995  197 HIS A CD2 
1605 C CE1 . HIS A 197 ? 1.1376 1.1743 1.3701 0.0003  0.0422  0.1074  197 HIS A CE1 
1606 N NE2 . HIS A 197 ? 1.1489 1.1806 1.3837 0.0011  0.0432  0.1075  197 HIS A NE2 
1607 N N   . GLU A 198 ? 0.5681 0.5873 0.7557 0.0013  0.0356  0.0724  198 GLU A N   
1608 C CA  . GLU A 198 ? 0.5166 0.5323 0.6979 -0.0002 0.0334  0.0645  198 GLU A CA  
1609 C C   . GLU A 198 ? 0.4510 0.4670 0.6201 0.0029  0.0343  0.0624  198 GLU A C   
1610 O O   . GLU A 198 ? 0.5131 0.5310 0.6781 0.0067  0.0368  0.0667  198 GLU A O   
1611 C CB  . GLU A 198 ? 0.4990 0.5092 0.6843 -0.0013 0.0328  0.0615  198 GLU A CB  
1612 C CG  . GLU A 198 ? 0.5608 0.5688 0.7563 -0.0056 0.0306  0.0601  198 GLU A CG  
1613 C CD  . GLU A 198 ? 0.7541 0.7560 0.9525 -0.0063 0.0299  0.0566  198 GLU A CD  
1614 O OE1 . GLU A 198 ? 0.7963 0.7965 0.9916 -0.0030 0.0319  0.0578  198 GLU A OE1 
1615 O OE2 . GLU A 198 ? 0.8302 0.8291 1.0338 -0.0100 0.0273  0.0525  198 GLU A OE2 
1616 N N   . ALA A 199 ? 0.3502 0.3644 0.5134 0.0012  0.0322  0.0558  199 ALA A N   
1617 C CA  . ALA A 199 ? 0.3341 0.3480 0.4859 0.0034  0.0326  0.0530  199 ALA A CA  
1618 C C   . ALA A 199 ? 0.4130 0.4241 0.5614 0.0010  0.0302  0.0455  199 ALA A C   
1619 O O   . ALA A 199 ? 0.4029 0.4133 0.5563 -0.0023 0.0279  0.0424  199 ALA A O   
1620 C CB  . ALA A 199 ? 0.2680 0.2856 0.4143 0.0045  0.0331  0.0550  199 ALA A CB  
1621 N N   . THR A 200 ? 0.4103 0.4199 0.5501 0.0027  0.0306  0.0426  200 THR A N   
1622 C CA  . THR A 200 ? 0.4914 0.4991 0.6272 0.0008  0.0285  0.0358  200 THR A CA  
1623 C C   . THR A 200 ? 0.4969 0.5064 0.6243 0.0005  0.0277  0.0335  200 THR A C   
1624 O O   . THR A 200 ? 0.4967 0.5073 0.6173 0.0029  0.0293  0.0357  200 THR A O   
1625 C CB  . THR A 200 ? 0.4829 0.4882 0.6148 0.0026  0.0293  0.0338  200 THR A CB  
1626 O OG1 . THR A 200 ? 0.5440 0.5473 0.6837 0.0031  0.0301  0.0359  200 THR A OG1 
1627 C CG2 . THR A 200 ? 0.3354 0.3393 0.4630 0.0008  0.0272  0.0269  200 THR A CG2 
1628 N N   . LEU A 201 ? 0.3890 0.3987 0.5168 -0.0024 0.0253  0.0289  201 LEU A N   
1629 C CA  . LEU A 201 ? 0.4134 0.4243 0.5330 -0.0029 0.0244  0.0259  201 LEU A CA  
1630 C C   . LEU A 201 ? 0.4544 0.4633 0.5689 -0.0033 0.0234  0.0204  201 LEU A C   
1631 O O   . LEU A 201 ? 0.4674 0.4748 0.5863 -0.0048 0.0220  0.0170  201 LEU A O   
1632 C CB  . LEU A 201 ? 0.3838 0.3971 0.5066 -0.0056 0.0224  0.0244  201 LEU A CB  
1633 C CG  . LEU A 201 ? 0.3499 0.3663 0.4774 -0.0053 0.0231  0.0298  201 LEU A CG  
1634 C CD1 . LEU A 201 ? 0.3739 0.3930 0.5049 -0.0082 0.0208  0.0277  201 LEU A CD1 
1635 C CD2 . LEU A 201 ? 0.2487 0.2663 0.3688 -0.0022 0.0253  0.0335  201 LEU A CD2 
1636 N N   . ARG A 202 ? 0.3870 0.3961 0.4923 -0.0020 0.0242  0.0195  202 ARG A N   
1637 C CA  . ARG A 202 ? 0.3581 0.3660 0.4583 -0.0024 0.0233  0.0147  202 ARG A CA  
1638 C C   . ARG A 202 ? 0.3667 0.3758 0.4593 -0.0035 0.0222  0.0116  202 ARG A C   
1639 O O   . ARG A 202 ? 0.4343 0.4440 0.5213 -0.0025 0.0232  0.0138  202 ARG A O   
1640 C CB  . ARG A 202 ? 0.3193 0.3261 0.4157 0.0001  0.0252  0.0163  202 ARG A CB  
1641 C CG  . ARG A 202 ? 0.4179 0.4242 0.5095 -0.0003 0.0244  0.0116  202 ARG A CG  
1642 C CD  . ARG A 202 ? 0.4677 0.4734 0.5571 0.0020  0.0262  0.0132  202 ARG A CD  
1643 N NE  . ARG A 202 ? 0.4934 0.4979 0.5907 0.0031  0.0269  0.0152  202 ARG A NE  
1644 C CZ  . ARG A 202 ? 0.5270 0.5315 0.6271 0.0052  0.0288  0.0203  202 ARG A CZ  
1645 N NH1 . ARG A 202 ? 0.5966 0.6021 0.6920 0.0067  0.0302  0.0236  202 ARG A NH1 
1646 N NH2 . ARG A 202 ? 0.4176 0.4209 0.5251 0.0060  0.0295  0.0221  202 ARG A NH2 
1647 N N   . CYS A 203 ? 0.3954 0.4048 0.4879 -0.0055 0.0203  0.0066  203 CYS A N   
1648 C CA  . CYS A 203 ? 0.3775 0.3883 0.4632 -0.0066 0.0192  0.0035  203 CYS A CA  
1649 C C   . CYS A 203 ? 0.2853 0.2956 0.3644 -0.0062 0.0193  0.0007  203 CYS A C   
1650 O O   . CYS A 203 ? 0.3419 0.3518 0.4229 -0.0065 0.0186  -0.0023 203 CYS A O   
1651 C CB  . CYS A 203 ? 0.3390 0.3514 0.4288 -0.0089 0.0167  -0.0003 203 CYS A CB  
1652 S SG  . CYS A 203 ? 0.6788 0.6938 0.7612 -0.0102 0.0154  -0.0035 203 CYS A SG  
1653 N N   . TRP A 204 ? 0.2683 0.2786 0.3394 -0.0056 0.0203  0.0017  204 TRP A N   
1654 C CA  . TRP A 204 ? 0.2646 0.2748 0.3291 -0.0054 0.0205  -0.0005 204 TRP A CA  
1655 C C   . TRP A 204 ? 0.2345 0.2462 0.2939 -0.0072 0.0191  -0.0042 204 TRP A C   
1656 O O   . TRP A 204 ? 0.3301 0.3424 0.3870 -0.0078 0.0188  -0.0035 204 TRP A O   
1657 C CB  . TRP A 204 ? 0.2921 0.3009 0.3505 -0.0038 0.0223  0.0028  204 TRP A CB  
1658 C CG  . TRP A 204 ? 0.2866 0.2944 0.3487 -0.0016 0.0239  0.0064  204 TRP A CG  
1659 C CD1 . TRP A 204 ? 0.3522 0.3595 0.4187 -0.0003 0.0250  0.0105  204 TRP A CD1 
1660 C CD2 . TRP A 204 ? 0.2971 0.3046 0.3586 -0.0004 0.0248  0.0064  204 TRP A CD2 
1661 N NE1 . TRP A 204 ? 0.3721 0.3789 0.4409 0.0017  0.0265  0.0132  204 TRP A NE1 
1662 C CE2 . TRP A 204 ? 0.3430 0.3498 0.4088 0.0018  0.0264  0.0107  204 TRP A CE2 
1663 C CE3 . TRP A 204 ? 0.3815 0.3898 0.4396 -0.0008 0.0244  0.0034  204 TRP A CE3 
1664 C CZ2 . TRP A 204 ? 0.3916 0.3984 0.4580 0.0036  0.0276  0.0120  204 TRP A CZ2 
1665 C CZ3 . TRP A 204 ? 0.4126 0.4210 0.4714 0.0010  0.0256  0.0047  204 TRP A CZ3 
1666 C CH2 . TRP A 204 ? 0.4190 0.4267 0.4819 0.0032  0.0271  0.0089  204 TRP A CH2 
1667 N N   . ALA A 205 ? 0.2502 0.2630 0.3080 -0.0079 0.0183  -0.0078 205 ALA A N   
1668 C CA  . ALA A 205 ? 0.2086 0.2233 0.2605 -0.0093 0.0173  -0.0108 205 ALA A CA  
1669 C C   . ALA A 205 ? 0.2386 0.2533 0.2845 -0.0090 0.0181  -0.0110 205 ALA A C   
1670 O O   . ALA A 205 ? 0.2703 0.2853 0.3181 -0.0082 0.0184  -0.0117 205 ALA A O   
1671 C CB  . ALA A 205 ? 0.1639 0.1808 0.2192 -0.0104 0.0154  -0.0151 205 ALA A CB  
1672 N N   . LEU A 206 ? 0.2102 0.2245 0.2487 -0.0097 0.0185  -0.0104 206 LEU A N   
1673 C CA  . LEU A 206 ? 0.2492 0.2635 0.2817 -0.0098 0.0192  -0.0104 206 LEU A CA  
1674 C C   . LEU A 206 ? 0.2828 0.2991 0.3095 -0.0118 0.0184  -0.0128 206 LEU A C   
1675 O O   . LEU A 206 ? 0.2537 0.2704 0.2793 -0.0126 0.0177  -0.0133 206 LEU A O   
1676 C CB  . LEU A 206 ? 0.2938 0.3051 0.3224 -0.0087 0.0208  -0.0067 206 LEU A CB  
1677 C CG  . LEU A 206 ? 0.3515 0.3611 0.3844 -0.0065 0.0221  -0.0035 206 LEU A CG  
1678 C CD1 . LEU A 206 ? 0.3175 0.3286 0.3546 -0.0056 0.0222  -0.0043 206 LEU A CD1 
1679 C CD2 . LEU A 206 ? 0.4501 0.4592 0.4889 -0.0059 0.0220  -0.0018 206 LEU A CD2 
1680 N N   . GLY A 207 ? 0.3279 0.3456 0.3510 -0.0124 0.0185  -0.0140 207 GLY A N   
1681 C CA  . GLY A 207 ? 0.3907 0.4103 0.4079 -0.0143 0.0179  -0.0155 207 GLY A CA  
1682 C C   . GLY A 207 ? 0.3787 0.4013 0.3967 -0.0154 0.0165  -0.0184 207 GLY A C   
1683 O O   . GLY A 207 ? 0.4512 0.4741 0.4647 -0.0167 0.0163  -0.0184 207 GLY A O   
1684 N N   . PHE A 208 ? 0.2638 0.2889 0.2875 -0.0147 0.0156  -0.0209 208 PHE A N   
1685 C CA  . PHE A 208 ? 0.3103 0.3387 0.3349 -0.0155 0.0142  -0.0240 208 PHE A CA  
1686 C C   . PHE A 208 ? 0.3298 0.3627 0.3537 -0.0157 0.0135  -0.0271 208 PHE A C   
1687 O O   . PHE A 208 ? 0.3373 0.3707 0.3623 -0.0149 0.0139  -0.0274 208 PHE A O   
1688 C CB  . PHE A 208 ? 0.3319 0.3598 0.3632 -0.0146 0.0133  -0.0249 208 PHE A CB  
1689 C CG  . PHE A 208 ? 0.2906 0.3175 0.3281 -0.0132 0.0134  -0.0254 208 PHE A CG  
1690 C CD1 . PHE A 208 ? 0.2604 0.2898 0.3002 -0.0127 0.0125  -0.0288 208 PHE A CD1 
1691 C CD2 . PHE A 208 ? 0.2564 0.2797 0.2972 -0.0122 0.0144  -0.0223 208 PHE A CD2 
1692 C CE1 . PHE A 208 ? 0.2490 0.2770 0.2944 -0.0113 0.0126  -0.0292 208 PHE A CE1 
1693 C CE2 . PHE A 208 ? 0.2282 0.2505 0.2749 -0.0108 0.0146  -0.0224 208 PHE A CE2 
1694 C CZ  . PHE A 208 ? 0.3201 0.3444 0.3691 -0.0104 0.0137  -0.0259 208 PHE A CZ  
1695 N N   . TYR A 209 ? 0.3473 0.3836 0.3692 -0.0166 0.0124  -0.0294 209 TYR A N   
1696 C CA  . TYR A 209 ? 0.3055 0.3468 0.3270 -0.0166 0.0116  -0.0325 209 TYR A CA  
1697 C C   . TYR A 209 ? 0.3653 0.4097 0.3877 -0.0167 0.0102  -0.0354 209 TYR A C   
1698 O O   . TYR A 209 ? 0.3920 0.4363 0.4120 -0.0176 0.0100  -0.0344 209 TYR A O   
1699 C CB  . TYR A 209 ? 0.2097 0.2533 0.2250 -0.0180 0.0123  -0.0316 209 TYR A CB  
1700 C CG  . TYR A 209 ? 0.2603 0.3096 0.2755 -0.0177 0.0117  -0.0344 209 TYR A CG  
1701 C CD1 . TYR A 209 ? 0.2154 0.2659 0.2324 -0.0165 0.0121  -0.0349 209 TYR A CD1 
1702 C CD2 . TYR A 209 ? 0.2663 0.3203 0.2795 -0.0183 0.0108  -0.0364 209 TYR A CD2 
1703 C CE1 . TYR A 209 ? 0.2297 0.2857 0.2465 -0.0158 0.0116  -0.0373 209 TYR A CE1 
1704 C CE2 . TYR A 209 ? 0.2424 0.3021 0.2553 -0.0176 0.0103  -0.0389 209 TYR A CE2 
1705 C CZ  . TYR A 209 ? 0.2673 0.3280 0.2820 -0.0164 0.0107  -0.0393 209 TYR A CZ  
1706 O OH  . TYR A 209 ? 0.2340 0.3007 0.2484 -0.0154 0.0103  -0.0416 209 TYR A OH  
1707 N N   . PRO A 210 ? 0.4155 0.4629 0.4414 -0.0155 0.0091  -0.0389 210 PRO A N   
1708 C CA  . PRO A 210 ? 0.3966 0.4443 0.4253 -0.0140 0.0093  -0.0402 210 PRO A CA  
1709 C C   . PRO A 210 ? 0.4222 0.4650 0.4568 -0.0128 0.0096  -0.0392 210 PRO A C   
1710 O O   . PRO A 210 ? 0.4244 0.4637 0.4605 -0.0133 0.0098  -0.0371 210 PRO A O   
1711 C CB  . PRO A 210 ? 0.3471 0.3992 0.3771 -0.0129 0.0078  -0.0446 210 PRO A CB  
1712 C CG  . PRO A 210 ? 0.3767 0.4291 0.4073 -0.0136 0.0066  -0.0457 210 PRO A CG  
1713 C CD  . PRO A 210 ? 0.3717 0.4227 0.3980 -0.0154 0.0075  -0.0421 210 PRO A CD  
1714 N N   . ALA A 211 ? 0.3723 0.4150 0.4101 -0.0111 0.0097  -0.0405 211 ALA A N   
1715 C CA  . ALA A 211 ? 0.3417 0.3799 0.3848 -0.0099 0.0103  -0.0390 211 ALA A CA  
1716 C C   . ALA A 211 ? 0.3808 0.4163 0.4301 -0.0094 0.0091  -0.0408 211 ALA A C   
1717 O O   . ALA A 211 ? 0.4541 0.4855 0.5082 -0.0088 0.0097  -0.0390 211 ALA A O   
1718 C CB  . ALA A 211 ? 0.2630 0.3021 0.3067 -0.0081 0.0111  -0.0393 211 ALA A CB  
1719 N N   . GLU A 212 ? 0.3827 0.4206 0.4321 -0.0098 0.0074  -0.0443 212 GLU A N   
1720 C CA  . GLU A 212 ? 0.3785 0.4141 0.4338 -0.0097 0.0059  -0.0464 212 GLU A CA  
1721 C C   . GLU A 212 ? 0.4071 0.4408 0.4637 -0.0113 0.0059  -0.0438 212 GLU A C   
1722 O O   . GLU A 212 ? 0.4628 0.4988 0.5152 -0.0125 0.0058  -0.0431 212 GLU A O   
1723 C CB  . GLU A 212 ? 0.4260 0.4652 0.4810 -0.0094 0.0040  -0.0515 212 GLU A CB  
1724 C CG  . GLU A 212 ? 0.6222 0.6586 0.6836 -0.0091 0.0022  -0.0544 212 GLU A CG  
1725 C CD  . GLU A 212 ? 0.8460 0.8860 0.9067 -0.0085 0.0002  -0.0598 212 GLU A CD  
1726 O OE1 . GLU A 212 ? 0.9056 0.9449 0.9696 -0.0093 -0.0017 -0.0621 212 GLU A OE1 
1727 O OE2 . GLU A 212 ? 0.9163 0.9599 0.9732 -0.0071 0.0003  -0.0617 212 GLU A OE2 
1728 N N   . ILE A 213 ? 0.2850 0.3145 0.3475 -0.0111 0.0060  -0.0422 213 ILE A N   
1729 C CA  . ILE A 213 ? 0.3351 0.3628 0.3996 -0.0123 0.0062  -0.0392 213 ILE A CA  
1730 C C   . ILE A 213 ? 0.3799 0.4044 0.4526 -0.0123 0.0054  -0.0394 213 ILE A C   
1731 O O   . ILE A 213 ? 0.3552 0.3772 0.4315 -0.0112 0.0056  -0.0402 213 ILE A O   
1732 C CB  . ILE A 213 ? 0.3107 0.3367 0.3722 -0.0121 0.0084  -0.0341 213 ILE A CB  
1733 C CG1 . ILE A 213 ? 0.2411 0.2662 0.3032 -0.0131 0.0086  -0.0310 213 ILE A CG1 
1734 C CG2 . ILE A 213 ? 0.1933 0.2161 0.2583 -0.0107 0.0097  -0.0321 213 ILE A CG2 
1735 C CD1 . ILE A 213 ? 0.1463 0.1697 0.2043 -0.0127 0.0107  -0.0264 213 ILE A CD1 
1736 N N   . THR A 214 ? 0.3097 0.3342 0.3852 -0.0137 0.0044  -0.0387 214 THR A N   
1737 C CA  . THR A 214 ? 0.3342 0.3558 0.4177 -0.0142 0.0036  -0.0386 214 THR A CA  
1738 C C   . THR A 214 ? 0.3437 0.3641 0.4295 -0.0148 0.0048  -0.0334 214 THR A C   
1739 O O   . THR A 214 ? 0.3459 0.3685 0.4291 -0.0156 0.0046  -0.0321 214 THR A O   
1740 C CB  . THR A 214 ? 0.4131 0.4367 0.4995 -0.0154 0.0008  -0.0431 214 THR A CB  
1741 O OG1 . THR A 214 ? 0.5189 0.5441 0.6024 -0.0146 -0.0003 -0.0480 214 THR A OG1 
1742 C CG2 . THR A 214 ? 0.3450 0.3651 0.4400 -0.0163 -0.0002 -0.0433 214 THR A CG2 
1743 N N   . LEU A 215 ? 0.3455 0.3623 0.4357 -0.0140 0.0061  -0.0303 215 LEU A N   
1744 C CA  . LEU A 215 ? 0.3826 0.3983 0.4756 -0.0142 0.0074  -0.0251 215 LEU A CA  
1745 C C   . LEU A 215 ? 0.4651 0.4788 0.5672 -0.0152 0.0063  -0.0248 215 LEU A C   
1746 O O   . LEU A 215 ? 0.4440 0.4545 0.5508 -0.0147 0.0065  -0.0250 215 LEU A O   
1747 C CB  . LEU A 215 ? 0.3452 0.3590 0.4357 -0.0124 0.0100  -0.0209 215 LEU A CB  
1748 C CG  . LEU A 215 ? 0.3650 0.3803 0.4470 -0.0118 0.0113  -0.0191 215 LEU A CG  
1749 C CD1 . LEU A 215 ? 0.4392 0.4571 0.5153 -0.0122 0.0103  -0.0233 215 LEU A CD1 
1750 C CD2 . LEU A 215 ? 0.2979 0.3112 0.3781 -0.0100 0.0136  -0.0157 215 LEU A CD2 
1751 N N   . THR A 216 ? 0.4496 0.4654 0.5543 -0.0168 0.0052  -0.0240 216 THR A N   
1752 C CA  . THR A 216 ? 0.4477 0.4621 0.5612 -0.0184 0.0039  -0.0237 216 THR A CA  
1753 C C   . THR A 216 ? 0.4019 0.4170 0.5185 -0.0185 0.0053  -0.0178 216 THR A C   
1754 O O   . THR A 216 ? 0.4235 0.4415 0.5357 -0.0183 0.0059  -0.0156 216 THR A O   
1755 C CB  . THR A 216 ? 0.5405 0.5576 0.6557 -0.0204 0.0010  -0.0285 216 THR A CB  
1756 O OG1 . THR A 216 ? 0.5867 0.6037 0.6986 -0.0199 -0.0003 -0.0340 216 THR A OG1 
1757 C CG2 . THR A 216 ? 0.5892 0.6047 0.7140 -0.0224 -0.0006 -0.0286 216 THR A CG2 
1758 N N   . TRP A 217 ? 0.3828 0.3951 0.5068 -0.0187 0.0059  -0.0150 217 TRP A N   
1759 C CA  . TRP A 217 ? 0.4061 0.4197 0.5344 -0.0191 0.0069  -0.0095 217 TRP A CA  
1760 C C   . TRP A 217 ? 0.4525 0.4679 0.5881 -0.0219 0.0045  -0.0108 217 TRP A C   
1761 O O   . TRP A 217 ? 0.3942 0.4073 0.5353 -0.0235 0.0026  -0.0142 217 TRP A O   
1762 C CB  . TRP A 217 ? 0.3378 0.3482 0.4703 -0.0176 0.0091  -0.0049 217 TRP A CB  
1763 C CG  . TRP A 217 ? 0.3545 0.3650 0.4803 -0.0149 0.0118  -0.0012 217 TRP A CG  
1764 C CD1 . TRP A 217 ? 0.3852 0.3933 0.5070 -0.0128 0.0133  -0.0015 217 TRP A CD1 
1765 C CD2 . TRP A 217 ? 0.2934 0.3064 0.4152 -0.0138 0.0133  0.0031  217 TRP A CD2 
1766 N NE1 . TRP A 217 ? 0.3647 0.3738 0.4805 -0.0108 0.0155  0.0022  217 TRP A NE1 
1767 C CE2 . TRP A 217 ? 0.3068 0.3185 0.4223 -0.0112 0.0156  0.0050  217 TRP A CE2 
1768 C CE3 . TRP A 217 ? 0.3369 0.3533 0.4599 -0.0146 0.0130  0.0055  217 TRP A CE3 
1769 C CZ2 . TRP A 217 ? 0.3333 0.3463 0.4434 -0.0095 0.0174  0.0090  217 TRP A CZ2 
1770 C CZ3 . TRP A 217 ? 0.3458 0.3637 0.4634 -0.0126 0.0150  0.0097  217 TRP A CZ3 
1771 C CH2 . TRP A 217 ? 0.4394 0.4554 0.5506 -0.0100 0.0171  0.0113  217 TRP A CH2 
1772 N N   . GLN A 218 ? 0.5326 0.5522 0.6680 -0.0225 0.0044  -0.0080 218 GLN A N   
1773 C CA  . GLN A 218 ? 0.5027 0.5251 0.6445 -0.0252 0.0021  -0.0089 218 GLN A CA  
1774 C C   . GLN A 218 ? 0.4968 0.5209 0.6447 -0.0255 0.0034  -0.0025 218 GLN A C   
1775 O O   . GLN A 218 ? 0.4853 0.5101 0.6297 -0.0232 0.0059  0.0025  218 GLN A O   
1776 C CB  . GLN A 218 ? 0.5522 0.5795 0.6887 -0.0258 0.0006  -0.0117 218 GLN A CB  
1777 C CG  . GLN A 218 ? 0.7513 0.7780 0.8815 -0.0254 -0.0006 -0.0177 218 GLN A CG  
1778 C CD  . GLN A 218 ? 0.9196 0.9515 1.0445 -0.0257 -0.0018 -0.0198 218 GLN A CD  
1779 O OE1 . GLN A 218 ? 0.9657 1.0017 1.0929 -0.0267 -0.0024 -0.0177 218 GLN A OE1 
1780 N NE2 . GLN A 218 ? 0.9812 1.0133 1.0992 -0.0248 -0.0022 -0.0239 218 GLN A NE2 
1781 N N   . ARG A 219 ? 0.5104 0.5352 0.6673 -0.0283 0.0015  -0.0027 219 ARG A N   
1782 C CA  . ARG A 219 ? 0.5392 0.5666 0.7026 -0.0291 0.0023  0.0033  219 ARG A CA  
1783 C C   . ARG A 219 ? 0.5917 0.6245 0.7593 -0.0320 -0.0004 0.0020  219 ARG A C   
1784 O O   . ARG A 219 ? 0.6132 0.6452 0.7867 -0.0350 -0.0031 -0.0020 219 ARG A O   
1785 C CB  . ARG A 219 ? 0.5703 0.5935 0.7424 -0.0299 0.0029  0.0057  219 ARG A CB  
1786 C CG  . ARG A 219 ? 0.6687 0.6952 0.8497 -0.0318 0.0028  0.0109  219 ARG A CG  
1787 C CD  . ARG A 219 ? 0.8093 0.8318 0.9975 -0.0317 0.0044  0.0150  219 ARG A CD  
1788 N NE  . ARG A 219 ? 1.0716 1.0983 1.2668 -0.0326 0.0052  0.0216  219 ARG A NE  
1789 C CZ  . ARG A 219 ? 1.2372 1.2673 1.4295 -0.0298 0.0080  0.0277  219 ARG A CZ  
1790 N NH1 . ARG A 219 ? 1.2400 1.2745 1.4393 -0.0306 0.0087  0.0337  219 ARG A NH1 
1791 N NH2 . ARG A 219 ? 1.3272 1.3564 1.5098 -0.0260 0.0101  0.0279  219 ARG A NH2 
1792 N N   . ASP A 220 ? 0.6184 0.6568 0.7828 -0.0310 0.0005  0.0053  220 ASP A N   
1793 C CA  . ASP A 220 ? 0.7376 0.7821 0.9052 -0.0334 -0.0018 0.0045  220 ASP A CA  
1794 C C   . ASP A 220 ? 0.7508 0.7960 0.9156 -0.0350 -0.0049 -0.0030 220 ASP A C   
1795 O O   . ASP A 220 ? 0.7116 0.7612 0.8807 -0.0377 -0.0076 -0.0051 220 ASP A O   
1796 C CB  . ASP A 220 ? 0.7874 0.8333 0.9667 -0.0365 -0.0030 0.0073  220 ASP A CB  
1797 C CG  . ASP A 220 ? 0.7875 0.8344 0.9699 -0.0348 0.0000  0.0153  220 ASP A CG  
1798 O OD1 . ASP A 220 ? 0.7796 0.8290 0.9554 -0.0316 0.0024  0.0190  220 ASP A OD1 
1799 O OD2 . ASP A 220 ? 0.7737 0.8188 0.9651 -0.0366 0.0000  0.0179  220 ASP A OD2 
1800 N N   . GLY A 221 ? 0.7492 0.7905 0.9071 -0.0334 -0.0045 -0.0070 221 GLY A N   
1801 C CA  . GLY A 221 ? 0.7516 0.7933 0.9064 -0.0344 -0.0072 -0.0141 221 GLY A CA  
1802 C C   . GLY A 221 ? 0.7878 0.8233 0.9445 -0.0350 -0.0082 -0.0188 221 GLY A C   
1803 O O   . GLY A 221 ? 0.8492 0.8832 0.9996 -0.0338 -0.0086 -0.0233 221 GLY A O   
1804 N N   . GLU A 222 ? 0.7629 0.7949 0.9284 -0.0368 -0.0086 -0.0176 222 GLU A N   
1805 C CA  . GLU A 222 ? 0.8510 0.8765 1.0190 -0.0373 -0.0095 -0.0216 222 GLU A CA  
1806 C C   . GLU A 222 ? 0.8660 0.8874 1.0272 -0.0339 -0.0069 -0.0212 222 GLU A C   
1807 O O   . GLU A 222 ? 0.9074 0.9298 1.0641 -0.0316 -0.0041 -0.0165 222 GLU A O   
1808 C CB  . GLU A 222 ? 0.9642 0.9862 1.1427 -0.0395 -0.0097 -0.0189 222 GLU A CB  
1809 C CG  . GLU A 222 ? 1.0772 1.1026 1.2637 -0.0435 -0.0128 -0.0199 222 GLU A CG  
1810 C CD  . GLU A 222 ? 1.2195 1.2407 1.4166 -0.0459 -0.0130 -0.0173 222 GLU A CD  
1811 O OE1 . GLU A 222 ? 1.2287 1.2450 1.4268 -0.0441 -0.0104 -0.0138 222 GLU A OE1 
1812 O OE2 . GLU A 222 ? 1.2997 1.3224 1.5041 -0.0497 -0.0158 -0.0188 222 GLU A OE2 
1813 N N   . ASP A 223 ? 0.8838 0.9006 1.0442 -0.0336 -0.0078 -0.0262 223 ASP A N   
1814 C CA  . ASP A 223 ? 0.8882 0.9013 1.0430 -0.0305 -0.0055 -0.0260 223 ASP A CA  
1815 C C   . ASP A 223 ? 0.8173 0.8247 0.9781 -0.0301 -0.0040 -0.0230 223 ASP A C   
1816 O O   . ASP A 223 ? 0.7744 0.7784 0.9428 -0.0321 -0.0057 -0.0247 223 ASP A O   
1817 C CB  . ASP A 223 ? 0.9536 0.9658 1.1030 -0.0298 -0.0071 -0.0330 223 ASP A CB  
1818 C CG  . ASP A 223 ? 1.0298 1.0477 1.1714 -0.0293 -0.0078 -0.0351 223 ASP A CG  
1819 O OD1 . ASP A 223 ? 1.0654 1.0866 1.2032 -0.0284 -0.0059 -0.0307 223 ASP A OD1 
1820 O OD2 . ASP A 223 ? 1.0505 1.0696 1.1898 -0.0297 -0.0100 -0.0410 223 ASP A OD2 
1821 N N   . GLN A 224 ? 0.7986 0.8049 0.9560 -0.0274 -0.0009 -0.0185 224 GLN A N   
1822 C CA  . GLN A 224 ? 0.8139 0.8154 0.9764 -0.0264 0.0010  -0.0148 224 GLN A CA  
1823 C C   . GLN A 224 ? 0.9283 0.9257 1.0869 -0.0241 0.0018  -0.0178 224 GLN A C   
1824 O O   . GLN A 224 ? 0.9749 0.9699 1.1335 -0.0219 0.0043  -0.0141 224 GLN A O   
1825 C CB  . GLN A 224 ? 0.7746 0.7781 0.9365 -0.0247 0.0040  -0.0074 224 GLN A CB  
1826 C CG  . GLN A 224 ? 0.7578 0.7661 0.9233 -0.0265 0.0036  -0.0038 224 GLN A CG  
1827 C CD  . GLN A 224 ? 0.7815 0.7886 0.9577 -0.0297 0.0020  -0.0030 224 GLN A CD  
1828 O OE1 . GLN A 224 ? 0.7511 0.7559 0.9335 -0.0295 0.0035  0.0017  224 GLN A OE1 
1829 N NE2 . GLN A 224 ? 0.8013 0.8101 0.9801 -0.0326 -0.0012 -0.0077 224 GLN A NE2 
1830 N N   . THR A 225 ? 0.9986 0.9958 1.1536 -0.0243 -0.0003 -0.0243 225 THR A N   
1831 C CA  . THR A 225 ? 1.0331 1.0273 1.1837 -0.0220 0.0002  -0.0276 225 THR A CA  
1832 C C   . THR A 225 ? 1.0169 1.0051 1.1733 -0.0210 0.0013  -0.0261 225 THR A C   
1833 O O   . THR A 225 ? 0.9903 0.9765 1.1432 -0.0183 0.0028  -0.0265 225 THR A O   
1834 C CB  . THR A 225 ? 1.0735 1.0682 1.2216 -0.0227 -0.0027 -0.0352 225 THR A CB  
1835 O OG1 . THR A 225 ? 1.0971 1.0887 1.2529 -0.0253 -0.0052 -0.0379 225 THR A OG1 
1836 C CG2 . THR A 225 ? 1.0788 1.0797 1.2207 -0.0233 -0.0036 -0.0367 225 THR A CG2 
1837 N N   . GLN A 226 ? 1.0456 1.0313 1.2109 -0.0232 0.0006  -0.0241 226 GLN A N   
1838 C CA  . GLN A 226 ? 1.0482 1.0275 1.2199 -0.0227 0.0013  -0.0228 226 GLN A CA  
1839 C C   . GLN A 226 ? 0.9969 0.9758 1.1697 -0.0204 0.0048  -0.0156 226 GLN A C   
1840 O O   . GLN A 226 ? 1.0214 0.9955 1.1976 -0.0189 0.0062  -0.0142 226 GLN A O   
1841 C CB  . GLN A 226 ? 1.0985 1.0751 1.2797 -0.0263 -0.0010 -0.0237 226 GLN A CB  
1842 C CG  . GLN A 226 ? 1.1517 1.1207 1.3379 -0.0264 -0.0020 -0.0269 226 GLN A CG  
1843 C CD  . GLN A 226 ? 1.1682 1.1345 1.3632 -0.0306 -0.0049 -0.0286 226 GLN A CD  
1844 O OE1 . GLN A 226 ? 1.1935 1.1642 1.3917 -0.0334 -0.0059 -0.0267 226 GLN A OE1 
1845 N NE2 . GLN A 226 ? 1.1429 1.1020 1.3421 -0.0309 -0.0062 -0.0323 226 GLN A NE2 
1846 N N   . ASP A 227 ? 0.8999 0.8837 1.0698 -0.0200 0.0064  -0.0111 227 ASP A N   
1847 C CA  . ASP A 227 ? 0.8756 0.8597 1.0467 -0.0180 0.0096  -0.0040 227 ASP A CA  
1848 C C   . ASP A 227 ? 0.8139 0.8018 0.9756 -0.0152 0.0116  -0.0023 227 ASP A C   
1849 O O   . ASP A 227 ? 0.7211 0.7108 0.8824 -0.0136 0.0140  0.0035  227 ASP A O   
1850 C CB  . ASP A 227 ? 0.8929 0.8789 1.0711 -0.0201 0.0097  0.0012  227 ASP A CB  
1851 C CG  . ASP A 227 ? 0.9774 0.9610 1.1640 -0.0239 0.0068  -0.0015 227 ASP A CG  
1852 O OD1 . ASP A 227 ? 0.9970 0.9760 1.1914 -0.0246 0.0071  0.0004  227 ASP A OD1 
1853 O OD2 . ASP A 227 ? 1.0001 0.9865 1.1856 -0.0263 0.0043  -0.0055 227 ASP A OD2 
1854 N N   . THR A 228 ? 0.7696 0.7588 0.9239 -0.0146 0.0106  -0.0074 228 THR A N   
1855 C CA  . THR A 228 ? 0.6833 0.6760 0.8284 -0.0126 0.0122  -0.0065 228 THR A CA  
1856 C C   . THR A 228 ? 0.6159 0.6068 0.7566 -0.0097 0.0136  -0.0074 228 THR A C   
1857 O O   . THR A 228 ? 0.6259 0.6144 0.7670 -0.0094 0.0125  -0.0119 228 THR A O   
1858 C CB  . THR A 228 ? 0.6369 0.6331 0.7759 -0.0139 0.0102  -0.0111 228 THR A CB  
1859 O OG1 . THR A 228 ? 0.6386 0.6369 0.7816 -0.0165 0.0087  -0.0104 228 THR A OG1 
1860 C CG2 . THR A 228 ? 0.5871 0.5865 0.7169 -0.0122 0.0118  -0.0097 228 THR A CG2 
1861 N N   . GLU A 229 ? 0.5228 0.5154 0.6593 -0.0074 0.0161  -0.0032 229 GLU A N   
1862 C CA  . GLU A 229 ? 0.5620 0.5543 0.6936 -0.0047 0.0175  -0.0039 229 GLU A CA  
1863 C C   . GLU A 229 ? 0.5379 0.5337 0.6599 -0.0045 0.0172  -0.0066 229 GLU A C   
1864 O O   . GLU A 229 ? 0.5399 0.5384 0.6575 -0.0046 0.0180  -0.0042 229 GLU A O   
1865 C CB  . GLU A 229 ? 0.6356 0.6275 0.7682 -0.0022 0.0204  0.0021  229 GLU A CB  
1866 C CG  . GLU A 229 ? 0.7595 0.7524 0.8858 0.0005  0.0219  0.0017  229 GLU A CG  
1867 C CD  . GLU A 229 ? 0.8545 0.8467 0.9832 0.0033  0.0245  0.0071  229 GLU A CD  
1868 O OE1 . GLU A 229 ? 0.8430 0.8371 0.9701 0.0042  0.0261  0.0116  229 GLU A OE1 
1869 O OE2 . GLU A 229 ? 0.9153 0.9049 1.0473 0.0049  0.0251  0.0067  229 GLU A OE2 
1870 N N   . LEU A 230 ? 0.4440 0.4398 0.5629 -0.0042 0.0162  -0.0116 230 LEU A N   
1871 C CA  . LEU A 230 ? 0.4961 0.4953 0.6062 -0.0039 0.0160  -0.0140 230 LEU A CA  
1872 C C   . LEU A 230 ? 0.5168 0.5164 0.6233 -0.0013 0.0176  -0.0135 230 LEU A C   
1873 O O   . LEU A 230 ? 0.6168 0.6139 0.7272 0.0001  0.0180  -0.0141 230 LEU A O   
1874 C CB  . LEU A 230 ? 0.4756 0.4758 0.5840 -0.0054 0.0135  -0.0200 230 LEU A CB  
1875 C CG  . LEU A 230 ? 0.4039 0.4054 0.5137 -0.0081 0.0115  -0.0216 230 LEU A CG  
1876 C CD1 . LEU A 230 ? 0.4365 0.4348 0.5553 -0.0094 0.0106  -0.0209 230 LEU A CD1 
1877 C CD2 . LEU A 230 ? 0.3542 0.3579 0.4601 -0.0088 0.0095  -0.0275 230 LEU A CD2 
1878 N N   . VAL A 231 ? 0.4520 0.4546 0.5512 -0.0007 0.0186  -0.0125 231 VAL A N   
1879 C CA  . VAL A 231 ? 0.4177 0.4218 0.5128 0.0013  0.0198  -0.0128 231 VAL A CA  
1880 C C   . VAL A 231 ? 0.3675 0.3743 0.4573 0.0006  0.0183  -0.0179 231 VAL A C   
1881 O O   . VAL A 231 ? 0.3308 0.3390 0.4186 -0.0014 0.0168  -0.0203 231 VAL A O   
1882 C CB  . VAL A 231 ? 0.3420 0.3480 0.4321 0.0024  0.0217  -0.0087 231 VAL A CB  
1883 C CG1 . VAL A 231 ? 0.3874 0.3913 0.4825 0.0042  0.0235  -0.0037 231 VAL A CG1 
1884 C CG2 . VAL A 231 ? 0.2466 0.2540 0.3318 0.0005  0.0212  -0.0082 231 VAL A CG2 
1885 N N   . GLU A 232 ? 0.2754 0.2836 0.3633 0.0024  0.0188  -0.0193 232 GLU A N   
1886 C CA  . GLU A 232 ? 0.2735 0.2850 0.3564 0.0021  0.0176  -0.0237 232 GLU A CA  
1887 C C   . GLU A 232 ? 0.3480 0.3628 0.4237 0.0004  0.0176  -0.0232 232 GLU A C   
1888 O O   . GLU A 232 ? 0.3106 0.3259 0.3837 0.0007  0.0190  -0.0195 232 GLU A O   
1889 C CB  . GLU A 232 ? 0.2543 0.2673 0.3361 0.0046  0.0185  -0.0245 232 GLU A CB  
1890 N N   . THR A 233 ? 0.3427 0.3599 0.4154 -0.0012 0.0160  -0.0268 233 THR A N   
1891 C CA  . THR A 233 ? 0.3042 0.3244 0.3699 -0.0028 0.0159  -0.0265 233 THR A CA  
1892 C C   . THR A 233 ? 0.2216 0.2446 0.2823 -0.0019 0.0172  -0.0254 233 THR A C   
1893 O O   . THR A 233 ? 0.3173 0.3425 0.3777 -0.0005 0.0171  -0.0274 233 THR A O   
1894 C CB  . THR A 233 ? 0.3186 0.3413 0.3820 -0.0043 0.0141  -0.0307 233 THR A CB  
1895 O OG1 . THR A 233 ? 0.3587 0.3793 0.4264 -0.0054 0.0128  -0.0314 233 THR A OG1 
1896 C CG2 . THR A 233 ? 0.1965 0.2223 0.2526 -0.0059 0.0142  -0.0302 233 THR A CG2 
1897 N N   . ARG A 234 ? 0.1476 0.1707 0.2042 -0.0025 0.0182  -0.0222 234 ARG A N   
1898 C CA  . ARG A 234 ? 0.2954 0.3211 0.3475 -0.0018 0.0194  -0.0209 234 ARG A CA  
1899 C C   . ARG A 234 ? 0.2787 0.3070 0.3234 -0.0040 0.0190  -0.0213 234 ARG A C   
1900 O O   . ARG A 234 ? 0.3587 0.3857 0.4013 -0.0057 0.0185  -0.0209 234 ARG A O   
1901 C CB  . ARG A 234 ? 0.2462 0.2695 0.2998 -0.0003 0.0211  -0.0166 234 ARG A CB  
1902 C CG  . ARG A 234 ? 0.2001 0.2213 0.2508 -0.0015 0.0215  -0.0138 234 ARG A CG  
1903 C CD  . ARG A 234 ? 0.2340 0.2524 0.2889 0.0003  0.0229  -0.0098 234 ARG A CD  
1904 N NE  . ARG A 234 ? 0.2939 0.3107 0.3451 -0.0003 0.0235  -0.0070 234 ARG A NE  
1905 C CZ  . ARG A 234 ? 0.2139 0.2284 0.2677 0.0012  0.0248  -0.0032 234 ARG A CZ  
1906 N NH1 . ARG A 234 ? 0.1740 0.1876 0.2344 0.0031  0.0255  -0.0016 234 ARG A NH1 
1907 N NH2 . ARG A 234 ? 0.3051 0.3183 0.3548 0.0009  0.0253  -0.0009 234 ARG A NH2 
1908 N N   . PRO A 235 ? 0.2435 0.2757 0.2843 -0.0039 0.0193  -0.0220 235 PRO A N   
1909 C CA  . PRO A 235 ? 0.2819 0.3168 0.3158 -0.0062 0.0190  -0.0221 235 PRO A CA  
1910 C C   . PRO A 235 ? 0.2956 0.3283 0.3258 -0.0067 0.0200  -0.0187 235 PRO A C   
1911 O O   . PRO A 235 ? 0.3346 0.3670 0.3658 -0.0050 0.0211  -0.0166 235 PRO A O   
1912 C CB  . PRO A 235 ? 0.1375 0.1776 0.1696 -0.0057 0.0189  -0.0238 235 PRO A CB  
1913 C CG  . PRO A 235 ? 0.2182 0.2578 0.2550 -0.0028 0.0199  -0.0228 235 PRO A CG  
1914 C CD  . PRO A 235 ? 0.2334 0.2682 0.2763 -0.0017 0.0198  -0.0227 235 PRO A CD  
1915 N N   . ALA A 236 ? 0.2840 0.3152 0.3097 -0.0088 0.0197  -0.0182 236 ALA A N   
1916 C CA  . ALA A 236 ? 0.2630 0.2919 0.2841 -0.0094 0.0205  -0.0154 236 ALA A CA  
1917 C C   . ALA A 236 ? 0.3780 0.4105 0.3943 -0.0104 0.0206  -0.0157 236 ALA A C   
1918 O O   . ALA A 236 ? 0.3534 0.3848 0.3666 -0.0103 0.0214  -0.0137 236 ALA A O   
1919 C CB  . ALA A 236 ? 0.1546 0.1806 0.1720 -0.0113 0.0202  -0.0150 236 ALA A CB  
1920 N N   . GLY A 237 ? 0.3791 0.4162 0.3948 -0.0114 0.0198  -0.0183 237 GLY A N   
1921 C CA  . GLY A 237 ? 0.3757 0.4174 0.3875 -0.0125 0.0197  -0.0186 237 GLY A CA  
1922 C C   . GLY A 237 ? 0.3869 0.4296 0.3927 -0.0159 0.0190  -0.0192 237 GLY A C   
1923 O O   . GLY A 237 ? 0.4103 0.4573 0.4128 -0.0175 0.0187  -0.0196 237 GLY A O   
1924 N N   . ASP A 238 ? 0.4596 0.4985 0.4641 -0.0170 0.0187  -0.0191 238 ASP A N   
1925 C CA  . ASP A 238 ? 0.4803 0.5193 0.4791 -0.0201 0.0181  -0.0193 238 ASP A CA  
1926 C C   . ASP A 238 ? 0.4621 0.5032 0.4620 -0.0208 0.0172  -0.0214 238 ASP A C   
1927 O O   . ASP A 238 ? 0.4724 0.5127 0.4684 -0.0230 0.0169  -0.0213 238 ASP A O   
1928 C CB  . ASP A 238 ? 0.5294 0.5620 0.5244 -0.0209 0.0186  -0.0171 238 ASP A CB  
1929 C CG  . ASP A 238 ? 0.5325 0.5611 0.5305 -0.0195 0.0187  -0.0166 238 ASP A CG  
1930 O OD1 . ASP A 238 ? 0.4320 0.4620 0.4359 -0.0177 0.0185  -0.0177 238 ASP A OD1 
1931 O OD2 . ASP A 238 ? 0.6200 0.6441 0.6145 -0.0201 0.0190  -0.0151 238 ASP A OD2 
1932 N N   . GLY A 239 ? 0.3721 0.4158 0.3772 -0.0188 0.0169  -0.0233 239 GLY A N   
1933 C CA  . GLY A 239 ? 0.3396 0.3860 0.3460 -0.0191 0.0160  -0.0256 239 GLY A CA  
1934 C C   . GLY A 239 ? 0.3366 0.3794 0.3471 -0.0177 0.0157  -0.0261 239 GLY A C   
1935 O O   . GLY A 239 ? 0.3349 0.3799 0.3475 -0.0174 0.0148  -0.0285 239 GLY A O   
1936 N N   . THR A 240 ? 0.2555 0.2930 0.2672 -0.0169 0.0164  -0.0239 240 THR A N   
1937 C CA  . THR A 240 ? 0.2443 0.2788 0.2604 -0.0158 0.0161  -0.0239 240 THR A CA  
1938 C C   . THR A 240 ? 0.2799 0.3127 0.3020 -0.0134 0.0166  -0.0234 240 THR A C   
1939 O O   . THR A 240 ? 0.3042 0.3378 0.3266 -0.0124 0.0174  -0.0226 240 THR A O   
1940 C CB  . THR A 240 ? 0.3635 0.3934 0.3766 -0.0166 0.0167  -0.0213 240 THR A CB  
1941 O OG1 . THR A 240 ? 0.4319 0.4587 0.4432 -0.0160 0.0178  -0.0186 240 THR A OG1 
1942 C CG2 . THR A 240 ? 0.2793 0.3101 0.2864 -0.0189 0.0163  -0.0215 240 THR A CG2 
1943 N N   . PHE A 241 ? 0.3323 0.3630 0.3594 -0.0125 0.0162  -0.0239 241 PHE A N   
1944 C CA  . PHE A 241 ? 0.3234 0.3523 0.3569 -0.0104 0.0166  -0.0233 241 PHE A CA  
1945 C C   . PHE A 241 ? 0.2723 0.2968 0.3087 -0.0099 0.0171  -0.0206 241 PHE A C   
1946 O O   . PHE A 241 ? 0.3111 0.3343 0.3453 -0.0110 0.0169  -0.0197 241 PHE A O   
1947 C CB  . PHE A 241 ? 0.2926 0.3234 0.3308 -0.0096 0.0154  -0.0269 241 PHE A CB  
1948 C CG  . PHE A 241 ? 0.2844 0.3200 0.3197 -0.0098 0.0149  -0.0296 241 PHE A CG  
1949 C CD1 . PHE A 241 ? 0.2563 0.2938 0.2931 -0.0081 0.0154  -0.0301 241 PHE A CD1 
1950 C CD2 . PHE A 241 ? 0.3251 0.3639 0.3563 -0.0115 0.0140  -0.0313 241 PHE A CD2 
1951 C CE1 . PHE A 241 ? 0.3029 0.3456 0.3370 -0.0081 0.0150  -0.0324 241 PHE A CE1 
1952 C CE2 . PHE A 241 ? 0.2646 0.3085 0.2933 -0.0116 0.0136  -0.0335 241 PHE A CE2 
1953 C CZ  . PHE A 241 ? 0.2676 0.3135 0.2977 -0.0099 0.0141  -0.0341 241 PHE A CZ  
1954 N N   . GLN A 242 ? 0.2598 0.2824 0.3013 -0.0081 0.0179  -0.0190 242 GLN A N   
1955 C CA  . GLN A 242 ? 0.2442 0.2634 0.2893 -0.0073 0.0186  -0.0160 242 GLN A CA  
1956 C C   . GLN A 242 ? 0.2388 0.2568 0.2919 -0.0062 0.0182  -0.0167 242 GLN A C   
1957 O O   . GLN A 242 ? 0.2967 0.3159 0.3522 -0.0055 0.0178  -0.0190 242 GLN A O   
1958 C CB  . GLN A 242 ? 0.2770 0.2946 0.3199 -0.0061 0.0203  -0.0123 242 GLN A CB  
1959 C CG  . GLN A 242 ? 0.2520 0.2701 0.2867 -0.0072 0.0206  -0.0117 242 GLN A CG  
1960 C CD  . GLN A 242 ? 0.2567 0.2738 0.2893 -0.0058 0.0221  -0.0088 242 GLN A CD  
1961 O OE1 . GLN A 242 ? 0.2597 0.2758 0.2970 -0.0037 0.0230  -0.0067 242 GLN A OE1 
1962 N NE2 . GLN A 242 ? 0.2421 0.2597 0.2678 -0.0068 0.0223  -0.0087 242 GLN A NE2 
1963 N N   . LYS A 243 ? 0.2622 0.2779 0.3195 -0.0062 0.0183  -0.0146 243 LYS A N   
1964 C CA  . LYS A 243 ? 0.2709 0.2850 0.3364 -0.0055 0.0178  -0.0149 243 LYS A CA  
1965 C C   . LYS A 243 ? 0.2900 0.3020 0.3593 -0.0055 0.0183  -0.0114 243 LYS A C   
1966 O O   . LYS A 243 ? 0.3184 0.3306 0.3842 -0.0063 0.0184  -0.0099 243 LYS A O   
1967 C CB  . LYS A 243 ? 0.2559 0.2713 0.3235 -0.0066 0.0158  -0.0195 243 LYS A CB  
1968 C CG  . LYS A 243 ? 0.2623 0.2756 0.3381 -0.0062 0.0151  -0.0206 243 LYS A CG  
1969 C CD  . LYS A 243 ? 0.3516 0.3661 0.4289 -0.0076 0.0128  -0.0251 243 LYS A CD  
1970 C CE  . LYS A 243 ? 0.3625 0.3747 0.4468 -0.0071 0.0118  -0.0274 243 LYS A CE  
1971 N NZ  . LYS A 243 ? 0.4046 0.4173 0.4875 -0.0054 0.0120  -0.0299 243 LYS A NZ  
1972 N N   . TRP A 244 ? 0.2660 0.2761 0.3426 -0.0046 0.0187  -0.0098 244 TRP A N   
1973 C CA  . TRP A 244 ? 0.2674 0.2762 0.3489 -0.0048 0.0189  -0.0066 244 TRP A CA  
1974 C C   . TRP A 244 ? 0.2861 0.2932 0.3764 -0.0052 0.0180  -0.0074 244 TRP A C   
1975 O O   . TRP A 244 ? 0.2963 0.3024 0.3892 -0.0047 0.0177  -0.0097 244 TRP A O   
1976 C CB  . TRP A 244 ? 0.2880 0.2959 0.3684 -0.0030 0.0211  -0.0014 244 TRP A CB  
1977 C CG  . TRP A 244 ? 0.3732 0.3802 0.4557 -0.0009 0.0226  0.0004  244 TRP A CG  
1978 C CD1 . TRP A 244 ? 0.2676 0.2754 0.3447 0.0005  0.0237  0.0008  244 TRP A CD1 
1979 C CD2 . TRP A 244 ? 0.3928 0.3979 0.4833 0.0001  0.0231  0.0022  244 TRP A CD2 
1980 N NE1 . TRP A 244 ? 0.2484 0.2554 0.3296 0.0025  0.0250  0.0028  244 TRP A NE1 
1981 C CE2 . TRP A 244 ? 0.3460 0.3512 0.4355 0.0024  0.0247  0.0038  244 TRP A CE2 
1982 C CE3 . TRP A 244 ? 0.4118 0.4154 0.5105 -0.0009 0.0224  0.0027  244 TRP A CE3 
1983 C CZ2 . TRP A 244 ? 0.3773 0.3808 0.4734 0.0040  0.0257  0.0060  244 TRP A CZ2 
1984 C CZ3 . TRP A 244 ? 0.4297 0.4313 0.5352 0.0004  0.0233  0.0049  244 TRP A CZ3 
1985 C CH2 . TRP A 244 ? 0.4192 0.4207 0.5233 0.0030  0.0250  0.0066  244 TRP A CH2 
1986 N N   . ALA A 245 ? 0.2576 0.2645 0.3525 -0.0063 0.0176  -0.0055 245 ALA A N   
1987 C CA  . ALA A 245 ? 0.2794 0.2845 0.3832 -0.0071 0.0167  -0.0057 245 ALA A CA  
1988 C C   . ALA A 245 ? 0.3089 0.3136 0.4173 -0.0066 0.0180  -0.0001 245 ALA A C   
1989 O O   . ALA A 245 ? 0.1972 0.2036 0.3023 -0.0065 0.0187  0.0026  245 ALA A O   
1990 C CB  . ALA A 245 ? 0.2479 0.2542 0.3533 -0.0094 0.0141  -0.0100 245 ALA A CB  
1991 N N   . ALA A 246 ? 0.3612 0.3636 0.4773 -0.0063 0.0185  0.0018  246 ALA A N   
1992 C CA  . ALA A 246 ? 0.3339 0.3363 0.4548 -0.0056 0.0200  0.0077  246 ALA A CA  
1993 C C   . ALA A 246 ? 0.3229 0.3240 0.4537 -0.0076 0.0188  0.0082  246 ALA A C   
1994 O O   . ALA A 246 ? 0.3676 0.3661 0.5027 -0.0084 0.0175  0.0050  246 ALA A O   
1995 C CB  . ALA A 246 ? 0.3275 0.3287 0.4479 -0.0027 0.0225  0.0114  246 ALA A CB  
1996 N N   . VAL A 247 ? 0.3356 0.3386 0.4698 -0.0083 0.0191  0.0121  247 VAL A N   
1997 C CA  . VAL A 247 ? 0.3657 0.3678 0.5100 -0.0101 0.0184  0.0140  247 VAL A CA  
1998 C C   . VAL A 247 ? 0.4453 0.4480 0.5935 -0.0084 0.0208  0.0211  247 VAL A C   
1999 O O   . VAL A 247 ? 0.5305 0.5358 0.6739 -0.0065 0.0225  0.0246  247 VAL A O   
2000 C CB  . VAL A 247 ? 0.2880 0.2928 0.4348 -0.0131 0.0161  0.0123  247 VAL A CB  
2001 C CG1 . VAL A 247 ? 0.4203 0.4237 0.5673 -0.0153 0.0132  0.0053  247 VAL A CG1 
2002 C CG2 . VAL A 247 ? 0.1301 0.1388 0.2699 -0.0123 0.0166  0.0138  247 VAL A CG2 
2003 N N   . VAL A 248 ? 0.4502 0.4505 0.6071 -0.0088 0.0211  0.0232  248 VAL A N   
2004 C CA  . VAL A 248 ? 0.4472 0.4486 0.6095 -0.0076 0.0232  0.0302  248 VAL A CA  
2005 C C   . VAL A 248 ? 0.4040 0.4080 0.5726 -0.0105 0.0219  0.0318  248 VAL A C   
2006 O O   . VAL A 248 ? 0.3965 0.3990 0.5706 -0.0137 0.0194  0.0285  248 VAL A O   
2007 C CB  . VAL A 248 ? 0.4395 0.4371 0.6086 -0.0068 0.0243  0.0322  248 VAL A CB  
2008 C CG1 . VAL A 248 ? 0.4101 0.4095 0.5847 -0.0054 0.0267  0.0400  248 VAL A CG1 
2009 C CG2 . VAL A 248 ? 0.2833 0.2787 0.4461 -0.0040 0.0255  0.0301  248 VAL A CG2 
2010 N N   . VAL A 249 ? 0.3613 0.3694 0.5287 -0.0093 0.0233  0.0369  249 VAL A N   
2011 C CA  . VAL A 249 ? 0.3432 0.3552 0.5149 -0.0116 0.0221  0.0384  249 VAL A CA  
2012 C C   . VAL A 249 ? 0.4692 0.4840 0.6474 -0.0107 0.0241  0.0462  249 VAL A C   
2013 O O   . VAL A 249 ? 0.6044 0.6196 0.7799 -0.0072 0.0269  0.0506  249 VAL A O   
2014 C CB  . VAL A 249 ? 0.4363 0.4518 0.5992 -0.0110 0.0217  0.0367  249 VAL A CB  
2015 C CG1 . VAL A 249 ? 0.4906 0.5112 0.6571 -0.0121 0.0214  0.0405  249 VAL A CG1 
2016 C CG2 . VAL A 249 ? 0.4533 0.4673 0.6119 -0.0130 0.0191  0.0292  249 VAL A CG2 
2017 N N   . PRO A 250 ? 0.3904 0.4075 0.5772 -0.0137 0.0228  0.0479  250 PRO A N   
2018 C CA  . PRO A 250 ? 0.4143 0.4353 0.6073 -0.0130 0.0246  0.0555  250 PRO A CA  
2019 C C   . PRO A 250 ? 0.5040 0.5303 0.6903 -0.0104 0.0260  0.0587  250 PRO A C   
2020 O O   . PRO A 250 ? 0.5845 0.6137 0.7679 -0.0118 0.0243  0.0560  250 PRO A O   
2021 C CB  . PRO A 250 ? 0.3634 0.3859 0.5665 -0.0177 0.0220  0.0550  250 PRO A CB  
2022 C CG  . PRO A 250 ? 0.3820 0.3994 0.5852 -0.0205 0.0192  0.0473  250 PRO A CG  
2023 C CD  . PRO A 250 ? 0.3938 0.4100 0.5855 -0.0181 0.0194  0.0427  250 PRO A CD  
2024 N N   . SER A 251 ? 0.5015 0.5292 0.6851 -0.0064 0.0290  0.0642  251 SER A N   
2025 C CA  . SER A 251 ? 0.5207 0.5534 0.6988 -0.0036 0.0305  0.0679  251 SER A CA  
2026 C C   . SER A 251 ? 0.4192 0.4574 0.6062 -0.0048 0.0308  0.0739  251 SER A C   
2027 O O   . SER A 251 ? 0.6261 0.6644 0.8219 -0.0053 0.0317  0.0781  251 SER A O   
2028 C CB  . SER A 251 ? 0.4982 0.5301 0.6691 0.0013  0.0335  0.0710  251 SER A CB  
2029 O OG  . SER A 251 ? 0.3396 0.3718 0.5172 0.0028  0.0356  0.0767  251 SER A OG  
2030 N N   . GLY A 252 ? 0.3086 0.3516 0.4935 -0.0050 0.0302  0.0744  252 GLY A N   
2031 C CA  . GLY A 252 ? 0.4459 0.4885 0.6204 -0.0043 0.0292  0.0697  252 GLY A CA  
2032 C C   . GLY A 252 ? 0.4763 0.5198 0.6531 -0.0086 0.0259  0.0643  252 GLY A C   
2033 O O   . GLY A 252 ? 0.3274 0.3762 0.5075 -0.0100 0.0250  0.0661  252 GLY A O   
2034 N N   . GLU A 253 ? 0.5014 0.5399 0.6761 -0.0105 0.0241  0.0577  253 GLU A N   
2035 C CA  . GLU A 253 ? 0.4695 0.5084 0.6450 -0.0142 0.0208  0.0518  253 GLU A CA  
2036 C C   . GLU A 253 ? 0.3461 0.3817 0.5112 -0.0133 0.0202  0.0458  253 GLU A C   
2037 O O   . GLU A 253 ? 0.3911 0.4261 0.5556 -0.0159 0.0176  0.0400  253 GLU A O   
2038 C CB  . GLU A 253 ? 0.5403 0.5766 0.7258 -0.0183 0.0187  0.0495  253 GLU A CB  
2039 C CG  . GLU A 253 ? 0.6620 0.7014 0.8586 -0.0198 0.0192  0.0555  253 GLU A CG  
2040 C CD  . GLU A 253 ? 0.8231 0.8600 1.0297 -0.0244 0.0165  0.0527  253 GLU A CD  
2041 O OE1 . GLU A 253 ? 0.8842 0.9148 1.0904 -0.0250 0.0159  0.0484  253 GLU A OE1 
2042 O OE2 . GLU A 253 ? 0.8669 0.9080 1.0815 -0.0276 0.0151  0.0546  253 GLU A OE2 
2043 N N   . GLU A 254 ? 0.2664 0.3001 0.4233 -0.0095 0.0226  0.0473  254 GLU A N   
2044 C CA  . GLU A 254 ? 0.3230 0.3535 0.4699 -0.0085 0.0223  0.0422  254 GLU A CA  
2045 C C   . GLU A 254 ? 0.3074 0.3405 0.4491 -0.0095 0.0206  0.0389  254 GLU A C   
2046 O O   . GLU A 254 ? 0.3190 0.3500 0.4554 -0.0103 0.0193  0.0334  254 GLU A O   
2047 C CB  . GLU A 254 ? 0.3606 0.3894 0.4996 -0.0043 0.0251  0.0451  254 GLU A CB  
2048 C CG  . GLU A 254 ? 0.4306 0.4569 0.5733 -0.0027 0.0269  0.0481  254 GLU A CG  
2049 C CD  . GLU A 254 ? 0.4876 0.5172 0.6357 -0.0008 0.0290  0.0555  254 GLU A CD  
2050 O OE1 . GLU A 254 ? 0.4532 0.4871 0.6066 -0.0022 0.0284  0.0580  254 GLU A OE1 
2051 O OE2 . GLU A 254 ? 0.4213 0.4498 0.5683 0.0022  0.0313  0.0589  254 GLU A OE2 
2052 N N   . GLN A 255 ? 0.3486 0.3868 0.4918 -0.0092 0.0208  0.0425  255 GLN A N   
2053 C CA  . GLN A 255 ? 0.4102 0.4514 0.5481 -0.0096 0.0196  0.0401  255 GLN A CA  
2054 C C   . GLN A 255 ? 0.4540 0.4967 0.5965 -0.0137 0.0162  0.0349  255 GLN A C   
2055 O O   . GLN A 255 ? 0.5188 0.5637 0.6566 -0.0142 0.0150  0.0320  255 GLN A O   
2056 C CB  . GLN A 255 ? 0.4172 0.4637 0.5549 -0.0076 0.0210  0.0458  255 GLN A CB  
2057 C CG  . GLN A 255 ? 0.4832 0.5353 0.6312 -0.0101 0.0197  0.0484  255 GLN A CG  
2058 C CD  . GLN A 255 ? 0.4829 0.5349 0.6402 -0.0105 0.0207  0.0529  255 GLN A CD  
2059 O OE1 . GLN A 255 ? 0.5433 0.5913 0.6989 -0.0084 0.0226  0.0545  255 GLN A OE1 
2060 N NE2 . GLN A 255 ? 0.3994 0.4560 0.5665 -0.0132 0.0195  0.0552  255 GLN A NE2 
2061 N N   . ARG A 256 ? 0.4685 0.5098 0.6198 -0.0165 0.0148  0.0336  256 ARG A N   
2062 C CA  . ARG A 256 ? 0.3852 0.4272 0.5410 -0.0204 0.0115  0.0282  256 ARG A CA  
2063 C C   . ARG A 256 ? 0.4219 0.4592 0.5726 -0.0208 0.0103  0.0216  256 ARG A C   
2064 O O   . ARG A 256 ? 0.3477 0.3853 0.5004 -0.0235 0.0075  0.0163  256 ARG A O   
2065 C CB  . ARG A 256 ? 0.3138 0.3558 0.4815 -0.0234 0.0103  0.0295  256 ARG A CB  
2066 C CG  . ARG A 256 ? 0.4779 0.5255 0.6524 -0.0237 0.0111  0.0359  256 ARG A CG  
2067 C CD  . ARG A 256 ? 0.6150 0.6602 0.7991 -0.0249 0.0116  0.0393  256 ARG A CD  
2068 N NE  . ARG A 256 ? 0.6928 0.7435 0.8866 -0.0273 0.0110  0.0436  256 ARG A NE  
2069 C CZ  . ARG A 256 ? 0.6794 0.7317 0.8810 -0.0317 0.0079  0.0408  256 ARG A CZ  
2070 N NH1 . ARG A 256 ? 0.5303 0.5790 0.7308 -0.0340 0.0052  0.0334  256 ARG A NH1 
2071 N NH2 . ARG A 256 ? 0.7689 0.8265 0.9793 -0.0339 0.0074  0.0452  256 ARG A NH2 
2072 N N   . TYR A 257 ? 0.4337 0.4671 0.5779 -0.0181 0.0124  0.0219  257 TYR A N   
2073 C CA  . TYR A 257 ? 0.3636 0.3928 0.5034 -0.0182 0.0116  0.0163  257 TYR A CA  
2074 C C   . TYR A 257 ? 0.3665 0.3963 0.4958 -0.0170 0.0116  0.0134  257 TYR A C   
2075 O O   . TYR A 257 ? 0.4137 0.4450 0.5372 -0.0148 0.0133  0.0166  257 TYR A O   
2076 C CB  . TYR A 257 ? 0.3579 0.3825 0.4979 -0.0164 0.0136  0.0180  257 TYR A CB  
2077 C CG  . TYR A 257 ? 0.3418 0.3643 0.4920 -0.0180 0.0131  0.0192  257 TYR A CG  
2078 C CD1 . TYR A 257 ? 0.2667 0.2912 0.4239 -0.0180 0.0142  0.0251  257 TYR A CD1 
2079 C CD2 . TYR A 257 ? 0.3512 0.3696 0.5039 -0.0194 0.0117  0.0145  257 TYR A CD2 
2080 C CE1 . TYR A 257 ? 0.2973 0.3197 0.4641 -0.0197 0.0139  0.0265  257 TYR A CE1 
2081 C CE2 . TYR A 257 ? 0.3494 0.3652 0.5113 -0.0208 0.0114  0.0156  257 TYR A CE2 
2082 C CZ  . TYR A 257 ? 0.4264 0.4441 0.5955 -0.0211 0.0125  0.0216  257 TYR A CZ  
2083 O OH  . TYR A 257 ? 0.4766 0.4914 0.6552 -0.0227 0.0122  0.0230  257 TYR A OH  
2084 N N   . THR A 258 ? 0.3417 0.3701 0.4686 -0.0183 0.0097  0.0074  258 THR A N   
2085 C CA  . THR A 258 ? 0.2792 0.3081 0.3965 -0.0173 0.0097  0.0044  258 THR A CA  
2086 C C   . THR A 258 ? 0.2782 0.3035 0.3925 -0.0173 0.0093  -0.0002 258 THR A C   
2087 O O   . THR A 258 ? 0.2223 0.2458 0.3422 -0.0187 0.0078  -0.0031 258 THR A O   
2088 C CB  . THR A 258 ? 0.3174 0.3507 0.4338 -0.0190 0.0074  0.0014  258 THR A CB  
2089 O OG1 . THR A 258 ? 0.3273 0.3607 0.4497 -0.0216 0.0047  -0.0034 258 THR A OG1 
2090 C CG2 . THR A 258 ? 0.3048 0.3426 0.4239 -0.0189 0.0078  0.0059  258 THR A CG2 
2091 N N   . CYS A 259 ? 0.3863 0.4106 0.4918 -0.0156 0.0105  -0.0007 259 CYS A N   
2092 C CA  . CYS A 259 ? 0.3825 0.4044 0.4844 -0.0155 0.0101  -0.0049 259 CYS A CA  
2093 C C   . CYS A 259 ? 0.3944 0.4190 0.4915 -0.0165 0.0083  -0.0095 259 CYS A C   
2094 O O   . CYS A 259 ? 0.4006 0.4273 0.4920 -0.0160 0.0088  -0.0085 259 CYS A O   
2095 C CB  . CYS A 259 ? 0.4302 0.4497 0.5257 -0.0132 0.0126  -0.0025 259 CYS A CB  
2096 S SG  . CYS A 259 ? 0.7896 0.8066 0.8813 -0.0128 0.0124  -0.0068 259 CYS A SG  
2097 N N   . HIS A 260 ? 0.3723 0.3967 0.4717 -0.0178 0.0063  -0.0146 260 HIS A N   
2098 C CA  . HIS A 260 ? 0.3082 0.3355 0.4034 -0.0186 0.0046  -0.0193 260 HIS A CA  
2099 C C   . HIS A 260 ? 0.2661 0.2918 0.3556 -0.0176 0.0051  -0.0220 260 HIS A C   
2100 O O   . HIS A 260 ? 0.2547 0.2777 0.3468 -0.0173 0.0051  -0.0235 260 HIS A O   
2101 C CB  . HIS A 260 ? 0.3777 0.4063 0.4795 -0.0206 0.0017  -0.0234 260 HIS A CB  
2102 C CG  . HIS A 260 ? 0.6079 0.6408 0.7062 -0.0214 -0.0003 -0.0274 260 HIS A CG  
2103 N ND1 . HIS A 260 ? 0.7136 0.7469 0.8101 -0.0216 -0.0019 -0.0330 260 HIS A ND1 
2104 C CD2 . HIS A 260 ? 0.6630 0.7003 0.7592 -0.0218 -0.0008 -0.0266 260 HIS A CD2 
2105 C CE1 . HIS A 260 ? 0.7055 0.7434 0.7990 -0.0221 -0.0033 -0.0354 260 HIS A CE1 
2106 N NE2 . HIS A 260 ? 0.6590 0.6994 0.7523 -0.0223 -0.0027 -0.0316 260 HIS A NE2 
2107 N N   . VAL A 261 ? 0.2536 0.2812 0.3351 -0.0171 0.0056  -0.0223 261 VAL A N   
2108 C CA  . VAL A 261 ? 0.3155 0.3423 0.3911 -0.0163 0.0062  -0.0244 261 VAL A CA  
2109 C C   . VAL A 261 ? 0.3923 0.4227 0.4639 -0.0170 0.0046  -0.0288 261 VAL A C   
2110 O O   . VAL A 261 ? 0.4285 0.4617 0.4965 -0.0173 0.0043  -0.0284 261 VAL A O   
2111 C CB  . VAL A 261 ? 0.2918 0.3171 0.3608 -0.0151 0.0086  -0.0204 261 VAL A CB  
2112 C CG1 . VAL A 261 ? 0.1484 0.1735 0.2115 -0.0147 0.0091  -0.0225 261 VAL A CG1 
2113 C CG2 . VAL A 261 ? 0.2729 0.2950 0.3453 -0.0141 0.0103  -0.0161 261 VAL A CG2 
2114 N N   . GLN A 262 ? 0.4319 0.4624 0.5040 -0.0169 0.0036  -0.0329 262 GLN A N   
2115 C CA  . GLN A 262 ? 0.4364 0.4707 0.5045 -0.0171 0.0022  -0.0372 262 GLN A CA  
2116 C C   . GLN A 262 ? 0.4716 0.5059 0.5340 -0.0162 0.0032  -0.0381 262 GLN A C   
2117 O O   . GLN A 262 ? 0.4849 0.5167 0.5489 -0.0154 0.0040  -0.0381 262 GLN A O   
2118 C CB  . GLN A 262 ? 0.4938 0.5291 0.5674 -0.0177 -0.0003 -0.0421 262 GLN A CB  
2119 C CG  . GLN A 262 ? 0.6039 0.6394 0.6839 -0.0189 -0.0017 -0.0416 262 GLN A CG  
2120 C CD  . GLN A 262 ? 0.6732 0.7087 0.7586 -0.0196 -0.0043 -0.0467 262 GLN A CD  
2121 O OE1 . GLN A 262 ? 0.6655 0.6971 0.7563 -0.0197 -0.0045 -0.0472 262 GLN A OE1 
2122 N NE2 . GLN A 262 ? 0.7293 0.7692 0.8130 -0.0201 -0.0063 -0.0506 262 GLN A NE2 
2123 N N   . HIS A 263 ? 0.4448 0.4824 0.5007 -0.0164 0.0033  -0.0386 263 HIS A N   
2124 C CA  . HIS A 263 ? 0.3334 0.3718 0.3837 -0.0159 0.0043  -0.0390 263 HIS A CA  
2125 C C   . HIS A 263 ? 0.4214 0.4645 0.4661 -0.0163 0.0037  -0.0407 263 HIS A C   
2126 O O   . HIS A 263 ? 0.3898 0.4342 0.4326 -0.0169 0.0036  -0.0393 263 HIS A O   
2127 C CB  . HIS A 263 ? 0.2631 0.2982 0.3102 -0.0157 0.0066  -0.0345 263 HIS A CB  
2128 C CG  . HIS A 263 ? 0.3043 0.3403 0.3459 -0.0155 0.0075  -0.0347 263 HIS A CG  
2129 N ND1 . HIS A 263 ? 0.3499 0.3857 0.3930 -0.0147 0.0077  -0.0362 263 HIS A ND1 
2130 C CD2 . HIS A 263 ? 0.2656 0.3029 0.3004 -0.0162 0.0084  -0.0334 263 HIS A CD2 
2131 C CE1 . HIS A 263 ? 0.2865 0.3240 0.3240 -0.0149 0.0085  -0.0359 263 HIS A CE1 
2132 N NE2 . HIS A 263 ? 0.2874 0.3256 0.3199 -0.0160 0.0089  -0.0341 263 HIS A NE2 
2133 N N   . GLU A 264 ? 0.5048 0.5506 0.5468 -0.0159 0.0033  -0.0436 264 GLU A N   
2134 C CA  . GLU A 264 ? 0.4231 0.4739 0.4599 -0.0162 0.0028  -0.0451 264 GLU A CA  
2135 C C   . GLU A 264 ? 0.5071 0.5576 0.5379 -0.0170 0.0043  -0.0412 264 GLU A C   
2136 O O   . GLU A 264 ? 0.5291 0.5832 0.5562 -0.0174 0.0040  -0.0415 264 GLU A O   
2137 C CB  . GLU A 264 ? 0.2564 0.3102 0.2912 -0.0155 0.0027  -0.0479 264 GLU A CB  
2138 N N   . GLY A 265 ? 0.4714 0.5174 0.5013 -0.0172 0.0060  -0.0375 265 GLY A N   
2139 C CA  . GLY A 265 ? 0.4552 0.4997 0.4792 -0.0179 0.0075  -0.0338 265 GLY A CA  
2140 C C   . GLY A 265 ? 0.4794 0.5226 0.5039 -0.0179 0.0076  -0.0315 265 GLY A C   
2141 O O   . GLY A 265 ? 0.4843 0.5273 0.5037 -0.0183 0.0084  -0.0292 265 GLY A O   
2142 N N   . LEU A 266 ? 0.5227 0.5652 0.5534 -0.0175 0.0067  -0.0320 266 LEU A N   
2143 C CA  . LEU A 266 ? 0.4406 0.4829 0.4727 -0.0173 0.0067  -0.0298 266 LEU A CA  
2144 C C   . LEU A 266 ? 0.5271 0.5746 0.5592 -0.0175 0.0050  -0.0323 266 LEU A C   
2145 O O   . LEU A 266 ? 0.5133 0.5638 0.5489 -0.0176 0.0032  -0.0364 266 LEU A O   
2146 C CB  . LEU A 266 ? 0.4029 0.4427 0.4421 -0.0170 0.0064  -0.0290 266 LEU A CB  
2147 C CG  . LEU A 266 ? 0.4184 0.4533 0.4585 -0.0165 0.0081  -0.0260 266 LEU A CG  
2148 C CD1 . LEU A 266 ? 0.4213 0.4548 0.4695 -0.0162 0.0075  -0.0260 266 LEU A CD1 
2149 C CD2 . LEU A 266 ? 0.2954 0.3276 0.3306 -0.0160 0.0099  -0.0215 266 LEU A CD2 
2150 N N   . PRO A 267 ? 0.6177 0.6663 0.6459 -0.0174 0.0055  -0.0300 267 PRO A N   
2151 C CA  . PRO A 267 ? 0.6332 0.6872 0.6611 -0.0174 0.0041  -0.0318 267 PRO A CA  
2152 C C   . PRO A 267 ? 0.6074 0.6631 0.6425 -0.0174 0.0023  -0.0333 267 PRO A C   
2153 O O   . PRO A 267 ? 0.5447 0.6049 0.5822 -0.0176 0.0003  -0.0372 267 PRO A O   
2154 C CB  . PRO A 267 ? 0.6397 0.6928 0.6623 -0.0169 0.0056  -0.0277 267 PRO A CB  
2155 C CG  . PRO A 267 ? 0.6268 0.6742 0.6453 -0.0170 0.0077  -0.0246 267 PRO A CG  
2156 C CD  . PRO A 267 ? 0.6589 0.7033 0.6825 -0.0171 0.0076  -0.0253 267 PRO A CD  
2157 N N   . LYS A 268 ? 0.6528 0.7050 0.6913 -0.0173 0.0031  -0.0303 268 LYS A N   
2158 C CA  . LYS A 268 ? 0.6283 0.6816 0.6744 -0.0177 0.0017  -0.0310 268 LYS A CA  
2159 C C   . LYS A 268 ? 0.5665 0.6148 0.6172 -0.0178 0.0024  -0.0296 268 LYS A C   
2160 O O   . LYS A 268 ? 0.5663 0.6106 0.6141 -0.0171 0.0045  -0.0261 268 LYS A O   
2161 C CB  . LYS A 268 ? 0.6863 0.7413 0.7321 -0.0173 0.0020  -0.0276 268 LYS A CB  
2162 C CG  . LYS A 268 ? 0.8194 0.8750 0.8731 -0.0178 0.0011  -0.0267 268 LYS A CG  
2163 C CD  . LYS A 268 ? 0.9174 0.9781 0.9759 -0.0188 -0.0018 -0.0311 268 LYS A CD  
2164 C CE  . LYS A 268 ? 0.9379 0.9995 1.0041 -0.0197 -0.0028 -0.0297 268 LYS A CE  
2165 N NZ  . LYS A 268 ? 0.9175 0.9844 0.9884 -0.0209 -0.0058 -0.0340 268 LYS A NZ  
2166 N N   . PRO A 269 ? 0.5124 0.5608 0.5701 -0.0185 0.0007  -0.0325 269 PRO A N   
2167 C CA  . PRO A 269 ? 0.4628 0.5068 0.5258 -0.0185 0.0014  -0.0310 269 PRO A CA  
2168 C C   . PRO A 269 ? 0.4127 0.4545 0.4764 -0.0180 0.0031  -0.0255 269 PRO A C   
2169 O O   . PRO A 269 ? 0.3489 0.3934 0.4120 -0.0179 0.0030  -0.0237 269 PRO A O   
2170 C CB  . PRO A 269 ? 0.5584 0.6038 0.6291 -0.0197 -0.0011 -0.0346 269 PRO A CB  
2171 C CG  . PRO A 269 ? 0.5717 0.6213 0.6397 -0.0199 -0.0030 -0.0395 269 PRO A CG  
2172 C CD  . PRO A 269 ? 0.5917 0.6443 0.6525 -0.0192 -0.0020 -0.0375 269 PRO A CD  
2173 N N   . LEU A 270 ? 0.4474 0.4848 0.5122 -0.0173 0.0048  -0.0229 270 LEU A N   
2174 C CA  . LEU A 270 ? 0.4316 0.4669 0.4967 -0.0164 0.0067  -0.0176 270 LEU A CA  
2175 C C   . LEU A 270 ? 0.3764 0.4115 0.4503 -0.0169 0.0061  -0.0161 270 LEU A C   
2176 O O   . LEU A 270 ? 0.3302 0.3639 0.4097 -0.0177 0.0052  -0.0183 270 LEU A O   
2177 C CB  . LEU A 270 ? 0.3648 0.3958 0.4253 -0.0152 0.0089  -0.0152 270 LEU A CB  
2178 C CG  . LEU A 270 ? 0.4496 0.4801 0.5009 -0.0146 0.0101  -0.0144 270 LEU A CG  
2179 C CD1 . LEU A 270 ? 0.5203 0.5466 0.5678 -0.0137 0.0120  -0.0125 270 LEU A CD1 
2180 C CD2 . LEU A 270 ? 0.4635 0.4951 0.5119 -0.0138 0.0108  -0.0112 270 LEU A CD2 
2181 N N   . THR A 271 ? 0.3855 0.4219 0.4606 -0.0164 0.0068  -0.0121 271 THR A N   
2182 C CA  . THR A 271 ? 0.4520 0.4883 0.5352 -0.0168 0.0068  -0.0095 271 THR A CA  
2183 C C   . THR A 271 ? 0.4822 0.5166 0.5633 -0.0148 0.0094  -0.0036 271 THR A C   
2184 O O   . THR A 271 ? 0.5010 0.5371 0.5778 -0.0137 0.0102  -0.0011 271 THR A O   
2185 C CB  . THR A 271 ? 0.4979 0.5392 0.5864 -0.0183 0.0047  -0.0105 271 THR A CB  
2186 O OG1 . THR A 271 ? 0.5361 0.5790 0.6263 -0.0200 0.0021  -0.0162 271 THR A OG1 
2187 C CG2 . THR A 271 ? 0.3830 0.4243 0.4803 -0.0191 0.0046  -0.0074 271 THR A CG2 
2188 N N   . LEU A 272 ? 0.5311 0.5622 0.6151 -0.0141 0.0107  -0.0015 272 LEU A N   
2189 C CA  . LEU A 272 ? 0.5182 0.5473 0.5999 -0.0119 0.0132  0.0038  272 LEU A CA  
2190 C C   . LEU A 272 ? 0.4534 0.4831 0.5436 -0.0119 0.0136  0.0075  272 LEU A C   
2191 O O   . LEU A 272 ? 0.3180 0.3460 0.4143 -0.0127 0.0132  0.0067  272 LEU A O   
2192 C CB  . LEU A 272 ? 0.5525 0.5773 0.6290 -0.0106 0.0148  0.0038  272 LEU A CB  
2193 C CG  . LEU A 272 ? 0.5575 0.5816 0.6270 -0.0112 0.0142  -0.0002 272 LEU A CG  
2194 C CD1 . LEU A 272 ? 0.5320 0.5524 0.5976 -0.0101 0.0157  0.0001  272 LEU A CD1 
2195 C CD2 . LEU A 272 ? 0.5943 0.6198 0.6566 -0.0107 0.0144  0.0003  272 LEU A CD2 
2196 N N   . ARG A 273 ? 0.5596 0.5919 0.6504 -0.0108 0.0144  0.0117  273 ARG A N   
2197 C CA  . ARG A 273 ? 0.5001 0.5337 0.5989 -0.0107 0.0150  0.0160  273 ARG A CA  
2198 C C   . ARG A 273 ? 0.4441 0.4748 0.5398 -0.0077 0.0179  0.0206  273 ARG A C   
2199 O O   . ARG A 273 ? 0.4111 0.4403 0.4984 -0.0056 0.0193  0.0217  273 ARG A O   
2200 C CB  . ARG A 273 ? 0.4792 0.5181 0.5810 -0.0110 0.0144  0.0183  273 ARG A CB  
2201 C CG  . ARG A 273 ? 0.5485 0.5895 0.6593 -0.0112 0.0149  0.0229  273 ARG A CG  
2202 C CD  . ARG A 273 ? 0.6200 0.6673 0.7353 -0.0124 0.0136  0.0243  273 ARG A CD  
2203 N NE  . ARG A 273 ? 0.6425 0.6918 0.7619 -0.0158 0.0105  0.0190  273 ARG A NE  
2204 C CZ  . ARG A 273 ? 0.6743 0.7237 0.8029 -0.0186 0.0087  0.0175  273 ARG A CZ  
2205 N NH1 . ARG A 273 ? 0.6722 0.7199 0.8071 -0.0185 0.0098  0.0210  273 ARG A NH1 
2206 N NH2 . ARG A 273 ? 0.7095 0.7606 0.8409 -0.0215 0.0057  0.0123  273 ARG A NH2 
2207 N N   . TRP A 274 ? 0.5038 0.5335 0.6062 -0.0076 0.0186  0.0231  274 TRP A N   
2208 C CA  . TRP A 274 ? 0.5238 0.5511 0.6239 -0.0047 0.0212  0.0274  274 TRP A CA  
2209 C C   . TRP A 274 ? 0.5585 0.5882 0.6563 -0.0021 0.0230  0.0327  274 TRP A C   
2210 O O   . TRP A 274 ? 0.6091 0.6428 0.7086 -0.0027 0.0222  0.0336  274 TRP A O   
2211 C CB  . TRP A 274 ? 0.4513 0.4775 0.5598 -0.0051 0.0216  0.0290  274 TRP A CB  
2212 C CG  . TRP A 274 ? 0.4133 0.4387 0.5212 -0.0020 0.0243  0.0345  274 TRP A CG  
2213 C CD1 . TRP A 274 ? 0.3948 0.4228 0.5090 -0.0010 0.0254  0.0400  274 TRP A CD1 
2214 C CD2 . TRP A 274 ? 0.4732 0.4953 0.5736 0.0007  0.0261  0.0352  274 TRP A CD2 
2215 N NE1 . TRP A 274 ? 0.4303 0.4570 0.5413 0.0024  0.0280  0.0440  274 TRP A NE1 
2216 C CE2 . TRP A 274 ? 0.4834 0.5063 0.5858 0.0035  0.0284  0.0410  274 TRP A CE2 
2217 C CE3 . TRP A 274 ? 0.5140 0.5330 0.6064 0.0010  0.0261  0.0315  274 TRP A CE3 
2218 C CZ2 . TRP A 274 ? 0.5070 0.5276 0.6034 0.0066  0.0304  0.0429  274 TRP A CZ2 
2219 C CZ3 . TRP A 274 ? 0.5493 0.5659 0.6359 0.0038  0.0281  0.0334  274 TRP A CZ3 
2220 C CH2 . TRP A 274 ? 0.5768 0.5942 0.6654 0.0066  0.0302  0.0389  274 TRP A CH2 
2226 N N   . GLN B 2   ? 0.4957 0.4242 0.4097 0.0480  0.0255  -0.0075 2   GLN B N   
2227 C CA  . GLN B 2   ? 0.4302 0.3603 0.3459 0.0474  0.0262  -0.0047 2   GLN B CA  
2228 C C   . GLN B 2   ? 0.3407 0.2711 0.2605 0.0427  0.0265  -0.0037 2   GLN B C   
2229 O O   . GLN B 2   ? 0.4549 0.3797 0.3757 0.0403  0.0271  -0.0039 2   GLN B O   
2230 C CB  . GLN B 2   ? 0.3941 0.3171 0.3061 0.0505  0.0278  -0.0032 2   GLN B CB  
2231 C CG  . GLN B 2   ? 0.4328 0.3579 0.3416 0.0553  0.0274  -0.0031 2   GLN B CG  
2232 C CD  . GLN B 2   ? 0.5437 0.4635 0.4492 0.0582  0.0288  -0.0010 2   GLN B CD  
2233 O OE1 . GLN B 2   ? 0.5319 0.4460 0.4373 0.0567  0.0305  0.0008  2   GLN B OE1 
2234 N NE2 . GLN B 2   ? 0.5985 0.5202 0.5016 0.0625  0.0280  -0.0009 2   GLN B NE2 
2235 N N   . ARG B 3   ? 0.3077 0.2447 0.2302 0.0415  0.0258  -0.0025 3   ARG B N   
2236 C CA  . ARG B 3   ? 0.4345 0.3726 0.3609 0.0374  0.0259  -0.0015 3   ARG B CA  
2237 C C   . ARG B 3   ? 0.4176 0.3582 0.3446 0.0381  0.0261  0.0008  3   ARG B C   
2238 O O   . ARG B 3   ? 0.4409 0.3865 0.3676 0.0401  0.0247  0.0008  3   ARG B O   
2239 C CB  . ARG B 3   ? 0.4591 0.4033 0.3889 0.0343  0.0241  -0.0031 3   ARG B CB  
2240 C CG  . ARG B 3   ? 0.5101 0.4501 0.4402 0.0322  0.0239  -0.0051 3   ARG B CG  
2241 C CD  . ARG B 3   ? 0.6187 0.5648 0.5506 0.0305  0.0220  -0.0069 3   ARG B CD  
2242 N NE  . ARG B 3   ? 0.6919 0.6415 0.6208 0.0339  0.0214  -0.0082 3   ARG B NE  
2243 C CZ  . ARG B 3   ? 0.7701 0.7221 0.6980 0.0342  0.0203  -0.0103 3   ARG B CZ  
2244 N NH1 . ARG B 3   ? 0.8259 0.7764 0.7553 0.0311  0.0192  -0.0118 3   ARG B NH1 
2245 N NH2 . ARG B 3   ? 0.7312 0.6870 0.6565 0.0378  0.0202  -0.0110 3   ARG B NH2 
2246 N N   . THR B 4   ? 0.4775 0.4145 0.4054 0.0365  0.0278  0.0026  4   THR B N   
2247 C CA  . THR B 4   ? 0.3457 0.2841 0.2734 0.0375  0.0282  0.0047  4   THR B CA  
2248 C C   . THR B 4   ? 0.2780 0.2238 0.2096 0.0350  0.0260  0.0042  4   THR B C   
2249 O O   . THR B 4   ? 0.3660 0.3139 0.3014 0.0311  0.0255  0.0034  4   THR B O   
2250 C CB  . THR B 4   ? 0.3894 0.3226 0.3177 0.0364  0.0311  0.0071  4   THR B CB  
2251 O OG1 . THR B 4   ? 0.5382 0.4642 0.4644 0.0376  0.0331  0.0077  4   THR B OG1 
2252 C CG2 . THR B 4   ? 0.3072 0.2407 0.2331 0.0393  0.0319  0.0094  4   THR B CG2 
2253 N N   . PRO B 5   ? 0.2750 0.2244 0.2059 0.0372  0.0244  0.0046  5   PRO B N   
2254 C CA  . PRO B 5   ? 0.3716 0.3274 0.3064 0.0349  0.0221  0.0044  5   PRO B CA  
2255 C C   . PRO B 5   ? 0.4700 0.4249 0.4068 0.0324  0.0234  0.0057  5   PRO B C   
2256 O O   . PRO B 5   ? 0.4618 0.4119 0.3964 0.0338  0.0259  0.0074  5   PRO B O   
2257 C CB  . PRO B 5   ? 0.2440 0.2019 0.1770 0.0385  0.0199  0.0047  5   PRO B CB  
2258 C CG  . PRO B 5   ? 0.2240 0.1754 0.1515 0.0426  0.0218  0.0057  5   PRO B CG  
2259 C CD  . PRO B 5   ? 0.3002 0.2475 0.2266 0.0420  0.0241  0.0052  5   PRO B CD  
2260 N N   . LYS B 6   ? 0.4596 0.4195 0.4008 0.0289  0.0217  0.0051  6   LYS B N   
2261 C CA  . LYS B 6   ? 0.4103 0.3707 0.3538 0.0270  0.0224  0.0062  6   LYS B CA  
2262 C C   . LYS B 6   ? 0.3559 0.3208 0.3001 0.0281  0.0195  0.0063  6   LYS B C   
2263 O O   . LYS B 6   ? 0.4137 0.3833 0.3599 0.0274  0.0167  0.0052  6   LYS B O   
2264 C CB  . LYS B 6   ? 0.4451 0.4073 0.3932 0.0223  0.0224  0.0055  6   LYS B CB  
2265 C CG  . LYS B 6   ? 0.5841 0.5409 0.5319 0.0212  0.0247  0.0053  6   LYS B CG  
2266 C CD  . LYS B 6   ? 0.7629 0.7216 0.7144 0.0173  0.0235  0.0036  6   LYS B CD  
2267 C CE  . LYS B 6   ? 0.8297 0.7822 0.7810 0.0166  0.0250  0.0030  6   LYS B CE  
2268 N NZ  . LYS B 6   ? 0.8417 0.7951 0.7960 0.0132  0.0233  0.0009  6   LYS B NZ  
2269 N N   . ILE B 7   ? 0.2986 0.2617 0.2410 0.0300  0.0203  0.0076  7   ILE B N   
2270 C CA  . ILE B 7   ? 0.2778 0.2433 0.2193 0.0324  0.0172  0.0074  7   ILE B CA  
2271 C C   . ILE B 7   ? 0.3616 0.3295 0.3056 0.0307  0.0165  0.0078  7   ILE B C   
2272 O O   . ILE B 7   ? 0.4377 0.4033 0.3813 0.0306  0.0195  0.0093  7   ILE B O   
2273 C CB  . ILE B 7   ? 0.3488 0.3097 0.2840 0.0379  0.0180  0.0082  7   ILE B CB  
2274 C CG1 . ILE B 7   ? 0.3106 0.2683 0.2429 0.0397  0.0192  0.0080  7   ILE B CG1 
2275 C CG2 . ILE B 7   ? 0.4058 0.3686 0.3398 0.0408  0.0138  0.0073  7   ILE B CG2 
2276 C CD1 . ILE B 7   ? 0.2663 0.2184 0.1922 0.0448  0.0212  0.0093  7   ILE B CD1 
2277 N N   . GLN B 8   ? 0.3478 0.3202 0.2947 0.0296  0.0127  0.0068  8   GLN B N   
2278 C CA  . GLN B 8   ? 0.2458 0.2205 0.1951 0.0283  0.0114  0.0070  8   GLN B CA  
2279 C C   . GLN B 8   ? 0.3553 0.3311 0.3035 0.0312  0.0071  0.0062  8   GLN B C   
2280 O O   . GLN B 8   ? 0.3830 0.3615 0.3332 0.0310  0.0036  0.0054  8   GLN B O   
2281 C CB  . GLN B 8   ? 0.2042 0.1835 0.1593 0.0231  0.0106  0.0065  8   GLN B CB  
2282 C CG  . GLN B 8   ? 0.2072 0.1852 0.1638 0.0201  0.0139  0.0068  8   GLN B CG  
2283 C CD  . GLN B 8   ? 0.3020 0.2842 0.2638 0.0155  0.0129  0.0062  8   GLN B CD  
2284 O OE1 . GLN B 8   ? 0.3001 0.2845 0.2638 0.0133  0.0120  0.0053  8   GLN B OE1 
2285 N NE2 . GLN B 8   ? 0.3416 0.3248 0.3055 0.0145  0.0129  0.0068  8   GLN B NE2 
2286 N N   . VAL B 9   ? 0.3557 0.3294 0.3009 0.0341  0.0072  0.0067  9   VAL B N   
2287 C CA  . VAL B 9   ? 0.2899 0.2638 0.2337 0.0373  0.0026  0.0057  9   VAL B CA  
2288 C C   . VAL B 9   ? 0.3825 0.3590 0.3294 0.0353  0.0012  0.0055  9   VAL B C   
2289 O O   . VAL B 9   ? 0.3570 0.3327 0.3031 0.0353  0.0045  0.0066  9   VAL B O   
2290 C CB  . VAL B 9   ? 0.3232 0.2920 0.2593 0.0437  0.0034  0.0059  9   VAL B CB  
2291 C CG1 . VAL B 9   ? 0.3123 0.2806 0.2467 0.0472  -0.0025 0.0042  9   VAL B CG1 
2292 C CG2 . VAL B 9   ? 0.3779 0.3436 0.3105 0.0456  0.0056  0.0063  9   VAL B CG2 
2293 N N   . TYR B 10  ? 0.3679 0.3476 0.3188 0.0337  -0.0038 0.0044  10  TYR B N   
2294 C CA  . TYR B 10  ? 0.2505 0.2330 0.2051 0.0314  -0.0056 0.0043  10  TYR B CA  
2295 C C   . TYR B 10  ? 0.4066 0.3909 0.3643 0.0314  -0.0120 0.0031  10  TYR B C   
2296 O O   . TYR B 10  ? 0.4362 0.4206 0.3944 0.0325  -0.0147 0.0026  10  TYR B O   
2297 C CB  . TYR B 10  ? 0.2329 0.2190 0.1927 0.0257  -0.0032 0.0050  10  TYR B CB  
2298 C CG  . TYR B 10  ? 0.2047 0.1938 0.1681 0.0226  -0.0041 0.0049  10  TYR B CG  
2299 C CD1 . TYR B 10  ? 0.2035 0.1910 0.1648 0.0233  -0.0013 0.0051  10  TYR B CD1 
2300 C CD2 . TYR B 10  ? 0.2414 0.2352 0.2104 0.0194  -0.0076 0.0048  10  TYR B CD2 
2301 C CE1 . TYR B 10  ? 0.2575 0.2480 0.2216 0.0211  -0.0019 0.0051  10  TYR B CE1 
2302 C CE2 . TYR B 10  ? 0.3084 0.3055 0.2805 0.0172  -0.0079 0.0052  10  TYR B CE2 
2303 C CZ  . TYR B 10  ? 0.2714 0.2669 0.2409 0.0182  -0.0050 0.0052  10  TYR B CZ  
2304 O OH  . TYR B 10  ? 0.2462 0.2451 0.2184 0.0165  -0.0052 0.0056  10  TYR B OH  
2305 N N   . SER B 11  ? 0.4253 0.4113 0.3857 0.0301  -0.0145 0.0028  11  SER B N   
2306 C CA  . SER B 11  ? 0.4354 0.4231 0.3998 0.0296  -0.0208 0.0019  11  SER B CA  
2307 C C   . SER B 11  ? 0.4491 0.4422 0.4209 0.0237  -0.0215 0.0028  11  SER B C   
2308 O O   . SER B 11  ? 0.4428 0.4378 0.4158 0.0206  -0.0177 0.0036  11  SER B O   
2309 C CB  . SER B 11  ? 0.4050 0.3900 0.3667 0.0331  -0.0239 0.0006  11  SER B CB  
2310 O OG  . SER B 11  ? 0.4168 0.4027 0.3783 0.0318  -0.0208 0.0013  11  SER B OG  
2311 N N   . ARG B 12  ? 0.3889 0.3840 0.3662 0.0219  -0.0258 0.0025  12  ARG B N   
2312 C CA  . ARG B 12  ? 0.4192 0.4193 0.4035 0.0167  -0.0263 0.0037  12  ARG B CA  
2313 C C   . ARG B 12  ? 0.4454 0.4459 0.4310 0.0150  -0.0264 0.0034  12  ARG B C   
2314 O O   . ARG B 12  ? 0.4809 0.4847 0.4684 0.0118  -0.0241 0.0046  12  ARG B O   
2315 C CB  . ARG B 12  ? 0.4321 0.4336 0.4225 0.0153  -0.0304 0.0038  12  ARG B CB  
2316 C CG  . ARG B 12  ? 0.3533 0.3598 0.3506 0.0102  -0.0304 0.0058  12  ARG B CG  
2317 C CD  . ARG B 12  ? 0.3619 0.3698 0.3656 0.0089  -0.0343 0.0068  12  ARG B CD  
2318 N NE  . ARG B 12  ? 0.5093 0.5181 0.5130 0.0107  -0.0345 0.0072  12  ARG B NE  
2319 C CZ  . ARG B 12  ? 0.4737 0.4851 0.4837 0.0095  -0.0372 0.0088  12  ARG B CZ  
2320 N NH1 . ARG B 12  ? 0.5228 0.5358 0.5395 0.0064  -0.0400 0.0105  12  ARG B NH1 
2321 N NH2 . ARG B 12  ? 0.3577 0.3701 0.3675 0.0115  -0.0372 0.0090  12  ARG B NH2 
2322 N N   . HIS B 13  ? 0.3960 0.3929 0.3801 0.0175  -0.0294 0.0018  13  HIS B N   
2323 C CA  . HIS B 13  ? 0.4113 0.4081 0.3960 0.0168  -0.0298 0.0014  13  HIS B CA  
2324 C C   . HIS B 13  ? 0.4689 0.4622 0.4464 0.0217  -0.0283 0.0005  13  HIS B C   
2325 O O   . HIS B 13  ? 0.4736 0.4636 0.4458 0.0261  -0.0281 -0.0002 13  HIS B O   
2326 C CB  . HIS B 13  ? 0.3663 0.3615 0.3551 0.0160  -0.0349 0.0003  13  HIS B CB  
2327 C CG  . HIS B 13  ? 0.5075 0.5055 0.5033 0.0120  -0.0366 0.0019  13  HIS B CG  
2328 N ND1 . HIS B 13  ? 0.5553 0.5577 0.5559 0.0073  -0.0349 0.0041  13  HIS B ND1 
2329 C CD2 . HIS B 13  ? 0.5264 0.5236 0.5251 0.0122  -0.0399 0.0020  13  HIS B CD2 
2330 C CE1 . HIS B 13  ? 0.5803 0.5847 0.5861 0.0050  -0.0367 0.0058  13  HIS B CE1 
2331 N NE2 . HIS B 13  ? 0.5734 0.5749 0.5788 0.0077  -0.0398 0.0047  13  HIS B NE2 
2332 N N   . PRO B 14  ? 0.4641 0.4585 0.4414 0.0213  -0.0269 0.0009  14  PRO B N   
2333 C CA  . PRO B 14  ? 0.5219 0.5135 0.4928 0.0263  -0.0253 0.0007  14  PRO B CA  
2334 C C   . PRO B 14  ? 0.5905 0.5770 0.5567 0.0317  -0.0290 -0.0017 14  PRO B C   
2335 O O   . PRO B 14  ? 0.5632 0.5485 0.5322 0.0311  -0.0337 -0.0036 14  PRO B O   
2336 C CB  . PRO B 14  ? 0.4511 0.4451 0.4247 0.0244  -0.0252 0.0011  14  PRO B CB  
2337 C CG  . PRO B 14  ? 0.4466 0.4453 0.4268 0.0181  -0.0244 0.0023  14  PRO B CG  
2338 C CD  . PRO B 14  ? 0.4540 0.4524 0.4370 0.0163  -0.0266 0.0018  14  PRO B CD  
2339 N N   . ALA B 15  ? 0.6242 0.6075 0.5832 0.0370  -0.0270 -0.0016 15  ALA B N   
2340 C CA  . ALA B 15  ? 0.6475 0.6257 0.6010 0.0428  -0.0307 -0.0042 15  ALA B CA  
2341 C C   . ALA B 15  ? 0.6438 0.6197 0.5950 0.0460  -0.0339 -0.0062 15  ALA B C   
2342 O O   . ALA B 15  ? 0.7212 0.6988 0.6716 0.0466  -0.0312 -0.0049 15  ALA B O   
2343 C CB  . ALA B 15  ? 0.6849 0.6600 0.6303 0.0483  -0.0271 -0.0033 15  ALA B CB  
2344 N N   . GLU B 16  ? 0.6086 0.5805 0.5591 0.0482  -0.0399 -0.0093 16  GLU B N   
2345 C CA  . GLU B 16  ? 0.5391 0.5077 0.4866 0.0520  -0.0440 -0.0118 16  GLU B CA  
2346 C C   . GLU B 16  ? 0.5507 0.5130 0.4925 0.0577  -0.0493 -0.0152 16  GLU B C   
2347 O O   . GLU B 16  ? 0.5666 0.5273 0.5129 0.0554  -0.0542 -0.0166 16  GLU B O   
2348 C CB  . GLU B 16  ? 0.4840 0.4542 0.4400 0.0464  -0.0476 -0.0123 16  GLU B CB  
2349 C CG  . GLU B 16  ? 0.6141 0.5799 0.5677 0.0501  -0.0531 -0.0153 16  GLU B CG  
2350 C CD  . GLU B 16  ? 0.8519 0.8181 0.8145 0.0445  -0.0574 -0.0156 16  GLU B CD  
2351 O OE1 . GLU B 16  ? 0.9467 0.9174 0.9170 0.0379  -0.0554 -0.0131 16  GLU B OE1 
2352 O OE2 . GLU B 16  ? 0.8934 0.8552 0.8550 0.0471  -0.0629 -0.0182 16  GLU B OE2 
2353 N N   . ASN B 17  ? 0.4840 0.4427 0.4157 0.0655  -0.0484 -0.0161 17  ASN B N   
2354 C CA  . ASN B 17  ? 0.4741 0.4264 0.3986 0.0720  -0.0536 -0.0195 17  ASN B CA  
2355 C C   . ASN B 17  ? 0.4246 0.3734 0.3540 0.0705  -0.0623 -0.0230 17  ASN B C   
2356 O O   . ASN B 17  ? 0.4230 0.3717 0.3554 0.0692  -0.0648 -0.0239 17  ASN B O   
2357 C CB  . ASN B 17  ? 0.4989 0.4478 0.4116 0.0811  -0.0519 -0.0202 17  ASN B CB  
2358 C CG  . ASN B 17  ? 0.5416 0.4933 0.4498 0.0831  -0.0432 -0.0160 17  ASN B CG  
2359 O OD1 . ASN B 17  ? 0.6064 0.5603 0.5176 0.0795  -0.0398 -0.0138 17  ASN B OD1 
2360 N ND2 . ASN B 17  ? 0.4911 0.4424 0.3925 0.0889  -0.0397 -0.0146 17  ASN B ND2 
2361 N N   . GLY B 18  ? 0.4929 0.4386 0.4236 0.0707  -0.0670 -0.0248 18  GLY B N   
2362 C CA  . GLY B 18  ? 0.5230 0.4646 0.4587 0.0698  -0.0758 -0.0278 18  GLY B CA  
2363 C C   . GLY B 18  ? 0.5537 0.4994 0.5027 0.0608  -0.0769 -0.0257 18  GLY B C   
2364 O O   . GLY B 18  ? 0.5976 0.5403 0.5526 0.0592  -0.0840 -0.0272 18  GLY B O   
2365 N N   . LYS B 19  ? 0.5285 0.4809 0.4821 0.0552  -0.0700 -0.0219 19  LYS B N   
2366 C CA  . LYS B 19  ? 0.4995 0.4564 0.4648 0.0471  -0.0702 -0.0193 19  LYS B CA  
2367 C C   . LYS B 19  ? 0.4852 0.4459 0.4535 0.0443  -0.0670 -0.0170 19  LYS B C   
2368 O O   . LYS B 19  ? 0.5324 0.4959 0.4964 0.0450  -0.0606 -0.0154 19  LYS B O   
2369 C CB  . LYS B 19  ? 0.5301 0.4918 0.4996 0.0424  -0.0660 -0.0168 19  LYS B CB  
2370 C CG  . LYS B 19  ? 0.7999 0.7587 0.7727 0.0416  -0.0711 -0.0182 19  LYS B CG  
2371 C CD  . LYS B 19  ? 0.9759 0.9321 0.9567 0.0390  -0.0783 -0.0186 19  LYS B CD  
2372 C CE  . LYS B 19  ? 1.0272 0.9785 1.0100 0.0398  -0.0849 -0.0206 19  LYS B CE  
2373 N NZ  . LYS B 19  ? 1.0366 0.9847 1.0276 0.0376  -0.0926 -0.0207 19  LYS B NZ  
2374 N N   . SER B 20  ? 0.4468 0.4076 0.4227 0.0413  -0.0715 -0.0167 20  SER B N   
2375 C CA  . SER B 20  ? 0.4427 0.4074 0.4222 0.0388  -0.0689 -0.0144 20  SER B CA  
2376 C C   . SER B 20  ? 0.4458 0.4174 0.4281 0.0338  -0.0615 -0.0108 20  SER B C   
2377 O O   . SER B 20  ? 0.3007 0.2747 0.2866 0.0302  -0.0601 -0.0094 20  SER B O   
2378 C CB  . SER B 20  ? 0.4297 0.3945 0.4187 0.0357  -0.0750 -0.0138 20  SER B CB  
2379 O OG  . SER B 20  ? 0.5435 0.5099 0.5411 0.0308  -0.0772 -0.0121 20  SER B OG  
2380 N N   . ASN B 21  ? 0.3290 0.3033 0.3095 0.0340  -0.0573 -0.0095 21  ASN B N   
2381 C CA  . ASN B 21  ? 0.3042 0.2839 0.2853 0.0307  -0.0505 -0.0066 21  ASN B CA  
2382 C C   . ASN B 21  ? 0.3924 0.3746 0.3743 0.0304  -0.0484 -0.0053 21  ASN B C   
2383 O O   . ASN B 21  ? 0.3873 0.3678 0.3706 0.0319  -0.0525 -0.0062 21  ASN B O   
2384 C CB  . ASN B 21  ? 0.3357 0.3139 0.3083 0.0342  -0.0460 -0.0071 21  ASN B CB  
2385 C CG  . ASN B 21  ? 0.3793 0.3624 0.3540 0.0301  -0.0405 -0.0046 21  ASN B CG  
2386 O OD1 . ASN B 21  ? 0.4563 0.4440 0.4367 0.0255  -0.0388 -0.0025 21  ASN B OD1 
2387 N ND2 . ASN B 21  ? 0.3473 0.3296 0.3173 0.0321  -0.0378 -0.0046 21  ASN B ND2 
2388 N N   . PHE B 22  ? 0.3700 0.3560 0.3509 0.0286  -0.0425 -0.0032 22  PHE B N   
2389 C CA  . PHE B 22  ? 0.3603 0.3483 0.3409 0.0289  -0.0403 -0.0020 22  PHE B CA  
2390 C C   . PHE B 22  ? 0.3862 0.3728 0.3590 0.0318  -0.0349 -0.0016 22  PHE B C   
2391 O O   . PHE B 22  ? 0.3889 0.3767 0.3602 0.0304  -0.0312 -0.0005 22  PHE B O   
2392 C CB  . PHE B 22  ? 0.3563 0.3508 0.3449 0.0235  -0.0390 0.0008  22  PHE B CB  
2393 C CG  . PHE B 22  ? 0.4010 0.3971 0.3976 0.0214  -0.0439 0.0014  22  PHE B CG  
2394 C CD1 . PHE B 22  ? 0.3910 0.3881 0.3939 0.0180  -0.0468 0.0022  22  PHE B CD1 
2395 C CD2 . PHE B 22  ? 0.5203 0.5171 0.5188 0.0229  -0.0458 0.0016  22  PHE B CD2 
2396 C CE1 . PHE B 22  ? 0.4684 0.4668 0.4794 0.0160  -0.0515 0.0034  22  PHE B CE1 
2397 C CE2 . PHE B 22  ? 0.4816 0.4803 0.4887 0.0208  -0.0506 0.0027  22  PHE B CE2 
2398 C CZ  . PHE B 22  ? 0.4691 0.4685 0.4826 0.0173  -0.0534 0.0038  22  PHE B CZ  
2399 N N   . LEU B 23  ? 0.3450 0.3287 0.3128 0.0358  -0.0347 -0.0022 23  LEU B N   
2400 C CA  . LEU B 23  ? 0.3081 0.2897 0.2686 0.0388  -0.0295 -0.0013 23  LEU B CA  
2401 C C   . LEU B 23  ? 0.3391 0.3241 0.3020 0.0365  -0.0265 0.0007  23  LEU B C   
2402 O O   . LEU B 23  ? 0.3609 0.3471 0.3263 0.0368  -0.0285 0.0006  23  LEU B O   
2403 C CB  . LEU B 23  ? 0.2745 0.2502 0.2270 0.0453  -0.0309 -0.0031 23  LEU B CB  
2404 C CG  . LEU B 23  ? 0.3284 0.3010 0.2730 0.0489  -0.0254 -0.0017 23  LEU B CG  
2405 C CD1 . LEU B 23  ? 0.2752 0.2472 0.2171 0.0486  -0.0213 -0.0006 23  LEU B CD1 
2406 C CD2 . LEU B 23  ? 0.3497 0.3168 0.2866 0.0555  -0.0271 -0.0034 23  LEU B CD2 
2407 N N   . ASN B 24  ? 0.3679 0.3542 0.3301 0.0338  -0.0212 0.0020  24  ASN B N   
2408 C CA  . ASN B 24  ? 0.3010 0.2899 0.2651 0.0313  -0.0176 0.0031  24  ASN B CA  
2409 C C   . ASN B 24  ? 0.2998 0.2845 0.2573 0.0338  -0.0125 0.0032  24  ASN B C   
2410 O O   . ASN B 24  ? 0.3918 0.3731 0.3447 0.0355  -0.0097 0.0032  24  ASN B O   
2411 C CB  . ASN B 24  ? 0.3126 0.3060 0.2815 0.0259  -0.0155 0.0041  24  ASN B CB  
2412 C CG  . ASN B 24  ? 0.4141 0.4120 0.3900 0.0231  -0.0201 0.0046  24  ASN B CG  
2413 O OD1 . ASN B 24  ? 0.4216 0.4213 0.4013 0.0236  -0.0242 0.0048  24  ASN B OD1 
2414 N ND2 . ASN B 24  ? 0.4042 0.4041 0.3824 0.0199  -0.0195 0.0050  24  ASN B ND2 
2415 N N   . CYS B 25  ? 0.2156 0.2007 0.1729 0.0343  -0.0113 0.0034  25  CYS B N   
2416 C CA  . CYS B 25  ? 0.2659 0.2476 0.2183 0.0355  -0.0062 0.0038  25  CYS B CA  
2417 C C   . CYS B 25  ? 0.3458 0.3311 0.3018 0.0320  -0.0041 0.0043  25  CYS B C   
2418 O O   . CYS B 25  ? 0.3358 0.3239 0.2944 0.0322  -0.0058 0.0044  25  CYS B O   
2419 C CB  . CYS B 25  ? 0.3188 0.2962 0.2657 0.0409  -0.0068 0.0033  25  CYS B CB  
2420 S SG  . CYS B 25  ? 0.4700 0.4421 0.4103 0.0429  -0.0005 0.0041  25  CYS B SG  
2421 N N   . TYR B 26  ? 0.3575 0.3428 0.3138 0.0290  -0.0005 0.0047  26  TYR B N   
2422 C CA  . TYR B 26  ? 0.2358 0.2242 0.1948 0.0260  0.0013  0.0048  26  TYR B CA  
2423 C C   . TYR B 26  ? 0.2564 0.2401 0.2108 0.0273  0.0054  0.0047  26  TYR B C   
2424 O O   . TYR B 26  ? 0.3296 0.3094 0.2816 0.0272  0.0083  0.0050  26  TYR B O   
2425 C CB  . TYR B 26  ? 0.2496 0.2410 0.2123 0.0216  0.0017  0.0050  26  TYR B CB  
2426 C CG  . TYR B 26  ? 0.2459 0.2405 0.2108 0.0188  0.0031  0.0049  26  TYR B CG  
2427 C CD1 . TYR B 26  ? 0.2513 0.2507 0.2191 0.0187  0.0015  0.0054  26  TYR B CD1 
2428 C CD2 . TYR B 26  ? 0.1945 0.1874 0.1587 0.0166  0.0059  0.0045  26  TYR B CD2 
2429 C CE1 . TYR B 26  ? 0.1590 0.1614 0.1279 0.0168  0.0030  0.0053  26  TYR B CE1 
2430 C CE2 . TYR B 26  ? 0.2521 0.2474 0.2175 0.0146  0.0068  0.0040  26  TYR B CE2 
2431 C CZ  . TYR B 26  ? 0.2620 0.2620 0.2292 0.0149  0.0054  0.0044  26  TYR B CZ  
2432 O OH  . TYR B 26  ? 0.3102 0.3126 0.2777 0.0136  0.0065  0.0040  26  TYR B OH  
2433 N N   . VAL B 27  ? 0.2930 0.2773 0.2468 0.0288  0.0056  0.0045  27  VAL B N   
2434 C CA  . VAL B 27  ? 0.2822 0.2620 0.2319 0.0300  0.0091  0.0042  27  VAL B CA  
2435 C C   . VAL B 27  ? 0.2584 0.2410 0.2102 0.0275  0.0102  0.0037  27  VAL B C   
2436 O O   . VAL B 27  ? 0.3136 0.3012 0.2681 0.0274  0.0085  0.0038  27  VAL B O   
2437 C CB  . VAL B 27  ? 0.2857 0.2627 0.2316 0.0346  0.0087  0.0042  27  VAL B CB  
2438 C CG1 . VAL B 27  ? 0.2658 0.2383 0.2076 0.0379  0.0085  0.0046  27  VAL B CG1 
2439 C CG2 . VAL B 27  ? 0.4282 0.4107 0.3778 0.0353  0.0053  0.0041  27  VAL B CG2 
2440 N N   . SER B 28  ? 0.1192 0.0985 0.0698 0.0258  0.0129  0.0033  28  SER B N   
2441 C CA  . SER B 28  ? 0.1883 0.1694 0.1399 0.0239  0.0137  0.0023  28  SER B CA  
2442 C C   . SER B 28  ? 0.2505 0.2252 0.1985 0.0245  0.0164  0.0016  28  SER B C   
2443 O O   . SER B 28  ? 0.2638 0.2331 0.2096 0.0256  0.0182  0.0023  28  SER B O   
2444 C CB  . SER B 28  ? 0.1900 0.1748 0.1454 0.0199  0.0128  0.0022  28  SER B CB  
2445 O OG  . SER B 28  ? 0.2958 0.2766 0.2511 0.0180  0.0143  0.0022  28  SER B OG  
2446 N N   . GLY B 29  ? 0.2546 0.2300 0.2022 0.0241  0.0167  0.0003  29  GLY B N   
2447 C CA  . GLY B 29  ? 0.2098 0.1791 0.1547 0.0243  0.0186  -0.0008 29  GLY B CA  
2448 C C   . GLY B 29  ? 0.3090 0.2734 0.2496 0.0282  0.0199  -0.0007 29  GLY B C   
2449 O O   . GLY B 29  ? 0.4254 0.3833 0.3639 0.0285  0.0216  -0.0011 29  GLY B O   
2450 N N   . PHE B 30  ? 0.2173 0.1848 0.1571 0.0311  0.0190  -0.0002 30  PHE B N   
2451 C CA  . PHE B 30  ? 0.2189 0.1821 0.1546 0.0351  0.0200  -0.0001 30  PHE B CA  
2452 C C   . PHE B 30  ? 0.3244 0.2897 0.2587 0.0376  0.0197  -0.0012 30  PHE B C   
2453 O O   . PHE B 30  ? 0.3163 0.2878 0.2531 0.0367  0.0186  -0.0016 30  PHE B O   
2454 C CB  . PHE B 30  ? 0.1948 0.1583 0.1299 0.0375  0.0191  0.0014  30  PHE B CB  
2455 C CG  . PHE B 30  ? 0.2614 0.2324 0.1999 0.0377  0.0162  0.0017  30  PHE B CG  
2456 C CD1 . PHE B 30  ? 0.2816 0.2571 0.2243 0.0349  0.0145  0.0022  30  PHE B CD1 
2457 C CD2 . PHE B 30  ? 0.2834 0.2569 0.2216 0.0409  0.0151  0.0016  30  PHE B CD2 
2458 C CE1 . PHE B 30  ? 0.2844 0.2664 0.2311 0.0349  0.0116  0.0028  30  PHE B CE1 
2459 C CE2 . PHE B 30  ? 0.2993 0.2798 0.2420 0.0409  0.0123  0.0023  30  PHE B CE2 
2460 C CZ  . PHE B 30  ? 0.2862 0.2708 0.2332 0.0378  0.0105  0.0029  30  PHE B CZ  
2461 N N   . HIS B 31  ? 0.3368 0.2969 0.2670 0.0410  0.0208  -0.0014 31  HIS B N   
2462 C CA  . HIS B 31  ? 0.3300 0.2914 0.2582 0.0441  0.0208  -0.0024 31  HIS B CA  
2463 C C   . HIS B 31  ? 0.3471 0.3023 0.2709 0.0481  0.0218  -0.0021 31  HIS B C   
2464 O O   . HIS B 31  ? 0.3340 0.2816 0.2551 0.0479  0.0234  -0.0019 31  HIS B O   
2465 C CB  . HIS B 31  ? 0.2764 0.2363 0.2034 0.0431  0.0214  -0.0044 31  HIS B CB  
2466 C CG  . HIS B 31  ? 0.2596 0.2251 0.1864 0.0454  0.0210  -0.0052 31  HIS B CG  
2467 N ND1 . HIS B 31  ? 0.2704 0.2344 0.1939 0.0498  0.0216  -0.0058 31  HIS B ND1 
2468 C CD2 . HIS B 31  ? 0.2980 0.2711 0.2275 0.0444  0.0202  -0.0053 31  HIS B CD2 
2469 C CE1 . HIS B 31  ? 0.2953 0.2659 0.2195 0.0514  0.0213  -0.0061 31  HIS B CE1 
2470 N NE2 . HIS B 31  ? 0.3177 0.2939 0.2455 0.0482  0.0206  -0.0057 31  HIS B NE2 
2471 N N   . PRO B 32  ? 0.4370 0.3954 0.3603 0.0517  0.0209  -0.0019 32  PRO B N   
2472 C CA  . PRO B 32  ? 0.4782 0.4457 0.4053 0.0522  0.0193  -0.0017 32  PRO B CA  
2473 C C   . PRO B 32  ? 0.4508 0.4240 0.3827 0.0506  0.0170  -0.0002 32  PRO B C   
2474 O O   . PRO B 32  ? 0.4288 0.3991 0.3606 0.0490  0.0167  0.0004  32  PRO B O   
2475 C CB  . PRO B 32  ? 0.3858 0.3526 0.3103 0.0570  0.0193  -0.0019 32  PRO B CB  
2476 C CG  . PRO B 32  ? 0.3608 0.3201 0.2814 0.0589  0.0198  -0.0014 32  PRO B CG  
2477 C CD  . PRO B 32  ? 0.4301 0.3831 0.3492 0.0558  0.0214  -0.0014 32  PRO B CD  
2478 N N   . SER B 33  ? 0.4232 0.4045 0.3596 0.0512  0.0153  0.0006  33  SER B N   
2479 C CA  . SER B 33  ? 0.3950 0.3825 0.3372 0.0493  0.0126  0.0020  33  SER B CA  
2480 C C   . SER B 33  ? 0.3581 0.3434 0.3000 0.0516  0.0103  0.0026  33  SER B C   
2481 O O   . SER B 33  ? 0.4121 0.3987 0.3566 0.0499  0.0082  0.0032  33  SER B O   
2482 C CB  . SER B 33  ? 0.3429 0.3400 0.2909 0.0492  0.0116  0.0032  33  SER B CB  
2483 O OG  . SER B 33  ? 0.4394 0.4377 0.3862 0.0532  0.0123  0.0032  33  SER B OG  
2484 N N   . ASP B 34  ? 0.3463 0.3283 0.2846 0.0558  0.0106  0.0022  34  ASP B N   
2485 C CA  . ASP B 34  ? 0.4245 0.4039 0.3615 0.0587  0.0082  0.0024  34  ASP B CA  
2486 C C   . ASP B 34  ? 0.4348 0.4081 0.3681 0.0576  0.0086  0.0023  34  ASP B C   
2487 O O   . ASP B 34  ? 0.4248 0.3913 0.3528 0.0580  0.0116  0.0021  34  ASP B O   
2488 C CB  . ASP B 34  ? 0.7207 0.6960 0.6530 0.0635  0.0091  0.0019  34  ASP B CB  
2489 C CG  . ASP B 34  ? 1.0617 1.0435 0.9976 0.0651  0.0088  0.0021  34  ASP B CG  
2490 O OD1 . ASP B 34  ? 1.1141 1.1041 1.0571 0.0639  0.0064  0.0032  34  ASP B OD1 
2491 O OD2 . ASP B 34  ? 1.1860 1.1646 1.1177 0.0676  0.0111  0.0013  34  ASP B OD2 
2492 N N   . ILE B 35  ? 0.3890 0.3649 0.3256 0.0565  0.0056  0.0028  35  ILE B N   
2493 C CA  . ILE B 35  ? 0.3446 0.3157 0.2781 0.0559  0.0059  0.0028  35  ILE B CA  
2494 C C   . ILE B 35  ? 0.3613 0.3335 0.2961 0.0576  0.0015  0.0028  35  ILE B C   
2495 O O   . ILE B 35  ? 0.3948 0.3733 0.3360 0.0566  -0.0021 0.0030  35  ILE B O   
2496 C CB  . ILE B 35  ? 0.3328 0.3057 0.2690 0.0509  0.0074  0.0031  35  ILE B CB  
2497 C CG1 . ILE B 35  ? 0.3330 0.3001 0.2652 0.0506  0.0091  0.0034  35  ILE B CG1 
2498 C CG2 . ILE B 35  ? 0.1465 0.1271 0.0900 0.0481  0.0040  0.0035  35  ILE B CG2 
2499 C CD1 . ILE B 35  ? 0.3060 0.2739 0.2405 0.0460  0.0112  0.0035  35  ILE B CD1 
2500 N N   . GLU B 36  ? 0.3428 0.3088 0.2717 0.0605  0.0016  0.0027  36  GLU B N   
2501 C CA  . GLU B 36  ? 0.4233 0.3892 0.3521 0.0629  -0.0029 0.0022  36  GLU B CA  
2502 C C   . GLU B 36  ? 0.3593 0.3239 0.2875 0.0610  -0.0028 0.0024  36  GLU B C   
2503 O O   . GLU B 36  ? 0.3585 0.3186 0.2821 0.0609  0.0012  0.0031  36  GLU B O   
2504 C CB  . GLU B 36  ? 0.5240 0.4839 0.4456 0.0690  -0.0035 0.0018  36  GLU B CB  
2505 C CG  . GLU B 36  ? 0.6914 0.6507 0.6123 0.0723  -0.0090 0.0008  36  GLU B CG  
2506 C CD  . GLU B 36  ? 0.8092 0.7624 0.7222 0.0789  -0.0097 0.0003  36  GLU B CD  
2507 O OE1 . GLU B 36  ? 0.8612 0.8093 0.7679 0.0808  -0.0051 0.0012  36  GLU B OE1 
2508 O OE2 . GLU B 36  ? 0.7979 0.7511 0.7111 0.0822  -0.0152 -0.0010 36  GLU B OE2 
2509 N N   . VAL B 37  ? 0.2994 0.2680 0.2326 0.0596  -0.0072 0.0020  37  VAL B N   
2510 C CA  . VAL B 37  ? 0.3187 0.2869 0.2521 0.0577  -0.0076 0.0020  37  VAL B CA  
2511 C C   . VAL B 37  ? 0.3595 0.3276 0.2934 0.0603  -0.0135 0.0009  37  VAL B C   
2512 O O   . VAL B 37  ? 0.4116 0.3839 0.3517 0.0597  -0.0182 0.0005  37  VAL B O   
2513 C CB  . VAL B 37  ? 0.2977 0.2716 0.2380 0.0517  -0.0066 0.0026  37  VAL B CB  
2514 C CG1 . VAL B 37  ? 0.2179 0.1916 0.1587 0.0499  -0.0074 0.0026  37  VAL B CG1 
2515 C CG2 . VAL B 37  ? 0.2903 0.2636 0.2295 0.0494  -0.0013 0.0033  37  VAL B CG2 
2516 N N   . ASP B 38  ? 0.3425 0.3055 0.2700 0.0634  -0.0132 0.0005  38  ASP B N   
2517 C CA  . ASP B 38  ? 0.3651 0.3269 0.2918 0.0664  -0.0190 -0.0009 38  ASP B CA  
2518 C C   . ASP B 38  ? 0.4367 0.3975 0.3620 0.0654  -0.0184 -0.0009 38  ASP B C   
2519 O O   . ASP B 38  ? 0.5331 0.4915 0.4543 0.0650  -0.0129 0.0003  38  ASP B O   
2520 C CB  . ASP B 38  ? 0.4827 0.4385 0.4009 0.0735  -0.0205 -0.0019 38  ASP B CB  
2521 C CG  . ASP B 38  ? 0.5907 0.5479 0.5114 0.0752  -0.0236 -0.0026 38  ASP B CG  
2522 O OD1 . ASP B 38  ? 0.7338 0.6939 0.6600 0.0748  -0.0297 -0.0041 38  ASP B OD1 
2523 O OD2 . ASP B 38  ? 0.5324 0.4878 0.4497 0.0766  -0.0198 -0.0018 38  ASP B OD2 
2524 N N   . LEU B 39  ? 0.4012 0.3638 0.3304 0.0650  -0.0241 -0.0021 39  LEU B N   
2525 C CA  . LEU B 39  ? 0.3859 0.3472 0.3132 0.0650  -0.0243 -0.0025 39  LEU B CA  
2526 C C   . LEU B 39  ? 0.4354 0.3909 0.3543 0.0716  -0.0272 -0.0048 39  LEU B C   
2527 O O   . LEU B 39  ? 0.4737 0.4282 0.3928 0.0739  -0.0326 -0.0072 39  LEU B O   
2528 C CB  . LEU B 39  ? 0.3871 0.3535 0.3234 0.0598  -0.0282 -0.0032 39  LEU B CB  
2529 C CG  . LEU B 39  ? 0.3235 0.2959 0.2676 0.0536  -0.0257 -0.0010 39  LEU B CG  
2530 C CD1 . LEU B 39  ? 0.2740 0.2513 0.2269 0.0490  -0.0299 -0.0015 39  LEU B CD1 
2531 C CD2 . LEU B 39  ? 0.3790 0.3507 0.3203 0.0515  -0.0189 0.0003  39  LEU B CD2 
2532 N N   . LEU B 40  ? 0.4064 0.3581 0.3179 0.0748  -0.0236 -0.0040 40  LEU B N   
2533 C CA  . LEU B 40  ? 0.3409 0.2869 0.2426 0.0821  -0.0255 -0.0057 40  LEU B CA  
2534 C C   . LEU B 40  ? 0.4156 0.3608 0.3159 0.0833  -0.0281 -0.0073 40  LEU B C   
2535 O O   . LEU B 40  ? 0.4813 0.4288 0.3843 0.0802  -0.0250 -0.0057 40  LEU B O   
2536 C CB  . LEU B 40  ? 0.3123 0.2539 0.2052 0.0866  -0.0189 -0.0031 40  LEU B CB  
2537 C CG  . LEU B 40  ? 0.3657 0.3074 0.2595 0.0853  -0.0149 -0.0012 40  LEU B CG  
2538 C CD1 . LEU B 40  ? 0.3548 0.2921 0.2405 0.0887  -0.0078 0.0013  40  LEU B CD1 
2539 C CD2 . LEU B 40  ? 0.3263 0.2673 0.2199 0.0877  -0.0199 -0.0034 40  LEU B CD2 
2540 N N   . LYS B 41  ? 0.3978 0.3395 0.2939 0.0881  -0.0343 -0.0107 41  LYS B N   
2541 C CA  . LYS B 41  ? 0.3921 0.3314 0.2841 0.0913  -0.0368 -0.0126 41  LYS B CA  
2542 C C   . LYS B 41  ? 0.4653 0.3983 0.3439 0.1005  -0.0358 -0.0131 41  LYS B C   
2543 O O   . LYS B 41  ? 0.4801 0.4092 0.3537 0.1055  -0.0403 -0.0156 41  LYS B O   
2544 C CB  . LYS B 41  ? 0.4208 0.3604 0.3187 0.0898  -0.0456 -0.0164 41  LYS B CB  
2545 C CG  . LYS B 41  ? 0.4561 0.3922 0.3490 0.0937  -0.0490 -0.0188 41  LYS B CG  
2546 C CD  . LYS B 41  ? 0.4439 0.3792 0.3431 0.0923  -0.0582 -0.0226 41  LYS B CD  
2547 C CE  . LYS B 41  ? 0.5573 0.4890 0.4519 0.0960  -0.0616 -0.0250 41  LYS B CE  
2548 N NZ  . LYS B 41  ? 0.6203 0.5501 0.5211 0.0948  -0.0711 -0.0288 41  LYS B NZ  
2549 N N   . ASN B 42  ? 0.5022 0.4344 0.3753 0.1030  -0.0297 -0.0103 42  ASN B N   
2550 C CA  . ASN B 42  ? 0.5146 0.4413 0.3748 0.1121  -0.0273 -0.0097 42  ASN B CA  
2551 C C   . ASN B 42  ? 0.5169 0.4407 0.3722 0.1152  -0.0256 -0.0088 42  ASN B C   
2552 O O   . ASN B 42  ? 0.5639 0.4825 0.4087 0.1233  -0.0271 -0.0100 42  ASN B O   
2553 C CB  . ASN B 42  ? 0.4677 0.3901 0.3208 0.1186  -0.0342 -0.0139 42  ASN B CB  
2554 C CG  . ASN B 42  ? 0.5352 0.4597 0.3916 0.1167  -0.0353 -0.0146 42  ASN B CG  
2555 O OD1 . ASN B 42  ? 0.5547 0.4818 0.4122 0.1151  -0.0290 -0.0111 42  ASN B OD1 
2556 N ND2 . ASN B 42  ? 0.5188 0.4419 0.3773 0.1169  -0.0437 -0.0192 42  ASN B ND2 
2557 N N   . GLY B 43  ? 0.4875 0.4146 0.3502 0.1091  -0.0225 -0.0067 43  GLY B N   
2558 C CA  . GLY B 43  ? 0.4528 0.3775 0.3118 0.1114  -0.0203 -0.0055 43  GLY B CA  
2559 C C   . GLY B 43  ? 0.4481 0.3735 0.3113 0.1101  -0.0270 -0.0088 43  GLY B C   
2560 O O   . GLY B 43  ? 0.4053 0.3307 0.2694 0.1094  -0.0253 -0.0077 43  GLY B O   
2561 N N   . GLU B 44  ? 0.5839 0.5097 0.4501 0.1099  -0.0347 -0.0127 44  GLU B N   
2562 C CA  . GLU B 44  ? 0.6327 0.5596 0.5047 0.1084  -0.0416 -0.0157 44  GLU B CA  
2563 C C   . GLU B 44  ? 0.6051 0.5388 0.4905 0.0994  -0.0410 -0.0143 44  GLU B C   
2564 O O   . GLU B 44  ? 0.5973 0.5349 0.4893 0.0940  -0.0397 -0.0132 44  GLU B O   
2565 C CB  . GLU B 44  ? 0.7298 0.6542 0.6014 0.1112  -0.0505 -0.0202 44  GLU B CB  
2566 C CG  . GLU B 44  ? 0.8335 0.7506 0.6923 0.1211  -0.0541 -0.0229 44  GLU B CG  
2567 C CD  . GLU B 44  ? 1.0008 0.9149 0.8605 0.1235  -0.0642 -0.0279 44  GLU B CD  
2568 O OE1 . GLU B 44  ? 1.0727 0.9832 0.9255 0.1281  -0.0660 -0.0297 44  GLU B OE1 
2569 O OE2 . GLU B 44  ? 1.0387 0.9541 0.9065 0.1209  -0.0705 -0.0299 44  GLU B OE2 
2570 N N   . ARG B 45  ? 0.4993 0.4346 0.3884 0.0983  -0.0420 -0.0141 45  ARG B N   
2571 C CA  . ARG B 45  ? 0.5459 0.4878 0.4471 0.0909  -0.0417 -0.0127 45  ARG B CA  
2572 C C   . ARG B 45  ? 0.5460 0.4912 0.4569 0.0869  -0.0486 -0.0148 45  ARG B C   
2573 O O   . ARG B 45  ? 0.5485 0.4910 0.4588 0.0901  -0.0556 -0.0180 45  ARG B O   
2574 C CB  . ARG B 45  ? 0.6081 0.5504 0.5099 0.0920  -0.0415 -0.0122 45  ARG B CB  
2575 C CG  . ARG B 45  ? 0.7446 0.6940 0.6586 0.0856  -0.0420 -0.0109 45  ARG B CG  
2576 C CD  . ARG B 45  ? 0.8986 0.8479 0.8115 0.0876  -0.0405 -0.0101 45  ARG B CD  
2577 N NE  . ARG B 45  ? 1.0872 1.0303 0.9906 0.0950  -0.0432 -0.0122 45  ARG B NE  
2578 C CZ  . ARG B 45  ? 1.1432 1.0843 1.0427 0.0985  -0.0421 -0.0118 45  ARG B CZ  
2579 N NH1 . ARG B 45  ? 1.1254 1.0704 1.0298 0.0954  -0.0383 -0.0096 45  ARG B NH1 
2580 N NH2 . ARG B 45  ? 1.1337 1.0689 1.0240 0.1055  -0.0449 -0.0139 45  ARG B NH2 
2581 N N   . ILE B 46  ? 0.5490 0.4998 0.4687 0.0801  -0.0466 -0.0130 46  ILE B N   
2582 C CA  . ILE B 46  ? 0.5159 0.4704 0.4461 0.0755  -0.0524 -0.0141 46  ILE B CA  
2583 C C   . ILE B 46  ? 0.5433 0.5032 0.4836 0.0719  -0.0544 -0.0130 46  ILE B C   
2584 O O   . ILE B 46  ? 0.4604 0.4241 0.4027 0.0695  -0.0493 -0.0104 46  ILE B O   
2585 C CB  . ILE B 46  ? 0.3753 0.3332 0.3099 0.0702  -0.0495 -0.0125 46  ILE B CB  
2586 C CG1 . ILE B 46  ? 0.3995 0.3526 0.3247 0.0741  -0.0476 -0.0134 46  ILE B CG1 
2587 C CG2 . ILE B 46  ? 0.3099 0.2714 0.2556 0.0654  -0.0552 -0.0132 46  ILE B CG2 
2588 C CD1 . ILE B 46  ? 0.4242 0.3806 0.3534 0.0694  -0.0446 -0.0118 46  ILE B CD1 
2589 N N   . GLU B 47  ? 0.6060 0.5662 0.5527 0.0717  -0.0619 -0.0149 47  GLU B N   
2590 C CA  . GLU B 47  ? 0.7687 0.7340 0.7250 0.0691  -0.0643 -0.0136 47  GLU B CA  
2591 C C   . GLU B 47  ? 0.8102 0.7832 0.7798 0.0618  -0.0644 -0.0110 47  GLU B C   
2592 O O   . GLU B 47  ? 0.8096 0.7887 0.7854 0.0590  -0.0617 -0.0082 47  GLU B O   
2593 C CB  . GLU B 47  ? 0.9121 0.8739 0.8692 0.0732  -0.0725 -0.0166 47  GLU B CB  
2594 C CG  . GLU B 47  ? 1.0950 1.0624 1.0627 0.0711  -0.0751 -0.0151 47  GLU B CG  
2595 C CD  . GLU B 47  ? 1.1620 1.1317 1.1264 0.0724  -0.0691 -0.0131 47  GLU B CD  
2596 O OE1 . GLU B 47  ? 1.1595 1.1314 1.1214 0.0703  -0.0618 -0.0107 47  GLU B OE1 
2597 O OE2 . GLU B 47  ? 1.1482 1.1173 1.1127 0.0758  -0.0720 -0.0139 47  GLU B OE2 
2598 N N   . LYS B 48  ? 0.8421 0.8147 0.8156 0.0591  -0.0675 -0.0116 48  LYS B N   
2599 C CA  . LYS B 48  ? 0.9075 0.8869 0.8929 0.0523  -0.0674 -0.0088 48  LYS B CA  
2600 C C   . LYS B 48  ? 0.7690 0.7519 0.7526 0.0489  -0.0597 -0.0063 48  LYS B C   
2601 O O   . LYS B 48  ? 0.8207 0.8029 0.8038 0.0468  -0.0589 -0.0064 48  LYS B O   
2602 C CB  . LYS B 48  ? 1.0572 1.0341 1.0474 0.0508  -0.0740 -0.0104 48  LYS B CB  
2603 C CG  . LYS B 48  ? 1.1125 1.0863 1.1071 0.0532  -0.0829 -0.0127 48  LYS B CG  
2604 C CD  . LYS B 48  ? 1.1264 1.1068 1.1365 0.0479  -0.0864 -0.0096 48  LYS B CD  
2605 C CE  . LYS B 48  ? 1.1114 1.0936 1.1291 0.0427  -0.0877 -0.0080 48  LYS B CE  
2606 N NZ  . LYS B 48  ? 1.0611 1.0494 1.0943 0.0378  -0.0916 -0.0044 48  LYS B NZ  
2607 N N   . VAL B 49  ? 0.5232 0.5097 0.5060 0.0487  -0.0544 -0.0041 49  VAL B N   
2608 C CA  . VAL B 49  ? 0.3903 0.3793 0.3706 0.0462  -0.0474 -0.0020 49  VAL B CA  
2609 C C   . VAL B 49  ? 0.4191 0.4162 0.4076 0.0422  -0.0447 0.0013  49  VAL B C   
2610 O O   . VAL B 49  ? 0.4000 0.3996 0.3900 0.0437  -0.0442 0.0023  49  VAL B O   
2611 C CB  . VAL B 49  ? 0.4082 0.3923 0.3771 0.0506  -0.0425 -0.0026 49  VAL B CB  
2612 C CG1 . VAL B 49  ? 0.3641 0.3509 0.3320 0.0478  -0.0359 -0.0003 49  VAL B CG1 
2613 C CG2 . VAL B 49  ? 0.4739 0.4509 0.4341 0.0547  -0.0438 -0.0053 49  VAL B CG2 
2614 N N   . GLU B 50  ? 0.4448 0.4461 0.4380 0.0375  -0.0430 0.0032  50  GLU B N   
2615 C CA  . GLU B 50  ? 0.4032 0.4124 0.4033 0.0340  -0.0402 0.0065  50  GLU B CA  
2616 C C   . GLU B 50  ? 0.4310 0.4403 0.4247 0.0344  -0.0338 0.0073  50  GLU B C   
2617 O O   . GLU B 50  ? 0.4314 0.4353 0.4171 0.0357  -0.0313 0.0058  50  GLU B O   
2618 C CB  . GLU B 50  ? 0.4569 0.4704 0.4652 0.0289  -0.0417 0.0083  50  GLU B CB  
2619 C CG  . GLU B 50  ? 0.6309 0.6521 0.6506 0.0263  -0.0437 0.0115  50  GLU B CG  
2620 C CD  . GLU B 50  ? 0.7278 0.7473 0.7537 0.0267  -0.0506 0.0107  50  GLU B CD  
2621 O OE1 . GLU B 50  ? 0.7229 0.7351 0.7434 0.0294  -0.0539 0.0073  50  GLU B OE1 
2622 O OE2 . GLU B 50  ? 0.6909 0.7166 0.7273 0.0246  -0.0528 0.0137  50  GLU B OE2 
2623 N N   . HIS B 51  ? 0.4186 0.4335 0.4159 0.0328  -0.0306 0.0093  51  HIS B N   
2624 C CA  . HIS B 51  ? 0.4064 0.4208 0.3983 0.0318  -0.0241 0.0093  51  HIS B CA  
2625 C C   . HIS B 51  ? 0.3978 0.4201 0.3962 0.0282  -0.0220 0.0119  51  HIS B C   
2626 O O   . HIS B 51  ? 0.3536 0.3820 0.3604 0.0274  -0.0247 0.0141  51  HIS B O   
2627 C CB  . HIS B 51  ? 0.3845 0.3950 0.3695 0.0356  -0.0210 0.0081  51  HIS B CB  
2628 C CG  . HIS B 51  ? 0.5258 0.5406 0.5152 0.0372  -0.0220 0.0093  51  HIS B CG  
2629 N ND1 . HIS B 51  ? 0.5765 0.5962 0.5676 0.0364  -0.0181 0.0107  51  HIS B ND1 
2630 C CD2 . HIS B 51  ? 0.6765 0.6919 0.6693 0.0399  -0.0264 0.0092  51  HIS B CD2 
2631 C CE1 . HIS B 51  ? 0.6794 0.7027 0.6748 0.0384  -0.0198 0.0117  51  HIS B CE1 
2632 N NE2 . HIS B 51  ? 0.7150 0.7359 0.7120 0.0404  -0.0249 0.0109  51  HIS B NE2 
2633 N N   . SER B 52  ? 0.3013 0.3234 0.2961 0.0263  -0.0174 0.0118  52  SER B N   
2634 C CA  . SER B 52  ? 0.2492 0.2782 0.2484 0.0235  -0.0152 0.0141  52  SER B CA  
2635 C C   . SER B 52  ? 0.3234 0.3555 0.3224 0.0256  -0.0124 0.0149  52  SER B C   
2636 O O   . SER B 52  ? 0.4341 0.4629 0.4299 0.0290  -0.0125 0.0137  52  SER B O   
2637 C CB  . SER B 52  ? 0.2380 0.2651 0.2328 0.0212  -0.0117 0.0132  52  SER B CB  
2638 O OG  . SER B 52  ? 0.2963 0.3187 0.2835 0.0230  -0.0076 0.0114  52  SER B OG  
2639 N N   . ASP B 53  ? 0.2601 0.2985 0.2622 0.0241  -0.0100 0.0169  53  ASP B N   
2640 C CA  . ASP B 53  ? 0.3235 0.3653 0.3249 0.0264  -0.0070 0.0177  53  ASP B CA  
2641 C C   . ASP B 53  ? 0.3810 0.4176 0.3732 0.0276  -0.0026 0.0152  53  ASP B C   
2642 O O   . ASP B 53  ? 0.4152 0.4497 0.4043 0.0254  -0.0011 0.0143  53  ASP B O   
2643 C CB  . ASP B 53  ? 0.3233 0.3748 0.3322 0.0249  -0.0064 0.0215  53  ASP B CB  
2644 C CG  . ASP B 53  ? 0.4289 0.4859 0.4483 0.0242  -0.0107 0.0244  53  ASP B CG  
2645 O OD1 . ASP B 53  ? 0.5385 0.5947 0.5597 0.0267  -0.0129 0.0241  53  ASP B OD1 
2646 O OD2 . ASP B 53  ? 0.3854 0.4475 0.4117 0.0211  -0.0122 0.0271  53  ASP B OD2 
2647 N N   . LEU B 54  ? 0.3248 0.3592 0.3129 0.0311  -0.0008 0.0142  54  LEU B N   
2648 C CA  . LEU B 54  ? 0.3290 0.3577 0.3087 0.0324  0.0029  0.0118  54  LEU B CA  
2649 C C   . LEU B 54  ? 0.3158 0.3477 0.2946 0.0308  0.0055  0.0121  54  LEU B C   
2650 O O   . LEU B 54  ? 0.3228 0.3624 0.3059 0.0309  0.0061  0.0144  54  LEU B O   
2651 C CB  . LEU B 54  ? 0.3283 0.3554 0.3049 0.0366  0.0042  0.0111  54  LEU B CB  
2652 C CG  . LEU B 54  ? 0.2627 0.2820 0.2305 0.0384  0.0073  0.0084  54  LEU B CG  
2653 C CD1 . LEU B 54  ? 0.1533 0.1643 0.1169 0.0378  0.0067  0.0067  54  LEU B CD1 
2654 C CD2 . LEU B 54  ? 0.2329 0.2517 0.1982 0.0427  0.0085  0.0080  54  LEU B CD2 
2655 N N   . SER B 55  ? 0.3281 0.3543 0.3014 0.0294  0.0071  0.0099  55  SER B N   
2656 C CA  . SER B 55  ? 0.3182 0.3461 0.2895 0.0283  0.0091  0.0095  55  SER B CA  
2657 C C   . SER B 55  ? 0.3336 0.3529 0.2977 0.0285  0.0109  0.0063  55  SER B C   
2658 O O   . SER B 55  ? 0.4676 0.4806 0.4292 0.0289  0.0107  0.0051  55  SER B O   
2659 C CB  . SER B 55  ? 0.3139 0.3460 0.2898 0.0245  0.0076  0.0110  55  SER B CB  
2660 O OG  . SER B 55  ? 0.3624 0.3994 0.3381 0.0243  0.0092  0.0119  55  SER B OG  
2661 N N   . PHE B 56  ? 0.2988 0.3180 0.2597 0.0283  0.0126  0.0051  56  PHE B N   
2662 C CA  . PHE B 56  ? 0.3014 0.3125 0.2563 0.0285  0.0139  0.0022  56  PHE B CA  
2663 C C   . PHE B 56  ? 0.3251 0.3356 0.2786 0.0261  0.0140  0.0008  56  PHE B C   
2664 O O   . PHE B 56  ? 0.2747 0.2915 0.2305 0.0252  0.0136  0.0021  56  PHE B O   
2665 C CB  . PHE B 56  ? 0.2936 0.3021 0.2438 0.0327  0.0156  0.0009  56  PHE B CB  
2666 C CG  . PHE B 56  ? 0.2730 0.2887 0.2236 0.0352  0.0165  0.0020  56  PHE B CG  
2667 C CD1 . PHE B 56  ? 0.3222 0.3380 0.2689 0.0360  0.0175  0.0004  56  PHE B CD1 
2668 C CD2 . PHE B 56  ? 0.1982 0.2205 0.1530 0.0371  0.0163  0.0046  56  PHE B CD2 
2669 C CE1 . PHE B 56  ? 0.3558 0.3785 0.3022 0.0390  0.0187  0.0017  56  PHE B CE1 
2670 C CE2 . PHE B 56  ? 0.2898 0.3195 0.2456 0.0397  0.0176  0.0062  56  PHE B CE2 
2671 C CZ  . PHE B 56  ? 0.3732 0.4032 0.3243 0.0409  0.0190  0.0048  56  PHE B CZ  
2672 N N   . SER B 57  ? 0.3062 0.3090 0.2563 0.0252  0.0144  -0.0016 57  SER B N   
2673 C CA  . SER B 57  ? 0.2047 0.2059 0.1537 0.0228  0.0140  -0.0033 57  SER B CA  
2674 C C   . SER B 57  ? 0.2847 0.2834 0.2284 0.0254  0.0147  -0.0057 57  SER B C   
2675 O O   . SER B 57  ? 0.3514 0.3501 0.2923 0.0291  0.0158  -0.0060 57  SER B O   
2676 C CB  . SER B 57  ? 0.1806 0.1754 0.1303 0.0200  0.0137  -0.0042 57  SER B CB  
2677 O OG  . SER B 57  ? 0.2940 0.2913 0.2480 0.0179  0.0128  -0.0022 57  SER B OG  
2678 N N   . LYS B 58  ? 0.3263 0.3228 0.2687 0.0236  0.0138  -0.0077 58  LYS B N   
2679 C CA  . LYS B 58  ? 0.4404 0.4343 0.3774 0.0263  0.0137  -0.0105 58  LYS B CA  
2680 C C   . LYS B 58  ? 0.4257 0.4114 0.3588 0.0286  0.0143  -0.0126 58  LYS B C   
2681 O O   . LYS B 58  ? 0.4054 0.3892 0.3334 0.0322  0.0144  -0.0147 58  LYS B O   
2682 C CB  . LYS B 58  ? 0.4373 0.4293 0.3740 0.0237  0.0119  -0.0126 58  LYS B CB  
2683 N N   . ASP B 59  ? 0.4182 0.3990 0.3533 0.0270  0.0148  -0.0120 59  ASP B N   
2684 C CA  . ASP B 59  ? 0.4136 0.3863 0.3455 0.0290  0.0155  -0.0135 59  ASP B CA  
2685 C C   . ASP B 59  ? 0.4194 0.3937 0.3502 0.0324  0.0170  -0.0119 59  ASP B C   
2686 O O   . ASP B 59  ? 0.3787 0.3465 0.3069 0.0343  0.0178  -0.0126 59  ASP B O   
2687 C CB  . ASP B 59  ? 0.4642 0.4299 0.3985 0.0256  0.0154  -0.0134 59  ASP B CB  
2688 C CG  . ASP B 59  ? 0.5523 0.5209 0.4908 0.0237  0.0162  -0.0104 59  ASP B CG  
2689 O OD1 . ASP B 59  ? 0.4981 0.4731 0.4376 0.0251  0.0164  -0.0086 59  ASP B OD1 
2690 O OD2 . ASP B 59  ? 0.6038 0.5682 0.5447 0.0211  0.0165  -0.0098 59  ASP B OD2 
2691 N N   . TRP B 60  ? 0.3313 0.3142 0.2645 0.0332  0.0172  -0.0096 60  TRP B N   
2692 C CA  . TRP B 60  ? 0.3337 0.3196 0.2670 0.0364  0.0182  -0.0079 60  TRP B CA  
2693 C C   . TRP B 60  ? 0.3898 0.3740 0.3257 0.0354  0.0182  -0.0061 60  TRP B C   
2694 O O   . TRP B 60  ? 0.4973 0.4839 0.4338 0.0380  0.0185  -0.0047 60  TRP B O   
2695 C CB  . TRP B 60  ? 0.3106 0.2920 0.2384 0.0408  0.0191  -0.0098 60  TRP B CB  
2696 C CG  . TRP B 60  ? 0.3559 0.3382 0.2798 0.0429  0.0190  -0.0120 60  TRP B CG  
2697 C CD1 . TRP B 60  ? 0.3858 0.3604 0.3051 0.0436  0.0182  -0.0154 60  TRP B CD1 
2698 C CD2 . TRP B 60  ? 0.3622 0.3534 0.2862 0.0451  0.0194  -0.0110 60  TRP B CD2 
2699 N NE1 . TRP B 60  ? 0.5047 0.4826 0.4204 0.0464  0.0180  -0.0169 60  TRP B NE1 
2700 C CE2 . TRP B 60  ? 0.4424 0.4307 0.3607 0.0474  0.0191  -0.0140 60  TRP B CE2 
2701 C CE3 . TRP B 60  ? 0.2726 0.2738 0.2012 0.0453  0.0200  -0.0075 60  TRP B CE3 
2702 C CZ2 . TRP B 60  ? 0.3893 0.3847 0.3055 0.0505  0.0197  -0.0136 60  TRP B CZ2 
2703 C CZ3 . TRP B 60  ? 0.2237 0.2322 0.1513 0.0478  0.0209  -0.0067 60  TRP B CZ3 
2704 C CH2 . TRP B 60  ? 0.2547 0.2604 0.1757 0.0506  0.0209  -0.0097 60  TRP B CH2 
2705 N N   . SER B 61  ? 0.3201 0.3003 0.2576 0.0321  0.0179  -0.0060 61  SER B N   
2706 C CA  . SER B 61  ? 0.3125 0.2909 0.2517 0.0317  0.0179  -0.0044 61  SER B CA  
2707 C C   . SER B 61  ? 0.3223 0.3086 0.2662 0.0307  0.0165  -0.0022 61  SER B C   
2708 O O   . SER B 61  ? 0.2504 0.2424 0.1971 0.0287  0.0156  -0.0018 61  SER B O   
2709 C CB  . SER B 61  ? 0.2370 0.2093 0.1766 0.0288  0.0183  -0.0046 61  SER B CB  
2710 O OG  . SER B 61  ? 0.2767 0.2525 0.2199 0.0251  0.0173  -0.0044 61  SER B OG  
2711 N N   . PHE B 62  ? 0.3412 0.3275 0.2859 0.0322  0.0160  -0.0009 62  PHE B N   
2712 C CA  . PHE B 62  ? 0.2931 0.2863 0.2426 0.0317  0.0140  0.0010  62  PHE B CA  
2713 C C   . PHE B 62  ? 0.3331 0.3259 0.2852 0.0288  0.0127  0.0018  62  PHE B C   
2714 O O   . PHE B 62  ? 0.3467 0.3337 0.2967 0.0278  0.0137  0.0012  62  PHE B O   
2715 C CB  . PHE B 62  ? 0.2134 0.2074 0.1629 0.0353  0.0133  0.0019  62  PHE B CB  
2716 C CG  . PHE B 62  ? 0.2763 0.2724 0.2242 0.0384  0.0144  0.0016  62  PHE B CG  
2717 C CD1 . PHE B 62  ? 0.2813 0.2857 0.2329 0.0384  0.0141  0.0028  62  PHE B CD1 
2718 C CD2 . PHE B 62  ? 0.3071 0.2972 0.2499 0.0416  0.0159  0.0003  62  PHE B CD2 
2719 C CE1 . PHE B 62  ? 0.2008 0.2077 0.1508 0.0418  0.0153  0.0026  62  PHE B CE1 
2720 C CE2 . PHE B 62  ? 0.3117 0.3037 0.2528 0.0449  0.0168  -0.0001 62  PHE B CE2 
2721 C CZ  . PHE B 62  ? 0.2283 0.2290 0.1730 0.0451  0.0166  0.0010  62  PHE B CZ  
2722 N N   . TYR B 63  ? 0.2063 0.2054 0.1633 0.0275  0.0104  0.0032  63  TYR B N   
2723 C CA  . TYR B 63  ? 0.3194 0.3183 0.2788 0.0256  0.0086  0.0039  63  TYR B CA  
2724 C C   . TYR B 63  ? 0.3960 0.3998 0.3600 0.0264  0.0055  0.0054  63  TYR B C   
2725 O O   . TYR B 63  ? 0.3181 0.3280 0.2858 0.0267  0.0046  0.0066  63  TYR B O   
2726 C CB  . TYR B 63  ? 0.2517 0.2522 0.2131 0.0217  0.0086  0.0037  63  TYR B CB  
2727 C CG  . TYR B 63  ? 0.2362 0.2439 0.2013 0.0202  0.0078  0.0046  63  TYR B CG  
2728 C CD1 . TYR B 63  ? 0.2204 0.2340 0.1909 0.0189  0.0053  0.0065  63  TYR B CD1 
2729 C CD2 . TYR B 63  ? 0.2939 0.3023 0.2569 0.0201  0.0096  0.0037  63  TYR B CD2 
2730 C CE1 . TYR B 63  ? 0.2734 0.2938 0.2475 0.0176  0.0049  0.0080  63  TYR B CE1 
2731 C CE2 . TYR B 63  ? 0.3465 0.3617 0.3122 0.0192  0.0092  0.0048  63  TYR B CE2 
2732 C CZ  . TYR B 63  ? 0.3497 0.3710 0.3211 0.0179  0.0071  0.0072  63  TYR B CZ  
2733 O OH  . TYR B 63  ? 0.4199 0.4482 0.3942 0.0171  0.0070  0.0090  63  TYR B OH  
2734 N N   . LEU B 64  ? 0.3027 0.3037 0.2664 0.0269  0.0037  0.0054  64  LEU B N   
2735 C CA  . LEU B 64  ? 0.2668 0.2711 0.2348 0.0277  -0.0001 0.0064  64  LEU B CA  
2736 C C   . LEU B 64  ? 0.3023 0.3049 0.2710 0.0265  -0.0023 0.0063  64  LEU B C   
2737 O O   . LEU B 64  ? 0.2731 0.2704 0.2376 0.0268  -0.0006 0.0054  64  LEU B O   
2738 C CB  . LEU B 64  ? 0.2996 0.3013 0.2652 0.0319  -0.0009 0.0061  64  LEU B CB  
2739 C CG  . LEU B 64  ? 0.4127 0.4181 0.3796 0.0337  -0.0002 0.0067  64  LEU B CG  
2740 C CD1 . LEU B 64  ? 0.3984 0.3998 0.3617 0.0381  -0.0007 0.0060  64  LEU B CD1 
2741 C CD2 . LEU B 64  ? 0.3300 0.3439 0.3052 0.0321  -0.0029 0.0087  64  LEU B CD2 
2742 N N   . LEU B 65  ? 0.2744 0.2814 0.2489 0.0254  -0.0062 0.0073  65  LEU B N   
2743 C CA  . LEU B 65  ? 0.2346 0.2396 0.2096 0.0251  -0.0091 0.0070  65  LEU B CA  
2744 C C   . LEU B 65  ? 0.2524 0.2565 0.2284 0.0282  -0.0134 0.0067  65  LEU B C   
2745 O O   . LEU B 65  ? 0.3129 0.3218 0.2951 0.0278  -0.0165 0.0079  65  LEU B O   
2746 C CB  . LEU B 65  ? 0.2122 0.2222 0.1930 0.0211  -0.0108 0.0081  65  LEU B CB  
2747 C CG  . LEU B 65  ? 0.3095 0.3179 0.2916 0.0210  -0.0146 0.0077  65  LEU B CG  
2748 C CD1 . LEU B 65  ? 0.2331 0.2359 0.2092 0.0217  -0.0121 0.0063  65  LEU B CD1 
2749 C CD2 . LEU B 65  ? 0.3274 0.3412 0.3164 0.0173  -0.0171 0.0091  65  LEU B CD2 
2750 N N   . TYR B 66  ? 0.1922 0.1901 0.1624 0.0314  -0.0137 0.0054  66  TYR B N   
2751 C CA  . TYR B 66  ? 0.2255 0.2216 0.1959 0.0347  -0.0186 0.0047  66  TYR B CA  
2752 C C   . TYR B 66  ? 0.3128 0.3077 0.2839 0.0341  -0.0218 0.0041  66  TYR B C   
2753 O O   . TYR B 66  ? 0.3640 0.3561 0.3312 0.0336  -0.0192 0.0037  66  TYR B O   
2754 C CB  . TYR B 66  ? 0.2527 0.2427 0.2153 0.0397  -0.0174 0.0035  66  TYR B CB  
2755 C CG  . TYR B 66  ? 0.3042 0.2951 0.2664 0.0412  -0.0156 0.0039  66  TYR B CG  
2756 C CD1 . TYR B 66  ? 0.3453 0.3364 0.3056 0.0397  -0.0104 0.0043  66  TYR B CD1 
2757 C CD2 . TYR B 66  ? 0.2952 0.2867 0.2591 0.0442  -0.0194 0.0036  66  TYR B CD2 
2758 C CE1 . TYR B 66  ? 0.4154 0.4071 0.3750 0.0414  -0.0089 0.0045  66  TYR B CE1 
2759 C CE2 . TYR B 66  ? 0.2948 0.2874 0.2584 0.0458  -0.0177 0.0039  66  TYR B CE2 
2760 C CZ  . TYR B 66  ? 0.3652 0.3579 0.3264 0.0445  -0.0123 0.0044  66  TYR B CZ  
2761 O OH  . TYR B 66  ? 0.4072 0.4008 0.3679 0.0464  -0.0107 0.0046  66  TYR B OH  
2762 N N   . TYR B 67  ? 0.3313 0.3282 0.3078 0.0342  -0.0277 0.0041  67  TYR B N   
2763 C CA  . TYR B 67  ? 0.3114 0.3070 0.2893 0.0331  -0.0308 0.0030  67  TYR B CA  
2764 C C   . TYR B 67  ? 0.3644 0.3578 0.3446 0.0350  -0.0368 0.0011  67  TYR B C   
2765 O O   . TYR B 67  ? 0.3445 0.3397 0.3286 0.0357  -0.0393 0.0014  67  TYR B O   
2766 C CB  . TYR B 67  ? 0.2832 0.2843 0.2680 0.0277  -0.0305 0.0047  67  TYR B CB  
2767 C CG  . TYR B 67  ? 0.3132 0.3207 0.3068 0.0249  -0.0322 0.0067  67  TYR B CG  
2768 C CD1 . TYR B 67  ? 0.3790 0.3907 0.3735 0.0247  -0.0292 0.0085  67  TYR B CD1 
2769 C CD2 . TYR B 67  ? 0.2987 0.3079 0.2998 0.0226  -0.0368 0.0071  67  TYR B CD2 
2770 C CE1 . TYR B 67  ? 0.4037 0.4220 0.4063 0.0227  -0.0304 0.0109  67  TYR B CE1 
2771 C CE2 . TYR B 67  ? 0.3242 0.3398 0.3342 0.0201  -0.0381 0.0097  67  TYR B CE2 
2772 C CZ  . TYR B 67  ? 0.4242 0.4448 0.4349 0.0203  -0.0347 0.0117  67  TYR B CZ  
2773 O OH  . TYR B 67  ? 0.4340 0.4616 0.4535 0.0183  -0.0356 0.0148  67  TYR B OH  
2774 N N   . THR B 68  ? 0.2870 0.2764 0.2648 0.0361  -0.0394 -0.0008 68  THR B N   
2775 C CA  . THR B 68  ? 0.3465 0.3328 0.3261 0.0380  -0.0459 -0.0030 68  THR B CA  
2776 C C   . THR B 68  ? 0.4229 0.4066 0.4026 0.0372  -0.0484 -0.0044 68  THR B C   
2777 O O   . THR B 68  ? 0.4591 0.4411 0.4332 0.0381  -0.0451 -0.0047 68  THR B O   
2778 C CB  . THR B 68  ? 0.3255 0.3059 0.2967 0.0444  -0.0472 -0.0054 68  THR B CB  
2779 O OG1 . THR B 68  ? 0.4380 0.4152 0.4113 0.0463  -0.0545 -0.0078 68  THR B OG1 
2780 C CG2 . THR B 68  ? 0.2594 0.2349 0.2203 0.0481  -0.0437 -0.0063 68  THR B CG2 
2781 N N   . GLU B 69  ? 0.3904 0.3740 0.3769 0.0356  -0.0544 -0.0050 69  GLU B N   
2782 C CA  . GLU B 69  ? 0.4746 0.4548 0.4609 0.0356  -0.0577 -0.0067 69  GLU B CA  
2783 C C   . GLU B 69  ? 0.4358 0.4089 0.4118 0.0422  -0.0594 -0.0102 69  GLU B C   
2784 O O   . GLU B 69  ? 0.4549 0.4248 0.4268 0.0465  -0.0616 -0.0118 69  GLU B O   
2785 C CB  . GLU B 69  ? 0.5075 0.4882 0.5037 0.0327  -0.0644 -0.0064 69  GLU B CB  
2786 N N   . PHE B 70  ? 0.3966 0.3672 0.3678 0.0434  -0.0582 -0.0112 70  PHE B N   
2787 C CA  . PHE B 70  ? 0.3950 0.3592 0.3559 0.0503  -0.0597 -0.0142 70  PHE B CA  
2788 C C   . PHE B 70  ? 0.4650 0.4270 0.4246 0.0507  -0.0612 -0.0155 70  PHE B C   
2789 O O   . PHE B 70  ? 0.4531 0.4188 0.4190 0.0455  -0.0599 -0.0138 70  PHE B O   
2790 C CB  . PHE B 70  ? 0.3583 0.3218 0.3100 0.0540  -0.0532 -0.0133 70  PHE B CB  
2791 C CG  . PHE B 70  ? 0.3524 0.3187 0.3027 0.0518  -0.0467 -0.0110 70  PHE B CG  
2792 C CD1 . PHE B 70  ? 0.3627 0.3261 0.3037 0.0567  -0.0428 -0.0108 70  PHE B CD1 
2793 C CD2 . PHE B 70  ? 0.4066 0.3786 0.3652 0.0452  -0.0446 -0.0086 70  PHE B CD2 
2794 C CE1 . PHE B 70  ? 0.4673 0.4333 0.4080 0.0547  -0.0372 -0.0084 70  PHE B CE1 
2795 C CE2 . PHE B 70  ? 0.4533 0.4277 0.4109 0.0433  -0.0393 -0.0067 70  PHE B CE2 
2796 C CZ  . PHE B 70  ? 0.4744 0.4458 0.4235 0.0479  -0.0357 -0.0066 70  PHE B CZ  
2797 N N   . THR B 71  ? 0.5344 0.4904 0.4853 0.0572  -0.0640 -0.0185 71  THR B N   
2798 C CA  . THR B 71  ? 0.4769 0.4306 0.4248 0.0589  -0.0652 -0.0199 71  THR B CA  
2799 C C   . THR B 71  ? 0.5111 0.4625 0.4472 0.0653  -0.0604 -0.0201 71  THR B C   
2800 O O   . THR B 71  ? 0.5536 0.4996 0.4808 0.0724  -0.0629 -0.0225 71  THR B O   
2801 C CB  . THR B 71  ? 0.5277 0.4757 0.4766 0.0615  -0.0743 -0.0236 71  THR B CB  
2802 O OG1 . THR B 71  ? 0.4979 0.4484 0.4591 0.0550  -0.0783 -0.0225 71  THR B OG1 
2803 C CG2 . THR B 71  ? 0.6171 0.5622 0.5611 0.0645  -0.0753 -0.0253 71  THR B CG2 
2804 N N   . PRO B 72  ? 0.4892 0.4446 0.4252 0.0630  -0.0536 -0.0172 72  PRO B N   
2805 C CA  . PRO B 72  ? 0.4507 0.4047 0.3768 0.0685  -0.0481 -0.0160 72  PRO B CA  
2806 C C   . PRO B 72  ? 0.5695 0.5184 0.4874 0.0755  -0.0514 -0.0188 72  PRO B C   
2807 O O   . PRO B 72  ? 0.6328 0.5810 0.5541 0.0744  -0.0559 -0.0207 72  PRO B O   
2808 C CB  . PRO B 72  ? 0.3705 0.3302 0.3014 0.0632  -0.0420 -0.0125 72  PRO B CB  
2809 C CG  . PRO B 72  ? 0.3522 0.3148 0.2932 0.0566  -0.0458 -0.0130 72  PRO B CG  
2810 C CD  . PRO B 72  ? 0.3495 0.3107 0.2949 0.0553  -0.0512 -0.0147 72  PRO B CD  
2811 N N   . THR B 73  ? 0.6139 0.5592 0.5210 0.0831  -0.0492 -0.0189 73  THR B N   
2812 C CA  . THR B 73  ? 0.6342 0.5752 0.5318 0.0909  -0.0508 -0.0208 73  THR B CA  
2813 C C   . THR B 73  ? 0.7368 0.6792 0.6276 0.0947  -0.0424 -0.0169 73  THR B C   
2814 O O   . THR B 73  ? 0.7945 0.7392 0.6862 0.0927  -0.0365 -0.0135 73  THR B O   
2815 C CB  . THR B 73  ? 0.6183 0.5523 0.5077 0.0984  -0.0572 -0.0249 73  THR B CB  
2816 O OG1 . THR B 73  ? 0.7482 0.6810 0.6320 0.1014  -0.0537 -0.0235 73  THR B OG1 
2817 C CG2 . THR B 73  ? 0.4389 0.3712 0.3364 0.0944  -0.0660 -0.0284 73  THR B CG2 
2818 N N   . GLU B 74  ? 0.7874 0.7283 0.6719 0.1004  -0.0417 -0.0172 74  GLU B N   
2819 C CA  . GLU B 74  ? 0.8026 0.7453 0.6821 0.1040  -0.0335 -0.0128 74  GLU B CA  
2820 C C   . GLU B 74  ? 0.7453 0.6852 0.6166 0.1094  -0.0291 -0.0107 74  GLU B C   
2821 O O   . GLU B 74  ? 0.7035 0.6460 0.5760 0.1081  -0.0214 -0.0061 74  GLU B O   
2822 C CB  . GLU B 74  ? 0.8500 0.7912 0.7231 0.1107  -0.0341 -0.0136 74  GLU B CB  
2823 C CG  . GLU B 74  ? 0.9568 0.9010 0.8275 0.1135  -0.0251 -0.0085 74  GLU B CG  
2824 C CD  . GLU B 74  ? 1.1274 1.0784 1.0095 0.1037  -0.0196 -0.0052 74  GLU B CD  
2825 O OE1 . GLU B 74  ? 1.1394 1.0926 1.0308 0.0960  -0.0235 -0.0063 74  GLU B OE1 
2826 O OE2 . GLU B 74  ? 1.2064 1.1606 1.0884 0.1039  -0.0114 -0.0015 74  GLU B OE2 
2827 N N   . LYS B 75  ? 0.7491 0.6834 0.6126 0.1155  -0.0342 -0.0143 75  LYS B N   
2828 C CA  . LYS B 75  ? 0.8283 0.7591 0.6822 0.1221  -0.0307 -0.0127 75  LYS B CA  
2829 C C   . LYS B 75  ? 0.7913 0.7231 0.6499 0.1171  -0.0293 -0.0115 75  LYS B C   
2830 O O   . LYS B 75  ? 0.7336 0.6649 0.5882 0.1194  -0.0230 -0.0079 75  LYS B O   
2831 C CB  . LYS B 75  ? 0.9355 0.8594 0.7774 0.1320  -0.0369 -0.0171 75  LYS B CB  
2832 C CG  . LYS B 75  ? 1.0468 0.9677 0.8922 0.1299  -0.0469 -0.0227 75  LYS B CG  
2833 C CD  . LYS B 75  ? 1.1379 1.0513 0.9711 0.1402  -0.0536 -0.0274 75  LYS B CD  
2834 C CE  . LYS B 75  ? 1.1828 1.0924 1.0191 0.1388  -0.0630 -0.0322 75  LYS B CE  
2835 N NZ  . LYS B 75  ? 1.2185 1.1310 1.0689 0.1294  -0.0681 -0.0340 75  LYS B NZ  
2836 N N   . ASP B 76  ? 0.7627 0.6959 0.6300 0.1105  -0.0349 -0.0143 76  ASP B N   
2837 C CA  . ASP B 76  ? 0.6734 0.6075 0.5451 0.1063  -0.0345 -0.0137 76  ASP B CA  
2838 C C   . ASP B 76  ? 0.5685 0.5074 0.4465 0.1002  -0.0267 -0.0088 76  ASP B C   
2839 O O   . ASP B 76  ? 0.6656 0.6089 0.5506 0.0948  -0.0243 -0.0070 76  ASP B O   
2840 C CB  . ASP B 76  ? 0.7254 0.6603 0.6059 0.1008  -0.0424 -0.0173 76  ASP B CB  
2841 C CG  . ASP B 76  ? 0.8255 0.7544 0.7001 0.1070  -0.0507 -0.0222 76  ASP B CG  
2842 O OD1 . ASP B 76  ? 0.8545 0.7786 0.7177 0.1152  -0.0500 -0.0227 76  ASP B OD1 
2843 O OD2 . ASP B 76  ? 0.8803 0.8089 0.7616 0.1039  -0.0580 -0.0254 76  ASP B OD2 
2844 N N   . GLU B 77  ? 0.4318 0.3694 0.3072 0.1012  -0.0233 -0.0069 77  GLU B N   
2845 C CA  . GLU B 77  ? 0.4975 0.4385 0.3784 0.0958  -0.0165 -0.0027 77  GLU B CA  
2846 C C   . GLU B 77  ? 0.4786 0.4216 0.3665 0.0902  -0.0188 -0.0036 77  GLU B C   
2847 O O   . GLU B 77  ? 0.4253 0.3657 0.3106 0.0928  -0.0233 -0.0062 77  GLU B O   
2848 C CB  . GLU B 77  ? 0.5685 0.5067 0.4411 0.1008  -0.0091 0.0004  77  GLU B CB  
2849 C CG  . GLU B 77  ? 0.7190 0.6557 0.5841 0.1070  -0.0057 0.0017  77  GLU B CG  
2850 C CD  . GLU B 77  ? 0.8915 0.8251 0.7480 0.1127  0.0014  0.0052  77  GLU B CD  
2851 O OE1 . GLU B 77  ? 0.9555 0.8844 0.8012 0.1217  -0.0003 0.0042  77  GLU B OE1 
2852 O OE2 . GLU B 77  ? 0.9008 0.8367 0.7616 0.1083  0.0084  0.0089  77  GLU B OE2 
2853 N N   . TYR B 78  ? 0.4219 0.3696 0.3186 0.0826  -0.0156 -0.0016 78  TYR B N   
2854 C CA  . TYR B 78  ? 0.3614 0.3115 0.2646 0.0776  -0.0170 -0.0018 78  TYR B CA  
2855 C C   . TYR B 78  ? 0.3540 0.3052 0.2585 0.0741  -0.0096 0.0011  78  TYR B C   
2856 O O   . TYR B 78  ? 0.4793 0.4315 0.3841 0.0725  -0.0040 0.0033  78  TYR B O   
2857 C CB  . TYR B 78  ? 0.3656 0.3206 0.2789 0.0709  -0.0214 -0.0032 78  TYR B CB  
2858 C CG  . TYR B 78  ? 0.4022 0.3559 0.3159 0.0727  -0.0289 -0.0071 78  TYR B CG  
2859 C CD1 . TYR B 78  ? 0.3734 0.3263 0.2854 0.0743  -0.0307 -0.0083 78  TYR B CD1 
2860 C CD2 . TYR B 78  ? 0.3570 0.3100 0.2729 0.0727  -0.0344 -0.0095 78  TYR B CD2 
2861 C CE1 . TYR B 78  ? 0.3743 0.3249 0.2865 0.0760  -0.0380 -0.0120 78  TYR B CE1 
2862 C CE2 . TYR B 78  ? 0.3325 0.2836 0.2496 0.0742  -0.0417 -0.0130 78  TYR B CE2 
2863 C CZ  . TYR B 78  ? 0.4301 0.3797 0.3451 0.0758  -0.0436 -0.0144 78  TYR B CZ  
2864 O OH  . TYR B 78  ? 0.4936 0.4403 0.4097 0.0774  -0.0514 -0.0180 78  TYR B OH  
2865 N N   . ALA B 79  ? 0.3029 0.2540 0.2087 0.0732  -0.0099 0.0010  79  ALA B N   
2866 C CA  . ALA B 79  ? 0.3245 0.2759 0.2313 0.0702  -0.0036 0.0033  79  ALA B CA  
2867 C C   . ALA B 79  ? 0.3643 0.3181 0.2764 0.0668  -0.0057 0.0025  79  ALA B C   
2868 O O   . ALA B 79  ? 0.3976 0.3531 0.3130 0.0666  -0.0117 0.0006  79  ALA B O   
2869 C CB  . ALA B 79  ? 0.1953 0.1415 0.0930 0.0762  0.0009  0.0050  79  ALA B CB  
2870 N N   . CYS B 80  ? 0.3742 0.3281 0.2874 0.0642  -0.0008 0.0042  80  CYS B N   
2871 C CA  . CYS B 80  ? 0.4235 0.3797 0.3410 0.0614  -0.0019 0.0036  80  CYS B CA  
2872 C C   . CYS B 80  ? 0.3927 0.3449 0.3052 0.0640  0.0021  0.0048  80  CYS B C   
2873 O O   . CYS B 80  ? 0.5404 0.4905 0.4512 0.0632  0.0077  0.0067  80  CYS B O   
2874 C CB  . CYS B 80  ? 0.4147 0.3761 0.3403 0.0543  -0.0004 0.0041  80  CYS B CB  
2875 S SG  . CYS B 80  ? 0.7896 0.7542 0.7201 0.0511  -0.0008 0.0038  80  CYS B SG  
2876 N N   . ARG B 81  ? 0.2490 0.2000 0.1596 0.0672  -0.0009 0.0037  81  ARG B N   
2877 C CA  . ARG B 81  ? 0.3407 0.2879 0.2467 0.0698  0.0024  0.0046  81  ARG B CA  
2878 C C   . ARG B 81  ? 0.3952 0.3458 0.3070 0.0656  0.0030  0.0044  81  ARG B C   
2879 O O   . ARG B 81  ? 0.3801 0.3346 0.2965 0.0647  -0.0013 0.0031  81  ARG B O   
2880 C CB  . ARG B 81  ? 0.2979 0.2414 0.1975 0.0766  -0.0011 0.0035  81  ARG B CB  
2881 C CG  . ARG B 81  ? 0.2743 0.2120 0.1662 0.0810  0.0033  0.0050  81  ARG B CG  
2882 C CD  . ARG B 81  ? 0.3244 0.2592 0.2110 0.0872  -0.0008 0.0036  81  ARG B CD  
2883 N NE  . ARG B 81  ? 0.5311 0.4676 0.4214 0.0857  -0.0017 0.0030  81  ARG B NE  
2884 C CZ  . ARG B 81  ? 0.5307 0.4633 0.4159 0.0892  0.0003  0.0036  81  ARG B CZ  
2885 N NH1 . ARG B 81  ? 0.5140 0.4405 0.3903 0.0944  0.0035  0.0051  81  ARG B NH1 
2886 N NH2 . ARG B 81  ? 0.5905 0.5254 0.4796 0.0878  -0.0006 0.0030  81  ARG B NH2 
2887 N N   . VAL B 82  ? 0.3274 0.2766 0.2392 0.0631  0.0082  0.0059  82  VAL B N   
2888 C CA  . VAL B 82  ? 0.3291 0.2806 0.2449 0.0600  0.0091  0.0056  82  VAL B CA  
2889 C C   . VAL B 82  ? 0.3652 0.3115 0.2757 0.0633  0.0120  0.0063  82  VAL B C   
2890 O O   . VAL B 82  ? 0.3888 0.3300 0.2945 0.0650  0.0160  0.0080  82  VAL B O   
2891 C CB  . VAL B 82  ? 0.2827 0.2370 0.2037 0.0540  0.0118  0.0061  82  VAL B CB  
2892 C CG1 . VAL B 82  ? 0.2376 0.1938 0.1615 0.0518  0.0125  0.0055  82  VAL B CG1 
2893 C CG2 . VAL B 82  ? 0.1749 0.1343 0.1012 0.0508  0.0088  0.0054  82  VAL B CG2 
2894 N N   . ASN B 83  ? 0.3720 0.3200 0.2837 0.0642  0.0101  0.0053  83  ASN B N   
2895 C CA  . ASN B 83  ? 0.4425 0.3860 0.3497 0.0671  0.0126  0.0057  83  ASN B CA  
2896 C C   . ASN B 83  ? 0.4396 0.3860 0.3511 0.0639  0.0134  0.0050  83  ASN B C   
2897 O O   . ASN B 83  ? 0.3755 0.3281 0.2924 0.0621  0.0104  0.0040  83  ASN B O   
2898 C CB  . ASN B 83  ? 0.4896 0.4312 0.3925 0.0729  0.0094  0.0050  83  ASN B CB  
2899 C CG  . ASN B 83  ? 0.5994 0.5349 0.4960 0.0768  0.0123  0.0058  83  ASN B CG  
2900 O OD1 . ASN B 83  ? 0.5888 0.5202 0.4834 0.0758  0.0169  0.0074  83  ASN B OD1 
2901 N ND2 . ASN B 83  ? 0.6945 0.6293 0.5885 0.0814  0.0093  0.0049  83  ASN B ND2 
2902 N N   . HIS B 84  ? 0.3931 0.3351 0.3023 0.0635  0.0174  0.0058  84  HIS B N   
2903 C CA  . HIS B 84  ? 0.3444 0.2884 0.2567 0.0609  0.0184  0.0049  84  HIS B CA  
2904 C C   . HIS B 84  ? 0.4182 0.3552 0.3256 0.0631  0.0216  0.0055  84  HIS B C   
2905 O O   . HIS B 84  ? 0.4927 0.4236 0.3958 0.0648  0.0241  0.0072  84  HIS B O   
2906 C CB  . HIS B 84  ? 0.4081 0.3549 0.3252 0.0553  0.0195  0.0048  84  HIS B CB  
2907 C CG  . HIS B 84  ? 0.3629 0.3121 0.2828 0.0529  0.0199  0.0036  84  HIS B CG  
2908 N ND1 . HIS B 84  ? 0.3408 0.2851 0.2590 0.0520  0.0227  0.0035  84  HIS B ND1 
2909 C CD2 . HIS B 84  ? 0.2634 0.2194 0.1875 0.0516  0.0178  0.0026  84  HIS B CD2 
2910 C CE1 . HIS B 84  ? 0.3354 0.2832 0.2559 0.0506  0.0221  0.0020  84  HIS B CE1 
2911 N NE2 . HIS B 84  ? 0.2489 0.2040 0.1729 0.0504  0.0195  0.0017  84  HIS B NE2 
2912 N N   . VAL B 85  ? 0.3951 0.3330 0.3033 0.0632  0.0215  0.0043  85  VAL B N   
2913 C CA  . VAL B 85  ? 0.4154 0.3466 0.3191 0.0657  0.0240  0.0046  85  VAL B CA  
2914 C C   . VAL B 85  ? 0.4015 0.3265 0.3043 0.0632  0.0276  0.0059  85  VAL B C   
2915 O O   . VAL B 85  ? 0.4287 0.3467 0.3274 0.0655  0.0298  0.0069  85  VAL B O   
2916 C CB  . VAL B 85  ? 0.4165 0.3503 0.3215 0.0661  0.0233  0.0028  85  VAL B CB  
2917 C CG1 . VAL B 85  ? 0.4016 0.3367 0.3099 0.0617  0.0243  0.0018  85  VAL B CG1 
2918 C CG2 . VAL B 85  ? 0.4603 0.3876 0.3599 0.0705  0.0246  0.0029  85  VAL B CG2 
2919 N N   . THR B 86  ? 0.3351 0.2625 0.2422 0.0586  0.0280  0.0060  86  THR B N   
2920 C CA  . THR B 86  ? 0.3959 0.3181 0.3037 0.0558  0.0310  0.0073  86  THR B CA  
2921 C C   . THR B 86  ? 0.4648 0.3838 0.3708 0.0567  0.0332  0.0102  86  THR B C   
2922 O O   . THR B 86  ? 0.4035 0.3172 0.3097 0.0555  0.0362  0.0122  86  THR B O   
2923 C CB  . THR B 86  ? 0.3702 0.2963 0.2837 0.0504  0.0304  0.0059  86  THR B CB  
2924 O OG1 . THR B 86  ? 0.4199 0.3525 0.3367 0.0485  0.0286  0.0059  86  THR B OG1 
2925 C CG2 . THR B 86  ? 0.2622 0.1906 0.1765 0.0501  0.0288  0.0033  86  THR B CG2 
2926 N N   . LEU B 87  ? 0.4706 0.3926 0.3748 0.0593  0.0317  0.0105  87  LEU B N   
2927 C CA  . LEU B 87  ? 0.4443 0.3634 0.3455 0.0614  0.0337  0.0132  87  LEU B CA  
2928 C C   . LEU B 87  ? 0.5641 0.4772 0.4583 0.0671  0.0351  0.0148  87  LEU B C   
2929 O O   . LEU B 87  ? 0.6543 0.5681 0.5453 0.0708  0.0326  0.0133  87  LEU B O   
2930 C CB  . LEU B 87  ? 0.2947 0.2193 0.1968 0.0617  0.0310  0.0126  87  LEU B CB  
2931 C CG  . LEU B 87  ? 0.3617 0.2926 0.2705 0.0564  0.0292  0.0111  87  LEU B CG  
2932 C CD1 . LEU B 87  ? 0.3390 0.2744 0.2482 0.0575  0.0261  0.0106  87  LEU B CD1 
2933 C CD2 . LEU B 87  ? 0.3568 0.2862 0.2692 0.0522  0.0323  0.0127  87  LEU B CD2 
2934 N N   . SER B 88  ? 0.6478 0.5552 0.5397 0.0680  0.0392  0.0181  88  SER B N   
2935 C CA  . SER B 88  ? 0.6513 0.5527 0.5360 0.0738  0.0410  0.0202  88  SER B CA  
2936 C C   . SER B 88  ? 0.6115 0.5143 0.4909 0.0788  0.0395  0.0205  88  SER B C   
2937 O O   . SER B 88  ? 0.6921 0.5907 0.5645 0.0846  0.0400  0.0216  88  SER B O   
2938 C CB  . SER B 88  ? 0.6390 0.5341 0.5235 0.0732  0.0461  0.0243  88  SER B CB  
2939 O OG  . SER B 88  ? 0.6617 0.5591 0.5505 0.0699  0.0482  0.0263  88  SER B OG  
2940 N N   . GLN B 89  ? 0.5465 0.4551 0.4291 0.0769  0.0372  0.0192  89  GLN B N   
2941 C CA  . GLN B 89  ? 0.5557 0.4657 0.4337 0.0814  0.0348  0.0189  89  GLN B CA  
2942 C C   . GLN B 89  ? 0.5283 0.4453 0.4120 0.0778  0.0311  0.0164  89  GLN B C   
2943 O O   . GLN B 89  ? 0.6114 0.5312 0.5012 0.0722  0.0322  0.0165  89  GLN B O   
2944 C CB  . GLN B 89  ? 0.6397 0.5459 0.5129 0.0846  0.0391  0.0227  89  GLN B CB  
2945 C CG  . GLN B 89  ? 0.7952 0.6983 0.6591 0.0925  0.0379  0.0231  89  GLN B CG  
2946 C CD  . GLN B 89  ? 0.8458 0.7432 0.7042 0.0966  0.0390  0.0239  89  GLN B CD  
2947 O OE1 . GLN B 89  ? 0.8724 0.7697 0.7273 0.1003  0.0349  0.0214  89  GLN B OE1 
2948 N NE2 . GLN B 89  ? 0.8091 0.7016 0.6670 0.0960  0.0443  0.0276  89  GLN B NE2 
2949 N N   . PRO B 90  ? 0.4397 0.3592 0.3214 0.0809  0.0264  0.0142  90  PRO B N   
2950 C CA  . PRO B 90  ? 0.4026 0.3285 0.2900 0.0776  0.0225  0.0121  90  PRO B CA  
2951 C C   . PRO B 90  ? 0.4448 0.3716 0.3336 0.0755  0.0249  0.0138  90  PRO B C   
2952 O O   . PRO B 90  ? 0.4981 0.4212 0.3814 0.0793  0.0277  0.0161  90  PRO B O   
2953 C CB  . PRO B 90  ? 0.3981 0.3243 0.2815 0.0828  0.0173  0.0102  90  PRO B CB  
2954 C CG  . PRO B 90  ? 0.4579 0.3798 0.3359 0.0874  0.0176  0.0104  90  PRO B CG  
2955 C CD  . PRO B 90  ? 0.4236 0.3401 0.2983 0.0876  0.0239  0.0135  90  PRO B CD  
2956 N N   . LYS B 91  ? 0.4332 0.3650 0.3294 0.0696  0.0240  0.0128  91  LYS B N   
2957 C CA  . LYS B 91  ? 0.4442 0.3774 0.3429 0.0670  0.0263  0.0143  91  LYS B CA  
2958 C C   . LYS B 91  ? 0.4673 0.4043 0.3668 0.0677  0.0221  0.0126  91  LYS B C   
2959 O O   . LYS B 91  ? 0.5237 0.4648 0.4270 0.0659  0.0174  0.0102  91  LYS B O   
2960 C CB  . LYS B 91  ? 0.5411 0.4767 0.4472 0.0602  0.0281  0.0144  91  LYS B CB  
2961 C CG  . LYS B 91  ? 0.6676 0.6043 0.5770 0.0572  0.0311  0.0163  91  LYS B CG  
2962 C CD  . LYS B 91  ? 0.8645 0.7961 0.7701 0.0599  0.0364  0.0201  91  LYS B CD  
2963 C CE  . LYS B 91  ? 0.9250 0.8584 0.8350 0.0570  0.0394  0.0224  91  LYS B CE  
2964 N NZ  . LYS B 91  ? 0.9252 0.8542 0.8321 0.0600  0.0450  0.0267  91  LYS B NZ  
2965 N N   . ILE B 92  ? 0.4482 0.3838 0.3442 0.0704  0.0237  0.0142  92  ILE B N   
2966 C CA  . ILE B 92  ? 0.3642 0.3026 0.2603 0.0716  0.0197  0.0126  92  ILE B CA  
2967 C C   . ILE B 92  ? 0.3999 0.3414 0.3008 0.0676  0.0219  0.0138  92  ILE B C   
2968 O O   . ILE B 92  ? 0.4450 0.3845 0.3437 0.0690  0.0266  0.0166  92  ILE B O   
2969 C CB  . ILE B 92  ? 0.3737 0.3081 0.2606 0.0796  0.0186  0.0127  92  ILE B CB  
2970 C CG1 . ILE B 92  ? 0.3757 0.3083 0.2593 0.0832  0.0142  0.0105  92  ILE B CG1 
2971 C CG2 . ILE B 92  ? 0.2955 0.2319 0.1820 0.0810  0.0155  0.0115  92  ILE B CG2 
2972 C CD1 . ILE B 92  ? 0.3431 0.2705 0.2164 0.0917  0.0135  0.0107  92  ILE B CD1 
2973 N N   . VAL B 93  ? 0.3920 0.3384 0.2997 0.0627  0.0186  0.0118  93  VAL B N   
2974 C CA  . VAL B 93  ? 0.3820 0.3318 0.2948 0.0586  0.0200  0.0126  93  VAL B CA  
2975 C C   . VAL B 93  ? 0.3397 0.2913 0.2515 0.0608  0.0159  0.0111  93  VAL B C   
2976 O O   . VAL B 93  ? 0.3151 0.2687 0.2288 0.0604  0.0103  0.0086  93  VAL B O   
2977 C CB  . VAL B 93  ? 0.3734 0.3273 0.2943 0.0515  0.0193  0.0116  93  VAL B CB  
2978 C CG1 . VAL B 93  ? 0.3035 0.2608 0.2296 0.0476  0.0204  0.0123  93  VAL B CG1 
2979 C CG2 . VAL B 93  ? 0.3055 0.2571 0.2271 0.0497  0.0229  0.0127  93  VAL B CG2 
2980 N N   . LYS B 94  ? 0.3726 0.3233 0.2818 0.0632  0.0185  0.0128  94  LYS B N   
2981 C CA  . LYS B 94  ? 0.4731 0.4249 0.3803 0.0662  0.0148  0.0113  94  LYS B CA  
2982 C C   . LYS B 94  ? 0.4181 0.3750 0.3331 0.0605  0.0126  0.0103  94  LYS B C   
2983 O O   . LYS B 94  ? 0.4351 0.3944 0.3556 0.0555  0.0160  0.0118  94  LYS B O   
2984 C CB  . LYS B 94  ? 0.5981 0.5473 0.4988 0.0719  0.0188  0.0137  94  LYS B CB  
2985 C CG  . LYS B 94  ? 0.7750 0.7189 0.6668 0.0784  0.0213  0.0152  94  LYS B CG  
2986 C CD  . LYS B 94  ? 0.9453 0.8876 0.8315 0.0837  0.0263  0.0184  94  LYS B CD  
2987 C CE  . LYS B 94  ? 1.0695 1.0067 0.9478 0.0893  0.0304  0.0210  94  LYS B CE  
2988 N NZ  . LYS B 94  ? 1.1251 1.0615 0.9990 0.0939  0.0366  0.0252  94  LYS B NZ  
2989 N N   . TRP B 95  ? 0.3664 0.3245 0.2819 0.0614  0.0065  0.0077  95  TRP B N   
2990 C CA  . TRP B 95  ? 0.4373 0.3998 0.3596 0.0566  0.0039  0.0067  95  TRP B CA  
2991 C C   . TRP B 95  ? 0.4927 0.4557 0.4140 0.0579  0.0069  0.0082  95  TRP B C   
2992 O O   . TRP B 95  ? 0.5097 0.4702 0.4245 0.0641  0.0063  0.0080  95  TRP B O   
2993 C CB  . TRP B 95  ? 0.3976 0.3608 0.3210 0.0575  -0.0036 0.0039  95  TRP B CB  
2994 C CG  . TRP B 95  ? 0.4339 0.4011 0.3636 0.0534  -0.0065 0.0031  95  TRP B CG  
2995 C CD1 . TRP B 95  ? 0.4106 0.3822 0.3474 0.0470  -0.0045 0.0040  95  TRP B CD1 
2996 C CD2 . TRP B 95  ? 0.4963 0.4633 0.4256 0.0557  -0.0121 0.0012  95  TRP B CD2 
2997 N NE1 . TRP B 95  ? 0.3589 0.3331 0.2996 0.0451  -0.0083 0.0030  95  TRP B NE1 
2998 C CE2 . TRP B 95  ? 0.4373 0.4086 0.3737 0.0503  -0.0130 0.0013  95  TRP B CE2 
2999 C CE3 . TRP B 95  ? 0.4570 0.4200 0.3802 0.0621  -0.0168 -0.0008 95  TRP B CE3 
3000 C CZ2 . TRP B 95  ? 0.4988 0.4706 0.4368 0.0508  -0.0182 -0.0003 95  TRP B CZ2 
3001 C CZ3 . TRP B 95  ? 0.4229 0.3862 0.3477 0.0626  -0.0223 -0.0027 95  TRP B CZ3 
3002 C CH2 . TRP B 95  ? 0.4928 0.4605 0.4251 0.0569  -0.0229 -0.0023 95  TRP B CH2 
3003 N N   . ASP B 96  ? 0.6082 0.5747 0.5358 0.0525  0.0100  0.0096  96  ASP B N   
3004 C CA  . ASP B 96  ? 0.7124 0.6803 0.6406 0.0531  0.0130  0.0112  96  ASP B CA  
3005 C C   . ASP B 96  ? 0.7662 0.7386 0.7012 0.0484  0.0098  0.0099  96  ASP B C   
3006 O O   . ASP B 96  ? 0.8610 0.8365 0.8027 0.0422  0.0104  0.0101  96  ASP B O   
3007 C CB  . ASP B 96  ? 0.7590 0.7270 0.6892 0.0512  0.0200  0.0146  96  ASP B CB  
3008 C CG  . ASP B 96  ? 0.9067 0.8772 0.8395 0.0509  0.0233  0.0167  96  ASP B CG  
3009 O OD1 . ASP B 96  ? 0.9223 0.8930 0.8517 0.0552  0.0216  0.0160  96  ASP B OD1 
3010 O OD2 . ASP B 96  ? 0.9885 0.9609 0.9272 0.0466  0.0274  0.0189  96  ASP B OD2 
3011 N N   . ARG B 97  ? 0.7787 0.7511 0.7115 0.0517  0.0061  0.0085  97  ARG B N   
3012 C CA  . ARG B 97  ? 0.8027 0.7789 0.7414 0.0478  0.0026  0.0072  97  ARG B CA  
3013 C C   . ARG B 97  ? 0.7930 0.7729 0.7378 0.0430  0.0070  0.0092  97  ARG B C   
3014 O O   . ARG B 97  ? 0.6679 0.6514 0.6191 0.0377  0.0048  0.0084  97  ARG B O   
3015 C CB  . ARG B 97  ? 0.8288 0.8035 0.7631 0.0531  -0.0012 0.0057  97  ARG B CB  
3016 C CG  . ARG B 97  ? 0.8537 0.8238 0.7811 0.0590  -0.0057 0.0036  97  ARG B CG  
3017 C CD  . ARG B 97  ? 0.9003 0.8689 0.8245 0.0634  -0.0109 0.0013  97  ARG B CD  
3018 N NE  . ARG B 97  ? 0.9190 0.8827 0.8363 0.0696  -0.0158 -0.0010 97  ARG B NE  
3019 C CZ  . ARG B 97  ? 0.8836 0.8449 0.7986 0.0732  -0.0226 -0.0038 97  ARG B CZ  
3020 N NH1 . ARG B 97  ? 0.8030 0.7664 0.7220 0.0712  -0.0250 -0.0046 97  ARG B NH1 
3021 N NH2 . ARG B 97  ? 0.8984 0.8550 0.8072 0.0784  -0.0268 -0.0066 97  ARG B NH2 
3022 N N   . ASP B 98  ? 0.9317 0.9109 0.8748 0.0448  0.0130  0.0119  98  ASP B N   
3023 C CA  . ASP B 98  ? 0.9327 0.9153 0.8822 0.0406  0.0172  0.0141  98  ASP B CA  
3024 C C   . ASP B 98  ? 0.9331 0.9162 0.8876 0.0348  0.0190  0.0146  98  ASP B C   
3025 O O   . ASP B 98  ? 0.9272 0.9137 0.8885 0.0292  0.0184  0.0143  98  ASP B O   
3026 C CB  . ASP B 98  ? 0.9705 0.9523 0.9170 0.0451  0.0230  0.0174  98  ASP B CB  
3027 C CG  . ASP B 98  ? 1.0475 1.0272 0.9860 0.0528  0.0215  0.0167  98  ASP B CG  
3028 O OD1 . ASP B 98  ? 1.0615 1.0421 0.9998 0.0535  0.0164  0.0142  98  ASP B OD1 
3029 O OD2 . ASP B 98  ? 1.0295 1.0065 0.9617 0.0585  0.0253  0.0188  98  ASP B OD2 
3030 N N   . LYS C 1   ? 0.4474 0.4530 0.4196 0.0687  -0.0720 0.0251  1   LYS C N   
3031 C CA  . LYS C 1   ? 0.3884 0.3982 0.3575 0.0727  -0.0710 0.0270  1   LYS C CA  
3032 C C   . LYS C 1   ? 0.2976 0.3043 0.2647 0.0738  -0.0736 0.0225  1   LYS C C   
3033 O O   . LYS C 1   ? 0.3802 0.3849 0.3446 0.0766  -0.0769 0.0177  1   LYS C O   
3034 C CB  . LYS C 1   ? 0.4739 0.4895 0.4384 0.0795  -0.0703 0.0285  1   LYS C CB  
3035 C CG  . LYS C 1   ? 0.5355 0.5566 0.4976 0.0840  -0.0679 0.0325  1   LYS C CG  
3036 C CD  . LYS C 1   ? 0.6570 0.6810 0.6244 0.0804  -0.0644 0.0391  1   LYS C CD  
3037 C CE  . LYS C 1   ? 0.7475 0.7781 0.7139 0.0852  -0.0616 0.0443  1   LYS C CE  
3038 N NZ  . LYS C 1   ? 0.8326 0.8661 0.8055 0.0815  -0.0588 0.0513  1   LYS C NZ  
3039 N N   . LEU C 2   ? 0.2719 0.2778 0.2404 0.0715  -0.0725 0.0239  2   LEU C N   
3040 C CA  . LEU C 2   ? 0.3218 0.3249 0.2884 0.0725  -0.0747 0.0199  2   LEU C CA  
3041 C C   . LEU C 2   ? 0.4381 0.4450 0.3985 0.0801  -0.0753 0.0193  2   LEU C C   
3042 O O   . LEU C 2   ? 0.5203 0.5330 0.4788 0.0840  -0.0727 0.0236  2   LEU C O   
3043 C CB  . LEU C 2   ? 0.3079 0.3093 0.2777 0.0682  -0.0733 0.0221  2   LEU C CB  
3044 C CG  . LEU C 2   ? 0.3555 0.3510 0.3299 0.0612  -0.0732 0.0217  2   LEU C CG  
3045 C CD1 . LEU C 2   ? 0.3807 0.3750 0.3572 0.0579  -0.0718 0.0245  2   LEU C CD1 
3046 C CD2 . LEU C 2   ? 0.3200 0.3101 0.2950 0.0598  -0.0762 0.0161  2   LEU C CD2 
3047 N N   . ILE C 3   ? 0.4814 0.4851 0.4386 0.0824  -0.0788 0.0140  3   ILE C N   
3048 C CA  . ILE C 3   ? 0.5111 0.5171 0.4612 0.0900  -0.0797 0.0130  3   ILE C CA  
3049 C C   . ILE C 3   ? 0.5101 0.5202 0.4602 0.0911  -0.0761 0.0176  3   ILE C C   
3050 O O   . ILE C 3   ? 0.5427 0.5514 0.4977 0.0857  -0.0748 0.0192  3   ILE C O   
3051 C CB  . ILE C 3   ? 0.4824 0.4829 0.4294 0.0917  -0.0848 0.0062  3   ILE C CB  
3052 C CG1 . ILE C 3   ? 0.4072 0.4092 0.3450 0.1007  -0.0863 0.0046  3   ILE C CG1 
3053 C CG2 . ILE C 3   ? 0.4623 0.4594 0.4130 0.0870  -0.0851 0.0050  3   ILE C CG2 
3054 C CD1 . ILE C 3   ? 0.3891 0.3850 0.3232 0.1031  -0.0925 -0.0023 3   ILE C CD1 
3055 N N   . GLU C 4   ? 0.5447 0.5597 0.4891 0.0985  -0.0744 0.0200  4   GLU C N   
3056 C CA  . GLU C 4   ? 0.5736 0.5938 0.5188 0.1002  -0.0704 0.0258  4   GLU C CA  
3057 C C   . GLU C 4   ? 0.5948 0.6139 0.5348 0.1048  -0.0715 0.0235  4   GLU C C   
3058 O O   . GLU C 4   ? 0.5090 0.5322 0.4500 0.1064  -0.0683 0.0280  4   GLU C O   
3059 C CB  . GLU C 4   ? 0.6789 0.7062 0.6221 0.1058  -0.0668 0.0315  4   GLU C CB  
3060 C CG  . GLU C 4   ? 0.8219 0.8494 0.7656 0.1049  -0.0673 0.0313  4   GLU C CG  
3061 C CD  . GLU C 4   ? 0.9721 0.9956 0.9087 0.1094  -0.0716 0.0248  4   GLU C CD  
3062 O OE1 . GLU C 4   ? 0.9520 0.9723 0.8827 0.1136  -0.0744 0.0204  4   GLU C OE1 
3063 O OE2 . GLU C 4   ? 1.0472 1.0704 0.9842 0.1088  -0.0725 0.0241  4   GLU C OE2 
3064 N N   . THR C 5   ? 0.6300 0.6436 0.5649 0.1070  -0.0761 0.0166  5   THR C N   
3065 C CA  . THR C 5   ? 0.5821 0.5938 0.5111 0.1117  -0.0777 0.0136  5   THR C CA  
3066 C C   . THR C 5   ? 0.5118 0.5170 0.4442 0.1060  -0.0814 0.0084  5   THR C C   
3067 O O   . THR C 5   ? 0.4238 0.4246 0.3599 0.1011  -0.0844 0.0048  5   THR C O   
3068 C CB  . THR C 5   ? 0.5505 0.5610 0.4690 0.1210  -0.0805 0.0100  5   THR C CB  
3069 O OG1 . THR C 5   ? 0.6716 0.6807 0.5837 0.1265  -0.0814 0.0082  5   THR C OG1 
3070 C CG2 . THR C 5   ? 0.5385 0.5426 0.4564 0.1193  -0.0864 0.0034  5   THR C CG2 
3071 N N   . TYR C 6   ? 0.4492 0.4540 0.3806 0.1068  -0.0809 0.0083  6   TYR C N   
3072 C CA  . TYR C 6   ? 0.3502 0.3494 0.2854 0.1012  -0.0837 0.0043  6   TYR C CA  
3073 C C   . TYR C 6   ? 0.3913 0.3881 0.3204 0.1061  -0.0859 0.0009  6   TYR C C   
3074 O O   . TYR C 6   ? 0.5572 0.5580 0.4813 0.1122  -0.0833 0.0039  6   TYR C O   
3075 C CB  . TYR C 6   ? 0.3194 0.3199 0.2630 0.0936  -0.0804 0.0086  6   TYR C CB  
3076 C CG  . TYR C 6   ? 0.4836 0.4844 0.4328 0.0882  -0.0792 0.0108  6   TYR C CG  
3077 C CD1 . TYR C 6   ? 0.4472 0.4537 0.3982 0.0888  -0.0753 0.0171  6   TYR C CD1 
3078 C CD2 . TYR C 6   ? 0.5078 0.5031 0.4607 0.0829  -0.0819 0.0070  6   TYR C CD2 
3079 C CE1 . TYR C 6   ? 0.4783 0.4848 0.4341 0.0841  -0.0744 0.0190  6   TYR C CE1 
3080 C CE2 . TYR C 6   ? 0.4540 0.4494 0.4114 0.0785  -0.0807 0.0090  6   TYR C CE2 
3081 C CZ  . TYR C 6   ? 0.4557 0.4563 0.4141 0.0791  -0.0771 0.0148  6   TYR C CZ  
3082 O OH  . TYR C 6   ? 0.4726 0.4729 0.4352 0.0748  -0.0760 0.0167  6   TYR C OH  
3083 N N   . PHE C 7   ? 0.3745 0.3649 0.3043 0.1036  -0.0906 -0.0051 7   PHE C N   
3084 C CA  . PHE C 7   ? 0.4756 0.4626 0.3998 0.1078  -0.0935 -0.0090 7   PHE C CA  
3085 C C   . PHE C 7   ? 0.4690 0.4507 0.3991 0.1011  -0.0961 -0.0125 7   PHE C C   
3086 O O   . PHE C 7   ? 0.3812 0.3590 0.3164 0.0962  -0.0989 -0.0154 7   PHE C O   
3087 C CB  . PHE C 7   ? 0.5556 0.5391 0.4710 0.1152  -0.0985 -0.0140 7   PHE C CB  
3088 C CG  . PHE C 7   ? 0.6389 0.6193 0.5573 0.1124  -0.1022 -0.0170 7   PHE C CG  
3089 C CD1 . PHE C 7   ? 0.5816 0.5655 0.4991 0.1142  -0.1003 -0.0142 7   PHE C CD1 
3090 C CD2 . PHE C 7   ? 0.7111 0.6851 0.6338 0.1081  -0.1075 -0.0222 7   PHE C CD2 
3091 C CE1 . PHE C 7   ? 0.5332 0.5144 0.4537 0.1116  -0.1037 -0.0168 7   PHE C CE1 
3092 C CE2 . PHE C 7   ? 0.6421 0.6135 0.5686 0.1056  -0.1109 -0.0244 7   PHE C CE2 
3093 C CZ  . PHE C 7   ? 0.5656 0.5406 0.4908 0.1074  -0.1090 -0.0218 7   PHE C CZ  
3094 N N   . SER C 8   ? 0.5463 0.5281 0.4759 0.1013  -0.0949 -0.0119 8   SER C N   
3095 C CA  . SER C 8   ? 0.4849 0.4621 0.4198 0.0953  -0.0967 -0.0147 8   SER C CA  
3096 C C   . SER C 8   ? 0.5117 0.4822 0.4448 0.0964  -0.1032 -0.0216 8   SER C C   
3097 O O   . SER C 8   ? 0.5014 0.4704 0.4281 0.1023  -0.1067 -0.0245 8   SER C O   
3098 C CB  . SER C 8   ? 0.5133 0.4923 0.4475 0.0958  -0.0941 -0.0124 8   SER C CB  
3099 O OG  . SER C 8   ? 0.7462 0.7253 0.6715 0.1041  -0.0954 -0.0141 8   SER C OG  
3100 N N   . LYS C 9   ? 0.6330 0.5992 0.5719 0.0907  -0.1051 -0.0241 9   LYS C N   
3101 C CA  . LYS C 9   ? 0.6055 0.5654 0.5460 0.0899  -0.1113 -0.0298 9   LYS C CA  
3102 C C   . LYS C 9   ? 0.6368 0.5928 0.5762 0.0905  -0.1141 -0.0332 9   LYS C C   
3103 O O   . LYS C 9   ? 0.5601 0.5131 0.4928 0.0964  -0.1185 -0.0372 9   LYS C O   
3104 C CB  . LYS C 9   ? 0.5167 0.4749 0.4668 0.0822  -0.1110 -0.0293 9   LYS C CB  
3105 C CG  . LYS C 9   ? 0.4977 0.4500 0.4523 0.0802  -0.1168 -0.0340 9   LYS C CG  
3106 C CD  . LYS C 9   ? 0.4203 0.3720 0.3841 0.0735  -0.1154 -0.0322 9   LYS C CD  
3107 C CE  . LYS C 9   ? 0.3919 0.3476 0.3548 0.0741  -0.1125 -0.0290 9   LYS C CE  
3108 N NZ  . LYS C 9   ? 0.3732 0.3277 0.3444 0.0684  -0.1118 -0.0278 9   LYS C NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   MET 5   5   5   MET MET A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  MET 45  45  45  MET MET A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  TRP 60  60  60  TRP TRP A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ARG 75  75  75  ARG ARG A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  TYR 84  84  84  TYR TYR A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  HIS 93  93  93  HIS HIS A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 MET 138 138 138 MET MET A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 THR 143 143 143 THR THR A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 TRP 147 147 147 TRP TRP A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLN 155 155 155 GLN GLN A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 TYR 159 159 159 TYR TYR A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASP 161 161 161 ASP ASP A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 CYS 164 164 164 CYS CYS A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TRP 167 167 167 TRP TRP A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 ARG 169 169 169 ARG ARG A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 THR 178 178 178 THR THR A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 HIS 188 188 188 HIS HIS A . n 
A 1 189 MET 189 189 189 MET MET A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 HIS 191 191 191 HIS HIS A . n 
A 1 192 HIS 192 192 192 HIS HIS A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 HIS 197 197 197 HIS HIS A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 CYS 203 203 203 CYS CYS A . n 
A 1 204 TRP 204 204 204 TRP TRP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 TYR 209 209 209 TYR TYR A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 GLU 232 232 232 GLU GLU A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 GLY 239 239 239 GLY GLY A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 PHE 241 241 241 PHE PHE A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 TRP 244 244 244 TRP TRP A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 GLU 253 253 253 GLU GLU A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 GLN 255 255 255 GLN GLN A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 HIS 260 260 260 HIS HIS A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 HIS 263 263 263 HIS HIS A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PRO 267 267 267 PRO PRO A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ARG 273 273 273 ARG ARG A . n 
A 1 274 TRP 274 274 274 TRP TRP A . n 
B 2 1   ALA 1   1   1   ALA ALA B . n 
B 2 2   GLN 2   2   2   GLN GLN B . n 
B 2 3   ARG 3   3   3   ARG ARG B . n 
B 2 4   THR 4   4   4   THR THR B . n 
B 2 5   PRO 5   5   5   PRO PRO B . n 
B 2 6   LYS 6   6   6   LYS LYS B . n 
B 2 7   ILE 7   7   7   ILE ILE B . n 
B 2 8   GLN 8   8   8   GLN GLN B . n 
B 2 9   VAL 9   9   9   VAL VAL B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  SER 11  11  11  SER SER B . n 
B 2 12  ARG 12  12  12  ARG ARG B . n 
B 2 13  HIS 13  13  13  HIS HIS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  ALA 15  15  15  ALA ALA B . n 
B 2 16  GLU 16  16  16  GLU GLU B . n 
B 2 17  ASN 17  17  17  ASN ASN B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  LYS 19  19  19  LYS LYS B . n 
B 2 20  SER 20  20  20  SER SER B . n 
B 2 21  ASN 21  21  21  ASN ASN B . n 
B 2 22  PHE 22  22  22  PHE PHE B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  ASN 24  24  24  ASN ASN B . n 
B 2 25  CYS 25  25  25  CYS CYS B . n 
B 2 26  TYR 26  26  26  TYR TYR B . n 
B 2 27  VAL 27  27  27  VAL VAL B . n 
B 2 28  SER 28  28  28  SER SER B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  PHE 30  30  30  PHE PHE B . n 
B 2 31  HIS 31  31  31  HIS HIS B . n 
B 2 32  PRO 32  32  32  PRO PRO B . n 
B 2 33  SER 33  33  33  SER SER B . n 
B 2 34  ASP 34  34  34  ASP ASP B . n 
B 2 35  ILE 35  35  35  ILE ILE B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  VAL 37  37  37  VAL VAL B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  LEU 39  39  39  LEU LEU B . n 
B 2 40  LEU 40  40  40  LEU LEU B . n 
B 2 41  LYS 41  41  41  LYS LYS B . n 
B 2 42  ASN 42  42  42  ASN ASN B . n 
B 2 43  GLY 43  43  43  GLY GLY B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  ARG 45  45  45  ARG ARG B . n 
B 2 46  ILE 46  46  46  ILE ILE B . n 
B 2 47  GLU 47  47  47  GLU GLU B . n 
B 2 48  LYS 48  48  48  LYS LYS B . n 
B 2 49  VAL 49  49  49  VAL VAL B . n 
B 2 50  GLU 50  50  50  GLU GLU B . n 
B 2 51  HIS 51  51  51  HIS HIS B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  ASP 53  53  53  ASP ASP B . n 
B 2 54  LEU 54  54  54  LEU LEU B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  PHE 56  56  56  PHE PHE B . n 
B 2 57  SER 57  57  57  SER SER B . n 
B 2 58  LYS 58  58  58  LYS LYS B . n 
B 2 59  ASP 59  59  59  ASP ASP B . n 
B 2 60  TRP 60  60  60  TRP TRP B . n 
B 2 61  SER 61  61  61  SER SER B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  TYR 63  63  63  TYR TYR B . n 
B 2 64  LEU 64  64  64  LEU LEU B . n 
B 2 65  LEU 65  65  65  LEU LEU B . n 
B 2 66  TYR 66  66  66  TYR TYR B . n 
B 2 67  TYR 67  67  67  TYR TYR B . n 
B 2 68  THR 68  68  68  THR THR B . n 
B 2 69  GLU 69  69  69  GLU GLU B . n 
B 2 70  PHE 70  70  70  PHE PHE B . n 
B 2 71  THR 71  71  71  THR THR B . n 
B 2 72  PRO 72  72  72  PRO PRO B . n 
B 2 73  THR 73  73  73  THR THR B . n 
B 2 74  GLU 74  74  74  GLU GLU B . n 
B 2 75  LYS 75  75  75  LYS LYS B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  GLU 77  77  77  GLU GLU B . n 
B 2 78  TYR 78  78  78  TYR TYR B . n 
B 2 79  ALA 79  79  79  ALA ALA B . n 
B 2 80  CYS 80  80  80  CYS CYS B . n 
B 2 81  ARG 81  81  81  ARG ARG B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  ASN 83  83  83  ASN ASN B . n 
B 2 84  HIS 84  84  84  HIS HIS B . n 
B 2 85  VAL 85  85  85  VAL VAL B . n 
B 2 86  THR 86  86  86  THR THR B . n 
B 2 87  LEU 87  87  87  LEU LEU B . n 
B 2 88  SER 88  88  88  SER SER B . n 
B 2 89  GLN 89  89  89  GLN GLN B . n 
B 2 90  PRO 90  90  90  PRO PRO B . n 
B 2 91  LYS 91  91  91  LYS LYS B . n 
B 2 92  ILE 92  92  92  ILE ILE B . n 
B 2 93  VAL 93  93  93  VAL VAL B . n 
B 2 94  LYS 94  94  94  LYS LYS B . n 
B 2 95  TRP 95  95  95  TRP TRP B . n 
B 2 96  ASP 96  96  96  ASP ASP B . n 
B 2 97  ARG 97  97  97  ARG ARG B . n 
B 2 98  ASP 98  98  98  ASP ASP B . n 
C 3 1   LYS 1   1   1   LYS LYS C . n 
C 3 2   LEU 2   2   2   LEU LEU C . n 
C 3 3   ILE 3   3   3   ILE ILE C . n 
C 3 4   GLU 4   4   4   GLU GLU C . n 
C 3 5   THR 5   5   5   THR THR C . n 
C 3 6   TYR 6   6   6   TYR TYR C . n 
C 3 7   PHE 7   7   7   PHE PHE C . n 
C 3 8   SER 8   8   8   SER SER C . n 
C 3 9   LYS 9   9   9   LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1 2001 2001 HOH HOH A . 
D 4 HOH 2 2002 2002 HOH HOH A . 
D 4 HOH 3 2003 2003 HOH HOH A . 
D 4 HOH 4 2004 2004 HOH HOH A . 
D 4 HOH 5 2005 2005 HOH HOH A . 
D 4 HOH 6 2006 2006 HOH HOH A . 
D 4 HOH 7 2007 2007 HOH HOH A . 
E 4 HOH 1 2001 2001 HOH HOH B . 
E 4 HOH 2 2002 2002 HOH HOH B . 
E 4 HOH 3 2003 2003 HOH HOH B . 
E 4 HOH 4 2004 2004 HOH HOH B . 
E 4 HOH 5 2005 2005 HOH HOH B . 
E 4 HOH 6 2006 2006 HOH HOH B . 
E 4 HOH 7 2007 2007 HOH HOH B . 
F 4 HOH 1 2001 2001 HOH HOH C . 
F 4 HOH 2 2002 2002 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4060  ? 
1 MORE         -16.6 ? 
1 'SSA (A^2)'  18690 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-04-27 
2 'Structure model' 1 1 2012-03-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'       
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 11.2798 -4.5660  -11.3491 0.0379 0.0552 -0.0059 0.0248  -0.0009 0.0002  0.4083 1.0286 0.1774 
0.1217  0.2125  -0.1727 -0.0221 -0.0337 -0.0755 0.0903  0.0391  -0.0051 -0.0663 -0.1380 -0.0084 
'X-RAY DIFFRACTION' 2 ? refined 43.5927 -10.9477 -23.5697 0.0788 0.0910 0.1727  -0.0102 0.0150  -0.0042 0.3374 0.0962 0.3904 
-0.1351 -0.0055 -0.1102 0.0151  -0.0462 0.1896  0.0107  -0.0617 -0.0916 -0.0300 0.0214  0.0409  
'X-RAY DIFFRACTION' 3 ? refined 23.6352 -10.1987 -34.8551 0.0704 0.0467 0.0158  0.0417  -0.0058 0.0033  0.4121 0.4754 0.2862 
-0.3398 0.1833  -0.1296 0.1344  0.0235  -0.0203 -0.1264 -0.0776 0.0342  -0.0564 -0.0327 -0.0293 
'X-RAY DIFFRACTION' 4 ? refined 5.0371  -3.0578  -6.7923  0.2356 0.2333 0.1797  0.0926  -0.0845 0.0044  0.2195 0.5578 0.1712 
-0.3300 0.1673  -0.3030 -0.1554 -0.2034 0.0141  0.1484  0.1651  -0.0266 -0.0838 -0.0871 -0.0083 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 1:181)'   
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESID 182:274)' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN B AND (RESID 2:98)'    
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN C AND (RESID 1:9)'     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE: 1.6.4_486)' ? 1 
XDS    'data reduction' .                            ? 2 
SCALA  'data scaling'   .                            ? 3 
MOLREP phasing          .                            ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 29  ? ? 62.22   -119.87 
2 1 LEU A 110 ? ? -123.40 -57.86  
3 1 ARG A 114 ? ? -164.25 111.85  
4 1 TYR A 123 ? ? -114.69 -70.12  
5 1 SER A 195 ? ? -144.09 -153.44 
6 1 ASP A 220 ? ? 57.96   18.39   
7 1 TRP B 60  ? ? 81.28   -3.58   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 232 ? CG  ? A GLU 232 CG  
2  1 Y 1 A GLU 232 ? CD  ? A GLU 232 CD  
3  1 Y 1 A GLU 232 ? OE1 ? A GLU 232 OE1 
4  1 Y 1 A GLU 232 ? OE2 ? A GLU 232 OE2 
5  1 Y 1 A GLU 264 ? CG  ? A GLU 264 CG  
6  1 Y 1 A GLU 264 ? CD  ? A GLU 264 CD  
7  1 Y 1 A GLU 264 ? OE1 ? A GLU 264 OE1 
8  1 Y 1 A GLU 264 ? OE2 ? A GLU 264 OE2 
9  1 Y 1 B LYS 58  ? CG  ? B LYS 58  CG  
10 1 Y 1 B LYS 58  ? CD  ? B LYS 58  CD  
11 1 Y 1 B LYS 58  ? CE  ? B LYS 58  CE  
12 1 Y 1 B LYS 58  ? NZ  ? B LYS 58  NZ  
13 1 Y 1 B GLU 69  ? CG  ? B GLU 69  CG  
14 1 Y 1 B GLU 69  ? CD  ? B GLU 69  CD  
15 1 Y 1 B GLU 69  ? OE1 ? B GLU 69  OE1 
16 1 Y 1 B GLU 69  ? OE2 ? B GLU 69  OE2 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#