data_2XRI
# 
_entry.id   2XRI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XRI         
PDBE  EBI-45387    
WWPDB D_1290045387 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XRI 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Welin, M.'        1  
'Siponen, M.I.'    2  
'Arrowsmith, C.H.' 3  
'Berglund, H.'     4  
'Bountra, C.'      5  
'Collins, R.'      6  
'Edwards, A.M.'    7  
'Flodin, S.'       8  
'Flores, A.'       9  
'Graslund, S.'     10 
'Hammarstrom, M.'  11 
'Johansson, I.'    12 
'Karlberg, T.'     13 
'Kol, S.'          14 
'Kotenyova, T.'    15 
'Kouznetsova, E.'  16 
'Moche, M.'        17 
'Nyman, T.'        18 
'Persson, C.'      19 
'Schuler, H.'      20 
'Schutz, P.'       21 
'Thorsell, A.G.'   22 
'Tresaugues, L.'   23 
'Van Der Berg, S.' 24 
'Wahlberg, E.'     25 
'Weigelt, J.'      26 
'Nordlund, P.'     27 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Eri1 Exoribonuclease 3' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Welin, M.'        1  
primary 'Siponen, M.I.'    2  
primary 'Arrowsmith, C.H.' 3  
primary 'Berglund, H.'     4  
primary 'Bountra, C.'      5  
primary 'Collins, R.'      6  
primary 'Edwards, A.M.'    7  
primary 'Flodin, S.'       8  
primary 'Flores, A.'       9  
primary 'Graslund, S.'     10 
primary 'Hammarstrom, M.'  11 
primary 'Johansson, I.'    12 
primary 'Karlberg, T.'     13 
primary 'Kol, S.'          14 
primary 'Kotenyova, T.'    15 
primary 'Kouznetsova, E.'  16 
primary 'Moche, M.'        17 
primary 'Nyman, T.'        18 
primary 'Persson, C.'      19 
primary 'Schuler, H.'      20 
primary 'Schutz, P.'       21 
primary 'Thorsell, A.G.'   22 
primary 'Tresaugues, L.'   23 
primary 'Van Der Berg, S.' 24 
primary 'Wahlberg, E.'     25 
primary 'Weigelt, J.'      26 
primary 'Nordlund, P.'     27 
# 
_cell.entry_id           2XRI 
_cell.length_a           68.720 
_cell.length_b           76.900 
_cell.length_c           86.980 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XRI 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ERI1 EXORIBONUCLEASE 3' 25784.811 1   3.1.-.- ? 'RESIDUES 137-337' ? 
2 non-polymer syn 'MAGNESIUM ION'          24.305    1   ?       ? ?                  ? 
3 non-polymer syn GLYCEROL                 92.094    1   ?       ? ?                  ? 
4 water       nat water                    18.015    104 ?       ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PRION PROTEIN-INTERACTING PROTEIN, PRION INTERACTOR 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMSFPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVH
PQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
NLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMSFPPQRYHYFLVLDFEATCDKPQIHPQEIIEFPILKLNGRTMEIESTFHMYVQPVVH
PQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
NLKKAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYRGFIFKQTSKPF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  SER n 
1 25  PHE n 
1 26  PRO n 
1 27  PRO n 
1 28  GLN n 
1 29  ARG n 
1 30  TYR n 
1 31  HIS n 
1 32  TYR n 
1 33  PHE n 
1 34  LEU n 
1 35  VAL n 
1 36  LEU n 
1 37  ASP n 
1 38  PHE n 
1 39  GLU n 
1 40  ALA n 
1 41  THR n 
1 42  CYS n 
1 43  ASP n 
1 44  LYS n 
1 45  PRO n 
1 46  GLN n 
1 47  ILE n 
1 48  HIS n 
1 49  PRO n 
1 50  GLN n 
1 51  GLU n 
1 52  ILE n 
1 53  ILE n 
1 54  GLU n 
1 55  PHE n 
1 56  PRO n 
1 57  ILE n 
1 58  LEU n 
1 59  LYS n 
1 60  LEU n 
1 61  ASN n 
1 62  GLY n 
1 63  ARG n 
1 64  THR n 
1 65  MET n 
1 66  GLU n 
1 67  ILE n 
1 68  GLU n 
1 69  SER n 
1 70  THR n 
1 71  PHE n 
1 72  HIS n 
1 73  MET n 
1 74  TYR n 
1 75  VAL n 
1 76  GLN n 
1 77  PRO n 
1 78  VAL n 
1 79  VAL n 
1 80  HIS n 
1 81  PRO n 
1 82  GLN n 
1 83  LEU n 
1 84  THR n 
1 85  PRO n 
1 86  PHE n 
1 87  CYS n 
1 88  THR n 
1 89  GLU n 
1 90  LEU n 
1 91  THR n 
1 92  GLY n 
1 93  ILE n 
1 94  ILE n 
1 95  GLN n 
1 96  ALA n 
1 97  MET n 
1 98  VAL n 
1 99  ASP n 
1 100 GLY n 
1 101 GLN n 
1 102 PRO n 
1 103 SER n 
1 104 LEU n 
1 105 GLN n 
1 106 GLN n 
1 107 VAL n 
1 108 LEU n 
1 109 GLU n 
1 110 ARG n 
1 111 VAL n 
1 112 ASP n 
1 113 GLU n 
1 114 TRP n 
1 115 MET n 
1 116 ALA n 
1 117 LYS n 
1 118 GLU n 
1 119 GLY n 
1 120 LEU n 
1 121 LEU n 
1 122 ASP n 
1 123 PRO n 
1 124 ASN n 
1 125 VAL n 
1 126 LYS n 
1 127 SER n 
1 128 ILE n 
1 129 PHE n 
1 130 VAL n 
1 131 THR n 
1 132 CYS n 
1 133 GLY n 
1 134 ASP n 
1 135 TRP n 
1 136 ASP n 
1 137 LEU n 
1 138 LYS n 
1 139 VAL n 
1 140 MET n 
1 141 LEU n 
1 142 PRO n 
1 143 GLY n 
1 144 GLN n 
1 145 CYS n 
1 146 GLN n 
1 147 TYR n 
1 148 LEU n 
1 149 GLY n 
1 150 LEU n 
1 151 PRO n 
1 152 VAL n 
1 153 ALA n 
1 154 ASP n 
1 155 TYR n 
1 156 PHE n 
1 157 LYS n 
1 158 GLN n 
1 159 TRP n 
1 160 ILE n 
1 161 ASN n 
1 162 LEU n 
1 163 LYS n 
1 164 LYS n 
1 165 ALA n 
1 166 TYR n 
1 167 SER n 
1 168 PHE n 
1 169 ALA n 
1 170 MET n 
1 171 GLY n 
1 172 CYS n 
1 173 TRP n 
1 174 PRO n 
1 175 LYS n 
1 176 ASN n 
1 177 GLY n 
1 178 LEU n 
1 179 LEU n 
1 180 ASP n 
1 181 MET n 
1 182 ASN n 
1 183 LYS n 
1 184 GLY n 
1 185 LEU n 
1 186 SER n 
1 187 LEU n 
1 188 GLN n 
1 189 HIS n 
1 190 ILE n 
1 191 GLY n 
1 192 ARG n 
1 193 PRO n 
1 194 HIS n 
1 195 SER n 
1 196 GLY n 
1 197 ILE n 
1 198 ASP n 
1 199 ASP n 
1 200 CYS n 
1 201 LYS n 
1 202 ASN n 
1 203 ILE n 
1 204 ALA n 
1 205 ASN n 
1 206 ILE n 
1 207 MET n 
1 208 LYS n 
1 209 THR n 
1 210 LEU n 
1 211 ALA n 
1 212 TYR n 
1 213 ARG n 
1 214 GLY n 
1 215 PHE n 
1 216 ILE n 
1 217 PHE n 
1 218 LYS n 
1 219 GLN n 
1 220 THR n 
1 221 SER n 
1 222 LYS n 
1 223 PRO n 
1 224 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R3 PRARE' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERI3_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O43414 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2XRI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 224 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O43414 
_struct_ref_seq.db_align_beg                  137 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  337 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       137 
_struct_ref_seq.pdbx_auth_seq_align_end       337 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XRI MET A 1  ? UNP O43414 ? ? 'expression tag' 114 1  
1 2XRI HIS A 2  ? UNP O43414 ? ? 'expression tag' 115 2  
1 2XRI HIS A 3  ? UNP O43414 ? ? 'expression tag' 116 3  
1 2XRI HIS A 4  ? UNP O43414 ? ? 'expression tag' 117 4  
1 2XRI HIS A 5  ? UNP O43414 ? ? 'expression tag' 118 5  
1 2XRI HIS A 6  ? UNP O43414 ? ? 'expression tag' 119 6  
1 2XRI HIS A 7  ? UNP O43414 ? ? 'expression tag' 120 7  
1 2XRI SER A 8  ? UNP O43414 ? ? 'expression tag' 121 8  
1 2XRI SER A 9  ? UNP O43414 ? ? 'expression tag' 122 9  
1 2XRI GLY A 10 ? UNP O43414 ? ? 'expression tag' 123 10 
1 2XRI VAL A 11 ? UNP O43414 ? ? 'expression tag' 124 11 
1 2XRI ASP A 12 ? UNP O43414 ? ? 'expression tag' 125 12 
1 2XRI LEU A 13 ? UNP O43414 ? ? 'expression tag' 126 13 
1 2XRI GLY A 14 ? UNP O43414 ? ? 'expression tag' 127 14 
1 2XRI THR A 15 ? UNP O43414 ? ? 'expression tag' 128 15 
1 2XRI GLU A 16 ? UNP O43414 ? ? 'expression tag' 129 16 
1 2XRI ASN A 17 ? UNP O43414 ? ? 'expression tag' 130 17 
1 2XRI LEU A 18 ? UNP O43414 ? ? 'expression tag' 131 18 
1 2XRI TYR A 19 ? UNP O43414 ? ? 'expression tag' 132 19 
1 2XRI PHE A 20 ? UNP O43414 ? ? 'expression tag' 133 20 
1 2XRI GLN A 21 ? UNP O43414 ? ? 'expression tag' 134 21 
1 2XRI SER A 22 ? UNP O43414 ? ? 'expression tag' 135 22 
1 2XRI MET A 23 ? UNP O43414 ? ? 'expression tag' 136 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XRI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.23 
_exptl_crystal.density_percent_sol   44.9 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M TRIS PH 8.5 20% PEG MONOMETHYL ETHER 2000 0.2M TRIMETHYLAMINE N-OXIDE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.97908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XRI 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.50 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   12879 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.10 
_reflns.B_iso_Wilson_estimate        24.2 
_reflns.pdbx_redundancy              12.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.30 
_reflns_shell.pdbx_redundancy        13.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XRI 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     12235 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.49 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.17674 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17497 
_refine.ls_R_factor_R_free                       0.21014 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  644 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.933 
_refine.B_iso_mean                               18.890 
_refine.aniso_B[1][1]                            -0.01 
_refine.aniso_B[2][2]                            1.03 
_refine.aniso_B[3][3]                            -1.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1W0H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.225 
_refine.pdbx_overall_ESU_R_Free                  0.175 
_refine.overall_SU_ML                            0.121 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.134 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1665 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               1776 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        43.49 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 1716 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1180 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.183  1.962  ? 2322 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.858  3.000  ? 2890 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.743  5.000  ? 204  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.278 24.872 ? 78   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.230 15.000 ? 300  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.910 15.000 ? 5    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.069  0.200  ? 248  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1863 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 334  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.204  0.200  ? 301  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.171  0.200  ? 1147 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.180  0.200  ? 806  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.084  0.200  ? 819  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.163  0.200  ? 95   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.051  0.200  ? 1    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.150  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.286  0.200  ? 36   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.132  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.743  1.500  ? 1340 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.125  1.500  ? 410  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.851  2.000  ? 1671 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.609  3.000  ? 827  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.047  4.500  ? 651  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.150 
_refine_ls_shell.d_res_low                        2.206 
_refine_ls_shell.number_reflns_R_work             875 
_refine_ls_shell.R_factor_R_work                  0.199 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.249 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             46 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XRI 
_struct.title                     'Crystal structure of human ERI1 exoribonuclease 3' 
_struct.pdbx_descriptor           'ERI1 EXORIBONUCLEASE 3 (E.C.3.1.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XRI 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, METAL BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 17  ? GLN A 21  ? ASN A 130 GLN A 134 5 ? 5  
HELX_P HELX_P2  2  THR A 84  ? GLY A 92  ? THR A 197 GLY A 205 1 ? 9  
HELX_P HELX_P3  3  ILE A 94  ? ASP A 99  ? ILE A 207 ASP A 212 1 ? 6  
HELX_P HELX_P4  4  SER A 103 ? GLU A 118 ? SER A 216 GLU A 231 1 ? 16 
HELX_P HELX_P5  5  ASP A 134 ? VAL A 139 ? ASP A 247 VAL A 252 1 ? 6  
HELX_P HELX_P6  6  VAL A 139 ? GLY A 149 ? VAL A 252 GLY A 262 1 ? 11 
HELX_P HELX_P7  7  ALA A 153 ? LYS A 157 ? ALA A 266 LYS A 270 5 ? 5  
HELX_P HELX_P8  8  LEU A 162 ? GLY A 171 ? LEU A 275 GLY A 284 1 ? 10 
HELX_P HELX_P9  9  GLY A 177 ? LEU A 185 ? GLY A 290 LEU A 298 1 ? 9  
HELX_P HELX_P10 10 SER A 195 ? ARG A 213 ? SER A 308 ARG A 326 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 37  OD2 ? ? A MG 1337 A ASP 150  1_555 ? ? ? ? ? ? ? 1.938 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A GLU 39  OE2 ? ? A MG 1337 A GLU 152  1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 199 OD2 ? ? A MG 1337 A ASP 312  1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 1337 A HOH 2020 1_555 ? ? ? ? ? ? ? 2.527 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          HIS 
_struct_mon_prot_cis.label_seq_id           48 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           HIS 
_struct_mon_prot_cis.auth_seq_id            161 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    49 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     162 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.21 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 39  ? ALA A 40  ? GLU A 152 ALA A 153 
AA 2 ILE A 52  ? ASN A 61  ? ILE A 165 ASN A 174 
AB 1 ILE A 67  ? TYR A 74  ? ILE A 180 TYR A 187 
AB 2 ILE A 52  ? ASN A 61  ? ILE A 165 ASN A 174 
AC 1 TRP A 159 ? ASN A 161 ? TRP A 272 ASN A 274 
AC 2 SER A 127 ? THR A 131 ? SER A 240 THR A 244 
AC 3 TYR A 32  ? LEU A 36  ? TYR A 145 LEU A 149 
AC 4 ILE A 52  ? ASN A 61  ? ILE A 165 ASN A 174 
AC 5 ILE A 67  ? TYR A 74  ? ILE A 180 TYR A 187 
AD 1 TRP A 159 ? ASN A 161 ? TRP A 272 ASN A 274 
AD 2 SER A 127 ? THR A 131 ? SER A 240 THR A 244 
AD 3 TYR A 32  ? LEU A 36  ? TYR A 145 LEU A 149 
AD 4 ILE A 52  ? ASN A 61  ? ILE A 165 ASN A 174 
AD 5 GLU A 39  ? ALA A 40  ? GLU A 152 ALA A 153 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O GLU A 39  ? O GLU A 152 N ILE A 53  ? N ILE A 166 
AB 1 2 N MET A 73  ? N MET A 186 O PHE A 55  ? O PHE A 168 
AC 1 2 N ILE A 160 ? N ILE A 273 O PHE A 129 ? O PHE A 242 
AC 2 3 N ILE A 128 ? N ILE A 241 O TYR A 32  ? O TYR A 145 
AC 3 4 N VAL A 35  ? N VAL A 148 O LEU A 58  ? O LEU A 171 
AC 4 5 O LYS A 59  ? O LYS A 172 N GLU A 68  ? N GLU A 181 
AD 1 2 N ILE A 160 ? N ILE A 273 O PHE A 129 ? O PHE A 242 
AD 2 3 N ILE A 128 ? N ILE A 241 O TYR A 32  ? O TYR A 145 
AD 3 4 N VAL A 35  ? N VAL A 148 O LEU A 58  ? O LEU A 171 
AD 4 5 N ILE A 53  ? N ILE A 166 O GLU A 39  ? O GLU A 152 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 1337'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL A 1338' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 37  ? ASP A 150  . ? 1_555 ? 
2  AC1 5 PHE A 38  ? PHE A 151  . ? 1_555 ? 
3  AC1 5 GLU A 39  ? GLU A 152  . ? 1_555 ? 
4  AC1 5 ASP A 199 ? ASP A 312  . ? 1_555 ? 
5  AC1 5 HOH D .   ? HOH A 2020 . ? 1_555 ? 
6  AC2 5 GLU A 39  ? GLU A 152  . ? 1_555 ? 
7  AC2 5 ALA A 40  ? ALA A 153  . ? 1_555 ? 
8  AC2 5 CYS A 42  ? CYS A 155  . ? 1_555 ? 
9  AC2 5 GLN A 50  ? GLN A 163  . ? 1_555 ? 
10 AC2 5 LEU A 90  ? LEU A 203  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XRI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XRI 
_atom_sites.fract_transf_matrix[1][1]   0.014552 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013004 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011497 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 17  ? 11.780  17.217 11.349  1.00 30.69 ? 130  ASN A N   1 
ATOM   2    C  CA  . ASN A 1 17  ? 11.007  16.249 10.463  1.00 28.87 ? 130  ASN A CA  1 
ATOM   3    C  C   . ASN A 1 17  ? 9.484   16.544 10.391  1.00 27.00 ? 130  ASN A C   1 
ATOM   4    O  O   . ASN A 1 17  ? 8.912   16.594 9.298   1.00 25.43 ? 130  ASN A O   1 
ATOM   5    C  CB  . ASN A 1 17  ? 11.251  14.813 10.937  1.00 31.42 ? 130  ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 17  ? 10.188  13.848 10.462  1.00 31.13 ? 130  ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 17  ? 9.899   13.770 9.278   1.00 33.71 ? 130  ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 17  ? 9.601   13.097 11.407  1.00 37.72 ? 130  ASN A ND2 1 
ATOM   9    N  N   . LEU A 1 18  ? 8.839   16.743 11.548  1.00 26.10 ? 131  LEU A N   1 
ATOM   10   C  CA  . LEU A 1 18  ? 7.622   17.567 11.598  1.00 24.70 ? 131  LEU A CA  1 
ATOM   11   C  C   . LEU A 1 18  ? 7.897   18.949 10.965  1.00 23.43 ? 131  LEU A C   1 
ATOM   12   O  O   . LEU A 1 18  ? 6.963   19.622 10.518  1.00 22.74 ? 131  LEU A O   1 
ATOM   13   C  CB  . LEU A 1 18  ? 7.116   17.787 13.032  1.00 25.44 ? 131  LEU A CB  1 
ATOM   14   C  CG  . LEU A 1 18  ? 6.061   16.821 13.570  1.00 25.84 ? 131  LEU A CG  1 
ATOM   15   C  CD1 . LEU A 1 18  ? 5.674   17.236 14.968  1.00 26.63 ? 131  LEU A CD1 1 
ATOM   16   C  CD2 . LEU A 1 18  ? 4.813   16.744 12.659  1.00 23.87 ? 131  LEU A CD2 1 
ATOM   17   N  N   . TYR A 1 19  ? 9.168   19.370 10.938  1.00 22.56 ? 132  TYR A N   1 
ATOM   18   C  CA  . TYR A 1 19  ? 9.567   20.618 10.259  1.00 22.33 ? 132  TYR A CA  1 
ATOM   19   C  C   . TYR A 1 19  ? 8.967   20.773 8.859   1.00 20.14 ? 132  TYR A C   1 
ATOM   20   O  O   . TYR A 1 19  ? 8.624   21.878 8.459   1.00 20.13 ? 132  TYR A O   1 
ATOM   21   C  CB  . TYR A 1 19  ? 11.096  20.736 10.185  1.00 22.10 ? 132  TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 19  ? 11.625  22.044 9.623   1.00 21.35 ? 132  TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 19  ? 11.828  23.145 10.442  1.00 21.10 ? 132  TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 19  ? 11.955  22.161 8.281   1.00 19.32 ? 132  TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 19  ? 12.340  24.334 9.938   1.00 22.09 ? 132  TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 19  ? 12.472  23.338 7.766   1.00 19.39 ? 132  TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 19  ? 12.656  24.422 8.594   1.00 19.91 ? 132  TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 19  ? 13.162  25.592 8.072   1.00 21.23 ? 132  TYR A OH  1 
ATOM   29   N  N   . PHE A 1 20  ? 8.858   19.670 8.125   1.00 19.30 ? 133  PHE A N   1 
ATOM   30   C  CA  . PHE A 1 20  ? 8.410   19.682 6.738   1.00 18.18 ? 133  PHE A CA  1 
ATOM   31   C  C   . PHE A 1 20  ? 6.918   19.367 6.521   1.00 17.75 ? 133  PHE A C   1 
ATOM   32   O  O   . PHE A 1 20  ? 6.439   19.445 5.390   1.00 16.72 ? 133  PHE A O   1 
ATOM   33   C  CB  . PHE A 1 20  ? 9.256   18.702 5.914   1.00 17.12 ? 133  PHE A CB  1 
ATOM   34   C  CG  . PHE A 1 20  ? 10.667  19.165 5.725   1.00 18.08 ? 133  PHE A CG  1 
ATOM   35   C  CD1 . PHE A 1 20  ? 11.678  18.667 6.517   1.00 18.10 ? 133  PHE A CD1 1 
ATOM   36   C  CD2 . PHE A 1 20  ? 10.970  20.151 4.784   1.00 17.13 ? 133  PHE A CD2 1 
ATOM   37   C  CE1 . PHE A 1 20  ? 12.982  19.115 6.364   1.00 20.79 ? 133  PHE A CE1 1 
ATOM   38   C  CE2 . PHE A 1 20  ? 12.274  20.599 4.620   1.00 19.36 ? 133  PHE A CE2 1 
ATOM   39   C  CZ  . PHE A 1 20  ? 13.282  20.083 5.413   1.00 19.69 ? 133  PHE A CZ  1 
ATOM   40   N  N   . GLN A 1 21  ? 6.201   19.006 7.577   1.00 19.37 ? 134  GLN A N   1 
ATOM   41   C  CA  . GLN A 1 21  ? 4.845   18.452 7.437   1.00 19.54 ? 134  GLN A CA  1 
ATOM   42   C  C   . GLN A 1 21  ? 3.918   19.373 6.628   1.00 18.71 ? 134  GLN A C   1 
ATOM   43   O  O   . GLN A 1 21  ? 3.190   18.900 5.793   1.00 17.78 ? 134  GLN A O   1 
ATOM   44   C  CB  . GLN A 1 21  ? 4.247   18.168 8.824   1.00 20.65 ? 134  GLN A CB  1 
ATOM   45   C  CG  . GLN A 1 21  ? 2.919   17.426 8.798   1.00 20.70 ? 134  GLN A CG  1 
ATOM   46   C  CD  . GLN A 1 21  ? 2.234   17.477 10.141  1.00 23.22 ? 134  GLN A CD  1 
ATOM   47   O  OE1 . GLN A 1 21  ? 1.913   18.562 10.637  1.00 26.63 ? 134  GLN A OE1 1 
ATOM   48   N  NE2 . GLN A 1 21  ? 2.042   16.314 10.762  1.00 23.31 ? 134  GLN A NE2 1 
ATOM   49   N  N   . SER A 1 22  ? 3.975   20.677 6.869   1.00 19.75 ? 135  SER A N   1 
ATOM   50   C  CA  . SER A 1 22  ? 3.187   21.668 6.107   1.00 20.95 ? 135  SER A CA  1 
ATOM   51   C  C   . SER A 1 22  ? 3.782   22.087 4.771   1.00 21.04 ? 135  SER A C   1 
ATOM   52   O  O   . SER A 1 22  ? 3.067   22.573 3.896   1.00 21.56 ? 135  SER A O   1 
ATOM   53   C  CB  . SER A 1 22  ? 2.998   22.941 6.925   1.00 21.56 ? 135  SER A CB  1 
ATOM   54   O  OG  . SER A 1 22  ? 1.974   22.763 7.863   1.00 23.73 ? 135  SER A OG  1 
ATOM   55   N  N   . MET A 1 23  ? 5.090   21.944 4.630   1.00 21.94 ? 136  MET A N   1 
ATOM   56   C  CA  . MET A 1 23  ? 5.814   22.456 3.480   1.00 21.89 ? 136  MET A CA  1 
ATOM   57   C  C   . MET A 1 23  ? 5.867   21.461 2.361   1.00 20.33 ? 136  MET A C   1 
ATOM   58   O  O   . MET A 1 23  ? 5.938   21.841 1.193   1.00 19.89 ? 136  MET A O   1 
ATOM   59   C  CB  . MET A 1 23  ? 7.271   22.694 3.849   1.00 22.71 ? 136  MET A CB  1 
ATOM   60   C  CG  . MET A 1 23  ? 7.541   23.898 4.623   1.00 25.40 ? 136  MET A CG  1 
ATOM   61   S  SD  . MET A 1 23  ? 9.275   23.800 5.099   1.00 28.86 ? 136  MET A SD  1 
ATOM   62   C  CE  . MET A 1 23  ? 10.035  24.092 3.514   1.00 25.25 ? 136  MET A CE  1 
ATOM   63   N  N   . SER A 1 24  ? 5.923   20.188 2.723   1.00 20.22 ? 137  SER A N   1 
ATOM   64   C  CA  . SER A 1 24  ? 6.156   19.144 1.750   1.00 20.02 ? 137  SER A CA  1 
ATOM   65   C  C   . SER A 1 24  ? 5.046   19.132 0.694   1.00 19.44 ? 137  SER A C   1 
ATOM   66   O  O   . SER A 1 24  ? 3.878   19.439 0.981   1.00 18.92 ? 137  SER A O   1 
ATOM   67   C  CB  . SER A 1 24  ? 6.274   17.786 2.435   1.00 20.58 ? 137  SER A CB  1 
ATOM   68   O  OG  . SER A 1 24  ? 5.078   17.488 3.133   1.00 24.86 ? 137  SER A OG  1 
ATOM   69   N  N   . PHE A 1 25  ? 5.445   18.811 -0.535  1.00 18.34 ? 138  PHE A N   1 
ATOM   70   C  CA  . PHE A 1 25  ? 4.536   18.695 -1.661  1.00 17.41 ? 138  PHE A CA  1 
ATOM   71   C  C   . PHE A 1 25  ? 3.626   19.890 -1.759  1.00 17.06 ? 138  PHE A C   1 
ATOM   72   O  O   . PHE A 1 25  ? 2.420   19.777 -1.602  1.00 17.88 ? 138  PHE A O   1 
ATOM   73   C  CB  . PHE A 1 25  ? 3.791   17.349 -1.618  1.00 17.47 ? 138  PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 25  ? 4.737   16.170 -1.523  1.00 17.75 ? 138  PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 25  ? 4.931   15.504 -0.316  1.00 18.70 ? 138  PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 25  ? 5.496   15.796 -2.617  1.00 17.45 ? 138  PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 25  ? 5.833   14.464 -0.210  1.00 19.01 ? 138  PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 25  ? 6.400   14.743 -2.526  1.00 18.71 ? 138  PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 25  ? 6.575   14.076 -1.316  1.00 18.66 ? 138  PHE A CZ  1 
ATOM   80   N  N   . PRO A 1 26  ? 4.212   21.058 -2.042  1.00 17.31 ? 139  PRO A N   1 
ATOM   81   C  CA  . PRO A 1 26  ? 3.399   22.246 -2.196  1.00 17.56 ? 139  PRO A CA  1 
ATOM   82   C  C   . PRO A 1 26  ? 2.654   22.212 -3.524  1.00 17.17 ? 139  PRO A C   1 
ATOM   83   O  O   . PRO A 1 26  ? 2.925   21.350 -4.357  1.00 16.32 ? 139  PRO A O   1 
ATOM   84   C  CB  . PRO A 1 26  ? 4.434   23.366 -2.206  1.00 17.77 ? 139  PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 26  ? 5.624   22.725 -2.840  1.00 17.12 ? 139  PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 26  ? 5.642   21.345 -2.266  1.00 17.28 ? 139  PRO A CD  1 
ATOM   87   N  N   . PRO A 1 27  ? 1.734   23.159 -3.730  1.00 18.15 ? 140  PRO A N   1 
ATOM   88   C  CA  . PRO A 1 27  ? 1.143   23.262 -5.045  1.00 18.40 ? 140  PRO A CA  1 
ATOM   89   C  C   . PRO A 1 27  ? 2.224   23.581 -6.088  1.00 18.11 ? 140  PRO A C   1 
ATOM   90   O  O   . PRO A 1 27  ? 3.071   24.439 -5.858  1.00 18.40 ? 140  PRO A O   1 
ATOM   91   C  CB  . PRO A 1 27  ? 0.166   24.420 -4.893  1.00 19.11 ? 140  PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 27  ? -0.063  24.540 -3.456  1.00 19.60 ? 140  PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 27  ? 1.191   24.165 -2.805  1.00 18.82 ? 140  PRO A CD  1 
ATOM   94   N  N   . GLN A 1 28  ? 2.194   22.873 -7.211  1.00 17.95 ? 141  GLN A N   1 
ATOM   95   C  CA  . GLN A 1 28  ? 3.171   23.055 -8.281  1.00 17.75 ? 141  GLN A CA  1 
ATOM   96   C  C   . GLN A 1 28  ? 2.541   23.808 -9.471  1.00 18.51 ? 141  GLN A C   1 
ATOM   97   O  O   . GLN A 1 28  ? 1.334   23.967 -9.535  1.00 19.29 ? 141  GLN A O   1 
ATOM   98   C  CB  . GLN A 1 28  ? 3.723   21.689 -8.704  1.00 16.83 ? 141  GLN A CB  1 
ATOM   99   C  CG  . GLN A 1 28  ? 4.498   20.929 -7.626  1.00 16.03 ? 141  GLN A CG  1 
ATOM   100  C  CD  . GLN A 1 28  ? 5.937   21.422 -7.370  1.00 17.53 ? 141  GLN A CD  1 
ATOM   101  O  OE1 . GLN A 1 28  ? 6.510   22.221 -8.131  1.00 16.25 ? 141  GLN A OE1 1 
ATOM   102  N  NE2 . GLN A 1 28  ? 6.524   20.933 -6.270  1.00 17.05 ? 141  GLN A NE2 1 
ATOM   103  N  N   . ARG A 1 29  ? 3.361   24.250 -10.423 1.00 18.72 ? 142  ARG A N   1 
ATOM   104  C  CA  . ARG A 1 29  ? 2.871   25.015 -11.574 1.00 19.73 ? 142  ARG A CA  1 
ATOM   105  C  C   . ARG A 1 29  ? 2.351   24.148 -12.723 1.00 18.69 ? 142  ARG A C   1 
ATOM   106  O  O   . ARG A 1 29  ? 1.833   24.676 -13.695 1.00 18.70 ? 142  ARG A O   1 
ATOM   107  C  CB  . ARG A 1 29  ? 3.971   25.922 -12.120 1.00 20.11 ? 142  ARG A CB  1 
ATOM   108  C  CG  . ARG A 1 29  ? 4.565   26.848 -11.079 1.00 22.26 ? 142  ARG A CG  1 
ATOM   109  C  CD  . ARG A 1 29  ? 5.743   27.627 -11.648 1.00 24.31 ? 142  ARG A CD  1 
ATOM   110  N  NE  . ARG A 1 29  ? 6.011   28.790 -10.813 1.00 28.84 ? 142  ARG A NE  1 
ATOM   111  C  CZ  . ARG A 1 29  ? 6.503   29.945 -11.248 1.00 31.90 ? 142  ARG A CZ  1 
ATOM   112  N  NH1 . ARG A 1 29  ? 6.841   30.119 -12.526 1.00 33.35 ? 142  ARG A NH1 1 
ATOM   113  N  NH2 . ARG A 1 29  ? 6.680   30.933 -10.379 1.00 32.57 ? 142  ARG A NH2 1 
ATOM   114  N  N   . TYR A 1 30  ? 2.485   22.829 -12.597 1.00 17.86 ? 143  TYR A N   1 
ATOM   115  C  CA  . TYR A 1 30  ? 2.145   21.893 -13.666 1.00 17.15 ? 143  TYR A CA  1 
ATOM   116  C  C   . TYR A 1 30  ? 1.290   20.786 -13.096 1.00 16.90 ? 143  TYR A C   1 
ATOM   117  O  O   . TYR A 1 30  ? 1.481   20.382 -11.949 1.00 17.29 ? 143  TYR A O   1 
ATOM   118  C  CB  . TYR A 1 30  ? 3.436   21.315 -14.315 1.00 16.27 ? 143  TYR A CB  1 
ATOM   119  C  CG  . TYR A 1 30  ? 4.255   22.402 -14.946 1.00 16.43 ? 143  TYR A CG  1 
ATOM   120  C  CD1 . TYR A 1 30  ? 3.994   22.831 -16.246 1.00 17.20 ? 143  TYR A CD1 1 
ATOM   121  C  CD2 . TYR A 1 30  ? 5.233   23.076 -14.209 1.00 15.18 ? 143  TYR A CD2 1 
ATOM   122  C  CE1 . TYR A 1 30  ? 4.705   23.895 -16.808 1.00 17.34 ? 143  TYR A CE1 1 
ATOM   123  C  CE2 . TYR A 1 30  ? 5.943   24.110 -14.748 1.00 16.21 ? 143  TYR A CE2 1 
ATOM   124  C  CZ  . TYR A 1 30  ? 5.696   24.518 -16.048 1.00 18.08 ? 143  TYR A CZ  1 
ATOM   125  O  OH  . TYR A 1 30  ? 6.421   25.582 -16.567 1.00 18.08 ? 143  TYR A OH  1 
ATOM   126  N  N   . HIS A 1 31  ? 0.352   20.298 -13.898 1.00 16.57 ? 144  HIS A N   1 
ATOM   127  C  CA  . HIS A 1 31  ? -0.442  19.139 -13.539 1.00 16.62 ? 144  HIS A CA  1 
ATOM   128  C  C   . HIS A 1 31  ? 0.399   17.874 -13.532 1.00 15.77 ? 144  HIS A C   1 
ATOM   129  O  O   . HIS A 1 31  ? 0.178   16.997 -12.706 1.00 15.61 ? 144  HIS A O   1 
ATOM   130  C  CB  . HIS A 1 31  ? -1.605  18.954 -14.523 1.00 17.03 ? 144  HIS A CB  1 
ATOM   131  C  CG  . HIS A 1 31  ? -2.715  19.935 -14.337 1.00 17.01 ? 144  HIS A CG  1 
ATOM   132  N  ND1 . HIS A 1 31  ? -3.102  20.811 -15.323 1.00 16.52 ? 144  HIS A ND1 1 
ATOM   133  C  CD2 . HIS A 1 31  ? -3.529  20.171 -13.282 1.00 17.27 ? 144  HIS A CD2 1 
ATOM   134  C  CE1 . HIS A 1 31  ? -4.106  21.550 -14.881 1.00 17.54 ? 144  HIS A CE1 1 
ATOM   135  N  NE2 . HIS A 1 31  ? -4.391  21.175 -13.649 1.00 14.60 ? 144  HIS A NE2 1 
ATOM   136  N  N   . TYR A 1 32  ? 1.340   17.790 -14.477 1.00 15.03 ? 145  TYR A N   1 
ATOM   137  C  CA  . TYR A 1 32  ? 2.209   16.626 -14.651 1.00 15.09 ? 145  TYR A CA  1 
ATOM   138  C  C   . TYR A 1 32  ? 3.626   17.063 -15.029 1.00 14.39 ? 145  TYR A C   1 
ATOM   139  O  O   . TYR A 1 32  ? 3.823   18.068 -15.725 1.00 13.81 ? 145  TYR A O   1 
ATOM   140  C  CB  . TYR A 1 32  ? 1.660   15.655 -15.731 1.00 15.82 ? 145  TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 32  ? 0.293   15.142 -15.386 1.00 16.86 ? 145  TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 32  ? 0.124   14.165 -14.408 1.00 16.38 ? 145  TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 32  ? -0.840  15.675 -15.997 1.00 18.76 ? 145  TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 32  ? -1.146  13.723 -14.044 1.00 17.72 ? 145  TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 32  ? -2.110  15.238 -15.652 1.00 19.52 ? 145  TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 32  ? -2.264  14.265 -14.672 1.00 19.32 ? 145  TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 32  ? -3.533  13.836 -14.345 1.00 19.68 ? 145  TYR A OH  1 
ATOM   148  N  N   . PHE A 1 33  ? 4.601   16.304 -14.537 1.00 14.51 ? 146  PHE A N   1 
ATOM   149  C  CA  . PHE A 1 33  ? 5.998   16.403 -15.008 1.00 13.84 ? 146  PHE A CA  1 
ATOM   150  C  C   . PHE A 1 33  ? 6.341   15.181 -15.819 1.00 13.92 ? 146  PHE A C   1 
ATOM   151  O  O   . PHE A 1 33  ? 6.015   14.065 -15.416 1.00 15.41 ? 146  PHE A O   1 
ATOM   152  C  CB  . PHE A 1 33  ? 6.935   16.533 -13.829 1.00 13.96 ? 146  PHE A CB  1 
ATOM   153  C  CG  . PHE A 1 33  ? 6.736   17.794 -13.075 1.00 13.73 ? 146  PHE A CG  1 
ATOM   154  C  CD1 . PHE A 1 33  ? 5.933   17.824 -11.950 1.00 15.25 ? 146  PHE A CD1 1 
ATOM   155  C  CD2 . PHE A 1 33  ? 7.278   18.965 -13.531 1.00 14.13 ? 146  PHE A CD2 1 
ATOM   156  C  CE1 . PHE A 1 33  ? 5.729   19.003 -11.270 1.00 14.13 ? 146  PHE A CE1 1 
ATOM   157  C  CE2 . PHE A 1 33  ? 7.063   20.146 -12.856 1.00 14.69 ? 146  PHE A CE2 1 
ATOM   158  C  CZ  . PHE A 1 33  ? 6.293   20.155 -11.725 1.00 14.17 ? 146  PHE A CZ  1 
ATOM   159  N  N   . LEU A 1 34  ? 6.970   15.402 -16.970 1.00 13.44 ? 147  LEU A N   1 
ATOM   160  C  CA  . LEU A 1 34  ? 7.274   14.346 -17.924 1.00 12.98 ? 147  LEU A CA  1 
ATOM   161  C  C   . LEU A 1 34  ? 8.782   14.149 -17.963 1.00 12.61 ? 147  LEU A C   1 
ATOM   162  O  O   . LEU A 1 34  ? 9.512   14.895 -18.609 1.00 12.64 ? 147  LEU A O   1 
ATOM   163  C  CB  . LEU A 1 34  ? 6.716   14.674 -19.304 1.00 12.51 ? 147  LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 34  ? 5.238   15.081 -19.322 1.00 13.82 ? 147  LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 34  ? 4.817   15.315 -20.751 1.00 12.37 ? 147  LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 34  ? 4.316   14.056 -18.611 1.00 13.63 ? 147  LEU A CD2 1 
ATOM   167  N  N   . VAL A 1 35  ? 9.236   13.151 -17.225 1.00 13.04 ? 148  VAL A N   1 
ATOM   168  C  CA  . VAL A 1 35  ? 10.646  12.881 -17.069 1.00 13.18 ? 148  VAL A CA  1 
ATOM   169  C  C   . VAL A 1 35  ? 11.137  12.110 -18.296 1.00 13.62 ? 148  VAL A C   1 
ATOM   170  O  O   . VAL A 1 35  ? 10.554  11.109 -18.668 1.00 13.49 ? 148  VAL A O   1 
ATOM   171  C  CB  . VAL A 1 35  ? 10.901  12.063 -15.801 1.00 13.63 ? 148  VAL A CB  1 
ATOM   172  C  CG1 . VAL A 1 35  ? 12.402  11.736 -15.673 1.00 11.66 ? 148  VAL A CG1 1 
ATOM   173  C  CG2 . VAL A 1 35  ? 10.376  12.837 -14.582 1.00 12.54 ? 148  VAL A CG2 1 
ATOM   174  N  N   . LEU A 1 36  ? 12.198  12.602 -18.919 1.00 13.78 ? 149  LEU A N   1 
ATOM   175  C  CA  . LEU A 1 36  ? 12.735  11.986 -20.124 1.00 14.08 ? 149  LEU A CA  1 
ATOM   176  C  C   . LEU A 1 36  ? 14.250  11.954 -20.035 1.00 14.59 ? 149  LEU A C   1 
ATOM   177  O  O   . LEU A 1 36  ? 14.867  12.910 -19.572 1.00 14.34 ? 149  LEU A O   1 
ATOM   178  C  CB  . LEU A 1 36  ? 12.273  12.763 -21.352 1.00 13.88 ? 149  LEU A CB  1 
ATOM   179  C  CG  . LEU A 1 36  ? 12.853  12.412 -22.735 1.00 13.71 ? 149  LEU A CG  1 
ATOM   180  C  CD1 . LEU A 1 36  ? 11.900  12.849 -23.844 1.00 12.53 ? 149  LEU A CD1 1 
ATOM   181  C  CD2 . LEU A 1 36  ? 14.229  13.054 -22.896 1.00 11.37 ? 149  LEU A CD2 1 
ATOM   182  N  N   . ASP A 1 37  ? 14.824  10.826 -20.448 1.00 15.32 ? 150  ASP A N   1 
ATOM   183  C  CA  . ASP A 1 37  ? 16.270  10.665 -20.560 1.00 15.87 ? 150  ASP A CA  1 
ATOM   184  C  C   . ASP A 1 37  ? 16.576  9.690  -21.682 1.00 16.54 ? 150  ASP A C   1 
ATOM   185  O  O   . ASP A 1 37  ? 16.246  8.499  -21.567 1.00 17.18 ? 150  ASP A O   1 
ATOM   186  C  CB  . ASP A 1 37  ? 16.871  10.111 -19.266 1.00 16.99 ? 150  ASP A CB  1 
ATOM   187  C  CG  . ASP A 1 37  ? 18.387  10.053 -19.321 1.00 18.48 ? 150  ASP A CG  1 
ATOM   188  O  OD1 . ASP A 1 37  ? 19.022  11.089 -19.079 1.00 21.68 ? 150  ASP A OD1 1 
ATOM   189  O  OD2 . ASP A 1 37  ? 18.952  8.987  -19.642 1.00 22.86 ? 150  ASP A OD2 1 
ATOM   190  N  N   . PHE A 1 38  ? 17.205  10.174 -22.754 1.00 16.09 ? 151  PHE A N   1 
ATOM   191  C  CA  . PHE A 1 38  ? 17.605  9.294  -23.872 1.00 16.67 ? 151  PHE A CA  1 
ATOM   192  C  C   . PHE A 1 38  ? 18.884  8.522  -23.630 1.00 17.65 ? 151  PHE A C   1 
ATOM   193  O  O   . PHE A 1 38  ? 19.792  8.974  -22.906 1.00 17.86 ? 151  PHE A O   1 
ATOM   194  C  CB  . PHE A 1 38  ? 17.837  10.078 -25.173 1.00 16.38 ? 151  PHE A CB  1 
ATOM   195  C  CG  . PHE A 1 38  ? 16.652  10.853 -25.655 1.00 15.73 ? 151  PHE A CG  1 
ATOM   196  C  CD1 . PHE A 1 38  ? 15.385  10.270 -25.719 1.00 16.58 ? 151  PHE A CD1 1 
ATOM   197  C  CD2 . PHE A 1 38  ? 16.805  12.164 -26.082 1.00 15.74 ? 151  PHE A CD2 1 
ATOM   198  C  CE1 . PHE A 1 38  ? 14.295  10.994 -26.191 1.00 16.20 ? 151  PHE A CE1 1 
ATOM   199  C  CE2 . PHE A 1 38  ? 15.730  12.888 -26.537 1.00 15.09 ? 151  PHE A CE2 1 
ATOM   200  C  CZ  . PHE A 1 38  ? 14.460  12.299 -26.601 1.00 15.10 ? 151  PHE A CZ  1 
ATOM   201  N  N   . GLU A 1 39  ? 18.969  7.364  -24.290 1.00 17.95 ? 152  GLU A N   1 
ATOM   202  C  CA  . GLU A 1 39  ? 20.261  6.800  -24.655 1.00 18.85 ? 152  GLU A CA  1 
ATOM   203  C  C   . GLU A 1 39  ? 20.355  6.853  -26.166 1.00 18.55 ? 152  GLU A C   1 
ATOM   204  O  O   . GLU A 1 39  ? 19.333  6.881  -26.856 1.00 18.00 ? 152  GLU A O   1 
ATOM   205  C  CB  . GLU A 1 39  ? 20.432  5.378  -24.134 1.00 20.13 ? 152  GLU A CB  1 
ATOM   206  C  CG  . GLU A 1 39  ? 20.332  5.292  -22.618 1.00 21.51 ? 152  GLU A CG  1 
ATOM   207  C  CD  . GLU A 1 39  ? 21.389  6.120  -21.921 1.00 23.25 ? 152  GLU A CD  1 
ATOM   208  O  OE1 . GLU A 1 39  ? 22.499  6.282  -22.467 1.00 25.82 ? 152  GLU A OE1 1 
ATOM   209  O  OE2 . GLU A 1 39  ? 21.111  6.619  -20.824 1.00 24.74 ? 152  GLU A OE2 1 
ATOM   210  N  N   . ALA A 1 40  ? 21.574  6.879  -26.667 1.00 18.96 ? 153  ALA A N   1 
ATOM   211  C  CA  . ALA A 1 40  ? 21.830  7.103  -28.082 1.00 20.03 ? 153  ALA A CA  1 
ATOM   212  C  C   . ALA A 1 40  ? 23.022  6.282  -28.536 1.00 21.33 ? 153  ALA A C   1 
ATOM   213  O  O   . ALA A 1 40  ? 23.853  5.903  -27.721 1.00 22.28 ? 153  ALA A O   1 
ATOM   214  C  CB  . ALA A 1 40  ? 22.103  8.598  -28.339 1.00 18.98 ? 153  ALA A CB  1 
ATOM   215  N  N   . THR A 1 41  ? 23.106  6.009  -29.834 1.00 22.39 ? 154  THR A N   1 
ATOM   216  C  CA  . THR A 1 41  ? 24.333  5.462  -30.396 1.00 24.79 ? 154  THR A CA  1 
ATOM   217  C  C   . THR A 1 41  ? 25.480  6.397  -30.037 1.00 25.93 ? 154  THR A C   1 
ATOM   218  O  O   . THR A 1 41  ? 25.295  7.625  -29.900 1.00 24.93 ? 154  THR A O   1 
ATOM   219  C  CB  . THR A 1 41  ? 24.299  5.353  -31.924 1.00 25.36 ? 154  THR A CB  1 
ATOM   220  O  OG1 . THR A 1 41  ? 24.067  6.659  -32.482 1.00 24.21 ? 154  THR A OG1 1 
ATOM   221  C  CG2 . THR A 1 41  ? 23.233  4.349  -32.393 1.00 23.73 ? 154  THR A CG2 1 
ATOM   222  N  N   . CYS A 1 42  ? 26.662  5.811  -29.899 1.00 28.22 ? 155  CYS A N   1 
ATOM   223  C  CA  . CYS A 1 42  ? 27.831  6.527  -29.436 1.00 29.34 ? 155  CYS A CA  1 
ATOM   224  C  C   . CYS A 1 42  ? 29.096  5.681  -29.509 1.00 31.92 ? 155  CYS A C   1 
ATOM   225  O  O   . CYS A 1 42  ? 29.042  4.452  -29.694 1.00 32.25 ? 155  CYS A O   1 
ATOM   226  C  CB  . CYS A 1 42  ? 27.636  6.993  -28.000 1.00 29.02 ? 155  CYS A CB  1 
ATOM   227  S  SG  . CYS A 1 42  ? 27.329  5.666  -26.829 1.00 30.89 ? 155  CYS A SG  1 
ATOM   228  N  N   . ASP A 1 43  ? 30.224  6.375  -29.377 1.00 33.57 ? 156  ASP A N   1 
ATOM   229  C  CA  . ASP A 1 43  ? 31.555  5.766  -29.314 1.00 36.24 ? 156  ASP A CA  1 
ATOM   230  C  C   . ASP A 1 43  ? 32.509  6.755  -28.619 1.00 37.66 ? 156  ASP A C   1 
ATOM   231  O  O   . ASP A 1 43  ? 32.115  7.865  -28.245 1.00 36.51 ? 156  ASP A O   1 
ATOM   232  C  CB  . ASP A 1 43  ? 32.062  5.388  -30.712 1.00 36.95 ? 156  ASP A CB  1 
ATOM   233  C  CG  . ASP A 1 43  ? 32.823  4.055  -30.729 1.00 39.49 ? 156  ASP A CG  1 
ATOM   234  O  OD1 . ASP A 1 43  ? 33.401  3.686  -29.688 1.00 40.53 ? 156  ASP A OD1 1 
ATOM   235  O  OD2 . ASP A 1 43  ? 32.848  3.376  -31.781 1.00 39.39 ? 156  ASP A OD2 1 
ATOM   236  N  N   . LYS A 1 44  ? 33.750  6.332  -28.408 1.00 40.97 ? 157  LYS A N   1 
ATOM   237  C  CA  . LYS A 1 44  ? 34.769  7.188  -27.804 1.00 42.22 ? 157  LYS A CA  1 
ATOM   238  C  C   . LYS A 1 44  ? 36.034  7.030  -28.612 1.00 44.51 ? 157  LYS A C   1 
ATOM   239  O  O   . LYS A 1 44  ? 36.520  5.921  -28.750 1.00 46.30 ? 157  LYS A O   1 
ATOM   240  C  CB  . LYS A 1 44  ? 35.004  6.804  -26.335 1.00 43.35 ? 157  LYS A CB  1 
ATOM   241  C  CG  . LYS A 1 44  ? 36.268  7.406  -25.718 1.00 45.80 ? 157  LYS A CG  1 
ATOM   242  C  CD  . LYS A 1 44  ? 36.165  7.492  -24.194 1.00 46.16 ? 157  LYS A CD  1 
ATOM   243  C  CE  . LYS A 1 44  ? 37.550  7.613  -23.552 1.00 50.38 ? 157  LYS A CE  1 
ATOM   244  N  NZ  . LYS A 1 44  ? 37.442  7.968  -22.102 1.00 51.40 ? 157  LYS A NZ  1 
ATOM   245  N  N   . GLN A 1 46  ? 33.759  9.192  -31.067 1.00 42.37 ? 159  GLN A N   1 
ATOM   246  C  CA  . GLN A 1 46  ? 32.314  9.454  -31.160 1.00 40.00 ? 159  GLN A CA  1 
ATOM   247  C  C   . GLN A 1 46  ? 31.842  9.407  -32.613 1.00 39.34 ? 159  GLN A C   1 
ATOM   248  O  O   . GLN A 1 46  ? 32.552  9.849  -33.506 1.00 40.43 ? 159  GLN A O   1 
ATOM   249  C  CB  . GLN A 1 46  ? 31.970  10.803 -30.531 1.00 39.27 ? 159  GLN A CB  1 
ATOM   250  C  CG  . GLN A 1 46  ? 30.473  11.176 -30.546 1.00 37.57 ? 159  GLN A CG  1 
ATOM   251  C  CD  . GLN A 1 46  ? 29.588  10.123 -29.898 1.00 36.62 ? 159  GLN A CD  1 
ATOM   252  O  OE1 . GLN A 1 46  ? 29.282  9.101  -30.508 1.00 36.61 ? 159  GLN A OE1 1 
ATOM   253  N  NE2 . GLN A 1 46  ? 29.169  10.374 -28.666 1.00 35.61 ? 159  GLN A NE2 1 
ATOM   254  N  N   . ILE A 1 47  ? 30.648  8.856  -32.832 1.00 37.90 ? 160  ILE A N   1 
ATOM   255  C  CA  . ILE A 1 47  ? 30.116  8.599  -34.183 1.00 36.91 ? 160  ILE A CA  1 
ATOM   256  C  C   . ILE A 1 47  ? 28.936  9.528  -34.497 1.00 34.71 ? 160  ILE A C   1 
ATOM   257  O  O   . ILE A 1 47  ? 28.263  10.032 -33.585 1.00 33.61 ? 160  ILE A O   1 
ATOM   258  C  CB  . ILE A 1 47  ? 29.707  7.106  -34.388 1.00 37.33 ? 160  ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 47  ? 28.589  6.671  -33.433 1.00 36.56 ? 160  ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 47  ? 30.928  6.171  -34.203 1.00 40.18 ? 160  ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 47  ? 28.260  5.212  -33.545 1.00 36.79 ? 160  ILE A CD1 1 
ATOM   262  N  N   . HIS A 1 48  ? 28.713  9.765  -35.790 1.00 33.72 ? 161  HIS A N   1 
ATOM   263  C  CA  . HIS A 1 48  ? 27.750  10.765 -36.240 1.00 31.99 ? 161  HIS A CA  1 
ATOM   264  C  C   . HIS A 1 48  ? 26.995  10.320 -37.472 1.00 30.69 ? 161  HIS A C   1 
ATOM   265  O  O   . HIS A 1 48  ? 27.548  9.634  -38.302 1.00 31.39 ? 161  HIS A O   1 
ATOM   266  C  CB  . HIS A 1 48  ? 28.458  12.087 -36.514 1.00 32.59 ? 161  HIS A CB  1 
ATOM   267  C  CG  . HIS A 1 48  ? 29.062  12.695 -35.289 1.00 32.26 ? 161  HIS A CG  1 
ATOM   268  N  ND1 . HIS A 1 48  ? 28.305  13.318 -34.319 1.00 30.74 ? 161  HIS A ND1 1 
ATOM   269  C  CD2 . HIS A 1 48  ? 30.344  12.751 -34.862 1.00 33.22 ? 161  HIS A CD2 1 
ATOM   270  C  CE1 . HIS A 1 48  ? 29.100  13.746 -33.355 1.00 31.87 ? 161  HIS A CE1 1 
ATOM   271  N  NE2 . HIS A 1 48  ? 30.343  13.417 -33.662 1.00 32.27 ? 161  HIS A NE2 1 
ATOM   272  N  N   . PRO A 1 49  ? 25.707  10.682 -37.573 1.00 28.71 ? 162  PRO A N   1 
ATOM   273  C  CA  . PRO A 1 49  ? 24.915  11.397 -36.574 1.00 26.85 ? 162  PRO A CA  1 
ATOM   274  C  C   . PRO A 1 49  ? 24.569  10.452 -35.429 1.00 26.02 ? 162  PRO A C   1 
ATOM   275  O  O   . PRO A 1 49  ? 24.462  9.254  -35.655 1.00 26.57 ? 162  PRO A O   1 
ATOM   276  C  CB  . PRO A 1 49  ? 23.645  11.778 -37.339 1.00 25.94 ? 162  PRO A CB  1 
ATOM   277  C  CG  . PRO A 1 49  ? 23.506  10.721 -38.360 1.00 27.67 ? 162  PRO A CG  1 
ATOM   278  C  CD  . PRO A 1 49  ? 24.911  10.346 -38.765 1.00 28.86 ? 162  PRO A CD  1 
ATOM   279  N  N   . GLN A 1 50  ? 24.397  10.975 -34.220 1.00 24.98 ? 163  GLN A N   1 
ATOM   280  C  CA  . GLN A 1 50  ? 24.012  10.123 -33.087 1.00 24.31 ? 163  GLN A CA  1 
ATOM   281  C  C   . GLN A 1 50  ? 22.523  9.868  -33.230 1.00 22.53 ? 163  GLN A C   1 
ATOM   282  O  O   . GLN A 1 50  ? 21.786  10.765 -33.622 1.00 22.26 ? 163  GLN A O   1 
ATOM   283  C  CB  . GLN A 1 50  ? 24.292  10.790 -31.743 1.00 24.02 ? 163  GLN A CB  1 
ATOM   284  C  CG  . GLN A 1 50  ? 25.738  10.761 -31.274 1.00 26.39 ? 163  GLN A CG  1 
ATOM   285  C  CD  . GLN A 1 50  ? 25.863  11.339 -29.866 1.00 27.36 ? 163  GLN A CD  1 
ATOM   286  O  OE1 . GLN A 1 50  ? 25.640  10.634 -28.863 1.00 31.33 ? 163  GLN A OE1 1 
ATOM   287  N  NE2 . GLN A 1 50  ? 26.184  12.632 -29.781 1.00 27.81 ? 163  GLN A NE2 1 
ATOM   288  N  N   . GLU A 1 51  ? 22.086  8.657  -32.911 1.00 21.44 ? 164  GLU A N   1 
ATOM   289  C  CA  . GLU A 1 51  ? 20.695  8.274  -33.079 1.00 20.19 ? 164  GLU A CA  1 
ATOM   290  C  C   . GLU A 1 51  ? 20.106  7.765  -31.779 1.00 19.00 ? 164  GLU A C   1 
ATOM   291  O  O   . GLU A 1 51  ? 20.684  6.887  -31.135 1.00 19.77 ? 164  GLU A O   1 
ATOM   292  C  CB  . GLU A 1 51  ? 20.589  7.188  -34.144 1.00 21.25 ? 164  GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 51  ? 20.961  7.669  -35.553 1.00 21.42 ? 164  GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 51  ? 21.092  6.535  -36.507 1.00 22.93 ? 164  GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 51  ? 22.159  5.875  -36.475 1.00 23.30 ? 164  GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 51  ? 20.125  6.297  -37.278 1.00 23.21 ? 164  GLU A OE2 1 
ATOM   297  N  N   . ILE A 1 52  ? 18.951  8.300  -31.394 1.00 17.08 ? 165  ILE A N   1 
ATOM   298  C  CA  . ILE A 1 52  ? 18.258  7.826  -30.193 1.00 16.15 ? 165  ILE A CA  1 
ATOM   299  C  C   . ILE A 1 52  ? 17.931  6.329  -30.336 1.00 16.47 ? 165  ILE A C   1 
ATOM   300  O  O   . ILE A 1 52  ? 17.380  5.882  -31.360 1.00 16.17 ? 165  ILE A O   1 
ATOM   301  C  CB  . ILE A 1 52  ? 16.978  8.652  -29.876 1.00 15.08 ? 165  ILE A CB  1 
ATOM   302  C  CG1 . ILE A 1 52  ? 17.366  10.094 -29.536 1.00 14.71 ? 165  ILE A CG1 1 
ATOM   303  C  CG2 . ILE A 1 52  ? 16.188  8.000  -28.739 1.00 14.79 ? 165  ILE A CG2 1 
ATOM   304  C  CD1 . ILE A 1 52  ? 16.352  11.169 -29.948 1.00 13.58 ? 165  ILE A CD1 1 
ATOM   305  N  N   . ILE A 1 53  ? 18.352  5.569  -29.322 1.00 16.27 ? 166  ILE A N   1 
ATOM   306  C  CA  . ILE A 1 53  ? 18.105  4.138  -29.212 1.00 16.75 ? 166  ILE A CA  1 
ATOM   307  C  C   . ILE A 1 53  ? 17.228  3.752  -27.999 1.00 16.45 ? 166  ILE A C   1 
ATOM   308  O  O   . ILE A 1 53  ? 16.790  2.615  -27.901 1.00 16.42 ? 166  ILE A O   1 
ATOM   309  C  CB  . ILE A 1 53  ? 19.435  3.318  -29.209 1.00 17.95 ? 166  ILE A CB  1 
ATOM   310  C  CG1 . ILE A 1 53  ? 20.272  3.553  -27.946 1.00 16.82 ? 166  ILE A CG1 1 
ATOM   311  C  CG2 . ILE A 1 53  ? 20.267  3.593  -30.496 1.00 18.61 ? 166  ILE A CG2 1 
ATOM   312  C  CD1 . ILE A 1 53  ? 21.544  2.716  -27.901 1.00 18.82 ? 166  ILE A CD1 1 
ATOM   313  N  N   . GLU A 1 54  ? 16.964  4.687  -27.087 1.00 15.74 ? 167  GLU A N   1 
ATOM   314  C  CA  . GLU A 1 54  ? 16.034  4.438  -25.973 1.00 15.64 ? 167  GLU A CA  1 
ATOM   315  C  C   . GLU A 1 54  ? 15.262  5.708  -25.685 1.00 14.68 ? 167  GLU A C   1 
ATOM   316  O  O   . GLU A 1 54  ? 15.854  6.789  -25.504 1.00 13.99 ? 167  GLU A O   1 
ATOM   317  C  CB  . GLU A 1 54  ? 16.752  3.966  -24.702 1.00 15.97 ? 167  GLU A CB  1 
ATOM   318  C  CG  . GLU A 1 54  ? 15.789  3.532  -23.564 1.00 16.55 ? 167  GLU A CG  1 
ATOM   319  C  CD  . GLU A 1 54  ? 16.502  3.149  -22.262 1.00 18.20 ? 167  GLU A CD  1 
ATOM   320  O  OE1 . GLU A 1 54  ? 17.749  3.230  -22.203 1.00 21.06 ? 167  GLU A OE1 1 
ATOM   321  O  OE2 . GLU A 1 54  ? 15.813  2.776  -21.286 1.00 18.53 ? 167  GLU A OE2 1 
ATOM   322  N  N   . PHE A 1 55  ? 13.938  5.567  -25.636 1.00 15.24 ? 168  PHE A N   1 
ATOM   323  C  CA  . PHE A 1 55  ? 13.017  6.699  -25.517 1.00 14.56 ? 168  PHE A CA  1 
ATOM   324  C  C   . PHE A 1 55  ? 12.050  6.448  -24.367 1.00 14.68 ? 168  PHE A C   1 
ATOM   325  O  O   . PHE A 1 55  ? 10.973  5.867  -24.577 1.00 14.55 ? 168  PHE A O   1 
ATOM   326  C  CB  . PHE A 1 55  ? 12.246  6.887  -26.826 1.00 14.76 ? 168  PHE A CB  1 
ATOM   327  C  CG  . PHE A 1 55  ? 11.796  8.308  -27.085 1.00 14.29 ? 168  PHE A CG  1 
ATOM   328  C  CD1 . PHE A 1 55  ? 12.092  8.934  -28.314 1.00 14.95 ? 168  PHE A CD1 1 
ATOM   329  C  CD2 . PHE A 1 55  ? 11.073  9.022  -26.134 1.00 13.22 ? 168  PHE A CD2 1 
ATOM   330  C  CE1 . PHE A 1 55  ? 11.680  10.258 -28.573 1.00 15.51 ? 168  PHE A CE1 1 
ATOM   331  C  CE2 . PHE A 1 55  ? 10.642  10.356 -26.399 1.00 14.34 ? 168  PHE A CE2 1 
ATOM   332  C  CZ  . PHE A 1 55  ? 10.946  10.972 -27.614 1.00 12.85 ? 168  PHE A CZ  1 
ATOM   333  N  N   . PRO A 1 56  ? 12.453  6.834  -23.138 1.00 14.77 ? 169  PRO A N   1 
ATOM   334  C  CA  . PRO A 1 56  ? 11.564  6.767  -21.986 1.00 15.01 ? 169  PRO A CA  1 
ATOM   335  C  C   . PRO A 1 56  ? 10.870  8.071  -21.637 1.00 14.15 ? 169  PRO A C   1 
ATOM   336  O  O   . PRO A 1 56  ? 11.463  9.138  -21.742 1.00 12.92 ? 169  PRO A O   1 
ATOM   337  C  CB  . PRO A 1 56  ? 12.504  6.373  -20.846 1.00 15.52 ? 169  PRO A CB  1 
ATOM   338  C  CG  . PRO A 1 56  ? 13.906  6.673  -21.347 1.00 15.55 ? 169  PRO A CG  1 
ATOM   339  C  CD  . PRO A 1 56  ? 13.800  7.255  -22.722 1.00 14.91 ? 169  PRO A CD  1 
ATOM   340  N  N   . ILE A 1 57  ? 9.614   7.977  -21.212 1.00 14.55 ? 170  ILE A N   1 
ATOM   341  C  CA  . ILE A 1 57  ? 8.955   9.118  -20.555 1.00 14.20 ? 170  ILE A CA  1 
ATOM   342  C  C   . ILE A 1 57  ? 8.184   8.615  -19.337 1.00 15.05 ? 170  ILE A C   1 
ATOM   343  O  O   . ILE A 1 57  ? 7.444   7.618  -19.421 1.00 15.16 ? 170  ILE A O   1 
ATOM   344  C  CB  . ILE A 1 57  ? 7.959   9.886  -21.459 1.00 14.16 ? 170  ILE A CB  1 
ATOM   345  C  CG1 . ILE A 1 57  ? 8.563   10.190 -22.835 1.00 14.07 ? 170  ILE A CG1 1 
ATOM   346  C  CG2 . ILE A 1 57  ? 7.492   11.182 -20.746 1.00 12.76 ? 170  ILE A CG2 1 
ATOM   347  C  CD1 . ILE A 1 57  ? 7.560   10.651 -23.882 1.00 13.68 ? 170  ILE A CD1 1 
ATOM   348  N  N   . LEU A 1 58  ? 8.369   9.304  -18.211 1.00 14.60 ? 171  LEU A N   1 
ATOM   349  C  CA  . LEU A 1 58  ? 7.613   9.025  -17.013 1.00 15.12 ? 171  LEU A CA  1 
ATOM   350  C  C   . LEU A 1 58  ? 6.672   10.191 -16.765 1.00 15.07 ? 171  LEU A C   1 
ATOM   351  O  O   . LEU A 1 58  ? 7.104   11.327 -16.658 1.00 14.42 ? 171  LEU A O   1 
ATOM   352  C  CB  . LEU A 1 58  ? 8.543   8.809  -15.811 1.00 15.57 ? 171  LEU A CB  1 
ATOM   353  C  CG  . LEU A 1 58  ? 9.531   7.622  -15.804 1.00 16.18 ? 171  LEU A CG  1 
ATOM   354  C  CD1 . LEU A 1 58  ? 10.300  7.537  -14.478 1.00 15.10 ? 171  LEU A CD1 1 
ATOM   355  C  CD2 . LEU A 1 58  ? 8.847   6.294  -16.080 1.00 17.86 ? 171  LEU A CD2 1 
ATOM   356  N  N   . LYS A 1 59  ? 5.375   9.904  -16.709 1.00 15.89 ? 172  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 59  ? 4.369   10.893 -16.347 1.00 16.02 ? 172  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 59  ? 4.213   10.921 -14.829 1.00 16.40 ? 172  LYS A C   1 
ATOM   359  O  O   . LYS A 1 59  ? 3.688   9.975  -14.224 1.00 17.61 ? 172  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 59  ? 3.034   10.528 -16.989 1.00 16.98 ? 172  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 59  ? 1.897   11.530 -16.821 1.00 17.32 ? 172  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 59  ? 0.558   10.840 -17.162 1.00 18.27 ? 172  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 59  ? -0.592  11.783 -17.040 1.00 20.37 ? 172  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 59  ? -1.903  11.112 -17.300 1.00 21.88 ? 172  LYS A NZ  1 
ATOM   365  N  N   . LEU A 1 60  ? 4.662   12.010 -14.215 1.00 15.79 ? 173  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 60  ? 4.563   12.166 -12.763 1.00 15.71 ? 173  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 60  ? 3.388   13.067 -12.409 1.00 15.94 ? 173  LEU A C   1 
ATOM   368  O  O   . LEU A 1 60  ? 3.226   14.158 -12.952 1.00 16.52 ? 173  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 60  ? 5.848   12.774 -12.167 1.00 14.60 ? 173  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 60  ? 7.227   12.182 -12.504 1.00 14.13 ? 173  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 60  ? 8.302   12.881 -11.681 1.00 11.17 ? 173  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 60  ? 7.274   10.648 -12.300 1.00 13.08 ? 173  LEU A CD2 1 
ATOM   373  N  N   . ASN A 1 61  ? 2.594   12.622 -11.454 1.00 16.66 ? 174  ASN A N   1 
ATOM   374  C  CA  . ASN A 1 61  ? 1.652   13.499 -10.781 1.00 16.22 ? 174  ASN A CA  1 
ATOM   375  C  C   . ASN A 1 61  ? 2.366   14.794 -10.367 1.00 15.22 ? 174  ASN A C   1 
ATOM   376  O  O   . ASN A 1 61  ? 3.392   14.752 -9.692  1.00 15.64 ? 174  ASN A O   1 
ATOM   377  C  CB  . ASN A 1 61  ? 1.084   12.785 -9.556  1.00 16.58 ? 174  ASN A CB  1 
ATOM   378  C  CG  . ASN A 1 61  ? -0.008  13.586 -8.869  1.00 17.75 ? 174  ASN A CG  1 
ATOM   379  O  OD1 . ASN A 1 61  ? 0.258   14.615 -8.227  1.00 17.61 ? 174  ASN A OD1 1 
ATOM   380  N  ND2 . ASN A 1 61  ? -1.246  13.131 -9.019  1.00 16.42 ? 174  ASN A ND2 1 
ATOM   381  N  N   . GLY A 1 62  ? 1.836   15.937 -10.786 1.00 14.80 ? 175  GLY A N   1 
ATOM   382  C  CA  . GLY A 1 62  ? 2.468   17.225 -10.528 1.00 14.47 ? 175  GLY A CA  1 
ATOM   383  C  C   . GLY A 1 62  ? 2.566   17.596 -9.065  1.00 14.95 ? 175  GLY A C   1 
ATOM   384  O  O   . GLY A 1 62  ? 3.431   18.366 -8.689  1.00 15.71 ? 175  GLY A O   1 
ATOM   385  N  N   . ARG A 1 63  ? 1.681   17.052 -8.230  1.00 15.30 ? 176  ARG A N   1 
ATOM   386  C  CA  . ARG A 1 63  ? 1.681   17.357 -6.816  1.00 15.77 ? 176  ARG A CA  1 
ATOM   387  C  C   . ARG A 1 63  ? 2.606   16.443 -6.026  1.00 15.54 ? 176  ARG A C   1 
ATOM   388  O  O   . ARG A 1 63  ? 3.443   16.925 -5.265  1.00 15.39 ? 176  ARG A O   1 
ATOM   389  C  CB  . ARG A 1 63  ? 0.249   17.272 -6.257  1.00 16.55 ? 176  ARG A CB  1 
ATOM   390  C  CG  . ARG A 1 63  ? 0.148   17.675 -4.811  1.00 16.67 ? 176  ARG A CG  1 
ATOM   391  C  CD  . ARG A 1 63  ? 0.246   19.174 -4.666  1.00 17.73 ? 176  ARG A CD  1 
ATOM   392  N  NE  . ARG A 1 63  ? 0.102   19.580 -3.270  1.00 19.05 ? 176  ARG A NE  1 
ATOM   393  C  CZ  . ARG A 1 63  ? -1.040  19.546 -2.592  1.00 20.31 ? 176  ARG A CZ  1 
ATOM   394  N  NH1 . ARG A 1 63  ? -2.163  19.132 -3.157  1.00 19.21 ? 176  ARG A NH1 1 
ATOM   395  N  NH2 . ARG A 1 63  ? -1.040  19.926 -1.328  1.00 22.68 ? 176  ARG A NH2 1 
ATOM   396  N  N   . THR A 1 64  ? 2.458   15.130 -6.225  1.00 16.01 ? 177  THR A N   1 
ATOM   397  C  CA  . THR A 1 64  ? 3.134   14.119 -5.387  1.00 16.70 ? 177  THR A CA  1 
ATOM   398  C  C   . THR A 1 64  ? 4.416   13.580 -5.977  1.00 16.48 ? 177  THR A C   1 
ATOM   399  O  O   . THR A 1 64  ? 5.218   12.973 -5.269  1.00 17.05 ? 177  THR A O   1 
ATOM   400  C  CB  . THR A 1 64  ? 2.217   12.910 -5.118  1.00 17.45 ? 177  THR A CB  1 
ATOM   401  O  OG1 . THR A 1 64  ? 1.819   12.324 -6.363  1.00 16.93 ? 177  THR A OG1 1 
ATOM   402  C  CG2 . THR A 1 64  ? 0.972   13.335 -4.331  1.00 18.89 ? 177  THR A CG2 1 
ATOM   403  N  N   . MET A 1 65  ? 4.590   13.782 -7.279  1.00 16.19 ? 178  MET A N   1 
ATOM   404  C  CA  . MET A 1 65  ? 5.731   13.288 -8.021  1.00 16.42 ? 178  MET A CA  1 
ATOM   405  C  C   . MET A 1 65  ? 5.670   11.791 -8.220  1.00 16.85 ? 178  MET A C   1 
ATOM   406  O  O   . MET A 1 65  ? 6.651   11.200 -8.654  1.00 16.94 ? 178  MET A O   1 
ATOM   407  C  CB  . MET A 1 65  ? 7.073   13.683 -7.366  1.00 16.60 ? 178  MET A CB  1 
ATOM   408  C  CG  . MET A 1 65  ? 7.256   15.174 -7.122  1.00 17.06 ? 178  MET A CG  1 
ATOM   409  S  SD  . MET A 1 65  ? 7.137   16.147 -8.622  1.00 17.03 ? 178  MET A SD  1 
ATOM   410  C  CE  . MET A 1 65  ? 6.659   17.736 -7.991  1.00 17.08 ? 178  MET A CE  1 
ATOM   411  N  N   . GLU A 1 66  ? 4.532   11.167 -7.934  1.00 17.67 ? 179  GLU A N   1 
ATOM   412  C  CA  . GLU A 1 66  ? 4.419   9.728  -8.147  1.00 18.86 ? 179  GLU A CA  1 
ATOM   413  C  C   . GLU A 1 66  ? 4.267   9.427  -9.631  1.00 18.82 ? 179  GLU A C   1 
ATOM   414  O  O   . GLU A 1 66  ? 3.587   10.157 -10.354 1.00 18.28 ? 179  GLU A O   1 
ATOM   415  C  CB  . GLU A 1 66  ? 3.240   9.120  -7.384  1.00 19.83 ? 179  GLU A CB  1 
ATOM   416  C  CG  . GLU A 1 66  ? 3.395   9.111  -5.856  1.00 22.73 ? 179  GLU A CG  1 
ATOM   417  C  CD  . GLU A 1 66  ? 4.619   8.339  -5.386  1.00 25.22 ? 179  GLU A CD  1 
ATOM   418  O  OE1 . GLU A 1 66  ? 5.243   8.793  -4.410  1.00 28.86 ? 179  GLU A OE1 1 
ATOM   419  O  OE2 . GLU A 1 66  ? 4.966   7.291  -5.993  1.00 26.15 ? 179  GLU A OE2 1 
ATOM   420  N  N   . ILE A 1 67  ? 4.875   8.323  -10.060 1.00 19.23 ? 180  ILE A N   1 
ATOM   421  C  CA  . ILE A 1 67  ? 4.795   7.867  -11.444 1.00 19.24 ? 180  ILE A CA  1 
ATOM   422  C  C   . ILE A 1 67  ? 3.409   7.293  -11.681 1.00 19.91 ? 180  ILE A C   1 
ATOM   423  O  O   . ILE A 1 67  ? 2.997   6.384  -10.979 1.00 21.59 ? 180  ILE A O   1 
ATOM   424  C  CB  . ILE A 1 67  ? 5.853   6.756  -11.756 1.00 20.07 ? 180  ILE A CB  1 
ATOM   425  C  CG1 . ILE A 1 67  ? 7.285   7.244  -11.470 1.00 19.74 ? 180  ILE A CG1 1 
ATOM   426  C  CG2 . ILE A 1 67  ? 5.714   6.248  -13.207 1.00 19.28 ? 180  ILE A CG2 1 
ATOM   427  C  CD1 . ILE A 1 67  ? 8.303   6.090  -11.334 1.00 20.34 ? 180  ILE A CD1 1 
ATOM   428  N  N   . GLU A 1 68  ? 2.702   7.831  -12.675 1.00 19.43 ? 181  GLU A N   1 
ATOM   429  C  CA  . GLU A 1 68  ? 1.352   7.424  -12.988 1.00 20.35 ? 181  GLU A CA  1 
ATOM   430  C  C   . GLU A 1 68  ? 1.242   6.732  -14.339 1.00 20.35 ? 181  GLU A C   1 
ATOM   431  O  O   . GLU A 1 68  ? 0.291   6.024  -14.581 1.00 21.05 ? 181  GLU A O   1 
ATOM   432  C  CB  . GLU A 1 68  ? 0.422   8.638  -12.941 1.00 20.38 ? 181  GLU A CB  1 
ATOM   433  C  CG  . GLU A 1 68  ? 0.294   9.183  -11.534 1.00 20.52 ? 181  GLU A CG  1 
ATOM   434  C  CD  . GLU A 1 68  ? -0.868  10.131 -11.349 1.00 21.62 ? 181  GLU A CD  1 
ATOM   435  O  OE1 . GLU A 1 68  ? -1.269  10.314 -10.180 1.00 22.81 ? 181  GLU A OE1 1 
ATOM   436  O  OE2 . GLU A 1 68  ? -1.368  10.692 -12.347 1.00 21.06 ? 181  GLU A OE2 1 
ATOM   437  N  N   . SER A 1 69  ? 2.215   6.933  -15.214 1.00 19.50 ? 182  SER A N   1 
ATOM   438  C  CA  . SER A 1 69  ? 2.212   6.267  -16.504 1.00 20.08 ? 182  SER A CA  1 
ATOM   439  C  C   . SER A 1 69  ? 3.627   6.258  -17.043 1.00 19.21 ? 182  SER A C   1 
ATOM   440  O  O   . SER A 1 69  ? 4.446   7.113  -16.696 1.00 18.32 ? 182  SER A O   1 
ATOM   441  C  CB  . SER A 1 69  ? 1.251   6.982  -17.467 1.00 20.23 ? 182  SER A CB  1 
ATOM   442  O  OG  . SER A 1 69  ? 1.175   6.328  -18.717 1.00 20.63 ? 182  SER A OG  1 
ATOM   443  N  N   . THR A 1 70  ? 3.920   5.274  -17.877 1.00 19.78 ? 183  THR A N   1 
ATOM   444  C  CA  . THR A 1 70  ? 5.273   5.073  -18.376 1.00 19.53 ? 183  THR A CA  1 
ATOM   445  C  C   . THR A 1 70  ? 5.180   4.869  -19.868 1.00 19.88 ? 183  THR A C   1 
ATOM   446  O  O   . THR A 1 70  ? 4.386   4.039  -20.328 1.00 20.13 ? 183  THR A O   1 
ATOM   447  C  CB  . THR A 1 70  ? 5.963   3.820  -17.735 1.00 20.48 ? 183  THR A CB  1 
ATOM   448  O  OG1 . THR A 1 70  ? 6.128   4.023  -16.327 1.00 20.78 ? 183  THR A OG1 1 
ATOM   449  C  CG2 . THR A 1 70  ? 7.348   3.565  -18.369 1.00 19.71 ? 183  THR A CG2 1 
ATOM   450  N  N   . PHE A 1 71  ? 5.943   5.669  -20.613 1.00 18.29 ? 184  PHE A N   1 
ATOM   451  C  CA  . PHE A 1 71  ? 6.201   5.383  -22.011 1.00 18.87 ? 184  PHE A CA  1 
ATOM   452  C  C   . PHE A 1 71  ? 7.639   4.878  -22.078 1.00 18.69 ? 184  PHE A C   1 
ATOM   453  O  O   . PHE A 1 71  ? 8.527   5.512  -21.526 1.00 17.08 ? 184  PHE A O   1 
ATOM   454  C  CB  . PHE A 1 71  ? 6.028   6.647  -22.865 1.00 17.99 ? 184  PHE A CB  1 
ATOM   455  C  CG  . PHE A 1 71  ? 6.282   6.429  -24.343 1.00 17.95 ? 184  PHE A CG  1 
ATOM   456  C  CD1 . PHE A 1 71  ? 5.238   6.145  -25.206 1.00 19.62 ? 184  PHE A CD1 1 
ATOM   457  C  CD2 . PHE A 1 71  ? 7.559   6.504  -24.854 1.00 15.63 ? 184  PHE A CD2 1 
ATOM   458  C  CE1 . PHE A 1 71  ? 5.480   5.944  -26.572 1.00 19.61 ? 184  PHE A CE1 1 
ATOM   459  C  CE2 . PHE A 1 71  ? 7.810   6.306  -26.191 1.00 17.66 ? 184  PHE A CE2 1 
ATOM   460  C  CZ  . PHE A 1 71  ? 6.775   6.017  -27.057 1.00 19.19 ? 184  PHE A CZ  1 
ATOM   461  N  N   . HIS A 1 72  ? 7.859   3.732  -22.723 1.00 19.90 ? 185  HIS A N   1 
ATOM   462  C  CA  . HIS A 1 72  ? 9.210   3.222  -22.926 1.00 20.28 ? 185  HIS A CA  1 
ATOM   463  C  C   . HIS A 1 72  ? 9.335   2.436  -24.231 1.00 21.42 ? 185  HIS A C   1 
ATOM   464  O  O   . HIS A 1 72  ? 8.722   1.380  -24.395 1.00 21.99 ? 185  HIS A O   1 
ATOM   465  C  CB  . HIS A 1 72  ? 9.655   2.331  -21.751 1.00 21.34 ? 185  HIS A CB  1 
ATOM   466  C  CG  . HIS A 1 72  ? 11.132  2.046  -21.735 1.00 21.26 ? 185  HIS A CG  1 
ATOM   467  N  ND1 . HIS A 1 72  ? 11.656  0.821  -21.390 1.00 25.45 ? 185  HIS A ND1 1 
ATOM   468  C  CD2 . HIS A 1 72  ? 12.194  2.834  -22.025 1.00 20.80 ? 185  HIS A CD2 1 
ATOM   469  C  CE1 . HIS A 1 72  ? 12.974  0.863  -21.475 1.00 24.25 ? 185  HIS A CE1 1 
ATOM   470  N  NE2 . HIS A 1 72  ? 13.326  2.077  -21.855 1.00 21.17 ? 185  HIS A NE2 1 
ATOM   471  N  N   . MET A 1 73  ? 10.150  2.953  -25.143 1.00 20.55 ? 186  MET A N   1 
ATOM   472  C  CA  . MET A 1 73  ? 10.487  2.235  -26.352 1.00 22.01 ? 186  MET A CA  1 
ATOM   473  C  C   . MET A 1 73  ? 11.984  2.273  -26.624 1.00 20.84 ? 186  MET A C   1 
ATOM   474  O  O   . MET A 1 73  ? 12.614  3.298  -26.441 1.00 18.87 ? 186  MET A O   1 
ATOM   475  C  CB  . MET A 1 73  ? 9.747   2.843  -27.550 1.00 22.07 ? 186  MET A CB  1 
ATOM   476  C  CG  . MET A 1 73  ? 8.228   2.697  -27.455 1.00 24.28 ? 186  MET A CG  1 
ATOM   477  S  SD  . MET A 1 73  ? 7.382   3.008  -29.032 1.00 25.22 ? 186  MET A SD  1 
ATOM   478  C  CE  . MET A 1 73  ? 7.892   1.593  -29.985 1.00 29.42 ? 186  MET A CE  1 
ATOM   479  N  N   . TYR A 1 74  ? 12.536  1.139  -27.044 1.00 21.68 ? 187  TYR A N   1 
ATOM   480  C  CA  . TYR A 1 74  ? 13.829  1.123  -27.712 1.00 22.22 ? 187  TYR A CA  1 
ATOM   481  C  C   . TYR A 1 74  ? 13.562  1.429  -29.178 1.00 21.85 ? 187  TYR A C   1 
ATOM   482  O  O   . TYR A 1 74  ? 12.478  1.143  -29.696 1.00 21.03 ? 187  TYR A O   1 
ATOM   483  C  CB  . TYR A 1 74  ? 14.568  -0.206 -27.523 1.00 24.34 ? 187  TYR A CB  1 
ATOM   484  C  CG  . TYR A 1 74  ? 14.931  -0.470 -26.074 1.00 25.36 ? 187  TYR A CG  1 
ATOM   485  C  CD1 . TYR A 1 74  ? 15.918  0.274  -25.445 1.00 25.48 ? 187  TYR A CD1 1 
ATOM   486  C  CD2 . TYR A 1 74  ? 14.279  -1.451 -25.331 1.00 27.82 ? 187  TYR A CD2 1 
ATOM   487  C  CE1 . TYR A 1 74  ? 16.257  0.054  -24.124 1.00 25.56 ? 187  TYR A CE1 1 
ATOM   488  C  CE2 . TYR A 1 74  ? 14.612  -1.683 -23.992 1.00 27.24 ? 187  TYR A CE2 1 
ATOM   489  C  CZ  . TYR A 1 74  ? 15.603  -0.917 -23.398 1.00 26.93 ? 187  TYR A CZ  1 
ATOM   490  O  OH  . TYR A 1 74  ? 15.960  -1.115 -22.073 1.00 27.43 ? 187  TYR A OH  1 
ATOM   491  N  N   . VAL A 1 75  ? 14.550  2.052  -29.811 1.00 21.20 ? 188  VAL A N   1 
ATOM   492  C  CA  . VAL A 1 75  ? 14.418  2.626  -31.142 1.00 21.44 ? 188  VAL A CA  1 
ATOM   493  C  C   . VAL A 1 75  ? 15.512  2.030  -32.009 1.00 22.42 ? 188  VAL A C   1 
ATOM   494  O  O   . VAL A 1 75  ? 16.655  1.905  -31.556 1.00 22.22 ? 188  VAL A O   1 
ATOM   495  C  CB  . VAL A 1 75  ? 14.603  4.177  -31.123 1.00 19.88 ? 188  VAL A CB  1 
ATOM   496  C  CG1 . VAL A 1 75  ? 14.390  4.782  -32.529 1.00 19.68 ? 188  VAL A CG1 1 
ATOM   497  C  CG2 . VAL A 1 75  ? 13.721  4.852  -30.067 1.00 17.57 ? 188  VAL A CG2 1 
ATOM   498  N  N   . GLN A 1 76  ? 15.166  1.656  -33.240 1.00 24.03 ? 189  GLN A N   1 
ATOM   499  C  CA  . GLN A 1 76  ? 16.156  1.094  -34.187 1.00 25.76 ? 189  GLN A CA  1 
ATOM   500  C  C   . GLN A 1 76  ? 16.908  2.206  -34.907 1.00 25.30 ? 189  GLN A C   1 
ATOM   501  O  O   . GLN A 1 76  ? 16.320  2.952  -35.703 1.00 24.78 ? 189  GLN A O   1 
ATOM   502  C  CB  . GLN A 1 76  ? 15.514  0.142  -35.214 1.00 27.07 ? 189  GLN A CB  1 
ATOM   503  C  CG  . GLN A 1 76  ? 16.526  -0.517 -36.144 1.00 28.25 ? 189  GLN A CG  1 
ATOM   504  C  CD  . GLN A 1 76  ? 15.880  -1.304 -37.256 1.00 30.88 ? 189  GLN A CD  1 
ATOM   505  O  OE1 . GLN A 1 76  ? 14.788  -1.861 -37.105 1.00 34.47 ? 189  GLN A OE1 1 
ATOM   506  N  NE2 . GLN A 1 76  ? 16.562  -1.377 -38.381 1.00 33.18 ? 189  GLN A NE2 1 
ATOM   507  N  N   . PRO A 1 77  ? 18.220  2.310  -34.646 1.00 26.10 ? 190  PRO A N   1 
ATOM   508  C  CA  . PRO A 1 77  ? 19.022  3.290  -35.365 1.00 26.13 ? 190  PRO A CA  1 
ATOM   509  C  C   . PRO A 1 77  ? 19.330  2.804  -36.781 1.00 28.10 ? 190  PRO A C   1 
ATOM   510  O  O   . PRO A 1 77  ? 19.497  1.605  -36.996 1.00 29.22 ? 190  PRO A O   1 
ATOM   511  C  CB  . PRO A 1 77  ? 20.293  3.382  -34.518 1.00 25.69 ? 190  PRO A CB  1 
ATOM   512  C  CG  . PRO A 1 77  ? 20.429  2.013  -33.896 1.00 26.68 ? 190  PRO A CG  1 
ATOM   513  C  CD  . PRO A 1 77  ? 19.030  1.504  -33.701 1.00 26.53 ? 190  PRO A CD  1 
ATOM   514  N  N   . VAL A 1 78  ? 19.433  3.735  -37.729 1.00 29.08 ? 191  VAL A N   1 
ATOM   515  C  CA  . VAL A 1 78  ? 19.544  3.413  -39.167 1.00 30.75 ? 191  VAL A CA  1 
ATOM   516  C  C   . VAL A 1 78  ? 20.908  3.746  -39.804 1.00 31.91 ? 191  VAL A C   1 
ATOM   517  O  O   . VAL A 1 78  ? 21.451  2.949  -40.564 1.00 32.99 ? 191  VAL A O   1 
ATOM   518  C  CB  . VAL A 1 78  ? 18.439  4.147  -39.936 1.00 30.93 ? 191  VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 78  ? 18.700  4.121  -41.467 1.00 32.68 ? 191  VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 78  ? 17.072  3.536  -39.563 1.00 31.36 ? 191  VAL A CG2 1 
ATOM   521  N  N   . VAL A 1 79  ? 21.457  4.920  -39.495 1.00 31.56 ? 192  VAL A N   1 
ATOM   522  C  CA  . VAL A 1 79  ? 22.747  5.321  -40.055 1.00 32.51 ? 192  VAL A CA  1 
ATOM   523  C  C   . VAL A 1 79  ? 23.892  4.453  -39.530 1.00 33.75 ? 192  VAL A C   1 
ATOM   524  O  O   . VAL A 1 79  ? 24.723  4.004  -40.317 1.00 34.97 ? 192  VAL A O   1 
ATOM   525  C  CB  . VAL A 1 79  ? 23.056  6.824  -39.789 1.00 31.78 ? 192  VAL A CB  1 
ATOM   526  C  CG1 . VAL A 1 79  ? 24.326  7.268  -40.541 1.00 31.96 ? 192  VAL A CG1 1 
ATOM   527  C  CG2 . VAL A 1 79  ? 21.874  7.675  -40.202 1.00 31.58 ? 192  VAL A CG2 1 
ATOM   528  N  N   . HIS A 1 80  ? 23.949  4.247  -38.209 1.00 33.37 ? 193  HIS A N   1 
ATOM   529  C  CA  . HIS A 1 80  ? 24.900  3.304  -37.590 1.00 34.78 ? 193  HIS A CA  1 
ATOM   530  C  C   . HIS A 1 80  ? 24.098  2.264  -36.802 1.00 34.86 ? 193  HIS A C   1 
ATOM   531  O  O   . HIS A 1 80  ? 23.954  2.376  -35.570 1.00 33.66 ? 193  HIS A O   1 
ATOM   532  C  CB  . HIS A 1 80  ? 25.877  4.004  -36.637 1.00 34.93 ? 193  HIS A CB  1 
ATOM   533  C  CG  . HIS A 1 80  ? 26.731  5.055  -37.278 1.00 36.17 ? 193  HIS A CG  1 
ATOM   534  N  ND1 . HIS A 1 80  ? 27.898  4.759  -37.950 1.00 38.24 ? 193  HIS A ND1 1 
ATOM   535  C  CD2 . HIS A 1 80  ? 26.613  6.404  -37.306 1.00 35.14 ? 193  HIS A CD2 1 
ATOM   536  C  CE1 . HIS A 1 80  ? 28.445  5.878  -38.392 1.00 38.75 ? 193  HIS A CE1 1 
ATOM   537  N  NE2 . HIS A 1 80  ? 27.685  6.890  -38.016 1.00 36.97 ? 193  HIS A NE2 1 
ATOM   538  N  N   . PRO A 1 81  ? 23.593  1.233  -37.500 1.00 36.07 ? 194  PRO A N   1 
ATOM   539  C  CA  . PRO A 1 81  ? 22.611  0.327  -36.911 1.00 36.05 ? 194  PRO A CA  1 
ATOM   540  C  C   . PRO A 1 81  ? 23.211  -0.664 -35.913 1.00 37.16 ? 194  PRO A C   1 
ATOM   541  O  O   . PRO A 1 81  ? 22.491  -1.190 -35.050 1.00 37.31 ? 194  PRO A O   1 
ATOM   542  C  CB  . PRO A 1 81  ? 22.036  -0.402 -38.123 1.00 37.10 ? 194  PRO A CB  1 
ATOM   543  C  CG  . PRO A 1 81  ? 23.141  -0.397 -39.130 1.00 38.65 ? 194  PRO A CG  1 
ATOM   544  C  CD  . PRO A 1 81  ? 23.976  0.827  -38.869 1.00 37.70 ? 194  PRO A CD  1 
ATOM   545  N  N   . GLN A 1 82  ? 24.514  -0.897 -36.007 1.00 37.77 ? 195  GLN A N   1 
ATOM   546  C  CA  . GLN A 1 82  ? 25.177  -1.826 -35.119 1.00 39.35 ? 195  GLN A CA  1 
ATOM   547  C  C   . GLN A 1 82  ? 25.748  -1.079 -33.935 1.00 38.54 ? 195  GLN A C   1 
ATOM   548  O  O   . GLN A 1 82  ? 26.670  -0.275 -34.084 1.00 38.44 ? 195  GLN A O   1 
ATOM   549  C  CB  . GLN A 1 82  ? 26.253  -2.623 -35.873 1.00 41.61 ? 195  GLN A CB  1 
ATOM   550  C  CG  . GLN A 1 82  ? 25.655  -3.509 -36.970 1.00 43.73 ? 195  GLN A CG  1 
ATOM   551  C  CD  . GLN A 1 82  ? 24.745  -4.622 -36.422 1.00 46.56 ? 195  GLN A CD  1 
ATOM   552  O  OE1 . GLN A 1 82  ? 23.622  -4.823 -36.903 1.00 46.14 ? 195  GLN A OE1 1 
ATOM   553  N  NE2 . GLN A 1 82  ? 25.236  -5.351 -35.417 1.00 48.38 ? 195  GLN A NE2 1 
ATOM   554  N  N   . LEU A 1 83  ? 25.168  -1.323 -32.759 1.00 37.79 ? 196  LEU A N   1 
ATOM   555  C  CA  . LEU A 1 83  ? 25.591  -0.640 -31.545 1.00 36.96 ? 196  LEU A CA  1 
ATOM   556  C  C   . LEU A 1 83  ? 27.035  -1.012 -31.267 1.00 38.94 ? 196  LEU A C   1 
ATOM   557  O  O   . LEU A 1 83  ? 27.428  -2.172 -31.424 1.00 40.80 ? 196  LEU A O   1 
ATOM   558  C  CB  . LEU A 1 83  ? 24.714  -1.021 -30.348 1.00 36.08 ? 196  LEU A CB  1 
ATOM   559  C  CG  . LEU A 1 83  ? 23.193  -0.861 -30.469 1.00 34.02 ? 196  LEU A CG  1 
ATOM   560  C  CD1 . LEU A 1 83  ? 22.546  -1.114 -29.129 1.00 33.74 ? 196  LEU A CD1 1 
ATOM   561  C  CD2 . LEU A 1 83  ? 22.809  0.498  -30.986 1.00 31.22 ? 196  LEU A CD2 1 
ATOM   562  N  N   . THR A 1 84  ? 27.824  -0.029 -30.858 1.00 38.58 ? 197  THR A N   1 
ATOM   563  C  CA  . THR A 1 84  ? 29.229  -0.253 -30.610 1.00 40.27 ? 197  THR A CA  1 
ATOM   564  C  C   . THR A 1 84  ? 29.438  -0.854 -29.221 1.00 41.24 ? 197  THR A C   1 
ATOM   565  O  O   . THR A 1 84  ? 28.617  -0.647 -28.327 1.00 40.09 ? 197  THR A O   1 
ATOM   566  C  CB  . THR A 1 84  ? 30.028  1.051  -30.712 1.00 39.76 ? 197  THR A CB  1 
ATOM   567  O  OG1 . THR A 1 84  ? 29.639  1.938  -29.655 1.00 38.55 ? 197  THR A OG1 1 
ATOM   568  C  CG2 . THR A 1 84  ? 29.798  1.707  -32.070 1.00 38.94 ? 197  THR A CG2 1 
ATOM   569  N  N   . PRO A 1 85  ? 30.527  -1.618 -29.045 1.00 43.45 ? 198  PRO A N   1 
ATOM   570  C  CA  . PRO A 1 85  ? 30.986  -2.115 -27.741 1.00 44.77 ? 198  PRO A CA  1 
ATOM   571  C  C   . PRO A 1 85  ? 30.971  -1.050 -26.661 1.00 43.56 ? 198  PRO A C   1 
ATOM   572  O  O   . PRO A 1 85  ? 30.544  -1.311 -25.536 1.00 43.88 ? 198  PRO A O   1 
ATOM   573  C  CB  . PRO A 1 85  ? 32.433  -2.555 -28.014 1.00 47.32 ? 198  PRO A CB  1 
ATOM   574  C  CG  . PRO A 1 85  ? 32.509  -2.794 -29.472 1.00 47.64 ? 198  PRO A CG  1 
ATOM   575  C  CD  . PRO A 1 85  ? 31.355  -2.120 -30.154 1.00 45.28 ? 198  PRO A CD  1 
ATOM   576  N  N   . PHE A 1 86  ? 31.452  0.141  -27.002 1.00 42.72 ? 199  PHE A N   1 
ATOM   577  C  CA  . PHE A 1 86  ? 31.375  1.280  -26.101 1.00 41.32 ? 199  PHE A CA  1 
ATOM   578  C  C   . PHE A 1 86  ? 29.909  1.589  -25.742 1.00 38.77 ? 199  PHE A C   1 
ATOM   579  O  O   . PHE A 1 86  ? 29.583  1.837  -24.577 1.00 38.50 ? 199  PHE A O   1 
ATOM   580  C  CB  . PHE A 1 86  ? 32.034  2.512  -26.746 1.00 41.14 ? 199  PHE A CB  1 
ATOM   581  C  CG  . PHE A 1 86  ? 31.898  3.750  -25.926 1.00 39.98 ? 199  PHE A CG  1 
ATOM   582  C  CD1 . PHE A 1 86  ? 32.806  4.031  -24.928 1.00 41.71 ? 199  PHE A CD1 1 
ATOM   583  C  CD2 . PHE A 1 86  ? 30.834  4.613  -26.121 1.00 38.24 ? 199  PHE A CD2 1 
ATOM   584  C  CE1 . PHE A 1 86  ? 32.670  5.158  -24.150 1.00 40.44 ? 199  PHE A CE1 1 
ATOM   585  C  CE2 . PHE A 1 86  ? 30.690  5.737  -25.346 1.00 37.38 ? 199  PHE A CE2 1 
ATOM   586  C  CZ  . PHE A 1 86  ? 31.617  6.010  -24.359 1.00 38.86 ? 199  PHE A CZ  1 
ATOM   587  N  N   . CYS A 1 87  ? 29.045  1.597  -26.756 1.00 37.30 ? 200  CYS A N   1 
ATOM   588  C  CA  . CYS A 1 87  ? 27.626  1.945  -26.576 1.00 35.49 ? 200  CYS A CA  1 
ATOM   589  C  C   . CYS A 1 87  ? 26.914  0.931  -25.699 1.00 35.29 ? 200  CYS A C   1 
ATOM   590  O  O   . CYS A 1 87  ? 26.228  1.301  -24.750 1.00 33.92 ? 200  CYS A O   1 
ATOM   591  C  CB  . CYS A 1 87  ? 26.911  2.033  -27.928 1.00 34.54 ? 200  CYS A CB  1 
ATOM   592  S  SG  . CYS A 1 87  ? 25.134  2.328  -27.781 1.00 31.80 ? 200  CYS A SG  1 
ATOM   593  N  N   . THR A 1 88  ? 27.096  -0.346 -26.025 1.00 37.08 ? 201  THR A N   1 
ATOM   594  C  CA  . THR A 1 88  ? 26.506  -1.444 -25.245 1.00 37.95 ? 201  THR A CA  1 
ATOM   595  C  C   . THR A 1 88  ? 27.000  -1.479 -23.807 1.00 38.91 ? 201  THR A C   1 
ATOM   596  O  O   . THR A 1 88  ? 26.189  -1.490 -22.873 1.00 38.37 ? 201  THR A O   1 
ATOM   597  C  CB  . THR A 1 88  ? 26.770  -2.788 -25.902 1.00 39.33 ? 201  THR A CB  1 
ATOM   598  O  OG1 . THR A 1 88  ? 25.998  -2.867 -27.102 1.00 37.36 ? 201  THR A OG1 1 
ATOM   599  C  CG2 . THR A 1 88  ? 26.377  -3.928 -24.969 1.00 40.96 ? 201  THR A CG2 1 
ATOM   600  N  N   . GLU A 1 89  ? 28.321  -1.467 -23.642 1.00 40.99 ? 202  GLU A N   1 
ATOM   601  C  CA  . GLU A 1 89  ? 28.962  -1.501 -22.317 1.00 42.44 ? 202  GLU A CA  1 
ATOM   602  C  C   . GLU A 1 89  ? 28.592  -0.295 -21.462 1.00 40.68 ? 202  GLU A C   1 
ATOM   603  O  O   . GLU A 1 89  ? 28.495  -0.405 -20.233 1.00 41.19 ? 202  GLU A O   1 
ATOM   604  C  CB  . GLU A 1 89  ? 30.495  -1.623 -22.443 1.00 44.88 ? 202  GLU A CB  1 
ATOM   605  C  CG  . GLU A 1 89  ? 30.971  -3.048 -22.830 1.00 48.69 ? 202  GLU A CG  1 
ATOM   606  C  CD  . GLU A 1 89  ? 32.501  -3.202 -22.912 1.00 51.43 ? 202  GLU A CD  1 
ATOM   607  O  OE1 . GLU A 1 89  ? 33.075  -3.973 -22.102 1.00 54.86 ? 202  GLU A OE1 1 
ATOM   608  O  OE2 . GLU A 1 89  ? 33.128  -2.570 -23.801 1.00 55.20 ? 202  GLU A OE2 1 
ATOM   609  N  N   . LEU A 1 90  ? 28.369  0.849  -22.106 1.00 38.92 ? 203  LEU A N   1 
ATOM   610  C  CA  . LEU A 1 90  ? 27.928  2.048  -21.397 1.00 37.13 ? 203  LEU A CA  1 
ATOM   611  C  C   . LEU A 1 90  ? 26.452  1.991  -21.048 1.00 35.33 ? 203  LEU A C   1 
ATOM   612  O  O   . LEU A 1 90  ? 26.063  2.301  -19.923 1.00 36.12 ? 203  LEU A O   1 
ATOM   613  C  CB  . LEU A 1 90  ? 28.167  3.307  -22.247 1.00 36.43 ? 203  LEU A CB  1 
ATOM   614  C  CG  . LEU A 1 90  ? 27.708  4.636  -21.620 1.00 34.79 ? 203  LEU A CG  1 
ATOM   615  C  CD1 . LEU A 1 90  ? 28.645  4.980  -20.481 1.00 37.90 ? 203  LEU A CD1 1 
ATOM   616  C  CD2 . LEU A 1 90  ? 27.656  5.759  -22.644 1.00 33.24 ? 203  LEU A CD2 1 
ATOM   617  N  N   . THR A 1 91  ? 25.610  1.662  -22.021 1.00 33.95 ? 204  THR A N   1 
ATOM   618  C  CA  . THR A 1 91  ? 24.155  1.816  -21.834 1.00 31.48 ? 204  THR A CA  1 
ATOM   619  C  C   . THR A 1 91  ? 23.473  0.555  -21.289 1.00 31.62 ? 204  THR A C   1 
ATOM   620  O  O   . THR A 1 91  ? 22.405  0.636  -20.697 1.00 31.54 ? 204  THR A O   1 
ATOM   621  C  CB  . THR A 1 91  ? 23.469  2.230  -23.148 1.00 30.00 ? 204  THR A CB  1 
ATOM   622  O  OG1 . THR A 1 91  ? 23.642  1.205  -24.125 1.00 31.14 ? 204  THR A OG1 1 
ATOM   623  C  CG2 . THR A 1 91  ? 24.075  3.511  -23.673 1.00 28.86 ? 204  THR A CG2 1 
ATOM   624  N  N   . GLY A 1 92  ? 24.092  -0.599 -21.499 1.00 32.84 ? 205  GLY A N   1 
ATOM   625  C  CA  . GLY A 1 92  ? 23.454  -1.893 -21.215 1.00 32.94 ? 205  GLY A CA  1 
ATOM   626  C  C   . GLY A 1 92  ? 22.615  -2.396 -22.381 1.00 31.72 ? 205  GLY A C   1 
ATOM   627  O  O   . GLY A 1 92  ? 22.138  -3.515 -22.367 1.00 32.04 ? 205  GLY A O   1 
ATOM   628  N  N   . ILE A 1 93  ? 22.438  -1.563 -23.403 1.00 29.44 ? 206  ILE A N   1 
ATOM   629  C  CA  . ILE A 1 93  ? 21.573  -1.900 -24.512 1.00 28.57 ? 206  ILE A CA  1 
ATOM   630  C  C   . ILE A 1 93  ? 22.328  -2.759 -25.507 1.00 29.64 ? 206  ILE A C   1 
ATOM   631  O  O   . ILE A 1 93  ? 23.256  -2.289 -26.150 1.00 30.05 ? 206  ILE A O   1 
ATOM   632  C  CB  . ILE A 1 93  ? 21.041  -0.633 -25.194 1.00 26.72 ? 206  ILE A CB  1 
ATOM   633  C  CG1 . ILE A 1 93  ? 20.204  0.178  -24.183 1.00 25.03 ? 206  ILE A CG1 1 
ATOM   634  C  CG2 . ILE A 1 93  ? 20.254  -1.000 -26.454 1.00 26.66 ? 206  ILE A CG2 1 
ATOM   635  C  CD1 . ILE A 1 93  ? 19.885  1.619  -24.615 1.00 22.58 ? 206  ILE A CD1 1 
ATOM   636  N  N   . ILE A 1 94  ? 21.934  -4.025 -25.615 1.00 30.62 ? 207  ILE A N   1 
ATOM   637  C  CA  . ILE A 1 94  ? 22.500  -4.945 -26.605 1.00 31.77 ? 207  ILE A CA  1 
ATOM   638  C  C   . ILE A 1 94  ? 21.760  -4.844 -27.940 1.00 30.87 ? 207  ILE A C   1 
ATOM   639  O  O   . ILE A 1 94  ? 20.645  -4.312 -28.019 1.00 28.53 ? 207  ILE A O   1 
ATOM   640  C  CB  . ILE A 1 94  ? 22.493  -6.418 -26.121 1.00 33.84 ? 207  ILE A CB  1 
ATOM   641  C  CG1 . ILE A 1 94  ? 21.060  -6.933 -25.887 1.00 33.14 ? 207  ILE A CG1 1 
ATOM   642  C  CG2 . ILE A 1 94  ? 23.373  -6.568 -24.884 1.00 35.22 ? 207  ILE A CG2 1 
ATOM   643  C  CD1 . ILE A 1 94  ? 20.988  -8.368 -25.346 1.00 35.39 ? 207  ILE A CD1 1 
ATOM   644  N  N   . GLN A 1 95  ? 22.395  -5.357 -28.987 1.00 32.11 ? 208  GLN A N   1 
ATOM   645  C  CA  . GLN A 1 95  ? 21.845  -5.290 -30.335 1.00 32.25 ? 208  GLN A CA  1 
ATOM   646  C  C   . GLN A 1 95  ? 20.437  -5.880 -30.418 1.00 32.65 ? 208  GLN A C   1 
ATOM   647  O  O   . GLN A 1 95  ? 19.551  -5.302 -31.044 1.00 31.78 ? 208  GLN A O   1 
ATOM   648  C  CB  . GLN A 1 95  ? 22.768  -6.006 -31.321 1.00 33.98 ? 208  GLN A CB  1 
ATOM   649  C  CG  . GLN A 1 95  ? 22.389  -5.803 -32.797 1.00 33.88 ? 208  GLN A CG  1 
ATOM   650  C  CD  . GLN A 1 95  ? 22.504  -4.351 -33.260 1.00 31.36 ? 208  GLN A CD  1 
ATOM   651  O  OE1 . GLN A 1 95  ? 23.474  -3.668 -32.948 1.00 31.02 ? 208  GLN A OE1 1 
ATOM   652  N  NE2 . GLN A 1 95  ? 21.517  -3.884 -34.013 1.00 29.61 ? 208  GLN A NE2 1 
ATOM   653  N  N   . ALA A 1 96  ? 20.244  -7.036 -29.792 1.00 34.63 ? 209  ALA A N   1 
ATOM   654  C  CA  . ALA A 1 96  ? 18.934  -7.693 -29.725 1.00 35.31 ? 209  ALA A CA  1 
ATOM   655  C  C   . ALA A 1 96  ? 17.820  -6.771 -29.225 1.00 33.45 ? 209  ALA A C   1 
ATOM   656  O  O   . ALA A 1 96  ? 16.654  -6.990 -29.556 1.00 33.56 ? 209  ALA A O   1 
ATOM   657  C  CB  . ALA A 1 96  ? 19.010  -8.922 -28.832 1.00 36.90 ? 209  ALA A CB  1 
ATOM   658  N  N   . MET A 1 97  ? 18.169  -5.779 -28.405 1.00 32.05 ? 210  MET A N   1 
ATOM   659  C  CA  . MET A 1 97  ? 17.166  -4.855 -27.845 1.00 31.10 ? 210  MET A CA  1 
ATOM   660  C  C   . MET A 1 97  ? 16.694  -3.781 -28.829 1.00 30.03 ? 210  MET A C   1 
ATOM   661  O  O   . MET A 1 97  ? 15.594  -3.261 -28.677 1.00 29.12 ? 210  MET A O   1 
ATOM   662  C  CB  . MET A 1 97  ? 17.680  -4.202 -26.566 1.00 29.78 ? 210  MET A CB  1 
ATOM   663  C  CG  . MET A 1 97  ? 17.731  -5.182 -25.402 1.00 31.89 ? 210  MET A CG  1 
ATOM   664  S  SD  . MET A 1 97  ? 18.755  -4.632 -24.034 1.00 31.77 ? 210  MET A SD  1 
ATOM   665  C  CE  . MET A 1 97  ? 18.058  -3.048 -23.691 1.00 27.30 ? 210  MET A CE  1 
ATOM   666  N  N   . VAL A 1 98  ? 17.514  -3.441 -29.826 1.00 30.72 ? 211  VAL A N   1 
ATOM   667  C  CA  . VAL A 1 98  ? 17.108  -2.439 -30.832 1.00 30.25 ? 211  VAL A CA  1 
ATOM   668  C  C   . VAL A 1 98  ? 16.703  -3.033 -32.185 1.00 31.92 ? 211  VAL A C   1 
ATOM   669  O  O   . VAL A 1 98  ? 16.167  -2.324 -33.014 1.00 31.75 ? 211  VAL A O   1 
ATOM   670  C  CB  . VAL A 1 98  ? 18.193  -1.347 -31.035 1.00 29.56 ? 211  VAL A CB  1 
ATOM   671  C  CG1 . VAL A 1 98  ? 18.377  -0.536 -29.747 1.00 27.27 ? 211  VAL A CG1 1 
ATOM   672  C  CG2 . VAL A 1 98  ? 19.516  -1.958 -31.502 1.00 29.95 ? 211  VAL A CG2 1 
ATOM   673  N  N   . ASP A 1 99  ? 16.906  -4.339 -32.383 1.00 35.06 ? 212  ASP A N   1 
ATOM   674  C  CA  . ASP A 1 99  ? 16.848  -4.950 -33.724 1.00 36.66 ? 212  ASP A CA  1 
ATOM   675  C  C   . ASP A 1 99  ? 15.508  -4.901 -34.474 1.00 37.53 ? 212  ASP A C   1 
ATOM   676  O  O   . ASP A 1 99  ? 15.471  -4.502 -35.625 1.00 38.79 ? 212  ASP A O   1 
ATOM   677  C  CB  . ASP A 1 99  ? 17.398  -6.388 -33.704 1.00 38.98 ? 212  ASP A CB  1 
ATOM   678  C  CG  . ASP A 1 99  ? 18.868  -6.458 -34.098 1.00 38.62 ? 212  ASP A CG  1 
ATOM   679  O  OD1 . ASP A 1 99  ? 19.428  -5.446 -34.566 1.00 36.14 ? 212  ASP A OD1 1 
ATOM   680  O  OD2 . ASP A 1 99  ? 19.469  -7.532 -33.954 1.00 41.74 ? 212  ASP A OD2 1 
ATOM   681  N  N   . GLY A 1 100 ? 14.408  -5.318 -33.874 1.00 38.43 ? 213  GLY A N   1 
ATOM   682  C  CA  . GLY A 1 100 ? 13.162  -5.294 -34.644 1.00 38.68 ? 213  GLY A CA  1 
ATOM   683  C  C   . GLY A 1 100 ? 12.370  -4.016 -34.476 1.00 37.13 ? 213  GLY A C   1 
ATOM   684  O  O   . GLY A 1 100 ? 11.206  -3.948 -34.870 1.00 37.89 ? 213  GLY A O   1 
ATOM   685  N  N   . GLN A 1 101 ? 12.992  -3.000 -33.886 1.00 35.21 ? 214  GLN A N   1 
ATOM   686  C  CA  . GLN A 1 101 ? 12.242  -1.923 -33.251 1.00 33.31 ? 214  GLN A CA  1 
ATOM   687  C  C   . GLN A 1 101 ? 11.875  -0.849 -34.261 1.00 32.23 ? 214  GLN A C   1 
ATOM   688  O  O   . GLN A 1 101 ? 12.505  -0.744 -35.305 1.00 32.49 ? 214  GLN A O   1 
ATOM   689  C  CB  . GLN A 1 101 ? 13.060  -1.317 -32.107 1.00 32.29 ? 214  GLN A CB  1 
ATOM   690  C  CG  . GLN A 1 101 ? 13.455  -2.323 -31.029 1.00 34.00 ? 214  GLN A CG  1 
ATOM   691  C  CD  . GLN A 1 101 ? 12.266  -2.890 -30.298 1.00 36.18 ? 214  GLN A CD  1 
ATOM   692  O  OE1 . GLN A 1 101 ? 11.198  -2.279 -30.247 1.00 35.89 ? 214  GLN A OE1 1 
ATOM   693  N  NE2 . GLN A 1 101 ? 12.440  -4.066 -29.724 1.00 40.36 ? 214  GLN A NE2 1 
ATOM   694  N  N   . PRO A 1 102 ? 10.833  -0.063 -33.955 1.00 31.08 ? 215  PRO A N   1 
ATOM   695  C  CA  . PRO A 1 102 ? 10.488  1.049  -34.828 1.00 30.25 ? 215  PRO A CA  1 
ATOM   696  C  C   . PRO A 1 102 ? 11.568  2.140  -34.889 1.00 28.61 ? 215  PRO A C   1 
ATOM   697  O  O   . PRO A 1 102 ? 12.444  2.226  -34.022 1.00 28.04 ? 215  PRO A O   1 
ATOM   698  C  CB  . PRO A 1 102 ? 9.176   1.579  -34.234 1.00 29.93 ? 215  PRO A CB  1 
ATOM   699  C  CG  . PRO A 1 102 ? 9.104   1.038  -32.869 1.00 30.14 ? 215  PRO A CG  1 
ATOM   700  C  CD  . PRO A 1 102 ? 9.907   -0.201 -32.815 1.00 30.89 ? 215  PRO A CD  1 
ATOM   701  N  N   . SER A 1 103 ? 11.493  2.943  -35.941 1.00 27.91 ? 216  SER A N   1 
ATOM   702  C  CA  . SER A 1 103 ? 12.404  4.045  -36.180 1.00 26.29 ? 216  SER A CA  1 
ATOM   703  C  C   . SER A 1 103 ? 12.003  5.191  -35.286 1.00 24.33 ? 216  SER A C   1 
ATOM   704  O  O   . SER A 1 103 ? 10.926  5.166  -34.712 1.00 23.78 ? 216  SER A O   1 
ATOM   705  C  CB  . SER A 1 103 ? 12.269  4.492  -37.636 1.00 27.30 ? 216  SER A CB  1 
ATOM   706  O  OG  . SER A 1 103 ? 10.991  5.091  -37.832 1.00 28.22 ? 216  SER A OG  1 
ATOM   707  N  N   . LEU A 1 104 ? 12.840  6.219  -35.188 1.00 22.95 ? 217  LEU A N   1 
ATOM   708  C  CA  . LEU A 1 104 ? 12.489  7.379  -34.354 1.00 21.71 ? 217  LEU A CA  1 
ATOM   709  C  C   . LEU A 1 104 ? 11.188  8.042  -34.787 1.00 21.67 ? 217  LEU A C   1 
ATOM   710  O  O   . LEU A 1 104 ? 10.411  8.452  -33.944 1.00 20.99 ? 217  LEU A O   1 
ATOM   711  C  CB  . LEU A 1 104 ? 13.618  8.428  -34.325 1.00 20.88 ? 217  LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 104 ? 13.362  9.695  -33.497 1.00 19.44 ? 217  LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 104 ? 13.216  9.357  -32.014 1.00 17.23 ? 217  LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 104 ? 14.446  10.734 -33.734 1.00 18.45 ? 217  LEU A CD2 1 
ATOM   715  N  N   . GLN A 1 105 ? 10.965  8.177  -36.091 1.00 22.99 ? 218  GLN A N   1 
ATOM   716  C  CA  . GLN A 1 105 ? 9.734   8.798  -36.595 1.00 23.72 ? 218  GLN A CA  1 
ATOM   717  C  C   . GLN A 1 105 ? 8.493   8.061  -36.064 1.00 23.81 ? 218  GLN A C   1 
ATOM   718  O  O   . GLN A 1 105 ? 7.551   8.671  -35.555 1.00 23.50 ? 218  GLN A O   1 
ATOM   719  C  CB  . GLN A 1 105 ? 9.727   8.830  -38.135 1.00 24.94 ? 218  GLN A CB  1 
ATOM   720  C  CG  . GLN A 1 105 ? 8.541   9.629  -38.712 1.00 25.99 ? 218  GLN A CG  1 
ATOM   721  C  CD  . GLN A 1 105 ? 8.520   9.694  -40.235 1.00 28.33 ? 218  GLN A CD  1 
ATOM   722  O  OE1 . GLN A 1 105 ? 9.457   9.269  -40.912 1.00 30.58 ? 218  GLN A OE1 1 
ATOM   723  N  NE2 . GLN A 1 105 ? 7.434   10.225 -40.779 1.00 30.64 ? 218  GLN A NE2 1 
ATOM   724  N  N   . GLN A 1 106 ? 8.515   6.742  -36.173 1.00 24.32 ? 219  GLN A N   1 
ATOM   725  C  CA  . GLN A 1 106 ? 7.439   5.907  -35.651 1.00 25.38 ? 219  GLN A CA  1 
ATOM   726  C  C   . GLN A 1 106 ? 7.307   6.065  -34.133 1.00 23.65 ? 219  GLN A C   1 
ATOM   727  O  O   . GLN A 1 106 ? 6.206   6.175  -33.625 1.00 23.06 ? 219  GLN A O   1 
ATOM   728  C  CB  . GLN A 1 106 ? 7.676   4.438  -36.018 1.00 26.66 ? 219  GLN A CB  1 
ATOM   729  C  CG  . GLN A 1 106 ? 7.561   4.150  -37.512 1.00 29.13 ? 219  GLN A CG  1 
ATOM   730  C  CD  . GLN A 1 106 ? 7.995   2.732  -37.884 1.00 31.24 ? 219  GLN A CD  1 
ATOM   731  O  OE1 . GLN A 1 106 ? 9.116   2.303  -37.577 1.00 34.31 ? 219  GLN A OE1 1 
ATOM   732  N  NE2 . GLN A 1 106 ? 7.108   2.001  -38.564 1.00 36.20 ? 219  GLN A NE2 1 
ATOM   733  N  N   . VAL A 1 107 ? 8.437   6.092  -33.423 1.00 22.50 ? 220  VAL A N   1 
ATOM   734  C  CA  . VAL A 1 107 ? 8.423   6.233  -31.958 1.00 21.65 ? 220  VAL A CA  1 
ATOM   735  C  C   . VAL A 1 107 ? 7.841   7.600  -31.558 1.00 20.26 ? 220  VAL A C   1 
ATOM   736  O  O   . VAL A 1 107 ? 7.077   7.699  -30.615 1.00 19.59 ? 220  VAL A O   1 
ATOM   737  C  CB  . VAL A 1 107 ? 9.831   6.023  -31.326 1.00 20.73 ? 220  VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 107 ? 9.829   6.429  -29.845 1.00 19.27 ? 220  VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 107 ? 10.247  4.580  -31.467 1.00 21.02 ? 220  VAL A CG2 1 
ATOM   740  N  N   . LEU A 1 108 ? 8.174   8.634  -32.314 1.00 20.21 ? 221  LEU A N   1 
ATOM   741  C  CA  . LEU A 1 108 ? 7.627   9.961  -32.068 1.00 20.19 ? 221  LEU A CA  1 
ATOM   742  C  C   . LEU A 1 108 ? 6.100   10.006 -32.283 1.00 21.51 ? 221  LEU A C   1 
ATOM   743  O  O   . LEU A 1 108 ? 5.398   10.670 -31.522 1.00 21.74 ? 221  LEU A O   1 
ATOM   744  C  CB  . LEU A 1 108 ? 8.339   11.010 -32.934 1.00 19.83 ? 221  LEU A CB  1 
ATOM   745  C  CG  . LEU A 1 108 ? 9.774   11.407 -32.568 1.00 18.49 ? 221  LEU A CG  1 
ATOM   746  C  CD1 . LEU A 1 108 ? 10.315  12.330 -33.654 1.00 17.23 ? 221  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A 1 108 ? 9.871   12.081 -31.170 1.00 17.44 ? 221  LEU A CD2 1 
ATOM   748  N  N   . GLU A 1 109 ? 5.586   9.311  -33.303 1.00 22.94 ? 222  GLU A N   1 
ATOM   749  C  CA  . GLU A 1 109 ? 4.130   9.183  -33.485 1.00 24.18 ? 222  GLU A CA  1 
ATOM   750  C  C   . GLU A 1 109 ? 3.501   8.457  -32.294 1.00 23.80 ? 222  GLU A C   1 
ATOM   751  O  O   . GLU A 1 109 ? 2.430   8.830  -31.820 1.00 22.97 ? 222  GLU A O   1 
ATOM   752  C  CB  . GLU A 1 109 ? 3.781   8.436  -34.776 1.00 25.54 ? 222  GLU A CB  1 
ATOM   753  C  CG  . GLU A 1 109 ? 4.150   9.163  -36.071 1.00 28.42 ? 222  GLU A CG  1 
ATOM   754  C  CD  . GLU A 1 109 ? 4.142   8.244  -37.330 1.00 30.50 ? 222  GLU A CD  1 
ATOM   755  O  OE1 . GLU A 1 109 ? 3.641   7.096  -37.256 1.00 35.61 ? 222  GLU A OE1 1 
ATOM   756  O  OE2 . GLU A 1 109 ? 4.635   8.682  -38.397 1.00 35.32 ? 222  GLU A OE2 1 
ATOM   757  N  N   . ARG A 1 110 ? 4.168   7.409  -31.821 1.00 23.57 ? 223  ARG A N   1 
ATOM   758  C  CA  . ARG A 1 110 ? 3.712   6.700  -30.636 1.00 24.04 ? 223  ARG A CA  1 
ATOM   759  C  C   . ARG A 1 110 ? 3.740   7.581  -29.371 1.00 22.07 ? 223  ARG A C   1 
ATOM   760  O  O   . ARG A 1 110 ? 2.851   7.489  -28.552 1.00 21.67 ? 223  ARG A O   1 
ATOM   761  C  CB  . ARG A 1 110 ? 4.518   5.409  -30.443 1.00 24.88 ? 223  ARG A CB  1 
ATOM   762  C  CG  . ARG A 1 110 ? 4.196   4.333  -31.507 1.00 28.29 ? 223  ARG A CG  1 
ATOM   763  C  CD  . ARG A 1 110 ? 5.223   3.245  -31.476 1.00 29.76 ? 223  ARG A CD  1 
ATOM   764  N  NE  . ARG A 1 110 ? 4.946   2.121  -32.387 1.00 35.38 ? 223  ARG A NE  1 
ATOM   765  C  CZ  . ARG A 1 110 ? 4.223   1.035  -32.083 1.00 37.93 ? 223  ARG A CZ  1 
ATOM   766  N  NH1 . ARG A 1 110 ? 3.628   0.908  -30.901 1.00 39.30 ? 223  ARG A NH1 1 
ATOM   767  N  NH2 . ARG A 1 110 ? 4.065   0.075  -32.990 1.00 40.49 ? 223  ARG A NH2 1 
ATOM   768  N  N   . VAL A 1 111 ? 4.750   8.432  -29.217 1.00 20.16 ? 224  VAL A N   1 
ATOM   769  C  CA  . VAL A 1 111 ? 4.783   9.371  -28.105 1.00 19.01 ? 224  VAL A CA  1 
ATOM   770  C  C   . VAL A 1 111 ? 3.560   10.289 -28.188 1.00 19.42 ? 224  VAL A C   1 
ATOM   771  O  O   . VAL A 1 111 ? 2.867   10.518 -27.182 1.00 18.36 ? 224  VAL A O   1 
ATOM   772  C  CB  . VAL A 1 111 ? 6.095   10.204 -28.102 1.00 18.24 ? 224  VAL A CB  1 
ATOM   773  C  CG1 . VAL A 1 111 ? 5.981   11.441 -27.212 1.00 16.29 ? 224  VAL A CG1 1 
ATOM   774  C  CG2 . VAL A 1 111 ? 7.275   9.313  -27.686 1.00 16.11 ? 224  VAL A CG2 1 
ATOM   775  N  N   . ASP A 1 112 ? 3.267   10.771 -29.392 1.00 20.13 ? 225  ASP A N   1 
ATOM   776  C  CA  . ASP A 1 112 ? 2.146   11.687 -29.576 1.00 21.49 ? 225  ASP A CA  1 
ATOM   777  C  C   . ASP A 1 112 ? 0.796   11.030 -29.234 1.00 22.71 ? 225  ASP A C   1 
ATOM   778  O  O   . ASP A 1 112 ? -0.063  11.648 -28.611 1.00 22.99 ? 225  ASP A O   1 
ATOM   779  C  CB  . ASP A 1 112 ? 2.117   12.244 -31.001 1.00 22.05 ? 225  ASP A CB  1 
ATOM   780  C  CG  . ASP A 1 112 ? 1.388   13.580 -31.084 1.00 22.52 ? 225  ASP A CG  1 
ATOM   781  O  OD1 . ASP A 1 112 ? 0.366   13.668 -31.811 1.00 23.14 ? 225  ASP A OD1 1 
ATOM   782  O  OD2 . ASP A 1 112 ? 1.848   14.537 -30.418 1.00 20.49 ? 225  ASP A OD2 1 
ATOM   783  N  N   . GLU A 1 113 ? 0.634   9.775  -29.630 1.00 23.83 ? 226  GLU A N   1 
ATOM   784  C  CA  . GLU A 1 113 ? -0.538  8.996  -29.263 1.00 26.04 ? 226  GLU A CA  1 
ATOM   785  C  C   . GLU A 1 113 ? -0.615  8.813  -27.765 1.00 24.50 ? 226  GLU A C   1 
ATOM   786  O  O   . GLU A 1 113 ? -1.685  8.878  -27.182 1.00 25.14 ? 226  GLU A O   1 
ATOM   787  C  CB  . GLU A 1 113 ? -0.514  7.626  -29.946 1.00 27.40 ? 226  GLU A CB  1 
ATOM   788  C  CG  . GLU A 1 113 ? -0.671  7.708  -31.453 1.00 30.72 ? 226  GLU A CG  1 
ATOM   789  C  CD  . GLU A 1 113 ? -0.288  6.415  -32.178 1.00 32.16 ? 226  GLU A CD  1 
ATOM   790  O  OE1 . GLU A 1 113 ? -0.046  5.385  -31.498 1.00 36.36 ? 226  GLU A OE1 1 
ATOM   791  O  OE2 . GLU A 1 113 ? -0.233  6.446  -33.432 1.00 36.89 ? 226  GLU A OE2 1 
ATOM   792  N  N   . TRP A 1 114 ? 0.527   8.574  -27.142 1.00 23.29 ? 227  TRP A N   1 
ATOM   793  C  CA  . TRP A 1 114 ? 0.588   8.442  -25.694 1.00 22.78 ? 227  TRP A CA  1 
ATOM   794  C  C   . TRP A 1 114 ? 0.212   9.760  -24.974 1.00 22.40 ? 227  TRP A C   1 
ATOM   795  O  O   . TRP A 1 114 ? -0.555  9.748  -23.995 1.00 22.99 ? 227  TRP A O   1 
ATOM   796  C  CB  . TRP A 1 114 ? 1.976   7.943  -25.290 1.00 21.77 ? 227  TRP A CB  1 
ATOM   797  C  CG  . TRP A 1 114 ? 2.167   7.741  -23.831 1.00 21.02 ? 227  TRP A CG  1 
ATOM   798  C  CD1 . TRP A 1 114 ? 1.793   6.646  -23.085 1.00 21.75 ? 227  TRP A CD1 1 
ATOM   799  C  CD2 . TRP A 1 114 ? 2.793   8.648  -22.927 1.00 20.02 ? 227  TRP A CD2 1 
ATOM   800  N  NE1 . TRP A 1 114 ? 2.150   6.831  -21.770 1.00 20.81 ? 227  TRP A NE1 1 
ATOM   801  C  CE2 . TRP A 1 114 ? 2.765   8.051  -21.645 1.00 20.40 ? 227  TRP A CE2 1 
ATOM   802  C  CE3 . TRP A 1 114 ? 3.381   9.906  -23.074 1.00 19.25 ? 227  TRP A CE3 1 
ATOM   803  C  CZ2 . TRP A 1 114 ? 3.315   8.675  -20.516 1.00 19.44 ? 227  TRP A CZ2 1 
ATOM   804  C  CZ3 . TRP A 1 114 ? 3.911   10.531 -21.950 1.00 18.76 ? 227  TRP A CZ3 1 
ATOM   805  C  CH2 . TRP A 1 114 ? 3.879   9.907  -20.689 1.00 18.54 ? 227  TRP A CH2 1 
ATOM   806  N  N   . MET A 1 115 ? 0.743   10.887 -25.457 1.00 21.46 ? 228  MET A N   1 
ATOM   807  C  CA  . MET A 1 115 ? 0.383   12.200 -24.921 1.00 20.92 ? 228  MET A CA  1 
ATOM   808  C  C   . MET A 1 115 ? -1.132  12.408 -25.011 1.00 22.33 ? 228  MET A C   1 
ATOM   809  O  O   . MET A 1 115 ? -1.763  12.891 -24.070 1.00 21.80 ? 228  MET A O   1 
ATOM   810  C  CB  . MET A 1 115 ? 1.095   13.326 -25.683 1.00 20.49 ? 228  MET A CB  1 
ATOM   811  C  CG  . MET A 1 115 ? 2.633   13.381 -25.545 1.00 19.24 ? 228  MET A CG  1 
ATOM   812  S  SD  . MET A 1 115 ? 3.224   13.882 -23.913 1.00 20.83 ? 228  MET A SD  1 
ATOM   813  C  CE  . MET A 1 115 ? 3.078   15.682 -24.002 1.00 15.86 ? 228  MET A CE  1 
ATOM   814  N  N   . ALA A 1 116 ? -1.701  12.050 -26.158 1.00 23.65 ? 229  ALA A N   1 
ATOM   815  C  CA  . ALA A 1 116 ? -3.141  12.169 -26.395 1.00 25.56 ? 229  ALA A CA  1 
ATOM   816  C  C   . ALA A 1 116 ? -3.933  11.309 -25.422 1.00 26.12 ? 229  ALA A C   1 
ATOM   817  O  O   . ALA A 1 116 ? -4.792  11.810 -24.713 1.00 25.72 ? 229  ALA A O   1 
ATOM   818  C  CB  . ALA A 1 116 ? -3.477  11.786 -27.837 1.00 26.47 ? 229  ALA A CB  1 
ATOM   819  N  N   . LYS A 1 117 ? -3.606  10.020 -25.381 1.00 27.39 ? 230  LYS A N   1 
ATOM   820  C  CA  . LYS A 1 117 ? -4.247  9.063  -24.487 1.00 28.38 ? 230  LYS A CA  1 
ATOM   821  C  C   . LYS A 1 117 ? -4.136  9.440  -23.008 1.00 26.97 ? 230  LYS A C   1 
ATOM   822  O  O   . LYS A 1 117 ? -5.056  9.184  -22.241 1.00 27.19 ? 230  LYS A O   1 
ATOM   823  C  CB  . LYS A 1 117 ? -3.664  7.659  -24.716 1.00 29.57 ? 230  LYS A CB  1 
ATOM   824  C  CG  . LYS A 1 117 ? -4.218  6.578  -23.766 1.00 31.84 ? 230  LYS A CG  1 
ATOM   825  C  CD  . LYS A 1 117 ? -3.879  5.115  -24.208 1.00 33.85 ? 230  LYS A CD  1 
ATOM   826  C  CE  . LYS A 1 117 ? -4.418  4.106  -23.162 1.00 36.82 ? 230  LYS A CE  1 
ATOM   827  N  NZ  . LYS A 1 117 ? -3.999  2.680  -23.397 1.00 38.99 ? 230  LYS A NZ  1 
ATOM   828  N  N   . GLU A 1 118 ? -3.017  10.043 -22.614 1.00 24.83 ? 231  GLU A N   1 
ATOM   829  C  CA  . GLU A 1 118 ? -2.802  10.460 -21.222 1.00 24.11 ? 231  GLU A CA  1 
ATOM   830  C  C   . GLU A 1 118 ? -3.438  11.817 -20.885 1.00 23.95 ? 231  GLU A C   1 
ATOM   831  O  O   . GLU A 1 118 ? -3.304  12.302 -19.768 1.00 23.44 ? 231  GLU A O   1 
ATOM   832  C  CB  . GLU A 1 118 ? -1.305  10.495 -20.893 1.00 22.06 ? 231  GLU A CB  1 
ATOM   833  C  CG  . GLU A 1 118 ? -0.652  9.106  -20.809 1.00 22.86 ? 231  GLU A CG  1 
ATOM   834  C  CD  . GLU A 1 118 ? -1.233  8.200  -19.718 1.00 22.77 ? 231  GLU A CD  1 
ATOM   835  O  OE1 . GLU A 1 118 ? -1.609  8.685  -18.632 1.00 22.63 ? 231  GLU A OE1 1 
ATOM   836  O  OE2 . GLU A 1 118 ? -1.314  6.983  -19.957 1.00 25.58 ? 231  GLU A OE2 1 
ATOM   837  N  N   . GLY A 1 119 ? -4.135  12.416 -21.847 1.00 25.02 ? 232  GLY A N   1 
ATOM   838  C  CA  . GLY A 1 119 ? -4.817  13.692 -21.624 1.00 24.85 ? 232  GLY A CA  1 
ATOM   839  C  C   . GLY A 1 119 ? -3.873  14.875 -21.587 1.00 23.32 ? 232  GLY A C   1 
ATOM   840  O  O   . GLY A 1 119 ? -4.260  15.961 -21.151 1.00 23.61 ? 232  GLY A O   1 
ATOM   841  N  N   . LEU A 1 120 ? -2.630  14.663 -22.025 1.00 21.93 ? 233  LEU A N   1 
ATOM   842  C  CA  . LEU A 1 120 ? -1.594  15.689 -21.975 1.00 20.61 ? 233  LEU A CA  1 
ATOM   843  C  C   . LEU A 1 120 ? -1.649  16.697 -23.130 1.00 21.09 ? 233  LEU A C   1 
ATOM   844  O  O   . LEU A 1 120 ? -0.906  17.689 -23.108 1.00 20.26 ? 233  LEU A O   1 
ATOM   845  C  CB  . LEU A 1 120 ? -0.196  15.046 -21.912 1.00 19.51 ? 233  LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 120 ? 0.072   14.239 -20.637 1.00 18.74 ? 233  LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 120 ? 1.277   13.328 -20.817 1.00 17.10 ? 233  LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 120 ? 0.241   15.164 -19.407 1.00 17.41 ? 233  LEU A CD2 1 
ATOM   849  N  N   . LEU A 1 121 ? -2.493  16.449 -24.133 1.00 21.79 ? 234  LEU A N   1 
ATOM   850  C  CA  . LEU A 1 121 ? -2.635  17.375 -25.257 1.00 22.61 ? 234  LEU A CA  1 
ATOM   851  C  C   . LEU A 1 121 ? -3.863  18.272 -25.139 1.00 23.48 ? 234  LEU A C   1 
ATOM   852  O  O   . LEU A 1 121 ? -4.188  18.986 -26.073 1.00 25.07 ? 234  LEU A O   1 
ATOM   853  C  CB  . LEU A 1 121 ? -2.670  16.609 -26.599 1.00 23.56 ? 234  LEU A CB  1 
ATOM   854  C  CG  . LEU A 1 121 ? -1.435  15.757 -26.877 1.00 22.82 ? 234  LEU A CG  1 
ATOM   855  C  CD1 . LEU A 1 121 ? -1.572  15.056 -28.204 1.00 24.07 ? 234  LEU A CD1 1 
ATOM   856  C  CD2 . LEU A 1 121 ? -0.137  16.587 -26.849 1.00 22.10 ? 234  LEU A CD2 1 
ATOM   857  N  N   . ASP A 1 122 ? -4.558  18.235 -24.011 1.00 23.53 ? 235  ASP A N   1 
ATOM   858  C  CA  . ASP A 1 122 ? -5.643  19.188 -23.773 1.00 24.47 ? 235  ASP A CA  1 
ATOM   859  C  C   . ASP A 1 122 ? -5.024  20.513 -23.352 1.00 23.26 ? 235  ASP A C   1 
ATOM   860  O  O   . ASP A 1 122 ? -4.162  20.524 -22.474 1.00 21.59 ? 235  ASP A O   1 
ATOM   861  C  CB  . ASP A 1 122 ? -6.605  18.675 -22.702 1.00 24.74 ? 235  ASP A CB  1 
ATOM   862  C  CG  . ASP A 1 122 ? -7.737  19.644 -22.416 1.00 27.40 ? 235  ASP A CG  1 
ATOM   863  O  OD1 . ASP A 1 122 ? -7.553  20.642 -21.696 1.00 28.00 ? 235  ASP A OD1 1 
ATOM   864  O  OD2 . ASP A 1 122 ? -8.847  19.400 -22.903 1.00 34.98 ? 235  ASP A OD2 1 
ATOM   865  N  N   . PRO A 1 123 ? -5.470  21.634 -23.952 1.00 24.67 ? 236  PRO A N   1 
ATOM   866  C  CA  . PRO A 1 123 ? -4.867  22.940 -23.632 1.00 24.69 ? 236  PRO A CA  1 
ATOM   867  C  C   . PRO A 1 123 ? -4.924  23.333 -22.141 1.00 24.41 ? 236  PRO A C   1 
ATOM   868  O  O   . PRO A 1 123 ? -4.072  24.086 -21.665 1.00 23.85 ? 236  PRO A O   1 
ATOM   869  C  CB  . PRO A 1 123 ? -5.657  23.927 -24.511 1.00 27.04 ? 236  PRO A CB  1 
ATOM   870  C  CG  . PRO A 1 123 ? -6.946  23.200 -24.894 1.00 28.50 ? 236  PRO A CG  1 
ATOM   871  C  CD  . PRO A 1 123 ? -6.538  21.749 -24.969 1.00 26.99 ? 236  PRO A CD  1 
ATOM   872  N  N   . ASN A 1 124 ? -5.885  22.782 -21.401 1.00 24.35 ? 237  ASN A N   1 
ATOM   873  C  CA  . ASN A 1 124 ? -6.043  23.079 -19.986 1.00 23.79 ? 237  ASN A CA  1 
ATOM   874  C  C   . ASN A 1 124 ? -5.113  22.284 -19.078 1.00 22.05 ? 237  ASN A C   1 
ATOM   875  O  O   . ASN A 1 124 ? -4.882  22.672 -17.920 1.00 21.87 ? 237  ASN A O   1 
ATOM   876  C  CB  . ASN A 1 124 ? -7.485  22.812 -19.580 1.00 25.29 ? 237  ASN A CB  1 
ATOM   877  C  CG  . ASN A 1 124 ? -8.449  23.606 -20.391 1.00 25.91 ? 237  ASN A CG  1 
ATOM   878  O  OD1 . ASN A 1 124 ? -8.680  24.772 -20.093 1.00 24.77 ? 237  ASN A OD1 1 
ATOM   879  N  ND2 . ASN A 1 124 ? -9.012  22.995 -21.441 1.00 24.87 ? 237  ASN A ND2 1 
ATOM   880  N  N   . VAL A 1 125 ? -4.597  21.168 -19.596 1.00 20.86 ? 238  VAL A N   1 
ATOM   881  C  CA  . VAL A 1 125 ? -3.718  20.312 -18.826 1.00 19.31 ? 238  VAL A CA  1 
ATOM   882  C  C   . VAL A 1 125 ? -2.282  20.794 -19.031 1.00 18.92 ? 238  VAL A C   1 
ATOM   883  O  O   . VAL A 1 125 ? -1.754  20.788 -20.156 1.00 18.52 ? 238  VAL A O   1 
ATOM   884  C  CB  . VAL A 1 125 ? -3.885  18.810 -19.197 1.00 19.15 ? 238  VAL A CB  1 
ATOM   885  C  CG1 . VAL A 1 125 ? -2.793  17.949 -18.502 1.00 15.72 ? 238  VAL A CG1 1 
ATOM   886  C  CG2 . VAL A 1 125 ? -5.316  18.301 -18.854 1.00 18.26 ? 238  VAL A CG2 1 
ATOM   887  N  N   . LYS A 1 126 ? -1.647  21.226 -17.945 1.00 18.62 ? 239  LYS A N   1 
ATOM   888  C  CA  . LYS A 1 126 ? -0.300  21.796 -18.038 1.00 17.90 ? 239  LYS A CA  1 
ATOM   889  C  C   . LYS A 1 126 ? 0.749   20.780 -17.652 1.00 17.04 ? 239  LYS A C   1 
ATOM   890  O  O   . LYS A 1 126 ? 0.678   20.176 -16.586 1.00 16.38 ? 239  LYS A O   1 
ATOM   891  C  CB  . LYS A 1 126 ? -0.185  23.027 -17.145 1.00 18.35 ? 239  LYS A CB  1 
ATOM   892  C  CG  . LYS A 1 126 ? -1.256  24.071 -17.365 1.00 19.07 ? 239  LYS A CG  1 
ATOM   893  C  CD  . LYS A 1 126 ? -1.245  24.664 -18.778 1.00 19.96 ? 239  LYS A CD  1 
ATOM   894  C  CE  . LYS A 1 126 ? -2.455  25.599 -18.932 1.00 22.19 ? 239  LYS A CE  1 
ATOM   895  N  NZ  . LYS A 1 126 ? -2.710  25.983 -20.345 1.00 22.85 ? 239  LYS A NZ  1 
ATOM   896  N  N   . SER A 1 127 ? 1.729   20.600 -18.537 1.00 17.43 ? 240  SER A N   1 
ATOM   897  C  CA  . SER A 1 127 ? 2.868   19.723 -18.278 1.00 15.85 ? 240  SER A CA  1 
ATOM   898  C  C   . SER A 1 127 ? 4.158   20.270 -18.866 1.00 15.43 ? 240  SER A C   1 
ATOM   899  O  O   . SER A 1 127 ? 4.165   21.216 -19.665 1.00 16.35 ? 240  SER A O   1 
ATOM   900  C  CB  . SER A 1 127 ? 2.609   18.314 -18.830 1.00 16.58 ? 240  SER A CB  1 
ATOM   901  O  OG  . SER A 1 127 ? 2.489   18.332 -20.232 1.00 15.71 ? 240  SER A OG  1 
ATOM   902  N  N   . ILE A 1 128 ? 5.260   19.691 -18.425 1.00 14.21 ? 241  ILE A N   1 
ATOM   903  C  CA  . ILE A 1 128 ? 6.576   20.125 -18.871 1.00 13.94 ? 241  ILE A CA  1 
ATOM   904  C  C   . ILE A 1 128 ? 7.520   18.945 -18.723 1.00 13.47 ? 241  ILE A C   1 
ATOM   905  O  O   . ILE A 1 128 ? 7.368   18.118 -17.805 1.00 13.12 ? 241  ILE A O   1 
ATOM   906  C  CB  . ILE A 1 128 ? 7.085   21.366 -18.070 1.00 14.08 ? 241  ILE A CB  1 
ATOM   907  C  CG1 . ILE A 1 128 ? 8.295   22.008 -18.763 1.00 14.46 ? 241  ILE A CG1 1 
ATOM   908  C  CG2 . ILE A 1 128 ? 7.392   20.999 -16.593 1.00 11.56 ? 241  ILE A CG2 1 
ATOM   909  C  CD1 . ILE A 1 128 ? 8.694   23.388 -18.210 1.00 14.14 ? 241  ILE A CD1 1 
ATOM   910  N  N   . PHE A 1 129 ? 8.460   18.847 -19.657 1.00 13.72 ? 242  PHE A N   1 
ATOM   911  C  CA  . PHE A 1 129 ? 9.493   17.820 -19.604 1.00 13.07 ? 242  PHE A CA  1 
ATOM   912  C  C   . PHE A 1 129 ? 10.541  18.182 -18.581 1.00 12.91 ? 242  PHE A C   1 
ATOM   913  O  O   . PHE A 1 129 ? 10.833  19.353 -18.355 1.00 13.91 ? 242  PHE A O   1 
ATOM   914  C  CB  . PHE A 1 129 ? 10.127  17.553 -20.993 1.00 12.94 ? 242  PHE A CB  1 
ATOM   915  C  CG  . PHE A 1 129 ? 9.264   16.697 -21.870 1.00 13.08 ? 242  PHE A CG  1 
ATOM   916  C  CD1 . PHE A 1 129 ? 8.260   17.265 -22.640 1.00 14.87 ? 242  PHE A CD1 1 
ATOM   917  C  CD2 . PHE A 1 129 ? 9.399   15.320 -21.870 1.00 13.19 ? 242  PHE A CD2 1 
ATOM   918  C  CE1 . PHE A 1 129 ? 7.432   16.478 -23.430 1.00 14.24 ? 242  PHE A CE1 1 
ATOM   919  C  CE2 . PHE A 1 129 ? 8.579   14.533 -22.648 1.00 13.17 ? 242  PHE A CE2 1 
ATOM   920  C  CZ  . PHE A 1 129 ? 7.582   15.109 -23.420 1.00 14.05 ? 242  PHE A CZ  1 
ATOM   921  N  N   . VAL A 1 130 ? 11.103  17.147 -17.973 1.00 12.98 ? 243  VAL A N   1 
ATOM   922  C  CA  . VAL A 1 130 ? 12.202  17.267 -17.022 1.00 12.74 ? 243  VAL A CA  1 
ATOM   923  C  C   . VAL A 1 130 ? 13.310  16.311 -17.465 1.00 12.47 ? 243  VAL A C   1 
ATOM   924  O  O   . VAL A 1 130 ? 13.055  15.137 -17.736 1.00 11.47 ? 243  VAL A O   1 
ATOM   925  C  CB  . VAL A 1 130 ? 11.737  16.949 -15.566 1.00 12.58 ? 243  VAL A CB  1 
ATOM   926  C  CG1 . VAL A 1 130 ? 12.898  17.142 -14.551 1.00 12.28 ? 243  VAL A CG1 1 
ATOM   927  C  CG2 . VAL A 1 130 ? 10.530  17.812 -15.205 1.00 11.70 ? 243  VAL A CG2 1 
ATOM   928  N  N   . THR A 1 131 ? 14.521  16.845 -17.560 1.00 12.90 ? 244  THR A N   1 
ATOM   929  C  CA  . THR A 1 131 ? 15.686  16.120 -18.035 1.00 14.12 ? 244  THR A CA  1 
ATOM   930  C  C   . THR A 1 131 ? 16.875  16.383 -17.099 1.00 15.16 ? 244  THR A C   1 
ATOM   931  O  O   . THR A 1 131 ? 16.911  17.390 -16.387 1.00 15.60 ? 244  THR A O   1 
ATOM   932  C  CB  . THR A 1 131 ? 16.029  16.514 -19.512 1.00 14.37 ? 244  THR A CB  1 
ATOM   933  O  OG1 . THR A 1 131 ? 16.339  17.914 -19.611 1.00 14.20 ? 244  THR A OG1 1 
ATOM   934  C  CG2 . THR A 1 131 ? 14.848  16.190 -20.429 1.00 12.85 ? 244  THR A CG2 1 
ATOM   935  N  N   . CYS A 1 132 ? 17.823  15.461 -17.060 1.00 16.19 ? 245  CYS A N   1 
ATOM   936  C  CA  . CYS A 1 132 ? 19.088  15.723 -16.382 1.00 17.20 ? 245  CYS A CA  1 
ATOM   937  C  C   . CYS A 1 132 ? 20.063  16.349 -17.377 1.00 18.05 ? 245  CYS A C   1 
ATOM   938  O  O   . CYS A 1 132 ? 20.622  15.665 -18.232 1.00 19.04 ? 245  CYS A O   1 
ATOM   939  C  CB  . CYS A 1 132 ? 19.645  14.424 -15.798 1.00 18.55 ? 245  CYS A CB  1 
ATOM   940  S  SG  . CYS A 1 132 ? 21.150  14.618 -14.889 1.00 21.42 ? 245  CYS A SG  1 
ATOM   941  N  N   . GLY A 1 133 ? 20.263  17.658 -17.277 1.00 18.46 ? 246  GLY A N   1 
ATOM   942  C  CA  . GLY A 1 133 ? 21.037  18.405 -18.261 1.00 18.40 ? 246  GLY A CA  1 
ATOM   943  C  C   . GLY A 1 133 ? 20.133  18.929 -19.368 1.00 17.33 ? 246  GLY A C   1 
ATOM   944  O  O   . GLY A 1 133 ? 18.930  18.654 -19.384 1.00 16.66 ? 246  GLY A O   1 
ATOM   945  N  N   . ASP A 1 134 ? 20.715  19.693 -20.285 1.00 17.12 ? 247  ASP A N   1 
ATOM   946  C  CA  . ASP A 1 134 ? 19.999  20.262 -21.431 1.00 16.81 ? 247  ASP A CA  1 
ATOM   947  C  C   . ASP A 1 134 ? 20.209  19.507 -22.756 1.00 16.60 ? 247  ASP A C   1 
ATOM   948  O  O   . ASP A 1 134 ? 19.536  19.813 -23.730 1.00 16.11 ? 247  ASP A O   1 
ATOM   949  C  CB  . ASP A 1 134 ? 20.431  21.721 -21.632 1.00 17.85 ? 247  ASP A CB  1 
ATOM   950  C  CG  . ASP A 1 134 ? 19.955  22.634 -20.509 1.00 18.56 ? 247  ASP A CG  1 
ATOM   951  O  OD1 . ASP A 1 134 ? 18.776  22.538 -20.118 1.00 17.95 ? 247  ASP A OD1 1 
ATOM   952  O  OD2 . ASP A 1 134 ? 20.755  23.451 -20.021 1.00 21.33 ? 247  ASP A OD2 1 
ATOM   953  N  N   . TRP A 1 135 ? 21.119  18.533 -22.795 1.00 16.34 ? 248  TRP A N   1 
ATOM   954  C  CA  . TRP A 1 135 ? 21.552  17.929 -24.060 1.00 16.60 ? 248  TRP A CA  1 
ATOM   955  C  C   . TRP A 1 135 ? 20.398  17.317 -24.847 1.00 15.48 ? 248  TRP A C   1 
ATOM   956  O  O   . TRP A 1 135 ? 20.273  17.545 -26.035 1.00 14.83 ? 248  TRP A O   1 
ATOM   957  C  CB  . TRP A 1 135 ? 22.572  16.828 -23.811 1.00 17.60 ? 248  TRP A CB  1 
ATOM   958  C  CG  . TRP A 1 135 ? 23.278  16.319 -25.025 1.00 18.35 ? 248  TRP A CG  1 
ATOM   959  C  CD1 . TRP A 1 135 ? 23.080  15.122 -25.660 1.00 18.59 ? 248  TRP A CD1 1 
ATOM   960  C  CD2 . TRP A 1 135 ? 24.332  16.974 -25.729 1.00 18.73 ? 248  TRP A CD2 1 
ATOM   961  N  NE1 . TRP A 1 135 ? 23.944  15.006 -26.724 1.00 18.40 ? 248  TRP A NE1 1 
ATOM   962  C  CE2 . TRP A 1 135 ? 24.723  16.128 -26.783 1.00 18.95 ? 248  TRP A CE2 1 
ATOM   963  C  CE3 . TRP A 1 135 ? 24.983  18.203 -25.573 1.00 21.34 ? 248  TRP A CE3 1 
ATOM   964  C  CZ2 . TRP A 1 135 ? 25.735  16.467 -27.671 1.00 21.18 ? 248  TRP A CZ2 1 
ATOM   965  C  CZ3 . TRP A 1 135 ? 26.000  18.536 -26.453 1.00 21.92 ? 248  TRP A CZ3 1 
ATOM   966  C  CH2 . TRP A 1 135 ? 26.362  17.673 -27.488 1.00 22.05 ? 248  TRP A CH2 1 
ATOM   967  N  N   . ASP A 1 136 ? 19.586  16.514 -24.178 1.00 14.19 ? 249  ASP A N   1 
ATOM   968  C  CA  . ASP A 1 136 ? 18.591  15.703 -24.870 1.00 14.31 ? 249  ASP A CA  1 
ATOM   969  C  C   . ASP A 1 136 ? 17.564  16.515 -25.672 1.00 13.95 ? 249  ASP A C   1 
ATOM   970  O  O   . ASP A 1 136 ? 17.227  16.127 -26.790 1.00 12.90 ? 249  ASP A O   1 
ATOM   971  C  CB  . ASP A 1 136 ? 17.879  14.764 -23.901 1.00 13.72 ? 249  ASP A CB  1 
ATOM   972  C  CG  . ASP A 1 136 ? 18.718  13.564 -23.549 1.00 15.11 ? 249  ASP A CG  1 
ATOM   973  O  OD1 . ASP A 1 136 ? 19.701  13.301 -24.265 1.00 16.05 ? 249  ASP A OD1 1 
ATOM   974  O  OD2 . ASP A 1 136 ? 18.386  12.868 -22.574 1.00 17.45 ? 249  ASP A OD2 1 
ATOM   975  N  N   . LEU A 1 137 ? 17.087  17.618 -25.096 1.00 13.68 ? 250  LEU A N   1 
ATOM   976  C  CA  . LEU A 1 137 ? 16.046  18.428 -25.724 1.00 14.04 ? 250  LEU A CA  1 
ATOM   977  C  C   . LEU A 1 137 ? 16.586  19.677 -26.391 1.00 15.01 ? 250  LEU A C   1 
ATOM   978  O  O   . LEU A 1 137 ? 15.943  20.237 -27.284 1.00 15.48 ? 250  LEU A O   1 
ATOM   979  C  CB  . LEU A 1 137 ? 14.924  18.762 -24.718 1.00 13.47 ? 250  LEU A CB  1 
ATOM   980  C  CG  . LEU A 1 137 ? 14.101  17.565 -24.205 1.00 12.49 ? 250  LEU A CG  1 
ATOM   981  C  CD1 . LEU A 1 137 ? 12.946  18.048 -23.293 1.00 10.39 ? 250  LEU A CD1 1 
ATOM   982  C  CD2 . LEU A 1 137 ? 13.558  16.680 -25.378 1.00 12.45 ? 250  LEU A CD2 1 
ATOM   983  N  N   . LYS A 1 138 ? 17.763  20.128 -25.978 1.00 16.44 ? 251  LYS A N   1 
ATOM   984  C  CA  . LYS A 1 138 ? 18.415  21.224 -26.666 1.00 17.13 ? 251  LYS A CA  1 
ATOM   985  C  C   . LYS A 1 138 ? 19.152  20.756 -27.913 1.00 17.63 ? 251  LYS A C   1 
ATOM   986  O  O   . LYS A 1 138 ? 19.256  21.499 -28.880 1.00 17.93 ? 251  LYS A O   1 
ATOM   987  C  CB  . LYS A 1 138 ? 19.387  21.949 -25.746 1.00 17.81 ? 251  LYS A CB  1 
ATOM   988  C  CG  . LYS A 1 138 ? 19.837  23.274 -26.313 1.00 20.69 ? 251  LYS A CG  1 
ATOM   989  C  CD  . LYS A 1 138 ? 20.673  24.089 -25.320 1.00 22.77 ? 251  LYS A CD  1 
ATOM   990  C  CE  . LYS A 1 138 ? 21.412  25.233 -26.067 1.00 27.19 ? 251  LYS A CE  1 
ATOM   991  N  NZ  . LYS A 1 138 ? 22.005  26.308 -25.183 1.00 31.07 ? 251  LYS A NZ  1 
ATOM   992  N  N   . VAL A 1 139 ? 19.708  19.543 -27.884 1.00 16.84 ? 252  VAL A N   1 
ATOM   993  C  CA  . VAL A 1 139 ? 20.681  19.163 -28.902 1.00 16.97 ? 252  VAL A CA  1 
ATOM   994  C  C   . VAL A 1 139 ? 20.277  17.889 -29.604 1.00 17.03 ? 252  VAL A C   1 
ATOM   995  O  O   . VAL A 1 139 ? 20.155  17.868 -30.837 1.00 17.73 ? 252  VAL A O   1 
ATOM   996  C  CB  . VAL A 1 139 ? 22.133  19.026 -28.302 1.00 17.81 ? 252  VAL A CB  1 
ATOM   997  C  CG1 . VAL A 1 139 ? 23.127  18.484 -29.344 1.00 17.05 ? 252  VAL A CG1 1 
ATOM   998  C  CG2 . VAL A 1 139 ? 22.601  20.380 -27.718 1.00 16.53 ? 252  VAL A CG2 1 
ATOM   999  N  N   . MET A 1 140 ? 20.068  16.830 -28.839 1.00 16.07 ? 253  MET A N   1 
ATOM   1000 C  CA  . MET A 1 140 ? 19.909  15.510 -29.424 1.00 16.09 ? 253  MET A CA  1 
ATOM   1001 C  C   . MET A 1 140 ? 18.629  15.385 -30.258 1.00 15.34 ? 253  MET A C   1 
ATOM   1002 O  O   . MET A 1 140 ? 18.694  15.080 -31.445 1.00 14.78 ? 253  MET A O   1 
ATOM   1003 C  CB  . MET A 1 140 ? 19.911  14.438 -28.323 1.00 16.42 ? 253  MET A CB  1 
ATOM   1004 C  CG  . MET A 1 140 ? 19.915  12.994 -28.840 1.00 18.14 ? 253  MET A CG  1 
ATOM   1005 S  SD  . MET A 1 140 ? 21.371  12.667 -29.867 1.00 25.26 ? 253  MET A SD  1 
ATOM   1006 C  CE  . MET A 1 140 ? 20.832  11.324 -30.923 1.00 25.48 ? 253  MET A CE  1 
ATOM   1007 N  N   . LEU A 1 141 ? 17.477  15.563 -29.616 1.00 14.09 ? 254  LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 141 ? 16.182  15.424 -30.310 1.00 14.16 ? 254  LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 141 ? 16.018  16.376 -31.504 1.00 14.23 ? 254  LEU A C   1 
ATOM   1010 O  O   . LEU A 1 141 ? 15.745  15.914 -32.595 1.00 15.29 ? 254  LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 141 ? 14.985  15.537 -29.336 1.00 13.05 ? 254  LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 141 ? 13.569  15.312 -29.906 1.00 13.28 ? 254  LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 141 ? 13.424  13.859 -30.402 1.00 11.29 ? 254  LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 141 ? 12.491  15.642 -28.887 1.00 12.32 ? 254  LEU A CD2 1 
ATOM   1015 N  N   . PRO A 1 142 ? 16.172  17.697 -31.304 1.00 14.41 ? 255  PRO A N   1 
ATOM   1016 C  CA  . PRO A 1 142 ? 16.015  18.596 -32.439 1.00 15.28 ? 255  PRO A CA  1 
ATOM   1017 C  C   . PRO A 1 142 ? 17.050  18.403 -33.536 1.00 16.09 ? 255  PRO A C   1 
ATOM   1018 O  O   . PRO A 1 142 ? 16.751  18.663 -34.711 1.00 15.70 ? 255  PRO A O   1 
ATOM   1019 C  CB  . PRO A 1 142 ? 16.130  19.997 -31.827 1.00 16.10 ? 255  PRO A CB  1 
ATOM   1020 C  CG  . PRO A 1 142 ? 16.624  19.808 -30.453 1.00 16.47 ? 255  PRO A CG  1 
ATOM   1021 C  CD  . PRO A 1 142 ? 16.442  18.400 -30.048 1.00 14.30 ? 255  PRO A CD  1 
ATOM   1022 N  N   . GLY A 1 143 ? 18.247  17.940 -33.153 1.00 15.81 ? 256  GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 143 ? 19.304  17.678 -34.092 1.00 16.51 ? 256  GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 143 ? 18.929  16.525 -34.985 1.00 16.72 ? 256  GLY A C   1 
ATOM   1025 O  O   . GLY A 1 143 ? 18.954  16.643 -36.215 1.00 17.28 ? 256  GLY A O   1 
ATOM   1026 N  N   . GLN A 1 144 ? 18.571  15.405 -34.371 1.00 16.21 ? 257  GLN A N   1 
ATOM   1027 C  CA  . GLN A 1 144 ? 18.223  14.226 -35.146 1.00 16.65 ? 257  GLN A CA  1 
ATOM   1028 C  C   . GLN A 1 144 ? 16.966  14.478 -35.983 1.00 16.98 ? 257  GLN A C   1 
ATOM   1029 O  O   . GLN A 1 144 ? 16.918  14.070 -37.141 1.00 16.42 ? 257  GLN A O   1 
ATOM   1030 C  CB  . GLN A 1 144 ? 18.055  12.972 -34.281 1.00 16.02 ? 257  GLN A CB  1 
ATOM   1031 C  CG  . GLN A 1 144 ? 18.062  11.665 -35.148 1.00 16.74 ? 257  GLN A CG  1 
ATOM   1032 C  CD  . GLN A 1 144 ? 17.921  10.395 -34.338 1.00 16.69 ? 257  GLN A CD  1 
ATOM   1033 O  OE1 . GLN A 1 144 ? 17.970  10.426 -33.108 1.00 17.60 ? 257  GLN A OE1 1 
ATOM   1034 N  NE2 . GLN A 1 144 ? 17.738  9.269  -35.021 1.00 16.17 ? 257  GLN A NE2 1 
ATOM   1035 N  N   . CYS A 1 145 ? 15.972  15.138 -35.392 1.00 16.77 ? 258  CYS A N   1 
ATOM   1036 C  CA  . CYS A 1 145 ? 14.757  15.514 -36.122 1.00 17.97 ? 258  CYS A CA  1 
ATOM   1037 C  C   . CYS A 1 145 ? 15.067  16.361 -37.343 1.00 19.26 ? 258  CYS A C   1 
ATOM   1038 O  O   . CYS A 1 145 ? 14.557  16.095 -38.425 1.00 19.79 ? 258  CYS A O   1 
ATOM   1039 C  CB  . CYS A 1 145 ? 13.772  16.253 -35.223 1.00 17.27 ? 258  CYS A CB  1 
ATOM   1040 S  SG  . CYS A 1 145 ? 12.941  15.144 -34.072 1.00 18.66 ? 258  CYS A SG  1 
ATOM   1041 N  N   . GLN A 1 146 ? 15.905  17.379 -37.167 1.00 20.06 ? 259  GLN A N   1 
ATOM   1042 C  CA  . GLN A 1 146 ? 16.331  18.213 -38.287 1.00 21.23 ? 259  GLN A CA  1 
ATOM   1043 C  C   . GLN A 1 146 ? 17.024  17.368 -39.362 1.00 21.14 ? 259  GLN A C   1 
ATOM   1044 O  O   . GLN A 1 146 ? 16.728  17.501 -40.540 1.00 21.05 ? 259  GLN A O   1 
ATOM   1045 C  CB  . GLN A 1 146 ? 17.191  19.395 -37.783 1.00 21.80 ? 259  GLN A CB  1 
ATOM   1046 C  CG  . GLN A 1 146 ? 17.917  20.167 -38.879 1.00 24.06 ? 259  GLN A CG  1 
ATOM   1047 C  CD  . GLN A 1 146 ? 18.593  21.457 -38.384 1.00 25.76 ? 259  GLN A CD  1 
ATOM   1048 O  OE1 . GLN A 1 146 ? 18.543  21.788 -37.192 1.00 29.70 ? 259  GLN A OE1 1 
ATOM   1049 N  NE2 . GLN A 1 146 ? 19.232  22.179 -39.305 1.00 27.62 ? 259  GLN A NE2 1 
ATOM   1050 N  N   . TYR A 1 147 ? 17.904  16.459 -38.949 1.00 21.34 ? 260  TYR A N   1 
ATOM   1051 C  CA  . TYR A 1 147 ? 18.577  15.545 -39.880 1.00 22.22 ? 260  TYR A CA  1 
ATOM   1052 C  C   . TYR A 1 147 ? 17.575  14.707 -40.684 1.00 22.37 ? 260  TYR A C   1 
ATOM   1053 O  O   . TYR A 1 147 ? 17.777  14.461 -41.882 1.00 22.58 ? 260  TYR A O   1 
ATOM   1054 C  CB  . TYR A 1 147 ? 19.563  14.625 -39.136 1.00 22.42 ? 260  TYR A CB  1 
ATOM   1055 C  CG  . TYR A 1 147 ? 20.204  13.556 -39.997 1.00 22.90 ? 260  TYR A CG  1 
ATOM   1056 C  CD1 . TYR A 1 147 ? 21.229  13.874 -40.887 1.00 25.57 ? 260  TYR A CD1 1 
ATOM   1057 C  CD2 . TYR A 1 147 ? 19.791  12.229 -39.919 1.00 23.31 ? 260  TYR A CD2 1 
ATOM   1058 C  CE1 . TYR A 1 147 ? 21.818  12.907 -41.678 1.00 25.22 ? 260  TYR A CE1 1 
ATOM   1059 C  CE2 . TYR A 1 147 ? 20.364  11.253 -40.697 1.00 24.26 ? 260  TYR A CE2 1 
ATOM   1060 C  CZ  . TYR A 1 147 ? 21.374  11.592 -41.577 1.00 26.14 ? 260  TYR A CZ  1 
ATOM   1061 O  OH  . TYR A 1 147 ? 21.950  10.607 -42.351 1.00 28.50 ? 260  TYR A OH  1 
ATOM   1062 N  N   . LEU A 1 148 ? 16.497  14.291 -40.025 1.00 21.50 ? 261  LEU A N   1 
ATOM   1063 C  CA  . LEU A 1 148 ? 15.497  13.394 -40.619 1.00 22.70 ? 261  LEU A CA  1 
ATOM   1064 C  C   . LEU A 1 148 ? 14.381  14.143 -41.367 1.00 23.45 ? 261  LEU A C   1 
ATOM   1065 O  O   . LEU A 1 148 ? 13.524  13.529 -42.004 1.00 24.06 ? 261  LEU A O   1 
ATOM   1066 C  CB  . LEU A 1 148 ? 14.888  12.499 -39.523 1.00 21.68 ? 261  LEU A CB  1 
ATOM   1067 C  CG  . LEU A 1 148 ? 15.820  11.440 -38.910 1.00 22.26 ? 261  LEU A CG  1 
ATOM   1068 C  CD1 . LEU A 1 148 ? 15.104  10.681 -37.776 1.00 19.94 ? 261  LEU A CD1 1 
ATOM   1069 C  CD2 . LEU A 1 148 ? 16.354  10.457 -39.978 1.00 22.29 ? 261  LEU A CD2 1 
ATOM   1070 N  N   . GLY A 1 149 ? 14.401  15.469 -41.300 1.00 23.82 ? 262  GLY A N   1 
ATOM   1071 C  CA  . GLY A 1 149 ? 13.325  16.272 -41.833 1.00 25.42 ? 262  GLY A CA  1 
ATOM   1072 C  C   . GLY A 1 149 ? 12.022  16.161 -41.042 1.00 25.54 ? 262  GLY A C   1 
ATOM   1073 O  O   . GLY A 1 149 ? 10.956  16.410 -41.588 1.00 27.10 ? 262  GLY A O   1 
ATOM   1074 N  N   . LEU A 1 150 ? 12.104  15.802 -39.762 1.00 24.93 ? 263  LEU A N   1 
ATOM   1075 C  CA  . LEU A 1 150 ? 10.928  15.656 -38.911 1.00 24.78 ? 263  LEU A CA  1 
ATOM   1076 C  C   . LEU A 1 150 ? 10.709  16.900 -38.081 1.00 24.93 ? 263  LEU A C   1 
ATOM   1077 O  O   . LEU A 1 150 ? 11.672  17.444 -37.534 1.00 24.67 ? 263  LEU A O   1 
ATOM   1078 C  CB  . LEU A 1 150 ? 11.093  14.493 -37.935 1.00 23.72 ? 263  LEU A CB  1 
ATOM   1079 C  CG  . LEU A 1 150 ? 11.354  13.091 -38.477 1.00 25.07 ? 263  LEU A CG  1 
ATOM   1080 C  CD1 . LEU A 1 150 ? 11.549  12.120 -37.278 1.00 23.44 ? 263  LEU A CD1 1 
ATOM   1081 C  CD2 . LEU A 1 150 ? 10.247  12.648 -39.427 1.00 26.52 ? 263  LEU A CD2 1 
ATOM   1082 N  N   . PRO A 1 151 ? 9.445   17.351 -37.955 1.00 25.88 ? 264  PRO A N   1 
ATOM   1083 C  CA  . PRO A 1 151 ? 9.187   18.445 -37.025 1.00 25.83 ? 264  PRO A CA  1 
ATOM   1084 C  C   . PRO A 1 151 ? 9.364   18.003 -35.578 1.00 24.64 ? 264  PRO A C   1 
ATOM   1085 O  O   . PRO A 1 151 ? 9.263   16.815 -35.275 1.00 25.34 ? 264  PRO A O   1 
ATOM   1086 C  CB  . PRO A 1 151 ? 7.721   18.808 -37.291 1.00 27.30 ? 264  PRO A CB  1 
ATOM   1087 C  CG  . PRO A 1 151 ? 7.115   17.550 -37.877 1.00 28.00 ? 264  PRO A CG  1 
ATOM   1088 C  CD  . PRO A 1 151 ? 8.220   16.910 -38.656 1.00 27.51 ? 264  PRO A CD  1 
ATOM   1089 N  N   . VAL A 1 152 ? 9.639   18.957 -34.702 1.00 23.94 ? 265  VAL A N   1 
ATOM   1090 C  CA  . VAL A 1 152 ? 9.738   18.693 -33.265 1.00 22.59 ? 265  VAL A CA  1 
ATOM   1091 C  C   . VAL A 1 152 ? 8.446   19.190 -32.644 1.00 22.21 ? 265  VAL A C   1 
ATOM   1092 O  O   . VAL A 1 152 ? 8.139   20.369 -32.749 1.00 22.82 ? 265  VAL A O   1 
ATOM   1093 C  CB  . VAL A 1 152 ? 10.921  19.441 -32.635 1.00 22.50 ? 265  VAL A CB  1 
ATOM   1094 C  CG1 . VAL A 1 152 ? 11.039  19.123 -31.113 1.00 21.02 ? 265  VAL A CG1 1 
ATOM   1095 C  CG2 . VAL A 1 152 ? 12.206  19.104 -33.385 1.00 23.00 ? 265  VAL A CG2 1 
ATOM   1096 N  N   . ALA A 1 153 ? 7.670   18.293 -32.049 1.00 21.22 ? 266  ALA A N   1 
ATOM   1097 C  CA  . ALA A 1 153 ? 6.409   18.698 -31.421 1.00 21.59 ? 266  ALA A CA  1 
ATOM   1098 C  C   . ALA A 1 153 ? 6.662   19.809 -30.384 1.00 20.56 ? 266  ALA A C   1 
ATOM   1099 O  O   . ALA A 1 153 ? 7.692   19.818 -29.707 1.00 19.45 ? 266  ALA A O   1 
ATOM   1100 C  CB  . ALA A 1 153 ? 5.716   17.503 -30.786 1.00 20.76 ? 266  ALA A CB  1 
ATOM   1101 N  N   . ASP A 1 154 ? 5.731   20.752 -30.290 1.00 21.36 ? 267  ASP A N   1 
ATOM   1102 C  CA  . ASP A 1 154 ? 5.865   21.906 -29.398 1.00 21.61 ? 267  ASP A CA  1 
ATOM   1103 C  C   . ASP A 1 154 ? 6.093   21.551 -27.927 1.00 19.40 ? 267  ASP A C   1 
ATOM   1104 O  O   . ASP A 1 154 ? 6.803   22.259 -27.227 1.00 18.87 ? 267  ASP A O   1 
ATOM   1105 C  CB  . ASP A 1 154 ? 4.655   22.846 -29.534 1.00 23.94 ? 267  ASP A CB  1 
ATOM   1106 C  CG  . ASP A 1 154 ? 4.658   23.646 -30.849 1.00 28.81 ? 267  ASP A CG  1 
ATOM   1107 O  OD1 . ASP A 1 154 ? 5.619   23.540 -31.659 1.00 33.18 ? 267  ASP A OD1 1 
ATOM   1108 O  OD2 . ASP A 1 154 ? 3.675   24.389 -31.075 1.00 36.10 ? 267  ASP A OD2 1 
ATOM   1109 N  N   . TYR A 1 155 ? 5.526   20.449 -27.462 1.00 18.79 ? 268  TYR A N   1 
ATOM   1110 C  CA  . TYR A 1 155 ? 5.734   20.036 -26.074 1.00 18.12 ? 268  TYR A CA  1 
ATOM   1111 C  C   . TYR A 1 155 ? 7.179   19.649 -25.699 1.00 17.25 ? 268  TYR A C   1 
ATOM   1112 O  O   . TYR A 1 155 ? 7.508   19.617 -24.518 1.00 16.99 ? 268  TYR A O   1 
ATOM   1113 C  CB  . TYR A 1 155 ? 4.765   18.934 -25.651 1.00 17.82 ? 268  TYR A CB  1 
ATOM   1114 C  CG  . TYR A 1 155 ? 4.590   17.777 -26.611 1.00 18.08 ? 268  TYR A CG  1 
ATOM   1115 C  CD1 . TYR A 1 155 ? 3.434   17.668 -27.385 1.00 18.18 ? 268  TYR A CD1 1 
ATOM   1116 C  CD2 . TYR A 1 155 ? 5.543   16.776 -26.718 1.00 17.02 ? 268  TYR A CD2 1 
ATOM   1117 C  CE1 . TYR A 1 155 ? 3.240   16.613 -28.243 1.00 19.02 ? 268  TYR A CE1 1 
ATOM   1118 C  CE2 . TYR A 1 155 ? 5.351   15.686 -27.593 1.00 17.09 ? 268  TYR A CE2 1 
ATOM   1119 C  CZ  . TYR A 1 155 ? 4.199   15.610 -28.344 1.00 18.66 ? 268  TYR A CZ  1 
ATOM   1120 O  OH  . TYR A 1 155 ? 3.983   14.542 -29.216 1.00 19.16 ? 268  TYR A OH  1 
ATOM   1121 N  N   . PHE A 1 156 ? 8.029   19.352 -26.685 1.00 17.18 ? 269  PHE A N   1 
ATOM   1122 C  CA  . PHE A 1 156 ? 9.450   19.106 -26.443 1.00 16.63 ? 269  PHE A CA  1 
ATOM   1123 C  C   . PHE A 1 156 ? 10.296  20.382 -26.321 1.00 17.44 ? 269  PHE A C   1 
ATOM   1124 O  O   . PHE A 1 156 ? 11.532  20.301 -26.187 1.00 17.26 ? 269  PHE A O   1 
ATOM   1125 C  CB  . PHE A 1 156 ? 10.053  18.279 -27.588 1.00 16.45 ? 269  PHE A CB  1 
ATOM   1126 C  CG  . PHE A 1 156 ? 9.591   16.861 -27.634 1.00 16.00 ? 269  PHE A CG  1 
ATOM   1127 C  CD1 . PHE A 1 156 ? 9.045   16.337 -28.795 1.00 18.28 ? 269  PHE A CD1 1 
ATOM   1128 C  CD2 . PHE A 1 156 ? 9.703   16.044 -26.533 1.00 15.08 ? 269  PHE A CD2 1 
ATOM   1129 C  CE1 . PHE A 1 156 ? 8.614   15.019 -28.842 1.00 17.20 ? 269  PHE A CE1 1 
ATOM   1130 C  CE2 . PHE A 1 156 ? 9.278   14.728 -26.587 1.00 16.02 ? 269  PHE A CE2 1 
ATOM   1131 C  CZ  . PHE A 1 156 ? 8.734   14.222 -27.734 1.00 14.42 ? 269  PHE A CZ  1 
ATOM   1132 N  N   . LYS A 1 157 ? 9.675   21.556 -26.421 1.00 17.97 ? 270  LYS A N   1 
ATOM   1133 C  CA  . LYS A 1 157 ? 10.445  22.778 -26.590 1.00 18.78 ? 270  LYS A CA  1 
ATOM   1134 C  C   . LYS A 1 157 ? 10.561  23.593 -25.323 1.00 18.53 ? 270  LYS A C   1 
ATOM   1135 O  O   . LYS A 1 157 ? 11.212  24.635 -25.327 1.00 19.73 ? 270  LYS A O   1 
ATOM   1136 C  CB  . LYS A 1 157 ? 9.850   23.607 -27.716 1.00 20.11 ? 270  LYS A CB  1 
ATOM   1137 C  CG  . LYS A 1 157 ? 10.013  22.952 -29.062 1.00 21.47 ? 270  LYS A CG  1 
ATOM   1138 C  CD  . LYS A 1 157 ? 9.332   23.749 -30.149 1.00 22.18 ? 270  LYS A CD  1 
ATOM   1139 C  CE  . LYS A 1 157 ? 9.491   23.032 -31.476 1.00 24.36 ? 270  LYS A CE  1 
ATOM   1140 N  NZ  . LYS A 1 157 ? 8.636   23.629 -32.537 1.00 27.17 ? 270  LYS A NZ  1 
ATOM   1141 N  N   . GLN A 1 158 ? 9.923   23.126 -24.252 1.00 18.07 ? 271  GLN A N   1 
ATOM   1142 C  CA  . GLN A 1 158 ? 10.051  23.730 -22.931 1.00 18.29 ? 271  GLN A CA  1 
ATOM   1143 C  C   . GLN A 1 158 ? 10.404  22.586 -22.003 1.00 16.83 ? 271  GLN A C   1 
ATOM   1144 O  O   . GLN A 1 158 ? 9.795   21.523 -22.092 1.00 17.00 ? 271  GLN A O   1 
ATOM   1145 C  CB  . GLN A 1 158 ? 8.727   24.371 -22.467 1.00 19.81 ? 271  GLN A CB  1 
ATOM   1146 C  CG  . GLN A 1 158 ? 8.042   25.307 -23.501 1.00 24.91 ? 271  GLN A CG  1 
ATOM   1147 C  CD  . GLN A 1 158 ? 7.094   24.579 -24.473 1.00 28.16 ? 271  GLN A CD  1 
ATOM   1148 O  OE1 . GLN A 1 158 ? 6.687   23.432 -24.239 1.00 32.07 ? 271  GLN A OE1 1 
ATOM   1149 N  NE2 . GLN A 1 158 ? 6.727   25.256 -25.558 1.00 29.45 ? 271  GLN A NE2 1 
ATOM   1150 N  N   . TRP A 1 159 ? 11.378  22.797 -21.122 1.00 15.53 ? 272  TRP A N   1 
ATOM   1151 C  CA  . TRP A 1 159 ? 11.774  21.797 -20.159 1.00 14.58 ? 272  TRP A CA  1 
ATOM   1152 C  C   . TRP A 1 159 ? 12.436  22.401 -18.916 1.00 14.12 ? 272  TRP A C   1 
ATOM   1153 O  O   . TRP A 1 159 ? 12.755  23.594 -18.856 1.00 13.53 ? 272  TRP A O   1 
ATOM   1154 C  CB  . TRP A 1 159 ? 12.669  20.702 -20.786 1.00 14.29 ? 272  TRP A CB  1 
ATOM   1155 C  CG  . TRP A 1 159 ? 14.020  21.171 -21.189 1.00 15.19 ? 272  TRP A CG  1 
ATOM   1156 C  CD1 . TRP A 1 159 ? 15.168  21.162 -20.422 1.00 15.40 ? 272  TRP A CD1 1 
ATOM   1157 C  CD2 . TRP A 1 159 ? 14.389  21.736 -22.454 1.00 15.18 ? 272  TRP A CD2 1 
ATOM   1158 N  NE1 . TRP A 1 159 ? 16.212  21.690 -21.142 1.00 15.65 ? 272  TRP A NE1 1 
ATOM   1159 C  CE2 . TRP A 1 159 ? 15.764  22.053 -22.384 1.00 15.96 ? 272  TRP A CE2 1 
ATOM   1160 C  CE3 . TRP A 1 159 ? 13.686  22.020 -23.630 1.00 15.36 ? 272  TRP A CE3 1 
ATOM   1161 C  CZ2 . TRP A 1 159 ? 16.449  22.633 -23.446 1.00 17.56 ? 272  TRP A CZ2 1 
ATOM   1162 C  CZ3 . TRP A 1 159 ? 14.368  22.593 -24.694 1.00 16.72 ? 272  TRP A CZ3 1 
ATOM   1163 C  CH2 . TRP A 1 159 ? 15.733  22.899 -24.594 1.00 17.60 ? 272  TRP A CH2 1 
ATOM   1164 N  N   . ILE A 1 160 ? 12.604  21.526 -17.931 1.00 13.70 ? 273  ILE A N   1 
ATOM   1165 C  CA  . ILE A 1 160 ? 13.322  21.800 -16.707 1.00 13.91 ? 273  ILE A CA  1 
ATOM   1166 C  C   . ILE A 1 160 ? 14.568  20.927 -16.669 1.00 13.48 ? 273  ILE A C   1 
ATOM   1167 O  O   . ILE A 1 160 ? 14.481  19.714 -16.720 1.00 12.92 ? 273  ILE A O   1 
ATOM   1168 C  CB  . ILE A 1 160 ? 12.467  21.452 -15.464 1.00 13.45 ? 273  ILE A CB  1 
ATOM   1169 C  CG1 . ILE A 1 160 ? 11.116  22.181 -15.521 1.00 14.25 ? 273  ILE A CG1 1 
ATOM   1170 C  CG2 . ILE A 1 160 ? 13.226  21.805 -14.206 1.00 14.03 ? 273  ILE A CG2 1 
ATOM   1171 C  CD1 . ILE A 1 160 ? 10.222  21.951 -14.315 1.00 12.32 ? 273  ILE A CD1 1 
ATOM   1172 N  N   . ASN A 1 161 ? 15.719  21.564 -16.585 1.00 14.01 ? 274  ASN A N   1 
ATOM   1173 C  CA  . ASN A 1 161 ? 16.974  20.890 -16.309 1.00 14.76 ? 274  ASN A CA  1 
ATOM   1174 C  C   . ASN A 1 161 ? 17.083  20.652 -14.793 1.00 15.00 ? 274  ASN A C   1 
ATOM   1175 O  O   . ASN A 1 161 ? 17.262  21.607 -14.027 1.00 15.11 ? 274  ASN A O   1 
ATOM   1176 C  CB  . ASN A 1 161 ? 18.133  21.767 -16.802 1.00 15.27 ? 274  ASN A CB  1 
ATOM   1177 C  CG  . ASN A 1 161 ? 19.482  21.162 -16.550 1.00 15.88 ? 274  ASN A CG  1 
ATOM   1178 O  OD1 . ASN A 1 161 ? 19.608  20.172 -15.858 1.00 18.26 ? 274  ASN A OD1 1 
ATOM   1179 N  ND2 . ASN A 1 161 ? 20.510  21.768 -17.112 1.00 16.08 ? 274  ASN A ND2 1 
ATOM   1180 N  N   . LEU A 1 162 ? 16.978  19.387 -14.378 1.00 15.00 ? 275  LEU A N   1 
ATOM   1181 C  CA  . LEU A 1 162 ? 17.064  19.016 -12.966 1.00 16.07 ? 275  LEU A CA  1 
ATOM   1182 C  C   . LEU A 1 162 ? 18.366  19.460 -12.291 1.00 17.83 ? 275  LEU A C   1 
ATOM   1183 O  O   . LEU A 1 162 ? 18.352  19.814 -11.090 1.00 18.28 ? 275  LEU A O   1 
ATOM   1184 C  CB  . LEU A 1 162 ? 16.899  17.499 -12.782 1.00 16.15 ? 275  LEU A CB  1 
ATOM   1185 C  CG  . LEU A 1 162 ? 16.914  16.994 -11.334 1.00 15.51 ? 275  LEU A CG  1 
ATOM   1186 C  CD1 . LEU A 1 162 ? 15.678  17.469 -10.569 1.00 15.19 ? 275  LEU A CD1 1 
ATOM   1187 C  CD2 . LEU A 1 162 ? 17.021  15.457 -11.302 1.00 16.36 ? 275  LEU A CD2 1 
ATOM   1188 N  N   . LYS A 1 163 ? 19.484  19.447 -13.029 1.00 18.39 ? 276  LYS A N   1 
ATOM   1189 C  CA  . LYS A 1 163 ? 20.758  19.881 -12.452 1.00 20.38 ? 276  LYS A CA  1 
ATOM   1190 C  C   . LYS A 1 163 ? 20.655  21.338 -11.994 1.00 20.96 ? 276  LYS A C   1 
ATOM   1191 O  O   . LYS A 1 163 ? 21.216  21.686 -10.957 1.00 21.42 ? 276  LYS A O   1 
ATOM   1192 C  CB  . LYS A 1 163 ? 21.942  19.671 -13.421 1.00 21.18 ? 276  LYS A CB  1 
ATOM   1193 C  CG  . LYS A 1 163 ? 22.253  18.179 -13.693 1.00 22.56 ? 276  LYS A CG  1 
ATOM   1194 C  CD  . LYS A 1 163 ? 23.161  17.918 -14.912 1.00 22.80 ? 276  LYS A CD  1 
ATOM   1195 C  CE  . LYS A 1 163 ? 24.562  18.372 -14.694 1.00 26.38 ? 276  LYS A CE  1 
ATOM   1196 N  NZ  . LYS A 1 163 ? 25.460  17.992 -15.831 1.00 26.79 ? 276  LYS A NZ  1 
ATOM   1197 N  N   . LYS A 1 164 ? 19.912  22.158 -12.750 1.00 20.41 ? 277  LYS A N   1 
ATOM   1198 C  CA  . LYS A 1 164 ? 19.710  23.574 -12.425 1.00 21.77 ? 277  LYS A CA  1 
ATOM   1199 C  C   . LYS A 1 164 ? 18.699  23.755 -11.282 1.00 21.34 ? 277  LYS A C   1 
ATOM   1200 O  O   . LYS A 1 164 ? 18.939  24.556 -10.356 1.00 21.45 ? 277  LYS A O   1 
ATOM   1201 C  CB  . LYS A 1 164 ? 19.274  24.376 -13.663 1.00 21.83 ? 277  LYS A CB  1 
ATOM   1202 C  CG  . LYS A 1 164 ? 20.383  24.610 -14.676 1.00 24.18 ? 277  LYS A CG  1 
ATOM   1203 C  CD  . LYS A 1 164 ? 19.852  25.228 -15.969 1.00 23.83 ? 277  LYS A CD  1 
ATOM   1204 C  CE  . LYS A 1 164 ? 20.989  25.664 -16.917 1.00 26.39 ? 277  LYS A CE  1 
ATOM   1205 N  NZ  . LYS A 1 164 ? 20.491  26.086 -18.285 1.00 26.91 ? 277  LYS A NZ  1 
ATOM   1206 N  N   . ALA A 1 165 ? 17.590  23.011 -11.331 1.00 19.99 ? 278  ALA A N   1 
ATOM   1207 C  CA  . ALA A 1 165 ? 16.632  22.990 -10.208 1.00 20.25 ? 278  ALA A CA  1 
ATOM   1208 C  C   . ALA A 1 165 ? 17.355  22.649 -8.892  1.00 21.60 ? 278  ALA A C   1 
ATOM   1209 O  O   . ALA A 1 165 ? 17.284  23.391 -7.895  1.00 22.49 ? 278  ALA A O   1 
ATOM   1210 C  CB  . ALA A 1 165 ? 15.495  22.004 -10.481 1.00 18.58 ? 278  ALA A CB  1 
ATOM   1211 N  N   . TYR A 1 166 ? 18.096  21.550 -8.927  1.00 22.12 ? 279  TYR A N   1 
ATOM   1212 C  CA  . TYR A 1 166 ? 18.908  21.084 -7.810  1.00 23.82 ? 279  TYR A CA  1 
ATOM   1213 C  C   . TYR A 1 166 ? 19.908  22.116 -7.296  1.00 25.85 ? 279  TYR A C   1 
ATOM   1214 O  O   . TYR A 1 166 ? 20.022  22.311 -6.086  1.00 26.13 ? 279  TYR A O   1 
ATOM   1215 C  CB  . TYR A 1 166 ? 19.663  19.827 -8.227  1.00 23.59 ? 279  TYR A CB  1 
ATOM   1216 C  CG  . TYR A 1 166 ? 20.465  19.201 -7.137  1.00 24.59 ? 279  TYR A CG  1 
ATOM   1217 C  CD1 . TYR A 1 166 ? 19.919  18.199 -6.337  1.00 23.85 ? 279  TYR A CD1 1 
ATOM   1218 C  CD2 . TYR A 1 166 ? 21.783  19.589 -6.906  1.00 26.44 ? 279  TYR A CD2 1 
ATOM   1219 C  CE1 . TYR A 1 166 ? 20.666  17.595 -5.339  1.00 26.33 ? 279  TYR A CE1 1 
ATOM   1220 C  CE2 . TYR A 1 166 ? 22.538  18.994 -5.904  1.00 28.34 ? 279  TYR A CE2 1 
ATOM   1221 C  CZ  . TYR A 1 166 ? 21.970  17.996 -5.125  1.00 27.59 ? 279  TYR A CZ  1 
ATOM   1222 O  OH  . TYR A 1 166 ? 22.703  17.401 -4.137  1.00 29.05 ? 279  TYR A OH  1 
ATOM   1223 N  N   . SER A 1 167 ? 20.630  22.774 -8.202  1.00 27.40 ? 280  SER A N   1 
ATOM   1224 C  CA  . SER A 1 167 ? 21.612  23.775 -7.783  1.00 30.38 ? 280  SER A CA  1 
ATOM   1225 C  C   . SER A 1 167 ? 20.950  24.968 -7.081  1.00 31.25 ? 280  SER A C   1 
ATOM   1226 O  O   . SER A 1 167 ? 21.517  25.514 -6.147  1.00 31.78 ? 280  SER A O   1 
ATOM   1227 C  CB  . SER A 1 167 ? 22.468  24.259 -8.946  1.00 30.96 ? 280  SER A CB  1 
ATOM   1228 O  OG  . SER A 1 167 ? 21.830  25.338 -9.591  1.00 33.11 ? 280  SER A OG  1 
ATOM   1229 N  N   . PHE A 1 168 ? 19.753  25.350 -7.532  1.00 31.47 ? 281  PHE A N   1 
ATOM   1230 C  CA  . PHE A 1 168 ? 18.942  26.377 -6.850  1.00 32.86 ? 281  PHE A CA  1 
ATOM   1231 C  C   . PHE A 1 168 ? 18.503  25.923 -5.446  1.00 33.14 ? 281  PHE A C   1 
ATOM   1232 O  O   . PHE A 1 168 ? 18.629  26.670 -4.479  1.00 34.21 ? 281  PHE A O   1 
ATOM   1233 C  CB  . PHE A 1 168 ? 17.673  26.720 -7.651  1.00 32.52 ? 281  PHE A CB  1 
ATOM   1234 C  CG  . PHE A 1 168 ? 17.913  27.483 -8.945  1.00 33.36 ? 281  PHE A CG  1 
ATOM   1235 C  CD1 . PHE A 1 168 ? 17.090  27.243 -10.052 1.00 32.45 ? 281  PHE A CD1 1 
ATOM   1236 C  CD2 . PHE A 1 168 ? 18.906  28.468 -9.045  1.00 36.56 ? 281  PHE A CD2 1 
ATOM   1237 C  CE1 . PHE A 1 168 ? 17.269  27.945 -11.250 1.00 34.62 ? 281  PHE A CE1 1 
ATOM   1238 C  CE2 . PHE A 1 168 ? 19.106  29.174 -10.237 1.00 36.54 ? 281  PHE A CE2 1 
ATOM   1239 C  CZ  . PHE A 1 168 ? 18.288  28.920 -11.341 1.00 35.94 ? 281  PHE A CZ  1 
ATOM   1240 N  N   . ALA A 1 169 ? 17.973  24.706 -5.354  1.00 32.21 ? 282  ALA A N   1 
ATOM   1241 C  CA  . ALA A 1 169 ? 17.562  24.123 -4.071  1.00 32.74 ? 282  ALA A CA  1 
ATOM   1242 C  C   . ALA A 1 169 ? 18.726  23.879 -3.091  1.00 34.67 ? 282  ALA A C   1 
ATOM   1243 O  O   . ALA A 1 169 ? 18.581  24.087 -1.893  1.00 35.82 ? 282  ALA A O   1 
ATOM   1244 C  CB  . ALA A 1 169 ? 16.780  22.832 -4.304  1.00 31.04 ? 282  ALA A CB  1 
ATOM   1245 N  N   . MET A 1 170 ? 19.879  23.466 -3.600  1.00 35.58 ? 283  MET A N   1 
ATOM   1246 C  CA  . MET A 1 170 ? 20.970  23.020 -2.742  1.00 37.48 ? 283  MET A CA  1 
ATOM   1247 C  C   . MET A 1 170 ? 22.156  23.980 -2.689  1.00 39.69 ? 283  MET A C   1 
ATOM   1248 O  O   . MET A 1 170 ? 23.076  23.790 -1.883  1.00 41.96 ? 283  MET A O   1 
ATOM   1249 C  CB  . MET A 1 170 ? 21.435  21.637 -3.199  1.00 37.16 ? 283  MET A CB  1 
ATOM   1250 C  CG  . MET A 1 170 ? 20.331  20.586 -3.157  1.00 36.07 ? 283  MET A CG  1 
ATOM   1251 S  SD  . MET A 1 170 ? 19.784  20.159 -1.492  1.00 37.60 ? 283  MET A SD  1 
ATOM   1252 C  CE  . MET A 1 170 ? 21.274  19.425 -0.839  1.00 33.48 ? 283  MET A CE  1 
ATOM   1253 N  N   . GLY A 1 171 ? 22.129  25.010 -3.531  1.00 39.73 ? 284  GLY A N   1 
ATOM   1254 C  CA  . GLY A 1 171 ? 23.196  26.004 -3.589  1.00 41.82 ? 284  GLY A CA  1 
ATOM   1255 C  C   . GLY A 1 171 ? 24.495  25.405 -4.075  1.00 43.08 ? 284  GLY A C   1 
ATOM   1256 O  O   . GLY A 1 171 ? 25.577  25.760 -3.610  1.00 45.45 ? 284  GLY A O   1 
ATOM   1257 N  N   . CYS A 1 172 ? 24.392  24.503 -5.037  1.00 42.22 ? 285  CYS A N   1 
ATOM   1258 C  CA  . CYS A 1 172 ? 25.507  23.644 -5.366  1.00 42.84 ? 285  CYS A CA  1 
ATOM   1259 C  C   . CYS A 1 172 ? 25.281  22.894 -6.680  1.00 40.83 ? 285  CYS A C   1 
ATOM   1260 O  O   . CYS A 1 172 ? 24.273  22.197 -6.834  1.00 38.84 ? 285  CYS A O   1 
ATOM   1261 C  CB  . CYS A 1 172 ? 25.663  22.647 -4.232  1.00 43.85 ? 285  CYS A CB  1 
ATOM   1262 S  SG  . CYS A 1 172 ? 27.002  21.567 -4.450  1.00 47.49 ? 285  CYS A SG  1 
ATOM   1263 N  N   . TRP A 1 173 ? 26.230  23.024 -7.607  1.00 41.05 ? 286  TRP A N   1 
ATOM   1264 C  CA  . TRP A 1 173 ? 26.125  22.407 -8.924  1.00 39.61 ? 286  TRP A CA  1 
ATOM   1265 C  C   . TRP A 1 173 ? 26.557  20.940 -8.888  1.00 39.44 ? 286  TRP A C   1 
ATOM   1266 O  O   . TRP A 1 173 ? 27.693  20.650 -8.524  1.00 40.86 ? 286  TRP A O   1 
ATOM   1267 C  CB  . TRP A 1 173 ? 26.999  23.154 -9.938  1.00 40.58 ? 286  TRP A CB  1 
ATOM   1268 C  CG  . TRP A 1 173 ? 26.805  22.637 -11.317 1.00 39.10 ? 286  TRP A CG  1 
ATOM   1269 C  CD1 . TRP A 1 173 ? 27.654  21.843 -12.026 1.00 39.33 ? 286  TRP A CD1 1 
ATOM   1270 C  CD2 . TRP A 1 173 ? 25.659  22.838 -12.137 1.00 36.44 ? 286  TRP A CD2 1 
ATOM   1271 N  NE1 . TRP A 1 173 ? 27.111  21.548 -13.252 1.00 38.08 ? 286  TRP A NE1 1 
ATOM   1272 C  CE2 . TRP A 1 173 ? 25.884  22.148 -13.344 1.00 36.43 ? 286  TRP A CE2 1 
ATOM   1273 C  CE3 . TRP A 1 173 ? 24.471  23.550 -11.978 1.00 35.78 ? 286  TRP A CE3 1 
ATOM   1274 C  CZ2 . TRP A 1 173 ? 24.956  22.147 -14.389 1.00 35.23 ? 286  TRP A CZ2 1 
ATOM   1275 C  CZ3 . TRP A 1 173 ? 23.546  23.542 -13.016 1.00 34.58 ? 286  TRP A CZ3 1 
ATOM   1276 C  CH2 . TRP A 1 173 ? 23.798  22.851 -14.205 1.00 33.85 ? 286  TRP A CH2 1 
ATOM   1277 N  N   . PRO A 1 174 ? 25.657  20.010 -9.282  1.00 37.67 ? 287  PRO A N   1 
ATOM   1278 C  CA  . PRO A 1 174 ? 26.040  18.599 -9.343  1.00 37.92 ? 287  PRO A CA  1 
ATOM   1279 C  C   . PRO A 1 174 ? 26.778  18.256 -10.640 1.00 37.91 ? 287  PRO A C   1 
ATOM   1280 O  O   . PRO A 1 174 ? 26.150  17.844 -11.616 1.00 35.88 ? 287  PRO A O   1 
ATOM   1281 C  CB  . PRO A 1 174 ? 24.693  17.879 -9.264  1.00 35.55 ? 287  PRO A CB  1 
ATOM   1282 C  CG  . PRO A 1 174 ? 23.743  18.813 -9.919  1.00 34.30 ? 287  PRO A CG  1 
ATOM   1283 C  CD  . PRO A 1 174 ? 24.250  20.203 -9.685  1.00 35.52 ? 287  PRO A CD  1 
ATOM   1284 N  N   . LYS A 1 175 ? 28.103  18.420 -10.645 1.00 40.28 ? 288  LYS A N   1 
ATOM   1285 C  CA  . LYS A 1 175 ? 28.883  18.178 -11.876 1.00 40.72 ? 288  LYS A CA  1 
ATOM   1286 C  C   . LYS A 1 175 ? 28.704  16.751 -12.392 1.00 39.89 ? 288  LYS A C   1 
ATOM   1287 O  O   . LYS A 1 175 ? 28.523  16.543 -13.606 1.00 39.23 ? 288  LYS A O   1 
ATOM   1288 C  CB  . LYS A 1 175 ? 30.376  18.528 -11.722 1.00 43.50 ? 288  LYS A CB  1 
ATOM   1289 C  CG  . LYS A 1 175 ? 31.086  17.908 -10.531 1.00 45.98 ? 288  LYS A CG  1 
ATOM   1290 C  CD  . LYS A 1 175 ? 32.598  17.833 -10.741 1.00 48.48 ? 288  LYS A CD  1 
ATOM   1291 C  CE  . LYS A 1 175 ? 33.304  17.371 -9.460  1.00 51.20 ? 288  LYS A CE  1 
ATOM   1292 N  NZ  . LYS A 1 175 ? 34.717  16.971 -9.696  1.00 54.34 ? 288  LYS A NZ  1 
ATOM   1293 N  N   . ASN A 1 176 ? 28.684  15.780 -11.478 1.00 39.90 ? 289  ASN A N   1 
ATOM   1294 C  CA  . ASN A 1 176 ? 28.528  14.371 -11.872 1.00 39.29 ? 289  ASN A CA  1 
ATOM   1295 C  C   . ASN A 1 176 ? 27.069  13.917 -12.021 1.00 36.37 ? 289  ASN A C   1 
ATOM   1296 O  O   . ASN A 1 176 ? 26.796  12.717 -11.953 1.00 36.50 ? 289  ASN A O   1 
ATOM   1297 C  CB  . ASN A 1 176 ? 29.264  13.448 -10.888 1.00 41.60 ? 289  ASN A CB  1 
ATOM   1298 C  CG  . ASN A 1 176 ? 30.673  13.917 -10.592 1.00 45.51 ? 289  ASN A CG  1 
ATOM   1299 O  OD1 . ASN A 1 176 ? 31.361  14.440 -11.473 1.00 48.60 ? 289  ASN A OD1 1 
ATOM   1300 N  ND2 . ASN A 1 176 ? 31.114  13.739 -9.344  1.00 49.17 ? 289  ASN A ND2 1 
ATOM   1301 N  N   . GLY A 1 177 ? 26.152  14.873 -12.219 1.00 34.06 ? 290  GLY A N   1 
ATOM   1302 C  CA  . GLY A 1 177 ? 24.737  14.600 -12.511 1.00 31.28 ? 290  GLY A CA  1 
ATOM   1303 C  C   . GLY A 1 177 ? 23.967  13.816 -11.456 1.00 30.07 ? 290  GLY A C   1 
ATOM   1304 O  O   . GLY A 1 177 ? 24.035  14.131 -10.278 1.00 29.84 ? 290  GLY A O   1 
ATOM   1305 N  N   . LEU A 1 178 ? 23.241  12.787 -11.892 1.00 28.62 ? 291  LEU A N   1 
ATOM   1306 C  CA  . LEU A 1 178 ? 22.419  11.969 -11.000 1.00 28.41 ? 291  LEU A CA  1 
ATOM   1307 C  C   . LEU A 1 178 ? 23.170  11.412 -9.784  1.00 29.81 ? 291  LEU A C   1 
ATOM   1308 O  O   . LEU A 1 178 ? 22.625  11.368 -8.677  1.00 29.22 ? 291  LEU A O   1 
ATOM   1309 C  CB  . LEU A 1 178 ? 21.769  10.815 -11.770 1.00 27.57 ? 291  LEU A CB  1 
ATOM   1310 C  CG  . LEU A 1 178 ? 20.674  11.182 -12.771 1.00 25.83 ? 291  LEU A CG  1 
ATOM   1311 C  CD1 . LEU A 1 178 ? 20.166  9.929  -13.457 1.00 24.18 ? 291  LEU A CD1 1 
ATOM   1312 C  CD2 . LEU A 1 178 ? 19.526  11.931 -12.079 1.00 24.31 ? 291  LEU A CD2 1 
ATOM   1313 N  N   . LEU A 1 179 ? 24.416  11.004 -9.985  1.00 31.74 ? 292  LEU A N   1 
ATOM   1314 C  CA  . LEU A 1 179 ? 25.204  10.401 -8.916  1.00 33.69 ? 292  LEU A CA  1 
ATOM   1315 C  C   . LEU A 1 179 ? 25.530  11.423 -7.817  1.00 34.27 ? 292  LEU A C   1 
ATOM   1316 O  O   . LEU A 1 179 ? 25.511  11.093 -6.626  1.00 35.25 ? 292  LEU A O   1 
ATOM   1317 C  CB  . LEU A 1 179 ? 26.480  9.763  -9.484  1.00 36.10 ? 292  LEU A CB  1 
ATOM   1318 C  CG  . LEU A 1 179 ? 26.263  8.621  -10.506 1.00 37.04 ? 292  LEU A CG  1 
ATOM   1319 C  CD1 . LEU A 1 179 ? 27.600  8.187  -11.130 1.00 39.93 ? 292  LEU A CD1 1 
ATOM   1320 C  CD2 . LEU A 1 179 ? 25.529  7.407  -9.905  1.00 37.85 ? 292  LEU A CD2 1 
ATOM   1321 N  N   . ASP A 1 180 ? 25.822  12.657 -8.219  1.00 33.44 ? 293  ASP A N   1 
ATOM   1322 C  CA  . ASP A 1 180 ? 26.055  13.744 -7.265  1.00 33.93 ? 293  ASP A CA  1 
ATOM   1323 C  C   . ASP A 1 180 ? 24.764  14.170 -6.548  1.00 31.83 ? 293  ASP A C   1 
ATOM   1324 O  O   . ASP A 1 180 ? 24.767  14.439 -5.341  1.00 32.05 ? 293  ASP A O   1 
ATOM   1325 C  CB  . ASP A 1 180 ? 26.676  14.962 -7.968  1.00 34.75 ? 293  ASP A CB  1 
ATOM   1326 C  CG  . ASP A 1 180 ? 28.192  14.960 -7.928  1.00 38.70 ? 293  ASP A CG  1 
ATOM   1327 O  OD1 . ASP A 1 180 ? 28.801  13.972 -7.471  1.00 43.96 ? 293  ASP A OD1 1 
ATOM   1328 O  OD2 . ASP A 1 180 ? 28.788  15.968 -8.355  1.00 42.73 ? 293  ASP A OD2 1 
ATOM   1329 N  N   . MET A 1 181 ? 23.665  14.229 -7.289  1.00 28.94 ? 294  MET A N   1 
ATOM   1330 C  CA  . MET A 1 181 ? 22.379  14.599 -6.702  1.00 27.31 ? 294  MET A CA  1 
ATOM   1331 C  C   . MET A 1 181 ? 21.887  13.547 -5.699  1.00 27.32 ? 294  MET A C   1 
ATOM   1332 O  O   . MET A 1 181 ? 21.451  13.888 -4.594  1.00 27.02 ? 294  MET A O   1 
ATOM   1333 C  CB  . MET A 1 181 ? 21.350  14.869 -7.803  1.00 25.04 ? 294  MET A CB  1 
ATOM   1334 C  CG  . MET A 1 181 ? 21.726  16.085 -8.633  1.00 24.05 ? 294  MET A CG  1 
ATOM   1335 S  SD  . MET A 1 181 ? 20.454  16.654 -9.754  1.00 23.14 ? 294  MET A SD  1 
ATOM   1336 C  CE  . MET A 1 181 ? 20.709  15.512 -11.126 1.00 23.18 ? 294  MET A CE  1 
ATOM   1337 N  N   . ASN A 1 182 ? 21.972  12.274 -6.070  1.00 27.07 ? 295  ASN A N   1 
ATOM   1338 C  CA  . ASN A 1 182 ? 21.670  11.197 -5.131  1.00 27.86 ? 295  ASN A CA  1 
ATOM   1339 C  C   . ASN A 1 182 ? 22.526  11.305 -3.866  1.00 29.82 ? 295  ASN A C   1 
ATOM   1340 O  O   . ASN A 1 182 ? 21.988  11.239 -2.763  1.00 29.94 ? 295  ASN A O   1 
ATOM   1341 C  CB  . ASN A 1 182 ? 21.809  9.817  -5.800  1.00 27.88 ? 295  ASN A CB  1 
ATOM   1342 C  CG  . ASN A 1 182 ? 20.606  9.473  -6.680  1.00 26.04 ? 295  ASN A CG  1 
ATOM   1343 O  OD1 . ASN A 1 182 ? 19.503  9.975  -6.464  1.00 25.44 ? 295  ASN A OD1 1 
ATOM   1344 N  ND2 . ASN A 1 182 ? 20.810  8.606  -7.654  1.00 25.02 ? 295  ASN A ND2 1 
ATOM   1345 N  N   . LYS A 1 183 ? 23.839  11.500 -4.028  1.00 31.59 ? 296  LYS A N   1 
ATOM   1346 C  CA  . LYS A 1 183 ? 24.756  11.684 -2.883  1.00 34.08 ? 296  LYS A CA  1 
ATOM   1347 C  C   . LYS A 1 183 ? 24.280  12.809 -1.963  1.00 33.78 ? 296  LYS A C   1 
ATOM   1348 O  O   . LYS A 1 183 ? 24.166  12.626 -0.753  1.00 34.28 ? 296  LYS A O   1 
ATOM   1349 C  CB  . LYS A 1 183 ? 26.187  12.013 -3.334  1.00 35.84 ? 296  LYS A CB  1 
ATOM   1350 C  CG  . LYS A 1 183 ? 27.033  10.819 -3.713  1.00 38.16 ? 296  LYS A CG  1 
ATOM   1351 C  CD  . LYS A 1 183 ? 28.503  11.037 -3.344  1.00 40.87 ? 296  LYS A CD  1 
ATOM   1352 C  CE  . LYS A 1 183 ? 29.336  9.784  -3.609  1.00 43.65 ? 296  LYS A CE  1 
ATOM   1353 N  NZ  . LYS A 1 183 ? 30.394  9.570  -2.598  1.00 46.80 ? 296  LYS A NZ  1 
ATOM   1354 N  N   . GLY A 1 184 ? 23.998  13.967 -2.554  1.00 31.97 ? 297  GLY A N   1 
ATOM   1355 C  CA  . GLY A 1 184 ? 23.628  15.135 -1.779  1.00 32.15 ? 297  GLY A CA  1 
ATOM   1356 C  C   . GLY A 1 184 ? 22.327  14.989 -1.015  1.00 31.20 ? 297  GLY A C   1 
ATOM   1357 O  O   . GLY A 1 184 ? 22.159  15.612 0.022   1.00 32.34 ? 297  GLY A O   1 
ATOM   1358 N  N   . LEU A 1 185 ? 21.412  14.164 -1.522  1.00 29.39 ? 298  LEU A N   1 
ATOM   1359 C  CA  . LEU A 1 185 ? 20.112  13.971 -0.898  1.00 28.36 ? 298  LEU A CA  1 
ATOM   1360 C  C   . LEU A 1 185 ? 20.031  12.660 -0.107  1.00 29.18 ? 298  LEU A C   1 
ATOM   1361 O  O   . LEU A 1 185 ? 18.962  12.279 0.337   1.00 28.67 ? 298  LEU A O   1 
ATOM   1362 C  CB  . LEU A 1 185 ? 19.019  14.006 -1.978  1.00 25.97 ? 298  LEU A CB  1 
ATOM   1363 C  CG  . LEU A 1 185 ? 18.917  15.305 -2.772  1.00 24.27 ? 298  LEU A CG  1 
ATOM   1364 C  CD1 . LEU A 1 185 ? 17.896  15.209 -3.912  1.00 21.06 ? 298  LEU A CD1 1 
ATOM   1365 C  CD2 . LEU A 1 185 ? 18.578  16.451 -1.834  1.00 25.27 ? 298  LEU A CD2 1 
ATOM   1366 N  N   . SER A 1 186 ? 21.156  11.977 0.061   1.00 31.55 ? 299  SER A N   1 
ATOM   1367 C  CA  . SER A 1 186 ? 21.213  10.686 0.758   1.00 33.51 ? 299  SER A CA  1 
ATOM   1368 C  C   . SER A 1 186 ? 20.265  9.627  0.166   1.00 32.47 ? 299  SER A C   1 
ATOM   1369 O  O   . SER A 1 186 ? 19.636  8.863  0.900   1.00 32.66 ? 299  SER A O   1 
ATOM   1370 C  CB  . SER A 1 186 ? 20.954  10.871 2.261   1.00 34.78 ? 299  SER A CB  1 
ATOM   1371 O  OG  . SER A 1 186 ? 21.934  11.729 2.829   1.00 37.34 ? 299  SER A OG  1 
ATOM   1372 N  N   . LEU A 1 187 ? 20.195  9.574  -1.161  1.00 31.58 ? 300  LEU A N   1 
ATOM   1373 C  CA  . LEU A 1 187 ? 19.332  8.614  -1.855  1.00 30.93 ? 300  LEU A CA  1 
ATOM   1374 C  C   . LEU A 1 187 ? 20.166  7.498  -2.451  1.00 32.26 ? 300  LEU A C   1 
ATOM   1375 O  O   . LEU A 1 187 ? 21.239  7.757  -3.000  1.00 32.98 ? 300  LEU A O   1 
ATOM   1376 C  CB  . LEU A 1 187 ? 18.545  9.299  -2.970  1.00 28.41 ? 300  LEU A CB  1 
ATOM   1377 C  CG  . LEU A 1 187 ? 17.607  10.426 -2.575  1.00 26.53 ? 300  LEU A CG  1 
ATOM   1378 C  CD1 . LEU A 1 187 ? 17.064  11.109 -3.826  1.00 22.53 ? 300  LEU A CD1 1 
ATOM   1379 C  CD2 . LEU A 1 187 ? 16.468  9.913  -1.671  1.00 25.89 ? 300  LEU A CD2 1 
ATOM   1380 N  N   . GLN A 1 188 ? 19.680  6.262  -2.333  1.00 33.32 ? 301  GLN A N   1 
ATOM   1381 C  CA  . GLN A 1 188 ? 20.323  5.109  -2.990  1.00 34.92 ? 301  GLN A CA  1 
ATOM   1382 C  C   . GLN A 1 188 ? 19.957  5.123  -4.463  1.00 32.85 ? 301  GLN A C   1 
ATOM   1383 O  O   . GLN A 1 188 ? 18.793  5.320  -4.807  1.00 30.58 ? 301  GLN A O   1 
ATOM   1384 C  CB  . GLN A 1 188 ? 19.871  3.766  -2.393  1.00 36.17 ? 301  GLN A CB  1 
ATOM   1385 C  CG  . GLN A 1 188 ? 20.697  3.272  -1.201  1.00 40.66 ? 301  GLN A CG  1 
ATOM   1386 C  CD  . GLN A 1 188 ? 20.794  1.742  -1.135  1.00 42.96 ? 301  GLN A CD  1 
ATOM   1387 O  OE1 . GLN A 1 188 ? 19.866  1.066  -1.640  1.00 46.33 ? 301  GLN A OE1 1 
ATOM   1388 N  NE2 . GLN A 1 188 ? 21.795  1.222  -0.576  1.00 47.40 ? 301  GLN A NE2 1 
ATOM   1389 N  N   . HIS A 1 189 ? 20.942  4.870  -5.318  1.00 33.67 ? 302  HIS A N   1 
ATOM   1390 C  CA  . HIS A 1 189 ? 20.733  4.886  -6.760  1.00 32.70 ? 302  HIS A CA  1 
ATOM   1391 C  C   . HIS A 1 189 ? 19.723  3.822  -7.182  1.00 32.57 ? 302  HIS A C   1 
ATOM   1392 O  O   . HIS A 1 189 ? 19.826  2.666  -6.784  1.00 33.96 ? 302  HIS A O   1 
ATOM   1393 C  CB  . HIS A 1 189 ? 22.050  4.684  -7.520  1.00 33.76 ? 302  HIS A CB  1 
ATOM   1394 C  CG  . HIS A 1 189 ? 22.004  5.192  -8.929  1.00 32.35 ? 302  HIS A CG  1 
ATOM   1395 N  ND1 . HIS A 1 189 ? 22.295  6.498  -9.254  1.00 33.05 ? 302  HIS A ND1 1 
ATOM   1396 C  CD2 . HIS A 1 189 ? 21.658  4.585  -10.089 1.00 32.51 ? 302  HIS A CD2 1 
ATOM   1397 C  CE1 . HIS A 1 189 ? 22.145  6.673  -10.557 1.00 31.28 ? 302  HIS A CE1 1 
ATOM   1398 N  NE2 . HIS A 1 189 ? 21.755  5.528  -11.087 1.00 31.62 ? 302  HIS A NE2 1 
ATOM   1399 N  N   . ILE A 1 190 ? 18.738  4.228  -7.973  1.00 30.94 ? 303  ILE A N   1 
ATOM   1400 C  CA  . ILE A 1 190 ? 17.737  3.305  -8.499  1.00 31.01 ? 303  ILE A CA  1 
ATOM   1401 C  C   . ILE A 1 190 ? 18.265  2.661  -9.789  1.00 31.69 ? 303  ILE A C   1 
ATOM   1402 O  O   . ILE A 1 190 ? 18.611  3.361  -10.740 1.00 30.82 ? 303  ILE A O   1 
ATOM   1403 C  CB  . ILE A 1 190 ? 16.386  4.033  -8.777  1.00 28.82 ? 303  ILE A CB  1 
ATOM   1404 C  CG1 . ILE A 1 190 ? 15.788  4.550  -7.466  1.00 28.79 ? 303  ILE A CG1 1 
ATOM   1405 C  CG2 . ILE A 1 190 ? 15.403  3.102  -9.488  1.00 28.49 ? 303  ILE A CG2 1 
ATOM   1406 C  CD1 . ILE A 1 190 ? 14.632  5.493  -7.662  1.00 27.28 ? 303  ILE A CD1 1 
ATOM   1407 N  N   . GLY A 1 191 ? 18.342  1.331  -9.794  1.00 33.48 ? 304  GLY A N   1 
ATOM   1408 C  CA  . GLY A 1 191 ? 18.689  0.565  -10.985 1.00 34.30 ? 304  GLY A CA  1 
ATOM   1409 C  C   . GLY A 1 191 ? 20.093  0.785  -11.518 1.00 35.21 ? 304  GLY A C   1 
ATOM   1410 O  O   . GLY A 1 191 ? 21.062  0.842  -10.766 1.00 35.74 ? 304  GLY A O   1 
ATOM   1411 N  N   . ARG A 1 192 ? 20.182  0.929  -12.835 1.00 35.24 ? 305  ARG A N   1 
ATOM   1412 C  CA  . ARG A 1 192 ? 21.447  0.969  -13.542 1.00 36.62 ? 305  ARG A CA  1 
ATOM   1413 C  C   . ARG A 1 192 ? 21.764  2.352  -14.119 1.00 35.43 ? 305  ARG A C   1 
ATOM   1414 O  O   . ARG A 1 192 ? 20.987  2.881  -14.907 1.00 33.86 ? 305  ARG A O   1 
ATOM   1415 C  CB  . ARG A 1 192 ? 21.390  -0.043 -14.688 1.00 37.61 ? 305  ARG A CB  1 
ATOM   1416 C  CG  . ARG A 1 192 ? 22.738  -0.372 -15.295 1.00 39.11 ? 305  ARG A CG  1 
ATOM   1417 C  CD  . ARG A 1 192 ? 22.601  -1.101 -16.633 1.00 40.07 ? 305  ARG A CD  1 
ATOM   1418 N  NE  . ARG A 1 192 ? 23.918  -1.456 -17.175 1.00 42.62 ? 305  ARG A NE  1 
ATOM   1419 C  CZ  . ARG A 1 192 ? 24.774  -0.585 -17.713 1.00 42.63 ? 305  ARG A CZ  1 
ATOM   1420 N  NH1 . ARG A 1 192 ? 24.468  0.707  -17.791 1.00 41.17 ? 305  ARG A NH1 1 
ATOM   1421 N  NH2 . ARG A 1 192 ? 25.942  -1.009 -18.179 1.00 43.98 ? 305  ARG A NH2 1 
ATOM   1422 N  N   . PRO A 1 193 ? 22.919  2.940  -13.745 1.00 36.68 ? 306  PRO A N   1 
ATOM   1423 C  CA  . PRO A 1 193 ? 23.413  4.150  -14.433 1.00 35.98 ? 306  PRO A CA  1 
ATOM   1424 C  C   . PRO A 1 193 ? 23.548  3.986  -15.953 1.00 35.66 ? 306  PRO A C   1 
ATOM   1425 O  O   . PRO A 1 193 ? 23.927  2.921  -16.428 1.00 36.56 ? 306  PRO A O   1 
ATOM   1426 C  CB  . PRO A 1 193 ? 24.787  4.378  -13.798 1.00 37.83 ? 306  PRO A CB  1 
ATOM   1427 C  CG  . PRO A 1 193 ? 24.702  3.726  -12.475 1.00 39.00 ? 306  PRO A CG  1 
ATOM   1428 C  CD  . PRO A 1 193 ? 23.803  2.542  -12.638 1.00 38.46 ? 306  PRO A CD  1 
ATOM   1429 N  N   . HIS A 1 194 ? 23.225  5.047  -16.693 1.00 34.68 ? 307  HIS A N   1 
ATOM   1430 C  CA  . HIS A 1 194 ? 23.237  5.066  -18.170 1.00 34.03 ? 307  HIS A CA  1 
ATOM   1431 C  C   . HIS A 1 194 ? 22.223  4.127  -18.818 1.00 32.99 ? 307  HIS A C   1 
ATOM   1432 O  O   . HIS A 1 194 ? 22.403  3.692  -19.953 1.00 33.01 ? 307  HIS A O   1 
ATOM   1433 C  CB  . HIS A 1 194 ? 24.645  4.808  -18.743 1.00 36.87 ? 307  HIS A CB  1 
ATOM   1434 C  CG  . HIS A 1 194 ? 25.685  5.786  -18.279 1.00 40.45 ? 307  HIS A CG  1 
ATOM   1435 N  ND1 . HIS A 1 194 ? 25.531  7.154  -18.395 1.00 42.28 ? 307  HIS A ND1 1 
ATOM   1436 C  CD2 . HIS A 1 194 ? 26.907  5.591  -17.724 1.00 44.62 ? 307  HIS A CD2 1 
ATOM   1437 C  CE1 . HIS A 1 194 ? 26.606  7.758  -17.916 1.00 44.09 ? 307  HIS A CE1 1 
ATOM   1438 N  NE2 . HIS A 1 194 ? 27.458  6.832  -17.509 1.00 45.75 ? 307  HIS A NE2 1 
ATOM   1439 N  N   . SER A 1 195 ? 21.172  3.790  -18.086 1.00 31.91 ? 308  SER A N   1 
ATOM   1440 C  CA  . SER A 1 195 ? 19.979  3.216  -18.672 1.00 30.86 ? 308  SER A CA  1 
ATOM   1441 C  C   . SER A 1 195 ? 18.973  4.350  -18.654 1.00 28.93 ? 308  SER A C   1 
ATOM   1442 O  O   . SER A 1 195 ? 18.795  4.992  -17.615 1.00 29.04 ? 308  SER A O   1 
ATOM   1443 C  CB  . SER A 1 195 ? 19.465  2.032  -17.851 1.00 31.89 ? 308  SER A CB  1 
ATOM   1444 O  OG  . SER A 1 195 ? 18.054  1.893  -17.996 1.00 31.52 ? 308  SER A OG  1 
ATOM   1445 N  N   . GLY A 1 196 ? 18.342  4.611  -19.797 1.00 27.09 ? 309  GLY A N   1 
ATOM   1446 C  CA  . GLY A 1 196 ? 17.379  5.704  -19.942 1.00 25.01 ? 309  GLY A CA  1 
ATOM   1447 C  C   . GLY A 1 196 ? 16.288  5.674  -18.889 1.00 23.93 ? 309  GLY A C   1 
ATOM   1448 O  O   . GLY A 1 196 ? 16.102  6.642  -18.159 1.00 23.36 ? 309  GLY A O   1 
ATOM   1449 N  N   . ILE A 1 197 ? 15.581  4.553  -18.814 1.00 23.64 ? 310  ILE A N   1 
ATOM   1450 C  CA  . ILE A 1 197 ? 14.457  4.380  -17.898 1.00 22.94 ? 310  ILE A CA  1 
ATOM   1451 C  C   . ILE A 1 197 ? 14.906  4.504  -16.427 1.00 22.73 ? 310  ILE A C   1 
ATOM   1452 O  O   . ILE A 1 197 ? 14.250  5.180  -15.626 1.00 20.83 ? 310  ILE A O   1 
ATOM   1453 C  CB  . ILE A 1 197 ? 13.708  3.024  -18.196 1.00 24.01 ? 310  ILE A CB  1 
ATOM   1454 C  CG1 . ILE A 1 197 ? 12.387  2.903  -17.411 1.00 24.78 ? 310  ILE A CG1 1 
ATOM   1455 C  CG2 . ILE A 1 197 ? 14.597  1.814  -17.937 1.00 25.42 ? 310  ILE A CG2 1 
ATOM   1456 C  CD1 . ILE A 1 197 ? 11.269  3.747  -17.960 1.00 25.37 ? 310  ILE A CD1 1 
ATOM   1457 N  N   . ASP A 1 198 ? 16.037  3.884  -16.077 1.00 23.22 ? 311  ASP A N   1 
ATOM   1458 C  CA  . ASP A 1 198 ? 16.516  3.918  -14.696 1.00 23.37 ? 311  ASP A CA  1 
ATOM   1459 C  C   . ASP A 1 198 ? 16.964  5.321  -14.324 1.00 21.98 ? 311  ASP A C   1 
ATOM   1460 O  O   . ASP A 1 198 ? 16.726  5.755  -13.208 1.00 21.58 ? 311  ASP A O   1 
ATOM   1461 C  CB  . ASP A 1 198 ? 17.638  2.910  -14.456 1.00 24.98 ? 311  ASP A CB  1 
ATOM   1462 C  CG  . ASP A 1 198 ? 17.137  1.470  -14.399 1.00 27.16 ? 311  ASP A CG  1 
ATOM   1463 O  OD1 . ASP A 1 198 ? 15.916  1.237  -14.300 1.00 28.54 ? 311  ASP A OD1 1 
ATOM   1464 O  OD2 . ASP A 1 198 ? 17.982  0.554  -14.440 1.00 32.09 ? 311  ASP A OD2 1 
ATOM   1465 N  N   . ASP A 1 199 ? 17.603  6.026  -15.253 1.00 21.10 ? 312  ASP A N   1 
ATOM   1466 C  CA  . ASP A 1 199 ? 17.911  7.441  -15.049 1.00 20.39 ? 312  ASP A CA  1 
ATOM   1467 C  C   . ASP A 1 199 ? 16.617  8.251  -14.818 1.00 19.02 ? 312  ASP A C   1 
ATOM   1468 O  O   . ASP A 1 199 ? 16.577  9.121  -13.954 1.00 18.75 ? 312  ASP A O   1 
ATOM   1469 C  CB  . ASP A 1 199 ? 18.676  8.015  -16.238 1.00 20.36 ? 312  ASP A CB  1 
ATOM   1470 C  CG  . ASP A 1 199 ? 20.166  7.684  -16.218 1.00 21.40 ? 312  ASP A CG  1 
ATOM   1471 O  OD1 . ASP A 1 199 ? 20.648  6.992  -15.313 1.00 21.39 ? 312  ASP A OD1 1 
ATOM   1472 O  OD2 . ASP A 1 199 ? 20.866  8.143  -17.135 1.00 23.70 ? 312  ASP A OD2 1 
ATOM   1473 N  N   . CYS A 1 200 ? 15.563  7.933  -15.571 1.00 17.79 ? 313  CYS A N   1 
ATOM   1474 C  CA  . CYS A 1 200 ? 14.262  8.577  -15.390 1.00 16.86 ? 313  CYS A CA  1 
ATOM   1475 C  C   . CYS A 1 200 ? 13.718  8.332  -13.977 1.00 16.58 ? 313  CYS A C   1 
ATOM   1476 O  O   . CYS A 1 200 ? 13.247  9.257  -13.339 1.00 15.31 ? 313  CYS A O   1 
ATOM   1477 C  CB  . CYS A 1 200 ? 13.255  8.106  -16.454 1.00 16.36 ? 313  CYS A CB  1 
ATOM   1478 S  SG  . CYS A 1 200 ? 13.515  8.801  -18.099 1.00 15.97 ? 313  CYS A SG  1 
ATOM   1479 N  N   . LYS A 1 201 ? 13.803  7.090  -13.499 1.00 17.65 ? 314  LYS A N   1 
ATOM   1480 C  CA  . LYS A 1 201 ? 13.358  6.736  -12.141 1.00 18.88 ? 314  LYS A CA  1 
ATOM   1481 C  C   . LYS A 1 201 ? 14.135  7.485  -11.064 1.00 18.45 ? 314  LYS A C   1 
ATOM   1482 O  O   . LYS A 1 201 ? 13.570  7.848  -10.034 1.00 17.90 ? 314  LYS A O   1 
ATOM   1483 C  CB  . LYS A 1 201 ? 13.455  5.221  -11.903 1.00 20.31 ? 314  LYS A CB  1 
ATOM   1484 C  CG  . LYS A 1 201 ? 12.512  4.402  -12.774 1.00 21.24 ? 314  LYS A CG  1 
ATOM   1485 C  CD  . LYS A 1 201 ? 12.906  2.945  -12.726 1.00 23.91 ? 314  LYS A CD  1 
ATOM   1486 C  CE  . LYS A 1 201 ? 11.898  2.044  -13.413 1.00 25.86 ? 314  LYS A CE  1 
ATOM   1487 N  NZ  . LYS A 1 201 ? 12.269  0.587  -13.241 1.00 29.74 ? 314  LYS A NZ  1 
ATOM   1488 N  N   . ASN A 1 202 ? 15.422  7.718  -11.314 1.00 19.03 ? 315  ASN A N   1 
ATOM   1489 C  CA  . ASN A 1 202 ? 16.266  8.503  -10.416 1.00 19.76 ? 315  ASN A CA  1 
ATOM   1490 C  C   . ASN A 1 202 ? 15.907  9.999  -10.416 1.00 18.59 ? 315  ASN A C   1 
ATOM   1491 O  O   . ASN A 1 202 ? 15.884  10.633 -9.361  1.00 17.70 ? 315  ASN A O   1 
ATOM   1492 C  CB  . ASN A 1 202 ? 17.749  8.327  -10.768 1.00 20.68 ? 315  ASN A CB  1 
ATOM   1493 C  CG  . ASN A 1 202 ? 18.319  7.051  -10.239 1.00 22.70 ? 315  ASN A CG  1 
ATOM   1494 O  OD1 . ASN A 1 202 ? 18.655  6.951  -9.049  1.00 24.53 ? 315  ASN A OD1 1 
ATOM   1495 N  ND2 . ASN A 1 202 ? 18.457  6.055  -11.116 1.00 22.37 ? 315  ASN A ND2 1 
ATOM   1496 N  N   . ILE A 1 203 ? 15.647  10.545 -11.602 1.00 18.04 ? 316  ILE A N   1 
ATOM   1497 C  CA  . ILE A 1 203 ? 15.191  11.922 -11.743 1.00 17.47 ? 316  ILE A CA  1 
ATOM   1498 C  C   . ILE A 1 203 ? 13.905  12.103 -10.934 1.00 17.21 ? 316  ILE A C   1 
ATOM   1499 O  O   . ILE A 1 203 ? 13.760  13.085 -10.180 1.00 17.48 ? 316  ILE A O   1 
ATOM   1500 C  CB  . ILE A 1 203 ? 14.955  12.317 -13.236 1.00 17.12 ? 316  ILE A CB  1 
ATOM   1501 C  CG1 . ILE A 1 203 ? 16.289  12.426 -13.995 1.00 18.47 ? 316  ILE A CG1 1 
ATOM   1502 C  CG2 . ILE A 1 203 ? 14.242  13.677 -13.353 1.00 15.73 ? 316  ILE A CG2 1 
ATOM   1503 C  CD1 . ILE A 1 203 ? 16.127  12.441 -15.558 1.00 16.24 ? 316  ILE A CD1 1 
ATOM   1504 N  N   . ALA A 1 204 ? 12.999  11.138 -11.082 1.00 16.87 ? 317  ALA A N   1 
ATOM   1505 C  CA  . ALA A 1 204 ? 11.696  11.147 -10.398 1.00 16.77 ? 317  ALA A CA  1 
ATOM   1506 C  C   . ALA A 1 204 ? 11.852  11.099 -8.864  1.00 17.19 ? 317  ALA A C   1 
ATOM   1507 O  O   . ALA A 1 204 ? 11.178  11.825 -8.158  1.00 17.45 ? 317  ALA A O   1 
ATOM   1508 C  CB  . ALA A 1 204 ? 10.819  9.986  -10.884 1.00 16.44 ? 317  ALA A CB  1 
ATOM   1509 N  N   . ASN A 1 205 ? 12.747  10.244 -8.382  1.00 18.10 ? 318  ASN A N   1 
ATOM   1510 C  CA  . ASN A 1 205 ? 13.086  10.139 -6.959  1.00 18.81 ? 318  ASN A CA  1 
ATOM   1511 C  C   . ASN A 1 205 ? 13.725  11.407 -6.374  1.00 18.38 ? 318  ASN A C   1 
ATOM   1512 O  O   . ASN A 1 205 ? 13.413  11.821 -5.264  1.00 18.46 ? 318  ASN A O   1 
ATOM   1513 C  CB  . ASN A 1 205 ? 14.016  8.933  -6.748  1.00 20.18 ? 318  ASN A CB  1 
ATOM   1514 C  CG  . ASN A 1 205 ? 14.071  8.467  -5.300  1.00 21.79 ? 318  ASN A CG  1 
ATOM   1515 O  OD1 . ASN A 1 205 ? 13.063  8.451  -4.605  1.00 22.74 ? 318  ASN A OD1 1 
ATOM   1516 N  ND2 . ASN A 1 205 ? 15.250  8.047  -4.856  1.00 24.82 ? 318  ASN A ND2 1 
ATOM   1517 N  N   . ILE A 1 206 ? 14.625  12.020 -7.125  1.00 17.86 ? 319  ILE A N   1 
ATOM   1518 C  CA  . ILE A 1 206 ? 15.216  13.291 -6.720  1.00 17.88 ? 319  ILE A CA  1 
ATOM   1519 C  C   . ILE A 1 206 ? 14.122  14.375 -6.633  1.00 17.41 ? 319  ILE A C   1 
ATOM   1520 O  O   . ILE A 1 206 ? 14.064  15.129 -5.659  1.00 17.18 ? 319  ILE A O   1 
ATOM   1521 C  CB  . ILE A 1 206 ? 16.377  13.717 -7.676  1.00 18.13 ? 319  ILE A CB  1 
ATOM   1522 C  CG1 . ILE A 1 206 ? 17.558  12.730 -7.585  1.00 18.28 ? 319  ILE A CG1 1 
ATOM   1523 C  CG2 . ILE A 1 206 ? 16.846  15.153 -7.367  1.00 17.94 ? 319  ILE A CG2 1 
ATOM   1524 C  CD1 . ILE A 1 206 ? 18.541  12.784 -8.809  1.00 17.70 ? 319  ILE A CD1 1 
ATOM   1525 N  N   . MET A 1 207 ? 13.235  14.420 -7.628  1.00 16.65 ? 320  MET A N   1 
ATOM   1526 C  CA  . MET A 1 207 ? 12.164  15.412 -7.650  1.00 16.44 ? 320  MET A CA  1 
ATOM   1527 C  C   . MET A 1 207 ? 11.228  15.274 -6.435  1.00 17.13 ? 320  MET A C   1 
ATOM   1528 O  O   . MET A 1 207 ? 10.851  16.266 -5.808  1.00 16.50 ? 320  MET A O   1 
ATOM   1529 C  CB  . MET A 1 207 ? 11.353  15.314 -8.959  1.00 15.74 ? 320  MET A CB  1 
ATOM   1530 C  CG  . MET A 1 207 ? 12.049  15.851 -10.211 1.00 13.78 ? 320  MET A CG  1 
ATOM   1531 S  SD  . MET A 1 207 ? 10.982  15.807 -11.677 1.00 14.64 ? 320  MET A SD  1 
ATOM   1532 C  CE  . MET A 1 207 ? 9.712   17.042 -11.319 1.00 11.47 ? 320  MET A CE  1 
ATOM   1533 N  N   . LYS A 1 208 ? 10.846  14.038 -6.142  1.00 18.53 ? 321  LYS A N   1 
ATOM   1534 C  CA  . LYS A 1 208 ? 10.069  13.679 -4.943  1.00 19.65 ? 321  LYS A CA  1 
ATOM   1535 C  C   . LYS A 1 208 ? 10.713  14.237 -3.665  1.00 20.21 ? 321  LYS A C   1 
ATOM   1536 O  O   . LYS A 1 208 ? 10.039  14.882 -2.851  1.00 20.61 ? 321  LYS A O   1 
ATOM   1537 C  CB  . LYS A 1 208 ? 9.933   12.145 -4.879  1.00 20.47 ? 321  LYS A CB  1 
ATOM   1538 C  CG  . LYS A 1 208 ? 9.065   11.546 -3.756  1.00 22.58 ? 321  LYS A CG  1 
ATOM   1539 C  CD  . LYS A 1 208 ? 8.605   10.151 -4.200  1.00 24.15 ? 321  LYS A CD  1 
ATOM   1540 C  CE  . LYS A 1 208 ? 8.220   9.225  -3.063  1.00 28.63 ? 321  LYS A CE  1 
ATOM   1541 N  NZ  . LYS A 1 208 ? 7.733   7.877  -3.626  1.00 30.72 ? 321  LYS A NZ  1 
ATOM   1542 N  N   . THR A 1 209 ? 12.022  14.028 -3.511  1.00 20.35 ? 322  THR A N   1 
ATOM   1543 C  CA  . THR A 1 209 ? 12.739  14.507 -2.318  1.00 20.69 ? 322  THR A CA  1 
ATOM   1544 C  C   . THR A 1 209 ? 12.787  16.041 -2.279  1.00 19.96 ? 322  THR A C   1 
ATOM   1545 O  O   . THR A 1 209 ? 12.613  16.633 -1.220  1.00 19.88 ? 322  THR A O   1 
ATOM   1546 C  CB  . THR A 1 209 ? 14.169  13.895 -2.232  1.00 21.96 ? 322  THR A CB  1 
ATOM   1547 O  OG1 . THR A 1 209 ? 14.066  12.463 -2.192  1.00 23.03 ? 322  THR A OG1 1 
ATOM   1548 C  CG2 . THR A 1 209 ? 14.946  14.388 -0.991  1.00 23.27 ? 322  THR A CG2 1 
ATOM   1549 N  N   . LEU A 1 210 ? 12.993  16.688 -3.422  1.00 18.28 ? 323  LEU A N   1 
ATOM   1550 C  CA  . LEU A 1 210 ? 13.051  18.148 -3.427  1.00 18.64 ? 323  LEU A CA  1 
ATOM   1551 C  C   . LEU A 1 210 ? 11.663  18.730 -3.101  1.00 17.98 ? 323  LEU A C   1 
ATOM   1552 O  O   . LEU A 1 210 ? 11.554  19.689 -2.330  1.00 18.06 ? 323  LEU A O   1 
ATOM   1553 C  CB  . LEU A 1 210 ? 13.592  18.697 -4.761  1.00 17.82 ? 323  LEU A CB  1 
ATOM   1554 C  CG  . LEU A 1 210 ? 15.088  18.445 -5.089  1.00 17.89 ? 323  LEU A CG  1 
ATOM   1555 C  CD1 . LEU A 1 210 ? 15.380  18.885 -6.536  1.00 14.93 ? 323  LEU A CD1 1 
ATOM   1556 C  CD2 . LEU A 1 210 ? 16.022  19.153 -4.113  1.00 14.59 ? 323  LEU A CD2 1 
ATOM   1557 N  N   . ALA A 1 211 ? 10.627  18.142 -3.709  1.00 16.84 ? 324  ALA A N   1 
ATOM   1558 C  CA  . ALA A 1 211 ? 9.231   18.472 -3.430  1.00 16.81 ? 324  ALA A CA  1 
ATOM   1559 C  C   . ALA A 1 211 ? 8.880   18.262 -1.951  1.00 17.22 ? 324  ALA A C   1 
ATOM   1560 O  O   . ALA A 1 211 ? 8.164   19.052 -1.380  1.00 17.41 ? 324  ALA A O   1 
ATOM   1561 C  CB  . ALA A 1 211 ? 8.294   17.649 -4.306  1.00 14.79 ? 324  ALA A CB  1 
ATOM   1562 N  N   . TYR A 1 212 ? 9.372   17.190 -1.352  1.00 18.44 ? 325  TYR A N   1 
ATOM   1563 C  CA  . TYR A 1 212 ? 9.196   16.945 0.098   1.00 19.49 ? 325  TYR A CA  1 
ATOM   1564 C  C   . TYR A 1 212 ? 9.799   18.079 0.943   1.00 19.95 ? 325  TYR A C   1 
ATOM   1565 O  O   . TYR A 1 212 ? 9.295   18.403 2.017   1.00 19.35 ? 325  TYR A O   1 
ATOM   1566 C  CB  . TYR A 1 212 ? 9.811   15.598 0.500   1.00 20.70 ? 325  TYR A CB  1 
ATOM   1567 C  CG  . TYR A 1 212 ? 9.922   15.417 1.997   1.00 22.67 ? 325  TYR A CG  1 
ATOM   1568 C  CD1 . TYR A 1 212 ? 8.839   14.970 2.743   1.00 23.36 ? 325  TYR A CD1 1 
ATOM   1569 C  CD2 . TYR A 1 212 ? 11.107  15.719 2.671   1.00 24.40 ? 325  TYR A CD2 1 
ATOM   1570 C  CE1 . TYR A 1 212 ? 8.939   14.819 4.106   1.00 25.45 ? 325  TYR A CE1 1 
ATOM   1571 C  CE2 . TYR A 1 212 ? 11.215  15.574 4.032   1.00 26.20 ? 325  TYR A CE2 1 
ATOM   1572 C  CZ  . TYR A 1 212 ? 10.124  15.119 4.748   1.00 26.51 ? 325  TYR A CZ  1 
ATOM   1573 O  OH  . TYR A 1 212 ? 10.219  14.966 6.104   1.00 28.98 ? 325  TYR A OH  1 
ATOM   1574 N  N   . ARG A 1 213 ? 10.892  18.658 0.451   1.00 19.98 ? 326  ARG A N   1 
ATOM   1575 C  CA  . ARG A 1 213 ? 11.517  19.815 1.076   1.00 21.65 ? 326  ARG A CA  1 
ATOM   1576 C  C   . ARG A 1 213 ? 10.869  21.150 0.683   1.00 21.00 ? 326  ARG A C   1 
ATOM   1577 O  O   . ARG A 1 213 ? 11.319  22.197 1.132   1.00 21.75 ? 326  ARG A O   1 
ATOM   1578 C  CB  . ARG A 1 213 ? 13.013  19.843 0.757   1.00 22.96 ? 326  ARG A CB  1 
ATOM   1579 C  CG  . ARG A 1 213 ? 13.745  18.613 1.226   1.00 23.97 ? 326  ARG A CG  1 
ATOM   1580 C  CD  . ARG A 1 213 ? 15.240  18.697 0.968   1.00 26.25 ? 326  ARG A CD  1 
ATOM   1581 N  NE  . ARG A 1 213 ? 15.893  17.472 1.436   1.00 29.80 ? 326  ARG A NE  1 
ATOM   1582 C  CZ  . ARG A 1 213 ? 17.205  17.269 1.475   1.00 31.69 ? 326  ARG A CZ  1 
ATOM   1583 N  NH1 . ARG A 1 213 ? 18.051  18.216 1.079   1.00 35.26 ? 326  ARG A NH1 1 
ATOM   1584 N  NH2 . ARG A 1 213 ? 17.668  16.114 1.930   1.00 32.24 ? 326  ARG A NH2 1 
ATOM   1585 N  N   . GLY A 1 214 ? 9.816   21.115 -0.141  1.00 19.75 ? 327  GLY A N   1 
ATOM   1586 C  CA  . GLY A 1 214 ? 9.072   22.321 -0.503  1.00 19.76 ? 327  GLY A CA  1 
ATOM   1587 C  C   . GLY A 1 214 ? 9.496   23.015 -1.796  1.00 19.53 ? 327  GLY A C   1 
ATOM   1588 O  O   . GLY A 1 214 ? 9.076   24.142 -2.067  1.00 19.45 ? 327  GLY A O   1 
ATOM   1589 N  N   . PHE A 1 215 ? 10.306  22.345 -2.609  1.00 19.04 ? 328  PHE A N   1 
ATOM   1590 C  CA  . PHE A 1 215 ? 10.769  22.928 -3.857  1.00 19.11 ? 328  PHE A CA  1 
ATOM   1591 C  C   . PHE A 1 215 ? 9.656   23.027 -4.911  1.00 18.18 ? 328  PHE A C   1 
ATOM   1592 O  O   . PHE A 1 215 ? 8.968   22.049 -5.199  1.00 18.15 ? 328  PHE A O   1 
ATOM   1593 C  CB  . PHE A 1 215 ? 11.949  22.136 -4.432  1.00 19.04 ? 328  PHE A CB  1 
ATOM   1594 C  CG  . PHE A 1 215 ? 12.670  22.860 -5.508  1.00 19.00 ? 328  PHE A CG  1 
ATOM   1595 C  CD1 . PHE A 1 215 ? 13.498  23.926 -5.207  1.00 21.35 ? 328  PHE A CD1 1 
ATOM   1596 C  CD2 . PHE A 1 215 ? 12.498  22.517 -6.824  1.00 19.56 ? 328  PHE A CD2 1 
ATOM   1597 C  CE1 . PHE A 1 215 ? 14.162  24.605 -6.203  1.00 22.69 ? 328  PHE A CE1 1 
ATOM   1598 C  CE2 . PHE A 1 215 ? 13.173  23.201 -7.831  1.00 20.06 ? 328  PHE A CE2 1 
ATOM   1599 C  CZ  . PHE A 1 215 ? 14.003  24.238 -7.519  1.00 19.72 ? 328  PHE A CZ  1 
ATOM   1600 N  N   . ILE A 1 216 ? 9.511   24.218 -5.486  1.00 18.72 ? 329  ILE A N   1 
ATOM   1601 C  CA  . ILE A 1 216 ? 8.599   24.463 -6.598  1.00 18.46 ? 329  ILE A CA  1 
ATOM   1602 C  C   . ILE A 1 216 ? 9.371   24.495 -7.897  1.00 17.56 ? 329  ILE A C   1 
ATOM   1603 O  O   . ILE A 1 216 ? 10.168  25.390 -8.124  1.00 18.93 ? 329  ILE A O   1 
ATOM   1604 C  CB  . ILE A 1 216 ? 7.856   25.823 -6.458  1.00 19.33 ? 329  ILE A CB  1 
ATOM   1605 C  CG1 . ILE A 1 216 ? 7.126   25.913 -5.115  1.00 20.36 ? 329  ILE A CG1 1 
ATOM   1606 C  CG2 . ILE A 1 216 ? 6.879   26.027 -7.636  1.00 18.72 ? 329  ILE A CG2 1 
ATOM   1607 C  CD1 . ILE A 1 216 ? 5.960   25.046 -5.024  1.00 19.47 ? 329  ILE A CD1 1 
ATOM   1608 N  N   . PHE A 1 217 ? 9.106   23.526 -8.762  1.00 17.44 ? 330  PHE A N   1 
ATOM   1609 C  CA  . PHE A 1 217 ? 9.793   23.397 -10.045 1.00 17.06 ? 330  PHE A CA  1 
ATOM   1610 C  C   . PHE A 1 217 ? 9.368   24.453 -11.055 1.00 17.49 ? 330  PHE A C   1 
ATOM   1611 O  O   . PHE A 1 217 ? 8.199   24.799 -11.140 1.00 17.10 ? 330  PHE A O   1 
ATOM   1612 C  CB  . PHE A 1 217 ? 9.578   22.000 -10.607 1.00 16.17 ? 330  PHE A CB  1 
ATOM   1613 C  CG  . PHE A 1 217 ? 10.225  20.937 -9.777  1.00 16.75 ? 330  PHE A CG  1 
ATOM   1614 C  CD1 . PHE A 1 217 ? 9.489   20.219 -8.846  1.00 16.95 ? 330  PHE A CD1 1 
ATOM   1615 C  CD2 . PHE A 1 217 ? 11.593  20.696 -9.888  1.00 16.34 ? 330  PHE A CD2 1 
ATOM   1616 C  CE1 . PHE A 1 217 ? 10.109  19.271 -8.038  1.00 16.71 ? 330  PHE A CE1 1 
ATOM   1617 C  CE2 . PHE A 1 217 ? 12.218  19.742 -9.092  1.00 16.06 ? 330  PHE A CE2 1 
ATOM   1618 C  CZ  . PHE A 1 217 ? 11.463  19.026 -8.167  1.00 15.47 ? 330  PHE A CZ  1 
ATOM   1619 N  N   . LYS A 1 218 ? 10.347  24.976 -11.793 1.00 17.81 ? 331  LYS A N   1 
ATOM   1620 C  CA  . LYS A 1 218 ? 10.107  25.981 -12.817 1.00 18.87 ? 331  LYS A CA  1 
ATOM   1621 C  C   . LYS A 1 218 ? 10.911  25.657 -14.060 1.00 18.25 ? 331  LYS A C   1 
ATOM   1622 O  O   . LYS A 1 218 ? 12.014  25.102 -13.966 1.00 18.45 ? 331  LYS A O   1 
ATOM   1623 C  CB  . LYS A 1 218 ? 10.512  27.375 -12.316 1.00 20.38 ? 331  LYS A CB  1 
ATOM   1624 C  CG  . LYS A 1 218 ? 9.940   27.775 -10.939 1.00 21.55 ? 331  LYS A CG  1 
ATOM   1625 C  CD  . LYS A 1 218 ? 10.411  29.182 -10.564 1.00 23.55 ? 331  LYS A CD  1 
ATOM   1626 C  CE  . LYS A 1 218 ? 10.168  29.559 -9.087  1.00 26.64 ? 331  LYS A CE  1 
ATOM   1627 N  NZ  . LYS A 1 218 ? 8.892   29.018 -8.587  1.00 29.07 ? 331  LYS A NZ  1 
ATOM   1628 N  N   . GLN A 1 219 ? 10.362  26.009 -15.218 1.00 18.08 ? 332  GLN A N   1 
ATOM   1629 C  CA  . GLN A 1 219 ? 11.095  25.962 -16.488 1.00 18.00 ? 332  GLN A CA  1 
ATOM   1630 C  C   . GLN A 1 219 ? 12.481  26.579 -16.347 1.00 19.00 ? 332  GLN A C   1 
ATOM   1631 O  O   . GLN A 1 219 ? 12.639  27.629 -15.730 1.00 19.62 ? 332  GLN A O   1 
ATOM   1632 C  CB  . GLN A 1 219 ? 10.319  26.706 -17.577 1.00 18.33 ? 332  GLN A CB  1 
ATOM   1633 C  CG  . GLN A 1 219 ? 10.992  26.684 -18.951 1.00 18.18 ? 332  GLN A CG  1 
ATOM   1634 C  CD  . GLN A 1 219 ? 10.144  27.346 -20.015 1.00 18.42 ? 332  GLN A CD  1 
ATOM   1635 O  OE1 . GLN A 1 219 ? 8.923   27.333 -19.925 1.00 18.52 ? 332  GLN A OE1 1 
ATOM   1636 N  NE2 . GLN A 1 219 ? 10.780  27.912 -21.027 1.00 13.93 ? 332  GLN A NE2 1 
ATOM   1637 N  N   . THR A 1 220 ? 13.493  25.906 -16.893 1.00 18.81 ? 333  THR A N   1 
ATOM   1638 C  CA  . THR A 1 220 ? 14.838  26.468 -16.948 1.00 19.97 ? 333  THR A CA  1 
ATOM   1639 C  C   . THR A 1 220 ? 15.245  26.768 -18.395 1.00 21.40 ? 333  THR A C   1 
ATOM   1640 O  O   . THR A 1 220 ? 16.132  27.589 -18.669 1.00 21.69 ? 333  THR A O   1 
ATOM   1641 C  CB  . THR A 1 220 ? 15.838  25.501 -16.299 1.00 19.97 ? 333  THR A CB  1 
ATOM   1642 O  OG1 . THR A 1 220 ? 15.766  24.235 -16.965 1.00 16.34 ? 333  THR A OG1 1 
ATOM   1643 C  CG2 . THR A 1 220 ? 15.532  25.327 -14.783 1.00 17.33 ? 333  THR A CG2 1 
ATOM   1644 N  N   . SER A 1 221 ? 14.592  26.057 -19.301 1.00 21.25 ? 334  SER A N   1 
ATOM   1645 C  CA  . SER A 1 221 ? 14.695  26.228 -20.729 1.00 22.83 ? 334  SER A CA  1 
ATOM   1646 C  C   . SER A 1 221 ? 14.440  27.694 -21.123 1.00 24.49 ? 334  SER A C   1 
ATOM   1647 O  O   . SER A 1 221 ? 13.453  28.283 -20.695 1.00 24.10 ? 334  SER A O   1 
ATOM   1648 C  CB  . SER A 1 221 ? 13.605  25.331 -21.334 1.00 21.57 ? 334  SER A CB  1 
ATOM   1649 O  OG  . SER A 1 221 ? 13.617  25.386 -22.721 1.00 26.60 ? 334  SER A OG  1 
ATOM   1650 N  N   . LYS A 1 222 ? 15.321  28.276 -21.935 1.00 26.80 ? 335  LYS A N   1 
ATOM   1651 C  CA  . LYS A 1 222 ? 15.123  29.641 -22.449 1.00 29.06 ? 335  LYS A CA  1 
ATOM   1652 C  C   . LYS A 1 222 ? 13.987  29.622 -23.479 1.00 29.07 ? 335  LYS A C   1 
ATOM   1653 O  O   . LYS A 1 222 ? 13.979  28.763 -24.350 1.00 28.58 ? 335  LYS A O   1 
ATOM   1654 C  CB  . LYS A 1 222 ? 16.424  30.186 -23.061 1.00 30.89 ? 335  LYS A CB  1 
ATOM   1655 C  CG  . LYS A 1 222 ? 17.186  31.147 -22.146 1.00 32.76 ? 335  LYS A CG  1 
ATOM   1656 C  CD  . LYS A 1 222 ? 18.705  31.091 -22.354 1.00 34.62 ? 335  LYS A CD  1 
ATOM   1657 C  CE  . LYS A 1 222 ? 19.398  32.313 -21.739 1.00 38.17 ? 335  LYS A CE  1 
ATOM   1658 N  NZ  . LYS A 1 222 ? 19.105  32.451 -20.268 1.00 39.83 ? 335  LYS A NZ  1 
ATOM   1659 N  N   . PRO A 1 223 ? 12.989  30.522 -23.348 1.00 30.29 ? 336  PRO A N   1 
ATOM   1660 C  CA  . PRO A 1 223 ? 11.782  30.453 -24.204 1.00 30.89 ? 336  PRO A CA  1 
ATOM   1661 C  C   . PRO A 1 223 ? 11.992  30.409 -25.734 1.00 31.93 ? 336  PRO A C   1 
ATOM   1662 O  O   . PRO A 1 223 ? 12.950  30.998 -26.250 1.00 34.04 ? 336  PRO A O   1 
ATOM   1663 C  CB  . PRO A 1 223 ? 11.006  31.707 -23.804 1.00 32.16 ? 336  PRO A CB  1 
ATOM   1664 C  CG  . PRO A 1 223 ? 11.410  31.959 -22.400 1.00 32.09 ? 336  PRO A CG  1 
ATOM   1665 C  CD  . PRO A 1 223 ? 12.873  31.601 -22.352 1.00 31.70 ? 336  PRO A CD  1 
HETATM 1666 MG MG  . MG  B 2 .   ? 20.764  8.315  -19.495 1.00 29.39 ? 1337 MG  A MG  1 
HETATM 1667 C  C1  . GOL C 3 .   ? 25.259  8.997  -26.046 1.00 35.17 ? 1338 GOL A C1  1 
HETATM 1668 O  O1  . GOL C 3 .   ? 26.406  9.803  -26.201 1.00 35.95 ? 1338 GOL A O1  1 
HETATM 1669 C  C2  . GOL C 3 .   ? 25.020  8.769  -24.562 1.00 34.23 ? 1338 GOL A C2  1 
HETATM 1670 O  O2  . GOL C 3 .   ? 26.138  9.164  -23.820 1.00 35.88 ? 1338 GOL A O2  1 
HETATM 1671 C  C3  . GOL C 3 .   ? 24.746  7.313  -24.268 1.00 33.28 ? 1338 GOL A C3  1 
HETATM 1672 O  O3  . GOL C 3 .   ? 23.380  7.123  -24.438 1.00 30.76 ? 1338 GOL A O3  1 
HETATM 1673 O  O   . HOH D 4 .   ? 15.592  16.014 10.115  1.00 37.11 ? 2001 HOH A O   1 
HETATM 1674 O  O   . HOH D 4 .   ? 9.962   15.557 13.780  1.00 18.40 ? 2002 HOH A O   1 
HETATM 1675 O  O   . HOH D 4 .   ? 6.190   22.558 7.640   1.00 17.18 ? 2003 HOH A O   1 
HETATM 1676 O  O   . HOH D 4 .   ? 8.902   24.539 9.397   1.00 20.59 ? 2004 HOH A O   1 
HETATM 1677 O  O   . HOH D 4 .   ? 3.346   16.287 5.159   1.00 33.81 ? 2005 HOH A O   1 
HETATM 1678 O  O   . HOH D 4 .   ? 2.805   22.506 1.115   1.00 22.54 ? 2006 HOH A O   1 
HETATM 1679 O  O   . HOH D 4 .   ? 3.854   25.913 3.978   1.00 35.48 ? 2007 HOH A O   1 
HETATM 1680 O  O   . HOH D 4 .   ? 3.015   25.001 1.361   1.00 35.92 ? 2008 HOH A O   1 
HETATM 1681 O  O   . HOH D 4 .   ? -0.117  20.958 7.639   1.00 19.58 ? 2009 HOH A O   1 
HETATM 1682 O  O   . HOH D 4 .   ? 6.023   23.391 -10.350 1.00 11.03 ? 2010 HOH A O   1 
HETATM 1683 O  O   . HOH D 4 .   ? 4.785   29.011 -8.068  1.00 28.43 ? 2011 HOH A O   1 
HETATM 1684 O  O   . HOH D 4 .   ? 7.619   27.557 -14.682 1.00 5.59  ? 2012 HOH A O   1 
HETATM 1685 O  O   . HOH D 4 .   ? 0.094   19.934 -9.866  1.00 23.97 ? 2013 HOH A O   1 
HETATM 1686 O  O   . HOH D 4 .   ? -6.327  22.169 -11.925 1.00 29.95 ? 2014 HOH A O   1 
HETATM 1687 O  O   . HOH D 4 .   ? -3.595  12.499 -12.218 1.00 25.54 ? 2015 HOH A O   1 
HETATM 1688 O  O   . HOH D 4 .   ? -4.545  13.028 -16.930 1.00 44.73 ? 2016 HOH A O   1 
HETATM 1689 O  O   . HOH D 4 .   ? 17.489  13.415 -19.058 1.00 20.69 ? 2017 HOH A O   1 
HETATM 1690 O  O   . HOH D 4 .   ? 20.641  11.161 -17.193 1.00 26.66 ? 2018 HOH A O   1 
HETATM 1691 O  O   . HOH D 4 .   ? 20.427  11.271 -21.552 1.00 23.99 ? 2019 HOH A O   1 
HETATM 1692 O  O   . HOH D 4 .   ? 22.454  9.823  -20.615 1.00 33.20 ? 2020 HOH A O   1 
HETATM 1693 O  O   . HOH D 4 .   ? 24.216  6.693  -34.962 1.00 23.11 ? 2021 HOH A O   1 
HETATM 1694 O  O   . HOH D 4 .   ? 35.185  10.816 -29.877 1.00 50.63 ? 2022 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? 25.589  14.623 -31.535 1.00 19.61 ? 2023 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? 18.281  7.988  -38.025 1.00 24.43 ? 2024 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 17.344  6.585  -33.957 1.00 19.60 ? 2025 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? -2.405  14.500 -6.703  1.00 43.20 ? 2026 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? -0.445  22.268 -0.274  0.50 23.89 ? 2027 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? 4.787   19.253 -4.755  1.00 15.69 ? 2028 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? 0.110   10.595 -6.119  1.00 24.51 ? 2029 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? 8.820   10.227 -7.742  1.00 21.45 ? 2030 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? 5.155   11.053 -3.102  1.00 32.39 ? 2031 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? 6.337   6.625  -8.177  1.00 24.79 ? 2032 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 4.349   4.045  -9.285  1.00 43.93 ? 2033 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? -2.381  9.929  -14.732 1.00 24.06 ? 2034 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? -1.137  3.993  -16.343 1.00 38.50 ? 2035 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? -0.731  8.974  -8.250  1.00 25.10 ? 2036 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? 8.351   2.828  -14.869 1.00 32.15 ? 2037 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 3.769   3.283  -14.741 1.00 23.64 ? 2038 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? 5.390   2.230  -23.909 1.00 33.28 ? 2039 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 10.245  -1.432 -23.375 1.00 42.05 ? 2040 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 17.718  0.682  -20.706 1.00 40.50 ? 2041 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? 10.785  -1.410 -26.735 1.00 34.10 ? 2042 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? 15.978  6.935  -38.181 1.00 24.57 ? 2043 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? 15.566  5.475  -35.875 1.00 14.17 ? 2044 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 25.506  2.239  -33.422 1.00 34.96 ? 2045 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 9.328   7.699  -7.867  1.00 29.33 ? 2046 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? 20.038  -1.048 -35.703 1.00 33.80 ? 2047 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? 9.018   0.649  -15.709 1.00 37.29 ? 2048 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? 26.428  2.736  -30.882 1.00 32.76 ? 2049 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? 30.544  -2.382 -19.373 1.00 48.01 ? 2050 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 34.360  -0.002 -23.387 0.50 22.91 ? 2051 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 19.813  -0.705 -20.411 1.00 41.72 ? 2052 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? 20.159  -3.578 -20.281 1.00 37.93 ? 2053 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 10.473  -0.621 -29.151 1.00 31.36 ? 2054 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? 13.047  7.878  -38.143 1.00 25.20 ? 2055 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? 7.084   11.399 -36.349 1.00 32.66 ? 2056 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? 1.946   5.227  -34.901 1.00 37.76 ? 2057 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? -4.812  14.682 -24.666 1.00 17.53 ? 2058 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? -1.587  5.349  -22.047 1.00 44.83 ? 2059 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 1.206   19.141 -24.543 1.00 30.27 ? 2060 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? -11.105 20.526 -22.902 1.00 27.27 ? 2061 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? -5.774  24.865 -16.585 1.00 26.80 ? 2062 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? -0.057  18.916 -20.744 1.00 14.44 ? 2063 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? -1.245  22.010 -22.622 1.00 26.32 ? 2064 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 1.313   22.007 -21.180 1.00 21.35 ? 2065 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? 3.230   20.793 -22.891 1.00 27.01 ? 2066 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 17.141  18.261 -22.265 1.00 18.66 ? 2067 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 17.709  24.467 -18.927 1.00 12.35 ? 2068 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 12.465  25.802 -2.122  1.00 43.05 ? 2069 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? 19.496  15.839 -21.226 1.00 24.71 ? 2070 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? 13.495  20.042 -28.011 1.00 15.36 ? 2071 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? 17.599  23.494 -29.824 1.00 38.81 ? 2072 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 24.096  10.750 -43.554 1.00 41.92 ? 2073 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 13.398  10.826 -42.537 1.00 37.59 ? 2074 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 10.220  16.819 -44.113 1.00 28.68 ? 2075 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 12.963  19.723 -37.542 1.00 39.57 ? 2076 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 10.251  21.567 -35.847 1.00 36.16 ? 2077 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? 7.622   15.238 -32.179 1.00 23.76 ? 2078 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? 3.184   20.581 -32.331 1.00 35.63 ? 2079 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 7.301   20.498 -22.164 1.00 21.07 ? 2080 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 5.995   13.334 -30.781 1.00 15.47 ? 2081 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? 13.424  25.483 -27.111 1.00 38.75 ? 2082 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? 3.787   22.662 -24.432 1.00 40.23 ? 2083 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? 23.392  21.174 -17.350 1.00 30.98 ? 2084 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? 25.173  17.975 -3.658  1.00 38.59 ? 2085 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 23.561  25.689 0.152   1.00 35.14 ? 2086 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? 25.404  10.580 -12.872 1.00 33.06 ? 2087 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 23.889  12.010 -14.429 1.00 29.84 ? 2088 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? 17.139  5.940  -0.794  1.00 29.73 ? 2089 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 16.548  5.908  -3.458  1.00 35.63 ? 2090 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? 20.166  5.069  -13.537 1.00 24.02 ? 2091 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? 23.510  8.446  -16.601 1.00 34.86 ? 2092 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? 11.434  6.583  -9.059  1.00 32.89 ? 2093 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 17.333  8.136  -6.751  1.00 21.15 ? 2094 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 20.865  18.697 2.971   1.00 40.88 ? 2095 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 12.838  23.453 -0.887  1.00 32.65 ? 2096 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? 11.033  26.797 -4.560  1.00 28.40 ? 2097 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? 11.988  27.269 -7.327  1.00 42.37 ? 2098 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? 13.144  24.279 -11.599 1.00 14.82 ? 2099 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 6.477   26.248 -19.256 1.00 30.41 ? 2100 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? 8.968   29.010 -23.136 1.00 28.88 ? 2101 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 12.036  29.760 -14.470 1.00 27.19 ? 2102 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 12.048  26.791 -23.790 1.00 22.07 ? 2103 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 18.000  26.564 -22.775 1.00 24.72 ? 2104 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 17  ? 0.4539 0.5372 0.1749 0.0181  -0.0776 -0.0042 130 ASN A N   
2    C CA  . ASN A 17  ? 0.4342 0.4953 0.1673 0.0257  -0.0659 0.0074  130 ASN A CA  
3    C C   . ASN A 17  ? 0.4213 0.4530 0.1515 0.0193  -0.0500 0.0053  130 ASN A C   
4    O O   . ASN A 17  ? 0.3975 0.4198 0.1489 0.0156  -0.0425 0.0047  130 ASN A O   
5    C CB  . ASN A 17  ? 0.4729 0.5310 0.1897 0.0437  -0.0665 0.0236  130 ASN A CB  
6    C CG  . ASN A 17  ? 0.4795 0.5067 0.1964 0.0480  -0.0509 0.0337  130 ASN A CG  
7    O OD1 . ASN A 17  ? 0.5063 0.5277 0.2469 0.0437  -0.0456 0.0330  130 ASN A OD1 
8    N ND2 . ASN A 17  ? 0.5792 0.5865 0.2676 0.0557  -0.0430 0.0428  130 ASN A ND2 
9    N N   . LEU A 18  ? 0.4227 0.4424 0.1266 0.0187  -0.0450 0.0038  131 LEU A N   
10   C CA  . LEU A 18  ? 0.4116 0.4129 0.1140 0.0099  -0.0326 -0.0040 131 LEU A CA  
11   C C   . LEU A 18  ? 0.3881 0.3958 0.1065 -0.0019 -0.0356 -0.0180 131 LEU A C   
12   O O   . LEU A 18  ? 0.3815 0.3750 0.1076 -0.0067 -0.0252 -0.0232 131 LEU A O   
13   C CB  . LEU A 18  ? 0.4353 0.4262 0.1049 0.0100  -0.0283 -0.0060 131 LEU A CB  
14   C CG  . LEU A 18  ? 0.4526 0.4232 0.1060 0.0167  -0.0148 0.0046  131 LEU A CG  
15   C CD1 . LEU A 18  ? 0.4763 0.4383 0.0970 0.0157  -0.0111 0.0007  131 LEU A CD1 
16   C CD2 . LEU A 18  ? 0.4249 0.3826 0.0994 0.0129  -0.0001 0.0051  131 LEU A CD2 
17   N N   . TYR A 19  ? 0.3686 0.3977 0.0910 -0.0062 -0.0490 -0.0241 132 TYR A N   
18   C CA  . TYR A 19  ? 0.3595 0.3925 0.0963 -0.0190 -0.0507 -0.0372 132 TYR A CA  
19   C C   . TYR A 19  ? 0.3272 0.3486 0.0895 -0.0197 -0.0421 -0.0358 132 TYR A C   
20   O O   . TYR A 19  ? 0.3299 0.3394 0.0955 -0.0276 -0.0360 -0.0451 132 TYR A O   
21   C CB  . TYR A 19  ? 0.3439 0.4073 0.0885 -0.0234 -0.0659 -0.0418 132 TYR A CB  
22   C CG  . TYR A 19  ? 0.3298 0.3964 0.0851 -0.0396 -0.0668 -0.0567 132 TYR A CG  
23   C CD1 . TYR A 19  ? 0.3339 0.3982 0.0696 -0.0530 -0.0675 -0.0713 132 TYR A CD1 
24   C CD2 . TYR A 19  ? 0.2940 0.3638 0.0763 -0.0422 -0.0659 -0.0565 132 TYR A CD2 
25   C CE1 . TYR A 19  ? 0.3447 0.4075 0.0871 -0.0695 -0.0663 -0.0854 132 TYR A CE1 
26   C CE2 . TYR A 19  ? 0.2926 0.3621 0.0820 -0.0575 -0.0651 -0.0695 132 TYR A CE2 
27   C CZ  . TYR A 19  ? 0.3075 0.3723 0.0767 -0.0715 -0.0646 -0.0840 132 TYR A CZ  
28   O OH  . TYR A 19  ? 0.3245 0.3840 0.0980 -0.0883 -0.0614 -0.0974 132 TYR A OH  
29   N N   . PHE A 20  ? 0.3107 0.3344 0.0884 -0.0110 -0.0414 -0.0244 133 PHE A N   
30   C CA  . PHE A 20  ? 0.2905 0.3079 0.0924 -0.0113 -0.0353 -0.0227 133 PHE A CA  
31   C C   . PHE A 20  ? 0.2904 0.2905 0.0935 -0.0075 -0.0221 -0.0181 133 PHE A C   
32   O O   . PHE A 20  ? 0.2721 0.2692 0.0941 -0.0077 -0.0173 -0.0176 133 PHE A O   
33   C CB  . PHE A 20  ? 0.2665 0.2981 0.0859 -0.0056 -0.0421 -0.0147 133 PHE A CB  
34   C CG  . PHE A 20  ? 0.2685 0.3221 0.0964 -0.0106 -0.0537 -0.0206 133 PHE A CG  
35   C CD1 . PHE A 20  ? 0.2648 0.3394 0.0836 -0.0059 -0.0646 -0.0180 133 PHE A CD1 
36   C CD2 . PHE A 20  ? 0.2510 0.3054 0.0946 -0.0203 -0.0529 -0.0292 133 PHE A CD2 
37   C CE1 . PHE A 20  ? 0.2865 0.3880 0.1154 -0.0117 -0.0754 -0.0247 133 PHE A CE1 
38   C CE2 . PHE A 20  ? 0.2691 0.3454 0.1211 -0.0275 -0.0622 -0.0359 133 PHE A CE2 
39   C CZ  . PHE A 20  ? 0.2665 0.3690 0.1128 -0.0239 -0.0737 -0.0342 133 PHE A CZ  
40   N N   . GLN A 21  ? 0.3204 0.3117 0.1039 -0.0044 -0.0163 -0.0152 134 GLN A N   
41   C CA  . GLN A 21  ? 0.3254 0.3058 0.1113 -0.0015 -0.0036 -0.0100 134 GLN A CA  
42   C C   . GLN A 21  ? 0.3113 0.2877 0.1120 -0.0041 0.0045  -0.0161 134 GLN A C   
43   O O   . GLN A 21  ? 0.2937 0.2716 0.1104 -0.0027 0.0102  -0.0124 134 GLN A O   
44   C CB  . GLN A 21  ? 0.3514 0.3224 0.1110 0.0006  0.0027  -0.0079 134 GLN A CB  
45   C CG  . GLN A 21  ? 0.3543 0.3168 0.1155 0.0019  0.0166  -0.0023 134 GLN A CG  
46   C CD  . GLN A 21  ? 0.3982 0.3506 0.1336 0.0025  0.0250  -0.0026 134 GLN A CD  
47   O OE1 . GLN A 21  ? 0.4451 0.3946 0.1720 0.0006  0.0278  -0.0110 134 GLN A OE1 
48   N NE2 . GLN A 21  ? 0.4072 0.3514 0.1272 0.0054  0.0301  0.0065  134 GLN A NE2 
49   N N   . SER A 22  ? 0.3286 0.2998 0.1222 -0.0075 0.0050  -0.0255 135 SER A N   
50   C CA  . SER A 22  ? 0.3423 0.3073 0.1465 -0.0068 0.0130  -0.0306 135 SER A CA  
51   C C   . SER A 22  ? 0.3359 0.3043 0.1592 -0.0085 0.0082  -0.0321 135 SER A C   
52   O O   . SER A 22  ? 0.3395 0.3053 0.1745 -0.0049 0.0145  -0.0327 135 SER A O   
53   C CB  . SER A 22  ? 0.3615 0.3124 0.1454 -0.0088 0.0181  -0.0400 135 SER A CB  
54   O OG  . SER A 22  ? 0.3952 0.3411 0.1654 -0.0051 0.0276  -0.0388 135 SER A OG  
55   N N   . MET A 23  ? 0.3439 0.3197 0.1698 -0.0132 -0.0024 -0.0329 136 MET A N   
56   C CA  . MET A 23  ? 0.3376 0.3157 0.1786 -0.0166 -0.0063 -0.0356 136 MET A CA  
57   C C   . MET A 23  ? 0.3074 0.2956 0.1695 -0.0128 -0.0088 -0.0277 136 MET A C   
58   O O   . MET A 23  ? 0.2974 0.2848 0.1734 -0.0130 -0.0079 -0.0284 136 MET A O   
59   C CB  . MET A 23  ? 0.3466 0.3336 0.1828 -0.0246 -0.0166 -0.0408 136 MET A CB  
60   C CG  . MET A 23  ? 0.3903 0.3671 0.2078 -0.0329 -0.0152 -0.0520 136 MET A CG  
61   S SD  . MET A 23  ? 0.4270 0.4267 0.2429 -0.0428 -0.0298 -0.0573 136 MET A SD  
62   C CE  . MET A 23  ? 0.3712 0.3761 0.2120 -0.0475 -0.0311 -0.0582 136 MET A CE  
63   N N   . SER A 24  ? 0.3037 0.2991 0.1653 -0.0096 -0.0114 -0.0202 137 SER A N   
64   C CA  . SER A 24  ? 0.2935 0.2958 0.1715 -0.0068 -0.0137 -0.0132 137 SER A CA  
65   C C   . SER A 24  ? 0.2823 0.2823 0.1742 -0.0052 -0.0060 -0.0122 137 SER A C   
66   O O   . SER A 24  ? 0.2781 0.2745 0.1663 -0.0037 0.0019  -0.0136 137 SER A O   
67   C CB  . SER A 24  ? 0.3031 0.3066 0.1723 -0.0026 -0.0147 -0.0050 137 SER A CB  
68   O OG  . SER A 24  ? 0.3637 0.3588 0.2221 -0.0016 -0.0056 -0.0032 137 SER A OG  
69   N N   . PHE A 25  ? 0.2613 0.2662 0.1693 -0.0052 -0.0086 -0.0101 138 PHE A N   
70   C CA  . PHE A 25  ? 0.2443 0.2512 0.1659 -0.0038 -0.0034 -0.0092 138 PHE A CA  
71   C C   . PHE A 25  ? 0.2413 0.2451 0.1616 -0.0014 0.0023  -0.0139 138 PHE A C   
72   O O   . PHE A 25  ? 0.2503 0.2577 0.1712 0.0011  0.0090  -0.0135 138 PHE A O   
73   C CB  . PHE A 25  ? 0.2439 0.2528 0.1672 -0.0039 0.0013  -0.0039 138 PHE A CB  
74   C CG  . PHE A 25  ? 0.2492 0.2555 0.1698 -0.0035 -0.0026 0.0018  138 PHE A CG  
75   C CD1 . PHE A 25  ? 0.2686 0.2690 0.1728 -0.0018 -0.0022 0.0060  138 PHE A CD1 
76   C CD2 . PHE A 25  ? 0.2407 0.2496 0.1729 -0.0032 -0.0065 0.0035  138 PHE A CD2 
77   C CE1 . PHE A 25  ? 0.2753 0.2725 0.1747 0.0021  -0.0054 0.0125  138 PHE A CE1 
78   C CE2 . PHE A 25  ? 0.2586 0.2648 0.1875 -0.0001 -0.0093 0.0092  138 PHE A CE2 
79   C CZ  . PHE A 25  ? 0.2656 0.2658 0.1778 0.0034  -0.0088 0.0141  138 PHE A CZ  
80   N N   . PRO A 26  ? 0.2477 0.2444 0.1656 -0.0020 0.0007  -0.0185 139 PRO A N   
81   C CA  . PRO A 26  ? 0.2550 0.2438 0.1685 0.0027  0.0076  -0.0221 139 PRO A CA  
82   C C   . PRO A 26  ? 0.2429 0.2391 0.1704 0.0087  0.0102  -0.0193 139 PRO A C   
83   O O   . PRO A 26  ? 0.2249 0.2303 0.1649 0.0067  0.0062  -0.0160 139 PRO A O   
84   C CB  . PRO A 26  ? 0.2651 0.2401 0.1699 -0.0018 0.0060  -0.0277 139 PRO A CB  
85   C CG  . PRO A 26  ? 0.2503 0.2338 0.1663 -0.0072 -0.0020 -0.0258 139 PRO A CG  
86   C CD  . PRO A 26  ? 0.2474 0.2428 0.1661 -0.0072 -0.0062 -0.0207 139 PRO A CD  
87   N N   . PRO A 27  ? 0.2576 0.2502 0.1819 0.0170  0.0170  -0.0207 140 PRO A N   
88   C CA  . PRO A 27  ? 0.2538 0.2555 0.1897 0.0242  0.0181  -0.0180 140 PRO A CA  
89   C C   . PRO A 27  ? 0.2526 0.2449 0.1907 0.0215  0.0140  -0.0177 140 PRO A C   
90   O O   . PRO A 27  ? 0.2661 0.2400 0.1931 0.0181  0.0148  -0.0210 140 PRO A O   
91   C CB  . PRO A 27  ? 0.2678 0.2635 0.1948 0.0361  0.0265  -0.0192 140 PRO A CB  
92   C CG  . PRO A 27  ? 0.2802 0.2696 0.1950 0.0340  0.0305  -0.0223 140 PRO A CG  
93   C CD  . PRO A 27  ? 0.2755 0.2557 0.1840 0.0217  0.0243  -0.0244 140 PRO A CD  
94   N N   . GLN A 28  ? 0.2417 0.2468 0.1934 0.0217  0.0105  -0.0145 141 GLN A N   
95   C CA  . GLN A 28  ? 0.2406 0.2386 0.1952 0.0193  0.0074  -0.0138 141 GLN A CA  
96   C C   . GLN A 28  ? 0.2508 0.2476 0.2048 0.0302  0.0110  -0.0116 141 GLN A C   
97   O O   . GLN A 28  ? 0.2564 0.2646 0.2118 0.0398  0.0140  -0.0103 141 GLN A O   
98   C CB  . GLN A 28  ? 0.2209 0.2309 0.1878 0.0123  0.0015  -0.0117 141 GLN A CB  
99   C CG  . GLN A 28  ? 0.2113 0.2211 0.1765 0.0047  -0.0022 -0.0121 141 GLN A CG  
100  C CD  . GLN A 28  ? 0.2348 0.2356 0.1957 -0.0011 -0.0055 -0.0146 141 GLN A CD  
101  O OE1 . GLN A 28  ? 0.2214 0.2141 0.1819 -0.0019 -0.0044 -0.0162 141 GLN A OE1 
102  N NE2 . GLN A 28  ? 0.2291 0.2328 0.1859 -0.0053 -0.0092 -0.0150 141 GLN A NE2 
103  N N   . ARG A 29  ? 0.2580 0.2431 0.2101 0.0293  0.0107  -0.0109 142 ARG A N   
104  C CA  . ARG A 29  ? 0.2741 0.2542 0.2213 0.0410  0.0145  -0.0077 142 ARG A CA  
105  C C   . ARG A 29  ? 0.2490 0.2519 0.2091 0.0442  0.0099  -0.0046 142 ARG A C   
106  O O   . ARG A 29  ? 0.2500 0.2543 0.2062 0.0555  0.0117  -0.0015 142 ARG A O   
107  C CB  . ARG A 29  ? 0.2912 0.2453 0.2274 0.0378  0.0183  -0.0084 142 ARG A CB  
108  C CG  . ARG A 29  ? 0.3312 0.2616 0.2529 0.0315  0.0236  -0.0134 142 ARG A CG  
109  C CD  . ARG A 29  ? 0.3681 0.2749 0.2807 0.0239  0.0281  -0.0155 142 ARG A CD  
110  N NE  . ARG A 29  ? 0.4411 0.3204 0.3344 0.0197  0.0364  -0.0210 142 ARG A NE  
111  C CZ  . ARG A 29  ? 0.4962 0.3440 0.3717 0.0177  0.0464  -0.0227 142 ARG A CZ  
112  N NH1 . ARG A 29  ? 0.5175 0.3575 0.3921 0.0202  0.0492  -0.0186 142 ARG A NH1 
113  N NH2 . ARG A 29  ? 0.5198 0.3414 0.3761 0.0121  0.0547  -0.0292 142 ARG A NH2 
114  N N   . TYR A 30  ? 0.2288 0.2481 0.2018 0.0346  0.0045  -0.0057 143 TYR A N   
115  C CA  . TYR A 30  ? 0.2101 0.2480 0.1936 0.0336  0.0007  -0.0046 143 TYR A CA  
116  C C   . TYR A 30  ? 0.1965 0.2556 0.1898 0.0283  -0.0007 -0.0065 143 TYR A C   
117  O O   . TYR A 30  ? 0.2031 0.2581 0.1958 0.0220  0.0001  -0.0077 143 TYR A O   
118  C CB  . TYR A 30  ? 0.2008 0.2300 0.1873 0.0249  -0.0021 -0.0045 143 TYR A CB  
119  C CG  . TYR A 30  ? 0.2126 0.2219 0.1898 0.0281  0.0008  -0.0031 143 TYR A CG  
120  C CD1 . TYR A 30  ? 0.2241 0.2326 0.1967 0.0362  0.0020  -0.0004 143 TYR A CD1 
121  C CD2 . TYR A 30  ? 0.2052 0.1959 0.1758 0.0228  0.0032  -0.0050 143 TYR A CD2 
122  C CE1 . TYR A 30  ? 0.2376 0.2232 0.1981 0.0391  0.0070  0.0013  143 TYR A CE1 
123  C CE2 . TYR A 30  ? 0.2282 0.1988 0.1889 0.0233  0.0080  -0.0049 143 TYR A CE2 
124  C CZ  . TYR A 30  ? 0.2555 0.2212 0.2104 0.0315  0.0107  -0.0013 143 TYR A CZ  
125  O OH  . TYR A 30  ? 0.2681 0.2089 0.2100 0.0313  0.0176  -0.0008 143 TYR A OH  
126  N N   . HIS A 31  ? 0.1823 0.2642 0.1832 0.0301  -0.0021 -0.0072 144 HIS A N   
127  C CA  . HIS A 31  ? 0.1729 0.2751 0.1833 0.0215  -0.0020 -0.0103 144 HIS A CA  
128  C C   . HIS A 31  ? 0.1649 0.2573 0.1771 0.0083  -0.0030 -0.0113 144 HIS A C   
129  O O   . HIS A 31  ? 0.1621 0.2556 0.1756 0.0001  -0.0005 -0.0127 144 HIS A O   
130  C CB  . HIS A 31  ? 0.1652 0.2980 0.1837 0.0248  -0.0037 -0.0124 144 HIS A CB  
131  C CG  . HIS A 31  ? 0.1589 0.3096 0.1780 0.0390  -0.0019 -0.0114 144 HIS A CG  
132  N ND1 . HIS A 31  ? 0.1506 0.3107 0.1664 0.0541  -0.0038 -0.0085 144 HIS A ND1 
133  C CD2 . HIS A 31  ? 0.1579 0.3189 0.1793 0.0421  0.0023  -0.0124 144 HIS A CD2 
134  C CE1 . HIS A 31  ? 0.1580 0.3339 0.1746 0.0673  -0.0008 -0.0075 144 HIS A CE1 
135  N NE2 . HIS A 31  ? 0.1188 0.2963 0.1395 0.0598  0.0031  -0.0102 144 HIS A NE2 
136  N N   . TYR A 32  ? 0.1596 0.2412 0.1702 0.0076  -0.0055 -0.0100 145 TYR A N   
137  C CA  . TYR A 32  ? 0.1635 0.2348 0.1749 -0.0019 -0.0056 -0.0103 145 TYR A CA  
138  C C   . TYR A 32  ? 0.1617 0.2152 0.1697 0.0005  -0.0071 -0.0076 145 TYR A C   
139  O O   . TYR A 32  ? 0.1564 0.2066 0.1615 0.0070  -0.0078 -0.0064 145 TYR A O   
140  C CB  . TYR A 32  ? 0.1671 0.2513 0.1825 -0.0085 -0.0056 -0.0138 145 TYR A CB  
141  C CG  . TYR A 32  ? 0.1715 0.2771 0.1920 -0.0143 -0.0033 -0.0181 145 TYR A CG  
142  C CD1 . TYR A 32  ? 0.1677 0.2676 0.1870 -0.0240 0.0015  -0.0194 145 TYR A CD1 
143  C CD2 . TYR A 32  ? 0.1847 0.3175 0.2105 -0.0093 -0.0055 -0.0206 145 TYR A CD2 
144  C CE1 . TYR A 32  ? 0.1763 0.2965 0.2006 -0.0313 0.0052  -0.0240 145 TYR A CE1 
145  C CE2 . TYR A 32  ? 0.1834 0.3418 0.2166 -0.0154 -0.0031 -0.0254 145 TYR A CE2 
146  C CZ  . TYR A 32  ? 0.1831 0.3350 0.2160 -0.0277 0.0027  -0.0276 145 TYR A CZ  
147  O OH  . TYR A 32  ? 0.1763 0.3545 0.2169 -0.0359 0.0065  -0.0331 145 TYR A OH  
148  N N   . PHE A 33  ? 0.1671 0.2095 0.1748 -0.0044 -0.0069 -0.0064 146 PHE A N   
149  C CA  . PHE A 33  ? 0.1622 0.1937 0.1701 -0.0038 -0.0080 -0.0046 146 PHE A CA  
150  C C   . PHE A 33  ? 0.1634 0.1925 0.1730 -0.0078 -0.0065 -0.0048 146 PHE A C   
151  O O   . PHE A 33  ? 0.1833 0.2108 0.1914 -0.0123 -0.0041 -0.0052 146 PHE A O   
152  C CB  . PHE A 33  ? 0.1663 0.1913 0.1729 -0.0041 -0.0092 -0.0031 146 PHE A CB  
153  C CG  . PHE A 33  ? 0.1653 0.1888 0.1677 -0.0017 -0.0097 -0.0041 146 PHE A CG  
154  C CD1 . PHE A 33  ? 0.1849 0.2111 0.1834 -0.0014 -0.0090 -0.0047 146 PHE A CD1 
155  C CD2 . PHE A 33  ? 0.1733 0.1902 0.1734 0.0000  -0.0091 -0.0050 146 PHE A CD2 
156  C CE1 . PHE A 33  ? 0.1742 0.1962 0.1664 0.0012  -0.0081 -0.0063 146 PHE A CE1 
157  C CE2 . PHE A 33  ? 0.1851 0.1954 0.1778 0.0018  -0.0076 -0.0067 146 PHE A CE2 
158  C CZ  . PHE A 33  ? 0.1789 0.1919 0.1677 0.0028  -0.0073 -0.0074 146 PHE A CZ  
159  N N   . LEU A 34  ? 0.1582 0.1841 0.1684 -0.0064 -0.0064 -0.0046 147 LEU A N   
160  C CA  . LEU A 34  ? 0.1538 0.1758 0.1636 -0.0095 -0.0040 -0.0055 147 LEU A CA  
161  C C   . LEU A 34  ? 0.1512 0.1644 0.1634 -0.0075 -0.0029 -0.0029 147 LEU A C   
162  O O   . LEU A 34  ? 0.1514 0.1635 0.1654 -0.0054 -0.0029 -0.0023 147 LEU A O   
163  C CB  . LEU A 34  ? 0.1466 0.1746 0.1541 -0.0090 -0.0043 -0.0079 147 LEU A CB  
164  C CG  . LEU A 34  ? 0.1579 0.2020 0.1649 -0.0082 -0.0065 -0.0103 147 LEU A CG  
165  C CD1 . LEU A 34  ? 0.1381 0.1905 0.1414 -0.0061 -0.0078 -0.0120 147 LEU A CD1 
166  C CD2 . LEU A 34  ? 0.1525 0.2040 0.1613 -0.0160 -0.0049 -0.0136 147 LEU A CD2 
167  N N   . VAL A 35  ? 0.1587 0.1664 0.1704 -0.0076 -0.0013 -0.0009 148 VAL A N   
168  C CA  . VAL A 35  ? 0.1602 0.1651 0.1756 -0.0034 -0.0008 0.0023  148 VAL A CA  
169  C C   . VAL A 35  ? 0.1687 0.1661 0.1828 -0.0029 0.0041  0.0019  148 VAL A C   
170  O O   . VAL A 35  ? 0.1724 0.1608 0.1795 -0.0060 0.0083  0.0003  148 VAL A O   
171  C CB  . VAL A 35  ? 0.1680 0.1696 0.1803 -0.0004 -0.0007 0.0059  148 VAL A CB  
172  C CG1 . VAL A 35  ? 0.1405 0.1449 0.1578 0.0067  -0.0008 0.0097  148 VAL A CG1 
173  C CG2 . VAL A 35  ? 0.1522 0.1606 0.1637 -0.0014 -0.0050 0.0057  148 VAL A CG2 
174  N N   . LEU A 36  ? 0.1676 0.1684 0.1877 -0.0003 0.0045  0.0025  149 LEU A N   
175  C CA  . LEU A 36  ? 0.1742 0.1680 0.1928 0.0008  0.0099  0.0020  149 LEU A CA  
176  C C   . LEU A 36  ? 0.1757 0.1755 0.2032 0.0067  0.0113  0.0049  149 LEU A C   
177  O O   . LEU A 36  ? 0.1655 0.1777 0.2016 0.0064  0.0077  0.0051  149 LEU A O   
178  C CB  . LEU A 36  ? 0.1725 0.1667 0.1880 -0.0025 0.0102  -0.0012 149 LEU A CB  
179  C CG  . LEU A 36  ? 0.1738 0.1613 0.1860 -0.0019 0.0158  -0.0023 149 LEU A CG  
180  C CD1 . LEU A 36  ? 0.1620 0.1488 0.1653 -0.0052 0.0152  -0.0055 149 LEU A CD1 
181  C CD2 . LEU A 36  ? 0.1392 0.1321 0.1607 0.0011  0.0178  -0.0002 149 LEU A CD2 
182  N N   . ASP A 37  ? 0.1885 0.1800 0.2136 0.0118  0.0173  0.0066  150 ASP A N   
183  C CA  . ASP A 37  ? 0.1894 0.1897 0.2240 0.0193  0.0199  0.0094  150 ASP A CA  
184  C C   . ASP A 37  ? 0.2049 0.1908 0.2329 0.0228  0.0289  0.0091  150 ASP A C   
185  O O   . ASP A 37  ? 0.2226 0.1909 0.2391 0.0261  0.0340  0.0104  150 ASP A O   
186  C CB  . ASP A 37  ? 0.1997 0.2079 0.2379 0.0282  0.0174  0.0145  150 ASP A CB  
187  C CG  . ASP A 37  ? 0.2081 0.2345 0.2596 0.0371  0.0187  0.0171  150 ASP A CG  
188  O OD1 . ASP A 37  ? 0.2368 0.2853 0.3015 0.0333  0.0140  0.0151  150 ASP A OD1 
189  O OD2 . ASP A 37  ? 0.2671 0.2861 0.3155 0.0474  0.0255  0.0206  150 ASP A OD2 
190  N N   . PHE A 38  ? 0.1961 0.1862 0.2288 0.0218  0.0325  0.0072  151 PHE A N   
191  C CA  . PHE A 38  ? 0.2105 0.1868 0.2361 0.0256  0.0421  0.0065  151 PHE A CA  
192  C C   . PHE A 38  ? 0.2187 0.2003 0.2515 0.0385  0.0475  0.0111  151 PHE A C   
193  O O   . PHE A 38  ? 0.2082 0.2135 0.2570 0.0436  0.0434  0.0140  151 PHE A O   
194  C CB  . PHE A 38  ? 0.2060 0.1841 0.2321 0.0205  0.0452  0.0032  151 PHE A CB  
195  C CG  . PHE A 38  ? 0.2025 0.1759 0.2194 0.0112  0.0408  -0.0004 151 PHE A CG  
196  C CD1 . PHE A 38  ? 0.2216 0.1833 0.2253 0.0066  0.0393  -0.0033 151 PHE A CD1 
197  C CD2 . PHE A 38  ? 0.1988 0.1799 0.2193 0.0073  0.0393  -0.0010 151 PHE A CD2 
198  C CE1 . PHE A 38  ? 0.2185 0.1819 0.2151 0.0002  0.0346  -0.0064 151 PHE A CE1 
199  C CE2 . PHE A 38  ? 0.1955 0.1723 0.2057 0.0024  0.0357  -0.0029 151 PHE A CE2 
200  C CZ  . PHE A 38  ? 0.2012 0.1719 0.2005 -0.0003 0.0326  -0.0055 151 PHE A CZ  
201  N N   . GLU A 39  ? 0.2337 0.1942 0.2541 0.0439  0.0573  0.0112  152 GLU A N   
202  C CA  . GLU A 39  ? 0.2417 0.2065 0.2681 0.0569  0.0657  0.0145  152 GLU A CA  
203  C C   . GLU A 39  ? 0.2437 0.1977 0.2635 0.0522  0.0738  0.0097  152 GLU A C   
204  O O   . GLU A 39  ? 0.2473 0.1842 0.2523 0.0414  0.0740  0.0045  152 GLU A O   
205  C CB  . GLU A 39  ? 0.2683 0.2137 0.2828 0.0705  0.0728  0.0196  152 GLU A CB  
206  C CG  . GLU A 39  ? 0.2816 0.2362 0.2993 0.0765  0.0651  0.0252  152 GLU A CG  
207  C CD  . GLU A 39  ? 0.2825 0.2769 0.3240 0.0827  0.0568  0.0284  152 GLU A CD  
208  O OE1 . GLU A 39  ? 0.3041 0.3176 0.3595 0.0892  0.0605  0.0288  152 GLU A OE1 
209  O OE2 . GLU A 39  ? 0.2951 0.3033 0.3415 0.0801  0.0469  0.0298  152 GLU A OE2 
210  N N   . ALA A 40  ? 0.2409 0.2078 0.2717 0.0603  0.0803  0.0113  153 ALA A N   
211  C CA  . ALA A 40  ? 0.2581 0.2186 0.2843 0.0561  0.0883  0.0072  153 ALA A CA  
212  C C   . ALA A 40  ? 0.2734 0.2341 0.3028 0.0707  0.1006  0.0098  153 ALA A C   
213  O O   . ALA A 40  ? 0.2756 0.2531 0.3179 0.0844  0.1007  0.0154  153 ALA A O   
214  C CB  . ALA A 40  ? 0.2326 0.2156 0.2729 0.0464  0.0834  0.0053  153 ALA A CB  
215  N N   . THR A 41  ? 0.2969 0.2403 0.3137 0.0690  0.1111  0.0060  154 THR A N   
216  C CA  . THR A 41  ? 0.3240 0.2717 0.3463 0.0825  0.1239  0.0080  154 THR A CA  
217  C C   . THR A 41  ? 0.3143 0.3045 0.3666 0.0851  0.1207  0.0106  154 THR A C   
218  O O   . THR A 41  ? 0.2925 0.2997 0.3550 0.0718  0.1123  0.0084  154 THR A O   
219  C CB  . THR A 41  ? 0.3435 0.2707 0.3493 0.0773  0.1350  0.0026  154 THR A CB  
220  O OG1 . THR A 41  ? 0.3235 0.2627 0.3336 0.0630  0.1297  -0.0007 154 THR A OG1 
221  C CG2 . THR A 41  ? 0.3468 0.2331 0.3217 0.0728  0.1397  -0.0022 154 THR A CG2 
222  N N   . CYS A 42  ? 0.3332 0.3403 0.3986 0.1021  0.1284  0.0148  155 CYS A N   
223  C CA  . CYS A 42  ? 0.3216 0.3754 0.4177 0.1054  0.1255  0.0167  155 CYS A CA  
224  C C   . CYS A 42  ? 0.3444 0.4159 0.4524 0.1273  0.1364  0.0213  155 CYS A C   
225  O O   . CYS A 42  ? 0.3640 0.4074 0.4542 0.1429  0.1457  0.0246  155 CYS A O   
226  C CB  . CYS A 42  ? 0.3056 0.3825 0.4148 0.1033  0.1102  0.0191  155 CYS A CB  
227  S SG  . CYS A 42  ? 0.3379 0.4002 0.4354 0.1227  0.1071  0.0269  155 CYS A SG  
228  N N   . ASP A 43  ? 0.3398 0.4582 0.4773 0.1277  0.1360  0.0209  156 ASP A N   
229  C CA  . ASP A 43  ? 0.3567 0.5072 0.5133 0.1492  0.1443  0.0253  156 ASP A CA  
230  C C   . ASP A 43  ? 0.3421 0.5541 0.5348 0.1437  0.1360  0.0236  156 ASP A C   
231  O O   . ASP A 43  ? 0.3222 0.5439 0.5210 0.1228  0.1255  0.0189  156 ASP A O   
232  C CB  . ASP A 43  ? 0.3726 0.5087 0.5224 0.1537  0.1627  0.0231  156 ASP A CB  
233  C CG  . ASP A 43  ? 0.4060 0.5408 0.5538 0.1835  0.1748  0.0298  156 ASP A CG  
234  O OD1 . ASP A 43  ? 0.4036 0.5693 0.5672 0.2017  0.1691  0.0363  156 ASP A OD1 
235  O OD2 . ASP A 43  ? 0.4219 0.5241 0.5506 0.1898  0.1905  0.0286  156 ASP A OD2 
236  N N   . LYS A 44  ? 0.3624 0.6164 0.5780 0.1626  0.1407  0.0272  157 LYS A N   
237  C CA  . LYS A 44  ? 0.3443 0.6636 0.5963 0.1570  0.1338  0.0242  157 LYS A CA  
238  C C   . LYS A 44  ? 0.3552 0.7078 0.6282 0.1666  0.1486  0.0232  157 LYS A C   
239  O O   . LYS A 44  ? 0.3790 0.7308 0.6495 0.1936  0.1575  0.0299  157 LYS A O   
240  C CB  . LYS A 44  ? 0.3443 0.6957 0.6072 0.1734  0.1199  0.0304  157 LYS A CB  
241  C CG  . LYS A 44  ? 0.3365 0.7646 0.6389 0.1734  0.1138  0.0275  157 LYS A CG  
242  C CD  . LYS A 44  ? 0.3297 0.7857 0.6385 0.1777  0.0953  0.0304  157 LYS A CD  
243  C CE  . LYS A 44  ? 0.3437 0.8805 0.6899 0.1887  0.0900  0.0300  157 LYS A CE  
244  N NZ  . LYS A 44  ? 0.3442 0.9120 0.6968 0.1862  0.0706  0.0300  157 LYS A NZ  
245  N N   . GLN A 46  ? 0.3823 0.6262 0.6012 0.0998  0.1580  0.0067  159 GLN A N   
246  C CA  . GLN A 46  ? 0.3784 0.5738 0.5677 0.0873  0.1507  0.0058  159 GLN A CA  
247  C C   . GLN A 46  ? 0.3926 0.5460 0.5559 0.0814  0.1631  0.0035  159 GLN A C   
248  O O   . GLN A 46  ? 0.4009 0.5643 0.5709 0.0755  0.1754  0.0004  159 GLN A O   
249  C CB  . GLN A 46  ? 0.3623 0.5704 0.5593 0.0654  0.1393  0.0015  159 GLN A CB  
250  C CG  . GLN A 46  ? 0.3649 0.5289 0.5337 0.0539  0.1311  0.0009  159 GLN A CG  
251  C CD  . GLN A 46  ? 0.3660 0.5065 0.5189 0.0671  0.1229  0.0057  159 GLN A CD  
252  O OE1 . GLN A 46  ? 0.3816 0.4931 0.5161 0.0780  0.1301  0.0078  159 GLN A OE1 
253  N NE2 . GLN A 46  ? 0.3481 0.4989 0.5059 0.0648  0.1090  0.0068  159 GLN A NE2 
254  N N   . ILE A 47  ? 0.3995 0.5077 0.5328 0.0824  0.1600  0.0044  160 ILE A N   
255  C CA  . ILE A 47  ? 0.4099 0.4778 0.5148 0.0790  0.1705  0.0019  160 ILE A CA  
256  C C   . ILE A 47  ? 0.3968 0.4400 0.4821 0.0603  0.1628  -0.0012 160 ILE A C   
257  O O   . ILE A 47  ? 0.3809 0.4275 0.4687 0.0534  0.1490  -0.0006 160 ILE A O   
258  C CB  . ILE A 47  ? 0.4338 0.4682 0.5163 0.0949  0.1760  0.0039  160 ILE A CB  
259  C CG1 . ILE A 47  ? 0.4345 0.4500 0.5046 0.0951  0.1628  0.0057  160 ILE A CG1 
260  C CG2 . ILE A 47  ? 0.4576 0.5131 0.5562 0.1174  0.1864  0.0081  160 ILE A CG2 
261  C CD1 . ILE A 47  ? 0.4563 0.4376 0.5040 0.1090  0.1701  0.0071  160 ILE A CD1 
262  N N   . HIS A 48  ? 0.3990 0.4184 0.4639 0.0537  0.1722  -0.0040 161 HIS A N   
263  C CA  . HIS A 48  ? 0.3898 0.3897 0.4361 0.0384  0.1668  -0.0059 161 HIS A CA  
264  C C   . HIS A 48  ? 0.3965 0.3601 0.4096 0.0379  0.1724  -0.0083 161 HIS A C   
265  O O   . HIS A 48  ? 0.4105 0.3657 0.4165 0.0448  0.1855  -0.0095 161 HIS A O   
266  C CB  . HIS A 48  ? 0.3873 0.4049 0.4461 0.0264  0.1725  -0.0068 161 HIS A CB  
267  C CG  . HIS A 48  ? 0.3610 0.4146 0.4500 0.0221  0.1654  -0.0066 161 HIS A CG  
268  N ND1 . HIS A 48  ? 0.3414 0.3955 0.4312 0.0149  0.1512  -0.0063 161 HIS A ND1 
269  C CD2 . HIS A 48  ? 0.3500 0.4429 0.4692 0.0240  0.1704  -0.0073 161 HIS A CD2 
270  C CE1 . HIS A 48  ? 0.3346 0.4244 0.4520 0.0114  0.1477  -0.0072 161 HIS A CE1 
271  N NE2 . HIS A 48  ? 0.3244 0.4405 0.4610 0.0166  0.1587  -0.0081 161 HIS A NE2 
272  N N   . PRO A 49  ? 0.3849 0.3287 0.3773 0.0301  0.1623  -0.0093 162 PRO A N   
273  C CA  . PRO A 49  ? 0.3572 0.3077 0.3553 0.0236  0.1471  -0.0079 162 PRO A CA  
274  C C   . PRO A 49  ? 0.3425 0.2971 0.3488 0.0307  0.1382  -0.0069 162 PRO A C   
275  O O   . PRO A 49  ? 0.3581 0.2976 0.3538 0.0383  0.1428  -0.0081 162 PRO A O   
276  C CB  . PRO A 49  ? 0.3635 0.2899 0.3323 0.0172  0.1422  -0.0095 162 PRO A CB  
277  C CG  . PRO A 49  ? 0.3992 0.3052 0.3469 0.0215  0.1502  -0.0130 162 PRO A CG  
278  C CD  . PRO A 49  ? 0.4076 0.3215 0.3674 0.0280  0.1656  -0.0125 162 PRO A CD  
279  N N   . GLN A 50  ? 0.3184 0.2900 0.3407 0.0280  0.1270  -0.0049 163 GLN A N   
280  C CA  . GLN A 50  ? 0.3076 0.2812 0.3350 0.0347  0.1187  -0.0033 163 GLN A CA  
281  C C   . GLN A 50  ? 0.3007 0.2503 0.3050 0.0295  0.1115  -0.0057 163 GLN A C   
282  O O   . GLN A 50  ? 0.3024 0.2469 0.2966 0.0208  0.1067  -0.0069 163 GLN A O   
283  C CB  . GLN A 50  ? 0.2874 0.2877 0.3375 0.0330  0.1089  -0.0010 163 GLN A CB  
284  C CG  . GLN A 50  ? 0.2978 0.3304 0.3745 0.0397  0.1134  0.0008  163 GLN A CG  
285  C CD  . GLN A 50  ? 0.2950 0.3538 0.3907 0.0369  0.1018  0.0020  163 GLN A CD  
286  O OE1 . GLN A 50  ? 0.3433 0.4056 0.4415 0.0455  0.0946  0.0049  163 GLN A OE1 
287  N NE2 . GLN A 50  ? 0.2921 0.3663 0.3982 0.0241  0.1007  -0.0007 163 GLN A NE2 
288  N N   . GLU A 51  ? 0.2947 0.2300 0.2901 0.0348  0.1114  -0.0063 164 GLU A N   
289  C CA  . GLU A 51  ? 0.2925 0.2078 0.2669 0.0279  0.1060  -0.0102 164 GLU A CA  
290  C C   . GLU A 51  ? 0.2759 0.1917 0.2545 0.0292  0.0980  -0.0085 164 GLU A C   
291  O O   . GLU A 51  ? 0.2844 0.1984 0.2685 0.0391  0.1023  -0.0054 164 GLU A O   
292  C CB  . GLU A 51  ? 0.3219 0.2115 0.2739 0.0290  0.1168  -0.0150 164 GLU A CB  
293  C CG  . GLU A 51  ? 0.3290 0.2144 0.2706 0.0265  0.1247  -0.0174 164 GLU A CG  
294  C CD  . GLU A 51  ? 0.3632 0.2239 0.2840 0.0291  0.1371  -0.0222 164 GLU A CD  
295  O OE1 . GLU A 51  ? 0.3662 0.2249 0.2941 0.0402  0.1484  -0.0199 164 GLU A OE1 
296  O OE2 . GLU A 51  ? 0.3802 0.2246 0.2771 0.0203  0.1358  -0.0287 164 GLU A OE2 
297  N N   . ILE A 52  ? 0.2521 0.1699 0.2268 0.0206  0.0873  -0.0100 165 ILE A N   
298  C CA  . ILE A 52  ? 0.2402 0.1570 0.2166 0.0201  0.0805  -0.0090 165 ILE A CA  
299  C C   . ILE A 52  ? 0.2587 0.1497 0.2176 0.0213  0.0885  -0.0121 165 ILE A C   
300  O O   . ILE A 52  ? 0.2668 0.1409 0.2067 0.0145  0.0933  -0.0185 165 ILE A O   
301  C CB  . ILE A 52  ? 0.2249 0.1489 0.1990 0.0106  0.0689  -0.0109 165 ILE A CB  
302  C CG1 . ILE A 52  ? 0.2087 0.1523 0.1978 0.0104  0.0630  -0.0074 165 ILE A CG1 
303  C CG2 . ILE A 52  ? 0.2230 0.1431 0.1959 0.0089  0.0643  -0.0108 165 ILE A CG2 
304  C CD1 . ILE A 52  ? 0.1962 0.1425 0.1773 0.0039  0.0562  -0.0090 165 ILE A CD1 
305  N N   . ILE A 53  ? 0.2557 0.1430 0.2195 0.0304  0.0909  -0.0074 166 ILE A N   
306  C CA  . ILE A 53  ? 0.2776 0.1356 0.2232 0.0329  0.1004  -0.0089 166 ILE A CA  
307  C C   . ILE A 53  ? 0.2769 0.1290 0.2191 0.0292  0.0952  -0.0076 166 ILE A C   
308  O O   . ILE A 53  ? 0.2923 0.1160 0.2157 0.0273  0.1036  -0.0099 166 ILE A O   
309  C CB  . ILE A 53  ? 0.2950 0.1448 0.2422 0.0507  0.1125  -0.0034 166 ILE A CB  
310  C CG1 . ILE A 53  ? 0.2659 0.1393 0.2340 0.0646  0.1071  0.0058  166 ILE A CG1 
311  C CG2 . ILE A 53  ? 0.3016 0.1551 0.2503 0.0534  0.1201  -0.0055 166 ILE A CG2 
312  C CD1 . ILE A 53  ? 0.2915 0.1617 0.2618 0.0851  0.1184  0.0120  166 ILE A CD1 
313  N N   . GLU A 54  ? 0.2547 0.1307 0.2127 0.0274  0.0829  -0.0044 167 GLU A N   
314  C CA  . GLU A 54  ? 0.2560 0.1280 0.2103 0.0225  0.0780  -0.0038 167 GLU A CA  
315  C C   . GLU A 54  ? 0.2320 0.1280 0.1976 0.0133  0.0649  -0.0055 167 GLU A C   
316  O O   . GLU A 54  ? 0.2104 0.1288 0.1924 0.0171  0.0583  -0.0022 167 GLU A O   
317  C CB  . GLU A 54  ? 0.2582 0.1305 0.2179 0.0368  0.0789  0.0050  167 GLU A CB  
318  C CG  . GLU A 54  ? 0.2721 0.1338 0.2230 0.0320  0.0768  0.0061  167 GLU A CG  
319  C CD  . GLU A 54  ? 0.2914 0.1548 0.2455 0.0479  0.0766  0.0159  167 GLU A CD  
320  O OE1 . GLU A 54  ? 0.3191 0.1967 0.2845 0.0630  0.0770  0.0217  167 GLU A OE1 
321  O OE2 . GLU A 54  ? 0.3020 0.1550 0.2472 0.0454  0.0760  0.0178  167 GLU A OE2 
322  N N   . PHE A 55  ? 0.2440 0.1349 0.2000 0.0010  0.0622  -0.0110 168 PHE A N   
323  C CA  . PHE A 55  ? 0.2259 0.1379 0.1895 -0.0068 0.0512  -0.0132 168 PHE A CA  
324  C C   . PHE A 55  ? 0.2277 0.1400 0.1900 -0.0121 0.0479  -0.0133 168 PHE A C   
325  O O   . PHE A 55  ? 0.2323 0.1372 0.1835 -0.0235 0.0502  -0.0199 168 PHE A O   
326  C CB  . PHE A 55  ? 0.2313 0.1445 0.1851 -0.0164 0.0507  -0.0209 168 PHE A CB  
327  C CG  . PHE A 55  ? 0.2153 0.1509 0.1770 -0.0174 0.0409  -0.0206 168 PHE A CG  
328  C CD1 . PHE A 55  ? 0.2238 0.1625 0.1817 -0.0162 0.0412  -0.0217 168 PHE A CD1 
329  C CD2 . PHE A 55  ? 0.1939 0.1446 0.1640 -0.0185 0.0326  -0.0189 168 PHE A CD2 
330  C CE1 . PHE A 55  ? 0.2246 0.1790 0.1857 -0.0150 0.0339  -0.0203 168 PHE A CE1 
331  C CE2 . PHE A 55  ? 0.2011 0.1684 0.1753 -0.0173 0.0252  -0.0180 168 PHE A CE2 
332  C CZ  . PHE A 55  ? 0.1838 0.1517 0.1527 -0.0151 0.0260  -0.0183 168 PHE A CZ  
333  N N   . PRO A 56  ? 0.2223 0.1437 0.1953 -0.0048 0.0432  -0.0068 169 PRO A N   
334  C CA  . PRO A 56  ? 0.2250 0.1484 0.1970 -0.0091 0.0399  -0.0063 169 PRO A CA  
335  C C   . PRO A 56  ? 0.2029 0.1494 0.1854 -0.0125 0.0296  -0.0071 169 PRO A C   
336  O O   . PRO A 56  ? 0.1794 0.1393 0.1722 -0.0076 0.0244  -0.0048 169 PRO A O   
337  C CB  . PRO A 56  ? 0.2322 0.1509 0.2066 0.0029  0.0413  0.0019  169 PRO A CB  
338  C CG  . PRO A 56  ? 0.2269 0.1531 0.2108 0.0135  0.0418  0.0054  169 PRO A CG  
339  C CD  . PRO A 56  ? 0.2166 0.1477 0.2020 0.0075  0.0416  0.0000  169 PRO A CD  
340  N N   . ILE A 57  ? 0.2080 0.1579 0.1870 -0.0211 0.0280  -0.0108 170 ILE A N   
341  C CA  . ILE A 57  ? 0.1940 0.1635 0.1819 -0.0215 0.0196  -0.0102 170 ILE A CA  
342  C C   . ILE A 57  ? 0.2069 0.1736 0.1914 -0.0257 0.0210  -0.0099 170 ILE A C   
343  O O   . ILE A 57  ? 0.2147 0.1714 0.1898 -0.0349 0.0273  -0.0142 170 ILE A O   
344  C CB  . ILE A 57  ? 0.1877 0.1735 0.1767 -0.0265 0.0150  -0.0155 170 ILE A CB  
345  C CG1 . ILE A 57  ? 0.1878 0.1722 0.1748 -0.0240 0.0156  -0.0164 170 ILE A CG1 
346  C CG2 . ILE A 57  ? 0.1617 0.1642 0.1588 -0.0226 0.0079  -0.0132 170 ILE A CG2 
347  C CD1 . ILE A 57  ? 0.1793 0.1778 0.1625 -0.0280 0.0120  -0.0216 170 ILE A CD1 
348  N N   . LEU A 58  ? 0.1966 0.1711 0.1872 -0.0201 0.0161  -0.0053 171 LEU A N   
349  C CA  . LEU A 58  ? 0.2046 0.1783 0.1917 -0.0234 0.0171  -0.0047 171 LEU A CA  
350  C C   . LEU A 58  ? 0.1946 0.1888 0.1891 -0.0252 0.0108  -0.0071 171 LEU A C   
351  O O   . LEU A 58  ? 0.1813 0.1843 0.1822 -0.0190 0.0052  -0.0051 171 LEU A O   
352  C CB  . LEU A 58  ? 0.2136 0.1794 0.1985 -0.0144 0.0170  0.0026  171 LEU A CB  
353  C CG  . LEU A 58  ? 0.2311 0.1765 0.2072 -0.0076 0.0238  0.0074  171 LEU A CG  
354  C CD1 . LEU A 58  ? 0.2185 0.1629 0.1922 0.0031  0.0217  0.0151  171 LEU A CD1 
355  C CD2 . LEU A 58  ? 0.2651 0.1875 0.2261 -0.0158 0.0348  0.0045  171 LEU A CD2 
356  N N   . LYS A 59  ? 0.2032 0.2047 0.1960 -0.0341 0.0130  -0.0120 172 LYS A N   
357  C CA  . LYS A 59  ? 0.1957 0.2178 0.1950 -0.0340 0.0085  -0.0138 172 LYS A CA  
358  C C   . LYS A 59  ? 0.2023 0.2213 0.1995 -0.0326 0.0096  -0.0106 172 LYS A C   
359  O O   . LYS A 59  ? 0.2223 0.2337 0.2131 -0.0398 0.0159  -0.0115 172 LYS A O   
360  C CB  . LYS A 59  ? 0.2022 0.2402 0.2027 -0.0442 0.0103  -0.0213 172 LYS A CB  
361  C CG  . LYS A 59  ? 0.1949 0.2597 0.2035 -0.0419 0.0058  -0.0234 172 LYS A CG  
362  C CD  . LYS A 59  ? 0.1997 0.2840 0.2106 -0.0549 0.0089  -0.0316 172 LYS A CD  
363  C CE  . LYS A 59  ? 0.2124 0.3285 0.2328 -0.0504 0.0047  -0.0335 172 LYS A CE  
364  N NZ  . LYS A 59  ? 0.2212 0.3634 0.2468 -0.0643 0.0075  -0.0425 172 LYS A NZ  
365  N N   . LEU A 60  ? 0.1922 0.2151 0.1926 -0.0243 0.0044  -0.0071 173 LEU A N   
366  C CA  . LEU A 60  ? 0.1932 0.2138 0.1899 -0.0224 0.0047  -0.0044 173 LEU A CA  
367  C C   . LEU A 60  ? 0.1894 0.2265 0.1900 -0.0223 0.0037  -0.0073 173 LEU A C   
368  O O   . LEU A 60  ? 0.1917 0.2388 0.1972 -0.0172 -0.0001 -0.0084 173 LEU A O   
369  C CB  . LEU A 60  ? 0.1812 0.1962 0.1773 -0.0146 0.0001  0.0000  173 LEU A CB  
370  C CG  . LEU A 60  ? 0.1787 0.1840 0.1743 -0.0108 -0.0004 0.0035  173 LEU A CG  
371  C CD1 . LEU A 60  ? 0.1398 0.1483 0.1364 -0.0049 -0.0057 0.0063  173 LEU A CD1 
372  C CD2 . LEU A 60  ? 0.1738 0.1632 0.1600 -0.0123 0.0064  0.0062  173 LEU A CD2 
373  N N   . ASN A 61  ? 0.1993 0.2376 0.1962 -0.0268 0.0082  -0.0079 174 ASN A N   
374  C CA  . ASN A 61  ? 0.1882 0.2405 0.1875 -0.0244 0.0081  -0.0094 174 ASN A CA  
375  C C   . ASN A 61  ? 0.1774 0.2258 0.1751 -0.0149 0.0030  -0.0070 174 ASN A C   
376  O O   . ASN A 61  ? 0.1890 0.2246 0.1807 -0.0129 0.0011  -0.0039 174 ASN A O   
377  C CB  . ASN A 61  ? 0.1967 0.2444 0.1889 -0.0300 0.0147  -0.0089 174 ASN A CB  
378  C CG  . ASN A 61  ? 0.2051 0.2691 0.2003 -0.0279 0.0164  -0.0112 174 ASN A CG  
379  O OD1 . ASN A 61  ? 0.2051 0.2668 0.1971 -0.0197 0.0135  -0.0095 174 ASN A OD1 
380  N ND2 . ASN A 61  ? 0.1803 0.2619 0.1816 -0.0358 0.0218  -0.0158 174 ASN A ND2 
381  N N   . GLY A 62  ? 0.1671 0.2264 0.1688 -0.0089 0.0013  -0.0088 175 GLY A N   
382  C CA  . GLY A 62  ? 0.1671 0.2181 0.1646 -0.0016 -0.0014 -0.0076 175 GLY A CA  
383  C C   . GLY A 62  ? 0.1784 0.2221 0.1676 -0.0008 -0.0002 -0.0073 175 GLY A C   
384  O O   . GLY A 62  ? 0.1934 0.2266 0.1769 0.0012  -0.0024 -0.0073 175 GLY A O   
385  N N   . ARG A 63  ? 0.1815 0.2310 0.1689 -0.0036 0.0040  -0.0078 176 ARG A N   
386  C CA  . ARG A 63  ? 0.1931 0.2357 0.1703 -0.0028 0.0058  -0.0076 176 ARG A CA  
387  C C   . ARG A 63  ? 0.1967 0.2277 0.1659 -0.0067 0.0043  -0.0044 176 ARG A C   
388  O O   . ARG A 63  ? 0.2001 0.2234 0.1611 -0.0049 0.0009  -0.0040 176 ARG A O   
389  C CB  . ARG A 63  ? 0.1986 0.2537 0.1767 -0.0031 0.0124  -0.0094 176 ARG A CB  
390  C CG  . ARG A 63  ? 0.2068 0.2541 0.1725 -0.0015 0.0154  -0.0095 176 ARG A CG  
391  C CD  . ARG A 63  ? 0.2240 0.2656 0.1842 0.0064  0.0149  -0.0117 176 ARG A CD  
392  N NE  . ARG A 63  ? 0.2481 0.2814 0.1944 0.0073  0.0185  -0.0130 176 ARG A NE  
393  C CZ  . ARG A 63  ? 0.2618 0.3035 0.2065 0.0088  0.0257  -0.0140 176 ARG A CZ  
394  N NH1 . ARG A 63  ? 0.2366 0.2988 0.1946 0.0090  0.0299  -0.0144 176 ARG A NH1 
395  N NH2 . ARG A 63  ? 0.3003 0.3317 0.2298 0.0095  0.0290  -0.0153 176 ARG A NH2 
396  N N   . THR A 64  ? 0.2028 0.2325 0.1729 -0.0118 0.0073  -0.0024 177 THR A N   
397  C CA  . THR A 64  ? 0.2197 0.2362 0.1786 -0.0129 0.0081  0.0022  177 THR A CA  
398  C C   . THR A 64  ? 0.2189 0.2283 0.1791 -0.0107 0.0037  0.0055  177 THR A C   
399  O O   . THR A 64  ? 0.2322 0.2327 0.1827 -0.0074 0.0025  0.0102  177 THR A O   
400  C CB  . THR A 64  ? 0.2321 0.2446 0.1862 -0.0198 0.0172  0.0031  177 THR A CB  
401  O OG1 . THR A 64  ? 0.2207 0.2381 0.1846 -0.0256 0.0197  0.0004  177 THR A OG1 
402  C CG2 . THR A 64  ? 0.2479 0.2694 0.2003 -0.0220 0.0230  0.0001  177 THR A CG2 
403  N N   . MET A 65  ? 0.2097 0.2242 0.1812 -0.0112 0.0016  0.0034  178 MET A N   
404  C CA  . MET A 65  ? 0.2131 0.2227 0.1878 -0.0091 -0.0012 0.0059  178 MET A CA  
405  C C   . MET A 65  ? 0.2246 0.2221 0.1936 -0.0116 0.0050  0.0089  178 MET A C   
406  O O   . MET A 65  ? 0.2282 0.2186 0.1968 -0.0079 0.0042  0.0120  178 MET A O   
407  C CB  . MET A 65  ? 0.2164 0.2261 0.1882 -0.0035 -0.0077 0.0084  178 MET A CB  
408  C CG  . MET A 65  ? 0.2189 0.2360 0.1932 -0.0035 -0.0122 0.0042  178 MET A CG  
409  S SD  . MET A 65  ? 0.2137 0.2344 0.1992 -0.0047 -0.0124 0.0001  178 MET A SD  
410  C CE  . MET A 65  ? 0.2163 0.2364 0.1962 -0.0044 -0.0122 -0.0043 178 MET A CE  
411  N N   . GLU A 66  ? 0.2377 0.2319 0.2017 -0.0183 0.0124  0.0075  179 GLU A N   
412  C CA  . GLU A 66  ? 0.2613 0.2386 0.2165 -0.0231 0.0209  0.0093  179 GLU A CA  
413  C C   . GLU A 66  ? 0.2572 0.2372 0.2209 -0.0287 0.0222  0.0047  179 GLU A C   
414  O O   . GLU A 66  ? 0.2404 0.2385 0.2156 -0.0322 0.0191  -0.0008 179 GLU A O   
415  C CB  . GLU A 66  ? 0.2784 0.2503 0.2245 -0.0317 0.0304  0.0080  179 GLU A CB  
416  C CG  . GLU A 66  ? 0.3230 0.2860 0.2547 -0.0263 0.0316  0.0136  179 GLU A CG  
417  C CD  . GLU A 66  ? 0.3661 0.3090 0.2831 -0.0163 0.0315  0.0222  179 GLU A CD  
418  O OE1 . GLU A 66  ? 0.4135 0.3590 0.3242 -0.0075 0.0255  0.0264  179 GLU A OE1 
419  O OE2 . GLU A 66  ? 0.3856 0.3111 0.2967 -0.0166 0.0374  0.0245  179 GLU A OE2 
420  N N   . ILE A 67  ? 0.2714 0.2322 0.2270 -0.0285 0.0273  0.0072  180 ILE A N   
421  C CA  . ILE A 67  ? 0.2709 0.2299 0.2305 -0.0346 0.0300  0.0025  180 ILE A CA  
422  C C   . ILE A 67  ? 0.2791 0.2406 0.2368 -0.0500 0.0379  -0.0047 180 ILE A C   
423  O O   . ILE A 67  ? 0.3104 0.2548 0.2551 -0.0563 0.0477  -0.0038 180 ILE A O   
424  C CB  . ILE A 67  ? 0.2935 0.2270 0.2419 -0.0293 0.0356  0.0073  180 ILE A CB  
425  C CG1 . ILE A 67  ? 0.2870 0.2240 0.2392 -0.0139 0.0278  0.0142  180 ILE A CG1 
426  C CG2 . ILE A 67  ? 0.2846 0.2137 0.2343 -0.0370 0.0396  0.0011  180 ILE A CG2 
427  C CD1 . ILE A 67  ? 0.3070 0.2201 0.2457 -0.0040 0.0341  0.0214  180 ILE A CD1 
428  N N   . GLU A 68  ? 0.2615 0.2453 0.2316 -0.0561 0.0341  -0.0120 181 GLU A N   
429  C CA  . GLU A 68  ? 0.2681 0.2647 0.2404 -0.0714 0.0397  -0.0205 181 GLU A CA  
430  C C   . GLU A 68  ? 0.2693 0.2637 0.2403 -0.0814 0.0428  -0.0275 181 GLU A C   
431  O O   . GLU A 68  ? 0.2776 0.2760 0.2461 -0.0974 0.0500  -0.0354 181 GLU A O   
432  C CB  . GLU A 68  ? 0.2519 0.2831 0.2393 -0.0694 0.0326  -0.0237 181 GLU A CB  
433  C CG  . GLU A 68  ? 0.2540 0.2856 0.2398 -0.0631 0.0325  -0.0189 181 GLU A CG  
434  C CD  . GLU A 68  ? 0.2536 0.3164 0.2514 -0.0627 0.0297  -0.0228 181 GLU A CD  
435  O OE1 . GLU A 68  ? 0.2696 0.3327 0.2644 -0.0618 0.0331  -0.0210 181 GLU A OE1 
436  O OE2 . GLU A 68  ? 0.2349 0.3217 0.2438 -0.0618 0.0246  -0.0273 181 GLU A OE2 
437  N N   . SER A 69  ? 0.2601 0.2486 0.2320 -0.0731 0.0379  -0.0253 182 SER A N   
438  C CA  . SER A 69  ? 0.2706 0.2539 0.2384 -0.0817 0.0413  -0.0318 182 SER A CA  
439  C C   . SER A 69  ? 0.2668 0.2321 0.2310 -0.0696 0.0394  -0.0261 182 SER A C   
440  O O   . SER A 69  ? 0.2519 0.2214 0.2229 -0.0557 0.0323  -0.0191 182 SER A O   
441  C CB  . SER A 69  ? 0.2565 0.2754 0.2366 -0.0871 0.0340  -0.0398 182 SER A CB  
442  O OG  . SER A 69  ? 0.2644 0.2806 0.2389 -0.0970 0.0368  -0.0474 182 SER A OG  
443  N N   . THR A 70  ? 0.2844 0.2297 0.2376 -0.0758 0.0469  -0.0298 183 THR A N   
444  C CA  . THR A 70  ? 0.2890 0.2154 0.2377 -0.0642 0.0479  -0.0245 183 THR A CA  
445  C C   . THR A 70  ? 0.2936 0.2220 0.2398 -0.0714 0.0488  -0.0323 183 THR A C   
446  O O   . THR A 70  ? 0.3020 0.2242 0.2387 -0.0873 0.0560  -0.0413 183 THR A O   
447  C CB  . THR A 70  ? 0.3194 0.2081 0.2504 -0.0604 0.0599  -0.0189 183 THR A CB  
448  O OG1 . THR A 70  ? 0.3237 0.2112 0.2548 -0.0520 0.0583  -0.0107 183 THR A OG1 
449  C CG2 . THR A 70  ? 0.3161 0.1891 0.2437 -0.0472 0.0617  -0.0139 183 THR A CG2 
450  N N   . PHE A 71  ? 0.2675 0.2057 0.2216 -0.0610 0.0417  -0.0296 184 PHE A N   
451  C CA  . PHE A 71  ? 0.2786 0.2117 0.2266 -0.0643 0.0440  -0.0349 184 PHE A CA  
452  C C   . PHE A 71  ? 0.2867 0.1944 0.2288 -0.0523 0.0502  -0.0282 184 PHE A C   
453  O O   . PHE A 71  ? 0.2614 0.1743 0.2131 -0.0388 0.0454  -0.0199 184 PHE A O   
454  C CB  . PHE A 71  ? 0.2545 0.2158 0.2134 -0.0603 0.0332  -0.0361 184 PHE A CB  
455  C CG  . PHE A 71  ? 0.2579 0.2153 0.2088 -0.0630 0.0350  -0.0413 184 PHE A CG  
456  C CD1 . PHE A 71  ? 0.2769 0.2469 0.2217 -0.0765 0.0345  -0.0517 184 PHE A CD1 
457  C CD2 . PHE A 71  ? 0.2337 0.1772 0.1831 -0.0526 0.0375  -0.0364 184 PHE A CD2 
458  C CE1 . PHE A 71  ? 0.2814 0.2475 0.2163 -0.0791 0.0360  -0.0570 184 PHE A CE1 
459  C CE2 . PHE A 71  ? 0.2640 0.2025 0.2045 -0.0548 0.0402  -0.0411 184 PHE A CE2 
460  C CZ  . PHE A 71  ? 0.2831 0.2311 0.2149 -0.0679 0.0394  -0.0513 184 PHE A CZ  
461  N N   . HIS A 72  ? 0.3163 0.1974 0.2423 -0.0573 0.0613  -0.0323 185 HIS A N   
462  C CA  . HIS A 72  ? 0.3308 0.1892 0.2507 -0.0441 0.0683  -0.0262 185 HIS A CA  
463  C C   . HIS A 72  ? 0.3568 0.1955 0.2614 -0.0506 0.0776  -0.0337 185 HIS A C   
464  O O   . HIS A 72  ? 0.3777 0.1934 0.2644 -0.0638 0.0882  -0.0410 185 HIS A O   
465  C CB  . HIS A 72  ? 0.3560 0.1886 0.2662 -0.0361 0.0769  -0.0186 185 HIS A CB  
466  C CG  . HIS A 72  ? 0.3595 0.1794 0.2690 -0.0169 0.0811  -0.0097 185 HIS A CG  
467  N ND1 . HIS A 72  ? 0.4303 0.2153 0.3213 -0.0087 0.0946  -0.0050 185 HIS A ND1 
468  C CD2 . HIS A 72  ? 0.3422 0.1811 0.2672 -0.0040 0.0744  -0.0048 185 HIS A CD2 
469  C CE1 . HIS A 72  ? 0.4125 0.1994 0.3094 0.0101  0.0950  0.0027  185 HIS A CE1 
470  N NE2 . HIS A 72  ? 0.3551 0.1759 0.2736 0.0119  0.0828  0.0024  185 HIS A NE2 
471  N N   . MET A 73  ? 0.3415 0.1876 0.2516 -0.0423 0.0750  -0.0324 186 MET A N   
472  C CA  . MET A 73  ? 0.3720 0.1975 0.2666 -0.0454 0.0846  -0.0383 186 MET A CA  
473  C C   . MET A 73  ? 0.3583 0.1765 0.2568 -0.0273 0.0887  -0.0304 186 MET A C   
474  O O   . MET A 73  ? 0.3195 0.1611 0.2363 -0.0171 0.0800  -0.0240 186 MET A O   
475  C CB  . MET A 73  ? 0.3659 0.2121 0.2605 -0.0569 0.0777  -0.0475 186 MET A CB  
476  C CG  . MET A 73  ? 0.3910 0.2497 0.2819 -0.0758 0.0743  -0.0573 186 MET A CG  
477  S SD  . MET A 73  ? 0.3983 0.2779 0.2820 -0.0894 0.0687  -0.0699 186 MET A SD  
478  C CE  . MET A 73  ? 0.4743 0.3125 0.3310 -0.0969 0.0857  -0.0782 186 MET A CE  
479  N N   . TYR A 74  ? 0.3859 0.1712 0.2665 -0.0238 0.1032  -0.0316 187 TYR A N   
480  C CA  . TYR A 74  ? 0.3937 0.1742 0.2762 -0.0091 0.1087  -0.0273 187 TYR A CA  
481  C C   . TYR A 74  ? 0.3897 0.1749 0.2657 -0.0192 0.1083  -0.0365 187 TYR A C   
482  O O   . TYR A 74  ? 0.3852 0.1659 0.2479 -0.0367 0.1084  -0.0470 187 TYR A O   
483  C CB  . TYR A 74  ? 0.4392 0.1816 0.3039 0.0022  0.1255  -0.0235 187 TYR A CB  
484  C CG  . TYR A 74  ? 0.4516 0.1910 0.3210 0.0159  0.1254  -0.0126 187 TYR A CG  
485  C CD1 . TYR A 74  ? 0.4361 0.2038 0.3282 0.0330  0.1169  -0.0024 187 TYR A CD1 
486  C CD2 . TYR A 74  ? 0.4994 0.2082 0.3493 0.0106  0.1342  -0.0129 187 TYR A CD2 
487  C CE1 . TYR A 74  ? 0.4358 0.2042 0.3311 0.0461  0.1155  0.0074  187 TYR A CE1 
488  C CE2 . TYR A 74  ? 0.4928 0.1981 0.3441 0.0246  0.1341  -0.0019 187 TYR A CE2 
489  C CZ  . TYR A 74  ? 0.4707 0.2075 0.3450 0.0430  0.1239  0.0083  187 TYR A CZ  
490  O OH  . TYR A 74  ? 0.4766 0.2139 0.3517 0.0576  0.1223  0.0191  187 TYR A OH  
491  N N   . VAL A 75  ? 0.3740 0.1715 0.2600 -0.0085 0.1074  -0.0326 188 VAL A N   
492  C CA  . VAL A 75  ? 0.3752 0.1821 0.2573 -0.0150 0.1050  -0.0388 188 VAL A CA  
493  C C   . VAL A 75  ? 0.3977 0.1844 0.2698 -0.0056 0.1187  -0.0386 188 VAL A C   
494  O O   . VAL A 75  ? 0.3918 0.1779 0.2745 0.0107  0.1238  -0.0301 188 VAL A O   
495  C CB  . VAL A 75  ? 0.3368 0.1782 0.2402 -0.0110 0.0919  -0.0336 188 VAL A CB  
496  C CG1 . VAL A 75  ? 0.3349 0.1831 0.2297 -0.0167 0.0902  -0.0390 188 VAL A CG1 
497  C CG2 . VAL A 75  ? 0.2968 0.1583 0.2125 -0.0157 0.0794  -0.0316 188 VAL A CG2 
498  N N   . GLN A 76  ? 0.4296 0.2020 0.2814 -0.0154 0.1246  -0.0482 189 GLN A N   
499  C CA  . GLN A 76  ? 0.4626 0.2140 0.3021 -0.0072 0.1390  -0.0492 189 GLN A CA  
500  C C   . GLN A 76  ? 0.4444 0.2194 0.2973 -0.0001 0.1350  -0.0452 189 GLN A C   
501  O O   . GLN A 76  ? 0.4348 0.2234 0.2834 -0.0095 0.1275  -0.0498 189 GLN A O   
502  C CB  . GLN A 76  ? 0.4994 0.2215 0.3075 -0.0216 0.1489  -0.0624 189 GLN A CB  
503  C CG  . GLN A 76  ? 0.5283 0.2243 0.3209 -0.0124 0.1657  -0.0637 189 GLN A CG  
504  C CD  . GLN A 76  ? 0.5815 0.2505 0.3414 -0.0287 0.1746  -0.0783 189 GLN A CD  
505  O OE1 . GLN A 76  ? 0.6355 0.2935 0.3806 -0.0465 0.1738  -0.0879 189 GLN A OE1 
506  N NE2 . GLN A 76  ? 0.6181 0.2767 0.3659 -0.0240 0.1841  -0.0810 189 GLN A NE2 
507  N N   . PRO A 77  ? 0.4476 0.2280 0.3160 0.0166  0.1408  -0.0365 190 PRO A N   
508  C CA  . PRO A 77  ? 0.4377 0.2377 0.3176 0.0216  0.1403  -0.0335 190 PRO A CA  
509  C C   . PRO A 77  ? 0.4769 0.2561 0.3348 0.0205  0.1533  -0.0399 190 PRO A C   
510  O O   . PRO A 77  ? 0.5069 0.2564 0.3470 0.0235  0.1665  -0.0436 190 PRO A O   
511  C CB  . PRO A 77  ? 0.4189 0.2341 0.3231 0.0385  0.1432  -0.0236 190 PRO A CB  
512  C CG  . PRO A 77  ? 0.4434 0.2329 0.3374 0.0474  0.1528  -0.0222 190 PRO A CG  
513  C CD  . PRO A 77  ? 0.4544 0.2243 0.3292 0.0321  0.1489  -0.0292 190 PRO A CD  
514  N N   . VAL A 78  ? 0.4853 0.2772 0.3424 0.0170  0.1509  -0.0410 191 VAL A N   
515  C CA  . VAL A 78  ? 0.5207 0.2943 0.3533 0.0137  0.1615  -0.0480 191 VAL A CA  
516  C C   . VAL A 78  ? 0.5312 0.3096 0.3718 0.0252  0.1731  -0.0433 191 VAL A C   
517  O O   . VAL A 78  ? 0.5573 0.3140 0.3820 0.0299  0.1882  -0.0470 191 VAL A O   
518  C CB  . VAL A 78  ? 0.5251 0.3071 0.3432 0.0001  0.1505  -0.0537 191 VAL A CB  
519  C CG1 . VAL A 78  ? 0.5596 0.3286 0.3536 -0.0018 0.1600  -0.0592 191 VAL A CG1 
520  C CG2 . VAL A 78  ? 0.5367 0.3124 0.3424 -0.0132 0.1426  -0.0616 191 VAL A CG2 
521  N N   . VAL A 79  ? 0.5095 0.3158 0.3740 0.0287  0.1673  -0.0360 192 VAL A N   
522  C CA  . VAL A 79  ? 0.5150 0.3304 0.3899 0.0371  0.1787  -0.0321 192 VAL A CA  
523  C C   . VAL A 79  ? 0.5257 0.3414 0.4153 0.0527  0.1904  -0.0282 192 VAL A C   
524  O O   . VAL A 79  ? 0.5465 0.3528 0.4296 0.0604  0.2059  -0.0293 192 VAL A O   
525  C CB  . VAL A 79  ? 0.4889 0.3331 0.3854 0.0344  0.1708  -0.0261 192 VAL A CB  
526  C CG1 . VAL A 79  ? 0.4859 0.3385 0.3900 0.0393  0.1846  -0.0239 192 VAL A CG1 
527  C CG2 . VAL A 79  ? 0.4922 0.3350 0.3728 0.0229  0.1591  -0.0283 192 VAL A CG2 
528  N N   . HIS A 80  ? 0.5104 0.3383 0.4191 0.0589  0.1834  -0.0231 193 HIS A N   
529  C CA  . HIS A 80  ? 0.5247 0.3523 0.4443 0.0767  0.1932  -0.0183 193 HIS A CA  
530  C C   . HIS A 80  ? 0.5387 0.3418 0.4441 0.0777  0.1907  -0.0192 193 HIS A C   
531  O O   . HIS A 80  ? 0.5133 0.3310 0.4346 0.0807  0.1805  -0.0139 193 HIS A O   
532  C CB  . HIS A 80  ? 0.5009 0.3694 0.4569 0.0855  0.1879  -0.0104 193 HIS A CB  
533  C CG  . HIS A 80  ? 0.5026 0.3969 0.4748 0.0825  0.1917  -0.0098 193 HIS A CG  
534  N ND1 . HIS A 80  ? 0.5249 0.4253 0.5029 0.0935  0.2077  -0.0091 193 HIS A ND1 
535  C CD2 . HIS A 80  ? 0.4791 0.3935 0.4625 0.0699  0.1832  -0.0098 193 HIS A CD2 
536  C CE1 . HIS A 80  ? 0.5188 0.4426 0.5110 0.0858  0.2089  -0.0092 193 HIS A CE1 
537  N NE2 . HIS A 80  ? 0.4934 0.4238 0.4877 0.0714  0.1946  -0.0095 193 HIS A NE2 
538  N N   . PRO A 81  ? 0.5775 0.3416 0.4514 0.0743  0.2012  -0.0263 194 PRO A N   
539  C CA  . PRO A 81  ? 0.5927 0.3289 0.4480 0.0687  0.1997  -0.0296 194 PRO A CA  
540  C C   . PRO A 81  ? 0.6098 0.3339 0.4682 0.0876  0.2080  -0.0221 194 PRO A C   
541  O O   . PRO A 81  ? 0.6195 0.3283 0.4699 0.0844  0.2043  -0.0216 194 PRO A O   
542  C CB  . PRO A 81  ? 0.6302 0.3295 0.4498 0.0575  0.2106  -0.0411 194 PRO A CB  
543  C CG  . PRO A 81  ? 0.6506 0.3489 0.4688 0.0682  0.2246  -0.0406 194 PRO A CG  
544  C CD  . PRO A 81  ? 0.6124 0.3550 0.4652 0.0749  0.2168  -0.0322 194 PRO A CD  
545  N N   . GLN A 82  ? 0.6108 0.3433 0.4808 0.1079  0.2192  -0.0158 195 GLN A N   
546  C CA  . GLN A 82  ? 0.6332 0.3566 0.5052 0.1304  0.2277  -0.0073 195 GLN A CA  
547  C C   . GLN A 82  ? 0.5956 0.3656 0.5033 0.1403  0.2139  0.0027  195 GLN A C   
548  O O   . GLN A 82  ? 0.5721 0.3816 0.5068 0.1458  0.2113  0.0058  195 GLN A O   
549  C CB  . GLN A 82  ? 0.6708 0.3770 0.5331 0.1498  0.2489  -0.0060 195 GLN A CB  
550  C CG  . GLN A 82  ? 0.7290 0.3822 0.5504 0.1396  0.2642  -0.0170 195 GLN A CG  
551  C CD  . GLN A 82  ? 0.7908 0.3965 0.5818 0.1350  0.2696  -0.0198 195 GLN A CD  
552  O OE1 . GLN A 82  ? 0.8026 0.3817 0.5686 0.1119  0.2686  -0.0312 195 GLN A OE1 
553  N NE2 . GLN A 82  ? 0.8168 0.4126 0.6088 0.1571  0.2759  -0.0095 195 GLN A NE2 
554  N N   . LEU A 83  ? 0.5877 0.3535 0.4945 0.1407  0.2053  0.0068  196 LEU A N   
555  C CA  . LEU A 83  ? 0.5529 0.3613 0.4901 0.1484  0.1911  0.0154  196 LEU A CA  
556  C C   . LEU A 83  ? 0.5650 0.3954 0.5191 0.1762  0.1994  0.0245  196 LEU A C   
557  O O   . LEU A 83  ? 0.6051 0.4049 0.5403 0.1947  0.2157  0.0278  196 LEU A O   
558  C CB  . LEU A 83  ? 0.5499 0.3434 0.4776 0.1459  0.1833  0.0185  196 LEU A CB  
559  C CG  . LEU A 83  ? 0.5370 0.3086 0.4470 0.1201  0.1762  0.0097  196 LEU A CG  
560  C CD1 . LEU A 83  ? 0.5361 0.3024 0.4433 0.1201  0.1686  0.0144  196 LEU A CD1 
561  C CD2 . LEU A 83  ? 0.4864 0.2876 0.4122 0.1014  0.1630  0.0039  196 LEU A CD2 
562  N N   . THR A 84  ? 0.5311 0.4148 0.5198 0.1793  0.1890  0.0281  197 THR A N   
563  C CA  . THR A 84  ? 0.5345 0.4510 0.5446 0.2044  0.1952  0.0358  197 THR A CA  
564  C C   . THR A 84  ? 0.5435 0.4673 0.5561 0.2251  0.1903  0.0463  197 THR A C   
565  O O   . THR A 84  ? 0.5317 0.4513 0.5404 0.2155  0.1777  0.0471  197 THR A O   
566  C CB  . THR A 84  ? 0.4963 0.4708 0.5434 0.1970  0.1866  0.0341  197 THR A CB  
567  O OG1 . THR A 84  ? 0.4661 0.4687 0.5299 0.1853  0.1675  0.0348  197 THR A OG1 
568  C CG2 . THR A 84  ? 0.4910 0.4559 0.5326 0.1770  0.1918  0.0249  197 THR A CG2 
569  N N   . PRO A 85  ? 0.5663 0.5007 0.5839 0.2551  0.2010  0.0547  198 PRO A N   
570  C CA  . PRO A 85  ? 0.5753 0.5272 0.5987 0.2803  0.1962  0.0665  198 PRO A CA  
571  C C   . PRO A 85  ? 0.5336 0.5364 0.5851 0.2703  0.1740  0.0675  198 PRO A C   
572  O O   . PRO A 85  ? 0.5424 0.5393 0.5857 0.2759  0.1656  0.0736  198 PRO A O   
573  C CB  . PRO A 85  ? 0.5921 0.5740 0.6317 0.3105  0.2081  0.0731  198 PRO A CB  
574  C CG  . PRO A 85  ? 0.6103 0.5630 0.6367 0.3047  0.2255  0.0657  198 PRO A CG  
575  C CD  . PRO A 85  ? 0.5931 0.5200 0.6074 0.2687  0.2199  0.0537  198 PRO A CD  
576  N N   . PHE A 86  ? 0.4966 0.5472 0.5794 0.2551  0.1659  0.0613  199 PHE A N   
577  C CA  . PHE A 86  ? 0.4560 0.5508 0.5633 0.2403  0.1462  0.0595  199 PHE A CA  
578  C C   . PHE A 86  ? 0.4421 0.5017 0.5294 0.2174  0.1365  0.0553  199 PHE A C   
579  O O   . PHE A 86  ? 0.4331 0.5059 0.5239 0.2163  0.1231  0.0585  199 PHE A O   
580  C CB  . PHE A 86  ? 0.4285 0.5683 0.5664 0.2233  0.1434  0.0515  199 PHE A CB  
581  C CG  . PHE A 86  ? 0.3940 0.5721 0.5532 0.2043  0.1253  0.0477  199 PHE A CG  
582  C CD1 . PHE A 86  ? 0.3877 0.6229 0.5743 0.2149  0.1154  0.0512  199 PHE A CD1 
583  C CD2 . PHE A 86  ? 0.3821 0.5389 0.5321 0.1766  0.1182  0.0404  199 PHE A CD2 
584  C CE1 . PHE A 86  ? 0.3553 0.6227 0.5586 0.1959  0.0996  0.0464  199 PHE A CE1 
585  C CE2 . PHE A 86  ? 0.3558 0.5426 0.5220 0.1600  0.1032  0.0368  199 PHE A CE2 
586  C CZ  . PHE A 86  ? 0.3478 0.5885 0.5401 0.1686  0.0943  0.0393  199 PHE A CZ  
587  N N   . CYS A 87  ? 0.4439 0.4624 0.5109 0.1995  0.1431  0.0479  200 CYS A N   
588  C CA  . CYS A 87  ? 0.4361 0.4260 0.4863 0.1768  0.1346  0.0427  200 CYS A CA  
589  C C   . CYS A 87  ? 0.4536 0.4082 0.4792 0.1859  0.1354  0.0485  200 CYS A C   
590  O O   . CYS A 87  ? 0.4348 0.3935 0.4605 0.1773  0.1231  0.0492  200 CYS A O   
591  C CB  . CYS A 87  ? 0.4412 0.3975 0.4734 0.1587  0.1424  0.0337  200 CYS A CB  
592  S SG  . CYS A 87  ? 0.4240 0.3490 0.4353 0.1336  0.1329  0.0272  200 CYS A SG  
593  N N   . THR A 88  ? 0.4961 0.4138 0.4988 0.2033  0.1517  0.0524  201 THR A N   
594  C CA  . THR A 88  ? 0.5304 0.4069 0.5048 0.2135  0.1569  0.0586  201 THR A CA  
595  C C   . THR A 88  ? 0.5291 0.4346 0.5149 0.2325  0.1471  0.0695  201 THR A C   
596  O O   . THR A 88  ? 0.5295 0.4232 0.5050 0.2258  0.1393  0.0714  201 THR A O   
597  C CB  . THR A 88  ? 0.5729 0.4024 0.5192 0.2306  0.1788  0.0610  201 THR A CB  
598  O OG1 . THR A 88  ? 0.5659 0.3600 0.4936 0.2088  0.1869  0.0494  201 THR A OG1 
599  C CG2 . THR A 88  ? 0.6172 0.4051 0.5341 0.2453  0.1861  0.0695  201 THR A CG2 
600  N N   . GLU A 89  ? 0.5345 0.4810 0.5420 0.2556  0.1474  0.0763  202 GLU A N   
601  C CA  . GLU A 89  ? 0.5365 0.5194 0.5565 0.2768  0.1373  0.0870  202 GLU A CA  
602  C C   . GLU A 89  ? 0.4946 0.5160 0.5351 0.2574  0.1163  0.0831  202 GLU A C   
603  O O   . GLU A 89  ? 0.4990 0.5297 0.5362 0.2666  0.1072  0.0902  202 GLU A O   
604  C CB  . GLU A 89  ? 0.5438 0.5734 0.5879 0.3039  0.1410  0.0931  202 GLU A CB  
605  C CG  . GLU A 89  ? 0.6134 0.6042 0.6325 0.3349  0.1622  0.1019  202 GLU A CG  
606  C CD  . GLU A 89  ? 0.6226 0.6645 0.6670 0.3654  0.1661  0.1089  202 GLU A CD  
607  O OE1 . GLU A 89  ? 0.6661 0.7147 0.7036 0.3988  0.1684  0.1222  202 GLU A OE1 
608  O OE2 . GLU A 89  ? 0.6506 0.7261 0.7208 0.3568  0.1678  0.1015  202 GLU A OE2 
609  N N   . LEU A 90  ? 0.4598 0.5003 0.5185 0.2311  0.1096  0.0722  203 LEU A N   
610  C CA  . LEU A 90  ? 0.4223 0.4917 0.4967 0.2105  0.0918  0.0673  203 LEU A CA  
611  C C   . LEU A 90  ? 0.4214 0.4491 0.4718 0.1936  0.0887  0.0647  203 LEU A C   
612  O O   . LEU A 90  ? 0.4279 0.4660 0.4786 0.1909  0.0772  0.0670  203 LEU A O   
613  C CB  . LEU A 90  ? 0.3961 0.4940 0.4941 0.1887  0.0881  0.0570  203 LEU A CB  
614  C CG  . LEU A 90  ? 0.3625 0.4850 0.4743 0.1662  0.0722  0.0509  203 LEU A CG  
615  C CD1 . LEU A 90  ? 0.3766 0.5523 0.5109 0.1768  0.0608  0.0547  203 LEU A CD1 
616  C CD2 . LEU A 90  ? 0.3364 0.4666 0.4600 0.1435  0.0729  0.0410  203 LEU A CD2 
617  N N   . THR A 91  ? 0.4250 0.4092 0.4556 0.1807  0.0985  0.0588  204 THR A N   
618  C CA  . THR A 91  ? 0.4096 0.3636 0.4229 0.1600  0.0945  0.0538  204 THR A CA  
619  C C   . THR A 91  ? 0.4373 0.3448 0.4193 0.1682  0.1033  0.0592  204 THR A C   
620  O O   . THR A 91  ? 0.4452 0.3371 0.4160 0.1552  0.0984  0.0574  204 THR A O   
621  C CB  . THR A 91  ? 0.3983 0.3348 0.4068 0.1385  0.0984  0.0432  204 THR A CB  
622  O OG1 . THR A 91  ? 0.4302 0.3329 0.4202 0.1461  0.1150  0.0426  204 THR A OG1 
623  C CG2 . THR A 91  ? 0.3617 0.3379 0.3969 0.1293  0.0915  0.0384  204 THR A CG2 
624  N N   . GLY A 92  ? 0.4655 0.3497 0.4324 0.1898  0.1178  0.0657  205 GLY A N   
625  C CA  . GLY A 92  ? 0.4972 0.3259 0.4284 0.1962  0.1314  0.0699  205 GLY A CA  
626  C C   . GLY A 92  ? 0.5045 0.2874 0.4132 0.1783  0.1445  0.0599  205 GLY A C   
627  O O   . GLY A 92  ? 0.5358 0.2685 0.4130 0.1808  0.1591  0.0610  205 GLY A O   
628  N N   . ILE A 93  ? 0.4653 0.2651 0.3884 0.1598  0.1398  0.0497  206 ILE A N   
629  C CA  . ILE A 93  ? 0.4729 0.2368 0.3759 0.1405  0.1492  0.0388  206 ILE A CA  
630  C C   . ILE A 93  ? 0.4994 0.2381 0.3887 0.1540  0.1671  0.0388  206 ILE A C   
631  O O   . ILE A 93  ? 0.4890 0.2554 0.3972 0.1615  0.1668  0.0389  206 ILE A O   
632  C CB  . ILE A 93  ? 0.4342 0.2260 0.3551 0.1173  0.1366  0.0290  206 ILE A CB  
633  C CG1 . ILE A 93  ? 0.4026 0.2147 0.3339 0.1047  0.1206  0.0289  206 ILE A CG1 
634  C CG2 . ILE A 93  ? 0.4510 0.2111 0.3510 0.0995  0.1458  0.0176  206 ILE A CG2 
635  C CD1 . ILE A 93  ? 0.3532 0.1992 0.3055 0.0879  0.1069  0.0223  206 ILE A CD1 
636  N N   . ILE A 94  ? 0.5413 0.2258 0.3964 0.1566  0.1842  0.0384  207 ILE A N   
637  C CA  . ILE A 94  ? 0.5739 0.2241 0.4091 0.1676  0.2042  0.0368  207 ILE A CA  
638  C C   . ILE A 94  ? 0.5726 0.2047 0.3956 0.1418  0.2084  0.0217  207 ILE A C   
639  O O   . ILE A 94  ? 0.5410 0.1784 0.3647 0.1161  0.1982  0.0128  207 ILE A O   
640  C CB  . ILE A 94  ? 0.6313 0.2245 0.4301 0.1840  0.2238  0.0435  207 ILE A CB  
641  C CG1 . ILE A 94  ? 0.6464 0.1962 0.4165 0.1590  0.2284  0.0355  207 ILE A CG1 
642  C CG2 . ILE A 94  ? 0.6388 0.2518 0.4476 0.2149  0.2203  0.0600  207 ILE A CG2 
643  C CD1 . ILE A 94  ? 0.7091 0.1963 0.4392 0.1727  0.2498  0.0420  207 ILE A CD1 
644  N N   . GLN A 95  ? 0.5986 0.2114 0.4101 0.1501  0.2236  0.0189  208 GLN A N   
645  C CA  . GLN A 95  ? 0.6100 0.2071 0.4082 0.1282  0.2283  0.0047  208 GLN A CA  
646  C C   . GLN A 95  ? 0.6385 0.1952 0.4067 0.1025  0.2327  -0.0064 208 GLN A C   
647  O O   . GLN A 95  ? 0.6232 0.1914 0.3928 0.0774  0.2236  -0.0177 208 GLN A O   
648  C CB  . GLN A 95  ? 0.6451 0.2176 0.4284 0.1440  0.2481  0.0041  208 GLN A CB  
649  C CG  . GLN A 95  ? 0.6507 0.2142 0.4224 0.1235  0.2519  -0.0101 208 GLN A CG  
650  C CD  . GLN A 95  ? 0.5902 0.2075 0.3937 0.1137  0.2341  -0.0122 208 GLN A CD  
651  O OE1 . GLN A 95  ? 0.5624 0.2202 0.3960 0.1293  0.2275  -0.0034 208 GLN A OE1 
652  N NE2 . GLN A 95  ? 0.5706 0.1883 0.3662 0.0879  0.2269  -0.0240 208 GLN A NE2 
653  N N   . ALA A 96  ? 0.6884 0.1986 0.4289 0.1092  0.2473  -0.0030 209 ALA A N   
654  C CA  . ALA A 96  ? 0.7201 0.1903 0.4314 0.0838  0.2538  -0.0136 209 ALA A CA  
655  C C   . ALA A 96  ? 0.6783 0.1840 0.4086 0.0604  0.2331  -0.0183 209 ALA A C   
656  O O   . ALA A 96  ? 0.6904 0.1803 0.4045 0.0332  0.2344  -0.0313 209 ALA A O   
657  C CB  . ALA A 96  ? 0.7670 0.1859 0.4491 0.0980  0.2717  -0.0055 209 ALA A CB  
658  N N   . MET A 97  ? 0.6337 0.1871 0.3970 0.0710  0.2151  -0.0082 210 MET A N   
659  C CA  . MET A 97  ? 0.6044 0.1914 0.3859 0.0522  0.1961  -0.0114 210 MET A CA  
660  C C   . MET A 97  ? 0.5739 0.1957 0.3715 0.0339  0.1826  -0.0215 210 MET A C   
661  O O   . MET A 97  ? 0.5550 0.1934 0.3578 0.0141  0.1714  -0.0281 210 MET A O   
662  C CB  . MET A 97  ? 0.5678 0.1891 0.3748 0.0693  0.1829  0.0022  210 MET A CB  
663  C CG  . MET A 97  ? 0.6118 0.2001 0.3997 0.0828  0.1931  0.0117  210 MET A CG  
664  S SD  . MET A 97  ? 0.5888 0.2158 0.4025 0.1111  0.1807  0.0291  210 MET A SD  
665  C CE  . MET A 97  ? 0.5032 0.1847 0.3493 0.0918  0.1557  0.0245  210 MET A CE  
666  N N   . VAL A 98  ? 0.5765 0.2097 0.3811 0.0416  0.1842  -0.0223 211 VAL A N   
667  C CA  . VAL A 98  ? 0.5574 0.2193 0.3727 0.0262  0.1729  -0.0308 211 VAL A CA  
668  C C   . VAL A 98  ? 0.5967 0.2310 0.3852 0.0115  0.1840  -0.0441 211 VAL A C   
669  O O   . VAL A 98  ? 0.5867 0.2413 0.3783 -0.0027 0.1750  -0.0520 211 VAL A O   
670  C CB  . VAL A 98  ? 0.5260 0.2271 0.3700 0.0407  0.1644  -0.0233 211 VAL A CB  
671  C CG1 . VAL A 98  ? 0.4767 0.2118 0.3477 0.0485  0.1500  -0.0134 211 VAL A CG1 
672  C CG2 . VAL A 98  ? 0.5372 0.2237 0.3770 0.0612  0.1796  -0.0184 211 VAL A CG2 
673  N N   . ASP A 99  ? 0.6621 0.2483 0.4217 0.0148  0.2039  -0.0469 212 ASP A N   
674  C CA  . ASP A 99  ? 0.7010 0.2581 0.4337 0.0051  0.2173  -0.0590 212 ASP A CA  
675  C C   . ASP A 99  ? 0.7169 0.2746 0.4344 -0.0256 0.2122  -0.0757 212 ASP A C   
676  O O   . ASP A 99  ? 0.7305 0.2993 0.4442 -0.0330 0.2096  -0.0833 212 ASP A O   
677  C CB  . ASP A 99  ? 0.7595 0.2597 0.4617 0.0168  0.2420  -0.0580 212 ASP A CB  
678  C CG  . ASP A 99  ? 0.7533 0.2527 0.4615 0.0444  0.2519  -0.0489 212 ASP A CG  
679  O OD1 . ASP A 99  ? 0.7000 0.2399 0.4332 0.0501  0.2412  -0.0460 212 ASP A OD1 
680  O OD2 . ASP A 99  ? 0.8139 0.2713 0.5009 0.0608  0.2715  -0.0448 212 ASP A OD2 
681  N N   . GLY A 100 ? 0.7349 0.2823 0.4429 -0.0437 0.2113  -0.0820 213 GLY A N   
682  C CA  . GLY A 100 ? 0.7401 0.2945 0.4350 -0.0730 0.2063  -0.0990 213 GLY A CA  
683  C C   . GLY A 100 ? 0.6931 0.3026 0.4153 -0.0816 0.1827  -0.0989 213 GLY A C   
684  O O   . GLY A 100 ? 0.7001 0.3238 0.4159 -0.1047 0.1760  -0.1117 213 GLY A O   
685  N N   . GLN A 101 ? 0.6481 0.2896 0.4001 -0.0630 0.1704  -0.0848 214 GLN A N   
686  C CA  . GLN A 101 ? 0.6014 0.2860 0.3781 -0.0679 0.1510  -0.0818 214 GLN A CA  
687  C C   . GLN A 101 ? 0.5733 0.2936 0.3577 -0.0737 0.1372  -0.0864 214 GLN A C   
688  O O   . GLN A 101 ? 0.5808 0.2962 0.3573 -0.0686 0.1415  -0.0879 214 GLN A O   
689  C CB  . GLN A 101 ? 0.5748 0.2750 0.3771 -0.0466 0.1448  -0.0656 214 GLN A CB  
690  C CG  . GLN A 101 ? 0.6100 0.2776 0.4041 -0.0369 0.1572  -0.0587 214 GLN A CG  
691  C CD  . GLN A 101 ? 0.6452 0.3008 0.4287 -0.0546 0.1588  -0.0647 214 GLN A CD  
692  O OE1 . GLN A 101 ? 0.6288 0.3132 0.4217 -0.0705 0.1463  -0.0708 214 GLN A OE1 
693  N NE2 . GLN A 101 ? 0.7194 0.3320 0.4823 -0.0514 0.1752  -0.0626 214 GLN A NE2 
694  N N   . PRO A 102 ? 0.5426 0.2977 0.3404 -0.0835 0.1216  -0.0884 215 PRO A N   
695  C CA  . PRO A 102 ? 0.5185 0.3079 0.3229 -0.0849 0.1082  -0.0903 215 PRO A CA  
696  C C   . PRO A 102 ? 0.4869 0.2909 0.3093 -0.0648 0.1033  -0.0775 215 PRO A C   
697  O O   . PRO A 102 ? 0.4763 0.2756 0.3134 -0.0507 0.1060  -0.0669 215 PRO A O   
698  C CB  . PRO A 102 ? 0.4997 0.3215 0.3160 -0.0960 0.0942  -0.0933 215 PRO A CB  
699  C CG  . PRO A 102 ? 0.5045 0.3130 0.3277 -0.0959 0.0987  -0.0889 215 PRO A CG  
700  C CD  . PRO A 102 ? 0.5352 0.2981 0.3405 -0.0928 0.1171  -0.0890 215 PRO A CD  
701  N N   . SER A 103 ? 0.4732 0.2947 0.2924 -0.0646 0.0969  -0.0792 216 SER A N   
702  C CA  . SER A 103 ? 0.4441 0.2784 0.2766 -0.0494 0.0936  -0.0689 216 SER A CA  
703  C C   . SER A 103 ? 0.4023 0.2653 0.2567 -0.0451 0.0799  -0.0612 216 SER A C   
704  O O   . SER A 103 ? 0.3900 0.2660 0.2475 -0.0537 0.0721  -0.0648 216 SER A O   
705  C CB  . SER A 103 ? 0.4603 0.3006 0.2765 -0.0520 0.0921  -0.0738 216 SER A CB  
706  O OG  . SER A 103 ? 0.4635 0.3310 0.2778 -0.0604 0.0783  -0.0783 216 SER A OG  
707  N N   . LEU A 104 ? 0.3767 0.2496 0.2455 -0.0328 0.0776  -0.0516 217 LEU A N   
708  C CA  . LEU A 104 ? 0.3473 0.2437 0.2341 -0.0288 0.0659  -0.0447 217 LEU A CA  
709  C C   . LEU A 104 ? 0.3420 0.2592 0.2222 -0.0347 0.0546  -0.0486 217 LEU A C   
710  O O   . LEU A 104 ? 0.3244 0.2580 0.2152 -0.0360 0.0459  -0.0472 217 LEU A O   
711  C CB  . LEU A 104 ? 0.3306 0.2321 0.2306 -0.0175 0.0671  -0.0355 217 LEU A CB  
712  C CG  . LEU A 104 ? 0.3009 0.2214 0.2164 -0.0138 0.0572  -0.0290 217 LEU A CG  
713  C CD1 . LEU A 104 ? 0.2667 0.1910 0.1971 -0.0139 0.0538  -0.0268 217 LEU A CD1 
714  C CD2 . LEU A 104 ? 0.2852 0.2074 0.2083 -0.0066 0.0608  -0.0223 217 LEU A CD2 
715  N N   . GLN A 105 ? 0.3642 0.2825 0.2267 -0.0368 0.0547  -0.0531 218 GLN A N   
716  C CA  . GLN A 105 ? 0.3682 0.3102 0.2229 -0.0397 0.0434  -0.0563 218 GLN A CA  
717  C C   . GLN A 105 ? 0.3645 0.3197 0.2204 -0.0527 0.0379  -0.0653 218 GLN A C   
718  O O   . GLN A 105 ? 0.3492 0.3294 0.2142 -0.0522 0.0276  -0.0641 218 GLN A O   
719  C CB  . GLN A 105 ? 0.3922 0.3318 0.2235 -0.0404 0.0452  -0.0608 218 GLN A CB  
720  C CG  . GLN A 105 ? 0.3990 0.3672 0.2213 -0.0389 0.0324  -0.0620 218 GLN A CG  
721  C CD  . GLN A 105 ? 0.4376 0.4049 0.2341 -0.0383 0.0333  -0.0658 218 GLN A CD  
722  O OE1 . GLN A 105 ? 0.4779 0.4213 0.2629 -0.0385 0.0443  -0.0669 218 GLN A OE1 
723  N NE2 . GLN A 105 ? 0.4608 0.4559 0.2474 -0.0365 0.0217  -0.0677 218 GLN A NE2 
724  N N   . GLN A 106 ? 0.3805 0.3172 0.2264 -0.0645 0.0465  -0.0744 219 GLN A N   
725  C CA  . GLN A 106 ? 0.3917 0.3355 0.2372 -0.0801 0.0448  -0.0841 219 GLN A CA  
726  C C   . GLN A 106 ? 0.3615 0.3096 0.2276 -0.0772 0.0424  -0.0775 219 GLN A C   
727  O O   . GLN A 106 ? 0.3440 0.3152 0.2171 -0.0844 0.0350  -0.0811 219 GLN A O   
728  C CB  . GLN A 106 ? 0.4243 0.3371 0.2515 -0.0931 0.0584  -0.0945 219 GLN A CB  
729  C CG  . GLN A 106 ? 0.4644 0.3747 0.2678 -0.1003 0.0604  -0.1044 219 GLN A CG  
730  C CD  . GLN A 106 ? 0.5109 0.3826 0.2935 -0.1112 0.0768  -0.1140 219 GLN A CD  
731  O OE1 . GLN A 106 ? 0.5601 0.4004 0.3431 -0.1016 0.0889  -0.1076 219 GLN A OE1 
732  N NE2 . GLN A 106 ? 0.5793 0.4536 0.3426 -0.1312 0.0777  -0.1299 219 GLN A NE2 
733  N N   . VAL A 107 ? 0.3502 0.2788 0.2260 -0.0663 0.0486  -0.0680 220 VAL A N   
734  C CA  . VAL A 107 ? 0.3327 0.2640 0.2259 -0.0625 0.0465  -0.0613 220 VAL A CA  
735  C C   . VAL A 107 ? 0.3004 0.2617 0.2078 -0.0557 0.0338  -0.0557 220 VAL A C   
736  O O   . VAL A 107 ? 0.2843 0.2589 0.2012 -0.0590 0.0290  -0.0556 220 VAL A O   
737  C CB  . VAL A 107 ? 0.3260 0.2353 0.2265 -0.0506 0.0547  -0.0523 220 VAL A CB  
738  C CG1 . VAL A 107 ? 0.2989 0.2165 0.2170 -0.0451 0.0498  -0.0448 220 VAL A CG1 
739  C CG2 . VAL A 107 ? 0.3452 0.2226 0.2308 -0.0553 0.0683  -0.0571 220 VAL A CG2 
740  N N   . LEU A 108 ? 0.2975 0.2669 0.2035 -0.0463 0.0299  -0.0510 221 LEU A N   
741  C CA  . LEU A 108 ? 0.2868 0.2791 0.2011 -0.0383 0.0198  -0.0454 221 LEU A CA  
742  C C   . LEU A 108 ? 0.2951 0.3159 0.2065 -0.0450 0.0110  -0.0523 221 LEU A C   
743  O O   . LEU A 108 ? 0.2880 0.3277 0.2103 -0.0411 0.0042  -0.0492 221 LEU A O   
744  C CB  . LEU A 108 ? 0.2854 0.2743 0.1939 -0.0270 0.0202  -0.0389 221 LEU A CB  
745  C CG  . LEU A 108 ? 0.2713 0.2427 0.1884 -0.0194 0.0270  -0.0310 221 LEU A CG  
746  C CD1 . LEU A 108 ? 0.2603 0.2273 0.1671 -0.0119 0.0293  -0.0268 221 LEU A CD1 
747  C CD2 . LEU A 108 ? 0.2504 0.2274 0.1850 -0.0149 0.0233  -0.0248 221 LEU A CD2 
748  N N   . GLU A 109 ? 0.3163 0.3422 0.2131 -0.0551 0.0113  -0.0622 222 GLU A N   
749  C CA  . GLU A 109 ? 0.3215 0.3801 0.2173 -0.0642 0.0030  -0.0710 222 GLU A CA  
750  C C   . GLU A 109 ? 0.3114 0.3739 0.2190 -0.0763 0.0048  -0.0757 222 GLU A C   
751  O O   . GLU A 109 ? 0.2875 0.3804 0.2051 -0.0775 -0.0027 -0.0773 222 GLU A O   
752  C CB  . GLU A 109 ? 0.3437 0.4063 0.2204 -0.0762 0.0038  -0.0829 222 GLU A CB  
753  C CG  . GLU A 109 ? 0.3848 0.4489 0.2461 -0.0649 0.0009  -0.0792 222 GLU A CG  
754  C CD  . GLU A 109 ? 0.4208 0.4781 0.2598 -0.0776 0.0050  -0.0913 222 GLU A CD  
755  O OE1 . GLU A 109 ? 0.4873 0.5436 0.3222 -0.0968 0.0087  -0.1042 222 GLU A OE1 
756  O OE2 . GLU A 109 ? 0.4892 0.5401 0.3126 -0.0690 0.0054  -0.0883 222 GLU A OE2 
757  N N   . ARG A 110 ? 0.3199 0.3508 0.2248 -0.0841 0.0157  -0.0775 223 ARG A N   
758  C CA  . ARG A 110 ? 0.3247 0.3517 0.2373 -0.0943 0.0198  -0.0803 223 ARG A CA  
759  C C   . ARG A 110 ? 0.2909 0.3263 0.2214 -0.0823 0.0150  -0.0696 223 ARG A C   
760  O O   . ARG A 110 ? 0.2776 0.3290 0.2167 -0.0888 0.0130  -0.0722 223 ARG A O   
761  C CB  . ARG A 110 ? 0.3527 0.3386 0.2541 -0.1015 0.0340  -0.0826 223 ARG A CB  
762  C CG  . ARG A 110 ? 0.4061 0.3817 0.2872 -0.1189 0.0409  -0.0966 223 ARG A CG  
763  C CD  . ARG A 110 ? 0.4447 0.3741 0.3118 -0.1197 0.0563  -0.0963 223 ARG A CD  
764  N NE  . ARG A 110 ? 0.5295 0.4410 0.3737 -0.1379 0.0658  -0.1106 223 ARG A NE  
765  C CZ  . ARG A 110 ? 0.5696 0.4685 0.4031 -0.1586 0.0747  -0.1219 223 ARG A CZ  
766  N NH1 . ARG A 110 ? 0.5816 0.4859 0.4256 -0.1640 0.0751  -0.1203 223 ARG A NH1 
767  N NH2 . ARG A 110 ? 0.6162 0.4959 0.4264 -0.1755 0.0842  -0.1356 223 ARG A NH2 
768  N N   . VAL A 111 ? 0.2684 0.2935 0.2040 -0.0661 0.0140  -0.0587 224 VAL A N   
769  C CA  . VAL A 111 ? 0.2464 0.2794 0.1965 -0.0556 0.0093  -0.0498 224 VAL A CA  
770  C C   . VAL A 111 ? 0.2382 0.3060 0.1937 -0.0525 -0.0005 -0.0508 224 VAL A C   
771  O O   . VAL A 111 ? 0.2166 0.2984 0.1826 -0.0529 -0.0032 -0.0499 224 VAL A O   
772  C CB  . VAL A 111 ? 0.2407 0.2586 0.1937 -0.0413 0.0103  -0.0398 224 VAL A CB  
773  C CG1 . VAL A 111 ? 0.2086 0.2376 0.1729 -0.0312 0.0045  -0.0324 224 VAL A CG1 
774  C CG2 . VAL A 111 ? 0.2233 0.2133 0.1757 -0.0417 0.0195  -0.0376 224 VAL A CG2 
775  N N   . ASP A 112 ? 0.2450 0.3274 0.1923 -0.0486 -0.0054 -0.0525 225 ASP A N   
776  C CA  . ASP A 112 ? 0.2496 0.3668 0.2003 -0.0414 -0.0149 -0.0521 225 ASP A CA  
777  C C   . ASP A 112 ? 0.2526 0.3999 0.2102 -0.0551 -0.0178 -0.0621 225 ASP A C   
778  O O   . ASP A 112 ? 0.2440 0.4171 0.2123 -0.0495 -0.0230 -0.0602 225 ASP A O   
779  C CB  . ASP A 112 ? 0.2582 0.3846 0.1950 -0.0333 -0.0193 -0.0515 225 ASP A CB  
780  C CG  . ASP A 112 ? 0.2553 0.4069 0.1933 -0.0161 -0.0275 -0.0448 225 ASP A CG  
781  O OD1 . ASP A 112 ? 0.2535 0.4387 0.1872 -0.0149 -0.0350 -0.0495 225 ASP A OD1 
782  O OD2 . ASP A 112 ? 0.2328 0.3707 0.1751 -0.0036 -0.0260 -0.0351 225 ASP A OD2 
783  N N   . GLU A 113 ? 0.2706 0.4134 0.2213 -0.0736 -0.0130 -0.0731 226 GLU A N   
784  C CA  . GLU A 113 ? 0.2887 0.4557 0.2452 -0.0914 -0.0128 -0.0843 226 GLU A CA  
785  C C   . GLU A 113 ? 0.2684 0.4258 0.2367 -0.0940 -0.0078 -0.0809 226 GLU A C   
786  O O   . GLU A 113 ? 0.2629 0.4498 0.2423 -0.0993 -0.0105 -0.0848 226 GLU A O   
787  C CB  . GLU A 113 ? 0.3152 0.4680 0.2577 -0.1129 -0.0054 -0.0973 226 GLU A CB  
788  C CG  . GLU A 113 ? 0.3564 0.5252 0.2855 -0.1137 -0.0110 -0.1035 226 GLU A CG  
789  C CD  . GLU A 113 ? 0.3899 0.5315 0.3005 -0.1325 -0.0013 -0.1149 226 GLU A CD  
790  O OE1 . GLU A 113 ? 0.4541 0.5657 0.3619 -0.1459 0.0105  -0.1188 226 GLU A OE1 
791  O OE2 . GLU A 113 ? 0.4524 0.6006 0.3488 -0.1328 -0.0047 -0.1198 226 GLU A OE2 
792  N N   . TRP A 114 ? 0.2670 0.3851 0.2327 -0.0898 -0.0005 -0.0736 227 TRP A N   
793  C CA  . TRP A 114 ? 0.2617 0.3680 0.2357 -0.0898 0.0040  -0.0689 227 TRP A CA  
794  C C   . TRP A 114 ? 0.2454 0.3733 0.2326 -0.0745 -0.0036 -0.0609 227 TRP A C   
795  O O   . TRP A 114 ? 0.2451 0.3870 0.2413 -0.0784 -0.0031 -0.0620 227 TRP A O   
796  C CB  . TRP A 114 ? 0.2655 0.3289 0.2328 -0.0857 0.0122  -0.0623 227 TRP A CB  
797  C CG  . TRP A 114 ? 0.2592 0.3081 0.2314 -0.0844 0.0167  -0.0568 227 TRP A CG  
798  C CD1 . TRP A 114 ? 0.2747 0.3098 0.2420 -0.0979 0.0257  -0.0610 227 TRP A CD1 
799  C CD2 . TRP A 114 ? 0.2451 0.2900 0.2255 -0.0694 0.0132  -0.0462 227 TRP A CD2 
800  N NE1 . TRP A 114 ? 0.2651 0.2889 0.2368 -0.0901 0.0272  -0.0527 227 TRP A NE1 
801  C CE2 . TRP A 114 ? 0.2545 0.2857 0.2348 -0.0732 0.0190  -0.0442 227 TRP A CE2 
802  C CE3 . TRP A 114 ? 0.2319 0.2818 0.2177 -0.0540 0.0066  -0.0388 227 TRP A CE3 
803  C CZ2 . TRP A 114 ? 0.2424 0.2679 0.2283 -0.0619 0.0170  -0.0353 227 TRP A CZ2 
804  C CZ3 . TRP A 114 ? 0.2259 0.2692 0.2178 -0.0448 0.0055  -0.0311 227 TRP A CZ3 
805  C CH2 . TRP A 114 ? 0.2264 0.2592 0.2187 -0.0487 0.0099  -0.0296 227 TRP A CH2 
806  N N   . MET A 115 ? 0.2336 0.3617 0.2200 -0.0575 -0.0092 -0.0531 228 MET A N   
807  C CA  . MET A 115 ? 0.2187 0.3628 0.2132 -0.0422 -0.0150 -0.0459 228 MET A CA  
808  C C   . MET A 115 ? 0.2198 0.4069 0.2217 -0.0438 -0.0206 -0.0516 228 MET A C   
809  O O   . MET A 115 ? 0.2051 0.4067 0.2166 -0.0391 -0.0215 -0.0494 228 MET A O   
810  C CB  . MET A 115 ? 0.2184 0.3539 0.2061 -0.0258 -0.0182 -0.0381 228 MET A CB  
811  C CG  . MET A 115 ? 0.2160 0.3154 0.1997 -0.0223 -0.0130 -0.0320 228 MET A CG  
812  S SD  . MET A 115 ? 0.2385 0.3222 0.2309 -0.0173 -0.0106 -0.0250 228 MET A SD  
813  C CE  . MET A 115 ? 0.1745 0.2635 0.1646 0.0003  -0.0144 -0.0178 228 MET A CE  
814  N N   . ALA A 116 ? 0.2306 0.4401 0.2279 -0.0502 -0.0244 -0.0593 229 ALA A N   
815  C CA  . ALA A 116 ? 0.2358 0.4942 0.2413 -0.0525 -0.0307 -0.0661 229 ALA A CA  
816  C C   . ALA A 116 ? 0.2349 0.5063 0.2514 -0.0705 -0.0257 -0.0742 229 ALA A C   
817  O O   . ALA A 116 ? 0.2165 0.5154 0.2454 -0.0653 -0.0278 -0.0732 229 ALA A O   
818  C CB  . ALA A 116 ? 0.2433 0.5226 0.2397 -0.0590 -0.0357 -0.0745 229 ALA A CB  
819  N N   . LYS A 117 ? 0.2608 0.5089 0.2710 -0.0911 -0.0175 -0.0818 230 LYS A N   
820  C CA  . LYS A 117 ? 0.2705 0.5214 0.2864 -0.1109 -0.0095 -0.0897 230 LYS A CA  
821  C C   . LYS A 117 ? 0.2544 0.4922 0.2780 -0.1032 -0.0056 -0.0812 230 LYS A C   
822  O O   . LYS A 117 ? 0.2473 0.5055 0.2803 -0.1129 -0.0022 -0.0859 230 LYS A O   
823  C CB  . LYS A 117 ? 0.3028 0.5167 0.3041 -0.1309 0.0012  -0.0969 230 LYS A CB  
824  C CG  . LYS A 117 ? 0.3340 0.5398 0.3358 -0.1525 0.0127  -0.1043 230 LYS A CG  
825  C CD  . LYS A 117 ? 0.3773 0.5484 0.3606 -0.1748 0.0249  -0.1141 230 LYS A CD  
826  C CE  . LYS A 117 ? 0.4205 0.5773 0.4011 -0.1953 0.0387  -0.1200 230 LYS A CE  
827  N NZ  . LYS A 117 ? 0.4707 0.5820 0.4289 -0.2148 0.0541  -0.1275 230 LYS A NZ  
828  N N   . GLU A 118 ? 0.2396 0.4451 0.2589 -0.0871 -0.0057 -0.0694 231 GLU A N   
829  C CA  . GLU A 118 ? 0.2335 0.4252 0.2575 -0.0792 -0.0027 -0.0615 231 GLU A CA  
830  C C   . GLU A 118 ? 0.2186 0.4385 0.2528 -0.0619 -0.0095 -0.0562 231 GLU A C   
831  O O   . GLU A 118 ? 0.2147 0.4245 0.2516 -0.0545 -0.0074 -0.0502 231 GLU A O   
832  C CB  . GLU A 118 ? 0.2249 0.3731 0.2401 -0.0709 0.0001  -0.0525 231 GLU A CB  
833  C CG  . GLU A 118 ? 0.2498 0.3646 0.2540 -0.0846 0.0096  -0.0553 231 GLU A CG  
834  C CD  . GLU A 118 ? 0.2512 0.3597 0.2544 -0.0986 0.0186  -0.0588 231 GLU A CD  
835  O OE1 . GLU A 118 ? 0.2446 0.3610 0.2545 -0.0937 0.0183  -0.0549 231 GLU A OE1 
836  O OE2 . GLU A 118 ? 0.2953 0.3879 0.2887 -0.1149 0.0273  -0.0657 231 GLU A OE2 
837  N N   . GLY A 119 ? 0.2195 0.4738 0.2573 -0.0546 -0.0171 -0.0585 232 GLY A N   
838  C CA  . GLY A 119 ? 0.2059 0.4871 0.2511 -0.0355 -0.0224 -0.0531 232 GLY A CA  
839  C C   . GLY A 119 ? 0.1987 0.4520 0.2355 -0.0151 -0.0240 -0.0416 232 GLY A C   
840  O O   . GLY A 119 ? 0.1985 0.4609 0.2376 0.0014  -0.0254 -0.0359 232 GLY A O   
841  N N   . LEU A 120 ? 0.1961 0.4145 0.2226 -0.0167 -0.0226 -0.0387 233 LEU A N   
842  C CA  . LEU A 120 ? 0.1917 0.3811 0.2101 -0.0017 -0.0224 -0.0292 233 LEU A CA  
843  C C   . LEU A 120 ? 0.1981 0.3951 0.2081 0.0144  -0.0271 -0.0248 233 LEU A C   
844  O O   . LEU A 120 ? 0.1983 0.3713 0.2001 0.0268  -0.0255 -0.0172 233 LEU A O   
845  C CB  . LEU A 120 ? 0.1921 0.3445 0.2048 -0.0099 -0.0181 -0.0279 233 LEU A CB  
846  C CG  . LEU A 120 ? 0.1860 0.3234 0.2026 -0.0205 -0.0128 -0.0289 233 LEU A CG  
847  C CD1 . LEU A 120 ? 0.1768 0.2852 0.1875 -0.0281 -0.0087 -0.0287 233 LEU A CD1 
848  C CD2 . LEU A 120 ? 0.1714 0.3002 0.1898 -0.0110 -0.0120 -0.0230 233 LEU A CD2 
849  N N   . LEU A 121 ? 0.1962 0.4253 0.2065 0.0138  -0.0323 -0.0297 234 LEU A N   
850  C CA  . LEU A 121 ? 0.2071 0.4453 0.2067 0.0312  -0.0371 -0.0247 234 LEU A CA  
851  C C   . LEU A 121 ? 0.2050 0.4785 0.2086 0.0488  -0.0412 -0.0218 234 LEU A C   
852  O O   . LEU A 121 ? 0.2238 0.5109 0.2177 0.0654  -0.0456 -0.0174 234 LEU A O   
853  C CB  . LEU A 121 ? 0.2170 0.4680 0.2102 0.0223  -0.0410 -0.0312 234 LEU A CB  
854  C CG  . LEU A 121 ? 0.2217 0.4369 0.2085 0.0081  -0.0359 -0.0335 234 LEU A CG  
855  C CD1 . LEU A 121 ? 0.2361 0.4641 0.2143 -0.0003 -0.0391 -0.0407 234 LEU A CD1 
856  C CD2 . LEU A 121 ? 0.2291 0.4043 0.2064 0.0189  -0.0313 -0.0237 234 LEU A CD2 
857  N N   . ASP A 122 ? 0.1961 0.4850 0.2129 0.0468  -0.0393 -0.0238 235 ASP A N   
858  C CA  . ASP A 122 ? 0.1965 0.5160 0.2172 0.0666  -0.0414 -0.0198 235 ASP A CA  
859  C C   . ASP A 122 ? 0.1981 0.4802 0.2054 0.0862  -0.0362 -0.0087 235 ASP A C   
860  O O   . ASP A 122 ? 0.1896 0.4355 0.1954 0.0788  -0.0303 -0.0073 235 ASP A O   
861  C CB  . ASP A 122 ? 0.1839 0.5330 0.2232 0.0568  -0.0396 -0.0264 235 ASP A CB  
862  C CG  . ASP A 122 ? 0.2043 0.5875 0.2491 0.0787  -0.0409 -0.0223 235 ASP A CG  
863  O OD1 . ASP A 122 ? 0.2220 0.5817 0.2602 0.0948  -0.0357 -0.0144 235 ASP A OD1 
864  O OD2 . ASP A 122 ? 0.2790 0.7151 0.3350 0.0798  -0.0467 -0.0278 235 ASP A OD2 
865  N N   . PRO A 123 ? 0.2169 0.5074 0.2130 0.1112  -0.0378 -0.0009 236 PRO A N   
866  C CA  . PRO A 123 ? 0.2369 0.4856 0.2156 0.1291  -0.0305 0.0092  236 PRO A CA  
867  C C   . PRO A 123 ? 0.2367 0.4703 0.2206 0.1292  -0.0236 0.0097  236 PRO A C   
868  O O   . PRO A 123 ? 0.2485 0.4384 0.2193 0.1325  -0.0164 0.0145  236 PRO A O   
869  C CB  . PRO A 123 ? 0.2644 0.5327 0.2302 0.1576  -0.0331 0.0171  236 PRO A CB  
870  C CG  . PRO A 123 ? 0.2553 0.5885 0.2389 0.1560  -0.0427 0.0101  236 PRO A CG  
871  C CD  . PRO A 123 ? 0.2303 0.5685 0.2269 0.1246  -0.0458 -0.0012 236 PRO A CD  
872  N N   . ASN A 124 ? 0.2180 0.4872 0.2202 0.1233  -0.0251 0.0039  237 ASN A N   
873  C CA  . ASN A 124 ? 0.2130 0.4714 0.2195 0.1232  -0.0185 0.0037  237 ASN A CA  
874  C C   . ASN A 124 ? 0.1987 0.4293 0.2097 0.0996  -0.0155 -0.0010 237 ASN A C   
875  O O   . ASN A 124 ? 0.2045 0.4135 0.2128 0.0995  -0.0095 0.0000  237 ASN A O   
876  C CB  . ASN A 124 ? 0.2087 0.5191 0.2332 0.1267  -0.0203 -0.0006 237 ASN A CB  
877  C CG  . ASN A 124 ? 0.2064 0.5503 0.2277 0.1530  -0.0237 0.0046  237 ASN A CG  
878  O OD1 . ASN A 124 ? 0.2003 0.5309 0.2098 0.1766  -0.0181 0.0124  237 ASN A OD1 
879  N ND2 . ASN A 124 ? 0.1760 0.5631 0.2058 0.1500  -0.0327 0.0004  237 ASN A ND2 
880  N N   . VAL A 125 ? 0.1817 0.4130 0.1979 0.0809  -0.0193 -0.0060 238 VAL A N   
881  C CA  . VAL A 125 ? 0.1691 0.3761 0.1885 0.0609  -0.0167 -0.0096 238 VAL A CA  
882  C C   . VAL A 125 ? 0.1831 0.3470 0.1889 0.0617  -0.0146 -0.0049 238 VAL A C   
883  O O   . VAL A 125 ? 0.1826 0.3393 0.1817 0.0627  -0.0168 -0.0034 238 VAL A O   
884  C CB  . VAL A 125 ? 0.1573 0.3830 0.1872 0.0405  -0.0195 -0.0176 238 VAL A CB  
885  C CG1 . VAL A 125 ? 0.1250 0.3186 0.1536 0.0238  -0.0159 -0.0190 238 VAL A CG1 
886  C CG2 . VAL A 125 ? 0.1263 0.3964 0.1712 0.0355  -0.0200 -0.0240 238 VAL A CG2 
887  N N   . LYS A 126 ? 0.1898 0.3266 0.1911 0.0604  -0.0099 -0.0032 239 LYS A N   
888  C CA  . LYS A 126 ? 0.1969 0.2967 0.1866 0.0599  -0.0072 0.0001  239 LYS A CA  
889  C C   . LYS A 126 ? 0.1884 0.2754 0.1835 0.0427  -0.0079 -0.0029 239 LYS A C   
890  O O   . LYS A 126 ? 0.1774 0.2666 0.1786 0.0343  -0.0072 -0.0054 239 LYS A O   
891  C CB  . LYS A 126 ? 0.2136 0.2911 0.1924 0.0692  -0.0013 0.0029  239 LYS A CB  
892  C CG  . LYS A 126 ? 0.2222 0.3090 0.1934 0.0896  0.0014  0.0069  239 LYS A CG  
893  C CD  . LYS A 126 ? 0.2384 0.3220 0.1982 0.1028  0.0009  0.0120  239 LYS A CD  
894  C CE  . LYS A 126 ? 0.2641 0.3623 0.2167 0.1266  0.0032  0.0169  239 LYS A CE  
895  N NZ  . LYS A 126 ? 0.2735 0.3789 0.2158 0.1418  0.0009  0.0224  239 LYS A NZ  
896  N N   . SER A 127 ? 0.1991 0.2726 0.1908 0.0389  -0.0086 -0.0020 240 SER A N   
897  C CA  . SER A 127 ? 0.1819 0.2426 0.1778 0.0260  -0.0086 -0.0036 240 SER A CA  
898  C C   . SER A 127 ? 0.1862 0.2247 0.1754 0.0262  -0.0064 -0.0013 240 SER A C   
899  O O   . SER A 127 ? 0.2038 0.2341 0.1832 0.0349  -0.0044 0.0017  240 SER A O   
900  C CB  . SER A 127 ? 0.1839 0.2591 0.1869 0.0165  -0.0109 -0.0073 240 SER A CB  
901  O OG  . SER A 127 ? 0.1721 0.2536 0.1713 0.0197  -0.0126 -0.0073 240 SER A OG  
902  N N   . ILE A 128 ? 0.1725 0.2014 0.1662 0.0171  -0.0062 -0.0023 241 ILE A N   
903  C CA  . ILE A 128 ? 0.1755 0.1879 0.1662 0.0151  -0.0036 -0.0011 241 ILE A CA  
904  C C   . ILE A 128 ? 0.1663 0.1799 0.1657 0.0067  -0.0047 -0.0023 241 ILE A C   
905  O O   . ILE A 128 ? 0.1582 0.1775 0.1627 0.0030  -0.0065 -0.0032 241 ILE A O   
906  C CB  . ILE A 128 ? 0.1846 0.1815 0.1690 0.0158  -0.0002 -0.0010 241 ILE A CB  
907  C CG1 . ILE A 128 ? 0.1963 0.1772 0.1761 0.0127  0.0044  -0.0005 241 ILE A CG1 
908  C CG2 . ILE A 128 ? 0.1498 0.1495 0.1398 0.0095  -0.0024 -0.0032 241 ILE A CG2 
909  C CD1 . ILE A 128 ? 0.2021 0.1637 0.1714 0.0117  0.0100  -0.0016 241 ILE A CD1 
910  N N   . PHE A 129 ? 0.1716 0.1788 0.1711 0.0051  -0.0025 -0.0017 242 PHE A N   
911  C CA  . PHE A 129 ? 0.1606 0.1682 0.1676 0.0000  -0.0023 -0.0021 242 PHE A CA  
912  C C   . PHE A 129 ? 0.1574 0.1635 0.1694 -0.0030 -0.0026 -0.0022 242 PHE A C   
913  O O   . PHE A 129 ? 0.1733 0.1733 0.1819 -0.0038 -0.0009 -0.0030 242 PHE A O   
914  C CB  . PHE A 129 ? 0.1610 0.1642 0.1666 -0.0001 0.0010  -0.0018 242 PHE A CB  
915  C CG  . PHE A 129 ? 0.1625 0.1703 0.1641 0.0001  0.0004  -0.0032 242 PHE A CG  
916  C CD1 . PHE A 129 ? 0.1864 0.1985 0.1800 0.0044  -0.0009 -0.0033 242 PHE A CD1 
917  C CD2 . PHE A 129 ? 0.1629 0.1710 0.1673 -0.0039 0.0013  -0.0048 242 PHE A CD2 
918  C CE1 . PHE A 129 ? 0.1764 0.1979 0.1667 0.0027  -0.0024 -0.0062 242 PHE A CE1 
919  C CE2 . PHE A 129 ? 0.1633 0.1748 0.1625 -0.0068 0.0015  -0.0080 242 PHE A CE2 
920  C CZ  . PHE A 129 ? 0.1733 0.1941 0.1665 -0.0045 -0.0010 -0.0093 242 PHE A CZ  
921  N N   . VAL A 130 ? 0.1543 0.1657 0.1730 -0.0045 -0.0042 -0.0017 243 VAL A N   
922  C CA  . VAL A 130 ? 0.1476 0.1643 0.1723 -0.0064 -0.0059 -0.0018 243 VAL A CA  
923  C C   . VAL A 130 ? 0.1400 0.1613 0.1723 -0.0050 -0.0044 -0.0002 243 VAL A C   
924  O O   . VAL A 130 ? 0.1289 0.1472 0.1598 -0.0021 -0.0031 0.0016  243 VAL A O   
925  C CB  . VAL A 130 ? 0.1448 0.1654 0.1677 -0.0059 -0.0098 -0.0014 243 VAL A CB  
926  C CG1 . VAL A 130 ? 0.1360 0.1663 0.1641 -0.0075 -0.0131 -0.0020 243 VAL A CG1 
927  C CG2 . VAL A 130 ? 0.1375 0.1539 0.1530 -0.0058 -0.0099 -0.0029 243 VAL A CG2 
928  N N   . THR A 131 ? 0.1407 0.1690 0.1804 -0.0074 -0.0035 -0.0014 244 THR A N   
929  C CA  . THR A 131 ? 0.1504 0.1868 0.1991 -0.0048 -0.0012 0.0000  244 THR A CA  
930  C C   . THR A 131 ? 0.1535 0.2094 0.2130 -0.0064 -0.0046 -0.0012 244 THR A C   
931  O O   . THR A 131 ? 0.1580 0.2179 0.2169 -0.0129 -0.0072 -0.0048 244 THR A O   
932  C CB  . THR A 131 ? 0.1559 0.1858 0.2043 -0.0070 0.0053  -0.0011 244 THR A CB  
933  O OG1 . THR A 131 ? 0.1544 0.1827 0.2022 -0.0141 0.0074  -0.0043 244 THR A OG1 
934  C CG2 . THR A 131 ? 0.1453 0.1606 0.1823 -0.0050 0.0071  -0.0004 244 THR A CG2 
935  N N   . CYS A 132 ? 0.1593 0.2283 0.2277 0.0001  -0.0046 0.0015  245 CYS A N   
936  C CA  . CYS A 132 ? 0.1589 0.2542 0.2405 -0.0009 -0.0080 -0.0002 245 CYS A CA  
937  C C   . CYS A 132 ? 0.1631 0.2673 0.2553 -0.0073 -0.0022 -0.0038 245 CYS A C   
938  O O   . CYS A 132 ? 0.1730 0.2796 0.2708 -0.0014 0.0029  -0.0014 245 CYS A O   
939  C CB  . CYS A 132 ? 0.1704 0.2783 0.2559 0.0123  -0.0107 0.0056  245 CYS A CB  
940  S SG  . CYS A 132 ? 0.1876 0.3363 0.2899 0.0141  -0.0170 0.0041  245 CYS A SG  
941  N N   . GLY A 133 ? 0.1673 0.2737 0.2603 -0.0200 -0.0013 -0.0099 246 GLY A N   
942  C CA  . GLY A 133 ? 0.1638 0.2724 0.2630 -0.0289 0.0067  -0.0139 246 GLY A CA  
943  C C   . GLY A 133 ? 0.1658 0.2430 0.2497 -0.0310 0.0136  -0.0131 246 GLY A C   
944  O O   . GLY A 133 ? 0.1676 0.2265 0.2388 -0.0252 0.0113  -0.0098 246 GLY A O   
945  N N   . ASP A 134 ? 0.1645 0.2371 0.2490 -0.0391 0.0223  -0.0160 247 ASP A N   
946  C CA  . ASP A 134 ? 0.1758 0.2193 0.2437 -0.0397 0.0297  -0.0144 247 ASP A CA  
947  C C   . ASP A 134 ? 0.1745 0.2138 0.2423 -0.0332 0.0356  -0.0109 247 ASP A C   
948  O O   . ASP A 134 ? 0.1809 0.1980 0.2333 -0.0313 0.0402  -0.0089 247 ASP A O   
949  C CB  . ASP A 134 ? 0.1945 0.2273 0.2565 -0.0534 0.0382  -0.0194 247 ASP A CB  
950  C CG  . ASP A 134 ? 0.2085 0.2340 0.2625 -0.0600 0.0349  -0.0233 247 ASP A CG  
951  O OD1 . ASP A 134 ? 0.2089 0.2216 0.2517 -0.0521 0.0296  -0.0201 247 ASP A OD1 
952  O OD2 . ASP A 134 ? 0.2396 0.2726 0.2980 -0.0739 0.0382  -0.0302 247 ASP A OD2 
953  N N   . TRP A 135 ? 0.1591 0.2193 0.2424 -0.0285 0.0355  -0.0101 248 TRP A N   
954  C CA  . TRP A 135 ? 0.1635 0.2202 0.2471 -0.0238 0.0434  -0.0082 248 TRP A CA  
955  C C   . TRP A 135 ? 0.1630 0.1961 0.2291 -0.0162 0.0433  -0.0047 248 TRP A C   
956  O O   . TRP A 135 ? 0.1635 0.1814 0.2186 -0.0168 0.0503  -0.0042 248 TRP A O   
957  C CB  . TRP A 135 ? 0.1617 0.2439 0.2632 -0.0160 0.0429  -0.0069 248 TRP A CB  
958  C CG  . TRP A 135 ? 0.1702 0.2524 0.2745 -0.0120 0.0529  -0.0060 248 TRP A CG  
959  C CD1 . TRP A 135 ? 0.1789 0.2506 0.2769 -0.0007 0.0557  -0.0026 248 TRP A CD1 
960  C CD2 . TRP A 135 ? 0.1685 0.2613 0.2819 -0.0202 0.0628  -0.0092 248 TRP A CD2 
961  N NE1 . TRP A 135 ? 0.1740 0.2489 0.2763 -0.0001 0.0665  -0.0032 248 TRP A NE1 
962  C CE2 . TRP A 135 ? 0.1727 0.2618 0.2853 -0.0119 0.0709  -0.0070 248 TRP A CE2 
963  C CE3 . TRP A 135 ? 0.1956 0.2990 0.3164 -0.0351 0.0668  -0.0145 248 TRP A CE3 
964  C CZ2 . TRP A 135 ? 0.1956 0.2934 0.3158 -0.0169 0.0827  -0.0092 248 TRP A CZ2 
965  C CZ3 . TRP A 135 ? 0.1973 0.3095 0.3262 -0.0417 0.0789  -0.0171 248 TRP A CZ3 
966  C CH2 . TRP A 135 ? 0.1994 0.3097 0.3285 -0.0321 0.0866  -0.0142 248 TRP A CH2 
967  N N   . ASP A 136 ? 0.1484 0.1797 0.2113 -0.0097 0.0357  -0.0027 249 ASP A N   
968  C CA  . ASP A 136 ? 0.1600 0.1746 0.2090 -0.0042 0.0358  -0.0009 249 ASP A CA  
969  C C   . ASP A 136 ? 0.1671 0.1642 0.1989 -0.0068 0.0366  -0.0013 249 ASP A C   
970  O O   . ASP A 136 ? 0.1610 0.1475 0.1818 -0.0046 0.0403  -0.0011 249 ASP A O   
971  C CB  . ASP A 136 ? 0.1526 0.1679 0.2008 0.0006  0.0289  0.0005  249 ASP A CB  
972  C CG  . ASP A 136 ? 0.1643 0.1885 0.2215 0.0083  0.0305  0.0027  249 ASP A CG  
973  O OD1 . ASP A 136 ? 0.1725 0.2015 0.2356 0.0111  0.0373  0.0029  249 ASP A OD1 
974  O OD2 . ASP A 136 ? 0.1938 0.2189 0.2505 0.0126  0.0260  0.0047  249 ASP A OD2 
975  N N   . LEU A 137 ? 0.1657 0.1600 0.1939 -0.0105 0.0335  -0.0017 250 LEU A N   
976  C CA  . LEU A 137 ? 0.1812 0.1600 0.1921 -0.0094 0.0340  -0.0006 250 LEU A CA  
977  C C   . LEU A 137 ? 0.2002 0.1670 0.2033 -0.0135 0.0424  -0.0004 250 LEU A C   
978  O O   . LEU A 137 ? 0.2171 0.1686 0.2026 -0.0099 0.0454  0.0019  250 LEU A O   
979  C CB  . LEU A 137 ? 0.1751 0.1543 0.1826 -0.0078 0.0265  -0.0005 250 LEU A CB  
980  C CG  . LEU A 137 ? 0.1592 0.1460 0.1694 -0.0046 0.0198  -0.0007 250 LEU A CG  
981  C CD1 . LEU A 137 ? 0.1335 0.1215 0.1399 -0.0032 0.0140  -0.0006 250 LEU A CD1 
982  C CD2 . LEU A 137 ? 0.1629 0.1458 0.1644 -0.0021 0.0210  -0.0011 250 LEU A CD2 
983  N N   . LYS A 138 ? 0.2119 0.1859 0.2268 -0.0213 0.0469  -0.0028 251 LYS A N   
984  C CA  . LYS A 138 ? 0.2275 0.1884 0.2348 -0.0280 0.0577  -0.0034 251 LYS A CA  
985  C C   . LYS A 138 ? 0.2340 0.1944 0.2413 -0.0274 0.0660  -0.0026 251 LYS A C   
986  O O   . LYS A 138 ? 0.2490 0.1911 0.2412 -0.0292 0.0754  -0.0011 251 LYS A O   
987  C CB  . LYS A 138 ? 0.2287 0.1995 0.2485 -0.0398 0.0603  -0.0082 251 LYS A CB  
988  C CG  . LYS A 138 ? 0.2762 0.2267 0.2833 -0.0493 0.0730  -0.0096 251 LYS A CG  
989  C CD  . LYS A 138 ? 0.2963 0.2555 0.3134 -0.0645 0.0758  -0.0164 251 LYS A CD  
990  C CE  . LYS A 138 ? 0.3625 0.3020 0.3686 -0.0773 0.0923  -0.0190 251 LYS A CE  
991  N NZ  . LYS A 138 ? 0.4116 0.3497 0.4193 -0.0952 0.0976  -0.0271 251 LYS A NZ  
992  N N   . VAL A 139 ? 0.2130 0.1914 0.2355 -0.0243 0.0639  -0.0034 252 VAL A N   
993  C CA  . VAL A 139 ? 0.2125 0.1936 0.2387 -0.0249 0.0736  -0.0037 252 VAL A CA  
994  C C   . VAL A 139 ? 0.2161 0.1942 0.2367 -0.0156 0.0721  -0.0021 252 VAL A C   
995  O O   . VAL A 139 ? 0.2348 0.1985 0.2402 -0.0137 0.0787  -0.0011 252 VAL A O   
996  C CB  . VAL A 139 ? 0.2055 0.2140 0.2573 -0.0307 0.0767  -0.0070 252 VAL A CB  
997  C CG1 . VAL A 139 ? 0.1919 0.2066 0.2495 -0.0291 0.0873  -0.0071 252 VAL A CG1 
998  C CG2 . VAL A 139 ? 0.1873 0.1979 0.2427 -0.0442 0.0801  -0.0108 252 VAL A CG2 
999  N N   . MET A 140 ? 0.1971 0.1863 0.2272 -0.0104 0.0646  -0.0021 253 MET A N   
1000 C CA  . MET A 140 ? 0.2004 0.1853 0.2258 -0.0033 0.0659  -0.0019 253 MET A CA  
1001 C C   . MET A 140 ? 0.2045 0.1712 0.2074 -0.0018 0.0636  -0.0020 253 MET A C   
1002 O O   . MET A 140 ? 0.2049 0.1613 0.1956 -0.0005 0.0700  -0.0026 253 MET A O   
1003 C CB  . MET A 140 ? 0.1971 0.1930 0.2339 0.0021  0.0596  -0.0013 253 MET A CB  
1004 C CG  . MET A 140 ? 0.2237 0.2110 0.2545 0.0092  0.0638  -0.0013 253 MET A CG  
1005 S SD  . MET A 140 ? 0.3103 0.3020 0.3475 0.0132  0.0773  -0.0015 253 MET A SD  
1006 C CE  . MET A 140 ? 0.3283 0.2954 0.3444 0.0180  0.0835  -0.0033 253 MET A CE  
1007 N N   . LEU A 141 ? 0.1905 0.1562 0.1886 -0.0019 0.0544  -0.0018 254 LEU A N   
1008 C CA  . LEU A 141 ? 0.2008 0.1572 0.1802 -0.0005 0.0506  -0.0026 254 LEU A CA  
1009 C C   . LEU A 141 ? 0.2112 0.1565 0.1732 0.0003  0.0551  -0.0010 254 LEU A C   
1010 O O   . LEU A 141 ? 0.2316 0.1702 0.1793 0.0018  0.0576  -0.0024 254 LEU A O   
1011 C CB  . LEU A 141 ? 0.1846 0.1467 0.1646 -0.0004 0.0405  -0.0028 254 LEU A CB  
1012 C CG  . LEU A 141 ? 0.1928 0.1542 0.1576 0.0006  0.0352  -0.0047 254 LEU A CG  
1013 C CD1 . LEU A 141 ? 0.1700 0.1286 0.1303 -0.0018 0.0370  -0.0092 254 LEU A CD1 
1014 C CD2 . LEU A 141 ? 0.1765 0.1468 0.1447 0.0010  0.0267  -0.0044 254 LEU A CD2 
1015 N N   . PRO A 142 ? 0.2155 0.1563 0.1757 -0.0007 0.0570  0.0018  255 PRO A N   
1016 C CA  . PRO A 142 ? 0.2385 0.1641 0.1780 0.0018  0.0629  0.0047  255 PRO A CA  
1017 C C   . PRO A 142 ? 0.2527 0.1709 0.1878 0.0000  0.0743  0.0044  255 PRO A C   
1018 O O   . PRO A 142 ? 0.2590 0.1648 0.1727 0.0036  0.0782  0.0063  255 PRO A O   
1019 C CB  . PRO A 142 ? 0.2519 0.1696 0.1904 -0.0001 0.0653  0.0074  255 PRO A CB  
1020 C CG  . PRO A 142 ? 0.2442 0.1760 0.2055 -0.0057 0.0615  0.0047  255 PRO A CG  
1021 C CD  . PRO A 142 ? 0.2077 0.1544 0.1812 -0.0041 0.0546  0.0022  255 PRO A CD  
1022 N N   . GLY A 143 ? 0.2394 0.1671 0.1942 -0.0045 0.0795  0.0023  256 GLY A N   
1023 C CA  . GLY A 143 ? 0.2495 0.1740 0.2039 -0.0059 0.0913  0.0016  256 GLY A CA  
1024 C C   . GLY A 143 ? 0.2576 0.1775 0.2001 -0.0012 0.0913  -0.0004 256 GLY A C   
1025 O O   . GLY A 143 ? 0.2753 0.1825 0.1989 0.0001  0.0982  0.0002  256 GLY A O   
1026 N N   . GLN A 144 ? 0.2455 0.1736 0.1967 0.0006  0.0844  -0.0030 257 GLN A N   
1027 C CA  . GLN A 144 ? 0.2577 0.1786 0.1963 0.0027  0.0857  -0.0065 257 GLN A CA  
1028 C C   . GLN A 144 ? 0.2726 0.1858 0.1867 0.0032  0.0803  -0.0074 257 GLN A C   
1029 O O   . GLN A 144 ? 0.2746 0.1784 0.1708 0.0037  0.0852  -0.0098 257 GLN A O   
1030 C CB  . GLN A 144 ? 0.2444 0.1706 0.1938 0.0038  0.0814  -0.0092 257 GLN A CB  
1031 C CG  . GLN A 144 ? 0.2623 0.1757 0.1980 0.0049  0.0880  -0.0138 257 GLN A CG  
1032 C CD  . GLN A 144 ? 0.2604 0.1717 0.2020 0.0062  0.0868  -0.0160 257 GLN A CD  
1033 O OE1 . GLN A 144 ? 0.2631 0.1847 0.2208 0.0077  0.0813  -0.0132 257 GLN A OE1 
1034 N NE2 . GLN A 144 ? 0.2644 0.1598 0.1902 0.0054  0.0928  -0.0210 257 GLN A NE2 
1035 N N   . CYS A 145 ? 0.2683 0.1874 0.1814 0.0038  0.0702  -0.0057 258 CYS A N   
1036 C CA  . CYS A 145 ? 0.2910 0.2091 0.1826 0.0066  0.0639  -0.0056 258 CYS A CA  
1037 C C   . CYS A 145 ? 0.3185 0.2235 0.1896 0.0104  0.0715  -0.0018 258 CYS A C   
1038 O O   . CYS A 145 ? 0.3333 0.2352 0.1833 0.0125  0.0709  -0.0037 258 CYS A O   
1039 C CB  . CYS A 145 ? 0.2776 0.2054 0.1734 0.0091  0.0537  -0.0030 258 CYS A CB  
1040 S SG  . CYS A 145 ? 0.2850 0.2281 0.1958 0.0045  0.0439  -0.0084 258 CYS A SG  
1041 N N   . GLN A 146 ? 0.3300 0.2267 0.2055 0.0104  0.0793  0.0031  259 GLN A N   
1042 C CA  . GLN A 146 ? 0.3574 0.2371 0.2121 0.0130  0.0896  0.0074  259 GLN A CA  
1043 C C   . GLN A 146 ? 0.3608 0.2346 0.2077 0.0113  0.0987  0.0040  259 GLN A C   
1044 O O   . GLN A 146 ? 0.3717 0.2353 0.1928 0.0152  0.1015  0.0051  259 GLN A O   
1045 C CB  . GLN A 146 ? 0.3651 0.2357 0.2276 0.0095  0.0984  0.0116  259 GLN A CB  
1046 C CG  . GLN A 146 ? 0.4070 0.2569 0.2502 0.0092  0.1134  0.0155  259 GLN A CG  
1047 C CD  . GLN A 146 ? 0.4316 0.2691 0.2781 0.0035  0.1231  0.0187  259 GLN A CD  
1048 O OE1 . GLN A 146 ? 0.4731 0.3186 0.3369 -0.0003 0.1179  0.0176  259 GLN A OE1 
1049 N NE2 . GLN A 146 ? 0.4682 0.2847 0.2965 0.0016  0.1382  0.0221  259 GLN A NE2 
1050 N N   . TYR A 147 ? 0.3542 0.2348 0.2217 0.0068  0.1031  -0.0001 260 TYR A N   
1051 C CA  . TYR A 147 ? 0.3695 0.2440 0.2306 0.0063  0.1128  -0.0038 260 TYR A CA  
1052 C C   . TYR A 147 ? 0.3800 0.2511 0.2188 0.0077  0.1070  -0.0087 260 TYR A C   
1053 O O   . TYR A 147 ? 0.3934 0.2531 0.2115 0.0085  0.1146  -0.0104 260 TYR A O   
1054 C CB  . TYR A 147 ? 0.3598 0.2443 0.2475 0.0046  0.1173  -0.0067 260 TYR A CB  
1055 C CG  . TYR A 147 ? 0.3707 0.2477 0.2518 0.0062  0.1280  -0.0107 260 TYR A CG  
1056 C CD1 . TYR A 147 ? 0.4083 0.2785 0.2846 0.0063  0.1427  -0.0094 260 TYR A CD1 
1057 C CD2 . TYR A 147 ? 0.3777 0.2520 0.2558 0.0070  0.1251  -0.0161 260 TYR A CD2 
1058 C CE1 . TYR A 147 ? 0.4088 0.2712 0.2781 0.0088  0.1536  -0.0132 260 TYR A CE1 
1059 C CE2 . TYR A 147 ? 0.3965 0.2596 0.2656 0.0090  0.1364  -0.0202 260 TYR A CE2 
1060 C CZ  . TYR A 147 ? 0.4234 0.2813 0.2884 0.0106  0.1504  -0.0186 260 TYR A CZ  
1061 O OH  . TYR A 147 ? 0.4606 0.3065 0.3159 0.0137  0.1627  -0.0228 260 TYR A OH  
1062 N N   . LEU A 148 ? 0.3641 0.2459 0.2067 0.0067  0.0940  -0.0116 261 LEU A N   
1063 C CA  . LEU A 148 ? 0.3847 0.2682 0.2098 0.0044  0.0877  -0.0186 261 LEU A CA  
1064 C C   . LEU A 148 ? 0.4005 0.2888 0.2018 0.0085  0.0792  -0.0169 261 LEU A C   
1065 O O   . LEU A 148 ? 0.4118 0.3058 0.1964 0.0059  0.0733  -0.0234 261 LEU A O   
1066 C CB  . LEU A 148 ? 0.3629 0.2568 0.2039 -0.0004 0.0793  -0.0235 261 LEU A CB  
1067 C CG  . LEU A 148 ? 0.3668 0.2544 0.2246 -0.0022 0.0874  -0.0259 261 LEU A CG  
1068 C CD1 . LEU A 148 ? 0.3312 0.2259 0.2007 -0.0064 0.0794  -0.0293 261 LEU A CD1 
1069 C CD2 . LEU A 148 ? 0.3781 0.2492 0.2196 -0.0035 0.0990  -0.0316 261 LEU A CD2 
1070 N N   . GLY A 149 ? 0.4069 0.2928 0.2053 0.0151  0.0792  -0.0084 262 GLY A N   
1071 C CA  . GLY A 149 ? 0.4325 0.3238 0.2094 0.0230  0.0708  -0.0045 262 GLY A CA  
1072 C C   . GLY A 149 ? 0.4235 0.3377 0.2093 0.0236  0.0556  -0.0069 262 GLY A C   
1073 O O   . GLY A 149 ? 0.4446 0.3719 0.2133 0.0295  0.0466  -0.0069 262 GLY A O   
1074 N N   . LEU A 150 ? 0.4047 0.3258 0.2169 0.0181  0.0528  -0.0088 263 LEU A N   
1075 C CA  . LEU A 150 ? 0.3921 0.3345 0.2148 0.0174  0.0402  -0.0114 263 LEU A CA  
1076 C C   . LEU A 150 ? 0.3911 0.3348 0.2213 0.0255  0.0373  -0.0032 263 LEU A C   
1077 O O   . LEU A 150 ? 0.3890 0.3186 0.2298 0.0250  0.0450  0.0013  263 LEU A O   
1078 C CB  . LEU A 150 ? 0.3703 0.3166 0.2146 0.0070  0.0398  -0.0180 263 LEU A CB  
1079 C CG  . LEU A 150 ? 0.3914 0.3310 0.2301 -0.0022 0.0448  -0.0271 263 LEU A CG  
1080 C CD1 . LEU A 150 ? 0.3642 0.3029 0.2235 -0.0093 0.0458  -0.0307 263 LEU A CD1 
1081 C CD2 . LEU A 150 ? 0.4122 0.3647 0.2306 -0.0060 0.0379  -0.0347 263 LEU A CD2 
1082 N N   . PRO A 151 ? 0.3987 0.3608 0.2237 0.0326  0.0267  -0.0018 264 PRO A N   
1083 C CA  . PRO A 151 ? 0.3959 0.3574 0.2283 0.0404  0.0249  0.0053  264 PRO A CA  
1084 C C   . PRO A 151 ? 0.3700 0.3366 0.2295 0.0319  0.0232  0.0021  264 PRO A C   
1085 O O   . PRO A 151 ? 0.3719 0.3481 0.2427 0.0221  0.0205  -0.0054 264 PRO A O   
1086 C CB  . PRO A 151 ? 0.4103 0.3955 0.2317 0.0511  0.0136  0.0064  264 PRO A CB  
1087 C CG  . PRO A 151 ? 0.4123 0.4193 0.2321 0.0420  0.0068  -0.0039 264 PRO A CG  
1088 C CD  . PRO A 151 ? 0.4157 0.4017 0.2278 0.0340  0.0164  -0.0070 264 PRO A CD  
1089 N N   . VAL A 152 ? 0.3617 0.3193 0.2286 0.0356  0.0258  0.0076  265 VAL A N   
1090 C CA  . VAL A 152 ? 0.3351 0.2984 0.2249 0.0293  0.0233  0.0054  265 VAL A CA  
1091 C C   . VAL A 152 ? 0.3246 0.3041 0.2152 0.0367  0.0147  0.0069  265 VAL A C   
1092 O O   . VAL A 152 ? 0.3389 0.3109 0.2172 0.0479  0.0160  0.0134  265 VAL A O   
1093 C CB  . VAL A 152 ? 0.3375 0.2824 0.2351 0.0268  0.0319  0.0090  265 VAL A CB  
1094 C CG1 . VAL A 152 ? 0.3085 0.2617 0.2285 0.0206  0.0284  0.0065  265 VAL A CG1 
1095 C CG2 . VAL A 152 ? 0.3484 0.2805 0.2448 0.0212  0.0417  0.0082  265 VAL A CG2 
1096 N N   . ALA A 153 ? 0.3009 0.3014 0.2041 0.0310  0.0072  0.0010  266 ALA A N   
1097 C CA  . ALA A 153 ? 0.2979 0.3182 0.2043 0.0376  -0.0005 0.0018  266 ALA A CA  
1098 C C   . ALA A 153 ? 0.2879 0.2948 0.1986 0.0433  0.0029  0.0076  266 ALA A C   
1099 O O   . ALA A 153 ? 0.2760 0.2671 0.1959 0.0363  0.0082  0.0076  266 ALA A O   
1100 C CB  . ALA A 153 ? 0.2753 0.3169 0.1965 0.0268  -0.0063 -0.0062 266 ALA A CB  
1101 N N   . ASP A 154 ? 0.2985 0.3122 0.2010 0.0566  0.0000  0.0122  267 ASP A N   
1102 C CA  . ASP A 154 ? 0.3077 0.3047 0.2088 0.0632  0.0046  0.0173  267 ASP A CA  
1103 C C   . ASP A 154 ? 0.2725 0.2714 0.1932 0.0530  0.0039  0.0134  267 ASP A C   
1104 O O   . ASP A 154 ? 0.2723 0.2513 0.1934 0.0512  0.0097  0.0153  267 ASP A O   
1105 C CB  . ASP A 154 ? 0.3382 0.3447 0.2265 0.0818  0.0017  0.0229  267 ASP A CB  
1106 C CG  . ASP A 154 ? 0.4133 0.4062 0.2753 0.0963  0.0056  0.0302  267 ASP A CG  
1107 O OD1 . ASP A 154 ? 0.4779 0.4519 0.3311 0.0906  0.0115  0.0308  267 ASP A OD1 
1108 O OD2 . ASP A 154 ? 0.5069 0.5085 0.3561 0.1148  0.0033  0.0360  267 ASP A OD2 
1109 N N   . TYR A 155 ? 0.2523 0.2741 0.1876 0.0454  -0.0026 0.0076  268 TYR A N   
1110 C CA  . TYR A 155 ? 0.2382 0.2608 0.1894 0.0367  -0.0031 0.0046  268 TYR A CA  
1111 C C   . TYR A 155 ? 0.2303 0.2359 0.1890 0.0263  0.0017  0.0035  268 TYR A C   
1112 O O   . TYR A 155 ? 0.2246 0.2279 0.1930 0.0217  0.0019  0.0026  268 TYR A O   
1113 C CB  . TYR A 155 ? 0.2222 0.2701 0.1847 0.0304  -0.0091 -0.0010 268 TYR A CB  
1114 C CG  . TYR A 155 ? 0.2220 0.2812 0.1836 0.0228  -0.0113 -0.0063 268 TYR A CG  
1115 C CD1 . TYR A 155 ? 0.2166 0.3008 0.1734 0.0264  -0.0168 -0.0089 268 TYR A CD1 
1116 C CD2 . TYR A 155 ? 0.2116 0.2582 0.1767 0.0121  -0.0077 -0.0093 268 TYR A CD2 
1117 C CE1 . TYR A 155 ? 0.2246 0.3191 0.1788 0.0171  -0.0185 -0.0156 268 TYR A CE1 
1118 C CE2 . TYR A 155 ? 0.2117 0.2647 0.1730 0.0043  -0.0081 -0.0152 268 TYR A CE2 
1119 C CZ  . TYR A 155 ? 0.2257 0.3020 0.1812 0.0054  -0.0135 -0.0190 268 TYR A CZ  
1120 O OH  . TYR A 155 ? 0.2318 0.3145 0.1817 -0.0046 -0.0137 -0.0266 268 TYR A OH  
1121 N N   . PHE A 156 ? 0.2341 0.2303 0.1884 0.0233  0.0056  0.0035  269 PHE A N   
1122 C CA  . PHE A 156 ? 0.2287 0.2127 0.1906 0.0158  0.0108  0.0029  269 PHE A CA  
1123 C C   . PHE A 156 ? 0.2465 0.2126 0.2035 0.0168  0.0175  0.0061  269 PHE A C   
1124 O O   . PHE A 156 ? 0.2437 0.2039 0.2081 0.0099  0.0222  0.0051  269 PHE A O   
1125 C CB  . PHE A 156 ? 0.2283 0.2095 0.1872 0.0125  0.0140  0.0013  269 PHE A CB  
1126 C CG  . PHE A 156 ? 0.2174 0.2097 0.1809 0.0073  0.0105  -0.0035 269 PHE A CG  
1127 C CD1 . PHE A 156 ? 0.2482 0.2452 0.2011 0.0072  0.0096  -0.0063 269 PHE A CD1 
1128 C CD2 . PHE A 156 ? 0.2003 0.1964 0.1762 0.0021  0.0091  -0.0055 269 PHE A CD2 
1129 C CE1 . PHE A 156 ? 0.2316 0.2354 0.1864 -0.0003 0.0081  -0.0123 269 PHE A CE1 
1130 C CE2 . PHE A 156 ? 0.2105 0.2109 0.1871 -0.0036 0.0084  -0.0101 269 PHE A CE2 
1131 C CZ  . PHE A 156 ? 0.1927 0.1962 0.1588 -0.0058 0.0084  -0.0140 269 PHE A CZ  
1132 N N   . LYS A 157 ? 0.2607 0.2178 0.2041 0.0252  0.0191  0.0097  270 LYS A N   
1133 C CA  . LYS A 157 ? 0.2824 0.2161 0.2149 0.0251  0.0283  0.0125  270 LYS A CA  
1134 C C   . LYS A 157 ? 0.2812 0.2066 0.2161 0.0222  0.0302  0.0114  270 LYS A C   
1135 O O   . LYS A 157 ? 0.3069 0.2107 0.2321 0.0192  0.0391  0.0121  270 LYS A O   
1136 C CB  . LYS A 157 ? 0.3114 0.2320 0.2206 0.0374  0.0322  0.0181  270 LYS A CB  
1137 C CG  . LYS A 157 ? 0.3293 0.2538 0.2326 0.0384  0.0323  0.0186  270 LYS A CG  
1138 C CD  . LYS A 157 ? 0.3501 0.2643 0.2281 0.0528  0.0348  0.0250  270 LYS A CD  
1139 C CE  . LYS A 157 ? 0.3784 0.2979 0.2493 0.0528  0.0344  0.0246  270 LYS A CE  
1140 N NZ  . LYS A 157 ? 0.4231 0.3403 0.2689 0.0689  0.0336  0.0308  270 LYS A NZ  
1141 N N   . GLN A 158 ? 0.2666 0.2075 0.2125 0.0220  0.0229  0.0091  271 GLN A N   
1142 C CA  . GLN A 158 ? 0.2702 0.2058 0.2190 0.0180  0.0237  0.0069  271 GLN A CA  
1143 C C   . GLN A 158 ? 0.2389 0.1936 0.2071 0.0097  0.0170  0.0030  271 GLN A C   
1144 O O   . GLN A 158 ? 0.2333 0.2040 0.2085 0.0116  0.0111  0.0029  271 GLN A O   
1145 C CB  . GLN A 158 ? 0.2930 0.2275 0.2321 0.0294  0.0222  0.0092  271 GLN A CB  
1146 C CG  . GLN A 158 ? 0.3696 0.2897 0.2873 0.0440  0.0271  0.0152  271 GLN A CG  
1147 C CD  . GLN A 158 ? 0.4033 0.3453 0.3213 0.0532  0.0202  0.0175  271 GLN A CD  
1148 O OE1 . GLN A 158 ? 0.4394 0.4064 0.3728 0.0487  0.0123  0.0140  271 GLN A OE1 
1149 N NE2 . GLN A 158 ? 0.4295 0.3613 0.3283 0.0660  0.0239  0.0232  271 GLN A NE2 
1150 N N   . TRP A 159 ? 0.2205 0.1736 0.1960 0.0005  0.0184  -0.0002 272 TRP A N   
1151 C CA  . TRP A 159 ? 0.1975 0.1678 0.1886 -0.0048 0.0123  -0.0027 272 TRP A CA  
1152 C C   . TRP A 159 ? 0.1909 0.1606 0.1849 -0.0125 0.0125  -0.0065 272 TRP A C   
1153 O O   . TRP A 159 ? 0.1918 0.1460 0.1764 -0.0167 0.0187  -0.0086 272 TRP A O   
1154 C CB  . TRP A 159 ? 0.1868 0.1671 0.1891 -0.0077 0.0120  -0.0026 272 TRP A CB  
1155 C CG  . TRP A 159 ? 0.1981 0.1751 0.2040 -0.0146 0.0180  -0.0042 272 TRP A CG  
1156 C CD1 . TRP A 159 ? 0.1929 0.1814 0.2109 -0.0224 0.0175  -0.0075 272 TRP A CD1 
1157 C CD2 . TRP A 159 ? 0.2051 0.1691 0.2026 -0.0150 0.0259  -0.0030 272 TRP A CD2 
1158 N NE1 . TRP A 159 ? 0.1965 0.1818 0.2163 -0.0288 0.0251  -0.0092 272 TRP A NE1 
1159 C CE2 . TRP A 159 ? 0.2108 0.1786 0.2171 -0.0246 0.0310  -0.0062 272 TRP A CE2 
1160 C CE3 . TRP A 159 ? 0.2167 0.1676 0.1992 -0.0079 0.0292  0.0004  272 TRP A CE3 
1161 C CZ2 . TRP A 159 ? 0.2370 0.1931 0.2373 -0.0286 0.0408  -0.0061 272 TRP A CZ2 
1162 C CZ3 . TRP A 159 ? 0.2412 0.1786 0.2154 -0.0101 0.0383  0.0015  272 TRP A CZ3 
1163 C CH2 . TRP A 159 ? 0.2491 0.1876 0.2321 -0.0210 0.0447  -0.0018 272 TRP A CH2 
1164 N N   . ILE A 160 ? 0.1767 0.1623 0.1816 -0.0144 0.0061  -0.0076 273 ILE A N   
1165 C CA  . ILE A 160 ? 0.1755 0.1679 0.1850 -0.0216 0.0039  -0.0115 273 ILE A CA  
1166 C C   . ILE A 160 ? 0.1589 0.1697 0.1834 -0.0250 0.0012  -0.0120 273 ILE A C   
1167 O O   . ILE A 160 ? 0.1467 0.1667 0.1775 -0.0194 -0.0023 -0.0087 273 ILE A O   
1168 C CB  . ILE A 160 ? 0.1687 0.1663 0.1762 -0.0183 -0.0017 -0.0113 273 ILE A CB  
1169 C CG1 . ILE A 160 ? 0.1878 0.1716 0.1822 -0.0121 0.0011  -0.0103 273 ILE A CG1 
1170 C CG2 . ILE A 160 ? 0.1730 0.1778 0.1823 -0.0258 -0.0044 -0.0159 273 ILE A CG2 
1171 C CD1 . ILE A 160 ? 0.1625 0.1511 0.1545 -0.0094 -0.0025 -0.0105 273 ILE A CD1 
1172 N N   . ASN A 161 ? 0.1623 0.1783 0.1919 -0.0341 0.0038  -0.0163 274 ASN A N   
1173 C CA  . ASN A 161 ? 0.1582 0.1986 0.2039 -0.0368 0.0006  -0.0175 274 ASN A CA  
1174 C C   . ASN A 161 ? 0.1553 0.2113 0.2035 -0.0373 -0.0075 -0.0193 274 ASN A C   
1175 O O   . ASN A 161 ? 0.1583 0.2140 0.2019 -0.0465 -0.0077 -0.0252 274 ASN A O   
1176 C CB  . ASN A 161 ? 0.1617 0.2057 0.2126 -0.0484 0.0072  -0.0229 274 ASN A CB  
1177 C CG  . ASN A 161 ? 0.1526 0.2282 0.2227 -0.0508 0.0040  -0.0247 274 ASN A CG  
1178 O OD1 . ASN A 161 ? 0.1742 0.2678 0.2517 -0.0428 -0.0036 -0.0217 274 ASN A OD1 
1179 N ND2 . ASN A 161 ? 0.1502 0.2332 0.2278 -0.0614 0.0106  -0.0295 274 ASN A ND2 
1180 N N   . LEU A 162 ? 0.1500 0.2170 0.2029 -0.0278 -0.0131 -0.0142 275 LEU A N   
1181 C CA  . LEU A 162 ? 0.1590 0.2400 0.2117 -0.0258 -0.0206 -0.0142 275 LEU A CA  
1182 C C   . LEU A 162 ? 0.1693 0.2764 0.2318 -0.0335 -0.0246 -0.0199 275 LEU A C   
1183 O O   . LEU A 162 ? 0.1742 0.2888 0.2314 -0.0373 -0.0299 -0.0234 275 LEU A O   
1184 C CB  . LEU A 162 ? 0.1581 0.2433 0.2122 -0.0132 -0.0235 -0.0067 275 LEU A CB  
1185 C CG  . LEU A 162 ? 0.1477 0.2439 0.1976 -0.0084 -0.0305 -0.0047 275 LEU A CG  
1186 C CD1 . LEU A 162 ? 0.1537 0.2340 0.1894 -0.0111 -0.0309 -0.0061 275 LEU A CD1 
1187 C CD2 . LEU A 162 ? 0.1583 0.2554 0.2080 0.0050  -0.0307 0.0035  275 LEU A CD2 
1188 N N   . LYS A 163 ? 0.1663 0.2895 0.2429 -0.0365 -0.0219 -0.0215 276 LYS A N   
1189 C CA  . LYS A 163 ? 0.1770 0.3317 0.2658 -0.0456 -0.0256 -0.0282 276 LYS A CA  
1190 C C   . LYS A 163 ? 0.1906 0.3356 0.2700 -0.0629 -0.0231 -0.0381 276 LYS A C   
1191 O O   . LYS A 163 ? 0.1886 0.3553 0.2701 -0.0707 -0.0291 -0.0445 276 LYS A O   
1192 C CB  . LYS A 163 ? 0.1743 0.3492 0.2812 -0.0467 -0.0213 -0.0288 276 LYS A CB  
1193 C CG  . LYS A 163 ? 0.1848 0.3722 0.3003 -0.0283 -0.0234 -0.0196 276 LYS A CG  
1194 C CD  . LYS A 163 ? 0.1793 0.3775 0.3094 -0.0270 -0.0162 -0.0190 276 LYS A CD  
1195 C CE  . LYS A 163 ? 0.2045 0.4435 0.3543 -0.0360 -0.0175 -0.0260 276 LYS A CE  
1196 N NZ  . LYS A 163 ? 0.2000 0.4525 0.3652 -0.0326 -0.0097 -0.0247 276 LYS A NZ  
1197 N N   . LYS A 164 ? 0.1990 0.3105 0.2659 -0.0677 -0.0141 -0.0390 277 LYS A N   
1198 C CA  . LYS A 164 ? 0.2272 0.3196 0.2802 -0.0824 -0.0085 -0.0476 277 LYS A CA  
1199 C C   . LYS A 164 ? 0.2313 0.3108 0.2685 -0.0792 -0.0129 -0.0478 277 LYS A C   
1200 O O   . LYS A 164 ? 0.2346 0.3160 0.2644 -0.0912 -0.0137 -0.0565 277 LYS A O   
1201 C CB  . LYS A 164 ? 0.2429 0.3016 0.2850 -0.0852 0.0039  -0.0468 277 LYS A CB  
1202 C CG  . LYS A 164 ? 0.2660 0.3334 0.3195 -0.0944 0.0114  -0.0497 277 LYS A CG  
1203 C CD  . LYS A 164 ? 0.2782 0.3099 0.3176 -0.0931 0.0234  -0.0463 277 LYS A CD  
1204 C CE  . LYS A 164 ? 0.3066 0.3425 0.3537 -0.1054 0.0336  -0.0504 277 LYS A CE  
1205 N NZ  . LYS A 164 ? 0.3296 0.3313 0.3615 -0.1008 0.0451  -0.0450 277 LYS A NZ  
1206 N N   . ALA A 165 ? 0.2202 0.2875 0.2518 -0.0643 -0.0151 -0.0392 278 ALA A N   
1207 C CA  . ALA A 165 ? 0.2304 0.2898 0.2492 -0.0599 -0.0191 -0.0386 278 ALA A CA  
1208 C C   . ALA A 165 ? 0.2370 0.3242 0.2596 -0.0629 -0.0287 -0.0421 278 ALA A C   
1209 O O   . ALA A 165 ? 0.2529 0.3375 0.2642 -0.0712 -0.0298 -0.0491 278 ALA A O   
1210 C CB  . ALA A 165 ? 0.2130 0.2633 0.2296 -0.0449 -0.0202 -0.0292 278 ALA A CB  
1211 N N   . TYR A 166 ? 0.2299 0.3436 0.2671 -0.0554 -0.0350 -0.0372 279 TYR A N   
1212 C CA  . TYR A 166 ? 0.2391 0.3848 0.2813 -0.0544 -0.0449 -0.0386 279 TYR A CA  
1213 C C   . TYR A 166 ? 0.2571 0.4229 0.3023 -0.0722 -0.0468 -0.0509 279 TYR A C   
1214 O O   . TYR A 166 ? 0.2589 0.4375 0.2963 -0.0761 -0.0536 -0.0557 279 TYR A O   
1215 C CB  . TYR A 166 ? 0.2230 0.3923 0.2811 -0.0417 -0.0488 -0.0308 279 TYR A CB  
1216 C CG  . TYR A 166 ? 0.2228 0.4264 0.2851 -0.0353 -0.0593 -0.0295 279 TYR A CG  
1217 C CD1 . TYR A 166 ? 0.2184 0.4180 0.2697 -0.0202 -0.0639 -0.0207 279 TYR A CD1 
1218 C CD2 . TYR A 166 ? 0.2287 0.4706 0.3052 -0.0439 -0.0644 -0.0370 279 TYR A CD2 
1219 C CE1 . TYR A 166 ? 0.2392 0.4697 0.2914 -0.0113 -0.0736 -0.0179 279 TYR A CE1 
1220 C CE2 . TYR A 166 ? 0.2391 0.5181 0.3195 -0.0356 -0.0754 -0.0353 279 TYR A CE2 
1221 C CZ  . TYR A 166 ? 0.2365 0.5083 0.3034 -0.0180 -0.0801 -0.0250 279 TYR A CZ  
1222 O OH  . TYR A 166 ? 0.2431 0.5500 0.3106 -0.0071 -0.0908 -0.0218 279 TYR A OH  
1223 N N   . SER A 167 ? 0.2724 0.4410 0.3276 -0.0841 -0.0403 -0.0568 280 SER A N   
1224 C CA  . SER A 167 ? 0.3027 0.4906 0.3611 -0.1048 -0.0403 -0.0704 280 SER A CA  
1225 C C   . SER A 167 ? 0.3309 0.4901 0.3664 -0.1180 -0.0356 -0.0794 280 SER A C   
1226 O O   . SER A 167 ? 0.3327 0.5100 0.3648 -0.1322 -0.0399 -0.0902 280 SER A O   
1227 C CB  . SER A 167 ? 0.3038 0.4966 0.3759 -0.1165 -0.0315 -0.0750 280 SER A CB  
1228 O OG  . SER A 167 ? 0.3510 0.5003 0.4068 -0.1261 -0.0184 -0.0784 280 SER A OG  
1229 N N   . PHE A 168 ? 0.3535 0.4694 0.3728 -0.1127 -0.0269 -0.0750 281 PHE A N   
1230 C CA  . PHE A 168 ? 0.3897 0.4740 0.3848 -0.1198 -0.0213 -0.0814 281 PHE A CA  
1231 C C   . PHE A 168 ? 0.3928 0.4876 0.3788 -0.1133 -0.0312 -0.0806 281 PHE A C   
1232 O O   . PHE A 168 ? 0.4113 0.5048 0.3837 -0.1259 -0.0317 -0.0910 281 PHE A O   
1233 C CB  . PHE A 168 ? 0.4043 0.4454 0.3857 -0.1097 -0.0109 -0.0744 281 PHE A CB  
1234 C CG  . PHE A 168 ? 0.4227 0.4417 0.4030 -0.1166 0.0016  -0.0757 281 PHE A CG  
1235 C CD1 . PHE A 168 ? 0.4188 0.4167 0.3975 -0.1023 0.0069  -0.0656 281 PHE A CD1 
1236 C CD2 . PHE A 168 ? 0.4643 0.4822 0.4428 -0.1381 0.0089  -0.0875 281 PHE A CD2 
1237 C CE1 . PHE A 168 ? 0.4554 0.4306 0.4294 -0.1067 0.0187  -0.0656 281 PHE A CE1 
1238 C CE2 . PHE A 168 ? 0.4736 0.4668 0.4479 -0.1443 0.0223  -0.0880 281 PHE A CE2 
1239 C CZ  . PHE A 168 ? 0.4746 0.4454 0.4456 -0.1275 0.0271  -0.0764 281 PHE A CZ  
1240 N N   . ALA A 169 ? 0.3766 0.4792 0.3679 -0.0944 -0.0378 -0.0687 282 ALA A N   
1241 C CA  . ALA A 169 ? 0.3835 0.4953 0.3653 -0.0864 -0.0462 -0.0660 282 ALA A CA  
1242 C C   . ALA A 169 ? 0.3923 0.5452 0.3798 -0.0922 -0.0580 -0.0717 282 ALA A C   
1243 O O   . ALA A 169 ? 0.4105 0.5672 0.3833 -0.0953 -0.0628 -0.0764 282 ALA A O   
1244 C CB  . ALA A 169 ? 0.3620 0.4700 0.3473 -0.0665 -0.0483 -0.0520 282 ALA A CB  
1245 N N   . MET A 170 ? 0.3860 0.5715 0.3945 -0.0933 -0.0624 -0.0716 283 MET A N   
1246 C CA  . MET A 170 ? 0.3917 0.6239 0.4086 -0.0935 -0.0751 -0.0744 283 MET A CA  
1247 C C   . MET A 170 ? 0.4072 0.6673 0.4333 -0.1165 -0.0760 -0.0900 283 MET A C   
1248 O O   . MET A 170 ? 0.4192 0.7235 0.4518 -0.1195 -0.0873 -0.0951 283 MET A O   
1249 C CB  . MET A 170 ? 0.3737 0.6297 0.4083 -0.0736 -0.0805 -0.0615 283 MET A CB  
1250 C CG  . MET A 170 ? 0.3722 0.6022 0.3962 -0.0531 -0.0792 -0.0472 283 MET A CG  
1251 S SD  . MET A 170 ? 0.3988 0.6299 0.4000 -0.0443 -0.0874 -0.0438 283 MET A SD  
1252 C CE  . MET A 170 ? 0.3235 0.6116 0.3367 -0.0354 -0.1018 -0.0420 283 MET A CE  
1253 N N   . GLY A 171 ? 0.4165 0.6514 0.4418 -0.1328 -0.0636 -0.0978 284 GLY A N   
1254 C CA  . GLY A 171 ? 0.4341 0.6887 0.4662 -0.1585 -0.0608 -0.1138 284 GLY A CA  
1255 C C   . GLY A 171 ? 0.4231 0.7288 0.4848 -0.1578 -0.0668 -0.1134 284 GLY A C   
1256 O O   . GLY A 171 ? 0.4354 0.7838 0.5078 -0.1741 -0.0725 -0.1257 284 GLY A O   
1257 N N   . CYS A 172 ? 0.4086 0.7115 0.4839 -0.1392 -0.0649 -0.0999 285 CYS A N   
1258 C CA  . CYS A 172 ? 0.3912 0.7434 0.4933 -0.1305 -0.0718 -0.0959 285 CYS A CA  
1259 C C   . CYS A 172 ? 0.3681 0.7027 0.4806 -0.1142 -0.0645 -0.0831 285 CYS A C   
1260 O O   . CYS A 172 ? 0.3569 0.6606 0.4584 -0.0961 -0.0635 -0.0709 285 CYS A O   
1261 C CB  . CYS A 172 ? 0.3929 0.7788 0.4946 -0.1122 -0.0873 -0.0890 285 CYS A CB  
1262 S SG  . CYS A 172 ? 0.4083 0.8565 0.5397 -0.0965 -0.0964 -0.0829 285 CYS A SG  
1263 N N   . TRP A 173 ? 0.3569 0.7127 0.4901 -0.1219 -0.0590 -0.0866 286 TRP A N   
1264 C CA  . TRP A 173 ? 0.3410 0.6808 0.4832 -0.1092 -0.0509 -0.0764 286 TRP A CA  
1265 C C   . TRP A 173 ? 0.3237 0.6945 0.4803 -0.0836 -0.0592 -0.0642 286 TRP A C   
1266 O O   . TRP A 173 ? 0.3179 0.7411 0.4936 -0.0823 -0.0666 -0.0671 286 TRP A O   
1267 C CB  . TRP A 173 ? 0.3454 0.6941 0.5023 -0.1279 -0.0398 -0.0852 286 TRP A CB  
1268 C CG  . TRP A 173 ? 0.3324 0.6591 0.4941 -0.1162 -0.0304 -0.0755 286 TRP A CG  
1269 C CD1 . TRP A 173 ? 0.3182 0.6746 0.5017 -0.1059 -0.0295 -0.0706 286 TRP A CD1 
1270 C CD2 . TRP A 173 ? 0.3233 0.5950 0.4663 -0.1121 -0.0208 -0.0694 286 TRP A CD2 
1271 N NE1 . TRP A 173 ? 0.3162 0.6365 0.4942 -0.0972 -0.0195 -0.0625 286 TRP A NE1 
1272 C CE2 . TRP A 173 ? 0.3202 0.5902 0.4738 -0.1009 -0.0147 -0.0616 286 TRP A CE2 
1273 C CE3 . TRP A 173 ? 0.3386 0.5641 0.4567 -0.1161 -0.0166 -0.0699 286 TRP A CE3 
1274 C CZ2 . TRP A 173 ? 0.3247 0.5499 0.4641 -0.0948 -0.0057 -0.0549 286 TRP A CZ2 
1275 C CZ3 . TRP A 173 ? 0.3414 0.5251 0.4472 -0.1081 -0.0078 -0.0623 286 TRP A CZ3 
1276 C CH2 . TRP A 173 ? 0.3283 0.5130 0.4446 -0.0983 -0.0030 -0.0553 286 TRP A CH2 
1277 N N   . PRO A 174 ? 0.3153 0.6540 0.4621 -0.0633 -0.0571 -0.0507 287 PRO A N   
1278 C CA  . PRO A 174 ? 0.3085 0.6674 0.4648 -0.0386 -0.0618 -0.0388 287 PRO A CA  
1279 C C   . PRO A 174 ? 0.2988 0.6679 0.4739 -0.0349 -0.0534 -0.0365 287 PRO A C   
1280 O O   . PRO A 174 ? 0.2870 0.6207 0.4557 -0.0276 -0.0449 -0.0297 287 PRO A O   
1281 C CB  . PRO A 174 ? 0.3005 0.6148 0.4354 -0.0238 -0.0603 -0.0279 287 PRO A CB  
1282 C CG  . PRO A 174 ? 0.3028 0.5748 0.4258 -0.0383 -0.0510 -0.0325 287 PRO A CG  
1283 C CD  . PRO A 174 ? 0.3134 0.5969 0.4393 -0.0620 -0.0499 -0.0464 287 PRO A CD  
1284 N N   . LYS A 175 ? 0.3043 0.7238 0.5025 -0.0403 -0.0558 -0.0427 288 LYS A N   
1285 C CA  . LYS A 175 ? 0.2991 0.7314 0.5166 -0.0383 -0.0465 -0.0417 288 LYS A CA  
1286 C C   . LYS A 175 ? 0.2934 0.7132 0.5092 -0.0102 -0.0442 -0.0271 288 LYS A C   
1287 O O   . LYS A 175 ? 0.2938 0.6876 0.5093 -0.0081 -0.0331 -0.0238 288 LYS A O   
1288 C CB  . LYS A 175 ? 0.3036 0.7999 0.5491 -0.0481 -0.0496 -0.0512 288 LYS A CB  
1289 C CG  . LYS A 175 ? 0.3136 0.8642 0.5691 -0.0337 -0.0646 -0.0491 288 LYS A CG  
1290 C CD  . LYS A 175 ? 0.3117 0.9302 0.6000 -0.0342 -0.0658 -0.0543 288 LYS A CD  
1291 C CE  . LYS A 175 ? 0.3232 1.0018 0.6205 -0.0208 -0.0826 -0.0535 288 LYS A CE  
1292 N NZ  . LYS A 175 ? 0.3289 1.0771 0.6589 -0.0115 -0.0845 -0.0544 288 LYS A NZ  
1293 N N   . ASN A 176 ? 0.2910 0.7236 0.5016 0.0109  -0.0536 -0.0182 289 ASN A N   
1294 C CA  . ASN A 176 ? 0.2905 0.7069 0.4956 0.0380  -0.0499 -0.0043 289 ASN A CA  
1295 C C   . ASN A 176 ? 0.2825 0.6387 0.4607 0.0429  -0.0454 0.0028  289 ASN A C   
1296 O O   . ASN A 176 ? 0.2933 0.6330 0.4607 0.0641  -0.0439 0.0139  289 ASN A O   
1297 C CB  . ASN A 176 ? 0.3047 0.7612 0.5146 0.0616  -0.0599 0.0035  289 ASN A CB  
1298 C CG  . ASN A 176 ? 0.3221 0.8472 0.5599 0.0564  -0.0666 -0.0044 289 ASN A CG  
1299 O OD1 . ASN A 176 ? 0.3481 0.8921 0.6062 0.0436  -0.0596 -0.0120 289 ASN A OD1 
1300 N ND2 . ASN A 176 ? 0.3549 0.9199 0.5936 0.0657  -0.0802 -0.0033 289 ASN A ND2 
1301 N N   . GLY A 177 ? 0.2673 0.5921 0.4347 0.0234  -0.0426 -0.0039 290 GLY A N   
1302 C CA  . GLY A 177 ? 0.2567 0.5297 0.4021 0.0249  -0.0377 0.0008  290 GLY A CA  
1303 C C   . GLY A 177 ? 0.2525 0.5103 0.3795 0.0378  -0.0433 0.0085  290 GLY A C   
1304 O O   . GLY A 177 ? 0.2451 0.5202 0.3687 0.0359  -0.0523 0.0064  290 GLY A O   
1305 N N   . LEU A 178 ? 0.2498 0.4742 0.3634 0.0499  -0.0369 0.0167  291 LEU A N   
1306 C CA  . LEU A 178 ? 0.2608 0.4641 0.3544 0.0608  -0.0390 0.0243  291 LEU A CA  
1307 C C   . LEU A 178 ? 0.2692 0.5015 0.3620 0.0766  -0.0475 0.0302  291 LEU A C   
1308 O O   . LEU A 178 ? 0.2687 0.4950 0.3466 0.0782  -0.0529 0.0323  291 LEU A O   
1309 C CB  . LEU A 178 ? 0.2668 0.4330 0.3477 0.0709  -0.0288 0.0315  291 LEU A CB  
1310 C CG  . LEU A 178 ? 0.2576 0.3914 0.3323 0.0572  -0.0218 0.0269  291 LEU A CG  
1311 C CD1 . LEU A 178 ? 0.2517 0.3536 0.3136 0.0663  -0.0121 0.0327  291 LEU A CD1 
1312 C CD2 . LEU A 178 ? 0.2463 0.3670 0.3104 0.0451  -0.0257 0.0229  291 LEU A CD2 
1313 N N   . LEU A 179 ? 0.2774 0.5427 0.3857 0.0892  -0.0486 0.0330  292 LEU A N   
1314 C CA  . LEU A 179 ? 0.2917 0.5890 0.3995 0.1083  -0.0569 0.0400  292 LEU A CA  
1315 C C   . LEU A 179 ? 0.2849 0.6190 0.3983 0.0961  -0.0700 0.0318  292 LEU A C   
1316 O O   . LEU A 179 ? 0.2983 0.6421 0.3989 0.1068  -0.0780 0.0368  292 LEU A O   
1317 C CB  . LEU A 179 ? 0.3059 0.6344 0.4313 0.1260  -0.0544 0.0447  292 LEU A CB  
1318 C CG  . LEU A 179 ? 0.3334 0.6243 0.4498 0.1409  -0.0404 0.0532  292 LEU A CG  
1319 C CD1 . LEU A 179 ? 0.3514 0.6774 0.4883 0.1568  -0.0371 0.0561  292 LEU A CD1 
1320 C CD2 . LEU A 179 ? 0.3668 0.6178 0.4535 0.1592  -0.0360 0.0654  292 LEU A CD2 
1321 N N   . ASP A 180 ? 0.2629 0.6146 0.3929 0.0733  -0.0711 0.0189  293 ASP A N   
1322 C CA  . ASP A 180 ? 0.2586 0.6390 0.3915 0.0566  -0.0814 0.0083  293 ASP A CA  
1323 C C   . ASP A 180 ? 0.2521 0.5958 0.3614 0.0469  -0.0824 0.0065  293 ASP A C   
1324 O O   . ASP A 180 ? 0.2528 0.6122 0.3529 0.0454  -0.0918 0.0042  293 ASP A O   
1325 C CB  . ASP A 180 ? 0.2551 0.6565 0.4089 0.0327  -0.0789 -0.0056 293 ASP A CB  
1326 C CG  . ASP A 180 ? 0.2757 0.7391 0.4554 0.0357  -0.0846 -0.0092 293 ASP A CG  
1327 O OD1 . ASP A 180 ? 0.3320 0.8234 0.5148 0.0597  -0.0904 0.0003  293 ASP A OD1 
1328 O OD2 . ASP A 180 ? 0.3139 0.7990 0.5105 0.0141  -0.0825 -0.0217 293 ASP A OD2 
1329 N N   . MET A 181 ? 0.2344 0.5315 0.3338 0.0409  -0.0726 0.0074  294 MET A N   
1330 C CA  . MET A 181 ? 0.2318 0.4952 0.3105 0.0331  -0.0720 0.0061  294 MET A CA  
1331 C C   . MET A 181 ? 0.2425 0.4942 0.3013 0.0508  -0.0749 0.0169  294 MET A C   
1332 O O   . MET A 181 ? 0.2438 0.4944 0.2885 0.0471  -0.0804 0.0149  294 MET A O   
1333 C CB  . MET A 181 ? 0.2178 0.4408 0.2927 0.0243  -0.0613 0.0047  294 MET A CB  
1334 C CG  . MET A 181 ? 0.1989 0.4278 0.2871 0.0058  -0.0578 -0.0059 294 MET A CG  
1335 S SD  . MET A 181 ? 0.2051 0.3894 0.2848 -0.0040 -0.0471 -0.0078 294 MET A SD  
1336 C CE  . MET A 181 ? 0.2054 0.3820 0.2932 0.0086  -0.0396 0.0000  294 MET A CE  
1337 N N   . ASN A 182 ? 0.2443 0.4847 0.2996 0.0698  -0.0699 0.0282  295 ASN A N   
1338 C CA  . ASN A 182 ? 0.2655 0.4935 0.2997 0.0883  -0.0709 0.0396  295 ASN A CA  
1339 C C   . ASN A 182 ? 0.2771 0.5458 0.3100 0.0965  -0.0837 0.0403  295 ASN A C   
1340 O O   . ASN A 182 ? 0.2882 0.5481 0.3012 0.0988  -0.0875 0.0429  295 ASN A O   
1341 C CB  . ASN A 182 ? 0.2738 0.4823 0.3034 0.1080  -0.0616 0.0511  295 ASN A CB  
1342 C CG  . ASN A 182 ? 0.2695 0.4302 0.2896 0.1006  -0.0492 0.0515  295 ASN A CG  
1343 O OD1 . ASN A 182 ? 0.2719 0.4118 0.2830 0.0868  -0.0478 0.0469  295 ASN A OD1 
1344 N ND2 . ASN A 182 ? 0.2613 0.4064 0.2829 0.1100  -0.0399 0.0565  295 ASN A ND2 
1345 N N   . LYS A 183 ? 0.2769 0.5923 0.3310 0.1000  -0.0904 0.0374  296 LYS A N   
1346 C CA  . LYS A 183 ? 0.2914 0.6558 0.3476 0.1063  -0.1044 0.0362  296 LYS A CA  
1347 C C   . LYS A 183 ? 0.2896 0.6570 0.3368 0.0856  -0.1114 0.0250  296 LYS A C   
1348 O O   . LYS A 183 ? 0.2998 0.6740 0.3287 0.0933  -0.1190 0.0284  296 LYS A O   
1349 C CB  . LYS A 183 ? 0.2851 0.7054 0.3712 0.1056  -0.1100 0.0303  296 LYS A CB  
1350 C CG  . LYS A 183 ? 0.3064 0.7438 0.3998 0.1341  -0.1079 0.0429  296 LYS A CG  
1351 C CD  . LYS A 183 ? 0.3087 0.8190 0.4253 0.1402  -0.1200 0.0391  296 LYS A CD  
1352 C CE  . LYS A 183 ? 0.3362 0.8647 0.4576 0.1739  -0.1178 0.0536  296 LYS A CE  
1353 N NZ  . LYS A 183 ? 0.3532 0.9450 0.4801 0.1925  -0.1326 0.0570  296 LYS A NZ  
1354 N N   . GLY A 184 ? 0.2660 0.6253 0.3236 0.0603  -0.1078 0.0118  297 GLY A N   
1355 C CA  . GLY A 184 ? 0.2707 0.6311 0.3198 0.0396  -0.1125 -0.0004 297 GLY A CA  
1356 C C   . GLY A 184 ? 0.2814 0.6014 0.3028 0.0413  -0.1097 0.0039  297 GLY A C   
1357 O O   . GLY A 184 ? 0.2979 0.6247 0.3063 0.0326  -0.1160 -0.0026 297 GLY A O   
1358 N N   . LEU A 185 ? 0.2753 0.5543 0.2871 0.0514  -0.0997 0.0141  298 LEU A N   
1359 C CA  . LEU A 185 ? 0.2831 0.5239 0.2705 0.0520  -0.0949 0.0180  298 LEU A CA  
1360 C C   . LEU A 185 ? 0.3026 0.5360 0.2702 0.0749  -0.0956 0.0325  298 LEU A C   
1361 O O   . LEU A 185 ? 0.3142 0.5138 0.2612 0.0769  -0.0894 0.0375  298 LEU A O   
1362 C CB  . LEU A 185 ? 0.2657 0.4661 0.2548 0.0446  -0.0824 0.0179  298 LEU A CB  
1363 C CG  . LEU A 185 ? 0.2402 0.4390 0.2430 0.0242  -0.0796 0.0054  298 LEU A CG  
1364 C CD1 . LEU A 185 ? 0.2108 0.3746 0.2150 0.0210  -0.0683 0.0070  298 LEU A CD1 
1365 C CD2 . LEU A 185 ? 0.2561 0.4559 0.2480 0.0098  -0.0832 -0.0047 298 LEU A CD2 
1366 N N   . SER A 186 ? 0.3204 0.5850 0.2933 0.0927  -0.1021 0.0395  299 SER A N   
1367 C CA  . SER A 186 ? 0.3553 0.6113 0.3068 0.1181  -0.1017 0.0550  299 SER A CA  
1368 C C   . SER A 186 ? 0.3639 0.5679 0.3018 0.1261  -0.0863 0.0653  299 SER A C   
1369 O O   . SER A 186 ? 0.3845 0.5607 0.2958 0.1367  -0.0814 0.0749  299 SER A O   
1370 C CB  . SER A 186 ? 0.3776 0.6388 0.3050 0.1199  -0.1094 0.0556  299 SER A CB  
1371 O OG  . SER A 186 ? 0.3891 0.7018 0.3277 0.1131  -0.1241 0.0458  299 SER A OG  
1372 N N   . LEU A 187 ? 0.3511 0.5426 0.3061 0.1202  -0.0782 0.0628  300 LEU A N   
1373 C CA  . LEU A 187 ? 0.3622 0.5071 0.3059 0.1243  -0.0635 0.0699  300 LEU A CA  
1374 C C   . LEU A 187 ? 0.3783 0.5232 0.3241 0.1455  -0.0586 0.0802  300 LEU A C   
1375 O O   . LEU A 187 ? 0.3686 0.5479 0.3368 0.1489  -0.0639 0.0774  300 LEU A O   
1376 C CB  . LEU A 187 ? 0.3314 0.4589 0.2892 0.1030  -0.0569 0.0598  300 LEU A CB  
1377 C CG  . LEU A 187 ? 0.3100 0.4322 0.2658 0.0831  -0.0589 0.0498  300 LEU A CG  
1378 C CD1 . LEU A 187 ? 0.2577 0.3689 0.2293 0.0667  -0.0533 0.0411  300 LEU A CD1 
1379 C CD2 . LEU A 187 ? 0.3208 0.4124 0.2504 0.0848  -0.0531 0.0551  300 LEU A CD2 
1380 N N   . GLN A 188 ? 0.4130 0.5185 0.3345 0.1595  -0.0472 0.0917  301 GLN A N   
1381 C CA  . GLN A 188 ? 0.4381 0.5319 0.3567 0.1802  -0.0385 0.1018  301 GLN A CA  
1382 C C   . GLN A 188 ? 0.4138 0.4877 0.3467 0.1667  -0.0287 0.0951  301 GLN A C   
1383 O O   . GLN A 188 ? 0.3961 0.4412 0.3244 0.1483  -0.0220 0.0891  301 GLN A O   
1384 C CB  . GLN A 188 ? 0.4806 0.5303 0.3635 0.1983  -0.0266 0.1161  301 GLN A CB  
1385 C CG  . GLN A 188 ? 0.5367 0.6057 0.4024 0.2255  -0.0339 0.1287  301 GLN A CG  
1386 C CD  . GLN A 188 ? 0.5901 0.6172 0.4251 0.2522  -0.0190 0.1454  301 GLN A CD  
1387 O OE1 . GLN A 188 ? 0.6561 0.6297 0.4745 0.2441  -0.0019 0.1463  301 GLN A OE1 
1388 N NE2 . GLN A 188 ? 0.6421 0.6900 0.4687 0.2811  -0.0238 0.1573  301 GLN A NE2 
1389 N N   . HIS A 189 ? 0.4132 0.5038 0.3622 0.1771  -0.0275 0.0964  302 HIS A N   
1390 C CA  . HIS A 189 ? 0.4020 0.4766 0.3638 0.1657  -0.0185 0.0901  302 HIS A CA  
1391 C C   . HIS A 189 ? 0.4274 0.4454 0.3649 0.1649  -0.0020 0.0942  302 HIS A C   
1392 O O   . HIS A 189 ? 0.4616 0.4533 0.3754 0.1840  0.0067  0.1056  302 HIS A O   
1393 C CB  . HIS A 189 ? 0.3998 0.5021 0.3807 0.1800  -0.0187 0.0920  302 HIS A CB  
1394 C CG  . HIS A 189 ? 0.3757 0.4771 0.3762 0.1637  -0.0142 0.0822  302 HIS A CG  
1395 N ND1 . HIS A 189 ? 0.3650 0.5004 0.3906 0.1460  -0.0230 0.0711  302 HIS A ND1 
1396 C CD2 . HIS A 189 ? 0.3905 0.4585 0.3862 0.1616  -0.0010 0.0816  302 HIS A CD2 
1397 C CE1 . HIS A 189 ? 0.3434 0.4666 0.3786 0.1353  -0.0157 0.0652  302 HIS A CE1 
1398 N NE2 . HIS A 189 ? 0.3665 0.4506 0.3844 0.1443  -0.0030 0.0711  302 HIS A NE2 
1399 N N   . ILE A 190 ? 0.4113 0.4108 0.3535 0.1426  0.0027  0.0846  303 ILE A N   
1400 C CA  . ILE A 190 ? 0.4352 0.3859 0.3573 0.1368  0.0182  0.0852  303 ILE A CA  
1401 C C   . ILE A 190 ? 0.4467 0.3846 0.3726 0.1428  0.0280  0.0853  303 ILE A C   
1402 O O   . ILE A 190 ? 0.4212 0.3802 0.3695 0.1344  0.0241  0.0777  303 ILE A O   
1403 C CB  . ILE A 190 ? 0.4089 0.3511 0.3350 0.1105  0.0180  0.0742  303 ILE A CB  
1404 C CG1 . ILE A 190 ? 0.4087 0.3578 0.3273 0.1057  0.0111  0.0746  303 ILE A CG1 
1405 C CG2 . ILE A 190 ? 0.4248 0.3237 0.3340 0.1014  0.0336  0.0724  303 ILE A CG2 
1406 C CD1 . ILE A 190 ? 0.3860 0.3375 0.3130 0.0832  0.0088  0.0640  303 ILE A CD1 
1407 N N   . GLY A 191 ? 0.4899 0.3907 0.3914 0.1579  0.0419  0.0942  304 GLY A N   
1408 C CA  . GLY A 191 ? 0.5089 0.3872 0.4070 0.1632  0.0546  0.0941  304 GLY A CA  
1409 C C   . GLY A 191 ? 0.5015 0.4148 0.4213 0.1792  0.0497  0.0961  304 GLY A C   
1410 O O   . GLY A 191 ? 0.4962 0.4400 0.4220 0.1988  0.0417  0.1040  304 GLY A O   
1411 N N   . ARG A 192 ? 0.4985 0.4100 0.4302 0.1699  0.0545  0.0885  305 ARG A N   
1412 C CA  . ARG A 192 ? 0.5014 0.4389 0.4512 0.1839  0.0545  0.0899  305 ARG A CA  
1413 C C   . ARG A 192 ? 0.4609 0.4419 0.4432 0.1678  0.0426  0.0796  305 ARG A C   
1414 O O   . ARG A 192 ? 0.4432 0.4140 0.4292 0.1462  0.0435  0.0699  305 ARG A O   
1415 C CB  . ARG A 192 ? 0.5330 0.4290 0.4670 0.1873  0.0724  0.0894  305 ARG A CB  
1416 C CG  . ARG A 192 ? 0.5423 0.4561 0.4876 0.2089  0.0770  0.0940  305 ARG A CG  
1417 C CD  . ARG A 192 ? 0.5716 0.4467 0.5041 0.2060  0.0940  0.0898  305 ARG A CD  
1418 N NE  . ARG A 192 ? 0.5951 0.4869 0.5376 0.2290  0.0999  0.0949  305 ARG A NE  
1419 C CZ  . ARG A 192 ? 0.5686 0.5081 0.5429 0.2275  0.0920  0.0905  305 ARG A CZ  
1420 N NH1 . ARG A 192 ? 0.5322 0.5031 0.5289 0.2043  0.0784  0.0811  305 ARG A NH1 
1421 N NH2 . ARG A 192 ? 0.5780 0.5324 0.5605 0.2496  0.0992  0.0954  305 ARG A NH2 
1422 N N   . PRO A 193 ? 0.4528 0.4830 0.4579 0.1781  0.0321  0.0814  306 PRO A N   
1423 C CA  . PRO A 193 ? 0.4215 0.4895 0.4559 0.1636  0.0248  0.0718  306 PRO A CA  
1424 C C   . PRO A 193 ? 0.4211 0.4741 0.4596 0.1589  0.0359  0.0670  306 PRO A C   
1425 O O   . PRO A 193 ? 0.4433 0.4752 0.4705 0.1752  0.0479  0.0726  306 PRO A O   
1426 C CB  . PRO A 193 ? 0.4211 0.5411 0.4752 0.1803  0.0158  0.0761  306 PRO A CB  
1427 C CG  . PRO A 193 ? 0.4436 0.5588 0.4794 0.1974  0.0121  0.0863  306 PRO A CG  
1428 C CD  . PRO A 193 ? 0.4677 0.5224 0.4714 0.2027  0.0265  0.0921  306 PRO A CD  
1429 N N   . HIS A 194 ? 0.4014 0.4631 0.4533 0.1372  0.0326  0.0569  307 HIS A N   
1430 C CA  . HIS A 194 ? 0.3970 0.4450 0.4511 0.1296  0.0420  0.0512  307 HIS A CA  
1431 C C   . HIS A 194 ? 0.4094 0.4065 0.4375 0.1259  0.0538  0.0505  307 HIS A C   
1432 O O   . HIS A 194 ? 0.4167 0.3972 0.4403 0.1269  0.0644  0.0482  307 HIS A O   
1433 C CB  . HIS A 194 ? 0.4195 0.4921 0.4893 0.1453  0.0475  0.0539  307 HIS A CB  
1434 C CG  . HIS A 194 ? 0.4370 0.5647 0.5353 0.1448  0.0370  0.0520  307 HIS A CG  
1435 N ND1 . HIS A 194 ? 0.4487 0.5961 0.5617 0.1229  0.0293  0.0431  307 HIS A ND1 
1436 C CD2 . HIS A 194 ? 0.4709 0.6391 0.5852 0.1631  0.0336  0.0573  307 HIS A CD2 
1437 C CE1 . HIS A 194 ? 0.4477 0.6437 0.5840 0.1249  0.0221  0.0418  307 HIS A CE1 
1438 N NE2 . HIS A 194 ? 0.4621 0.6751 0.6012 0.1491  0.0237  0.0501  307 HIS A NE2 
1439 N N   . SER A 195 ? 0.4097 0.3827 0.4199 0.1210  0.0527  0.0517  308 SER A N   
1440 C CA  . SER A 195 ? 0.4174 0.3490 0.4062 0.1087  0.0614  0.0472  308 SER A CA  
1441 C C   . SER A 195 ? 0.3871 0.3291 0.3831 0.0872  0.0516  0.0394  308 SER A C   
1442 O O   . SER A 195 ? 0.3801 0.3404 0.3828 0.0850  0.0415  0.0407  308 SER A O   
1443 C CB  . SER A 195 ? 0.4505 0.3475 0.4136 0.1169  0.0691  0.0537  308 SER A CB  
1444 O OG  . SER A 195 ? 0.4600 0.3298 0.4079 0.0976  0.0722  0.0471  308 SER A OG  
1445 N N   . GLY A 196 ? 0.3681 0.2994 0.3619 0.0728  0.0548  0.0315  309 GLY A N   
1446 C CA  . GLY A 196 ? 0.3365 0.2776 0.3360 0.0551  0.0465  0.0246  309 GLY A CA  
1447 C C   . GLY A 196 ? 0.3280 0.2621 0.3190 0.0487  0.0423  0.0249  309 GLY A C   
1448 O O   . GLY A 196 ? 0.3107 0.2651 0.3117 0.0447  0.0324  0.0245  309 GLY A O   
1449 N N   . ILE A 197 ? 0.3411 0.2449 0.3122 0.0468  0.0511  0.0250  310 ILE A N   
1450 C CA  . ILE A 197 ? 0.3389 0.2329 0.2998 0.0389  0.0501  0.0246  310 ILE A CA  
1451 C C   . ILE A 197 ? 0.3317 0.2371 0.2948 0.0502  0.0441  0.0327  310 ILE A C   
1452 O O   . ILE A 197 ? 0.3026 0.2197 0.2691 0.0434  0.0366  0.0315  310 ILE A O   
1453 C CB  . ILE A 197 ? 0.3734 0.2288 0.3102 0.0329  0.0640  0.0223  310 ILE A CB  
1454 C CG1 . ILE A 197 ? 0.3888 0.2363 0.3164 0.0200  0.0642  0.0196  310 ILE A CG1 
1455 C CG2 . ILE A 197 ? 0.4049 0.2346 0.3264 0.0502  0.0752  0.0305  310 ILE A CG2 
1456 C CD1 . ILE A 197 ? 0.3872 0.2527 0.3241 0.0024  0.0577  0.0100  310 ILE A CD1 
1457 N N   . ASP A 198 ? 0.3391 0.2433 0.2999 0.0685  0.0471  0.0408  311 ASP A N   
1458 C CA  . ASP A 198 ? 0.3368 0.2538 0.2973 0.0811  0.0410  0.0489  311 ASP A CA  
1459 C C   . ASP A 198 ? 0.2980 0.2556 0.2813 0.0780  0.0266  0.0463  311 ASP A C   
1460 O O   . ASP A 198 ? 0.2895 0.2582 0.2722 0.0773  0.0192  0.0479  311 ASP A O   
1461 C CB  . ASP A 198 ? 0.3624 0.2719 0.3148 0.1043  0.0474  0.0589  311 ASP A CB  
1462 C CG  . ASP A 198 ? 0.4160 0.2776 0.3385 0.1090  0.0632  0.0633  311 ASP A CG  
1463 O OD1 . ASP A 198 ? 0.4460 0.2838 0.3547 0.0932  0.0681  0.0588  311 ASP A OD1 
1464 O OD2 . ASP A 198 ? 0.4867 0.3341 0.3986 0.1289  0.0718  0.0713  311 ASP A OD2 
1465 N N   . ASP A 199 ? 0.2745 0.2517 0.2754 0.0750  0.0240  0.0418  312 ASP A N   
1466 C CA  . ASP A 199 ? 0.2482 0.2581 0.2682 0.0675  0.0128  0.0373  312 ASP A CA  
1467 C C   . ASP A 199 ? 0.2336 0.2387 0.2505 0.0514  0.0087  0.0314  312 ASP A C   
1468 O O   . ASP A 199 ? 0.2226 0.2447 0.2448 0.0479  0.0003  0.0301  312 ASP A O   
1469 C CB  . ASP A 199 ? 0.2377 0.2623 0.2735 0.0646  0.0141  0.0329  312 ASP A CB  
1470 C CG  . ASP A 199 ? 0.2396 0.2864 0.2872 0.0799  0.0146  0.0376  312 ASP A CG  
1471 O OD1 . ASP A 199 ? 0.2392 0.2912 0.2823 0.0950  0.0134  0.0449  312 ASP A OD1 
1472 O OD2 . ASP A 199 ? 0.2594 0.3204 0.3208 0.0774  0.0166  0.0341  312 ASP A OD2 
1473 N N   . CYS A 200 ? 0.2285 0.2114 0.2360 0.0423  0.0148  0.0276  313 CYS A N   
1474 C CA  . CYS A 200 ? 0.2184 0.1990 0.2230 0.0295  0.0117  0.0226  313 CYS A CA  
1475 C C   . CYS A 200 ? 0.2195 0.1961 0.2145 0.0309  0.0097  0.0260  313 CYS A C   
1476 O O   . CYS A 200 ? 0.1983 0.1866 0.1970 0.0254  0.0034  0.0236  313 CYS A O   
1477 C CB  . CYS A 200 ? 0.2209 0.1833 0.2173 0.0201  0.0186  0.0176  313 CYS A CB  
1478 S SG  . CYS A 200 ? 0.2108 0.1800 0.2161 0.0153  0.0189  0.0122  313 CYS A SG  
1479 N N   . LYS A 201 ? 0.2441 0.2017 0.2247 0.0390  0.0164  0.0320  314 LYS A N   
1480 C CA  . LYS A 201 ? 0.2664 0.2166 0.2341 0.0418  0.0163  0.0366  314 LYS A CA  
1481 C C   . LYS A 201 ? 0.2502 0.2256 0.2253 0.0494  0.0057  0.0397  314 LYS A C   
1482 O O   . LYS A 201 ? 0.2443 0.2224 0.2137 0.0462  0.0020  0.0398  314 LYS A O   
1483 C CB  . LYS A 201 ? 0.3014 0.2215 0.2486 0.0512  0.0275  0.0436  314 LYS A CB  
1484 C CG  . LYS A 201 ? 0.3266 0.2182 0.2621 0.0398  0.0395  0.0388  314 LYS A CG  
1485 C CD  . LYS A 201 ? 0.3789 0.2368 0.2929 0.0507  0.0526  0.0456  314 LYS A CD  
1486 C CE  . LYS A 201 ? 0.4197 0.2453 0.3177 0.0362  0.0662  0.0396  314 LYS A CE  
1487 N NZ  . LYS A 201 ? 0.4913 0.2757 0.3628 0.0472  0.0818  0.0468  314 LYS A NZ  
1488 N N   . ASN A 202 ? 0.2467 0.2422 0.2342 0.0583  0.0013  0.0414  315 ASN A N   
1489 C CA  . ASN A 202 ? 0.2427 0.2683 0.2397 0.0628  -0.0095 0.0421  315 ASN A CA  
1490 C C   . ASN A 202 ? 0.2188 0.2605 0.2271 0.0481  -0.0165 0.0334  315 ASN A C   
1491 O O   . ASN A 202 ? 0.2039 0.2582 0.2106 0.0461  -0.0234 0.0322  315 ASN A O   
1492 C CB  . ASN A 202 ? 0.2429 0.2904 0.2526 0.0751  -0.0115 0.0452  315 ASN A CB  
1493 C CG  . ASN A 202 ? 0.2755 0.3148 0.2722 0.0952  -0.0075 0.0558  315 ASN A CG  
1494 O OD1 . ASN A 202 ? 0.2967 0.3486 0.2869 0.1050  -0.0136 0.0611  315 ASN A OD1 
1495 N ND2 . ASN A 202 ? 0.2808 0.2979 0.2713 0.1027  0.0033  0.0592  315 ASN A ND2 
1496 N N   . ILE A 203 ? 0.2097 0.2487 0.2269 0.0387  -0.0139 0.0276  316 ILE A N   
1497 C CA  . ILE A 203 ? 0.1979 0.2443 0.2216 0.0263  -0.0177 0.0202  316 ILE A CA  
1498 C C   . ILE A 203 ? 0.2022 0.2375 0.2143 0.0212  -0.0179 0.0192  316 ILE A C   
1499 O O   . ILE A 203 ? 0.2026 0.2468 0.2147 0.0164  -0.0230 0.0158  316 ILE A O   
1500 C CB  . ILE A 203 ? 0.1935 0.2334 0.2235 0.0196  -0.0132 0.0159  316 ILE A CB  
1501 C CG1 . ILE A 203 ? 0.2016 0.2556 0.2445 0.0226  -0.0125 0.0156  316 ILE A CG1 
1502 C CG2 . ILE A 203 ? 0.1754 0.2160 0.2064 0.0094  -0.0152 0.0099  316 ILE A CG2 
1503 C CD1 . ILE A 203 ? 0.1764 0.2195 0.2212 0.0189  -0.0061 0.0132  316 ILE A CD1 
1504 N N   . ALA A 204 ? 0.2079 0.2237 0.2096 0.0215  -0.0114 0.0216  317 ALA A N   
1505 C CA  . ALA A 204 ? 0.2131 0.2193 0.2046 0.0161  -0.0096 0.0205  317 ALA A CA  
1506 C C   . ALA A 204 ? 0.2204 0.2301 0.2026 0.0209  -0.0133 0.0242  317 ALA A C   
1507 O O   . ALA A 204 ? 0.2237 0.2365 0.2028 0.0160  -0.0155 0.0212  317 ALA A O   
1508 C CB  . ALA A 204 ? 0.2188 0.2048 0.2011 0.0133  -0.0005 0.0214  317 ALA A CB  
1509 N N   . ASN A 205 ? 0.2339 0.2432 0.2104 0.0320  -0.0136 0.0310  318 ASN A N   
1510 C CA  . ASN A 205 ? 0.2445 0.2598 0.2104 0.0394  -0.0182 0.0357  318 ASN A CA  
1511 C C   . ASN A 205 ? 0.2275 0.2687 0.2020 0.0364  -0.0287 0.0307  318 ASN A C   
1512 O O   . ASN A 205 ? 0.2305 0.2749 0.1959 0.0348  -0.0322 0.0298  318 ASN A O   
1513 C CB  . ASN A 205 ? 0.2659 0.2769 0.2238 0.0553  -0.0162 0.0451  318 ASN A CB  
1514 C CG  . ASN A 205 ? 0.2936 0.3017 0.2328 0.0651  -0.0179 0.0523  318 ASN A CG  
1515 O OD1 . ASN A 205 ? 0.3147 0.3087 0.2407 0.0593  -0.0145 0.0520  318 ASN A OD1 
1516 N ND2 . ASN A 205 ? 0.3278 0.3503 0.2651 0.0810  -0.0228 0.0591  318 ASN A ND2 
1517 N N   . ILE A 206 ? 0.2096 0.2683 0.2006 0.0344  -0.0325 0.0268  319 ILE A N   
1518 C CA  . ILE A 206 ? 0.1998 0.2808 0.1989 0.0274  -0.0403 0.0198  319 ILE A CA  
1519 C C   . ILE A 206 ? 0.1985 0.2690 0.1939 0.0153  -0.0386 0.0129  319 ILE A C   
1520 O O   . ILE A 206 ? 0.1956 0.2724 0.1847 0.0110  -0.0429 0.0089  319 ILE A O   
1521 C CB  . ILE A 206 ? 0.1904 0.2904 0.2082 0.0254  -0.0422 0.0163  319 ILE A CB  
1522 C CG1 . ILE A 206 ? 0.1850 0.3020 0.2074 0.0398  -0.0445 0.0232  319 ILE A CG1 
1523 C CG2 . ILE A 206 ? 0.1797 0.2977 0.2043 0.0132  -0.0476 0.0069  319 ILE A CG2 
1524 C CD1 . ILE A 206 ? 0.1669 0.2976 0.2079 0.0400  -0.0423 0.0215  319 ILE A CD1 
1525 N N   . MET A 207 ? 0.1934 0.2481 0.1910 0.0111  -0.0322 0.0116  320 MET A N   
1526 C CA  . MET A 207 ? 0.1947 0.2409 0.1891 0.0032  -0.0299 0.0062  320 MET A CA  
1527 C C   . MET A 207 ? 0.2104 0.2495 0.1907 0.0038  -0.0290 0.0073  320 MET A C   
1528 O O   . MET A 207 ? 0.2042 0.2434 0.1793 -0.0007 -0.0300 0.0025  320 MET A O   
1529 C CB  . MET A 207 ? 0.1880 0.2232 0.1870 0.0012  -0.0239 0.0056  320 MET A CB  
1530 C CG  . MET A 207 ? 0.1583 0.1972 0.1682 -0.0013 -0.0234 0.0030  320 MET A CG  
1531 S SD  . MET A 207 ? 0.1723 0.2003 0.1838 -0.0028 -0.0175 0.0022  320 MET A SD  
1532 C CE  . MET A 207 ? 0.1357 0.1594 0.1405 -0.0054 -0.0164 -0.0017 320 MET A CE  
1533 N N   . LYS A 208 ? 0.2337 0.2640 0.2064 0.0091  -0.0255 0.0135  321 LYS A N   
1534 C CA  . LYS A 208 ? 0.2556 0.2779 0.2130 0.0102  -0.0232 0.0159  321 LYS A CA  
1535 C C   . LYS A 208 ? 0.2618 0.2949 0.2110 0.0120  -0.0303 0.0150  321 LYS A C   
1536 O O   . LYS A 208 ? 0.2707 0.3012 0.2110 0.0082  -0.0296 0.0115  321 LYS A O   
1537 C CB  . LYS A 208 ? 0.2738 0.2821 0.2220 0.0162  -0.0173 0.0237  321 LYS A CB  
1538 C CG  . LYS A 208 ? 0.3110 0.3060 0.2410 0.0167  -0.0117 0.0273  321 LYS A CG  
1539 C CD  . LYS A 208 ? 0.3400 0.3147 0.2628 0.0172  -0.0015 0.0322  321 LYS A CD  
1540 C CE  . LYS A 208 ? 0.4102 0.3670 0.3106 0.0208  0.0054  0.0389  321 LYS A CE  
1541 N NZ  . LYS A 208 ? 0.4478 0.3797 0.3396 0.0182  0.0181  0.0421  321 LYS A NZ  
1542 N N   . THR A 209 ? 0.2576 0.3054 0.2101 0.0176  -0.0370 0.0172  322 THR A N   
1543 C CA  . THR A 209 ? 0.2591 0.3229 0.2041 0.0187  -0.0453 0.0154  322 THR A CA  
1544 C C   . THR A 209 ? 0.2459 0.3170 0.1954 0.0068  -0.0481 0.0046  322 THR A C   
1545 O O   . THR A 209 ? 0.2484 0.3211 0.1857 0.0033  -0.0506 0.0006  322 THR A O   
1546 C CB  . THR A 209 ? 0.2666 0.3513 0.2166 0.0286  -0.0524 0.0202  322 THR A CB  
1547 O OG1 . THR A 209 ? 0.2878 0.3587 0.2283 0.0415  -0.0476 0.0311  322 THR A OG1 
1548 C CG2 . THR A 209 ? 0.2779 0.3858 0.2205 0.0292  -0.0626 0.0173  322 THR A CG2 
1549 N N   . LEU A 210 ? 0.2195 0.2916 0.1836 0.0005  -0.0464 -0.0002 323 LEU A N   
1550 C CA  . LEU A 210 ? 0.2236 0.2962 0.1884 -0.0107 -0.0465 -0.0101 323 LEU A CA  
1551 C C   . LEU A 210 ? 0.2258 0.2784 0.1788 -0.0132 -0.0400 -0.0125 323 LEU A C   
1552 O O   . LEU A 210 ? 0.2313 0.2811 0.1739 -0.0192 -0.0402 -0.0192 323 LEU A O   
1553 C CB  . LEU A 210 ? 0.2074 0.2820 0.1876 -0.0162 -0.0443 -0.0137 323 LEU A CB  
1554 C CG  . LEU A 210 ? 0.1956 0.2946 0.1897 -0.0162 -0.0500 -0.0140 323 LEU A CG  
1555 C CD1 . LEU A 210 ? 0.1550 0.2499 0.1623 -0.0212 -0.0448 -0.0164 323 LEU A CD1 
1556 C CD2 . LEU A 210 ? 0.1473 0.2677 0.1393 -0.0242 -0.0571 -0.0217 323 LEU A CD2 
1557 N N   . ALA A 211 ? 0.2147 0.2553 0.1698 -0.0087 -0.0338 -0.0077 324 ALA A N   
1558 C CA  . ALA A 211 ? 0.2214 0.2489 0.1682 -0.0088 -0.0273 -0.0087 324 ALA A CA  
1559 C C   . ALA A 211 ? 0.2327 0.2586 0.1631 -0.0073 -0.0277 -0.0079 324 ALA A C   
1560 O O   . ALA A 211 ? 0.2406 0.2591 0.1616 -0.0095 -0.0240 -0.0122 324 ALA A O   
1561 C CB  . ALA A 211 ? 0.1953 0.2176 0.1489 -0.0054 -0.0217 -0.0040 324 ALA A CB  
1562 N N   . TYR A 212 ? 0.2481 0.2792 0.1733 -0.0023 -0.0313 -0.0018 325 TYR A N   
1563 C CA  . TYR A 212 ? 0.2681 0.2977 0.1746 0.0001  -0.0323 -0.0001 325 TYR A CA  
1564 C C   . TYR A 212 ? 0.2743 0.3115 0.1721 -0.0055 -0.0380 -0.0082 325 TYR A C   
1565 O O   . TYR A 212 ? 0.2742 0.3056 0.1553 -0.0065 -0.0363 -0.0105 325 TYR A O   
1566 C CB  . TYR A 212 ? 0.2843 0.3173 0.1847 0.0090  -0.0353 0.0092  325 TYR A CB  
1567 C CG  . TYR A 212 ? 0.3161 0.3502 0.1951 0.0129  -0.0382 0.0115  325 TYR A CG  
1568 C CD1 . TYR A 212 ? 0.3356 0.3537 0.1984 0.0143  -0.0302 0.0150  325 TYR A CD1 
1569 C CD2 . TYR A 212 ? 0.3331 0.3865 0.2076 0.0146  -0.0490 0.0094  325 TYR A CD2 
1570 C CE1 . TYR A 212 ? 0.3696 0.3871 0.2102 0.0183  -0.0323 0.0175  325 TYR A CE1 
1571 C CE2 . TYR A 212 ? 0.3622 0.4183 0.2150 0.0187  -0.0526 0.0113  325 TYR A CE2 
1572 C CZ  . TYR A 212 ? 0.3788 0.4150 0.2135 0.0211  -0.0440 0.0158  325 TYR A CZ  
1573 O OH  . TYR A 212 ? 0.4178 0.4548 0.2283 0.0257  -0.0469 0.0182  325 TYR A OH  
1574 N N   . ARG A 213 ? 0.2669 0.3171 0.1753 -0.0104 -0.0441 -0.0133 326 ARG A N   
1575 C CA  . ARG A 213 ? 0.2879 0.3451 0.1894 -0.0197 -0.0484 -0.0234 326 ARG A CA  
1576 C C   . ARG A 213 ? 0.2864 0.3256 0.1857 -0.0279 -0.0406 -0.0319 326 ARG A C   
1577 O O   . ARG A 213 ? 0.2989 0.3376 0.1899 -0.0377 -0.0416 -0.0417 326 ARG A O   
1578 C CB  . ARG A 213 ? 0.2922 0.3740 0.2063 -0.0232 -0.0573 -0.0261 326 ARG A CB  
1579 C CG  . ARG A 213 ? 0.2984 0.3998 0.2125 -0.0121 -0.0652 -0.0175 326 ARG A CG  
1580 C CD  . ARG A 213 ? 0.3122 0.4446 0.2407 -0.0147 -0.0743 -0.0208 326 ARG A CD  
1581 N NE  . ARG A 213 ? 0.3514 0.5027 0.2783 0.0003  -0.0814 -0.0107 326 ARG A NE  
1582 C CZ  . ARG A 213 ? 0.3603 0.5458 0.2980 0.0035  -0.0908 -0.0111 326 ARG A CZ  
1583 N NH1 . ARG A 213 ? 0.3937 0.6002 0.3460 -0.0104 -0.0942 -0.0222 326 ARG A NH1 
1584 N NH2 . ARG A 213 ? 0.3645 0.5633 0.2972 0.0210  -0.0959 -0.0001 326 ARG A NH2 
1585 N N   . GLY A 214 ? 0.2735 0.2980 0.1787 -0.0237 -0.0324 -0.0284 327 GLY A N   
1586 C CA  . GLY A 214 ? 0.2813 0.2875 0.1821 -0.0267 -0.0240 -0.0342 327 GLY A CA  
1587 C C   . GLY A 214 ? 0.2762 0.2777 0.1883 -0.0306 -0.0215 -0.0370 327 GLY A C   
1588 O O   . GLY A 214 ? 0.2836 0.2671 0.1883 -0.0327 -0.0141 -0.0419 327 GLY A O   
1589 N N   . PHE A 215 ? 0.2601 0.2752 0.1881 -0.0304 -0.0264 -0.0332 328 PHE A N   
1590 C CA  . PHE A 215 ? 0.2591 0.2699 0.1970 -0.0343 -0.0236 -0.0353 328 PHE A CA  
1591 C C   . PHE A 215 ? 0.2508 0.2478 0.1920 -0.0267 -0.0163 -0.0310 328 PHE A C   
1592 O O   . PHE A 215 ? 0.2466 0.2488 0.1943 -0.0192 -0.0166 -0.0243 328 PHE A O   
1593 C CB  . PHE A 215 ? 0.2461 0.2770 0.2003 -0.0351 -0.0302 -0.0324 328 PHE A CB  
1594 C CG  . PHE A 215 ? 0.2438 0.2721 0.2061 -0.0422 -0.0270 -0.0365 328 PHE A CG  
1595 C CD1 . PHE A 215 ? 0.2753 0.3033 0.2326 -0.0553 -0.0262 -0.0462 328 PHE A CD1 
1596 C CD2 . PHE A 215 ? 0.2486 0.2730 0.2214 -0.0372 -0.0238 -0.0313 328 PHE A CD2 
1597 C CE1 . PHE A 215 ? 0.2919 0.3151 0.2552 -0.0634 -0.0213 -0.0500 328 PHE A CE1 
1598 C CE2 . PHE A 215 ? 0.2548 0.2747 0.2329 -0.0437 -0.0196 -0.0346 328 PHE A CE2 
1599 C CZ  . PHE A 215 ? 0.2524 0.2710 0.2259 -0.0568 -0.0179 -0.0436 328 PHE A CZ  
1600 N N   . ILE A 216 ? 0.2656 0.2450 0.2007 -0.0289 -0.0093 -0.0350 329 ILE A N   
1601 C CA  . ILE A 216 ? 0.2652 0.2339 0.2024 -0.0204 -0.0030 -0.0309 329 ILE A CA  
1602 C C   . ILE A 216 ? 0.2503 0.2195 0.1974 -0.0230 -0.0028 -0.0297 329 ILE A C   
1603 O O   . ILE A 216 ? 0.2728 0.2315 0.2150 -0.0312 0.0007  -0.0349 329 ILE A O   
1604 C CB  . ILE A 216 ? 0.2901 0.2345 0.2099 -0.0173 0.0067  -0.0345 329 ILE A CB  
1605 C CG1 . ILE A 216 ? 0.3078 0.2500 0.2158 -0.0151 0.0080  -0.0367 329 ILE A CG1 
1606 C CG2 . ILE A 216 ? 0.2837 0.2219 0.2056 -0.0050 0.0121  -0.0288 329 ILE A CG2 
1607 C CD1 . ILE A 216 ? 0.2900 0.2449 0.2048 -0.0052 0.0074  -0.0306 329 ILE A CD1 
1608 N N   . PHE A 217 ? 0.2411 0.2210 0.2006 -0.0169 -0.0053 -0.0235 330 PHE A N   
1609 C CA  . PHE A 217 ? 0.2327 0.2141 0.2015 -0.0183 -0.0049 -0.0217 330 PHE A CA  
1610 C C   . PHE A 217 ? 0.2473 0.2095 0.2075 -0.0144 0.0030  -0.0214 330 PHE A C   
1611 O O   . PHE A 217 ? 0.2472 0.2023 0.2001 -0.0050 0.0066  -0.0191 330 PHE A O   
1612 C CB  . PHE A 217 ? 0.2125 0.2084 0.1936 -0.0133 -0.0090 -0.0160 330 PHE A CB  
1613 C CG  . PHE A 217 ? 0.2128 0.2235 0.2000 -0.0155 -0.0153 -0.0149 330 PHE A CG  
1614 C CD1 . PHE A 217 ? 0.2153 0.2299 0.1989 -0.0121 -0.0170 -0.0126 330 PHE A CD1 
1615 C CD2 . PHE A 217 ? 0.2015 0.2226 0.1969 -0.0201 -0.0187 -0.0159 330 PHE A CD2 
1616 C CE1 . PHE A 217 ? 0.2084 0.2331 0.1934 -0.0121 -0.0220 -0.0104 330 PHE A CE1 
1617 C CE2 . PHE A 217 ? 0.1916 0.2275 0.1910 -0.0189 -0.0246 -0.0138 330 PHE A CE2 
1618 C CZ  . PHE A 217 ? 0.1865 0.2221 0.1790 -0.0141 -0.0261 -0.0105 330 PHE A CZ  
1619 N N   . LYS A 218 ? 0.2538 0.2085 0.2144 -0.0209 0.0063  -0.0234 331 LYS A N   
1620 C CA  . LYS A 218 ? 0.2784 0.2109 0.2276 -0.0171 0.0151  -0.0222 331 LYS A CA  
1621 C C   . LYS A 218 ? 0.2664 0.2026 0.2243 -0.0198 0.0157  -0.0201 331 LYS A C   
1622 O O   . LYS A 218 ? 0.2596 0.2110 0.2302 -0.0288 0.0118  -0.0224 331 LYS A O   
1623 C CB  . LYS A 218 ? 0.3116 0.2191 0.2436 -0.0252 0.0237  -0.0287 331 LYS A CB  
1624 C CG  . LYS A 218 ? 0.3320 0.2338 0.2531 -0.0252 0.0240  -0.0328 331 LYS A CG  
1625 C CD  . LYS A 218 ? 0.3739 0.2461 0.2748 -0.0353 0.0344  -0.0406 331 LYS A CD  
1626 C CE  . LYS A 218 ? 0.4185 0.2859 0.3078 -0.0399 0.0345  -0.0473 331 LYS A CE  
1627 N NZ  . LYS A 218 ? 0.4457 0.3225 0.3363 -0.0251 0.0309  -0.0419 331 LYS A NZ  
1628 N N   . GLN A 219 ? 0.2710 0.1947 0.2214 -0.0109 0.0208  -0.0154 332 GLN A N   
1629 C CA  . GLN A 219 ? 0.2701 0.1906 0.2231 -0.0132 0.0242  -0.0135 332 GLN A CA  
1630 C C   . GLN A 219 ? 0.2851 0.1984 0.2383 -0.0287 0.0294  -0.0197 332 GLN A C   
1631 O O   . GLN A 219 ? 0.3035 0.1983 0.2437 -0.0355 0.0358  -0.0247 332 GLN A O   
1632 C CB  . GLN A 219 ? 0.2866 0.1867 0.2230 -0.0012 0.0313  -0.0082 332 GLN A CB  
1633 C CG  . GLN A 219 ? 0.2869 0.1812 0.2225 -0.0026 0.0357  -0.0056 332 GLN A CG  
1634 C CD  . GLN A 219 ? 0.3023 0.1784 0.2190 0.0120  0.0417  0.0009  332 GLN A CD  
1635 O OE1 . GLN A 219 ? 0.3033 0.1848 0.2156 0.0255  0.0384  0.0045  332 GLN A OE1 
1636 N NE2 . GLN A 219 ? 0.2558 0.1123 0.1612 0.0101  0.0505  0.0028  332 GLN A NE2 
1637 N N   . THR A 220 ? 0.2726 0.2016 0.2405 -0.0350 0.0274  -0.0201 333 THR A N   
1638 C CA  . THR A 220 ? 0.2867 0.2143 0.2576 -0.0504 0.0332  -0.0263 333 THR A CA  
1639 C C   . THR A 220 ? 0.3111 0.2249 0.2772 -0.0506 0.0423  -0.0234 333 THR A C   
1640 O O   . THR A 220 ? 0.3204 0.2220 0.2816 -0.0633 0.0519  -0.0281 333 THR A O   
1641 C CB  . THR A 220 ? 0.2679 0.2296 0.2611 -0.0575 0.0243  -0.0296 333 THR A CB  
1642 O OG1 . THR A 220 ? 0.2125 0.1901 0.2182 -0.0480 0.0190  -0.0235 333 THR A OG1 
1643 C CG2 . THR A 220 ? 0.2305 0.2035 0.2245 -0.0583 0.0162  -0.0328 333 THR A CG2 
1644 N N   . SER A 221 ? 0.3079 0.2247 0.2749 -0.0377 0.0394  -0.0163 334 SER A N   
1645 C CA  . SER A 221 ? 0.3350 0.2384 0.2939 -0.0338 0.0467  -0.0120 334 SER A CA  
1646 C C   . SER A 221 ? 0.3771 0.2434 0.3100 -0.0333 0.0596  -0.0110 334 SER A C   
1647 O O   . SER A 221 ? 0.3822 0.2331 0.3003 -0.0245 0.0603  -0.0091 334 SER A O   
1648 C CB  . SER A 221 ? 0.3160 0.2282 0.2753 -0.0186 0.0396  -0.0055 334 SER A CB  
1649 O OG  . SER A 221 ? 0.3862 0.2881 0.3364 -0.0135 0.0451  -0.0013 334 SER A OG  
1650 N N   . LYS A 222 ? 0.4140 0.2644 0.3398 -0.0419 0.0709  -0.0121 335 LYS A N   
1651 C CA  . LYS A 222 ? 0.4662 0.2749 0.3628 -0.0406 0.0859  -0.0100 335 LYS A CA  
1652 C C   . LYS A 222 ? 0.4762 0.2726 0.3558 -0.0191 0.0857  0.0004  335 LYS A C   
1653 O O   . LYS A 222 ? 0.4616 0.2747 0.3496 -0.0135 0.0806  0.0041  335 LYS A O   
1654 C CB  . LYS A 222 ? 0.4945 0.2905 0.3886 -0.0576 0.0994  -0.0142 335 LYS A CB  
1655 C CG  . LYS A 222 ? 0.5240 0.3069 0.4139 -0.0782 0.1083  -0.0244 335 LYS A CG  
1656 C CD  . LYS A 222 ? 0.5366 0.3358 0.4432 -0.1001 0.1143  -0.0324 335 LYS A CD  
1657 C CE  . LYS A 222 ? 0.5930 0.3698 0.4873 -0.1228 0.1280  -0.0431 335 LYS A CE  
1658 N NZ  . LYS A 222 ? 0.6101 0.3958 0.5075 -0.1275 0.1196  -0.0502 335 LYS A NZ  
1659 N N   . PRO A 223 ? 0.5084 0.2784 0.3641 -0.0061 0.0906  0.0048  336 PRO A N   
1660 C CA  . PRO A 223 ? 0.5215 0.2891 0.3632 0.0170  0.0877  0.0146  336 PRO A CA  
1661 C C   . PRO A 223 ? 0.5417 0.3000 0.3714 0.0232  0.0930  0.0210  336 PRO A C   
1662 O O   . PRO A 223 ? 0.5801 0.3143 0.3989 0.0125  0.1061  0.0200  336 PRO A O   
1663 C CB  . PRO A 223 ? 0.5580 0.2917 0.3724 0.0285  0.0970  0.0178  336 PRO A CB  
1664 C CG  . PRO A 223 ? 0.5545 0.2874 0.3772 0.0132  0.0974  0.0086  336 PRO A CG  
1665 C CD  . PRO A 223 ? 0.5400 0.2840 0.3805 -0.0107 0.0986  0.0005  336 PRO A CD  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   114 ?   ?   ?   A . n 
A 1 2   HIS 2   115 ?   ?   ?   A . n 
A 1 3   HIS 3   116 ?   ?   ?   A . n 
A 1 4   HIS 4   117 ?   ?   ?   A . n 
A 1 5   HIS 5   118 ?   ?   ?   A . n 
A 1 6   HIS 6   119 ?   ?   ?   A . n 
A 1 7   HIS 7   120 ?   ?   ?   A . n 
A 1 8   SER 8   121 ?   ?   ?   A . n 
A 1 9   SER 9   122 ?   ?   ?   A . n 
A 1 10  GLY 10  123 ?   ?   ?   A . n 
A 1 11  VAL 11  124 ?   ?   ?   A . n 
A 1 12  ASP 12  125 ?   ?   ?   A . n 
A 1 13  LEU 13  126 ?   ?   ?   A . n 
A 1 14  GLY 14  127 ?   ?   ?   A . n 
A 1 15  THR 15  128 ?   ?   ?   A . n 
A 1 16  GLU 16  129 ?   ?   ?   A . n 
A 1 17  ASN 17  130 130 ASN ASN A . n 
A 1 18  LEU 18  131 131 LEU LEU A . n 
A 1 19  TYR 19  132 132 TYR TYR A . n 
A 1 20  PHE 20  133 133 PHE PHE A . n 
A 1 21  GLN 21  134 134 GLN GLN A . n 
A 1 22  SER 22  135 135 SER SER A . n 
A 1 23  MET 23  136 136 MET MET A . n 
A 1 24  SER 24  137 137 SER SER A . n 
A 1 25  PHE 25  138 138 PHE PHE A . n 
A 1 26  PRO 26  139 139 PRO PRO A . n 
A 1 27  PRO 27  140 140 PRO PRO A . n 
A 1 28  GLN 28  141 141 GLN GLN A . n 
A 1 29  ARG 29  142 142 ARG ARG A . n 
A 1 30  TYR 30  143 143 TYR TYR A . n 
A 1 31  HIS 31  144 144 HIS HIS A . n 
A 1 32  TYR 32  145 145 TYR TYR A . n 
A 1 33  PHE 33  146 146 PHE PHE A . n 
A 1 34  LEU 34  147 147 LEU LEU A . n 
A 1 35  VAL 35  148 148 VAL VAL A . n 
A 1 36  LEU 36  149 149 LEU LEU A . n 
A 1 37  ASP 37  150 150 ASP ASP A . n 
A 1 38  PHE 38  151 151 PHE PHE A . n 
A 1 39  GLU 39  152 152 GLU GLU A . n 
A 1 40  ALA 40  153 153 ALA ALA A . n 
A 1 41  THR 41  154 154 THR THR A . n 
A 1 42  CYS 42  155 155 CYS CYS A . n 
A 1 43  ASP 43  156 156 ASP ASP A . n 
A 1 44  LYS 44  157 157 LYS LYS A . n 
A 1 45  PRO 45  158 ?   ?   ?   A . n 
A 1 46  GLN 46  159 159 GLN GLN A . n 
A 1 47  ILE 47  160 160 ILE ILE A . n 
A 1 48  HIS 48  161 161 HIS HIS A . n 
A 1 49  PRO 49  162 162 PRO PRO A . n 
A 1 50  GLN 50  163 163 GLN GLN A . n 
A 1 51  GLU 51  164 164 GLU GLU A . n 
A 1 52  ILE 52  165 165 ILE ILE A . n 
A 1 53  ILE 53  166 166 ILE ILE A . n 
A 1 54  GLU 54  167 167 GLU GLU A . n 
A 1 55  PHE 55  168 168 PHE PHE A . n 
A 1 56  PRO 56  169 169 PRO PRO A . n 
A 1 57  ILE 57  170 170 ILE ILE A . n 
A 1 58  LEU 58  171 171 LEU LEU A . n 
A 1 59  LYS 59  172 172 LYS LYS A . n 
A 1 60  LEU 60  173 173 LEU LEU A . n 
A 1 61  ASN 61  174 174 ASN ASN A . n 
A 1 62  GLY 62  175 175 GLY GLY A . n 
A 1 63  ARG 63  176 176 ARG ARG A . n 
A 1 64  THR 64  177 177 THR THR A . n 
A 1 65  MET 65  178 178 MET MET A . n 
A 1 66  GLU 66  179 179 GLU GLU A . n 
A 1 67  ILE 67  180 180 ILE ILE A . n 
A 1 68  GLU 68  181 181 GLU GLU A . n 
A 1 69  SER 69  182 182 SER SER A . n 
A 1 70  THR 70  183 183 THR THR A . n 
A 1 71  PHE 71  184 184 PHE PHE A . n 
A 1 72  HIS 72  185 185 HIS HIS A . n 
A 1 73  MET 73  186 186 MET MET A . n 
A 1 74  TYR 74  187 187 TYR TYR A . n 
A 1 75  VAL 75  188 188 VAL VAL A . n 
A 1 76  GLN 76  189 189 GLN GLN A . n 
A 1 77  PRO 77  190 190 PRO PRO A . n 
A 1 78  VAL 78  191 191 VAL VAL A . n 
A 1 79  VAL 79  192 192 VAL VAL A . n 
A 1 80  HIS 80  193 193 HIS HIS A . n 
A 1 81  PRO 81  194 194 PRO PRO A . n 
A 1 82  GLN 82  195 195 GLN GLN A . n 
A 1 83  LEU 83  196 196 LEU LEU A . n 
A 1 84  THR 84  197 197 THR THR A . n 
A 1 85  PRO 85  198 198 PRO PRO A . n 
A 1 86  PHE 86  199 199 PHE PHE A . n 
A 1 87  CYS 87  200 200 CYS CYS A . n 
A 1 88  THR 88  201 201 THR THR A . n 
A 1 89  GLU 89  202 202 GLU GLU A . n 
A 1 90  LEU 90  203 203 LEU LEU A . n 
A 1 91  THR 91  204 204 THR THR A . n 
A 1 92  GLY 92  205 205 GLY GLY A . n 
A 1 93  ILE 93  206 206 ILE ILE A . n 
A 1 94  ILE 94  207 207 ILE ILE A . n 
A 1 95  GLN 95  208 208 GLN GLN A . n 
A 1 96  ALA 96  209 209 ALA ALA A . n 
A 1 97  MET 97  210 210 MET MET A . n 
A 1 98  VAL 98  211 211 VAL VAL A . n 
A 1 99  ASP 99  212 212 ASP ASP A . n 
A 1 100 GLY 100 213 213 GLY GLY A . n 
A 1 101 GLN 101 214 214 GLN GLN A . n 
A 1 102 PRO 102 215 215 PRO PRO A . n 
A 1 103 SER 103 216 216 SER SER A . n 
A 1 104 LEU 104 217 217 LEU LEU A . n 
A 1 105 GLN 105 218 218 GLN GLN A . n 
A 1 106 GLN 106 219 219 GLN GLN A . n 
A 1 107 VAL 107 220 220 VAL VAL A . n 
A 1 108 LEU 108 221 221 LEU LEU A . n 
A 1 109 GLU 109 222 222 GLU GLU A . n 
A 1 110 ARG 110 223 223 ARG ARG A . n 
A 1 111 VAL 111 224 224 VAL VAL A . n 
A 1 112 ASP 112 225 225 ASP ASP A . n 
A 1 113 GLU 113 226 226 GLU GLU A . n 
A 1 114 TRP 114 227 227 TRP TRP A . n 
A 1 115 MET 115 228 228 MET MET A . n 
A 1 116 ALA 116 229 229 ALA ALA A . n 
A 1 117 LYS 117 230 230 LYS LYS A . n 
A 1 118 GLU 118 231 231 GLU GLU A . n 
A 1 119 GLY 119 232 232 GLY GLY A . n 
A 1 120 LEU 120 233 233 LEU LEU A . n 
A 1 121 LEU 121 234 234 LEU LEU A . n 
A 1 122 ASP 122 235 235 ASP ASP A . n 
A 1 123 PRO 123 236 236 PRO PRO A . n 
A 1 124 ASN 124 237 237 ASN ASN A . n 
A 1 125 VAL 125 238 238 VAL VAL A . n 
A 1 126 LYS 126 239 239 LYS LYS A . n 
A 1 127 SER 127 240 240 SER SER A . n 
A 1 128 ILE 128 241 241 ILE ILE A . n 
A 1 129 PHE 129 242 242 PHE PHE A . n 
A 1 130 VAL 130 243 243 VAL VAL A . n 
A 1 131 THR 131 244 244 THR THR A . n 
A 1 132 CYS 132 245 245 CYS CYS A . n 
A 1 133 GLY 133 246 246 GLY GLY A . n 
A 1 134 ASP 134 247 247 ASP ASP A . n 
A 1 135 TRP 135 248 248 TRP TRP A . n 
A 1 136 ASP 136 249 249 ASP ASP A . n 
A 1 137 LEU 137 250 250 LEU LEU A . n 
A 1 138 LYS 138 251 251 LYS LYS A . n 
A 1 139 VAL 139 252 252 VAL VAL A . n 
A 1 140 MET 140 253 253 MET MET A . n 
A 1 141 LEU 141 254 254 LEU LEU A . n 
A 1 142 PRO 142 255 255 PRO PRO A . n 
A 1 143 GLY 143 256 256 GLY GLY A . n 
A 1 144 GLN 144 257 257 GLN GLN A . n 
A 1 145 CYS 145 258 258 CYS CYS A . n 
A 1 146 GLN 146 259 259 GLN GLN A . n 
A 1 147 TYR 147 260 260 TYR TYR A . n 
A 1 148 LEU 148 261 261 LEU LEU A . n 
A 1 149 GLY 149 262 262 GLY GLY A . n 
A 1 150 LEU 150 263 263 LEU LEU A . n 
A 1 151 PRO 151 264 264 PRO PRO A . n 
A 1 152 VAL 152 265 265 VAL VAL A . n 
A 1 153 ALA 153 266 266 ALA ALA A . n 
A 1 154 ASP 154 267 267 ASP ASP A . n 
A 1 155 TYR 155 268 268 TYR TYR A . n 
A 1 156 PHE 156 269 269 PHE PHE A . n 
A 1 157 LYS 157 270 270 LYS LYS A . n 
A 1 158 GLN 158 271 271 GLN GLN A . n 
A 1 159 TRP 159 272 272 TRP TRP A . n 
A 1 160 ILE 160 273 273 ILE ILE A . n 
A 1 161 ASN 161 274 274 ASN ASN A . n 
A 1 162 LEU 162 275 275 LEU LEU A . n 
A 1 163 LYS 163 276 276 LYS LYS A . n 
A 1 164 LYS 164 277 277 LYS LYS A . n 
A 1 165 ALA 165 278 278 ALA ALA A . n 
A 1 166 TYR 166 279 279 TYR TYR A . n 
A 1 167 SER 167 280 280 SER SER A . n 
A 1 168 PHE 168 281 281 PHE PHE A . n 
A 1 169 ALA 169 282 282 ALA ALA A . n 
A 1 170 MET 170 283 283 MET MET A . n 
A 1 171 GLY 171 284 284 GLY GLY A . n 
A 1 172 CYS 172 285 285 CYS CYS A . n 
A 1 173 TRP 173 286 286 TRP TRP A . n 
A 1 174 PRO 174 287 287 PRO PRO A . n 
A 1 175 LYS 175 288 288 LYS LYS A . n 
A 1 176 ASN 176 289 289 ASN ASN A . n 
A 1 177 GLY 177 290 290 GLY GLY A . n 
A 1 178 LEU 178 291 291 LEU LEU A . n 
A 1 179 LEU 179 292 292 LEU LEU A . n 
A 1 180 ASP 180 293 293 ASP ASP A . n 
A 1 181 MET 181 294 294 MET MET A . n 
A 1 182 ASN 182 295 295 ASN ASN A . n 
A 1 183 LYS 183 296 296 LYS LYS A . n 
A 1 184 GLY 184 297 297 GLY GLY A . n 
A 1 185 LEU 185 298 298 LEU LEU A . n 
A 1 186 SER 186 299 299 SER SER A . n 
A 1 187 LEU 187 300 300 LEU LEU A . n 
A 1 188 GLN 188 301 301 GLN GLN A . n 
A 1 189 HIS 189 302 302 HIS HIS A . n 
A 1 190 ILE 190 303 303 ILE ILE A . n 
A 1 191 GLY 191 304 304 GLY GLY A . n 
A 1 192 ARG 192 305 305 ARG ARG A . n 
A 1 193 PRO 193 306 306 PRO PRO A . n 
A 1 194 HIS 194 307 307 HIS HIS A . n 
A 1 195 SER 195 308 308 SER SER A . n 
A 1 196 GLY 196 309 309 GLY GLY A . n 
A 1 197 ILE 197 310 310 ILE ILE A . n 
A 1 198 ASP 198 311 311 ASP ASP A . n 
A 1 199 ASP 199 312 312 ASP ASP A . n 
A 1 200 CYS 200 313 313 CYS CYS A . n 
A 1 201 LYS 201 314 314 LYS LYS A . n 
A 1 202 ASN 202 315 315 ASN ASN A . n 
A 1 203 ILE 203 316 316 ILE ILE A . n 
A 1 204 ALA 204 317 317 ALA ALA A . n 
A 1 205 ASN 205 318 318 ASN ASN A . n 
A 1 206 ILE 206 319 319 ILE ILE A . n 
A 1 207 MET 207 320 320 MET MET A . n 
A 1 208 LYS 208 321 321 LYS LYS A . n 
A 1 209 THR 209 322 322 THR THR A . n 
A 1 210 LEU 210 323 323 LEU LEU A . n 
A 1 211 ALA 211 324 324 ALA ALA A . n 
A 1 212 TYR 212 325 325 TYR TYR A . n 
A 1 213 ARG 213 326 326 ARG ARG A . n 
A 1 214 GLY 214 327 327 GLY GLY A . n 
A 1 215 PHE 215 328 328 PHE PHE A . n 
A 1 216 ILE 216 329 329 ILE ILE A . n 
A 1 217 PHE 217 330 330 PHE PHE A . n 
A 1 218 LYS 218 331 331 LYS LYS A . n 
A 1 219 GLN 219 332 332 GLN GLN A . n 
A 1 220 THR 220 333 333 THR THR A . n 
A 1 221 SER 221 334 334 SER SER A . n 
A 1 222 LYS 222 335 335 LYS LYS A . n 
A 1 223 PRO 223 336 336 PRO PRO A . n 
A 1 224 PHE 224 337 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   1337 1337 MG  MG  A . 
C 3 GOL 1   1338 1338 GOL GOL A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2051 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? A ASP 37  ? A ASP 150 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 OE2 ? A GLU 39  ? A GLU 152  ? 1_555 111.8 ? 
2 OD2 ? A ASP 37  ? A ASP 150 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 OD2 ? A ASP 199 ? A ASP 312  ? 1_555 98.1  ? 
3 OE2 ? A GLU 39  ? A GLU 152 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 OD2 ? A ASP 199 ? A ASP 312  ? 1_555 122.9 ? 
4 OD2 ? A ASP 37  ? A ASP 150 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 O   ? D HOH .   ? A HOH 2020 ? 1_555 112.6 ? 
5 OE2 ? A GLU 39  ? A GLU 152 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 O   ? D HOH .   ? A HOH 2020 ? 1_555 95.0  ? 
6 OD2 ? A ASP 199 ? A ASP 312 ? 1_555 MG ? B MG . ? A MG 1337 ? 1_555 O   ? D HOH .   ? A HOH 2020 ? 1_555 117.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-09-29 
2 'Structure model' 1 1 2013-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Source and taxonomy'       
3 2 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         13.9803 
_pdbx_refine_tls.origin_y         12.7294 
_pdbx_refine_tls.origin_z         -19.0152 
_pdbx_refine_tls.T[1][1]          -0.0941 
_pdbx_refine_tls.T[2][2]          -0.0859 
_pdbx_refine_tls.T[3][3]          -0.0636 
_pdbx_refine_tls.T[1][2]          0.0050 
_pdbx_refine_tls.T[1][3]          0.0056 
_pdbx_refine_tls.T[2][3]          0.0050 
_pdbx_refine_tls.L[1][1]          1.1828 
_pdbx_refine_tls.L[2][2]          1.3032 
_pdbx_refine_tls.L[3][3]          3.2473 
_pdbx_refine_tls.L[1][2]          -0.1519 
_pdbx_refine_tls.L[1][3]          -1.2247 
_pdbx_refine_tls.L[2][3]          0.2991 
_pdbx_refine_tls.S[1][1]          -0.0732 
_pdbx_refine_tls.S[1][2]          -0.0861 
_pdbx_refine_tls.S[1][3]          -0.0818 
_pdbx_refine_tls.S[2][1]          -0.0400 
_pdbx_refine_tls.S[2][2]          -0.0033 
_pdbx_refine_tls.S[2][3]          -0.1825 
_pdbx_refine_tls.S[3][1]          0.1775 
_pdbx_refine_tls.S[3][2]          0.1615 
_pdbx_refine_tls.S[3][3]          0.0765 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     130 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     336 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019 ? 1 
XDS    'data reduction' .        ? 2 
XSCALE 'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    214 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2054 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    VAL 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     252 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -125.02 
_pdbx_validate_torsion.psi             -56.03 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 114 ? A MET 1   
2  1 Y 1 A HIS 115 ? A HIS 2   
3  1 Y 1 A HIS 116 ? A HIS 3   
4  1 Y 1 A HIS 117 ? A HIS 4   
5  1 Y 1 A HIS 118 ? A HIS 5   
6  1 Y 1 A HIS 119 ? A HIS 6   
7  1 Y 1 A HIS 120 ? A HIS 7   
8  1 Y 1 A SER 121 ? A SER 8   
9  1 Y 1 A SER 122 ? A SER 9   
10 1 Y 1 A GLY 123 ? A GLY 10  
11 1 Y 1 A VAL 124 ? A VAL 11  
12 1 Y 1 A ASP 125 ? A ASP 12  
13 1 Y 1 A LEU 126 ? A LEU 13  
14 1 Y 1 A GLY 127 ? A GLY 14  
15 1 Y 1 A THR 128 ? A THR 15  
16 1 Y 1 A GLU 129 ? A GLU 16  
17 1 Y 1 A PRO 158 ? A PRO 45  
18 1 Y 1 A PHE 337 ? A PHE 224 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 GLYCEROL        GOL 
4 water           HOH 
#