data_2XTJ
# 
_entry.id   2XTJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XTJ         
PDBE  EBI-45730    
WWPDB D_1290045730 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2W2N unspecified 'WT PCSK9-DELTAC BOUND TO EGF-A H306Y MUTANT OF LDLR'  
PDB 2W2P unspecified 'PCSK9-DELTAC D374A MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2M unspecified 'WT PCSK9-DELTAC BOUND TO WT EGF-A OF LDLR'            
PDB 2W2O unspecified 'PCSK9-DELTAC D374Y MUTANT BOUND TO WT EGF -A OF LDLR' 
PDB 2W2Q unspecified 'PCSK9-DELTAC D374H MUTANT BOUND TO WT EGF -A OF LDLR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XTJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Di Marco, S.' 1 
'Volpari, C.'  2 
'Carfi, A.'    3 
# 
_citation.id                        primary 
_citation.title                     
'A Pcsk9-Binding Antibody that Structurally Mimics the Egf(A) Domain of Ldl-Receptor Reduces Ldl Cholesterol in Vivo.' 
_citation.journal_abbrev            'J.Lipid Res.' 
_citation.journal_volume            52 
_citation.page_first                78 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           JLPRAW 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2275 
_citation.journal_id_CSD            0484 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20959675 
_citation.pdbx_database_id_DOI      10.1194/JLR.M011445 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ni, Y.G.'        1  ? 
primary 'Di Marco, S.'    2  ? 
primary 'Condra, J.H.'    3  ? 
primary 'Peterson, L.B.'  4  ? 
primary 'Wang, W.'        5  ? 
primary 'Wang, F.'        6  ? 
primary 'Pandit, S.'      7  ? 
primary 'Hammond, H.A.'   8  ? 
primary 'Rosa, R.'        9  ? 
primary 'Cummings, R.T.'  10 ? 
primary 'Wood, D.D.'      11 ? 
primary 'Liu, X.'         12 ? 
primary 'Bottomley, M.J.' 13 ? 
primary 'Shen, X.'        14 ? 
primary 'Cubbon, R.M.'    15 ? 
primary 'Wang, S.P.'      16 ? 
primary 'Johns, D.G.'     17 ? 
primary 'Volpari, C.'     18 ? 
primary 'Hamuro, L.'      19 ? 
primary 'Chin, J.'        20 ? 
primary 'Huang, L.'       21 ? 
primary 'Zhao, J.Z.'      22 ? 
primary 'Vitelli, S.'     23 ? 
primary 'Haytko, P.'      24 ? 
primary 'Wisniewski, D.'  25 ? 
primary 'Mitnaul, L.J.'   26 ? 
primary 'Sparrow, C.P.'   27 ? 
primary 'Hubbard, B.'     28 ? 
primary 'Carfi, A.'       29 ? 
primary 'Sitlani, A.'     30 ? 
# 
_cell.entry_id           2XTJ 
_cell.length_a           66.589 
_cell.length_b           67.834 
_cell.length_c           250.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XTJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9' 33083.238 1   3.4.21.- ? 'CATALYTIC DOMAIN, RESIDUES 153-451' ? 
2 polymer     man 'FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05'    11568.840 1   ?        ? 
'LIGHT CHAIN VARIABLE DOMAIN, RESIDUES 1-107'   ? 
3 polymer     man 'FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05'    11588.751 1   ?        ? 
'LIGHT CHAIN CONSTANT DOMAIN, RESIDUES 108-213' ? 
4 polymer     man 'FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05'    14359.157 1   ?        ? 
'HEAVY CHAIN VARIABLE DOMAIN, RESIDUES 1-131'   ? 
5 polymer     man 'FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05'    13113.582 1   ?        ? 
'HEAVY CHAIN CONSTANT DOMAIN, RESIDUES 132-233' ? 
6 polymer     man 'PROPROTEIN CONVERTASE SUBTILISIN-KEXIN TYPE 9' 12679.604 1   3.4.21.- ? 'PRODOMAIN, RESIDUES 53-152' ? 
7 non-polymer syn 'CALCIUM ION'                                   40.078    1   ?        ? ? ? 
8 water       nat water                                           18.015    199 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PCSK9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9' 
6 'PCSK9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLILFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
;SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAG
VVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLV
TAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHV
AGIAAMMLSAEPELTLAELRQRLILFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAAGTAAASHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;DIQMTQSPSSLSASVGDRVTITCRASQGIRSALNWYQQKPGKAPKLLIYNGSTLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFAVYYCQQFDGDPTFGQGTKVEIKR
;
;DIQMTQSPSSLSASVGDRVTITCRASQGIRSALNWYQQKPGKAPKLLIYNGSTLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFAVYYCQQFDGDPTFGQGTKVEIKR
;
B ? 
3 'polypeptide(L)' no no 
;TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEA
;
;TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEK
HKVYACEVTHQGLSSPVTKSFNRGEA
;
C ? 
4 'polypeptide(L)' no no 
;QVQLVQSGAEVKKPGSSVKVSCKASGGTFNSHAISWVRQAPGQGLEWMGGINPILGIANYAQKFQGRVTITADESTSTAY
MELSSLRSEDTAVYYCARHYEIQIGRYGMNVYYLMYRFASWGQGTLVTVSS
;
;QVQLVQSGAEVKKPGSSVKVSCKASGGTFNSHAISWVRQAPGQGLEWMGGINPILGIANYAQKFQGRVTITADESTSTAY
MELSSLRSEDTAVYYCARHYEIQIGRYGMNVYYLMYRFASWGQGTLVTVSS
;
D ? 
5 'polypeptide(L)' no no 
;ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSEFEQKLISEEDLNGAPHHHHHH
;
;ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPKSEFEQKLISEEDLNGAPHHHHHH
;
E ? 
6 'polypeptide(L)' no no 
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
;MKGSKGSKGSKPMSAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGL
LPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
;
P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ILE n 
1 3   PRO n 
1 4   TRP n 
1 5   ASN n 
1 6   LEU n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  THR n 
1 11  PRO n 
1 12  PRO n 
1 13  ARG n 
1 14  TYR n 
1 15  ARG n 
1 16  ALA n 
1 17  ASP n 
1 18  GLU n 
1 19  TYR n 
1 20  GLN n 
1 21  PRO n 
1 22  PRO n 
1 23  ASP n 
1 24  GLY n 
1 25  GLY n 
1 26  SER n 
1 27  LEU n 
1 28  VAL n 
1 29  GLU n 
1 30  VAL n 
1 31  TYR n 
1 32  LEU n 
1 33  LEU n 
1 34  ASP n 
1 35  THR n 
1 36  SER n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  ASP n 
1 41  HIS n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  VAL n 
1 49  MET n 
1 50  VAL n 
1 51  THR n 
1 52  ASP n 
1 53  PHE n 
1 54  GLU n 
1 55  ASN n 
1 56  VAL n 
1 57  PRO n 
1 58  GLU n 
1 59  GLU n 
1 60  ASP n 
1 61  GLY n 
1 62  THR n 
1 63  ARG n 
1 64  PHE n 
1 65  HIS n 
1 66  ARG n 
1 67  GLN n 
1 68  ALA n 
1 69  SER n 
1 70  LYS n 
1 71  CYS n 
1 72  ASP n 
1 73  SER n 
1 74  HIS n 
1 75  GLY n 
1 76  THR n 
1 77  HIS n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  VAL n 
1 82  VAL n 
1 83  SER n 
1 84  GLY n 
1 85  ARG n 
1 86  ASP n 
1 87  ALA n 
1 88  GLY n 
1 89  VAL n 
1 90  ALA n 
1 91  LYS n 
1 92  GLY n 
1 93  ALA n 
1 94  SER n 
1 95  MET n 
1 96  ARG n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 VAL n 
1 101 LEU n 
1 102 ASN n 
1 103 CYS n 
1 104 GLN n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 THR n 
1 109 VAL n 
1 110 SER n 
1 111 GLY n 
1 112 THR n 
1 113 LEU n 
1 114 ILE n 
1 115 GLY n 
1 116 LEU n 
1 117 GLU n 
1 118 PHE n 
1 119 ILE n 
1 120 ARG n 
1 121 LYS n 
1 122 SER n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLN n 
1 127 PRO n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 LEU n 
1 132 VAL n 
1 133 VAL n 
1 134 LEU n 
1 135 LEU n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 GLY n 
1 140 GLY n 
1 141 TYR n 
1 142 SER n 
1 143 ARG n 
1 144 VAL n 
1 145 LEU n 
1 146 ASN n 
1 147 ALA n 
1 148 ALA n 
1 149 CYS n 
1 150 GLN n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 ARG n 
1 155 ALA n 
1 156 GLY n 
1 157 VAL n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 THR n 
1 162 ALA n 
1 163 ALA n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 ARG n 
1 168 ASP n 
1 169 ASP n 
1 170 ALA n 
1 171 CYS n 
1 172 LEU n 
1 173 TYR n 
1 174 SER n 
1 175 PRO n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 VAL n 
1 182 ILE n 
1 183 THR n 
1 184 VAL n 
1 185 GLY n 
1 186 ALA n 
1 187 THR n 
1 188 ASN n 
1 189 ALA n 
1 190 GLN n 
1 191 ASP n 
1 192 GLN n 
1 193 PRO n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 THR n 
1 199 LEU n 
1 200 GLY n 
1 201 THR n 
1 202 ASN n 
1 203 PHE n 
1 204 GLY n 
1 205 ARG n 
1 206 CYS n 
1 207 VAL n 
1 208 ASP n 
1 209 LEU n 
1 210 PHE n 
1 211 ALA n 
1 212 PRO n 
1 213 GLY n 
1 214 GLU n 
1 215 ASP n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 ALA n 
1 220 SER n 
1 221 SER n 
1 222 ASP n 
1 223 CYS n 
1 224 SER n 
1 225 THR n 
1 226 CYS n 
1 227 PHE n 
1 228 VAL n 
1 229 SER n 
1 230 GLN n 
1 231 SER n 
1 232 GLY n 
1 233 THR n 
1 234 SER n 
1 235 GLN n 
1 236 ALA n 
1 237 ALA n 
1 238 ALA n 
1 239 HIS n 
1 240 VAL n 
1 241 ALA n 
1 242 GLY n 
1 243 ILE n 
1 244 ALA n 
1 245 ALA n 
1 246 MET n 
1 247 MET n 
1 248 LEU n 
1 249 SER n 
1 250 ALA n 
1 251 GLU n 
1 252 PRO n 
1 253 GLU n 
1 254 LEU n 
1 255 THR n 
1 256 LEU n 
1 257 ALA n 
1 258 GLU n 
1 259 LEU n 
1 260 ARG n 
1 261 GLN n 
1 262 ARG n 
1 263 LEU n 
1 264 ILE n 
1 265 LEU n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 LYS n 
1 270 ASP n 
1 271 VAL n 
1 272 ILE n 
1 273 ASN n 
1 274 GLU n 
1 275 ALA n 
1 276 TRP n 
1 277 PHE n 
1 278 PRO n 
1 279 GLU n 
1 280 ASP n 
1 281 GLN n 
1 282 ARG n 
1 283 VAL n 
1 284 LEU n 
1 285 THR n 
1 286 PRO n 
1 287 ASN n 
1 288 LEU n 
1 289 VAL n 
1 290 ALA n 
1 291 ALA n 
1 292 LEU n 
1 293 PRO n 
1 294 PRO n 
1 295 SER n 
1 296 THR n 
1 297 HIS n 
1 298 GLY n 
1 299 ALA n 
1 300 ALA n 
1 301 GLY n 
1 302 THR n 
1 303 ALA n 
1 304 ALA n 
1 305 ALA n 
1 306 SER n 
1 307 HIS n 
1 308 HIS n 
1 309 HIS n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
2 1   ASP n 
2 2   ILE n 
2 3   GLN n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   SER n 
2 10  SER n 
2 11  LEU n 
2 12  SER n 
2 13  ALA n 
2 14  SER n 
2 15  VAL n 
2 16  GLY n 
2 17  ASP n 
2 18  ARG n 
2 19  VAL n 
2 20  THR n 
2 21  ILE n 
2 22  THR n 
2 23  CYS n 
2 24  ARG n 
2 25  ALA n 
2 26  SER n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  ARG n 
2 31  SER n 
2 32  ALA n 
2 33  LEU n 
2 34  ASN n 
2 35  TRP n 
2 36  TYR n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  GLY n 
2 42  LYS n 
2 43  ALA n 
2 44  PRO n 
2 45  LYS n 
2 46  LEU n 
2 47  LEU n 
2 48  ILE n 
2 49  TYR n 
2 50  ASN n 
2 51  GLY n 
2 52  SER n 
2 53  THR n 
2 54  LEU n 
2 55  GLN n 
2 56  SER n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  SER n 
2 61  ARG n 
2 62  PHE n 
2 63  SER n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  GLY n 
2 69  THR n 
2 70  ASP n 
2 71  PHE n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  LEU n 
2 79  GLN n 
2 80  PRO n 
2 81  GLU n 
2 82  ASP n 
2 83  PHE n 
2 84  ALA n 
2 85  VAL n 
2 86  TYR n 
2 87  TYR n 
2 88  CYS n 
2 89  GLN n 
2 90  GLN n 
2 91  PHE n 
2 92  ASP n 
2 93  GLY n 
2 94  ASP n 
2 95  PRO n 
2 96  THR n 
2 97  PHE n 
2 98  GLY n 
2 99  GLN n 
2 100 GLY n 
2 101 THR n 
2 102 LYS n 
2 103 VAL n 
2 104 GLU n 
2 105 ILE n 
2 106 LYS n 
2 107 ARG n 
3 1   THR n 
3 2   VAL n 
3 3   ALA n 
3 4   ALA n 
3 5   PRO n 
3 6   SER n 
3 7   VAL n 
3 8   PHE n 
3 9   ILE n 
3 10  PHE n 
3 11  PRO n 
3 12  PRO n 
3 13  SER n 
3 14  ASP n 
3 15  GLU n 
3 16  GLN n 
3 17  LEU n 
3 18  LYS n 
3 19  SER n 
3 20  GLY n 
3 21  THR n 
3 22  ALA n 
3 23  SER n 
3 24  VAL n 
3 25  VAL n 
3 26  CYS n 
3 27  LEU n 
3 28  LEU n 
3 29  ASN n 
3 30  ASN n 
3 31  PHE n 
3 32  TYR n 
3 33  PRO n 
3 34  ARG n 
3 35  GLU n 
3 36  ALA n 
3 37  LYS n 
3 38  VAL n 
3 39  GLN n 
3 40  TRP n 
3 41  LYS n 
3 42  VAL n 
3 43  ASP n 
3 44  ASN n 
3 45  ALA n 
3 46  LEU n 
3 47  GLN n 
3 48  SER n 
3 49  GLY n 
3 50  ASN n 
3 51  SER n 
3 52  GLN n 
3 53  GLU n 
3 54  SER n 
3 55  VAL n 
3 56  THR n 
3 57  GLU n 
3 58  GLN n 
3 59  ASP n 
3 60  SER n 
3 61  LYS n 
3 62  ASP n 
3 63  SER n 
3 64  THR n 
3 65  TYR n 
3 66  SER n 
3 67  LEU n 
3 68  SER n 
3 69  SER n 
3 70  THR n 
3 71  LEU n 
3 72  THR n 
3 73  LEU n 
3 74  SER n 
3 75  LYS n 
3 76  ALA n 
3 77  ASP n 
3 78  TYR n 
3 79  GLU n 
3 80  LYS n 
3 81  HIS n 
3 82  LYS n 
3 83  VAL n 
3 84  TYR n 
3 85  ALA n 
3 86  CYS n 
3 87  GLU n 
3 88  VAL n 
3 89  THR n 
3 90  HIS n 
3 91  GLN n 
3 92  GLY n 
3 93  LEU n 
3 94  SER n 
3 95  SER n 
3 96  PRO n 
3 97  VAL n 
3 98  THR n 
3 99  LYS n 
3 100 SER n 
3 101 PHE n 
3 102 ASN n 
3 103 ARG n 
3 104 GLY n 
3 105 GLU n 
3 106 ALA n 
4 1   GLN n 
4 2   VAL n 
4 3   GLN n 
4 4   LEU n 
4 5   VAL n 
4 6   GLN n 
4 7   SER n 
4 8   GLY n 
4 9   ALA n 
4 10  GLU n 
4 11  VAL n 
4 12  LYS n 
4 13  LYS n 
4 14  PRO n 
4 15  GLY n 
4 16  SER n 
4 17  SER n 
4 18  VAL n 
4 19  LYS n 
4 20  VAL n 
4 21  SER n 
4 22  CYS n 
4 23  LYS n 
4 24  ALA n 
4 25  SER n 
4 26  GLY n 
4 27  GLY n 
4 28  THR n 
4 29  PHE n 
4 30  ASN n 
4 31  SER n 
4 32  HIS n 
4 33  ALA n 
4 34  ILE n 
4 35  SER n 
4 36  TRP n 
4 37  VAL n 
4 38  ARG n 
4 39  GLN n 
4 40  ALA n 
4 41  PRO n 
4 42  GLY n 
4 43  GLN n 
4 44  GLY n 
4 45  LEU n 
4 46  GLU n 
4 47  TRP n 
4 48  MET n 
4 49  GLY n 
4 50  GLY n 
4 51  ILE n 
4 52  ASN n 
4 53  PRO n 
4 54  ILE n 
4 55  LEU n 
4 56  GLY n 
4 57  ILE n 
4 58  ALA n 
4 59  ASN n 
4 60  TYR n 
4 61  ALA n 
4 62  GLN n 
4 63  LYS n 
4 64  PHE n 
4 65  GLN n 
4 66  GLY n 
4 67  ARG n 
4 68  VAL n 
4 69  THR n 
4 70  ILE n 
4 71  THR n 
4 72  ALA n 
4 73  ASP n 
4 74  GLU n 
4 75  SER n 
4 76  THR n 
4 77  SER n 
4 78  THR n 
4 79  ALA n 
4 80  TYR n 
4 81  MET n 
4 82  GLU n 
4 83  LEU n 
4 84  SER n 
4 85  SER n 
4 86  LEU n 
4 87  ARG n 
4 88  SER n 
4 89  GLU n 
4 90  ASP n 
4 91  THR n 
4 92  ALA n 
4 93  VAL n 
4 94  TYR n 
4 95  TYR n 
4 96  CYS n 
4 97  ALA n 
4 98  ARG n 
4 99  HIS n 
4 100 TYR n 
4 101 GLU n 
4 102 ILE n 
4 103 GLN n 
4 104 ILE n 
4 105 GLY n 
4 106 ARG n 
4 107 TYR n 
4 108 GLY n 
4 109 MET n 
4 110 ASN n 
4 111 VAL n 
4 112 TYR n 
4 113 TYR n 
4 114 LEU n 
4 115 MET n 
4 116 TYR n 
4 117 ARG n 
4 118 PHE n 
4 119 ALA n 
4 120 SER n 
4 121 TRP n 
4 122 GLY n 
4 123 GLN n 
4 124 GLY n 
4 125 THR n 
4 126 LEU n 
4 127 VAL n 
4 128 THR n 
4 129 VAL n 
4 130 SER n 
4 131 SER n 
5 1   ALA n 
5 2   SER n 
5 3   THR n 
5 4   LYS n 
5 5   GLY n 
5 6   PRO n 
5 7   SER n 
5 8   VAL n 
5 9   PHE n 
5 10  PRO n 
5 11  LEU n 
5 12  ALA n 
5 13  PRO n 
5 14  SER n 
5 15  SER n 
5 16  LYS n 
5 17  SER n 
5 18  THR n 
5 19  SER n 
5 20  GLY n 
5 21  GLY n 
5 22  THR n 
5 23  ALA n 
5 24  ALA n 
5 25  LEU n 
5 26  GLY n 
5 27  CYS n 
5 28  LEU n 
5 29  VAL n 
5 30  LYS n 
5 31  ASP n 
5 32  TYR n 
5 33  PHE n 
5 34  PRO n 
5 35  GLU n 
5 36  PRO n 
5 37  VAL n 
5 38  THR n 
5 39  VAL n 
5 40  SER n 
5 41  TRP n 
5 42  ASN n 
5 43  SER n 
5 44  GLY n 
5 45  ALA n 
5 46  LEU n 
5 47  THR n 
5 48  SER n 
5 49  GLY n 
5 50  VAL n 
5 51  HIS n 
5 52  THR n 
5 53  PHE n 
5 54  PRO n 
5 55  ALA n 
5 56  VAL n 
5 57  LEU n 
5 58  GLN n 
5 59  SER n 
5 60  SER n 
5 61  GLY n 
5 62  LEU n 
5 63  TYR n 
5 64  SER n 
5 65  LEU n 
5 66  SER n 
5 67  SER n 
5 68  VAL n 
5 69  VAL n 
5 70  THR n 
5 71  VAL n 
5 72  PRO n 
5 73  SER n 
5 74  SER n 
5 75  SER n 
5 76  LEU n 
5 77  GLY n 
5 78  THR n 
5 79  GLN n 
5 80  THR n 
5 81  TYR n 
5 82  ILE n 
5 83  CYS n 
5 84  ASN n 
5 85  VAL n 
5 86  ASN n 
5 87  HIS n 
5 88  LYS n 
5 89  PRO n 
5 90  SER n 
5 91  ASN n 
5 92  THR n 
5 93  LYS n 
5 94  VAL n 
5 95  ASP n 
5 96  LYS n 
5 97  LYS n 
5 98  VAL n 
5 99  GLU n 
5 100 PRO n 
5 101 LYS n 
5 102 SER n 
5 103 GLU n 
5 104 PHE n 
5 105 GLU n 
5 106 GLN n 
5 107 LYS n 
5 108 LEU n 
5 109 ILE n 
5 110 SER n 
5 111 GLU n 
5 112 GLU n 
5 113 ASP n 
5 114 LEU n 
5 115 ASN n 
5 116 GLY n 
5 117 ALA n 
5 118 PRO n 
5 119 HIS n 
5 120 HIS n 
5 121 HIS n 
5 122 HIS n 
5 123 HIS n 
5 124 HIS n 
6 1   MET n 
6 2   LYS n 
6 3   GLY n 
6 4   SER n 
6 5   LYS n 
6 6   GLY n 
6 7   SER n 
6 8   LYS n 
6 9   GLY n 
6 10  SER n 
6 11  LYS n 
6 12  PRO n 
6 13  MET n 
6 14  SER n 
6 15  ALA n 
6 16  GLU n 
6 17  ALA n 
6 18  PRO n 
6 19  GLU n 
6 20  HIS n 
6 21  GLY n 
6 22  THR n 
6 23  THR n 
6 24  ALA n 
6 25  THR n 
6 26  PHE n 
6 27  HIS n 
6 28  ARG n 
6 29  CYS n 
6 30  ALA n 
6 31  LYS n 
6 32  ASP n 
6 33  PRO n 
6 34  TRP n 
6 35  ARG n 
6 36  LEU n 
6 37  PRO n 
6 38  GLY n 
6 39  THR n 
6 40  TYR n 
6 41  VAL n 
6 42  VAL n 
6 43  VAL n 
6 44  LEU n 
6 45  LYS n 
6 46  GLU n 
6 47  GLU n 
6 48  THR n 
6 49  HIS n 
6 50  LEU n 
6 51  SER n 
6 52  GLN n 
6 53  SER n 
6 54  GLU n 
6 55  ARG n 
6 56  THR n 
6 57  ALA n 
6 58  ARG n 
6 59  ARG n 
6 60  LEU n 
6 61  GLN n 
6 62  ALA n 
6 63  GLN n 
6 64  ALA n 
6 65  ALA n 
6 66  ARG n 
6 67  ARG n 
6 68  GLY n 
6 69  TYR n 
6 70  LEU n 
6 71  THR n 
6 72  LYS n 
6 73  ILE n 
6 74  LEU n 
6 75  HIS n 
6 76  VAL n 
6 77  PHE n 
6 78  HIS n 
6 79  GLY n 
6 80  LEU n 
6 81  LEU n 
6 82  PRO n 
6 83  GLY n 
6 84  PHE n 
6 85  LEU n 
6 86  VAL n 
6 87  LYS n 
6 88  MET n 
6 89  SER n 
6 90  GLY n 
6 91  ASP n 
6 92  LEU n 
6 93  LEU n 
6 94  GLU n 
6 95  LEU n 
6 96  ALA n 
6 97  LEU n 
6 98  LYS n 
6 99  LEU n 
6 100 PRO n 
6 101 HIS n 
6 102 VAL n 
6 103 ASP n 
6 104 TYR n 
6 105 ILE n 
6 106 GLU n 
6 107 GLU n 
6 108 ASP n 
6 109 SER n 
6 110 SER n 
6 111 VAL n 
6 112 PHE n 
6 113 ALA n 
6 114 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? PLASMID ? ? ? PETM-10  ? ?                                                    
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? PLASMID ? ? ? PMORPHX9 ? 'HUMAN COMBINATORIAL ANTIBODY PHAGE DISPLAY LIBRARY' 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? ?       ? ? ? PMORPHX9 ? 'HUMAN COMBINATORIAL ANTIBODY PHAGE DISPLAY LIBRARY' 
4 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? PLASMID ? ? ? PMORPHX9 ? 'HUMAN COMBINATORIAL ANTIBODY PHAGE DISPLAY LIBRARY' 
5 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? PLASMID ? ? ? PMORPHX9 ? 'HUMAN COMBINATORIAL ANTIBODY PHAGE DISPLAY LIBRARY' 
6 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? PLASMID ? ? ? PETM-10  ? ?                                                    
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PCSK9_HUMAN 1 ? ? Q8NBP7 ? 
2 PDB 2XTJ        2 ? ? 2XTJ   ? 
3 PDB 2XTJ        3 ? ? 2XTJ   ? 
4 PDB 2XTJ        4 ? ? 2XTJ   ? 
5 PDB 2XTJ        5 ? ? 2XTJ   ? 
6 UNP PCSK9_HUMAN 6 ? ? Q8NBP7 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XTJ A 1  ? 299 ? Q8NBP7 153 ? 451 ? 153 451 
2 2 2XTJ B 1  ? 107 ? 2XTJ   1   ? 107 ? 1   107 
3 3 2XTJ C 1  ? 106 ? 2XTJ   108 ? 213 ? 108 213 
4 4 2XTJ D 1  ? 131 ? 2XTJ   1   ? 131 ? 1   131 
5 5 2XTJ E 1  ? 102 ? 2XTJ   132 ? 233 ? 132 233 
6 6 2XTJ P 15 ? 114 ? Q8NBP7 53  ? 152 ? 53  152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XTJ LEU A 265 ? UNP Q8NBP7 HIS 417 'SEE REMARK 999' 417 1  
1 2XTJ ALA A 300 ? UNP Q8NBP7 ?   ?   'expression tag' 452 2  
1 2XTJ GLY A 301 ? UNP Q8NBP7 ?   ?   'expression tag' 453 3  
1 2XTJ THR A 302 ? UNP Q8NBP7 ?   ?   'expression tag' 454 4  
1 2XTJ ALA A 303 ? UNP Q8NBP7 ?   ?   'expression tag' 455 5  
1 2XTJ ALA A 304 ? UNP Q8NBP7 ?   ?   'expression tag' 456 6  
1 2XTJ ALA A 305 ? UNP Q8NBP7 ?   ?   'expression tag' 457 7  
1 2XTJ SER A 306 ? UNP Q8NBP7 ?   ?   'expression tag' 458 8  
1 2XTJ HIS A 307 ? UNP Q8NBP7 ?   ?   'expression tag' 459 9  
1 2XTJ HIS A 308 ? UNP Q8NBP7 ?   ?   'expression tag' 460 10 
1 2XTJ HIS A 309 ? UNP Q8NBP7 ?   ?   'expression tag' 461 11 
1 2XTJ HIS A 310 ? UNP Q8NBP7 ?   ?   'expression tag' 462 12 
1 2XTJ HIS A 311 ? UNP Q8NBP7 ?   ?   'expression tag' 463 13 
1 2XTJ HIS A 312 ? UNP Q8NBP7 ?   ?   'expression tag' 464 14 
6 2XTJ MET P 1   ? UNP Q8NBP7 ?   ?   'expression tag' 39  15 
6 2XTJ LYS P 2   ? UNP Q8NBP7 ?   ?   'expression tag' 40  16 
6 2XTJ GLY P 3   ? UNP Q8NBP7 ?   ?   'expression tag' 41  17 
6 2XTJ SER P 4   ? UNP Q8NBP7 ?   ?   'expression tag' 42  18 
6 2XTJ LYS P 5   ? UNP Q8NBP7 ?   ?   'expression tag' 43  19 
6 2XTJ GLY P 6   ? UNP Q8NBP7 ?   ?   'expression tag' 44  20 
6 2XTJ SER P 7   ? UNP Q8NBP7 ?   ?   'expression tag' 45  21 
6 2XTJ LYS P 8   ? UNP Q8NBP7 ?   ?   'expression tag' 46  22 
6 2XTJ GLY P 9   ? UNP Q8NBP7 ?   ?   'expression tag' 47  23 
6 2XTJ SER P 10  ? UNP Q8NBP7 ?   ?   'expression tag' 48  24 
6 2XTJ LYS P 11  ? UNP Q8NBP7 ?   ?   'expression tag' 49  25 
6 2XTJ PRO P 12  ? UNP Q8NBP7 ?   ?   'expression tag' 50  26 
6 2XTJ MET P 13  ? UNP Q8NBP7 ?   ?   'expression tag' 51  27 
6 2XTJ SER P 14  ? UNP Q8NBP7 ?   ?   'expression tag' 52  28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XTJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58.34 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTALLIZATION EXPERIMENTS WERE PERFORMED AT ROOM TEMPERATURE BY THE HANGING-DROP AND SITTING-DROP METHODS. THIN PLATE-LIKE CRYSTALS WERE OBTAINED IN 100 MM NA CITRATE PH 6.5, 13% PEG 6000. FOR DATA COLLECTION CRYSTALS WERE TRANSFERRED TO A STABILIZING SOLUTION (20 MM TRIS PH 8.0, 50 MM NACITRATE PH 6.5, 100 MM NACL, 5% GLYCEROL, 1 MM TCEP, 1 MICROM CACL2, 25% PEG6000), THEN TRANSFERRED FOR 2 MIN TO A CRYOPROTECTANT SOLUTION (20 MM TRIS PH 8.0, 50 MM NACITRATE PH 6.5, 100 MM NACL, 20% GLYCEROL, 1 MM TCEP, 1 MICROM CACL2, 35% PEG6000) AND FINALLY PLACED DIRECTLY INTO LIQUID NITROGEN.
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XTJ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   32238 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.13 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.50 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.51 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.60 
_reflns_shell.pdbx_redundancy        4.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XTJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30522 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.20293 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19992 
_refine.ls_R_factor_R_free                       0.25944 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1629 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.877 
_refine.B_iso_mean                               34.080 
_refine.aniso_B[1][1]                            0.70 
_refine.aniso_B[2][2]                            -1.15 
_refine.aniso_B[3][3]                            0.46 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. THE FINAL MODEL CONTAINS RESIDUES 61-152 FROM THE PCSK9 PRODOMAIN (CHAIN P) AND RESIDUES 155-157 AND 178-422 FROM THE PCSK9 CATALYTIC DOMAIN (CHAIN A) THE FINAL MODEL CONTAINS RESIDUES 1-212 FROM THE FAB LIGHT CHAIN (CHAINS B AND C)AND RESIDUES 1-236 FROM THE FAB HEAVY CHAIN (CHAINS D AND E). THERE WAS NO ELECTRON DENSITY PRESENT FOR PCSK9 RESIDUES 53-60, 153-154, 158-177 AND 423-451, NOR FOR 1D05 FAB RESIDUES 237-255 OF THE CONSTANT DOMAIN OF THE HEAVY CHAIN (CHAIN E) AND RESIDUE 213 OF THE CONSTANT DOMAIN OF THE LIGHT CHAIN (CHAIN C). THESE RESIDUES WERE THEREFORE EXCLUDED FROM THE REFINEMENT. ALL OVER THE STRUCTURE, WHEN POOR DENSITY FOR SIDE CHAINS WAS PRESENT, THE CORRESPONDING RESIDUE WAS MODELED AS ALA. ALL OVER THE STRUCTURE, WHEN POOR DENSITY FOR SIDE CHAINS WAS PRESENT, THE CORRESPONDING RESIDUE WAS MODELED AS ALA.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2W2M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.547 
_refine.pdbx_overall_ESU_R_Free                  0.319 
_refine.overall_SU_ML                            0.236 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.580 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5875 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             199 
_refine_hist.number_atoms_total               6075 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 6019 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.413  1.957  ? 8178 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.414  5.000  ? 780  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.930 24.059 ? 239  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.365 15.000 ? 971  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.378 15.000 ? 33   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 939  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 4516 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.222  0.200  ? 2633 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 4006 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.134  0.200  ? 286  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.133  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.207  0.200  ? 50   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.070  0.200  ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.581  1.500  ? 3969 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.051  2.000  ? 6253 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.323  3.000  ? 2300 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.353  4.500  ? 1924 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             2194 
_refine_ls_shell.R_factor_R_work                  0.320 
_refine_ls_shell.percent_reflns_obs               99.79 
_refine_ls_shell.R_factor_R_free                  0.394 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             136 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XTJ 
_struct.title                     'The crystal structure of PCSK9 in complex with 1D05 Fab' 
_struct.pdbx_descriptor           
;PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9 (E.C.3.4.21.-), FAB FROM A HUMAN MONOCLONAL ANTIBODY, 1D05, PROPROTEIN CONVERTASE SUBTILISIN-KEXIN TYPE 9 (E.C.3.4.21.-)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XTJ 
_struct_keywords.pdbx_keywords   HYDROLASE/ANTIBODY 
_struct_keywords.text            'HYDROLASE-ANTIBODY COMPLEX, SERINE PROTEASE, LDL-C, LDLR, EGF-A, HYPERCHOLESTEROLEMIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
I N N 8 ? 
J N N 8 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 72  ? GLY A 84  ? ASP A 224 GLY A 236 1 ? 13 
HELX_P HELX_P2  2  VAL A 109 ? GLN A 126 ? VAL A 261 GLN A 278 1 ? 18 
HELX_P HELX_P3  3  SER A 142 ? ALA A 155 ? SER A 294 ALA A 307 1 ? 14 
HELX_P HELX_P4  4  GLY A 232 ? GLU A 251 ? GLY A 384 GLU A 403 1 ? 20 
HELX_P HELX_P5  5  THR A 255 ? SER A 267 ? THR A 407 SER A 419 1 ? 13 
HELX_P HELX_P6  6  GLN B 79  ? PHE B 83  ? GLN B 79  PHE B 83  5 ? 5  
HELX_P HELX_P7  7  SER C 13  ? GLY C 20  ? SER C 120 GLY C 127 1 ? 8  
HELX_P HELX_P8  8  LYS C 75  ? GLU C 79  ? LYS C 182 GLU C 186 1 ? 5  
HELX_P HELX_P9  9  GLN D 62  ? GLN D 65  ? GLN D 62  GLN D 65  5 ? 4  
HELX_P HELX_P10 10 ARG D 87  ? THR D 91  ? ARG D 87  THR D 91  5 ? 5  
HELX_P HELX_P11 11 SER E 43  ? ALA E 45  ? SER E 174 ALA E 176 5 ? 3  
HELX_P HELX_P12 12 SER E 74  ? LEU E 76  ? SER E 205 LEU E 207 5 ? 3  
HELX_P HELX_P13 13 LYS E 88  ? ASN E 91  ? LYS E 219 ASN E 222 5 ? 4  
HELX_P HELX_P14 14 LYS F 31  ? PRO F 33  ? LYS P 69  PRO P 71  5 ? 3  
HELX_P HELX_P15 15 HIS F 49  ? ARG F 66  ? HIS P 87  ARG P 104 1 ? 18 
HELX_P HELX_P16 16 SER F 89  ? ASP F 91  ? SER P 127 ASP P 129 5 ? 3  
HELX_P HELX_P17 17 LEU F 92  ? LEU F 97  ? LEU P 130 LEU P 135 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 103 SG  ? ? A CYS 223  A CYS 255 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf2 disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 206 SG  ? ? A CYS 323  A CYS 358 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf3 disulf ? ? A CYS 223 SG ? ? ? 1_555 A CYS 226 SG  ? ? A CYS 375  A CYS 378 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf4 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG  ? ? B CYS 23   B CYS 88  1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf5 disulf ? ? C CYS 26  SG ? ? ? 1_555 C CYS 86  SG  ? ? C CYS 133  C CYS 193 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf6 disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 96  SG  ? ? D CYS 22   D CYS 96  1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf7 disulf ? ? E CYS 27  SG ? ? ? 1_555 E CYS 83  SG  ? ? E CYS 158  E CYS 214 1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc1 metalc ? ? G CA  .   CA ? ? ? 1_555 A ALA 178 O   ? ? A CA  1423 A ALA 330 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc2 metalc ? ? G CA  .   CA ? ? ? 1_555 A THR 183 OG1 ? ? A CA  1423 A THR 335 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc3 metalc ? ? G CA  .   CA ? ? ? 1_555 A VAL 181 O   ? ? A CA  1423 A VAL 333 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc4 metalc ? ? G CA  .   CA ? ? ? 1_555 A ASP 208 OD2 ? ? A CA  1423 A ASP 360 1_555 ? ? ? ? ? ? ? 2.318 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 127 A . ? PRO 279 A VAL 128 A ? VAL 280 A 1 -14.75 
2  SER 174 A . ? SER 326 A PRO 175 A ? PRO 327 A 1 1.10   
3  SER 7   B . ? SER 7   B PRO 8   B ? PRO 8   B 1 -9.41  
4  ASP 92  B . ? ASP 92  B GLY 93  B ? GLY 93  B 1 27.54  
5  TYR 32  C . ? TYR 139 C PRO 33  C ? PRO 140 C 1 1.23   
6  GLY 108 D . ? GLY 108 D MET 109 D ? MET 109 D 1 19.33  
7  MET 109 D . ? MET 109 D ASN 110 D ? ASN 110 D 1 9.24   
8  SER 15  E . ? SER 146 E LYS 16  E ? LYS 147 E 1 8.05   
9  PHE 33  E . ? PHE 164 E PRO 34  E ? PRO 165 E 1 -8.94  
10 GLU 35  E . ? GLU 166 E PRO 36  E ? PRO 167 E 1 -1.11  
11 SER 102 E . ? SER 233 E GLU 103 E ? GLU 234 E 1 20.24  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 2 ? 
AC ? 6 ? 
AD ? 4 ? 
AE ? 6 ? 
AF ? 7 ? 
BA ? 4 ? 
BB ? 4 ? 
BC ? 6 ? 
BD ? 2 ? 
CA ? 4 ? 
CB ? 4 ? 
DA ? 4 ? 
EA ? 2 ? 
EB ? 2 ? 
EC ? 2 ? 
ED ? 2 ? 
EE ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AA 6 7 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? parallel      
AE 5 6 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BC 5 6 ? anti-parallel 
BD 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
EA 1 2 ? anti-parallel 
EB 1 2 ? anti-parallel 
EC 1 2 ? anti-parallel 
ED 1 2 ? parallel      
EE 1 2 ? anti-parallel 
EE 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 48  ? GLU A 54  ? VAL A 200 GLU A 206 
AA 2 MET A 95  ? ARG A 99  ? MET A 247 ARG A 251 
AA 3 GLU A 29  ? ASP A 34  ? GLU A 181 ASP A 186 
AA 4 LEU A 131 ? LEU A 135 ? LEU A 283 LEU A 287 
AA 5 VAL A 158 ? ALA A 162 ? VAL A 310 ALA A 314 
AA 6 ILE A 182 ? THR A 187 ? ILE A 334 THR A 339 
AA 7 LEU A 209 ? PRO A 212 ? LEU A 361 PRO A 364 
AB 1 LYS A 106 ? THR A 108 ? LYS A 258 THR A 260 
AB 2 VAL F 102 ? ALA F 113 ? VAL P 140 ALA P 151 
AC 1 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AC 2 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AC 3 VAL F 102 ? ALA F 113 ? VAL P 140 ALA P 151 
AC 4 ARG F 35  ? LEU F 44  ? ARG P 73  LEU P 82  
AC 5 GLY F 83  ? LYS F 87  ? GLY P 121 LYS P 125 
AC 6 LYS F 72  ? PHE F 77  ? LYS P 110 PHE P 115 
AD 1 TYR A 173 ? SER A 174 ? TYR A 325 SER A 326 
AD 2 LEU A 137 ? GLY A 140 ? LEU A 289 GLY A 292 
AD 3 VAL F 102 ? ALA F 113 ? VAL P 140 ALA P 151 
AD 4 THR F 25  ? HIS F 27  ? THR P 63  HIS P 65  
AE 1 ILE A 216 ? ALA A 219 ? ILE A 368 ALA A 371 
AE 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AE 3 VAL D 111 ? MET D 115 ? VAL D 111 MET D 115 
AE 4 ALA D 92  ? GLN D 103 ? ALA D 92  GLN D 103 
AE 5 THR D 125 ? VAL D 129 ? THR D 125 VAL D 129 
AE 6 GLU D 10  ? LYS D 12  ? GLU D 10  LYS D 12  
AF 1 ILE A 216 ? ALA A 219 ? ILE A 368 ALA A 371 
AF 2 CYS A 226 ? GLN A 230 ? CYS A 378 GLN A 382 
AF 3 VAL D 111 ? MET D 115 ? VAL D 111 MET D 115 
AF 4 ALA D 92  ? GLN D 103 ? ALA D 92  GLN D 103 
AF 5 ALA D 33  ? GLN D 39  ? ALA D 33  GLN D 39  
AF 6 GLU D 46  ? ASN D 52  ? GLU D 46  ASN D 52  
AF 7 ILE D 57  ? TYR D 60  ? ILE D 57  TYR D 60  
BA 1 MET B 4   ? SER B 7   ? MET B 4   SER B 7   
BA 2 VAL B 19  ? ALA B 25  ? VAL B 19  ALA B 25  
BA 3 ASP B 70  ? ILE B 75  ? ASP B 70  ILE B 75  
BA 4 PHE B 62  ? SER B 67  ? PHE B 62  SER B 67  
BB 1 SER B 10  ? ALA B 13  ? SER B 10  ALA B 13  
BB 2 THR B 101 ? ILE B 105 ? THR B 101 ILE B 105 
BB 3 VAL B 85  ? GLN B 90  ? VAL B 85  GLN B 90  
BB 4 THR B 96  ? PHE B 97  ? THR B 96  PHE B 97  
BC 1 SER B 10  ? ALA B 13  ? SER B 10  ALA B 13  
BC 2 THR B 101 ? ILE B 105 ? THR B 101 ILE B 105 
BC 3 VAL B 85  ? GLN B 90  ? VAL B 85  GLN B 90  
BC 4 LEU B 33  ? GLN B 38  ? LEU B 33  GLN B 38  
BC 5 LYS B 45  ? TYR B 49  ? LYS B 45  TYR B 49  
BC 6 THR B 53  ? LEU B 54  ? THR B 53  LEU B 54  
BD 1 THR B 96  ? PHE B 97  ? THR B 96  PHE B 97  
BD 2 VAL B 85  ? GLN B 90  ? VAL B 85  GLN B 90  
CA 1 SER C 6   ? PHE C 10  ? SER C 113 PHE C 117 
CA 2 THR C 21  ? PHE C 31  ? THR C 128 PHE C 138 
CA 3 TYR C 65  ? SER C 74  ? TYR C 172 SER C 181 
CA 4 SER C 51  ? VAL C 55  ? SER C 158 VAL C 162 
CB 1 ALA C 45  ? GLN C 47  ? ALA C 152 GLN C 154 
CB 2 LYS C 37  ? VAL C 42  ? LYS C 144 VAL C 149 
CB 3 VAL C 83  ? THR C 89  ? VAL C 190 THR C 196 
CB 4 VAL C 97  ? ASN C 102 ? VAL C 204 ASN C 209 
DA 1 GLN D 3   ? GLN D 6   ? GLN D 3   GLN D 6   
DA 2 VAL D 18  ? SER D 25  ? VAL D 18  SER D 25  
DA 3 THR D 78  ? LEU D 83  ? THR D 78  LEU D 83  
DA 4 VAL D 68  ? ASP D 73  ? VAL D 68  ASP D 73  
EA 1 SER E 7   ? LEU E 11  ? SER E 138 LEU E 142 
EA 2 THR E 22  ? TYR E 32  ? THR E 153 TYR E 163 
EB 1 THR E 18  ? SER E 19  ? THR E 149 SER E 150 
EB 2 THR E 22  ? TYR E 32  ? THR E 153 TYR E 163 
EC 1 VAL E 50  ? THR E 52  ? VAL E 181 THR E 183 
EC 2 TYR E 63  ? PRO E 72  ? TYR E 194 PRO E 203 
ED 1 VAL E 56  ? LEU E 57  ? VAL E 187 LEU E 188 
ED 2 TYR E 63  ? PRO E 72  ? TYR E 194 PRO E 203 
EE 1 THR E 38  ? TRP E 41  ? THR E 169 TRP E 172 
EE 2 ILE E 82  ? HIS E 87  ? ILE E 213 HIS E 218 
EE 3 THR E 92  ? LYS E 97  ? THR E 223 LYS E 228 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N MET A 49  ? N MET A 201 O MET A 95  ? O MET A 247 
AA 2 3 N ARG A 96  ? N ARG A 248 O VAL A 30  ? O VAL A 182 
AA 3 4 N TYR A 31  ? N TYR A 183 O VAL A 132 ? O VAL A 284 
AA 4 5 N VAL A 133 ? N VAL A 285 O VAL A 158 ? O VAL A 310 
AA 5 6 N THR A 161 ? N THR A 313 O ILE A 182 ? O ILE A 334 
AA 6 7 N GLY A 185 ? N GLY A 337 O LEU A 209 ? O LEU A 361 
AB 1 2 N GLY A 107 ? N GLY A 259 O VAL F 111 ? O VAL P 149 
AC 1 2 N SER A 174 ? N SER A 326 O GLY A 139 ? O GLY A 291 
AC 2 3 N ALA A 138 ? N ALA A 290 O PHE F 112 ? O PHE P 150 
AC 3 4 O ASP F 108 ? O ASP P 146 N LEU F 36  ? N LEU P 74  
AC 4 5 N VAL F 42  ? N VAL P 80  O PHE F 84  ? O PHE P 122 
AC 5 6 N LYS F 87  ? N LYS P 125 O LYS F 72  ? O LYS P 110 
AD 1 2 N SER A 174 ? N SER A 326 O GLY A 139 ? O GLY A 291 
AD 2 3 N ALA A 138 ? N ALA A 290 O PHE F 112 ? O PHE P 150 
AD 3 4 N ILE F 105 ? N ILE P 143 O THR F 25  ? O THR P 63  
AE 1 2 N GLY A 218 ? N GLY A 370 O VAL A 228 ? O VAL A 380 
AE 2 3 N PHE A 227 ? N PHE A 379 O TYR D 112 ? O TYR D 112 
AE 3 4 N MET D 115 ? N MET D 115 O TYR D 100 ? O TYR D 100 
AE 4 5 N TYR D 94  ? N TYR D 94  O THR D 125 ? O THR D 125 
AE 5 6 N THR D 128 ? N THR D 128 O GLU D 10  ? O GLU D 10  
AF 1 2 N GLY A 218 ? N GLY A 370 O VAL A 228 ? O VAL A 380 
AF 2 3 N PHE A 227 ? N PHE A 379 O TYR D 112 ? O TYR D 112 
AF 3 4 N MET D 115 ? N MET D 115 O TYR D 100 ? O TYR D 100 
AF 4 5 N HIS D 99  ? N HIS D 99  O ALA D 33  ? O ALA D 33  
AF 5 6 N ARG D 38  ? N ARG D 38  O GLU D 46  ? O GLU D 46  
AF 6 7 N ASN D 52  ? N ASN D 52  O ILE D 57  ? O ILE D 57  
BA 1 2 N SER B 7   ? N SER B 7   O THR B 22  ? O THR B 22  
BA 2 3 N CYS B 23  ? N CYS B 23  O PHE B 71  ? O PHE B 71  
BA 3 4 N THR B 74  ? N THR B 74  O SER B 63  ? O SER B 63  
BB 1 2 N LEU B 11  ? N LEU B 11  O LYS B 102 ? O LYS B 102 
BB 2 3 N THR B 101 ? N THR B 101 O TYR B 86  ? O TYR B 86  
BB 3 4 N GLN B 90  ? N GLN B 90  O THR B 96  ? O THR B 96  
BC 1 2 N LEU B 11  ? N LEU B 11  O LYS B 102 ? O LYS B 102 
BC 2 3 N THR B 101 ? N THR B 101 O TYR B 86  ? O TYR B 86  
BC 3 4 N GLN B 89  ? N GLN B 89  O ASN B 34  ? O ASN B 34  
BC 4 5 N GLN B 37  ? N GLN B 37  O LYS B 45  ? O LYS B 45  
BC 5 6 N TYR B 49  ? N TYR B 49  O THR B 53  ? O THR B 53  
BD 1 2 N THR B 96  ? N THR B 96  O GLN B 90  ? O GLN B 90  
CA 1 2 N PHE C 10  ? N PHE C 117 O VAL C 25  ? O VAL C 132 
CA 2 3 N PHE C 31  ? N PHE C 138 O TYR C 65  ? O TYR C 172 
CA 3 4 N THR C 70  ? N THR C 177 O GLN C 52  ? O GLN C 159 
CB 1 2 N GLN C 47  ? N GLN C 154 O TRP C 40  ? O TRP C 147 
CB 2 3 N LYS C 41  ? N LYS C 148 O ALA C 85  ? O ALA C 192 
CB 3 4 N VAL C 88  ? N VAL C 195 O VAL C 97  ? O VAL C 204 
DA 1 2 N VAL D 5   ? N VAL D 5   O LYS D 23  ? O LYS D 23  
DA 2 3 N CYS D 22  ? N CYS D 22  O ALA D 79  ? O ALA D 79  
DA 3 4 N GLU D 82  ? N GLU D 82  O THR D 69  ? O THR D 69  
EA 1 2 N LEU E 11  ? N LEU E 142 O GLY E 26  ? O GLY E 157 
EB 1 2 N SER E 19  ? N SER E 150 O THR E 22  ? O THR E 153 
EC 1 2 N HIS E 51  ? N HIS E 182 O VAL E 68  ? O VAL E 199 
ED 1 2 N VAL E 56  ? N VAL E 187 O SER E 64  ? O SER E 195 
EE 1 2 N SER E 40  ? N SER E 171 O ASN E 84  ? O ASN E 215 
EE 2 3 N HIS E 87  ? N HIS E 218 O THR E 92  ? O THR E 223 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 1423' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ALA A 178 ? ALA A 330 . ? 1_555 ? 
2 AC1 4 VAL A 181 ? VAL A 333 . ? 1_555 ? 
3 AC1 4 THR A 183 ? THR A 335 . ? 1_555 ? 
4 AC1 4 ASP A 208 ? ASP A 360 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XTJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XTJ 
_atom_sites.fract_transf_matrix[1][1]   0.015017 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014742 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003986 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 3   ? 23.495  -25.867 13.049  1.00 80.14 ? 155  PRO A N   1 
ATOM   2    C  CA  . PRO A 1 3   ? 23.204  -24.709 12.194  1.00 80.14 ? 155  PRO A CA  1 
ATOM   3    C  C   . PRO A 1 3   ? 24.492  -23.997 11.750  1.00 80.04 ? 155  PRO A C   1 
ATOM   4    O  O   . PRO A 1 3   ? 25.110  -23.272 12.542  1.00 79.98 ? 155  PRO A O   1 
ATOM   5    C  CB  . PRO A 1 3   ? 22.329  -23.812 13.088  1.00 80.10 ? 155  PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 3   ? 22.478  -24.372 14.516  1.00 80.21 ? 155  PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 3   ? 23.450  -25.526 14.479  1.00 80.11 ? 155  PRO A CD  1 
ATOM   8    N  N   . TRP A 1 4   ? 24.863  -24.199 10.483  1.00 79.94 ? 156  TRP A N   1 
ATOM   9    C  CA  . TRP A 1 4   ? 26.211  -23.897 9.953   1.00 79.88 ? 156  TRP A CA  1 
ATOM   10   C  C   . TRP A 1 4   ? 26.829  -22.533 10.323  1.00 79.87 ? 156  TRP A C   1 
ATOM   11   O  O   . TRP A 1 4   ? 28.040  -22.435 10.540  1.00 79.93 ? 156  TRP A O   1 
ATOM   12   C  CB  . TRP A 1 4   ? 26.247  -24.110 8.432   1.00 79.82 ? 156  TRP A CB  1 
ATOM   13   C  CG  . TRP A 1 4   ? 25.765  -22.927 7.616   1.00 80.01 ? 156  TRP A CG  1 
ATOM   14   C  CD1 . TRP A 1 4   ? 24.479  -22.657 7.234   1.00 79.87 ? 156  TRP A CD1 1 
ATOM   15   C  CD2 . TRP A 1 4   ? 26.572  -21.864 7.084   1.00 80.05 ? 156  TRP A CD2 1 
ATOM   16   N  NE1 . TRP A 1 4   ? 24.437  -21.494 6.500   1.00 79.73 ? 156  TRP A NE1 1 
ATOM   17   C  CE2 . TRP A 1 4   ? 25.706  -20.988 6.393   1.00 79.85 ? 156  TRP A CE2 1 
ATOM   18   C  CE3 . TRP A 1 4   ? 27.944  -21.569 7.126   1.00 79.98 ? 156  TRP A CE3 1 
ATOM   19   C  CZ2 . TRP A 1 4   ? 26.167  -19.838 5.746   1.00 79.70 ? 156  TRP A CZ2 1 
ATOM   20   C  CZ3 . TRP A 1 4   ? 28.399  -20.429 6.485   1.00 79.82 ? 156  TRP A CZ3 1 
ATOM   21   C  CH2 . TRP A 1 4   ? 27.512  -19.580 5.799   1.00 79.92 ? 156  TRP A CH2 1 
ATOM   22   N  N   . ASN A 1 5   ? 25.999  -21.493 10.375  1.00 79.81 ? 157  ASN A N   1 
ATOM   23   C  CA  . ASN A 1 5   ? 26.442  -20.144 10.728  1.00 79.61 ? 157  ASN A CA  1 
ATOM   24   C  C   . ASN A 1 5   ? 26.554  -19.944 12.244  1.00 79.54 ? 157  ASN A C   1 
ATOM   25   O  O   . ASN A 1 5   ? 27.508  -19.339 12.737  1.00 79.29 ? 157  ASN A O   1 
ATOM   26   C  CB  . ASN A 1 5   ? 25.494  -19.105 10.121  1.00 79.49 ? 157  ASN A CB  1 
ATOM   27   C  CG  . ASN A 1 5   ? 24.043  -19.297 10.563  1.00 79.55 ? 157  ASN A CG  1 
ATOM   28   O  OD1 . ASN A 1 5   ? 23.435  -20.351 10.338  1.00 79.28 ? 157  ASN A OD1 1 
ATOM   29   N  ND2 . ASN A 1 5   ? 23.480  -18.267 11.187  1.00 79.35 ? 157  ASN A ND2 1 
ATOM   30   N  N   . SER A 1 26  ? 27.626  -5.130  30.235  1.00 44.54 ? 178  SER A N   1 
ATOM   31   C  CA  . SER A 1 26  ? 27.688  -3.753  29.720  1.00 44.44 ? 178  SER A CA  1 
ATOM   32   C  C   . SER A 1 26  ? 26.728  -3.536  28.533  1.00 44.16 ? 178  SER A C   1 
ATOM   33   O  O   . SER A 1 26  ? 26.854  -4.193  27.489  1.00 44.55 ? 178  SER A O   1 
ATOM   34   C  CB  . SER A 1 26  ? 29.129  -3.383  29.342  1.00 44.37 ? 178  SER A CB  1 
ATOM   35   O  OG  . SER A 1 26  ? 29.194  -2.099  28.747  1.00 44.33 ? 178  SER A OG  1 
ATOM   36   N  N   . LEU A 1 27  ? 25.781  -2.613  28.697  1.00 43.39 ? 179  LEU A N   1 
ATOM   37   C  CA  . LEU A 1 27  ? 24.690  -2.456  27.732  1.00 42.68 ? 179  LEU A CA  1 
ATOM   38   C  C   . LEU A 1 27  ? 25.029  -1.691  26.441  1.00 41.46 ? 179  LEU A C   1 
ATOM   39   O  O   . LEU A 1 27  ? 25.395  -0.504  26.455  1.00 41.48 ? 179  LEU A O   1 
ATOM   40   C  CB  . LEU A 1 27  ? 23.429  -1.868  28.386  1.00 43.38 ? 179  LEU A CB  1 
ATOM   41   C  CG  . LEU A 1 27  ? 22.243  -1.727  27.413  1.00 44.45 ? 179  LEU A CG  1 
ATOM   42   C  CD1 . LEU A 1 27  ? 21.563  -3.081  27.199  1.00 45.41 ? 179  LEU A CD1 1 
ATOM   43   C  CD2 . LEU A 1 27  ? 21.238  -0.659  27.870  1.00 45.36 ? 179  LEU A CD2 1 
ATOM   44   N  N   . VAL A 1 28  ? 24.856  -2.414  25.339  1.00 39.47 ? 180  VAL A N   1 
ATOM   45   C  CA  . VAL A 1 28  ? 24.989  -1.930  23.984  1.00 37.41 ? 180  VAL A CA  1 
ATOM   46   C  C   . VAL A 1 28  ? 23.573  -1.827  23.439  1.00 36.29 ? 180  VAL A C   1 
ATOM   47   O  O   . VAL A 1 28  ? 22.672  -2.519  23.892  1.00 36.27 ? 180  VAL A O   1 
ATOM   48   C  CB  . VAL A 1 28  ? 25.777  -2.958  23.148  1.00 37.24 ? 180  VAL A CB  1 
ATOM   49   C  CG1 . VAL A 1 28  ? 25.880  -2.546  21.697  1.00 36.75 ? 180  VAL A CG1 1 
ATOM   50   C  CG2 . VAL A 1 28  ? 27.159  -3.157  23.739  1.00 37.62 ? 180  VAL A CG2 1 
ATOM   51   N  N   . GLU A 1 29  ? 23.377  -0.944  22.474  1.00 34.82 ? 181  GLU A N   1 
ATOM   52   C  CA  . GLU A 1 29  ? 22.097  -0.798  21.826  1.00 33.48 ? 181  GLU A CA  1 
ATOM   53   C  C   . GLU A 1 29  ? 22.284  -1.039  20.319  1.00 31.71 ? 181  GLU A C   1 
ATOM   54   O  O   . GLU A 1 29  ? 23.163  -0.434  19.697  1.00 31.18 ? 181  GLU A O   1 
ATOM   55   C  CB  . GLU A 1 29  ? 21.563  0.609   22.108  1.00 34.28 ? 181  GLU A CB  1 
ATOM   56   C  CG  . GLU A 1 29  ? 20.038  0.757   22.048  1.00 36.99 ? 181  GLU A CG  1 
ATOM   57   C  CD  . GLU A 1 29  ? 19.318  0.129   23.245  1.00 40.15 ? 181  GLU A CD  1 
ATOM   58   O  OE1 . GLU A 1 29  ? 19.483  0.627   24.396  1.00 40.12 ? 181  GLU A OE1 1 
ATOM   59   O  OE2 . GLU A 1 29  ? 18.575  -0.857  23.011  1.00 40.60 ? 181  GLU A OE2 1 
ATOM   60   N  N   . VAL A 1 30  ? 21.485  -1.944  19.748  1.00 29.58 ? 182  VAL A N   1 
ATOM   61   C  CA  . VAL A 1 30  ? 21.520  -2.212  18.304  1.00 27.93 ? 182  VAL A CA  1 
ATOM   62   C  C   . VAL A 1 30  ? 20.314  -1.602  17.608  1.00 26.98 ? 182  VAL A C   1 
ATOM   63   O  O   . VAL A 1 30  ? 19.171  -1.996  17.862  1.00 27.44 ? 182  VAL A O   1 
ATOM   64   C  CB  . VAL A 1 30  ? 21.594  -3.735  17.958  1.00 27.88 ? 182  VAL A CB  1 
ATOM   65   C  CG1 . VAL A 1 30  ? 21.711  -3.944  16.453  1.00 27.00 ? 182  VAL A CG1 1 
ATOM   66   C  CG2 . VAL A 1 30  ? 22.772  -4.400  18.649  1.00 27.59 ? 182  VAL A CG2 1 
ATOM   67   N  N   . TYR A 1 31  ? 20.566  -0.648  16.723  1.00 25.37 ? 183  TYR A N   1 
ATOM   68   C  CA  . TYR A 1 31  ? 19.490  -0.059  15.935  1.00 24.23 ? 183  TYR A CA  1 
ATOM   69   C  C   . TYR A 1 31  ? 19.384  -0.724  14.574  1.00 23.02 ? 183  TYR A C   1 
ATOM   70   O  O   . TYR A 1 31  ? 20.379  -0.885  13.874  1.00 22.55 ? 183  TYR A O   1 
ATOM   71   C  CB  . TYR A 1 31  ? 19.697  1.450   15.763  1.00 24.56 ? 183  TYR A CB  1 
ATOM   72   C  CG  . TYR A 1 31  ? 19.435  2.233   17.018  1.00 24.71 ? 183  TYR A CG  1 
ATOM   73   C  CD1 . TYR A 1 31  ? 18.234  2.924   17.191  1.00 24.82 ? 183  TYR A CD1 1 
ATOM   74   C  CD2 . TYR A 1 31  ? 20.381  2.282   18.041  1.00 24.74 ? 183  TYR A CD2 1 
ATOM   75   C  CE1 . TYR A 1 31  ? 17.984  3.651   18.342  1.00 24.41 ? 183  TYR A CE1 1 
ATOM   76   C  CE2 . TYR A 1 31  ? 20.139  2.996   19.202  1.00 24.84 ? 183  TYR A CE2 1 
ATOM   77   C  CZ  . TYR A 1 31  ? 18.941  3.683   19.343  1.00 24.91 ? 183  TYR A CZ  1 
ATOM   78   O  OH  . TYR A 1 31  ? 18.701  4.391   20.500  1.00 25.71 ? 183  TYR A OH  1 
ATOM   79   N  N   . LEU A 1 32  ? 18.167  -1.101  14.210  1.00 21.92 ? 184  LEU A N   1 
ATOM   80   C  CA  . LEU A 1 32  ? 17.884  -1.649  12.896  1.00 21.34 ? 184  LEU A CA  1 
ATOM   81   C  C   . LEU A 1 32  ? 17.024  -0.694  12.065  1.00 21.36 ? 184  LEU A C   1 
ATOM   82   O  O   . LEU A 1 32  ? 15.964  -0.246  12.502  1.00 21.11 ? 184  LEU A O   1 
ATOM   83   C  CB  . LEU A 1 32  ? 17.199  -3.014  13.035  1.00 21.12 ? 184  LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 32  ? 16.580  -3.709  11.818  1.00 20.69 ? 184  LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 32  ? 17.628  -4.186  10.834  1.00 20.53 ? 184  LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 32  ? 15.735  -4.871  12.258  1.00 21.12 ? 184  LEU A CD2 1 
ATOM   87   N  N   . LEU A 1 33  ? 17.489  -0.378  10.864  1.00 21.61 ? 185  LEU A N   1 
ATOM   88   C  CA  . LEU A 1 33  ? 16.682  0.399   9.927   1.00 21.99 ? 185  LEU A CA  1 
ATOM   89   C  C   . LEU A 1 33  ? 16.262  -0.540  8.808   1.00 22.58 ? 185  LEU A C   1 
ATOM   90   O  O   . LEU A 1 33  ? 17.105  -1.052  8.073   1.00 23.20 ? 185  LEU A O   1 
ATOM   91   C  CB  . LEU A 1 33  ? 17.477  1.593   9.378   1.00 21.46 ? 185  LEU A CB  1 
ATOM   92   C  CG  . LEU A 1 33  ? 17.562  2.860   10.228  1.00 21.24 ? 185  LEU A CG  1 
ATOM   93   C  CD1 . LEU A 1 33  ? 18.302  2.605   11.506  1.00 21.80 ? 185  LEU A CD1 1 
ATOM   94   C  CD2 . LEU A 1 33  ? 18.239  3.985   9.472   1.00 21.84 ? 185  LEU A CD2 1 
ATOM   95   N  N   . ASP A 1 34  ? 14.967  -0.783  8.681   1.00 23.03 ? 186  ASP A N   1 
ATOM   96   C  CA  . ASP A 1 34  ? 14.490  -1.849  7.811   1.00 23.68 ? 186  ASP A CA  1 
ATOM   97   C  C   . ASP A 1 34  ? 13.000  -1.698  7.623   1.00 23.35 ? 186  ASP A C   1 
ATOM   98   O  O   . ASP A 1 34  ? 12.432  -0.622  7.862   1.00 23.21 ? 186  ASP A O   1 
ATOM   99   C  CB  . ASP A 1 34  ? 14.786  -3.228  8.456   1.00 24.68 ? 186  ASP A CB  1 
ATOM   100  C  CG  . ASP A 1 34  ? 14.957  -4.358  7.422   1.00 26.95 ? 186  ASP A CG  1 
ATOM   101  O  OD1 . ASP A 1 34  ? 13.961  -4.828  6.836   1.00 29.41 ? 186  ASP A OD1 1 
ATOM   102  O  OD2 . ASP A 1 34  ? 16.099  -4.789  7.197   1.00 30.12 ? 186  ASP A OD2 1 
ATOM   103  N  N   . THR A 1 35  ? 12.367  -2.791  7.211   1.00 23.11 ? 187  THR A N   1 
ATOM   104  C  CA  . THR A 1 35  ? 10.930  -2.858  7.088   1.00 23.18 ? 187  THR A CA  1 
ATOM   105  C  C   . THR A 1 35  ? 10.369  -2.898  8.497   1.00 23.45 ? 187  THR A C   1 
ATOM   106  O  O   . THR A 1 35  ? 11.131  -2.933  9.470   1.00 23.17 ? 187  THR A O   1 
ATOM   107  C  CB  . THR A 1 35  ? 10.499  -4.135  6.373   1.00 23.08 ? 187  THR A CB  1 
ATOM   108  O  OG1 . THR A 1 35  ? 10.686  -5.250  7.257   1.00 23.14 ? 187  THR A OG1 1 
ATOM   109  C  CG2 . THR A 1 35  ? 11.290  -4.331  5.092   1.00 22.06 ? 187  THR A CG2 1 
ATOM   110  N  N   . SER A 1 36  ? 9.043   -2.890  8.612   1.00 23.70 ? 188  SER A N   1 
ATOM   111  C  CA  . SER A 1 36  ? 8.423   -3.141  9.898   1.00 24.34 ? 188  SER A CA  1 
ATOM   112  C  C   . SER A 1 36  ? 8.836   -4.541  10.368  1.00 25.05 ? 188  SER A C   1 
ATOM   113  O  O   . SER A 1 36  ? 9.356   -5.369  9.579   1.00 24.73 ? 188  SER A O   1 
ATOM   114  C  CB  . SER A 1 36  ? 6.903   -3.019  9.821   1.00 24.16 ? 188  SER A CB  1 
ATOM   115  O  OG  . SER A 1 36  ? 6.399   -3.784  8.745   1.00 24.45 ? 188  SER A OG  1 
ATOM   116  N  N   . ILE A 1 37  ? 8.638   -4.785  11.661  1.00 25.32 ? 189  ILE A N   1 
ATOM   117  C  CA  . ILE A 1 37  ? 8.974   -6.060  12.231  1.00 25.68 ? 189  ILE A CA  1 
ATOM   118  C  C   . ILE A 1 37  ? 7.779   -6.633  13.014  1.00 26.10 ? 189  ILE A C   1 
ATOM   119  O  O   . ILE A 1 37  ? 6.936   -5.878  13.528  1.00 25.71 ? 189  ILE A O   1 
ATOM   120  C  CB  . ILE A 1 37  ? 10.255  -5.964  13.087  1.00 25.85 ? 189  ILE A CB  1 
ATOM   121  C  CG1 . ILE A 1 37  ? 9.950   -5.410  14.467  1.00 26.32 ? 189  ILE A CG1 1 
ATOM   122  C  CG2 . ILE A 1 37  ? 11.351  -5.093  12.391  1.00 25.30 ? 189  ILE A CG2 1 
ATOM   123  C  CD1 . ILE A 1 37  ? 11.047  -5.697  15.464  1.00 27.45 ? 189  ILE A CD1 1 
ATOM   124  N  N   A GLN A 1 38  ? 7.704   -7.959  13.072  0.50 26.18 ? 190  GLN A N   1 
ATOM   125  N  N   B GLN A 1 38  ? 7.698   -7.969  13.075  0.50 26.22 ? 190  GLN A N   1 
ATOM   126  C  CA  A GLN A 1 38  ? 6.699   -8.610  13.888  0.50 26.16 ? 190  GLN A CA  1 
ATOM   127  C  CA  B GLN A 1 38  ? 6.698   -8.678  13.894  0.50 26.26 ? 190  GLN A CA  1 
ATOM   128  C  C   A GLN A 1 38  ? 7.267   -8.775  15.301  0.50 26.12 ? 190  GLN A C   1 
ATOM   129  C  C   B GLN A 1 38  ? 7.245   -8.799  15.323  0.50 26.18 ? 190  GLN A C   1 
ATOM   130  O  O   A GLN A 1 38  ? 7.881   -9.791  15.626  0.50 26.23 ? 190  GLN A O   1 
ATOM   131  O  O   B GLN A 1 38  ? 7.837   -9.816  15.682  0.50 26.28 ? 190  GLN A O   1 
ATOM   132  C  CB  A GLN A 1 38  ? 6.261   -9.943  13.270  0.50 26.07 ? 190  GLN A CB  1 
ATOM   133  C  CB  B GLN A 1 38  ? 6.374   -10.072 13.306  0.50 26.21 ? 190  GLN A CB  1 
ATOM   134  C  CG  A GLN A 1 38  ? 4.826   -10.331 13.589  0.50 25.65 ? 190  GLN A CG  1 
ATOM   135  C  CG  B GLN A 1 38  ? 4.983   -10.656 13.673  0.50 25.99 ? 190  GLN A CG  1 
ATOM   136  C  CD  A GLN A 1 38  ? 4.593   -10.522 15.075  0.50 25.55 ? 190  GLN A CD  1 
ATOM   137  C  CD  B GLN A 1 38  ? 4.983   -12.190 13.871  0.50 26.32 ? 190  GLN A CD  1 
ATOM   138  O  OE1 A GLN A 1 38  ? 4.759   -11.622 15.597  0.50 26.28 ? 190  GLN A OE1 1 
ATOM   139  O  OE1 B GLN A 1 38  ? 4.384   -12.948 13.094  0.50 25.60 ? 190  GLN A OE1 1 
ATOM   140  N  NE2 A GLN A 1 38  ? 4.227   -9.447  15.767  0.50 24.91 ? 190  GLN A NE2 1 
ATOM   141  N  NE2 B GLN A 1 38  ? 5.652   -12.641 14.920  0.50 25.96 ? 190  GLN A NE2 1 
ATOM   142  N  N   . SER A 1 39  ? 7.052   -7.752  16.124  1.00 26.02 ? 191  SER A N   1 
ATOM   143  C  CA  . SER A 1 39  ? 7.623   -7.669  17.481  1.00 25.82 ? 191  SER A CA  1 
ATOM   144  C  C   . SER A 1 39  ? 7.197   -8.774  18.464  1.00 25.71 ? 191  SER A C   1 
ATOM   145  O  O   . SER A 1 39  ? 7.891   -9.013  19.456  1.00 25.73 ? 191  SER A O   1 
ATOM   146  C  CB  . SER A 1 39  ? 7.303   -6.302  18.090  1.00 25.68 ? 191  SER A CB  1 
ATOM   147  O  OG  . SER A 1 39  ? 5.914   -6.037  17.977  1.00 25.67 ? 191  SER A OG  1 
ATOM   148  N  N   . ASP A 1 40  ? 6.070   -9.437  18.186  1.00 25.29 ? 192  ASP A N   1 
ATOM   149  C  CA  . ASP A 1 40  ? 5.572   -10.556 19.004  1.00 24.57 ? 192  ASP A CA  1 
ATOM   150  C  C   . ASP A 1 40  ? 6.298   -11.876 18.804  1.00 23.61 ? 192  ASP A C   1 
ATOM   151  O  O   . ASP A 1 40  ? 6.203   -12.762 19.636  1.00 23.48 ? 192  ASP A O   1 
ATOM   152  C  CB  . ASP A 1 40  ? 4.098   -10.803 18.715  1.00 24.94 ? 192  ASP A CB  1 
ATOM   153  C  CG  . ASP A 1 40  ? 3.196   -10.007 19.602  1.00 27.00 ? 192  ASP A CG  1 
ATOM   154  O  OD1 . ASP A 1 40  ? 3.682   -9.477  20.621  1.00 27.38 ? 192  ASP A OD1 1 
ATOM   155  O  OD2 . ASP A 1 40  ? 1.992   -9.912  19.275  1.00 31.36 ? 192  ASP A OD2 1 
ATOM   156  N  N   . HIS A 1 41  ? 6.991   -12.027 17.689  1.00 22.80 ? 193  HIS A N   1 
ATOM   157  C  CA  . HIS A 1 41  ? 7.626   -13.283 17.392  1.00 22.37 ? 193  HIS A CA  1 
ATOM   158  C  C   . HIS A 1 41  ? 8.369   -13.818 18.606  1.00 22.60 ? 193  HIS A C   1 
ATOM   159  O  O   . HIS A 1 41  ? 9.026   -13.051 19.326  1.00 22.96 ? 193  HIS A O   1 
ATOM   160  C  CB  . HIS A 1 41  ? 8.590   -13.144 16.232  1.00 22.12 ? 193  HIS A CB  1 
ATOM   161  C  CG  . HIS A 1 41  ? 9.073   -14.457 15.726  1.00 21.98 ? 193  HIS A CG  1 
ATOM   162  N  ND1 . HIS A 1 41  ? 8.575   -15.037 14.580  1.00 22.31 ? 193  HIS A ND1 1 
ATOM   163  C  CD2 . HIS A 1 41  ? 9.960   -15.335 16.245  1.00 21.93 ? 193  HIS A CD2 1 
ATOM   164  C  CE1 . HIS A 1 41  ? 9.162   -16.204 14.397  1.00 23.30 ? 193  HIS A CE1 1 
ATOM   165  N  NE2 . HIS A 1 41  ? 10.005  -16.409 15.395  1.00 24.06 ? 193  HIS A NE2 1 
ATOM   166  N  N   . ARG A 1 42  ? 8.288   -15.133 18.815  1.00 22.07 ? 194  ARG A N   1 
ATOM   167  C  CA  . ARG A 1 42  ? 8.893   -15.766 19.989  1.00 21.53 ? 194  ARG A CA  1 
ATOM   168  C  C   . ARG A 1 42  ? 10.401  -15.508 20.193  1.00 21.64 ? 194  ARG A C   1 
ATOM   169  O  O   . ARG A 1 42  ? 10.896  -15.560 21.329  1.00 21.73 ? 194  ARG A O   1 
ATOM   170  C  CB  . ARG A 1 42  ? 8.556   -17.270 20.032  1.00 21.28 ? 194  ARG A CB  1 
ATOM   171  C  CG  . ARG A 1 42  ? 9.316   -18.172 19.063  1.00 20.06 ? 194  ARG A CG  1 
ATOM   172  C  CD  . ARG A 1 42  ? 10.685  -18.581 19.600  1.00 17.30 ? 194  ARG A CD  1 
ATOM   173  N  NE  . ARG A 1 42  ? 10.604  -19.183 20.924  1.00 17.60 ? 194  ARG A NE  1 
ATOM   174  C  CZ  . ARG A 1 42  ? 11.660  -19.475 21.676  1.00 18.35 ? 194  ARG A CZ  1 
ATOM   175  N  NH1 . ARG A 1 42  ? 12.890  -19.208 21.238  1.00 16.85 ? 194  ARG A NH1 1 
ATOM   176  N  NH2 . ARG A 1 42  ? 11.485  -20.028 22.871  1.00 18.29 ? 194  ARG A NH2 1 
ATOM   177  N  N   . GLU A 1 43  ? 11.113  -15.218 19.108  1.00 21.65 ? 195  GLU A N   1 
ATOM   178  C  CA  . GLU A 1 43  ? 12.560  -15.016 19.154  1.00 22.35 ? 195  GLU A CA  1 
ATOM   179  C  C   . GLU A 1 43  ? 12.980  -13.631 19.670  1.00 22.74 ? 195  GLU A C   1 
ATOM   180  O  O   . GLU A 1 43  ? 14.094  -13.448 20.178  1.00 22.62 ? 195  GLU A O   1 
ATOM   181  C  CB  . GLU A 1 43  ? 13.150  -15.234 17.762  1.00 22.59 ? 195  GLU A CB  1 
ATOM   182  C  CG  . GLU A 1 43  ? 13.446  -16.678 17.427  1.00 23.36 ? 195  GLU A CG  1 
ATOM   183  C  CD  . GLU A 1 43  ? 14.785  -17.124 17.974  1.00 24.79 ? 195  GLU A CD  1 
ATOM   184  O  OE1 . GLU A 1 43  ? 14.824  -17.658 19.105  1.00 24.43 ? 195  GLU A OE1 1 
ATOM   185  O  OE2 . GLU A 1 43  ? 15.806  -16.919 17.278  1.00 26.07 ? 195  GLU A OE2 1 
ATOM   186  N  N   . ILE A 1 44  ? 12.085  -12.660 19.535  1.00 23.32 ? 196  ILE A N   1 
ATOM   187  C  CA  . ILE A 1 44  ? 12.438  -11.262 19.742  1.00 23.60 ? 196  ILE A CA  1 
ATOM   188  C  C   . ILE A 1 44  ? 11.496  -10.525 20.696  1.00 24.85 ? 196  ILE A C   1 
ATOM   189  O  O   . ILE A 1 44  ? 11.827  -9.416  21.136  1.00 25.07 ? 196  ILE A O   1 
ATOM   190  C  CB  . ILE A 1 44  ? 12.551  -10.489 18.388  1.00 23.43 ? 196  ILE A CB  1 
ATOM   191  C  CG1 . ILE A 1 44  ? 11.226  -10.512 17.623  1.00 22.94 ? 196  ILE A CG1 1 
ATOM   192  C  CG2 . ILE A 1 44  ? 13.702  -11.035 17.518  1.00 23.09 ? 196  ILE A CG2 1 
ATOM   193  C  CD1 . ILE A 1 44  ? 11.219  -9.674  16.381  1.00 22.87 ? 196  ILE A CD1 1 
ATOM   194  N  N   . GLU A 1 45  ? 10.347  -11.123 21.039  1.00 26.10 ? 197  GLU A N   1 
ATOM   195  C  CA  . GLU A 1 45  ? 9.377   -10.419 21.891  1.00 27.72 ? 197  GLU A CA  1 
ATOM   196  C  C   . GLU A 1 45  ? 9.934   -10.114 23.276  1.00 28.38 ? 197  GLU A C   1 
ATOM   197  O  O   . GLU A 1 45  ? 10.580  -10.956 23.894  1.00 28.18 ? 197  GLU A O   1 
ATOM   198  C  CB  . GLU A 1 45  ? 7.992   -11.090 21.937  1.00 27.89 ? 197  GLU A CB  1 
ATOM   199  C  CG  . GLU A 1 45  ? 7.823   -12.263 22.874  1.00 30.13 ? 197  GLU A CG  1 
ATOM   200  C  CD  . GLU A 1 45  ? 7.446   -11.859 24.304  1.00 33.04 ? 197  GLU A CD  1 
ATOM   201  O  OE1 . GLU A 1 45  ? 7.345   -10.645 24.590  1.00 33.27 ? 197  GLU A OE1 1 
ATOM   202  O  OE2 . GLU A 1 45  ? 7.256   -12.772 25.150  1.00 34.58 ? 197  GLU A OE2 1 
ATOM   203  N  N   . GLY A 1 46  ? 9.702   -8.882  23.728  1.00 29.48 ? 198  GLY A N   1 
ATOM   204  C  CA  . GLY A 1 46  ? 10.252  -8.391  24.987  1.00 30.56 ? 198  GLY A CA  1 
ATOM   205  C  C   . GLY A 1 46  ? 11.684  -7.875  24.919  1.00 31.55 ? 198  GLY A C   1 
ATOM   206  O  O   . GLY A 1 46  ? 12.159  -7.289  25.875  1.00 31.43 ? 198  GLY A O   1 
ATOM   207  N  N   . ARG A 1 47  ? 12.385  -8.094  23.810  1.00 32.80 ? 199  ARG A N   1 
ATOM   208  C  CA  . ARG A 1 47  ? 13.775  -7.632  23.690  1.00 34.34 ? 199  ARG A CA  1 
ATOM   209  C  C   . ARG A 1 47  ? 13.982  -6.692  22.498  1.00 34.61 ? 199  ARG A C   1 
ATOM   210  O  O   . ARG A 1 47  ? 15.104  -6.280  22.206  1.00 34.76 ? 199  ARG A O   1 
ATOM   211  C  CB  . ARG A 1 47  ? 14.747  -8.816  23.578  1.00 34.52 ? 199  ARG A CB  1 
ATOM   212  C  CG  . ARG A 1 47  ? 14.620  -9.898  24.651  1.00 37.73 ? 199  ARG A CG  1 
ATOM   213  C  CD  . ARG A 1 47  ? 15.233  -9.514  26.011  1.00 43.23 ? 199  ARG A CD  1 
ATOM   214  N  NE  . ARG A 1 47  ? 16.554  -8.871  25.914  1.00 47.40 ? 199  ARG A NE  1 
ATOM   215  C  CZ  . ARG A 1 47  ? 16.864  -7.696  26.479  1.00 48.90 ? 199  ARG A CZ  1 
ATOM   216  N  NH1 . ARG A 1 47  ? 15.955  -7.035  27.193  1.00 48.50 ? 199  ARG A NH1 1 
ATOM   217  N  NH2 . ARG A 1 47  ? 18.084  -7.178  26.337  1.00 48.83 ? 199  ARG A NH2 1 
ATOM   218  N  N   . VAL A 1 48  ? 12.901  -6.364  21.802  1.00 35.19 ? 200  VAL A N   1 
ATOM   219  C  CA  . VAL A 1 48  ? 12.993  -5.524  20.621  1.00 35.77 ? 200  VAL A CA  1 
ATOM   220  C  C   . VAL A 1 48  ? 12.025  -4.355  20.706  1.00 36.05 ? 200  VAL A C   1 
ATOM   221  O  O   . VAL A 1 48  ? 10.834  -4.497  20.464  1.00 36.15 ? 200  VAL A O   1 
ATOM   222  C  CB  . VAL A 1 48  ? 12.784  -6.335  19.325  1.00 35.76 ? 200  VAL A CB  1 
ATOM   223  C  CG1 . VAL A 1 48  ? 12.866  -5.421  18.119  1.00 35.99 ? 200  VAL A CG1 1 
ATOM   224  C  CG2 . VAL A 1 48  ? 13.860  -7.401  19.210  1.00 36.52 ? 200  VAL A CG2 1 
ATOM   225  N  N   . MET A 1 49  ? 12.556  -3.194  21.060  1.00 36.64 ? 201  MET A N   1 
ATOM   226  C  CA  . MET A 1 49  ? 11.755  -1.986  21.205  1.00 36.90 ? 201  MET A CA  1 
ATOM   227  C  C   . MET A 1 49  ? 11.435  -1.406  19.821  1.00 36.15 ? 201  MET A C   1 
ATOM   228  O  O   . MET A 1 49  ? 12.344  -0.992  19.090  1.00 36.08 ? 201  MET A O   1 
ATOM   229  C  CB  . MET A 1 49  ? 12.514  -0.980  22.072  1.00 37.42 ? 201  MET A CB  1 
ATOM   230  C  CG  . MET A 1 49  ? 11.636  -0.011  22.843  1.00 40.93 ? 201  MET A CG  1 
ATOM   231  S  SD  . MET A 1 49  ? 11.242  1.501   21.924  1.00 47.78 ? 201  MET A SD  1 
ATOM   232  C  CE  . MET A 1 49  ? 12.776  2.426   22.062  1.00 45.84 ? 201  MET A CE  1 
ATOM   233  N  N   . VAL A 1 50  ? 10.153  -1.416  19.449  1.00 35.14 ? 202  VAL A N   1 
ATOM   234  C  CA  . VAL A 1 50  ? 9.708   -0.761  18.214  1.00 34.26 ? 202  VAL A CA  1 
ATOM   235  C  C   . VAL A 1 50  ? 9.545   0.743   18.441  1.00 34.04 ? 202  VAL A C   1 
ATOM   236  O  O   . VAL A 1 50  ? 8.573   1.186   19.058  1.00 34.50 ? 202  VAL A O   1 
ATOM   237  C  CB  . VAL A 1 50  ? 8.383   -1.357  17.665  1.00 34.05 ? 202  VAL A CB  1 
ATOM   238  C  CG1 . VAL A 1 50  ? 7.907   -0.601  16.419  1.00 32.82 ? 202  VAL A CG1 1 
ATOM   239  C  CG2 . VAL A 1 50  ? 8.552   -2.827  17.350  1.00 33.90 ? 202  VAL A CG2 1 
ATOM   240  N  N   . THR A 1 51  ? 10.503  1.524   17.952  1.00 33.46 ? 203  THR A N   1 
ATOM   241  C  CA  . THR A 1 51  ? 10.413  2.984   17.995  1.00 32.88 ? 203  THR A CA  1 
ATOM   242  C  C   . THR A 1 51  ? 9.302   3.410   17.039  1.00 33.14 ? 203  THR A C   1 
ATOM   243  O  O   . THR A 1 51  ? 8.827   2.608   16.229  1.00 33.28 ? 203  THR A O   1 
ATOM   244  C  CB  . THR A 1 51  ? 11.744  3.661   17.587  1.00 32.67 ? 203  THR A CB  1 
ATOM   245  O  OG1 . THR A 1 51  ? 11.833  3.736   16.160  1.00 32.26 ? 203  THR A OG1 1 
ATOM   246  C  CG2 . THR A 1 51  ? 12.946  2.887   18.123  1.00 31.48 ? 203  THR A CG2 1 
ATOM   247  N  N   . ASP A 1 52  ? 8.865   4.658   17.107  1.00 33.11 ? 204  ASP A N   1 
ATOM   248  C  CA  . ASP A 1 52  ? 7.776   5.043   16.215  1.00 33.14 ? 204  ASP A CA  1 
ATOM   249  C  C   . ASP A 1 52  ? 8.225   5.779   14.966  1.00 32.14 ? 204  ASP A C   1 
ATOM   250  O  O   . ASP A 1 52  ? 7.401   6.322   14.243  1.00 32.36 ? 204  ASP A O   1 
ATOM   251  C  CB  . ASP A 1 52  ? 6.694   5.819   16.960  1.00 33.93 ? 204  ASP A CB  1 
ATOM   252  C  CG  . ASP A 1 52  ? 7.257   6.929   17.804  1.00 36.16 ? 204  ASP A CG  1 
ATOM   253  O  OD1 . ASP A 1 52  ? 6.540   7.353   18.739  1.00 39.56 ? 204  ASP A OD1 1 
ATOM   254  O  OD2 . ASP A 1 52  ? 8.407   7.369   17.545  1.00 38.32 ? 204  ASP A OD2 1 
ATOM   255  N  N   . PHE A 1 53  ? 9.524   5.793   14.702  1.00 31.28 ? 205  PHE A N   1 
ATOM   256  C  CA  . PHE A 1 53  ? 10.009  6.374   13.466  1.00 30.64 ? 205  PHE A CA  1 
ATOM   257  C  C   . PHE A 1 53  ? 9.546   5.552   12.281  1.00 30.46 ? 205  PHE A C   1 
ATOM   258  O  O   . PHE A 1 53  ? 9.736   4.340   12.243  1.00 30.69 ? 205  PHE A O   1 
ATOM   259  C  CB  . PHE A 1 53  ? 11.534  6.495   13.434  1.00 30.60 ? 205  PHE A CB  1 
ATOM   260  C  CG  . PHE A 1 53  ? 12.050  7.100   12.165  1.00 30.01 ? 205  PHE A CG  1 
ATOM   261  C  CD1 . PHE A 1 53  ? 12.412  8.444   12.120  1.00 30.21 ? 205  PHE A CD1 1 
ATOM   262  C  CD2 . PHE A 1 53  ? 12.134  6.346   11.002  1.00 29.66 ? 205  PHE A CD2 1 
ATOM   263  C  CE1 . PHE A 1 53  ? 12.866  9.031   10.932  1.00 30.13 ? 205  PHE A CE1 1 
ATOM   264  C  CE2 . PHE A 1 53  ? 12.577  6.921   9.807   1.00 30.50 ? 205  PHE A CE2 1 
ATOM   265  C  CZ  . PHE A 1 53  ? 12.945  8.270   9.776   1.00 30.32 ? 205  PHE A CZ  1 
ATOM   266  N  N   . GLU A 1 54  ? 8.948   6.225   11.307  1.00 30.41 ? 206  GLU A N   1 
ATOM   267  C  CA  . GLU A 1 54  ? 8.555   5.593   10.059  1.00 30.44 ? 206  GLU A CA  1 
ATOM   268  C  C   . GLU A 1 54  ? 8.592   6.606   8.946   1.00 30.06 ? 206  GLU A C   1 
ATOM   269  O  O   . GLU A 1 54  ? 7.958   7.656   9.025   1.00 30.44 ? 206  GLU A O   1 
ATOM   270  C  CB  . GLU A 1 54  ? 7.163   4.999   10.185  1.00 30.89 ? 206  GLU A CB  1 
ATOM   271  C  CG  . GLU A 1 54  ? 6.446   4.731   8.879   1.00 32.86 ? 206  GLU A CG  1 
ATOM   272  C  CD  . GLU A 1 54  ? 5.192   3.929   9.107   1.00 36.37 ? 206  GLU A CD  1 
ATOM   273  O  OE1 . GLU A 1 54  ? 4.747   3.863   10.275  1.00 38.13 ? 206  GLU A OE1 1 
ATOM   274  O  OE2 . GLU A 1 54  ? 4.654   3.357   8.137   1.00 38.40 ? 206  GLU A OE2 1 
ATOM   275  N  N   . ASN A 1 55  ? 9.357   6.297   7.913   1.00 29.49 ? 207  ASN A N   1 
ATOM   276  C  CA  . ASN A 1 55  ? 9.442   7.165   6.770   1.00 28.99 ? 207  ASN A CA  1 
ATOM   277  C  C   . ASN A 1 55  ? 9.629   6.307   5.542   1.00 29.09 ? 207  ASN A C   1 
ATOM   278  O  O   . ASN A 1 55  ? 10.737  5.836   5.278   1.00 28.70 ? 207  ASN A O   1 
ATOM   279  C  CB  . ASN A 1 55  ? 10.599  8.153   6.948   1.00 28.93 ? 207  ASN A CB  1 
ATOM   280  C  CG  . ASN A 1 55  ? 10.542  9.312   5.969   1.00 27.28 ? 207  ASN A CG  1 
ATOM   281  O  OD1 . ASN A 1 55  ? 10.384  9.126   4.759   1.00 25.81 ? 207  ASN A OD1 1 
ATOM   282  N  ND2 . ASN A 1 55  ? 10.688  10.515  6.490   1.00 25.68 ? 207  ASN A ND2 1 
ATOM   283  N  N   . VAL A 1 56  ? 8.539   6.097   4.805   1.00 29.40 ? 208  VAL A N   1 
ATOM   284  C  CA  . VAL A 1 56  ? 8.535   5.159   3.678   1.00 30.15 ? 208  VAL A CA  1 
ATOM   285  C  C   . VAL A 1 56  ? 7.749   5.701   2.491   1.00 31.20 ? 208  VAL A C   1 
ATOM   286  O  O   . VAL A 1 56  ? 6.747   6.375   2.690   1.00 31.17 ? 208  VAL A O   1 
ATOM   287  C  CB  . VAL A 1 56  ? 7.978   3.748   4.086   1.00 29.80 ? 208  VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 56  ? 8.813   3.136   5.190   1.00 28.94 ? 208  VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 56  ? 6.522   3.810   4.507   1.00 28.94 ? 208  VAL A CG2 1 
ATOM   290  N  N   . PRO A 1 57  ? 8.200   5.411   1.255   1.00 32.48 ? 209  PRO A N   1 
ATOM   291  C  CA  . PRO A 1 57  ? 7.448   5.795   0.059   1.00 33.97 ? 209  PRO A CA  1 
ATOM   292  C  C   . PRO A 1 57  ? 6.215   4.920   -0.157  1.00 35.94 ? 209  PRO A C   1 
ATOM   293  O  O   . PRO A 1 57  ? 6.152   3.794   0.339   1.00 36.26 ? 209  PRO A O   1 
ATOM   294  C  CB  . PRO A 1 57  ? 8.448   5.558   -1.081  1.00 33.29 ? 209  PRO A CB  1 
ATOM   295  C  CG  . PRO A 1 57  ? 9.318   4.487   -0.598  1.00 32.67 ? 209  PRO A CG  1 
ATOM   296  C  CD  . PRO A 1 57  ? 9.440   4.697   0.904   1.00 32.74 ? 209  PRO A CD  1 
ATOM   297  N  N   . GLU A 1 58  ? 5.254   5.435   -0.914  1.00 38.30 ? 210  GLU A N   1 
ATOM   298  C  CA  . GLU A 1 58  ? 4.051   4.692   -1.268  1.00 40.79 ? 210  GLU A CA  1 
ATOM   299  C  C   . GLU A 1 58  ? 4.422   3.445   -2.084  1.00 41.48 ? 210  GLU A C   1 
ATOM   300  O  O   . GLU A 1 58  ? 5.467   3.434   -2.745  1.00 41.87 ? 210  GLU A O   1 
ATOM   301  C  CB  . GLU A 1 58  ? 3.111   5.603   -2.054  1.00 41.15 ? 210  GLU A CB  1 
ATOM   302  C  CG  . GLU A 1 58  ? 1.638   5.248   -1.893  1.00 45.44 ? 210  GLU A CG  1 
ATOM   303  C  CD  . GLU A 1 58  ? 0.701   6.388   -2.294  1.00 50.58 ? 210  GLU A CD  1 
ATOM   304  O  OE1 . GLU A 1 58  ? 0.922   7.539   -1.815  1.00 52.63 ? 210  GLU A OE1 1 
ATOM   305  O  OE2 . GLU A 1 58  ? -0.256  6.126   -3.077  1.00 50.65 ? 210  GLU A OE2 1 
ATOM   306  N  N   . GLU A 1 59  ? 3.582   2.406   -2.033  1.00 42.32 ? 211  GLU A N   1 
ATOM   307  C  CA  . GLU A 1 59  ? 3.887   1.120   -2.680  1.00 43.26 ? 211  GLU A CA  1 
ATOM   308  C  C   . GLU A 1 59  ? 3.856   1.201   -4.202  1.00 43.42 ? 211  GLU A C   1 
ATOM   309  O  O   . GLU A 1 59  ? 2.889   1.698   -4.770  1.00 43.52 ? 211  GLU A O   1 
ATOM   310  C  CB  . GLU A 1 59  ? 2.941   0.007   -2.190  1.00 43.67 ? 211  GLU A CB  1 
ATOM   311  C  CG  . GLU A 1 59  ? 3.473   -0.833  -1.013  1.00 45.18 ? 211  GLU A CG  1 
ATOM   312  C  CD  . GLU A 1 59  ? 3.307   -0.135  0.339   1.00 48.22 ? 211  GLU A CD  1 
ATOM   313  O  OE1 . GLU A 1 59  ? 2.473   0.804   0.415   1.00 49.96 ? 211  GLU A OE1 1 
ATOM   314  O  OE2 . GLU A 1 59  ? 4.006   -0.518  1.322   1.00 48.05 ? 211  GLU A OE2 1 
ATOM   315  N  N   . ASP A 1 60  ? 4.917   0.708   -4.848  1.00 43.86 ? 212  ASP A N   1 
ATOM   316  C  CA  . ASP A 1 60  ? 5.053   0.752   -6.315  1.00 44.10 ? 212  ASP A CA  1 
ATOM   317  C  C   . ASP A 1 60  ? 4.432   -0.475  -6.959  1.00 44.31 ? 212  ASP A C   1 
ATOM   318  O  O   . ASP A 1 60  ? 3.386   -0.372  -7.600  1.00 44.82 ? 212  ASP A O   1 
ATOM   319  C  CB  . ASP A 1 60  ? 6.521   0.884   -6.733  1.00 44.01 ? 212  ASP A CB  1 
ATOM   320  N  N   . GLN A 1 67  ? 6.965   -10.991 -4.939  1.00 54.95 ? 219  GLN A N   1 
ATOM   321  C  CA  . GLN A 1 67  ? 5.741   -10.373 -4.435  1.00 54.95 ? 219  GLN A CA  1 
ATOM   322  C  C   . GLN A 1 67  ? 5.127   -11.177 -3.288  1.00 54.42 ? 219  GLN A C   1 
ATOM   323  O  O   . GLN A 1 67  ? 4.106   -10.774 -2.725  1.00 54.62 ? 219  GLN A O   1 
ATOM   324  C  CB  . GLN A 1 67  ? 4.704   -10.256 -5.558  1.00 54.88 ? 219  GLN A CB  1 
ATOM   325  C  CG  . GLN A 1 67  ? 5.289   -9.977  -6.944  1.00 55.79 ? 219  GLN A CG  1 
ATOM   326  C  CD  . GLN A 1 67  ? 4.236   -9.989  -8.050  1.00 55.99 ? 219  GLN A CD  1 
ATOM   327  O  OE1 . GLN A 1 67  ? 4.382   -10.694 -9.055  1.00 57.39 ? 219  GLN A OE1 1 
ATOM   328  N  NE2 . GLN A 1 67  ? 3.170   -9.207  -7.869  1.00 56.85 ? 219  GLN A NE2 1 
ATOM   329  N  N   . ALA A 1 68  ? 5.751   -12.303 -2.939  1.00 53.57 ? 220  ALA A N   1 
ATOM   330  C  CA  . ALA A 1 68  ? 5.111   -13.305 -2.072  1.00 52.69 ? 220  ALA A CA  1 
ATOM   331  C  C   . ALA A 1 68  ? 5.535   -13.325 -0.588  1.00 51.83 ? 220  ALA A C   1 
ATOM   332  O  O   . ALA A 1 68  ? 4.934   -14.049 0.227   1.00 51.84 ? 220  ALA A O   1 
ATOM   333  C  CB  . ALA A 1 68  ? 5.265   -14.689 -2.684  1.00 52.87 ? 220  ALA A CB  1 
ATOM   334  N  N   . SER A 1 69  ? 6.561   -12.546 -0.243  1.00 50.26 ? 221  SER A N   1 
ATOM   335  C  CA  . SER A 1 69  ? 6.977   -12.407 1.154   1.00 48.60 ? 221  SER A CA  1 
ATOM   336  C  C   . SER A 1 69  ? 6.161   -11.310 1.856   1.00 47.23 ? 221  SER A C   1 
ATOM   337  O  O   . SER A 1 69  ? 5.805   -10.289 1.240   1.00 46.94 ? 221  SER A O   1 
ATOM   338  C  CB  . SER A 1 69  ? 8.467   -12.094 1.239   1.00 48.81 ? 221  SER A CB  1 
ATOM   339  O  OG  . SER A 1 69  ? 8.735   -10.824 0.669   1.00 49.08 ? 221  SER A OG  1 
ATOM   340  N  N   . LYS A 1 70  ? 5.875   -11.525 3.143   1.00 45.17 ? 222  LYS A N   1 
ATOM   341  C  CA  . LYS A 1 70  ? 5.074   -10.583 3.926   1.00 42.87 ? 222  LYS A CA  1 
ATOM   342  C  C   . LYS A 1 70  ? 5.718   -9.217  4.071   1.00 41.23 ? 222  LYS A C   1 
ATOM   343  O  O   . LYS A 1 70  ? 6.914   -9.021  3.850   1.00 40.90 ? 222  LYS A O   1 
ATOM   344  C  CB  . LYS A 1 70  ? 4.739   -11.142 5.307   1.00 43.01 ? 222  LYS A CB  1 
ATOM   345  C  CG  . LYS A 1 70  ? 3.590   -12.137 5.312   1.00 43.03 ? 222  LYS A CG  1 
ATOM   346  C  CD  . LYS A 1 70  ? 3.233   -12.582 6.725   1.00 43.08 ? 222  LYS A CD  1 
ATOM   347  C  CE  . LYS A 1 70  ? 2.277   -11.614 7.384   1.00 43.35 ? 222  LYS A CE  1 
ATOM   348  N  NZ  . LYS A 1 70  ? 2.022   -12.011 8.789   1.00 43.95 ? 222  LYS A NZ  1 
ATOM   349  N  N   . CYS A 1 71  ? 4.891   -8.271  4.467   1.00 39.29 ? 223  CYS A N   1 
ATOM   350  C  CA  . CYS A 1 71  ? 5.269   -6.881  4.523   1.00 37.28 ? 223  CYS A CA  1 
ATOM   351  C  C   . CYS A 1 71  ? 6.318   -6.580  5.627   1.00 35.55 ? 223  CYS A C   1 
ATOM   352  O  O   . CYS A 1 71  ? 7.047   -5.587  5.560   1.00 35.19 ? 223  CYS A O   1 
ATOM   353  C  CB  . CYS A 1 71  ? 3.983   -6.079  4.660   1.00 37.17 ? 223  CYS A CB  1 
ATOM   354  S  SG  . CYS A 1 71  ? 4.209   -4.392  4.982   1.00 39.26 ? 223  CYS A SG  1 
ATOM   355  N  N   . ASP A 1 72  ? 6.421   -7.472  6.611   1.00 33.39 ? 224  ASP A N   1 
ATOM   356  C  CA  . ASP A 1 72  ? 7.402   -7.345  7.686   1.00 31.32 ? 224  ASP A CA  1 
ATOM   357  C  C   . ASP A 1 72  ? 8.381   -8.550  7.761   1.00 29.99 ? 224  ASP A C   1 
ATOM   358  O  O   . ASP A 1 72  ? 8.913   -8.894  8.830   1.00 29.32 ? 224  ASP A O   1 
ATOM   359  C  CB  . ASP A 1 72  ? 6.670   -7.163  9.009   1.00 31.04 ? 224  ASP A CB  1 
ATOM   360  C  CG  . ASP A 1 72  ? 5.745   -8.316  9.322   1.00 31.68 ? 224  ASP A CG  1 
ATOM   361  O  OD1 . ASP A 1 72  ? 5.663   -9.268  8.505   1.00 32.52 ? 224  ASP A OD1 1 
ATOM   362  O  OD2 . ASP A 1 72  ? 5.098   -8.282  10.392  1.00 32.41 ? 224  ASP A OD2 1 
ATOM   363  N  N   . SER A 1 73  ? 8.628   -9.183  6.622   1.00 28.21 ? 225  SER A N   1 
ATOM   364  C  CA  . SER A 1 73  ? 9.404   -10.413 6.638   1.00 27.07 ? 225  SER A CA  1 
ATOM   365  C  C   . SER A 1 73  ? 10.908  -10.176 6.642   1.00 26.00 ? 225  SER A C   1 
ATOM   366  O  O   . SER A 1 73  ? 11.641  -10.886 7.311   1.00 25.67 ? 225  SER A O   1 
ATOM   367  C  CB  . SER A 1 73  ? 8.967   -11.378 5.528   1.00 26.87 ? 225  SER A CB  1 
ATOM   368  O  OG  . SER A 1 73  ? 9.187   -10.834 4.249   1.00 27.36 ? 225  SER A OG  1 
ATOM   369  N  N   . HIS A 1 74  ? 11.356  -9.154  5.930   1.00 25.01 ? 226  HIS A N   1 
ATOM   370  C  CA  . HIS A 1 74  ? 12.773  -8.853  5.849   1.00 24.23 ? 226  HIS A CA  1 
ATOM   371  C  C   . HIS A 1 74  ? 13.370  -8.442  7.205   1.00 23.73 ? 226  HIS A C   1 
ATOM   372  O  O   . HIS A 1 74  ? 14.440  -8.912  7.584   1.00 24.36 ? 226  HIS A O   1 
ATOM   373  C  CB  . HIS A 1 74  ? 13.000  -7.774  4.793   1.00 24.41 ? 226  HIS A CB  1 
ATOM   374  C  CG  . HIS A 1 74  ? 14.436  -7.546  4.453   1.00 25.14 ? 226  HIS A CG  1 
ATOM   375  N  ND1 . HIS A 1 74  ? 15.149  -6.460  4.922   1.00 26.56 ? 226  HIS A ND1 1 
ATOM   376  C  CD2 . HIS A 1 74  ? 15.293  -8.258  3.684   1.00 26.26 ? 226  HIS A CD2 1 
ATOM   377  C  CE1 . HIS A 1 74  ? 16.387  -6.518  4.464   1.00 27.10 ? 226  HIS A CE1 1 
ATOM   378  N  NE2 . HIS A 1 74  ? 16.502  -7.599  3.709   1.00 27.69 ? 226  HIS A NE2 1 
ATOM   379  N  N   . GLY A 1 75  ? 12.683  -7.578  7.939   1.00 22.72 ? 227  GLY A N   1 
ATOM   380  C  CA  . GLY A 1 75  ? 13.212  -7.050  9.190   1.00 21.81 ? 227  GLY A CA  1 
ATOM   381  C  C   . GLY A 1 75  ? 13.078  -7.974  10.385  1.00 21.27 ? 227  GLY A C   1 
ATOM   382  O  O   . GLY A 1 75  ? 13.956  -8.000  11.264  1.00 21.48 ? 227  GLY A O   1 
ATOM   383  N  N   . THR A 1 76  ? 11.979  -8.726  10.427  1.00 20.42 ? 228  THR A N   1 
ATOM   384  C  CA  . THR A 1 76  ? 11.765  -9.713  11.473  1.00 19.60 ? 228  THR A CA  1 
ATOM   385  C  C   . THR A 1 76  ? 12.872  -10.763 11.410  1.00 19.38 ? 228  THR A C   1 
ATOM   386  O  O   . THR A 1 76  ? 13.429  -11.156 12.437  1.00 19.32 ? 228  THR A O   1 
ATOM   387  C  CB  . THR A 1 76  ? 10.385  -10.367 11.342  1.00 19.79 ? 228  THR A CB  1 
ATOM   388  O  OG1 . THR A 1 76  ? 9.363   -9.350  11.375  1.00 19.60 ? 228  THR A OG1 1 
ATOM   389  C  CG2 . THR A 1 76  ? 10.147  -11.364 12.472  1.00 18.99 ? 228  THR A CG2 1 
ATOM   390  N  N   . HIS A 1 77  ? 13.217  -11.182 10.196  1.00 18.74 ? 229  HIS A N   1 
ATOM   391  C  CA  . HIS A 1 77  ? 14.302  -12.116 10.014  1.00 18.48 ? 229  HIS A CA  1 
ATOM   392  C  C   . HIS A 1 77  ? 15.627  -11.562 10.502  1.00 18.47 ? 229  HIS A C   1 
ATOM   393  O  O   . HIS A 1 77  ? 16.386  -12.276 11.164  1.00 18.60 ? 229  HIS A O   1 
ATOM   394  C  CB  . HIS A 1 77  ? 14.441  -12.537 8.558   1.00 18.52 ? 229  HIS A CB  1 
ATOM   395  C  CG  . HIS A 1 77  ? 15.420  -13.654 8.353   1.00 19.01 ? 229  HIS A CG  1 
ATOM   396  N  ND1 . HIS A 1 77  ? 16.691  -13.451 7.860   1.00 18.16 ? 229  HIS A ND1 1 
ATOM   397  C  CD2 . HIS A 1 77  ? 15.321  -14.982 8.600   1.00 18.77 ? 229  HIS A CD2 1 
ATOM   398  C  CE1 . HIS A 1 77  ? 17.320  -14.608 7.781   1.00 17.76 ? 229  HIS A CE1 1 
ATOM   399  N  NE2 . HIS A 1 77  ? 16.510  -15.553 8.222   1.00 18.81 ? 229  HIS A NE2 1 
ATOM   400  N  N   . LEU A 1 78  ? 15.921  -10.308 10.164  1.00 18.10 ? 230  LEU A N   1 
ATOM   401  C  CA  . LEU A 1 78  ? 17.213  -9.744  10.517  1.00 17.74 ? 230  LEU A CA  1 
ATOM   402  C  C   . LEU A 1 78  ? 17.306  -9.442  12.011  1.00 17.57 ? 230  LEU A C   1 
ATOM   403  O  O   . LEU A 1 78  ? 18.362  -9.606  12.606  1.00 16.81 ? 230  LEU A O   1 
ATOM   404  C  CB  . LEU A 1 78  ? 17.521  -8.509  9.685   1.00 18.05 ? 230  LEU A CB  1 
ATOM   405  C  CG  . LEU A 1 78  ? 17.832  -8.762  8.212   1.00 18.48 ? 230  LEU A CG  1 
ATOM   406  C  CD1 . LEU A 1 78  ? 17.846  -7.450  7.523   1.00 17.53 ? 230  LEU A CD1 1 
ATOM   407  C  CD2 . LEU A 1 78  ? 19.168  -9.483  8.005   1.00 18.51 ? 230  LEU A CD2 1 
ATOM   408  N  N   . ALA A 1 79  ? 16.198  -9.003  12.609  1.00 17.27 ? 231  ALA A N   1 
ATOM   409  C  CA  . ALA A 1 79  ? 16.151  -8.832  14.058  1.00 16.88 ? 231  ALA A CA  1 
ATOM   410  C  C   . ALA A 1 79  ? 16.498  -10.168 14.687  1.00 16.77 ? 231  ALA A C   1 
ATOM   411  O  O   . ALA A 1 79  ? 17.215  -10.206 15.688  1.00 16.89 ? 231  ALA A O   1 
ATOM   412  C  CB  . ALA A 1 79  ? 14.776  -8.335  14.521  1.00 16.25 ? 231  ALA A CB  1 
ATOM   413  N  N   . GLY A 1 80  ? 16.010  -11.245 14.060  1.00 16.85 ? 232  GLY A N   1 
ATOM   414  C  CA  . GLY A 1 80  ? 16.262  -12.632 14.447  1.00 16.88 ? 232  GLY A CA  1 
ATOM   415  C  C   . GLY A 1 80  ? 17.722  -13.039 14.434  1.00 17.20 ? 232  GLY A C   1 
ATOM   416  O  O   . GLY A 1 80  ? 18.295  -13.307 15.487  1.00 17.51 ? 232  GLY A O   1 
ATOM   417  N  N   . VAL A 1 81  ? 18.341  -13.086 13.258  1.00 17.55 ? 233  VAL A N   1 
ATOM   418  C  CA  . VAL A 1 81  ? 19.803  -13.091 13.178  1.00 18.24 ? 233  VAL A CA  1 
ATOM   419  C  C   . VAL A 1 81  ? 20.145  -11.911 14.052  1.00 19.11 ? 233  VAL A C   1 
ATOM   420  O  O   . VAL A 1 81  ? 19.331  -10.999 14.168  1.00 21.23 ? 233  VAL A O   1 
ATOM   421  C  CB  . VAL A 1 81  ? 20.288  -12.733 11.761  1.00 17.76 ? 233  VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1 81  ? 21.689  -13.222 11.550  1.00 18.76 ? 233  VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1 81  ? 19.373  -13.289 10.696  1.00 17.55 ? 233  VAL A CG2 1 
ATOM   424  N  N   . VAL A 1 82  ? 21.312  -11.845 14.658  1.00 19.07 ? 234  VAL A N   1 
ATOM   425  C  CA  . VAL A 1 82  ? 21.619  -10.676 15.526  1.00 19.01 ? 234  VAL A CA  1 
ATOM   426  C  C   . VAL A 1 82  ? 21.175  -10.944 16.939  1.00 19.09 ? 234  VAL A C   1 
ATOM   427  O  O   . VAL A 1 82  ? 22.006  -11.192 17.790  1.00 18.70 ? 234  VAL A O   1 
ATOM   428  C  CB  . VAL A 1 82  ? 20.971  -9.276  15.118  1.00 18.85 ? 234  VAL A CB  1 
ATOM   429  C  CG1 . VAL A 1 82  ? 21.362  -8.199  16.141  1.00 18.77 ? 234  VAL A CG1 1 
ATOM   430  C  CG2 . VAL A 1 82  ? 21.382  -8.809  13.740  1.00 17.86 ? 234  VAL A CG2 1 
ATOM   431  N  N   . SER A 1 83  ? 19.869  -10.896 17.190  1.00 19.66 ? 235  SER A N   1 
ATOM   432  C  CA  . SER A 1 83  ? 19.397  -10.914 18.575  1.00 20.66 ? 235  SER A CA  1 
ATOM   433  C  C   . SER A 1 83  ? 18.400  -12.005 18.975  1.00 20.98 ? 235  SER A C   1 
ATOM   434  O  O   . SER A 1 83  ? 17.992  -12.054 20.131  1.00 21.55 ? 235  SER A O   1 
ATOM   435  C  CB  . SER A 1 83  ? 18.863  -9.528  18.980  1.00 20.56 ? 235  SER A CB  1 
ATOM   436  O  OG  . SER A 1 83  ? 17.538  -9.337  18.514  1.00 21.30 ? 235  SER A OG  1 
ATOM   437  N  N   . GLY A 1 84  ? 18.025  -12.882 18.051  1.00 21.37 ? 236  GLY A N   1 
ATOM   438  C  CA  . GLY A 1 84  ? 17.023  -13.914 18.343  1.00 22.25 ? 236  GLY A CA  1 
ATOM   439  C  C   . GLY A 1 84  ? 17.402  -14.803 19.518  1.00 22.99 ? 236  GLY A C   1 
ATOM   440  O  O   . GLY A 1 84  ? 18.564  -15.189 19.661  1.00 23.23 ? 236  GLY A O   1 
ATOM   441  N  N   . ARG A 1 85  ? 16.413  -15.129 20.351  1.00 23.54 ? 237  ARG A N   1 
ATOM   442  C  CA  . ARG A 1 85  ? 16.609  -15.894 21.593  1.00 24.12 ? 237  ARG A CA  1 
ATOM   443  C  C   . ARG A 1 85  ? 17.364  -17.216 21.418  1.00 24.08 ? 237  ARG A C   1 
ATOM   444  O  O   . ARG A 1 85  ? 18.250  -17.539 22.215  1.00 24.55 ? 237  ARG A O   1 
ATOM   445  C  CB  . ARG A 1 85  ? 15.263  -16.157 22.261  1.00 24.08 ? 237  ARG A CB  1 
ATOM   446  C  CG  . ARG A 1 85  ? 15.271  -15.921 23.753  1.00 27.16 ? 237  ARG A CG  1 
ATOM   447  C  CD  . ARG A 1 85  ? 13.860  -15.903 24.345  1.00 31.83 ? 237  ARG A CD  1 
ATOM   448  N  NE  . ARG A 1 85  ? 13.014  -14.926 23.656  1.00 35.51 ? 237  ARG A NE  1 
ATOM   449  C  CZ  . ARG A 1 85  ? 12.497  -13.832 24.212  1.00 36.27 ? 237  ARG A CZ  1 
ATOM   450  N  NH1 . ARG A 1 85  ? 12.703  -13.558 25.498  1.00 36.44 ? 237  ARG A NH1 1 
ATOM   451  N  NH2 . ARG A 1 85  ? 11.749  -13.023 23.476  1.00 36.16 ? 237  ARG A NH2 1 
ATOM   452  N  N   . ASP A 1 86  ? 17.033  -17.978 20.380  1.00 23.63 ? 238  ASP A N   1 
ATOM   453  C  CA  . ASP A 1 86  ? 17.672  -19.274 20.187  1.00 23.29 ? 238  ASP A CA  1 
ATOM   454  C  C   . ASP A 1 86  ? 18.408  -19.405 18.848  1.00 23.44 ? 238  ASP A C   1 
ATOM   455  O  O   . ASP A 1 86  ? 19.332  -20.209 18.729  1.00 23.31 ? 238  ASP A O   1 
ATOM   456  C  CB  . ASP A 1 86  ? 16.651  -20.395 20.395  1.00 23.18 ? 238  ASP A CB  1 
ATOM   457  C  CG  . ASP A 1 86  ? 16.221  -20.529 21.857  1.00 23.24 ? 238  ASP A CG  1 
ATOM   458  O  OD1 . ASP A 1 86  ? 17.115  -20.706 22.718  1.00 24.21 ? 238  ASP A OD1 1 
ATOM   459  O  OD2 . ASP A 1 86  ? 15.003  -20.451 22.154  1.00 20.84 ? 238  ASP A OD2 1 
ATOM   460  N  N   . ALA A 1 87  ? 18.024  -18.600 17.857  1.00 23.41 ? 239  ALA A N   1 
ATOM   461  C  CA  . ALA A 1 87  ? 18.702  -18.613 16.557  1.00 23.54 ? 239  ALA A CA  1 
ATOM   462  C  C   . ALA A 1 87  ? 19.679  -17.437 16.332  1.00 23.97 ? 239  ALA A C   1 
ATOM   463  O  O   . ALA A 1 87  ? 20.387  -17.402 15.326  1.00 23.64 ? 239  ALA A O   1 
ATOM   464  C  CB  . ALA A 1 87  ? 17.688  -18.686 15.438  1.00 23.04 ? 239  ALA A CB  1 
ATOM   465  N  N   . GLY A 1 88  ? 19.732  -16.491 17.265  1.00 24.32 ? 240  GLY A N   1 
ATOM   466  C  CA  . GLY A 1 88  ? 20.505  -15.268 17.052  1.00 25.38 ? 240  GLY A CA  1 
ATOM   467  C  C   . GLY A 1 88  ? 21.989  -15.389 17.325  1.00 26.26 ? 240  GLY A C   1 
ATOM   468  O  O   . GLY A 1 88  ? 22.439  -16.332 17.987  1.00 26.78 ? 240  GLY A O   1 
ATOM   469  N  N   . VAL A 1 89  ? 22.746  -14.415 16.821  1.00 26.99 ? 241  VAL A N   1 
ATOM   470  C  CA  . VAL A 1 89  ? 24.206  -14.310 17.032  1.00 27.33 ? 241  VAL A CA  1 
ATOM   471  C  C   . VAL A 1 89  ? 24.530  -13.705 18.404  1.00 27.91 ? 241  VAL A C   1 
ATOM   472  O  O   . VAL A 1 89  ? 25.377  -14.216 19.121  1.00 27.88 ? 241  VAL A O   1 
ATOM   473  C  CB  . VAL A 1 89  ? 24.877  -13.478 15.899  1.00 27.23 ? 241  VAL A CB  1 
ATOM   474  C  CG1 . VAL A 1 89  ? 26.385  -13.405 16.076  1.00 26.38 ? 241  VAL A CG1 1 
ATOM   475  C  CG2 . VAL A 1 89  ? 24.526  -14.067 14.523  1.00 27.37 ? 241  VAL A CG2 1 
ATOM   476  N  N   . ALA A 1 90  ? 23.858  -12.608 18.750  1.00 28.68 ? 242  ALA A N   1 
ATOM   477  C  CA  . ALA A 1 90  ? 23.964  -11.996 20.071  1.00 29.42 ? 242  ALA A CA  1 
ATOM   478  C  C   . ALA A 1 90  ? 22.654  -12.259 20.794  1.00 30.30 ? 242  ALA A C   1 
ATOM   479  O  O   . ALA A 1 90  ? 21.769  -11.400 20.832  1.00 30.88 ? 242  ALA A O   1 
ATOM   480  C  CB  . ALA A 1 90  ? 24.238  -10.483 19.957  1.00 28.89 ? 242  ALA A CB  1 
ATOM   481  N  N   . LYS A 1 91  ? 22.530  -13.451 21.372  1.00 31.35 ? 243  LYS A N   1 
ATOM   482  C  CA  . LYS A 1 91  ? 21.253  -13.909 21.922  1.00 32.06 ? 243  LYS A CA  1 
ATOM   483  C  C   . LYS A 1 91  ? 20.566  -12.937 22.890  1.00 32.90 ? 243  LYS A C   1 
ATOM   484  O  O   . LYS A 1 91  ? 19.331  -12.865 22.892  1.00 33.05 ? 243  LYS A O   1 
ATOM   485  C  CB  . LYS A 1 91  ? 21.357  -15.324 22.490  1.00 31.84 ? 243  LYS A CB  1 
ATOM   486  C  CG  . LYS A 1 91  ? 21.290  -16.404 21.419  1.00 31.51 ? 243  LYS A CG  1 
ATOM   487  C  CD  . LYS A 1 91  ? 22.242  -17.536 21.741  1.00 32.33 ? 243  LYS A CD  1 
ATOM   488  C  CE  . LYS A 1 91  ? 21.830  -18.822 21.063  1.00 33.76 ? 243  LYS A CE  1 
ATOM   489  N  NZ  . LYS A 1 91  ? 22.145  -18.836 19.604  1.00 35.98 ? 243  LYS A NZ  1 
ATOM   490  N  N   . GLY A 1 92  ? 21.339  -12.175 23.672  1.00 33.62 ? 244  GLY A N   1 
ATOM   491  C  CA  . GLY A 1 92  ? 20.799  -10.962 24.337  1.00 34.68 ? 244  GLY A CA  1 
ATOM   492  C  C   . GLY A 1 92  ? 19.558  -10.491 23.559  1.00 35.10 ? 244  GLY A C   1 
ATOM   493  O  O   . GLY A 1 92  ? 18.452  -10.980 23.811  1.00 35.63 ? 244  GLY A O   1 
ATOM   494  N  N   . ALA A 1 93  ? 19.681  -9.508  22.666  1.00 34.76 ? 245  ALA A N   1 
ATOM   495  C  CA  . ALA A 1 93  ? 20.570  -8.366  22.789  1.00 34.36 ? 245  ALA A CA  1 
ATOM   496  C  C   . ALA A 1 93  ? 19.532  -7.248  22.662  1.00 34.06 ? 245  ALA A C   1 
ATOM   497  O  O   . ALA A 1 93  ? 18.388  -7.518  22.274  1.00 33.81 ? 245  ALA A O   1 
ATOM   498  C  CB  . ALA A 1 93  ? 21.572  -8.321  21.653  1.00 34.00 ? 245  ALA A CB  1 
ATOM   499  N  N   . SER A 1 94  ? 19.885  -6.012  22.990  1.00 33.61 ? 246  SER A N   1 
ATOM   500  C  CA  . SER A 1 94  ? 18.869  -4.971  22.975  1.00 33.35 ? 246  SER A CA  1 
ATOM   501  C  C   . SER A 1 94  ? 18.740  -4.371  21.576  1.00 32.71 ? 246  SER A C   1 
ATOM   502  O  O   . SER A 1 94  ? 19.742  -3.973  20.984  1.00 33.04 ? 246  SER A O   1 
ATOM   503  C  CB  . SER A 1 94  ? 19.203  -3.903  24.005  1.00 33.58 ? 246  SER A CB  1 
ATOM   504  O  OG  . SER A 1 94  ? 18.074  -3.092  24.264  1.00 35.10 ? 246  SER A OG  1 
ATOM   505  N  N   . MET A 1 95  ? 17.521  -4.328  21.038  1.00 31.61 ? 247  MET A N   1 
ATOM   506  C  CA  . MET A 1 95  ? 17.316  -3.807  19.683  1.00 30.85 ? 247  MET A CA  1 
ATOM   507  C  C   . MET A 1 95  ? 16.245  -2.735  19.566  1.00 30.59 ? 247  MET A C   1 
ATOM   508  O  O   . MET A 1 95  ? 15.208  -2.781  20.249  1.00 30.64 ? 247  MET A O   1 
ATOM   509  C  CB  . MET A 1 95  ? 17.020  -4.929  18.690  1.00 30.70 ? 247  MET A CB  1 
ATOM   510  C  CG  . MET A 1 95  ? 18.275  -5.654  18.235  1.00 31.44 ? 247  MET A CG  1 
ATOM   511  S  SD  . MET A 1 95  ? 18.093  -6.631  16.733  1.00 30.74 ? 247  MET A SD  1 
ATOM   512  C  CE  . MET A 1 95  ? 17.755  -5.374  15.514  1.00 30.83 ? 247  MET A CE  1 
ATOM   513  N  N   . ARG A 1 96  ? 16.490  -1.778  18.679  1.00 29.64 ? 248  ARG A N   1 
ATOM   514  C  CA  . ARG A 1 96  ? 15.489  -0.772  18.383  1.00 29.13 ? 248  ARG A CA  1 
ATOM   515  C  C   . ARG A 1 96  ? 15.212  -0.671  16.893  1.00 28.23 ? 248  ARG A C   1 
ATOM   516  O  O   . ARG A 1 96  ? 16.119  -0.512  16.076  1.00 28.19 ? 248  ARG A O   1 
ATOM   517  C  CB  . ARG A 1 96  ? 15.899  0.580   18.953  1.00 29.68 ? 248  ARG A CB  1 
ATOM   518  C  CG  . ARG A 1 96  ? 15.721  0.694   20.440  1.00 31.89 ? 248  ARG A CG  1 
ATOM   519  C  CD  . ARG A 1 96  ? 16.472  1.880   20.967  1.00 36.47 ? 248  ARG A CD  1 
ATOM   520  N  NE  . ARG A 1 96  ? 16.807  1.689   22.369  1.00 41.27 ? 248  ARG A NE  1 
ATOM   521  C  CZ  . ARG A 1 96  ? 16.296  2.397   23.372  1.00 43.94 ? 248  ARG A CZ  1 
ATOM   522  N  NH1 . ARG A 1 96  ? 16.678  2.137   24.620  1.00 44.31 ? 248  ARG A NH1 1 
ATOM   523  N  NH2 . ARG A 1 96  ? 15.418  3.372   23.131  1.00 45.35 ? 248  ARG A NH2 1 
ATOM   524  N  N   . SER A 1 97  ? 13.933  -0.749  16.558  1.00 27.31 ? 249  SER A N   1 
ATOM   525  C  CA  . SER A 1 97  ? 13.488  -0.830  15.180  1.00 26.13 ? 249  SER A CA  1 
ATOM   526  C  C   . SER A 1 97  ? 13.031  0.542   14.660  1.00 25.11 ? 249  SER A C   1 
ATOM   527  O  O   . SER A 1 97  ? 12.179  1.192   15.267  1.00 24.75 ? 249  SER A O   1 
ATOM   528  C  CB  . SER A 1 97  ? 12.358  -1.866  15.098  1.00 25.88 ? 249  SER A CB  1 
ATOM   529  O  OG  . SER A 1 97  ? 11.608  -1.738  13.907  1.00 26.68 ? 249  SER A OG  1 
ATOM   530  N  N   . LEU A 1 98  ? 13.611  0.975   13.543  1.00 23.98 ? 250  LEU A N   1 
ATOM   531  C  CA  . LEU A 1 98  ? 13.149  2.173   12.826  1.00 23.33 ? 250  LEU A CA  1 
ATOM   532  C  C   . LEU A 1 98  ? 12.684  1.736   11.461  1.00 22.96 ? 250  LEU A C   1 
ATOM   533  O  O   . LEU A 1 98  ? 13.352  0.913   10.828  1.00 23.20 ? 250  LEU A O   1 
ATOM   534  C  CB  . LEU A 1 98  ? 14.270  3.206   12.649  1.00 23.15 ? 250  LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 98  ? 14.595  4.175   13.783  1.00 22.43 ? 250  LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 98  ? 15.504  3.548   14.830  1.00 21.30 ? 250  LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 98  ? 15.242  5.410   13.194  1.00 22.48 ? 250  LEU A CD2 1 
ATOM   538  N  N   . ARG A 1 99  ? 11.560  2.268   10.990  1.00 22.27 ? 251  ARG A N   1 
ATOM   539  C  CA  . ARG A 1 99  ? 11.038  1.786   9.717   1.00 22.32 ? 251  ARG A CA  1 
ATOM   540  C  C   . ARG A 1 99  ? 11.444  2.677   8.533   1.00 22.16 ? 251  ARG A C   1 
ATOM   541  O  O   . ARG A 1 99  ? 10.949  3.791   8.413   1.00 22.61 ? 251  ARG A O   1 
ATOM   542  C  CB  . ARG A 1 99  ? 9.516   1.552   9.767   1.00 21.90 ? 251  ARG A CB  1 
ATOM   543  C  CG  . ARG A 1 99  ? 8.990   0.957   8.465   1.00 22.17 ? 251  ARG A CG  1 
ATOM   544  C  CD  . ARG A 1 99  ? 7.490   0.758   8.437   1.00 22.40 ? 251  ARG A CD  1 
ATOM   545  N  NE  . ARG A 1 99  ? 7.086   0.031   7.233   1.00 23.14 ? 251  ARG A NE  1 
ATOM   546  C  CZ  . ARG A 1 99  ? 5.899   0.139   6.633   1.00 23.83 ? 251  ARG A CZ  1 
ATOM   547  N  NH1 . ARG A 1 99  ? 5.633   -0.560  5.536   1.00 23.45 ? 251  ARG A NH1 1 
ATOM   548  N  NH2 . ARG A 1 99  ? 4.977   0.954   7.114   1.00 24.62 ? 251  ARG A NH2 1 
ATOM   549  N  N   . VAL A 1 100 ? 12.343  2.197   7.671   1.00 21.71 ? 252  VAL A N   1 
ATOM   550  C  CA  . VAL A 1 100 ? 12.698  2.950   6.464   1.00 21.46 ? 252  VAL A CA  1 
ATOM   551  C  C   . VAL A 1 100 ? 12.387  2.237   5.152   1.00 21.84 ? 252  VAL A C   1 
ATOM   552  O  O   . VAL A 1 100 ? 12.675  2.767   4.088   1.00 22.28 ? 252  VAL A O   1 
ATOM   553  C  CB  . VAL A 1 100 ? 14.175  3.433   6.448   1.00 21.25 ? 252  VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 100 ? 14.463  4.368   7.611   1.00 21.37 ? 252  VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 100 ? 15.137  2.272   6.449   1.00 21.18 ? 252  VAL A CG2 1 
ATOM   556  N  N   . LEU A 1 101 ? 11.809  1.039   5.213   1.00 22.35 ? 253  LEU A N   1 
ATOM   557  C  CA  . LEU A 1 101 ? 11.457  0.287   3.996   1.00 22.48 ? 253  LEU A CA  1 
ATOM   558  C  C   . LEU A 1 101 ? 9.980   -0.048  4.008   1.00 23.23 ? 253  LEU A C   1 
ATOM   559  O  O   . LEU A 1 101 ? 9.425   -0.363  5.067   1.00 23.53 ? 253  LEU A O   1 
ATOM   560  C  CB  . LEU A 1 101 ? 12.300  -0.987  3.862   1.00 21.84 ? 253  LEU A CB  1 
ATOM   561  C  CG  . LEU A 1 101 ? 13.837  -0.877  3.965   1.00 21.40 ? 253  LEU A CG  1 
ATOM   562  C  CD1 . LEU A 1 101 ? 14.517  -2.235  3.929   1.00 20.17 ? 253  LEU A CD1 1 
ATOM   563  C  CD2 . LEU A 1 101 ? 14.450  0.023   2.903   1.00 21.69 ? 253  LEU A CD2 1 
ATOM   564  N  N   . ASN A 1 102 ? 9.333   0.041   2.848   1.00 24.04 ? 254  ASN A N   1 
ATOM   565  C  CA  . ASN A 1 102 ? 7.904   -0.272  2.763   1.00 25.17 ? 254  ASN A CA  1 
ATOM   566  C  C   . ASN A 1 102 ? 7.646   -1.773  2.604   1.00 26.00 ? 254  ASN A C   1 
ATOM   567  O  O   . ASN A 1 102 ? 8.571   -2.577  2.781   1.00 26.14 ? 254  ASN A O   1 
ATOM   568  C  CB  . ASN A 1 102 ? 7.228   0.549   1.662   1.00 25.31 ? 254  ASN A CB  1 
ATOM   569  C  CG  . ASN A 1 102 ? 7.691   0.176   0.263   1.00 26.29 ? 254  ASN A CG  1 
ATOM   570  O  OD1 . ASN A 1 102 ? 8.472   -0.759  0.068   1.00 26.37 ? 254  ASN A OD1 1 
ATOM   571  N  ND2 . ASN A 1 102 ? 7.199   0.913   -0.724  1.00 26.48 ? 254  ASN A ND2 1 
ATOM   572  N  N   . CYS A 1 103 ? 6.414   -2.163  2.271   1.00 26.92 ? 255  CYS A N   1 
ATOM   573  C  CA  . CYS A 1 103 ? 6.087   -3.594  2.207   1.00 28.08 ? 255  CYS A CA  1 
ATOM   574  C  C   . CYS A 1 103 ? 6.905   -4.332  1.162   1.00 27.75 ? 255  CYS A C   1 
ATOM   575  O  O   . CYS A 1 103 ? 7.273   -5.479  1.373   1.00 28.02 ? 255  CYS A O   1 
ATOM   576  C  CB  . CYS A 1 103 ? 4.613   -3.833  1.949   1.00 28.68 ? 255  CYS A CB  1 
ATOM   577  S  SG  . CYS A 1 103 ? 3.527   -3.396  3.320   1.00 33.64 ? 255  CYS A SG  1 
ATOM   578  N  N   . GLN A 1 104 ? 7.197   -3.664  0.049   1.00 27.35 ? 256  GLN A N   1 
ATOM   579  C  CA  . GLN A 1 104 ? 8.006   -4.238  -1.022  1.00 26.95 ? 256  GLN A CA  1 
ATOM   580  C  C   . GLN A 1 104 ? 9.512   -4.075  -0.763  1.00 25.53 ? 256  GLN A C   1 
ATOM   581  O  O   . GLN A 1 104 ? 10.320  -4.290  -1.664  1.00 25.10 ? 256  GLN A O   1 
ATOM   582  C  CB  . GLN A 1 104 ? 7.632   -3.600  -2.364  1.00 26.95 ? 256  GLN A CB  1 
ATOM   583  C  CG  . GLN A 1 104 ? 6.118   -3.414  -2.606  1.00 28.64 ? 256  GLN A CG  1 
ATOM   584  C  CD  . GLN A 1 104 ? 5.820   -2.359  -3.678  1.00 29.67 ? 256  GLN A CD  1 
ATOM   585  O  OE1 . GLN A 1 104 ? 6.582   -1.392  -3.860  1.00 34.78 ? 256  GLN A OE1 1 
ATOM   586  N  NE2 . GLN A 1 104 ? 4.710   -2.534  -4.387  1.00 32.60 ? 256  GLN A NE2 1 
ATOM   587  N  N   . GLY A 1 105 ? 9.888   -3.691  0.459   1.00 24.38 ? 257  GLY A N   1 
ATOM   588  C  CA  . GLY A 1 105 ? 11.303  -3.552  0.831   1.00 23.49 ? 257  GLY A CA  1 
ATOM   589  C  C   . GLY A 1 105 ? 12.024  -2.368  0.197   1.00 23.00 ? 257  GLY A C   1 
ATOM   590  O  O   . GLY A 1 105 ? 13.244  -2.385  0.011   1.00 22.59 ? 257  GLY A O   1 
ATOM   591  N  N   . LYS A 1 106 ? 11.257  -1.324  -0.099  1.00 22.57 ? 258  LYS A N   1 
ATOM   592  C  CA  . LYS A 1 106 ? 11.717  -0.187  -0.868  1.00 22.30 ? 258  LYS A CA  1 
ATOM   593  C  C   . LYS A 1 106 ? 11.668  1.060   0.027   1.00 21.64 ? 258  LYS A C   1 
ATOM   594  O  O   . LYS A 1 106 ? 10.642  1.348   0.645   1.00 21.87 ? 258  LYS A O   1 
ATOM   595  C  CB  . LYS A 1 106 ? 10.804  -0.046  -2.081  1.00 22.35 ? 258  LYS A CB  1 
ATOM   596  C  CG  . LYS A 1 106 ? 11.331  0.748   -3.237  1.00 24.62 ? 258  LYS A CG  1 
ATOM   597  C  CD  . LYS A 1 106 ? 10.681  0.248   -4.529  1.00 29.89 ? 258  LYS A CD  1 
ATOM   598  C  CE  . LYS A 1 106 ? 10.633  1.331   -5.627  1.00 32.33 ? 258  LYS A CE  1 
ATOM   599  N  NZ  . LYS A 1 106 ? 9.786   2.503   -5.212  1.00 34.04 ? 258  LYS A NZ  1 
ATOM   600  N  N   . GLY A 1 107 ? 12.785  1.771   0.121   1.00 20.55 ? 259  GLY A N   1 
ATOM   601  C  CA  . GLY A 1 107 ? 12.853  3.011   0.904   1.00 19.70 ? 259  GLY A CA  1 
ATOM   602  C  C   . GLY A 1 107 ? 13.379  4.172   0.072   1.00 18.72 ? 259  GLY A C   1 
ATOM   603  O  O   . GLY A 1 107 ? 13.347  4.123   -1.156  1.00 18.91 ? 259  GLY A O   1 
ATOM   604  N  N   . THR A 1 108 ? 13.868  5.217   0.728   1.00 17.84 ? 260  THR A N   1 
ATOM   605  C  CA  . THR A 1 108 ? 14.486  6.350   0.011   1.00 17.12 ? 260  THR A CA  1 
ATOM   606  C  C   . THR A 1 108 ? 15.743  6.791   0.713   1.00 17.20 ? 260  THR A C   1 
ATOM   607  O  O   . THR A 1 108 ? 15.871  6.631   1.933   1.00 17.61 ? 260  THR A O   1 
ATOM   608  C  CB  . THR A 1 108 ? 13.552  7.609   -0.109  1.00 16.91 ? 260  THR A CB  1 
ATOM   609  O  OG1 . THR A 1 108 ? 13.355  8.198   1.180   1.00 14.56 ? 260  THR A OG1 1 
ATOM   610  C  CG2 . THR A 1 108 ? 12.206  7.266   -0.725  1.00 15.42 ? 260  THR A CG2 1 
ATOM   611  N  N   . VAL A 1 109 ? 16.671  7.367   -0.047  1.00 17.36 ? 261  VAL A N   1 
ATOM   612  C  CA  . VAL A 1 109 ? 17.855  7.996   0.557   1.00 17.17 ? 261  VAL A CA  1 
ATOM   613  C  C   . VAL A 1 109 ? 17.411  8.996   1.625   1.00 17.38 ? 261  VAL A C   1 
ATOM   614  O  O   . VAL A 1 109 ? 17.927  8.973   2.741   1.00 17.31 ? 261  VAL A O   1 
ATOM   615  C  CB  . VAL A 1 109 ? 18.739  8.684   -0.495  1.00 16.93 ? 261  VAL A CB  1 
ATOM   616  C  CG1 . VAL A 1 109 ? 19.718  9.621   0.152   1.00 15.70 ? 261  VAL A CG1 1 
ATOM   617  C  CG2 . VAL A 1 109 ? 19.474  7.636   -1.327  1.00 17.37 ? 261  VAL A CG2 1 
ATOM   618  N  N   . SER A 1 110 ? 16.427  9.837   1.299   1.00 17.32 ? 262  SER A N   1 
ATOM   619  C  CA  . SER A 1 110 ? 15.991  10.865  2.238   1.00 17.62 ? 262  SER A CA  1 
ATOM   620  C  C   . SER A 1 110 ? 15.417  10.307  3.549   1.00 17.97 ? 262  SER A C   1 
ATOM   621  O  O   . SER A 1 110 ? 15.773  10.772  4.639   1.00 17.66 ? 262  SER A O   1 
ATOM   622  C  CB  . SER A 1 110 ? 15.037  11.871  1.576   1.00 17.55 ? 262  SER A CB  1 
ATOM   623  O  OG  . SER A 1 110 ? 13.764  11.332  1.305   1.00 16.21 ? 262  SER A OG  1 
ATOM   624  N  N   . GLY A 1 111 ? 14.559  9.288   3.427   1.00 18.66 ? 263  GLY A N   1 
ATOM   625  C  CA  . GLY A 1 111 ? 13.934  8.613   4.576   1.00 18.52 ? 263  GLY A CA  1 
ATOM   626  C  C   . GLY A 1 111 ? 14.992  7.956   5.434   1.00 18.66 ? 263  GLY A C   1 
ATOM   627  O  O   . GLY A 1 111 ? 14.920  7.996   6.661   1.00 18.78 ? 263  GLY A O   1 
ATOM   628  N  N   . THR A 1 112 ? 15.990  7.371   4.787   1.00 18.54 ? 264  THR A N   1 
ATOM   629  C  CA  . THR A 1 112 ? 17.128  6.815   5.501   1.00 19.25 ? 264  THR A CA  1 
ATOM   630  C  C   . THR A 1 112 ? 17.912  7.866   6.304   1.00 19.52 ? 264  THR A C   1 
ATOM   631  O  O   . THR A 1 112 ? 18.256  7.627   7.459   1.00 19.14 ? 264  THR A O   1 
ATOM   632  C  CB  . THR A 1 112 ? 18.055  6.082   4.527   1.00 19.51 ? 264  THR A CB  1 
ATOM   633  O  OG1 . THR A 1 112 ? 17.280  5.145   3.757   1.00 20.36 ? 264  THR A OG1 1 
ATOM   634  C  CG2 . THR A 1 112 ? 19.180  5.360   5.269   1.00 19.10 ? 264  THR A CG2 1 
ATOM   635  N  N   . LEU A 1 113 ? 18.190  9.017   5.678   1.00 20.33 ? 265  LEU A N   1 
ATOM   636  C  CA  . LEU A 1 113 ? 18.876  10.147  6.326   1.00 20.79 ? 265  LEU A CA  1 
ATOM   637  C  C   . LEU A 1 113 ? 18.129  10.598  7.574   1.00 20.72 ? 265  LEU A C   1 
ATOM   638  O  O   . LEU A 1 113 ? 18.742  10.861  8.621   1.00 20.26 ? 265  LEU A O   1 
ATOM   639  C  CB  . LEU A 1 113 ? 18.975  11.344  5.386   1.00 20.93 ? 265  LEU A CB  1 
ATOM   640  C  CG  . LEU A 1 113 ? 19.906  11.326  4.188   1.00 22.48 ? 265  LEU A CG  1 
ATOM   641  C  CD1 . LEU A 1 113 ? 19.435  12.375  3.213   1.00 24.22 ? 265  LEU A CD1 1 
ATOM   642  C  CD2 . LEU A 1 113 ? 21.323  11.613  4.613   1.00 23.85 ? 265  LEU A CD2 1 
ATOM   643  N  N   . ILE A 1 114 ? 16.805  10.686  7.465   1.00 20.71 ? 266  ILE A N   1 
ATOM   644  C  CA  . ILE A 1 114 ? 16.021  11.164  8.590   1.00 21.27 ? 266  ILE A CA  1 
ATOM   645  C  C   . ILE A 1 114 ? 16.065  10.142  9.732   1.00 21.75 ? 266  ILE A C   1 
ATOM   646  O  O   . ILE A 1 114 ? 16.171  10.513  10.903  1.00 21.72 ? 266  ILE A O   1 
ATOM   647  C  CB  . ILE A 1 114 ? 14.595  11.588  8.178   1.00 21.31 ? 266  ILE A CB  1 
ATOM   648  C  CG1 . ILE A 1 114 ? 14.655  12.783  7.212   1.00 20.73 ? 266  ILE A CG1 1 
ATOM   649  C  CG2 . ILE A 1 114 ? 13.772  11.977  9.402   1.00 21.32 ? 266  ILE A CG2 1 
ATOM   650  C  CD1 . ILE A 1 114 ? 13.394  12.943  6.349   1.00 19.56 ? 266  ILE A CD1 1 
ATOM   651  N  N   . GLY A 1 115 ? 16.043  8.857   9.368   1.00 22.19 ? 267  GLY A N   1 
ATOM   652  C  CA  . GLY A 1 115 ? 16.199  7.768   10.323  1.00 22.38 ? 267  GLY A CA  1 
ATOM   653  C  C   . GLY A 1 115 ? 17.547  7.833   10.998  1.00 22.91 ? 267  GLY A C   1 
ATOM   654  O  O   . GLY A 1 115 ? 17.644  7.708   12.216  1.00 22.72 ? 267  GLY A O   1 
ATOM   655  N  N   . LEU A 1 116 ? 18.597  8.046   10.213  1.00 23.68 ? 268  LEU A N   1 
ATOM   656  C  CA  . LEU A 1 116 ? 19.929  8.199   10.791  1.00 24.73 ? 268  LEU A CA  1 
ATOM   657  C  C   . LEU A 1 116 ? 19.936  9.358   11.779  1.00 25.97 ? 268  LEU A C   1 
ATOM   658  O  O   . LEU A 1 116 ? 20.574  9.290   12.839  1.00 25.78 ? 268  LEU A O   1 
ATOM   659  C  CB  . LEU A 1 116 ? 20.984  8.423   9.712   1.00 24.14 ? 268  LEU A CB  1 
ATOM   660  C  CG  . LEU A 1 116 ? 21.422  7.215   8.887   1.00 23.31 ? 268  LEU A CG  1 
ATOM   661  C  CD1 . LEU A 1 116 ? 22.233  7.696   7.699   1.00 22.29 ? 268  LEU A CD1 1 
ATOM   662  C  CD2 . LEU A 1 116 ? 22.200  6.210   9.733   1.00 19.84 ? 268  LEU A CD2 1 
ATOM   663  N  N   . GLU A 1 117 ? 19.207  10.414  11.426  1.00 27.37 ? 269  GLU A N   1 
ATOM   664  C  CA  . GLU A 1 117 ? 19.165  11.601  12.250  1.00 28.99 ? 269  GLU A CA  1 
ATOM   665  C  C   . GLU A 1 117 ? 18.426  11.325  13.569  1.00 29.37 ? 269  GLU A C   1 
ATOM   666  O  O   . GLU A 1 117 ? 18.873  11.751  14.642  1.00 29.34 ? 269  GLU A O   1 
ATOM   667  C  CB  . GLU A 1 117 ? 18.557  12.753  11.466  1.00 29.28 ? 269  GLU A CB  1 
ATOM   668  C  CG  . GLU A 1 117 ? 18.458  14.032  12.247  1.00 32.73 ? 269  GLU A CG  1 
ATOM   669  C  CD  . GLU A 1 117 ? 18.088  15.215  11.383  1.00 37.36 ? 269  GLU A CD  1 
ATOM   670  O  OE1 . GLU A 1 117 ? 16.956  15.723  11.557  1.00 38.79 ? 269  GLU A OE1 1 
ATOM   671  O  OE2 . GLU A 1 117 ? 18.926  15.631  10.540  1.00 39.62 ? 269  GLU A OE2 1 
ATOM   672  N  N   . PHE A 1 118 ? 17.319  10.587  13.482  1.00 30.01 ? 270  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 118 ? 16.592  10.113  14.657  1.00 30.62 ? 270  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 118 ? 17.529  9.388   15.632  1.00 31.39 ? 270  PHE A C   1 
ATOM   675  O  O   . PHE A 1 118 ? 17.434  9.583   16.845  1.00 31.89 ? 270  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 118 ? 15.445  9.205   14.218  1.00 30.50 ? 270  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 118 ? 14.597  8.674   15.349  1.00 31.29 ? 270  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 118 ? 13.382  9.283   15.671  1.00 31.50 ? 270  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 118 ? 14.995  7.536   16.073  1.00 31.68 ? 270  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 118 ? 12.575  8.779   16.710  1.00 31.48 ? 270  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 118 ? 14.206  7.025   17.112  1.00 30.96 ? 270  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 118 ? 12.989  7.652   17.428  1.00 31.26 ? 270  PHE A CZ  1 
ATOM   683  N  N   . ILE A 1 119 ? 18.441  8.574   15.105  1.00 32.04 ? 271  ILE A N   1 
ATOM   684  C  CA  . ILE A 1 119 ? 19.374  7.827   15.947  1.00 32.80 ? 271  ILE A CA  1 
ATOM   685  C  C   . ILE A 1 119 ? 20.348  8.732   16.678  1.00 34.01 ? 271  ILE A C   1 
ATOM   686  O  O   . ILE A 1 119 ? 20.585  8.555   17.881  1.00 34.28 ? 271  ILE A O   1 
ATOM   687  C  CB  . ILE A 1 119 ? 20.153  6.788   15.142  1.00 32.54 ? 271  ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 119 ? 19.207  5.670   14.720  1.00 31.77 ? 271  ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 119 ? 21.352  6.252   15.950  1.00 31.62 ? 271  ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 119 ? 19.754  4.828   13.631  1.00 32.24 ? 271  ILE A CD1 1 
ATOM   691  N  N   . ARG A 1 120 ? 20.902  9.698   15.943  1.00 35.31 ? 272  ARG A N   1 
ATOM   692  C  CA  . ARG A 1 120 ? 21.834  10.684  16.487  1.00 36.53 ? 272  ARG A CA  1 
ATOM   693  C  C   . ARG A 1 120 ? 21.200  11.470  17.636  1.00 37.43 ? 272  ARG A C   1 
ATOM   694  O  O   . ARG A 1 120 ? 21.825  11.660  18.683  1.00 36.94 ? 272  ARG A O   1 
ATOM   695  C  CB  . ARG A 1 120 ? 22.317  11.610  15.367  1.00 36.39 ? 272  ARG A CB  1 
ATOM   696  C  CG  . ARG A 1 120 ? 23.168  12.788  15.785  1.00 37.28 ? 272  ARG A CG  1 
ATOM   697  C  CD  . ARG A 1 120 ? 24.323  12.402  16.683  1.00 39.96 ? 272  ARG A CD  1 
ATOM   698  N  NE  . ARG A 1 120 ? 25.285  13.496  16.804  1.00 42.68 ? 272  ARG A NE  1 
ATOM   699  C  CZ  . ARG A 1 120 ? 26.169  13.629  17.789  1.00 43.21 ? 272  ARG A CZ  1 
ATOM   700  N  NH1 . ARG A 1 120 ? 26.225  12.742  18.776  1.00 43.62 ? 272  ARG A NH1 1 
ATOM   701  N  NH2 . ARG A 1 120 ? 26.996  14.662  17.782  1.00 43.38 ? 272  ARG A NH2 1 
ATOM   702  N  N   . LYS A 1 121 ? 19.954  11.894  17.434  1.00 39.03 ? 273  LYS A N   1 
ATOM   703  C  CA  . LYS A 1 121 ? 19.205  12.618  18.451  1.00 40.94 ? 273  LYS A CA  1 
ATOM   704  C  C   . LYS A 1 121 ? 19.099  11.811  19.744  1.00 41.98 ? 273  LYS A C   1 
ATOM   705  O  O   . LYS A 1 121 ? 19.315  12.359  20.833  1.00 42.11 ? 273  LYS A O   1 
ATOM   706  C  CB  . LYS A 1 121 ? 17.811  13.011  17.942  1.00 40.90 ? 273  LYS A CB  1 
ATOM   707  C  CG  . LYS A 1 121 ? 16.960  13.740  18.977  1.00 41.30 ? 273  LYS A CG  1 
ATOM   708  C  CD  . LYS A 1 121 ? 15.644  14.267  18.398  1.00 41.78 ? 273  LYS A CD  1 
ATOM   709  C  CE  . LYS A 1 121 ? 14.881  15.125  19.436  1.00 42.39 ? 273  LYS A CE  1 
ATOM   710  N  NZ  . LYS A 1 121 ? 13.595  15.694  18.908  1.00 43.27 ? 273  LYS A NZ  1 
ATOM   711  N  N   . SER A 1 122 ? 18.786  10.517  19.622  1.00 43.35 ? 274  SER A N   1 
ATOM   712  C  CA  . SER A 1 122 ? 18.589  9.655   20.799  1.00 44.63 ? 274  SER A CA  1 
ATOM   713  C  C   . SER A 1 122 ? 19.914  9.208   21.418  1.00 45.41 ? 274  SER A C   1 
ATOM   714  O  O   . SER A 1 122 ? 19.959  8.829   22.589  1.00 45.63 ? 274  SER A O   1 
ATOM   715  C  CB  . SER A 1 122 ? 17.687  8.452   20.485  1.00 44.62 ? 274  SER A CB  1 
ATOM   716  O  OG  . SER A 1 122 ? 18.429  7.380   19.928  1.00 44.86 ? 274  SER A OG  1 
ATOM   717  N  N   . GLN A 1 123 ? 20.985  9.253   20.634  1.00 46.44 ? 275  GLN A N   1 
ATOM   718  C  CA  . GLN A 1 123 ? 22.323  9.093   21.187  1.00 47.72 ? 275  GLN A CA  1 
ATOM   719  C  C   . GLN A 1 123 ? 22.641  10.239  22.158  1.00 48.78 ? 275  GLN A C   1 
ATOM   720  O  O   . GLN A 1 123 ? 23.073  9.999   23.289  1.00 49.31 ? 275  GLN A O   1 
ATOM   721  C  CB  . GLN A 1 123 ? 23.371  9.034   20.078  1.00 47.58 ? 275  GLN A CB  1 
ATOM   722  C  CG  . GLN A 1 123 ? 24.788  8.809   20.580  1.00 47.24 ? 275  GLN A CG  1 
ATOM   723  C  CD  . GLN A 1 123 ? 25.838  9.106   19.532  1.00 47.65 ? 275  GLN A CD  1 
ATOM   724  O  OE1 . GLN A 1 123 ? 25.648  9.958   18.657  1.00 47.85 ? 275  GLN A OE1 1 
ATOM   725  N  NE2 . GLN A 1 123 ? 26.963  8.408   19.618  1.00 47.78 ? 275  GLN A NE2 1 
ATOM   726  N  N   . LEU A 1 124 ? 22.420  11.474  21.708  1.00 49.88 ? 276  LEU A N   1 
ATOM   727  C  CA  . LEU A 1 124 ? 22.696  12.672  22.503  1.00 50.88 ? 276  LEU A CA  1 
ATOM   728  C  C   . LEU A 1 124 ? 21.783  12.824  23.710  1.00 51.77 ? 276  LEU A C   1 
ATOM   729  O  O   . LEU A 1 124 ? 22.218  13.295  24.764  1.00 52.05 ? 276  LEU A O   1 
ATOM   730  C  CB  . LEU A 1 124 ? 22.581  13.929  21.642  1.00 50.72 ? 276  LEU A CB  1 
ATOM   731  C  CG  . LEU A 1 124 ? 23.766  14.289  20.747  1.00 51.00 ? 276  LEU A CG  1 
ATOM   732  C  CD1 . LEU A 1 124 ? 23.400  15.462  19.850  1.00 50.37 ? 276  LEU A CD1 1 
ATOM   733  C  CD2 . LEU A 1 124 ? 25.019  14.595  21.574  1.00 51.40 ? 276  LEU A CD2 1 
ATOM   734  N  N   . VAL A 1 125 ? 20.518  12.438  23.562  1.00 52.72 ? 277  VAL A N   1 
ATOM   735  C  CA  . VAL A 1 125 ? 19.545  12.669  24.631  1.00 53.46 ? 277  VAL A CA  1 
ATOM   736  C  C   . VAL A 1 125 ? 19.644  11.600  25.720  1.00 53.88 ? 277  VAL A C   1 
ATOM   737  O  O   . VAL A 1 125 ? 19.715  11.924  26.908  1.00 53.97 ? 277  VAL A O   1 
ATOM   738  C  CB  . VAL A 1 125 ? 18.079  12.871  24.085  1.00 53.67 ? 277  VAL A CB  1 
ATOM   739  C  CG1 . VAL A 1 125 ? 17.190  11.631  24.300  1.00 53.28 ? 277  VAL A CG1 1 
ATOM   740  C  CG2 . VAL A 1 125 ? 17.430  14.140  24.694  1.00 53.67 ? 277  VAL A CG2 1 
ATOM   741  N  N   . GLN A 1 126 ? 19.698  10.335  25.309  1.00 54.30 ? 278  GLN A N   1 
ATOM   742  C  CA  . GLN A 1 126 ? 19.651  9.223   26.259  1.00 54.64 ? 278  GLN A CA  1 
ATOM   743  C  C   . GLN A 1 126 ? 20.829  8.253   26.106  1.00 54.76 ? 278  GLN A C   1 
ATOM   744  O  O   . GLN A 1 126 ? 20.619  7.099   25.696  1.00 55.02 ? 278  GLN A O   1 
ATOM   745  C  CB  . GLN A 1 126 ? 18.299  8.473   26.150  1.00 54.55 ? 278  GLN A CB  1 
ATOM   746  N  N   . PRO A 1 127 ? 22.067  8.720   26.423  1.00 54.70 ? 279  PRO A N   1 
ATOM   747  C  CA  . PRO A 1 127 ? 23.253  7.847   26.550  1.00 54.41 ? 279  PRO A CA  1 
ATOM   748  C  C   . PRO A 1 127 ? 23.335  7.322   27.992  1.00 53.79 ? 279  PRO A C   1 
ATOM   749  O  O   . PRO A 1 127 ? 22.578  7.818   28.831  1.00 53.90 ? 279  PRO A O   1 
ATOM   750  C  CB  . PRO A 1 127 ? 24.410  8.806   26.261  1.00 54.74 ? 279  PRO A CB  1 
ATOM   751  C  CG  . PRO A 1 127 ? 23.924  10.148  26.784  1.00 54.92 ? 279  PRO A CG  1 
ATOM   752  C  CD  . PRO A 1 127 ? 22.407  10.138  26.683  1.00 54.69 ? 279  PRO A CD  1 
ATOM   753  N  N   . VAL A 1 128 ? 24.155  6.320   28.332  1.00 53.03 ? 280  VAL A N   1 
ATOM   754  C  CA  . VAL A 1 128 ? 24.900  5.321   27.498  1.00 51.93 ? 280  VAL A CA  1 
ATOM   755  C  C   . VAL A 1 128 ? 26.235  5.662   26.810  1.00 50.73 ? 280  VAL A C   1 
ATOM   756  O  O   . VAL A 1 128 ? 26.694  6.818   26.801  1.00 50.77 ? 280  VAL A O   1 
ATOM   757  C  CB  . VAL A 1 128 ? 24.022  4.306   26.606  1.00 52.19 ? 280  VAL A CB  1 
ATOM   758  C  CG1 . VAL A 1 128 ? 24.125  2.885   27.166  1.00 52.49 ? 280  VAL A CG1 1 
ATOM   759  C  CG2 . VAL A 1 128 ? 22.557  4.719   26.429  1.00 52.21 ? 280  VAL A CG2 1 
ATOM   760  N  N   . GLY A 1 129 ? 26.860  4.574   26.331  1.00 48.98 ? 281  GLY A N   1 
ATOM   761  C  CA  . GLY A 1 129 ? 27.978  4.556   25.381  1.00 46.19 ? 281  GLY A CA  1 
ATOM   762  C  C   . GLY A 1 129 ? 27.630  3.792   24.086  1.00 44.02 ? 281  GLY A C   1 
ATOM   763  O  O   . GLY A 1 129 ? 26.933  4.342   23.229  1.00 44.44 ? 281  GLY A O   1 
ATOM   764  N  N   . PRO A 1 130 ? 28.044  2.502   23.965  1.00 41.71 ? 282  PRO A N   1 
ATOM   765  C  CA  . PRO A 1 130 ? 28.271  1.800   22.671  1.00 39.55 ? 282  PRO A CA  1 
ATOM   766  C  C   . PRO A 1 130 ? 27.032  1.560   21.814  1.00 37.41 ? 282  PRO A C   1 
ATOM   767  O  O   . PRO A 1 130 ? 26.069  0.945   22.266  1.00 37.46 ? 282  PRO A O   1 
ATOM   768  C  CB  . PRO A 1 130 ? 28.882  0.454   23.082  1.00 39.61 ? 282  PRO A CB  1 
ATOM   769  C  CG  . PRO A 1 130 ? 29.140  0.544   24.543  1.00 40.91 ? 282  PRO A CG  1 
ATOM   770  C  CD  . PRO A 1 130 ? 28.239  1.597   25.107  1.00 41.46 ? 282  PRO A CD  1 
ATOM   771  N  N   . LEU A 1 131 ? 27.089  2.007   20.566  1.00 34.84 ? 283  LEU A N   1 
ATOM   772  C  CA  . LEU A 1 131 ? 25.923  2.056   19.708  1.00 32.22 ? 283  LEU A CA  1 
ATOM   773  C  C   . LEU A 1 131 ? 26.220  1.426   18.355  1.00 30.05 ? 283  LEU A C   1 
ATOM   774  O  O   . LEU A 1 131 ? 27.132  1.847   17.647  1.00 29.30 ? 283  LEU A O   1 
ATOM   775  C  CB  . LEU A 1 131 ? 25.524  3.515   19.528  1.00 32.72 ? 283  LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 131 ? 24.070  3.971   19.551  1.00 33.88 ? 283  LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 131 ? 23.392  3.571   20.854  1.00 36.64 ? 283  LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 131 ? 24.039  5.475   19.404  1.00 32.92 ? 283  LEU A CD2 1 
ATOM   779  N  N   . VAL A 1 132 ? 25.447  0.398   18.007  1.00 28.02 ? 284  VAL A N   1 
ATOM   780  C  CA  . VAL A 1 132 ? 25.554  -0.265  16.705  1.00 25.69 ? 284  VAL A CA  1 
ATOM   781  C  C   . VAL A 1 132 ? 24.300  0.017   15.889  1.00 24.39 ? 284  VAL A C   1 
ATOM   782  O  O   . VAL A 1 132 ? 23.188  0.026   16.429  1.00 24.12 ? 284  VAL A O   1 
ATOM   783  C  CB  . VAL A 1 132 ? 25.823  -1.791  16.832  1.00 25.62 ? 284  VAL A CB  1 
ATOM   784  C  CG1 . VAL A 1 132 ? 25.941  -2.435  15.468  1.00 24.82 ? 284  VAL A CG1 1 
ATOM   785  C  CG2 . VAL A 1 132 ? 27.107  -2.028  17.603  1.00 25.28 ? 284  VAL A CG2 1 
ATOM   786  N  N   . VAL A 1 133 ? 24.503  0.279   14.598  1.00 22.60 ? 285  VAL A N   1 
ATOM   787  C  CA  . VAL A 1 133 ? 23.421  0.563   13.658  1.00 21.06 ? 285  VAL A CA  1 
ATOM   788  C  C   . VAL A 1 133 ? 23.562  -0.349  12.460  1.00 20.16 ? 285  VAL A C   1 
ATOM   789  O  O   . VAL A 1 133 ? 24.604  -0.370  11.804  1.00 19.25 ? 285  VAL A O   1 
ATOM   790  C  CB  . VAL A 1 133 ? 23.441  2.030   13.134  1.00 21.22 ? 285  VAL A CB  1 
ATOM   791  C  CG1 . VAL A 1 133 ? 22.227  2.296   12.242  1.00 20.33 ? 285  VAL A CG1 1 
ATOM   792  C  CG2 . VAL A 1 133 ? 23.502  3.019   14.272  1.00 20.55 ? 285  VAL A CG2 1 
ATOM   793  N  N   . LEU A 1 134 ? 22.498  -1.089  12.178  1.00 19.55 ? 286  LEU A N   1 
ATOM   794  C  CA  . LEU A 1 134 ? 22.492  -2.041  11.093  1.00 19.26 ? 286  LEU A CA  1 
ATOM   795  C  C   . LEU A 1 134 ? 21.724  -1.464  9.916   1.00 19.44 ? 286  LEU A C   1 
ATOM   796  O  O   . LEU A 1 134 ? 20.548  -1.088  10.055  1.00 19.92 ? 286  LEU A O   1 
ATOM   797  C  CB  . LEU A 1 134 ? 21.881  -3.369  11.554  1.00 19.32 ? 286  LEU A CB  1 
ATOM   798  C  CG  . LEU A 1 134 ? 21.755  -4.562  10.606  1.00 18.79 ? 286  LEU A CG  1 
ATOM   799  C  CD1 . LEU A 1 134 ? 23.104  -4.928  10.008  1.00 19.51 ? 286  LEU A CD1 1 
ATOM   800  C  CD2 . LEU A 1 134 ? 21.212  -5.726  11.388  1.00 18.58 ? 286  LEU A CD2 1 
ATOM   801  N  N   . LEU A 1 135 ? 22.395  -1.393  8.765   1.00 18.98 ? 287  LEU A N   1 
ATOM   802  C  CA  . LEU A 1 135 ? 21.800  -0.861  7.540   1.00 18.92 ? 287  LEU A CA  1 
ATOM   803  C  C   . LEU A 1 135 ? 21.749  -1.928  6.436   1.00 18.46 ? 287  LEU A C   1 
ATOM   804  O  O   . LEU A 1 135 ? 22.577  -1.935  5.533   1.00 18.25 ? 287  LEU A O   1 
ATOM   805  C  CB  . LEU A 1 135 ? 22.585  0.374   7.068   1.00 19.24 ? 287  LEU A CB  1 
ATOM   806  C  CG  . LEU A 1 135 ? 22.551  1.592   8.004   1.00 19.72 ? 287  LEU A CG  1 
ATOM   807  C  CD1 . LEU A 1 135 ? 23.862  2.344   7.989   1.00 20.62 ? 287  LEU A CD1 1 
ATOM   808  C  CD2 . LEU A 1 135 ? 21.420  2.511   7.625   1.00 20.49 ? 287  LEU A CD2 1 
ATOM   809  N  N   . PRO A 1 136 ? 20.768  -2.841  6.514   1.00 18.15 ? 288  PRO A N   1 
ATOM   810  C  CA  . PRO A 1 136 ? 20.636  -3.943  5.559   1.00 17.57 ? 288  PRO A CA  1 
ATOM   811  C  C   . PRO A 1 136 ? 19.978  -3.475  4.261   1.00 17.18 ? 288  PRO A C   1 
ATOM   812  O  O   . PRO A 1 136 ? 19.017  -4.085  3.775   1.00 17.22 ? 288  PRO A O   1 
ATOM   813  C  CB  . PRO A 1 136 ? 19.711  -4.908  6.295   1.00 17.62 ? 288  PRO A CB  1 
ATOM   814  C  CG  . PRO A 1 136 ? 18.805  -4.002  7.066   1.00 17.30 ? 288  PRO A CG  1 
ATOM   815  C  CD  . PRO A 1 136 ? 19.701  -2.880  7.537   1.00 18.36 ? 288  PRO A CD  1 
ATOM   816  N  N   . LEU A 1 137 ? 20.483  -2.381  3.714   1.00 16.48 ? 289  LEU A N   1 
ATOM   817  C  CA  . LEU A 1 137 ? 19.937  -1.862  2.483   1.00 15.90 ? 289  LEU A CA  1 
ATOM   818  C  C   . LEU A 1 137 ? 21.051  -1.301  1.623   1.00 15.84 ? 289  LEU A C   1 
ATOM   819  O  O   . LEU A 1 137 ? 22.178  -1.120  2.090   1.00 15.84 ? 289  LEU A O   1 
ATOM   820  C  CB  . LEU A 1 137 ? 18.868  -0.804  2.779   1.00 15.57 ? 289  LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 137 ? 19.233  0.194   3.870   1.00 14.55 ? 289  LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 137 ? 20.019  1.362   3.284   1.00 12.54 ? 289  LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 137 ? 17.972  0.662   4.567   1.00 14.58 ? 289  LEU A CD2 1 
ATOM   824  N  N   . ALA A 1 138 ? 20.730  -1.044  0.361   1.00 15.65 ? 290  ALA A N   1 
ATOM   825  C  CA  . ALA A 1 138 ? 21.652  -0.392  -0.535  1.00 15.52 ? 290  ALA A CA  1 
ATOM   826  C  C   . ALA A 1 138 ? 20.849  0.377   -1.576  1.00 15.62 ? 290  ALA A C   1 
ATOM   827  O  O   . ALA A 1 138 ? 19.740  -0.035  -1.933  1.00 15.50 ? 290  ALA A O   1 
ATOM   828  C  CB  . ALA A 1 138 ? 22.555  -1.416  -1.189  1.00 15.25 ? 290  ALA A CB  1 
ATOM   829  N  N   . GLY A 1 139 ? 21.399  1.518   -2.008  1.00 15.61 ? 291  GLY A N   1 
ATOM   830  C  CA  . GLY A 1 139 ? 20.978  2.221   -3.242  1.00 15.43 ? 291  GLY A CA  1 
ATOM   831  C  C   . GLY A 1 139 ? 22.218  2.568   -4.057  1.00 15.32 ? 291  GLY A C   1 
ATOM   832  O  O   . GLY A 1 139 ? 23.317  2.130   -3.715  1.00 15.58 ? 291  GLY A O   1 
ATOM   833  N  N   . GLY A 1 140 ? 22.071  3.354   -5.119  1.00 15.06 ? 292  GLY A N   1 
ATOM   834  C  CA  . GLY A 1 140 ? 23.237  3.827   -5.859  1.00 15.11 ? 292  GLY A CA  1 
ATOM   835  C  C   . GLY A 1 140 ? 24.145  4.725   -5.026  1.00 15.67 ? 292  GLY A C   1 
ATOM   836  O  O   . GLY A 1 140 ? 23.713  5.290   -4.020  1.00 15.65 ? 292  GLY A O   1 
ATOM   837  N  N   . TYR A 1 141 ? 25.407  4.866   -5.443  1.00 16.03 ? 293  TYR A N   1 
ATOM   838  C  CA  . TYR A 1 141 ? 26.344  5.742   -4.749  1.00 16.27 ? 293  TYR A CA  1 
ATOM   839  C  C   . TYR A 1 141 ? 25.668  7.059   -4.415  1.00 16.68 ? 293  TYR A C   1 
ATOM   840  O  O   . TYR A 1 141 ? 25.182  7.746   -5.307  1.00 16.81 ? 293  TYR A O   1 
ATOM   841  C  CB  . TYR A 1 141 ? 27.609  6.010   -5.576  1.00 16.15 ? 293  TYR A CB  1 
ATOM   842  C  CG  . TYR A 1 141 ? 28.471  7.087   -4.952  1.00 16.75 ? 293  TYR A CG  1 
ATOM   843  C  CD1 . TYR A 1 141 ? 29.134  6.865   -3.739  1.00 17.49 ? 293  TYR A CD1 1 
ATOM   844  C  CD2 . TYR A 1 141 ? 28.590  8.351   -5.545  1.00 17.73 ? 293  TYR A CD2 1 
ATOM   845  C  CE1 . TYR A 1 141 ? 29.905  7.880   -3.139  1.00 17.49 ? 293  TYR A CE1 1 
ATOM   846  C  CE2 . TYR A 1 141 ? 29.361  9.371   -4.957  1.00 16.64 ? 293  TYR A CE2 1 
ATOM   847  C  CZ  . TYR A 1 141 ? 30.012  9.121   -3.759  1.00 16.96 ? 293  TYR A CZ  1 
ATOM   848  O  OH  . TYR A 1 141 ? 30.773  10.107  -3.187  1.00 16.29 ? 293  TYR A OH  1 
ATOM   849  N  N   . SER A 1 142 ? 25.638  7.403   -3.131  1.00 17.31 ? 294  SER A N   1 
ATOM   850  C  CA  . SER A 1 142 ? 25.074  8.673   -2.676  1.00 17.65 ? 294  SER A CA  1 
ATOM   851  C  C   . SER A 1 142 ? 26.011  9.474   -1.780  1.00 18.06 ? 294  SER A C   1 
ATOM   852  O  O   . SER A 1 142 ? 26.303  9.064   -0.646  1.00 17.88 ? 294  SER A O   1 
ATOM   853  C  CB  . SER A 1 142 ? 23.768  8.446   -1.944  1.00 17.63 ? 294  SER A CB  1 
ATOM   854  O  OG  . SER A 1 142 ? 23.411  9.629   -1.263  1.00 18.55 ? 294  SER A OG  1 
ATOM   855  N  N   . ARG A 1 143 ? 26.451  10.623  -2.301  1.00 18.54 ? 295  ARG A N   1 
ATOM   856  C  CA  . ARG A 1 143 ? 27.287  11.594  -1.588  1.00 19.34 ? 295  ARG A CA  1 
ATOM   857  C  C   . ARG A 1 143 ? 26.721  11.968  -0.185  1.00 18.79 ? 295  ARG A C   1 
ATOM   858  O  O   . ARG A 1 143 ? 27.457  12.033  0.797   1.00 18.34 ? 295  ARG A O   1 
ATOM   859  C  CB  . ARG A 1 143 ? 27.407  12.847  -2.464  1.00 20.21 ? 295  ARG A CB  1 
ATOM   860  C  CG  . ARG A 1 143 ? 28.780  13.513  -2.526  1.00 23.76 ? 295  ARG A CG  1 
ATOM   861  C  CD  . ARG A 1 143 ? 29.122  14.032  -3.969  1.00 30.27 ? 295  ARG A CD  1 
ATOM   862  N  NE  . ARG A 1 143 ? 28.354  13.356  -5.037  1.00 35.83 ? 295  ARG A NE  1 
ATOM   863  C  CZ  . ARG A 1 143 ? 28.697  13.268  -6.331  1.00 37.38 ? 295  ARG A CZ  1 
ATOM   864  N  NH1 . ARG A 1 143 ? 29.834  13.793  -6.782  1.00 38.31 ? 295  ARG A NH1 1 
ATOM   865  N  NH2 . ARG A 1 143 ? 27.895  12.627  -7.184  1.00 37.23 ? 295  ARG A NH2 1 
ATOM   866  N  N   . VAL A 1 144 ? 25.413  12.196  -0.099  1.00 18.20 ? 296  VAL A N   1 
ATOM   867  C  CA  . VAL A 1 144 ? 24.819  12.685  1.134   1.00 18.14 ? 296  VAL A CA  1 
ATOM   868  C  C   . VAL A 1 144 ? 24.594  11.568  2.133   1.00 18.42 ? 296  VAL A C   1 
ATOM   869  O  O   . VAL A 1 144 ? 24.803  11.760  3.333   1.00 18.42 ? 296  VAL A O   1 
ATOM   870  C  CB  . VAL A 1 144 ? 23.516  13.525  0.892   1.00 18.30 ? 296  VAL A CB  1 
ATOM   871  C  CG1 . VAL A 1 144 ? 22.361  12.666  0.378   1.00 17.94 ? 296  VAL A CG1 1 
ATOM   872  C  CG2 . VAL A 1 144 ? 23.106  14.232  2.152   1.00 17.33 ? 296  VAL A CG2 1 
ATOM   873  N  N   . LEU A 1 145 ? 24.170  10.399  1.646   1.00 18.49 ? 297  LEU A N   1 
ATOM   874  C  CA  . LEU A 1 145 ? 24.069  9.229   2.516   1.00 18.17 ? 297  LEU A CA  1 
ATOM   875  C  C   . LEU A 1 145 ? 25.449  8.927   3.101   1.00 17.66 ? 297  LEU A C   1 
ATOM   876  O  O   . LEU A 1 145 ? 25.605  8.925   4.317   1.00 17.92 ? 297  LEU A O   1 
ATOM   877  C  CB  . LEU A 1 145 ? 23.477  8.030   1.778   1.00 18.48 ? 297  LEU A CB  1 
ATOM   878  C  CG  . LEU A 1 145 ? 23.025  6.808   2.595   1.00 19.41 ? 297  LEU A CG  1 
ATOM   879  C  CD1 . LEU A 1 145 ? 22.162  7.195   3.802   1.00 19.38 ? 297  LEU A CD1 1 
ATOM   880  C  CD2 . LEU A 1 145 ? 22.278  5.805   1.693   1.00 18.22 ? 297  LEU A CD2 1 
ATOM   881  N  N   . ASN A 1 146 ? 26.458  8.753   2.249   1.00 17.28 ? 298  ASN A N   1 
ATOM   882  C  CA  . ASN A 1 146 ? 27.835  8.541   2.724   1.00 17.22 ? 298  ASN A CA  1 
ATOM   883  C  C   . ASN A 1 146 ? 28.320  9.585   3.745   1.00 17.58 ? 298  ASN A C   1 
ATOM   884  O  O   . ASN A 1 146 ? 29.098  9.252   4.649   1.00 17.64 ? 298  ASN A O   1 
ATOM   885  C  CB  . ASN A 1 146 ? 28.812  8.450   1.557   1.00 16.77 ? 298  ASN A CB  1 
ATOM   886  C  CG  . ASN A 1 146 ? 28.755  7.099   0.835   1.00 17.36 ? 298  ASN A CG  1 
ATOM   887  O  OD1 . ASN A 1 146 ? 27.718  6.424   0.795   1.00 16.89 ? 298  ASN A OD1 1 
ATOM   888  N  ND2 . ASN A 1 146 ? 29.882  6.705   0.254   1.00 16.76 ? 298  ASN A ND2 1 
ATOM   889  N  N   . ALA A 1 147 ? 27.845  10.831  3.610   1.00 17.27 ? 299  ALA A N   1 
ATOM   890  C  CA  . ALA A 1 147 ? 28.214  11.914  4.522   1.00 17.08 ? 299  ALA A CA  1 
ATOM   891  C  C   . ALA A 1 147 ? 27.584  11.753  5.901   1.00 17.21 ? 299  ALA A C   1 
ATOM   892  O  O   . ALA A 1 147 ? 28.247  11.931  6.933   1.00 16.68 ? 299  ALA A O   1 
ATOM   893  C  CB  . ALA A 1 147 ? 27.827  13.243  3.935   1.00 17.14 ? 299  ALA A CB  1 
ATOM   894  N  N   . ALA A 1 148 ? 26.296  11.424  5.915   1.00 17.77 ? 300  ALA A N   1 
ATOM   895  C  CA  . ALA A 1 148 ? 25.573  11.227  7.166   1.00 18.30 ? 300  ALA A CA  1 
ATOM   896  C  C   . ALA A 1 148 ? 26.231  10.106  7.959   1.00 18.90 ? 300  ALA A C   1 
ATOM   897  O  O   . ALA A 1 148 ? 26.408  10.210  9.184   1.00 18.61 ? 300  ALA A O   1 
ATOM   898  C  CB  . ALA A 1 148 ? 24.116  10.930  6.903   1.00 18.00 ? 300  ALA A CB  1 
ATOM   899  N  N   . CYS A 1 149 ? 26.630  9.060   7.234   1.00 19.70 ? 301  CYS A N   1 
ATOM   900  C  CA  . CYS A 1 149 ? 27.328  7.932   7.825   1.00 20.58 ? 301  CYS A CA  1 
ATOM   901  C  C   . CYS A 1 149 ? 28.652  8.364   8.404   1.00 21.45 ? 301  CYS A C   1 
ATOM   902  O  O   . CYS A 1 149 ? 28.976  8.022   9.538   1.00 21.54 ? 301  CYS A O   1 
ATOM   903  C  CB  . CYS A 1 149 ? 27.524  6.818   6.803   1.00 20.49 ? 301  CYS A CB  1 
ATOM   904  S  SG  . CYS A 1 149 ? 25.972  6.046   6.332   1.00 19.51 ? 301  CYS A SG  1 
ATOM   905  N  N   . GLN A 1 150 ? 29.407  9.143   7.639   1.00 22.56 ? 302  GLN A N   1 
ATOM   906  C  CA  . GLN A 1 150 ? 30.647  9.699   8.153   1.00 23.81 ? 302  GLN A CA  1 
ATOM   907  C  C   . GLN A 1 150 ? 30.444  10.534  9.420   1.00 24.73 ? 302  GLN A C   1 
ATOM   908  O  O   . GLN A 1 150 ? 31.214  10.405  10.381  1.00 24.75 ? 302  GLN A O   1 
ATOM   909  C  CB  . GLN A 1 150 ? 31.359  10.523  7.089   1.00 23.66 ? 302  GLN A CB  1 
ATOM   910  C  CG  . GLN A 1 150 ? 32.644  11.128  7.589   1.00 24.49 ? 302  GLN A CG  1 
ATOM   911  C  CD  . GLN A 1 150 ? 33.316  11.929  6.543   1.00 25.63 ? 302  GLN A CD  1 
ATOM   912  O  OE1 . GLN A 1 150 ? 34.257  11.469  5.907   1.00 28.45 ? 302  GLN A OE1 1 
ATOM   913  N  NE2 . GLN A 1 150 ? 32.828  13.128  6.324   1.00 26.36 ? 302  GLN A NE2 1 
ATOM   914  N  N   . ARG A 1 151 ? 29.424  11.388  9.423   1.00 26.06 ? 303  ARG A N   1 
ATOM   915  C  CA  . ARG A 1 151 ? 29.202  12.265  10.567  1.00 28.02 ? 303  ARG A CA  1 
ATOM   916  C  C   . ARG A 1 151 ? 28.851  11.438  11.805  1.00 28.15 ? 303  ARG A C   1 
ATOM   917  O  O   . ARG A 1 151 ? 29.289  11.732  12.919  1.00 28.29 ? 303  ARG A O   1 
ATOM   918  C  CB  . ARG A 1 151 ? 28.139  13.339  10.251  1.00 28.79 ? 303  ARG A CB  1 
ATOM   919  C  CG  . ARG A 1 151 ? 27.591  14.147  11.462  1.00 31.84 ? 303  ARG A CG  1 
ATOM   920  C  CD  . ARG A 1 151 ? 28.545  15.262  11.957  1.00 36.92 ? 303  ARG A CD  1 
ATOM   921  N  NE  . ARG A 1 151 ? 29.548  14.755  12.909  1.00 40.74 ? 303  ARG A NE  1 
ATOM   922  C  CZ  . ARG A 1 151 ? 29.388  14.661  14.239  1.00 42.30 ? 303  ARG A CZ  1 
ATOM   923  N  NH1 . ARG A 1 151 ? 28.250  15.049  14.829  1.00 42.98 ? 303  ARG A NH1 1 
ATOM   924  N  NH2 . ARG A 1 151 ? 30.379  14.174  14.990  1.00 41.97 ? 303  ARG A NH2 1 
ATOM   925  N  N   . LEU A 1 152 ? 28.101  10.371  11.592  1.00 28.64 ? 304  LEU A N   1 
ATOM   926  C  CA  . LEU A 1 152 ? 27.658  9.531   12.685  1.00 29.05 ? 304  LEU A CA  1 
ATOM   927  C  C   . LEU A 1 152 ? 28.797  8.675   13.224  1.00 29.21 ? 304  LEU A C   1 
ATOM   928  O  O   . LEU A 1 152 ? 28.851  8.384   14.416  1.00 29.52 ? 304  LEU A O   1 
ATOM   929  C  CB  . LEU A 1 152 ? 26.503  8.672   12.200  1.00 29.33 ? 304  LEU A CB  1 
ATOM   930  C  CG  . LEU A 1 152 ? 25.544  8.074   13.215  1.00 30.25 ? 304  LEU A CG  1 
ATOM   931  C  CD1 . LEU A 1 152 ? 24.806  9.148   14.007  1.00 30.56 ? 304  LEU A CD1 1 
ATOM   932  C  CD2 . LEU A 1 152 ? 24.571  7.205   12.443  1.00 31.16 ? 304  LEU A CD2 1 
ATOM   933  N  N   . ALA A 1 153 ? 29.711  8.286   12.347  1.00 29.39 ? 305  ALA A N   1 
ATOM   934  C  CA  . ALA A 1 153 ? 30.904  7.572   12.757  1.00 29.97 ? 305  ALA A CA  1 
ATOM   935  C  C   . ALA A 1 153 ? 31.797  8.444   13.643  1.00 31.01 ? 305  ALA A C   1 
ATOM   936  O  O   . ALA A 1 153 ? 32.329  7.961   14.647  1.00 31.04 ? 305  ALA A O   1 
ATOM   937  C  CB  . ALA A 1 153 ? 31.668  7.074   11.547  1.00 29.71 ? 305  ALA A CB  1 
ATOM   938  N  N   . ARG A 1 154 ? 31.955  9.727   13.288  1.00 32.09 ? 306  ARG A N   1 
ATOM   939  C  CA  . ARG A 1 154 ? 32.743  10.660  14.114  1.00 33.24 ? 306  ARG A CA  1 
ATOM   940  C  C   . ARG A 1 154 ? 32.264  10.692  15.569  1.00 32.26 ? 306  ARG A C   1 
ATOM   941  O  O   . ARG A 1 154 ? 33.060  10.871  16.485  1.00 32.61 ? 306  ARG A O   1 
ATOM   942  C  CB  . ARG A 1 154 ? 32.720  12.081  13.556  1.00 33.42 ? 306  ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 154 ? 33.578  12.330  12.305  1.00 35.82 ? 306  ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 154 ? 33.595  13.862  12.012  1.00 36.20 ? 306  ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 154 ? 34.011  14.215  10.644  1.00 41.73 ? 306  ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 154 ? 35.217  14.690  10.308  1.00 43.60 ? 306  ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 154 ? 36.163  14.878  11.231  1.00 44.38 ? 306  ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 154 ? 35.484  14.980  9.038   1.00 44.60 ? 306  ARG A NH2 1 
ATOM   949  N  N   . ALA A 1 155 ? 30.967  10.505  15.778  1.00 31.30 ? 307  ALA A N   1 
ATOM   950  C  CA  . ALA A 1 155 ? 30.421  10.464  17.125  1.00 30.48 ? 307  ALA A CA  1 
ATOM   951  C  C   . ALA A 1 155 ? 30.628  9.105   17.812  1.00 29.96 ? 307  ALA A C   1 
ATOM   952  O  O   . ALA A 1 155 ? 30.166  8.899   18.935  1.00 30.27 ? 307  ALA A O   1 
ATOM   953  C  CB  . ALA A 1 155 ? 28.933  10.863  17.111  1.00 30.83 ? 307  ALA A CB  1 
ATOM   954  N  N   . GLY A 1 156 ? 31.320  8.185   17.139  1.00 29.00 ? 308  GLY A N   1 
ATOM   955  C  CA  . GLY A 1 156 ? 31.684  6.893   17.727  1.00 27.04 ? 308  GLY A CA  1 
ATOM   956  C  C   . GLY A 1 156 ? 30.654  5.798   17.524  1.00 25.88 ? 308  GLY A C   1 
ATOM   957  O  O   . GLY A 1 156 ? 30.691  4.776   18.211  1.00 25.71 ? 308  GLY A O   1 
ATOM   958  N  N   . VAL A 1 157 ? 29.739  6.009   16.575  1.00 24.78 ? 309  VAL A N   1 
ATOM   959  C  CA  . VAL A 1 157 ? 28.736  5.001   16.199  1.00 23.33 ? 309  VAL A CA  1 
ATOM   960  C  C   . VAL A 1 157 ? 29.307  3.928   15.271  1.00 22.52 ? 309  VAL A C   1 
ATOM   961  O  O   . VAL A 1 157 ? 30.045  4.220   14.316  1.00 22.21 ? 309  VAL A O   1 
ATOM   962  C  CB  . VAL A 1 157 ? 27.471  5.639   15.567  1.00 23.29 ? 309  VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 157 ? 26.548  4.583   14.993  1.00 23.41 ? 309  VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 157 ? 26.708  6.453   16.606  1.00 23.78 ? 309  VAL A CG2 1 
ATOM   965  N  N   . VAL A 1 158 ? 28.959  2.676   15.564  1.00 21.41 ? 310  VAL A N   1 
ATOM   966  C  CA  . VAL A 1 158 ? 29.354  1.563   14.717  1.00 20.18 ? 310  VAL A CA  1 
ATOM   967  C  C   . VAL A 1 158 ? 28.283  1.394   13.671  1.00 19.65 ? 310  VAL A C   1 
ATOM   968  O  O   . VAL A 1 158 ? 27.126  1.106   14.009  1.00 19.87 ? 310  VAL A O   1 
ATOM   969  C  CB  . VAL A 1 158 ? 29.472  0.247   15.515  1.00 20.28 ? 310  VAL A CB  1 
ATOM   970  C  CG1 . VAL A 1 158 ? 30.038  -0.853  14.632  1.00 19.28 ? 310  VAL A CG1 1 
ATOM   971  C  CG2 . VAL A 1 158 ? 30.313  0.444   16.778  1.00 19.38 ? 310  VAL A CG2 1 
ATOM   972  N  N   . LEU A 1 159 ? 28.655  1.594   12.410  1.00 18.76 ? 311  LEU A N   1 
ATOM   973  C  CA  . LEU A 1 159 ? 27.731  1.399   11.290  1.00 18.01 ? 311  LEU A CA  1 
ATOM   974  C  C   . LEU A 1 159 ? 28.104  0.163   10.491  1.00 17.57 ? 311  LEU A C   1 
ATOM   975  O  O   . LEU A 1 159 ? 29.257  -0.011  10.095  1.00 17.22 ? 311  LEU A O   1 
ATOM   976  C  CB  . LEU A 1 159 ? 27.696  2.630   10.390  1.00 18.21 ? 311  LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 159 ? 27.169  3.891   11.087  1.00 18.84 ? 311  LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 159 ? 27.994  5.076   10.704  1.00 19.75 ? 311  LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 159 ? 25.724  4.136   10.764  1.00 19.50 ? 311  LEU A CD2 1 
ATOM   980  N  N   . VAL A 1 160 ? 27.115  -0.706  10.295  1.00 17.42 ? 312  VAL A N   1 
ATOM   981  C  CA  . VAL A 1 160 ? 27.286  -1.981  9.600   1.00 17.06 ? 312  VAL A CA  1 
ATOM   982  C  C   . VAL A 1 160 ? 26.252  -2.043  8.498   1.00 17.62 ? 312  VAL A C   1 
ATOM   983  O  O   . VAL A 1 160 ? 25.040  -1.930  8.757   1.00 18.36 ? 312  VAL A O   1 
ATOM   984  C  CB  . VAL A 1 160 ? 27.044  -3.211  10.511  1.00 16.72 ? 312  VAL A CB  1 
ATOM   985  C  CG1 . VAL A 1 160 ? 27.608  -4.434  9.858   1.00 15.86 ? 312  VAL A CG1 1 
ATOM   986  C  CG2 . VAL A 1 160 ? 27.638  -3.037  11.917  1.00 16.19 ? 312  VAL A CG2 1 
ATOM   987  N  N   . THR A 1 161 ? 26.712  -2.224  7.267   1.00 17.59 ? 313  THR A N   1 
ATOM   988  C  CA  . THR A 1 161 ? 25.799  -2.261  6.136   1.00 17.15 ? 313  THR A CA  1 
ATOM   989  C  C   . THR A 1 161 ? 26.092  -3.447  5.224   1.00 17.17 ? 313  THR A C   1 
ATOM   990  O  O   . THR A 1 161 ? 27.187  -4.006  5.249   1.00 17.36 ? 313  THR A O   1 
ATOM   991  C  CB  . THR A 1 161 ? 25.838  -0.948  5.336   1.00 17.05 ? 313  THR A CB  1 
ATOM   992  O  OG1 . THR A 1 161 ? 24.685  -0.866  4.489   1.00 17.75 ? 313  THR A OG1 1 
ATOM   993  C  CG2 . THR A 1 161 ? 27.098  -0.863  4.468   1.00 16.66 ? 313  THR A CG2 1 
ATOM   994  N  N   . ALA A 1 162 ? 25.092  -3.822  4.435   1.00 16.99 ? 314  ALA A N   1 
ATOM   995  C  CA  . ALA A 1 162 ? 25.242  -4.773  3.343   1.00 16.92 ? 314  ALA A CA  1 
ATOM   996  C  C   . ALA A 1 162 ? 26.124  -4.205  2.210   1.00 16.61 ? 314  ALA A C   1 
ATOM   997  O  O   . ALA A 1 162 ? 26.053  -3.019  1.907   1.00 16.80 ? 314  ALA A O   1 
ATOM   998  C  CB  . ALA A 1 162 ? 23.863  -5.128  2.803   1.00 16.45 ? 314  ALA A CB  1 
ATOM   999  N  N   . ALA A 1 163 ? 26.936  -5.051  1.578   1.00 16.19 ? 315  ALA A N   1 
ATOM   1000 C  CA  . ALA A 1 163 ? 27.676  -4.637  0.375   1.00 15.80 ? 315  ALA A CA  1 
ATOM   1001 C  C   . ALA A 1 163 ? 26.765  -4.609  -0.848  1.00 15.42 ? 315  ALA A C   1 
ATOM   1002 O  O   . ALA A 1 163 ? 27.122  -4.072  -1.886  1.00 14.77 ? 315  ALA A O   1 
ATOM   1003 C  CB  . ALA A 1 163 ? 28.875  -5.544  0.129   1.00 15.23 ? 315  ALA A CB  1 
ATOM   1004 N  N   . GLY A 1 164 ? 25.584  -5.204  -0.714  1.00 15.88 ? 316  GLY A N   1 
ATOM   1005 C  CA  . GLY A 1 164 ? 24.631  -5.296  -1.824  1.00 15.92 ? 316  GLY A CA  1 
ATOM   1006 C  C   . GLY A 1 164 ? 24.749  -6.584  -2.619  1.00 15.64 ? 316  GLY A C   1 
ATOM   1007 O  O   . GLY A 1 164 ? 25.816  -7.192  -2.682  1.00 15.46 ? 316  GLY A O   1 
ATOM   1008 N  N   . ASN A 1 165 ? 23.649  -6.963  -3.256  1.00 15.52 ? 317  ASN A N   1 
ATOM   1009 C  CA  . ASN A 1 165 ? 23.513  -8.241  -3.919  1.00 15.72 ? 317  ASN A CA  1 
ATOM   1010 C  C   . ASN A 1 165 ? 23.620  -8.178  -5.455  1.00 16.87 ? 317  ASN A C   1 
ATOM   1011 O  O   . ASN A 1 165 ? 22.924  -8.927  -6.143  1.00 17.09 ? 317  ASN A O   1 
ATOM   1012 C  CB  . ASN A 1 165 ? 22.155  -8.842  -3.549  1.00 14.92 ? 317  ASN A CB  1 
ATOM   1013 C  CG  . ASN A 1 165 ? 21.946  -8.955  -2.057  1.00 14.52 ? 317  ASN A CG  1 
ATOM   1014 O  OD1 . ASN A 1 165 ? 22.875  -9.201  -1.296  1.00 17.13 ? 317  ASN A OD1 1 
ATOM   1015 N  ND2 . ASN A 1 165 ? 20.714  -8.793  -1.629  1.00 13.86 ? 317  ASN A ND2 1 
ATOM   1016 N  N   . PHE A 1 166 ? 24.484  -7.328  -6.013  1.00 17.83 ? 318  PHE A N   1 
ATOM   1017 C  CA  . PHE A 1 166 ? 24.444  -7.134  -7.471  1.00 19.23 ? 318  PHE A CA  1 
ATOM   1018 C  C   . PHE A 1 166 ? 25.583  -7.775  -8.298  1.00 20.09 ? 318  PHE A C   1 
ATOM   1019 O  O   . PHE A 1 166 ? 25.703  -7.466  -9.491  1.00 20.42 ? 318  PHE A O   1 
ATOM   1020 C  CB  . PHE A 1 166 ? 24.239  -5.642  -7.832  1.00 19.66 ? 318  PHE A CB  1 
ATOM   1021 C  CG  . PHE A 1 166 ? 23.104  -4.984  -7.071  1.00 21.17 ? 318  PHE A CG  1 
ATOM   1022 C  CD1 . PHE A 1 166 ? 21.779  -5.118  -7.503  1.00 21.90 ? 318  PHE A CD1 1 
ATOM   1023 C  CD2 . PHE A 1 166 ? 23.353  -4.271  -5.893  1.00 20.78 ? 318  PHE A CD2 1 
ATOM   1024 C  CE1 . PHE A 1 166 ? 20.726  -4.542  -6.781  1.00 21.53 ? 318  PHE A CE1 1 
ATOM   1025 C  CE2 . PHE A 1 166 ? 22.306  -3.696  -5.170  1.00 20.71 ? 318  PHE A CE2 1 
ATOM   1026 C  CZ  . PHE A 1 166 ? 20.996  -3.828  -5.617  1.00 20.77 ? 318  PHE A CZ  1 
ATOM   1027 N  N   . ARG A 1 167 ? 26.372  -8.681  -7.703  1.00 20.54 ? 319  ARG A N   1 
ATOM   1028 C  CA  . ARG A 1 167 ? 27.604  -9.200  -8.342  1.00 21.69 ? 319  ARG A CA  1 
ATOM   1029 C  C   . ARG A 1 167 ? 28.337  -8.070  -9.062  1.00 21.43 ? 319  ARG A C   1 
ATOM   1030 O  O   . ARG A 1 167 ? 28.633  -8.157  -10.262 1.00 21.35 ? 319  ARG A O   1 
ATOM   1031 C  CB  . ARG A 1 167 ? 27.327  -10.355 -9.313  1.00 22.22 ? 319  ARG A CB  1 
ATOM   1032 C  CG  . ARG A 1 167 ? 27.301  -11.738 -8.664  1.00 25.48 ? 319  ARG A CG  1 
ATOM   1033 C  CD  . ARG A 1 167 ? 28.394  -12.713 -9.148  1.00 29.07 ? 319  ARG A CD  1 
ATOM   1034 N  NE  . ARG A 1 167 ? 29.708  -12.504 -8.522  1.00 33.16 ? 319  ARG A NE  1 
ATOM   1035 C  CZ  . ARG A 1 167 ? 30.006  -12.723 -7.235  1.00 33.46 ? 319  ARG A CZ  1 
ATOM   1036 N  NH1 . ARG A 1 167 ? 29.071  -13.143 -6.393  1.00 34.79 ? 319  ARG A NH1 1 
ATOM   1037 N  NH2 . ARG A 1 167 ? 31.246  -12.506 -6.785  1.00 32.33 ? 319  ARG A NH2 1 
ATOM   1038 N  N   . ASP A 1 168 ? 28.599  -7.003  -8.304  1.00 21.02 ? 320  ASP A N   1 
ATOM   1039 C  CA  . ASP A 1 168 ? 29.078  -5.746  -8.841  1.00 20.29 ? 320  ASP A CA  1 
ATOM   1040 C  C   . ASP A 1 168 ? 30.103  -5.197  -7.873  1.00 20.21 ? 320  ASP A C   1 
ATOM   1041 O  O   . ASP A 1 168 ? 30.318  -5.765  -6.797  1.00 20.24 ? 320  ASP A O   1 
ATOM   1042 C  CB  . ASP A 1 168 ? 27.899  -4.776  -8.990  1.00 20.14 ? 320  ASP A CB  1 
ATOM   1043 C  CG  . ASP A 1 168 ? 28.144  -3.687  -10.034 1.00 20.18 ? 320  ASP A CG  1 
ATOM   1044 O  OD1 . ASP A 1 168 ? 29.185  -3.686  -10.727 1.00 19.96 ? 320  ASP A OD1 1 
ATOM   1045 O  OD2 . ASP A 1 168 ? 27.272  -2.815  -10.160 1.00 19.90 ? 320  ASP A OD2 1 
ATOM   1046 N  N   . ASP A 1 169 ? 30.737  -4.097  -8.264  1.00 20.05 ? 321  ASP A N   1 
ATOM   1047 C  CA  . ASP A 1 169 ? 31.708  -3.400  -7.437  1.00 20.08 ? 321  ASP A CA  1 
ATOM   1048 C  C   . ASP A 1 169 ? 30.927  -2.589  -6.416  1.00 19.49 ? 321  ASP A C   1 
ATOM   1049 O  O   . ASP A 1 169 ? 30.164  -1.707  -6.790  1.00 19.48 ? 321  ASP A O   1 
ATOM   1050 C  CB  . ASP A 1 169 ? 32.568  -2.494  -8.339  1.00 20.69 ? 321  ASP A CB  1 
ATOM   1051 C  CG  . ASP A 1 169 ? 33.489  -1.542  -7.560  1.00 22.14 ? 321  ASP A CG  1 
ATOM   1052 O  OD1 . ASP A 1 169 ? 33.356  -1.392  -6.325  1.00 23.31 ? 321  ASP A OD1 1 
ATOM   1053 O  OD2 . ASP A 1 169 ? 34.363  -0.928  -8.211  1.00 24.46 ? 321  ASP A OD2 1 
ATOM   1054 N  N   . ALA A 1 170 ? 31.126  -2.883  -5.132  1.00 18.98 ? 322  ALA A N   1 
ATOM   1055 C  CA  . ALA A 1 170 ? 30.371  -2.234  -4.057  1.00 18.63 ? 322  ALA A CA  1 
ATOM   1056 C  C   . ALA A 1 170 ? 30.559  -0.714  -3.996  1.00 18.79 ? 322  ALA A C   1 
ATOM   1057 O  O   . ALA A 1 170 ? 29.661  0.013   -3.557  1.00 19.00 ? 322  ALA A O   1 
ATOM   1058 C  CB  . ALA A 1 170 ? 30.708  -2.856  -2.731  1.00 18.35 ? 322  ALA A CB  1 
ATOM   1059 N  N   . CYS A 1 171 ? 31.718  -0.233  -4.440  1.00 18.76 ? 323  CYS A N   1 
ATOM   1060 C  CA  . CYS A 1 171 ? 31.975  1.208   -4.511  1.00 18.98 ? 323  CYS A CA  1 
ATOM   1061 C  C   . CYS A 1 171 ? 30.907  2.007   -5.279  1.00 18.72 ? 323  CYS A C   1 
ATOM   1062 O  O   . CYS A 1 171 ? 30.801  3.228   -5.097  1.00 19.40 ? 323  CYS A O   1 
ATOM   1063 C  CB  . CYS A 1 171 ? 33.356  1.498   -5.088  1.00 18.65 ? 323  CYS A CB  1 
ATOM   1064 S  SG  . CYS A 1 171 ? 34.741  0.840   -4.129  1.00 20.93 ? 323  CYS A SG  1 
ATOM   1065 N  N   . LEU A 1 172 ? 30.123  1.329   -6.122  1.00 17.79 ? 324  LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 172 ? 29.030  1.977   -6.842  1.00 16.67 ? 324  LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 172 ? 27.739  2.105   -6.022  1.00 16.07 ? 324  LEU A C   1 
ATOM   1068 O  O   . LEU A 1 172 ? 26.742  2.592   -6.536  1.00 16.36 ? 324  LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 172 ? 28.749  1.241   -8.151  1.00 16.62 ? 324  LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 172 ? 29.882  1.210   -9.191  1.00 17.33 ? 324  LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 172 ? 29.646  0.127   -10.229 1.00 18.47 ? 324  LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 172 ? 30.069  2.542   -9.882  1.00 16.40 ? 324  LEU A CD2 1 
ATOM   1073 N  N   . TYR A 1 173 ? 27.753  1.685   -4.756  1.00 14.99 ? 325  TYR A N   1 
ATOM   1074 C  CA  . TYR A 1 173 ? 26.522  1.613   -3.952  1.00 14.18 ? 325  TYR A CA  1 
ATOM   1075 C  C   . TYR A 1 173 ? 26.628  2.343   -2.608  1.00 13.88 ? 325  TYR A C   1 
ATOM   1076 O  O   . TYR A 1 173 ? 27.721  2.487   -2.041  1.00 14.27 ? 325  TYR A O   1 
ATOM   1077 C  CB  . TYR A 1 173 ? 26.066  0.133   -3.768  1.00 14.21 ? 325  TYR A CB  1 
ATOM   1078 C  CG  . TYR A 1 173 ? 25.772  -0.492  -5.103  1.00 13.39 ? 325  TYR A CG  1 
ATOM   1079 C  CD1 . TYR A 1 173 ? 24.532  -0.330  -5.705  1.00 12.70 ? 325  TYR A CD1 1 
ATOM   1080 C  CD2 . TYR A 1 173 ? 26.774  -1.160  -5.816  1.00 13.43 ? 325  TYR A CD2 1 
ATOM   1081 C  CE1 . TYR A 1 173 ? 24.280  -0.847  -6.968  1.00 13.15 ? 325  TYR A CE1 1 
ATOM   1082 C  CE2 . TYR A 1 173 ? 26.536  -1.677  -7.086  1.00 12.58 ? 325  TYR A CE2 1 
ATOM   1083 C  CZ  . TYR A 1 173 ? 25.290  -1.513  -7.645  1.00 13.23 ? 325  TYR A CZ  1 
ATOM   1084 O  OH  . TYR A 1 173 ? 25.051  -2.018  -8.880  1.00 13.50 ? 325  TYR A OH  1 
ATOM   1085 N  N   . SER A 1 174 ? 25.495  2.810   -2.093  1.00 12.86 ? 326  SER A N   1 
ATOM   1086 C  CA  . SER A 1 174 ? 25.502  3.431   -0.784  1.00 12.03 ? 326  SER A CA  1 
ATOM   1087 C  C   . SER A 1 174 ? 24.449  2.844   0.121   1.00 11.27 ? 326  SER A C   1 
ATOM   1088 O  O   . SER A 1 174 ? 23.351  2.544   -0.346  1.00 11.02 ? 326  SER A O   1 
ATOM   1089 C  CB  . SER A 1 174 ? 25.353  4.943   -0.912  1.00 12.16 ? 326  SER A CB  1 
ATOM   1090 O  OG  . SER A 1 174 ? 26.570  5.488   -1.413  1.00 12.24 ? 326  SER A OG  1 
ATOM   1091 N  N   . PRO A 1 175 ? 24.767  2.683   1.426   1.00 10.96 ? 327  PRO A N   1 
ATOM   1092 C  CA  . PRO A 1 175 ? 25.984  2.997   2.187   1.00 11.08 ? 327  PRO A CA  1 
ATOM   1093 C  C   . PRO A 1 175 ? 27.206  2.076   2.004   1.00 12.20 ? 327  PRO A C   1 
ATOM   1094 O  O   . PRO A 1 175 ? 28.255  2.317   2.636   1.00 12.69 ? 327  PRO A O   1 
ATOM   1095 C  CB  . PRO A 1 175 ? 25.516  2.892   3.637   1.00 10.51 ? 327  PRO A CB  1 
ATOM   1096 C  CG  . PRO A 1 175 ? 24.037  2.826   3.581   1.00 10.11 ? 327  PRO A CG  1 
ATOM   1097 C  CD  . PRO A 1 175 ? 23.716  2.172   2.319   1.00 10.73 ? 327  PRO A CD  1 
ATOM   1098 N  N   . ALA A 1 176 ? 27.100  1.037   1.176   1.00 12.90 ? 328  ALA A N   1 
ATOM   1099 C  CA  . ALA A 1 176 ? 28.220  0.104   0.986   1.00 13.66 ? 328  ALA A CA  1 
ATOM   1100 C  C   . ALA A 1 176 ? 29.555  0.808   0.710   1.00 14.53 ? 328  ALA A C   1 
ATOM   1101 O  O   . ALA A 1 176 ? 30.601  0.384   1.219   1.00 14.97 ? 328  ALA A O   1 
ATOM   1102 C  CB  . ALA A 1 176 ? 27.914  -0.885  -0.121  1.00 13.72 ? 328  ALA A CB  1 
ATOM   1103 N  N   . SER A 1 177 ? 29.523  1.893   -0.068  1.00 15.13 ? 329  SER A N   1 
ATOM   1104 C  CA  . SER A 1 177 ? 30.765  2.513   -0.539  1.00 15.58 ? 329  SER A CA  1 
ATOM   1105 C  C   . SER A 1 177 ? 31.458  3.411   0.479   1.00 15.74 ? 329  SER A C   1 
ATOM   1106 O  O   . SER A 1 177 ? 32.598  3.837   0.252   1.00 15.45 ? 329  SER A O   1 
ATOM   1107 C  CB  . SER A 1 177 ? 30.538  3.273   -1.838  1.00 15.46 ? 329  SER A CB  1 
ATOM   1108 O  OG  . SER A 1 177 ? 29.771  4.424   -1.595  1.00 16.96 ? 329  SER A OG  1 
ATOM   1109 N  N   . ALA A 1 178 ? 30.782  3.687   1.593   1.00 15.95 ? 330  ALA A N   1 
ATOM   1110 C  CA  . ALA A 1 178 ? 31.336  4.542   2.645   1.00 16.44 ? 330  ALA A CA  1 
ATOM   1111 C  C   . ALA A 1 178 ? 32.481  3.885   3.423   1.00 16.99 ? 330  ALA A C   1 
ATOM   1112 O  O   . ALA A 1 178 ? 32.243  2.903   4.115   1.00 17.42 ? 330  ALA A O   1 
ATOM   1113 C  CB  . ALA A 1 178 ? 30.236  4.925   3.609   1.00 15.86 ? 330  ALA A CB  1 
ATOM   1114 N  N   . PRO A 1 179 ? 33.708  4.457   3.382   1.00 17.80 ? 331  PRO A N   1 
ATOM   1115 C  CA  . PRO A 1 179 ? 34.702  3.989   4.380   1.00 18.60 ? 331  PRO A CA  1 
ATOM   1116 C  C   . PRO A 1 179 ? 34.104  4.439   5.701   1.00 19.13 ? 331  PRO A C   1 
ATOM   1117 O  O   . PRO A 1 179 ? 33.132  5.153   5.657   1.00 20.49 ? 331  PRO A O   1 
ATOM   1118 C  CB  . PRO A 1 179 ? 35.969  4.780   4.027   1.00 18.41 ? 331  PRO A CB  1 
ATOM   1119 C  CG  . PRO A 1 179 ? 35.500  5.966   3.247   1.00 17.70 ? 331  PRO A CG  1 
ATOM   1120 C  CD  . PRO A 1 179 ? 34.233  5.556   2.547   1.00 18.06 ? 331  PRO A CD  1 
ATOM   1121 N  N   . GLU A 1 180 ? 34.566  4.033   6.862   1.00 19.27 ? 332  GLU A N   1 
ATOM   1122 C  CA  . GLU A 1 180 ? 33.836  4.500   8.081   1.00 20.37 ? 332  GLU A CA  1 
ATOM   1123 C  C   . GLU A 1 180 ? 32.405  3.987   8.298   1.00 20.21 ? 332  GLU A C   1 
ATOM   1124 O  O   . GLU A 1 180 ? 31.808  4.266   9.331   1.00 20.76 ? 332  GLU A O   1 
ATOM   1125 C  CB  . GLU A 1 180 ? 33.863  6.039   8.268   1.00 20.64 ? 332  GLU A CB  1 
ATOM   1126 C  CG  . GLU A 1 180 ? 32.757  6.847   7.595   1.00 21.85 ? 332  GLU A CG  1 
ATOM   1127 C  CD  . GLU A 1 180 ? 33.283  7.746   6.457   1.00 25.01 ? 332  GLU A CD  1 
ATOM   1128 O  OE1 . GLU A 1 180 ? 34.292  8.460   6.672   1.00 25.98 ? 332  GLU A OE1 1 
ATOM   1129 O  OE2 . GLU A 1 180 ? 32.684  7.752   5.348   1.00 25.59 ? 332  GLU A OE2 1 
ATOM   1130 N  N   . VAL A 1 181 ? 31.867  3.253   7.331   1.00 20.26 ? 333  VAL A N   1 
ATOM   1131 C  CA  . VAL A 1 181 ? 30.782  2.298   7.576   1.00 20.15 ? 333  VAL A CA  1 
ATOM   1132 C  C   . VAL A 1 181 ? 31.364  0.894   7.352   1.00 20.18 ? 333  VAL A C   1 
ATOM   1133 O  O   . VAL A 1 181 ? 32.094  0.688   6.370   1.00 20.34 ? 333  VAL A O   1 
ATOM   1134 C  CB  . VAL A 1 181 ? 29.613  2.507   6.593   1.00 20.16 ? 333  VAL A CB  1 
ATOM   1135 C  CG1 . VAL A 1 181 ? 28.674  1.318   6.621   1.00 20.19 ? 333  VAL A CG1 1 
ATOM   1136 C  CG2 . VAL A 1 181 ? 28.856  3.771   6.920   1.00 20.43 ? 333  VAL A CG2 1 
ATOM   1137 N  N   . ILE A 1 182 ? 31.059  -0.074  8.223   1.00 20.00 ? 334  ILE A N   1 
ATOM   1138 C  CA  . ILE A 1 182 ? 31.592  -1.442  8.028   1.00 19.57 ? 334  ILE A CA  1 
ATOM   1139 C  C   . ILE A 1 182 ? 30.801  -2.215  6.974   1.00 19.24 ? 334  ILE A C   1 
ATOM   1140 O  O   . ILE A 1 182 ? 29.644  -2.550  7.184   1.00 19.47 ? 334  ILE A O   1 
ATOM   1141 C  CB  . ILE A 1 182 ? 31.717  -2.258  9.330   1.00 19.59 ? 334  ILE A CB  1 
ATOM   1142 C  CG1 . ILE A 1 182 ? 32.490  -1.469  10.392  1.00 19.16 ? 334  ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A 1 182 ? 32.442  -3.560  9.034   1.00 19.87 ? 334  ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A 1 182 ? 32.516  -2.099  11.760  1.00 19.55 ? 334  ILE A CD1 1 
ATOM   1145 N  N   . THR A 1 183 ? 31.437  -2.486  5.839   1.00 18.60 ? 335  THR A N   1 
ATOM   1146 C  CA  . THR A 1 183 ? 30.742  -3.016  4.673   1.00 18.01 ? 335  THR A CA  1 
ATOM   1147 C  C   . THR A 1 183 ? 30.973  -4.519  4.573   1.00 18.05 ? 335  THR A C   1 
ATOM   1148 O  O   . THR A 1 183 ? 32.128  -4.996  4.504   1.00 18.22 ? 335  THR A O   1 
ATOM   1149 C  CB  . THR A 1 183 ? 31.199  -2.276  3.413   1.00 17.94 ? 335  THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 183 ? 30.949  -0.879  3.600   1.00 18.80 ? 335  THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 183 ? 30.477  -2.748  2.154   1.00 17.39 ? 335  THR A CG2 1 
ATOM   1152 N  N   . VAL A 1 184 ? 29.871  -5.262  4.594   1.00 17.38 ? 336  VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 184 ? 29.936  -6.704  4.719   1.00 17.16 ? 336  VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 184 ? 29.428  -7.407  3.456   1.00 17.72 ? 336  VAL A C   1 
ATOM   1155 O  O   . VAL A 1 184 ? 28.314  -7.138  2.990   1.00 18.13 ? 336  VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 184 ? 29.173  -7.194  5.964   1.00 16.86 ? 336  VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 184 ? 29.467  -8.669  6.204   1.00 17.24 ? 336  VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 184 ? 29.551  -6.370  7.197   1.00 15.31 ? 336  VAL A CG2 1 
ATOM   1159 N  N   . GLY A 1 185 ? 30.255  -8.286  2.891   1.00 17.65 ? 337  GLY A N   1 
ATOM   1160 C  CA  . GLY A 1 185 ? 29.840  -9.111  1.753   1.00 17.90 ? 337  GLY A CA  1 
ATOM   1161 C  C   . GLY A 1 185 ? 29.400  -10.482 2.245   1.00 17.94 ? 337  GLY A C   1 
ATOM   1162 O  O   . GLY A 1 185 ? 29.645  -10.827 3.400   1.00 18.15 ? 337  GLY A O   1 
ATOM   1163 N  N   . ALA A 1 186 ? 28.771  -11.262 1.374   1.00 18.04 ? 338  ALA A N   1 
ATOM   1164 C  CA  . ALA A 1 186 ? 28.238  -12.578 1.747   1.00 18.76 ? 338  ALA A CA  1 
ATOM   1165 C  C   . ALA A 1 186 ? 29.047  -13.787 1.231   1.00 19.49 ? 338  ALA A C   1 
ATOM   1166 O  O   . ALA A 1 186 ? 29.283  -13.929 0.021   1.00 19.14 ? 338  ALA A O   1 
ATOM   1167 C  CB  . ALA A 1 186 ? 26.802  -12.687 1.288   1.00 18.31 ? 338  ALA A CB  1 
ATOM   1168 N  N   . THR A 1 187 ? 29.469  -14.663 2.141   1.00 20.87 ? 339  THR A N   1 
ATOM   1169 C  CA  . THR A 1 187 ? 30.003  -15.976 1.723   1.00 22.92 ? 339  THR A CA  1 
ATOM   1170 C  C   . THR A 1 187 ? 28.986  -17.070 2.021   1.00 24.06 ? 339  THR A C   1 
ATOM   1171 O  O   . THR A 1 187 ? 28.086  -16.875 2.820   1.00 24.14 ? 339  THR A O   1 
ATOM   1172 C  CB  . THR A 1 187 ? 31.356  -16.327 2.373   1.00 22.38 ? 339  THR A CB  1 
ATOM   1173 O  OG1 . THR A 1 187 ? 31.237  -16.257 3.798   1.00 24.07 ? 339  THR A OG1 1 
ATOM   1174 C  CG2 . THR A 1 187 ? 32.446  -15.372 1.912   1.00 21.88 ? 339  THR A CG2 1 
ATOM   1175 N  N   . ASN A 1 188 ? 29.118  -18.208 1.359   1.00 26.37 ? 340  ASN A N   1 
ATOM   1176 C  CA  . ASN A 1 188 ? 28.219  -19.345 1.586   1.00 28.78 ? 340  ASN A CA  1 
ATOM   1177 C  C   . ASN A 1 188 ? 28.827  -20.350 2.568   1.00 30.47 ? 340  ASN A C   1 
ATOM   1178 O  O   . ASN A 1 188 ? 29.711  -19.982 3.354   1.00 31.09 ? 340  ASN A O   1 
ATOM   1179 C  CB  . ASN A 1 188 ? 27.861  -20.016 0.259   1.00 28.51 ? 340  ASN A CB  1 
ATOM   1180 C  CG  . ASN A 1 188 ? 29.083  -20.500 -0.490  1.00 29.21 ? 340  ASN A CG  1 
ATOM   1181 O  OD1 . ASN A 1 188 ? 30.098  -20.882 0.118   1.00 29.57 ? 340  ASN A OD1 1 
ATOM   1182 N  ND2 . ASN A 1 188 ? 29.005  -20.475 -1.817  1.00 28.52 ? 340  ASN A ND2 1 
ATOM   1183 N  N   . ALA A 1 189 ? 28.362  -21.605 2.527   1.00 32.65 ? 341  ALA A N   1 
ATOM   1184 C  CA  . ALA A 1 189 ? 28.844  -22.647 3.466   1.00 34.39 ? 341  ALA A CA  1 
ATOM   1185 C  C   . ALA A 1 189 ? 30.323  -23.054 3.248   1.00 35.29 ? 341  ALA A C   1 
ATOM   1186 O  O   . ALA A 1 189 ? 31.049  -23.322 4.218   1.00 35.48 ? 341  ALA A O   1 
ATOM   1187 C  CB  . ALA A 1 189 ? 27.927  -23.862 3.441   1.00 34.54 ? 341  ALA A CB  1 
ATOM   1188 N  N   . GLN A 1 190 ? 30.757  -23.053 1.984   1.00 36.00 ? 342  GLN A N   1 
ATOM   1189 C  CA  . GLN A 1 190 ? 32.145  -23.328 1.607   1.00 36.82 ? 342  GLN A CA  1 
ATOM   1190 C  C   . GLN A 1 190 ? 33.003  -22.063 1.517   1.00 36.57 ? 342  GLN A C   1 
ATOM   1191 O  O   . GLN A 1 190 ? 34.039  -22.052 0.843   1.00 36.38 ? 342  GLN A O   1 
ATOM   1192 C  CB  . GLN A 1 190 ? 32.211  -24.069 0.264   1.00 37.47 ? 342  GLN A CB  1 
ATOM   1193 C  CG  . GLN A 1 190 ? 31.148  -25.139 0.060   1.00 40.67 ? 342  GLN A CG  1 
ATOM   1194 C  CD  . GLN A 1 190 ? 29.807  -24.533 -0.325  1.00 44.95 ? 342  GLN A CD  1 
ATOM   1195 O  OE1 . GLN A 1 190 ? 29.654  -23.969 -1.416  1.00 45.68 ? 342  GLN A OE1 1 
ATOM   1196 N  NE2 . GLN A 1 190 ? 28.829  -24.630 0.581   1.00 46.69 ? 342  GLN A NE2 1 
ATOM   1197 N  N   . ASP A 1 191 ? 32.567  -20.992 2.179   1.00 36.50 ? 343  ASP A N   1 
ATOM   1198 C  CA  . ASP A 1 191 ? 33.370  -19.759 2.288   1.00 36.44 ? 343  ASP A CA  1 
ATOM   1199 C  C   . ASP A 1 191 ? 33.644  -19.088 0.935   1.00 35.73 ? 343  ASP A C   1 
ATOM   1200 O  O   . ASP A 1 191 ? 34.638  -18.386 0.769   1.00 35.51 ? 343  ASP A O   1 
ATOM   1201 C  CB  . ASP A 1 191 ? 34.687  -20.025 3.039   1.00 36.77 ? 343  ASP A CB  1 
ATOM   1202 C  CG  . ASP A 1 191 ? 34.835  -19.152 4.274   1.00 38.59 ? 343  ASP A CG  1 
ATOM   1203 O  OD1 . ASP A 1 191 ? 35.511  -19.566 5.243   1.00 40.74 ? 343  ASP A OD1 1 
ATOM   1204 O  OD2 . ASP A 1 191 ? 34.251  -18.049 4.293   1.00 41.09 ? 343  ASP A OD2 1 
ATOM   1205 N  N   . GLN A 1 192 ? 32.744  -19.313 -0.018  1.00 35.10 ? 344  GLN A N   1 
ATOM   1206 C  CA  . GLN A 1 192 ? 32.819  -18.706 -1.341  1.00 34.54 ? 344  GLN A CA  1 
ATOM   1207 C  C   . GLN A 1 192 ? 31.764  -17.596 -1.510  1.00 33.71 ? 344  GLN A C   1 
ATOM   1208 O  O   . GLN A 1 192 ? 30.741  -17.598 -0.820  1.00 33.44 ? 344  GLN A O   1 
ATOM   1209 C  CB  . GLN A 1 192 ? 32.653  -19.788 -2.417  1.00 34.92 ? 344  GLN A CB  1 
ATOM   1210 C  CG  . GLN A 1 192 ? 33.785  -20.818 -2.439  1.00 36.20 ? 344  GLN A CG  1 
ATOM   1211 C  CD  . GLN A 1 192 ? 35.156  -20.190 -2.681  1.00 38.60 ? 344  GLN A CD  1 
ATOM   1212 O  OE1 . GLN A 1 192 ? 35.351  -19.438 -3.652  1.00 40.24 ? 344  GLN A OE1 1 
ATOM   1213 N  NE2 . GLN A 1 192 ? 36.117  -20.497 -1.800  1.00 37.70 ? 344  GLN A NE2 1 
ATOM   1214 N  N   . PRO A 1 193 ? 32.017  -16.632 -2.413  1.00 32.83 ? 345  PRO A N   1 
ATOM   1215 C  CA  . PRO A 1 193 ? 31.028  -15.591 -2.667  1.00 32.19 ? 345  PRO A CA  1 
ATOM   1216 C  C   . PRO A 1 193 ? 29.631  -16.175 -2.917  1.00 31.64 ? 345  PRO A C   1 
ATOM   1217 O  O   . PRO A 1 193 ? 29.488  -17.094 -3.709  1.00 31.49 ? 345  PRO A O   1 
ATOM   1218 C  CB  . PRO A 1 193 ? 31.566  -14.920 -3.934  1.00 32.23 ? 345  PRO A CB  1 
ATOM   1219 C  CG  . PRO A 1 193 ? 33.020  -15.099 -3.851  1.00 32.37 ? 345  PRO A CG  1 
ATOM   1220 C  CD  . PRO A 1 193 ? 33.230  -16.446 -3.234  1.00 32.62 ? 345  PRO A CD  1 
ATOM   1221 N  N   . VAL A 1 194 ? 28.614  -15.651 -2.238  1.00 31.20 ? 346  VAL A N   1 
ATOM   1222 C  CA  . VAL A 1 194 ? 27.248  -16.162 -2.384  1.00 30.39 ? 346  VAL A CA  1 
ATOM   1223 C  C   . VAL A 1 194 ? 26.674  -15.815 -3.745  1.00 30.22 ? 346  VAL A C   1 
ATOM   1224 O  O   . VAL A 1 194 ? 26.783  -14.671 -4.199  1.00 30.36 ? 346  VAL A O   1 
ATOM   1225 C  CB  . VAL A 1 194 ? 26.298  -15.625 -1.279  1.00 30.39 ? 346  VAL A CB  1 
ATOM   1226 C  CG1 . VAL A 1 194 ? 24.844  -15.939 -1.600  1.00 30.65 ? 346  VAL A CG1 1 
ATOM   1227 C  CG2 . VAL A 1 194 ? 26.641  -16.221 0.062   1.00 29.89 ? 346  VAL A CG2 1 
ATOM   1228 N  N   . THR A 1 195 ? 26.072  -16.811 -4.394  1.00 29.80 ? 347  THR A N   1 
ATOM   1229 C  CA  . THR A 1 195 ? 25.279  -16.580 -5.597  1.00 29.23 ? 347  THR A CA  1 
ATOM   1230 C  C   . THR A 1 195 ? 23.828  -16.314 -5.231  1.00 29.17 ? 347  THR A C   1 
ATOM   1231 O  O   . THR A 1 195 ? 23.254  -17.026 -4.428  1.00 29.17 ? 347  THR A O   1 
ATOM   1232 C  CB  . THR A 1 195 ? 25.401  -17.743 -6.579  1.00 28.87 ? 347  THR A CB  1 
ATOM   1233 O  OG1 . THR A 1 195 ? 26.618  -17.579 -7.299  1.00 28.70 ? 347  THR A OG1 1 
ATOM   1234 C  CG2 . THR A 1 195 ? 24.254  -17.757 -7.573  1.00 28.04 ? 347  THR A CG2 1 
ATOM   1235 N  N   . LEU A 1 196 ? 23.248  -15.270 -5.809  1.00 29.46 ? 348  LEU A N   1 
ATOM   1236 C  CA  . LEU A 1 196 ? 21.858  -14.935 -5.526  1.00 29.95 ? 348  LEU A CA  1 
ATOM   1237 C  C   . LEU A 1 196 ? 21.002  -15.226 -6.763  1.00 30.44 ? 348  LEU A C   1 
ATOM   1238 O  O   . LEU A 1 196 ? 21.073  -16.351 -7.263  1.00 31.50 ? 348  LEU A O   1 
ATOM   1239 C  CB  . LEU A 1 196 ? 21.714  -13.538 -4.889  1.00 29.79 ? 348  LEU A CB  1 
ATOM   1240 C  CG  . LEU A 1 196 ? 22.352  -13.561 -3.471  1.00 29.41 ? 348  LEU A CG  1 
ATOM   1241 C  CD1 . LEU A 1 196 ? 22.788  -12.217 -2.949  1.00 27.14 ? 348  LEU A CD1 1 
ATOM   1242 C  CD2 . LEU A 1 196 ? 21.474  -14.252 -2.438  1.00 29.64 ? 348  LEU A CD2 1 
ATOM   1243 N  N   . GLY A 1 197 ? 20.192  -14.302 -7.269  1.00 30.22 ? 349  GLY A N   1 
ATOM   1244 C  CA  . GLY A 1 197 ? 19.341  -14.673 -8.410  1.00 29.43 ? 349  GLY A CA  1 
ATOM   1245 C  C   . GLY A 1 197 ? 20.238  -15.032 -9.587  1.00 29.13 ? 349  GLY A C   1 
ATOM   1246 O  O   . GLY A 1 197 ? 20.952  -16.045 -9.568  1.00 28.58 ? 349  GLY A O   1 
ATOM   1247 N  N   . THR A 1 198 ? 20.227  -14.181 -10.606 1.00 28.56 ? 350  THR A N   1 
ATOM   1248 C  CA  . THR A 1 198 ? 21.281  -14.218 -11.597 1.00 28.07 ? 350  THR A CA  1 
ATOM   1249 C  C   . THR A 1 198 ? 22.400  -13.239 -11.165 1.00 27.74 ? 350  THR A C   1 
ATOM   1250 O  O   . THR A 1 198 ? 23.230  -12.811 -11.978 1.00 27.96 ? 350  THR A O   1 
ATOM   1251 C  CB  . THR A 1 198 ? 20.737  -13.884 -12.988 1.00 28.12 ? 350  THR A CB  1 
ATOM   1252 O  OG1 . THR A 1 198 ? 20.374  -12.502 -13.036 1.00 28.64 ? 350  THR A OG1 1 
ATOM   1253 C  CG2 . THR A 1 198 ? 19.505  -14.730 -13.294 1.00 28.14 ? 350  THR A CG2 1 
ATOM   1254 N  N   . LEU A 1 199 ? 22.424  -12.895 -9.879  1.00 26.70 ? 351  LEU A N   1 
ATOM   1255 C  CA  . LEU A 1 199 ? 23.414  -11.957 -9.375  1.00 26.07 ? 351  LEU A CA  1 
ATOM   1256 C  C   . LEU A 1 199 ? 24.163  -12.568 -8.179  1.00 25.46 ? 351  LEU A C   1 
ATOM   1257 O  O   . LEU A 1 199 ? 24.583  -13.721 -8.263  1.00 25.74 ? 351  LEU A O   1 
ATOM   1258 C  CB  . LEU A 1 199 ? 22.766  -10.578 -9.097  1.00 26.31 ? 351  LEU A CB  1 
ATOM   1259 C  CG  . LEU A 1 199 ? 22.210  -9.824  -10.340 1.00 26.12 ? 351  LEU A CG  1 
ATOM   1260 C  CD1 . LEU A 1 199 ? 21.322  -8.601  -10.018 1.00 23.97 ? 351  LEU A CD1 1 
ATOM   1261 C  CD2 . LEU A 1 199 ? 23.318  -9.465  -11.349 1.00 23.68 ? 351  LEU A CD2 1 
ATOM   1262 N  N   . GLY A 1 200 ? 24.339  -11.834 -7.080  1.00 24.32 ? 352  GLY A N   1 
ATOM   1263 C  CA  . GLY A 1 200 ? 25.098  -12.357 -5.934  1.00 22.77 ? 352  GLY A CA  1 
ATOM   1264 C  C   . GLY A 1 200 ? 25.804  -11.260 -5.166  1.00 22.01 ? 352  GLY A C   1 
ATOM   1265 O  O   . GLY A 1 200 ? 25.580  -10.087 -5.421  1.00 22.12 ? 352  GLY A O   1 
ATOM   1266 N  N   . THR A 1 201 ? 26.677  -11.626 -4.236  1.00 20.89 ? 353  THR A N   1 
ATOM   1267 C  CA  . THR A 1 201 ? 27.287  -10.637 -3.356  1.00 19.89 ? 353  THR A CA  1 
ATOM   1268 C  C   . THR A 1 201 ? 28.111  -9.617  -4.142  1.00 19.91 ? 353  THR A C   1 
ATOM   1269 O  O   . THR A 1 201 ? 28.671  -9.945  -5.189  1.00 20.51 ? 353  THR A O   1 
ATOM   1270 C  CB  . THR A 1 201 ? 28.177  -11.304 -2.294  1.00 19.91 ? 353  THR A CB  1 
ATOM   1271 O  OG1 . THR A 1 201 ? 28.752  -10.296 -1.446  1.00 18.67 ? 353  THR A OG1 1 
ATOM   1272 C  CG2 . THR A 1 201 ? 29.293  -12.145 -2.965  1.00 18.91 ? 353  THR A CG2 1 
ATOM   1273 N  N   . ASN A 1 202 ? 28.183  -8.383  -3.647  1.00 19.22 ? 354  ASN A N   1 
ATOM   1274 C  CA  . ASN A 1 202 ? 29.095  -7.405  -4.223  1.00 18.79 ? 354  ASN A CA  1 
ATOM   1275 C  C   . ASN A 1 202 ? 30.498  -7.703  -3.750  1.00 18.26 ? 354  ASN A C   1 
ATOM   1276 O  O   . ASN A 1 202 ? 30.675  -8.481  -2.811  1.00 17.60 ? 354  ASN A O   1 
ATOM   1277 C  CB  . ASN A 1 202 ? 28.702  -5.973  -3.856  1.00 18.97 ? 354  ASN A CB  1 
ATOM   1278 C  CG  . ASN A 1 202 ? 27.609  -5.408  -4.756  1.00 19.51 ? 354  ASN A CG  1 
ATOM   1279 O  OD1 . ASN A 1 202 ? 27.059  -6.097  -5.620  1.00 21.51 ? 354  ASN A OD1 1 
ATOM   1280 N  ND2 . ASN A 1 202 ? 27.290  -4.146  -4.551  1.00 19.44 ? 354  ASN A ND2 1 
ATOM   1281 N  N   . PHE A 1 203 ? 31.478  -7.072  -4.404  1.00 17.94 ? 355  PHE A N   1 
ATOM   1282 C  CA  . PHE A 1 203 ? 32.909  -7.338  -4.201  1.00 17.35 ? 355  PHE A CA  1 
ATOM   1283 C  C   . PHE A 1 203 ? 33.757  -6.074  -4.374  1.00 17.56 ? 355  PHE A C   1 
ATOM   1284 O  O   . PHE A 1 203 ? 33.265  -5.015  -4.788  1.00 17.72 ? 355  PHE A O   1 
ATOM   1285 C  CB  . PHE A 1 203 ? 33.394  -8.425  -5.178  1.00 16.90 ? 355  PHE A CB  1 
ATOM   1286 C  CG  . PHE A 1 203 ? 33.144  -8.096  -6.643  1.00 17.10 ? 355  PHE A CG  1 
ATOM   1287 C  CD1 . PHE A 1 203 ? 31.978  -8.529  -7.286  1.00 16.22 ? 355  PHE A CD1 1 
ATOM   1288 C  CD2 . PHE A 1 203 ? 34.074  -7.355  -7.383  1.00 15.74 ? 355  PHE A CD2 1 
ATOM   1289 C  CE1 . PHE A 1 203 ? 31.745  -8.217  -8.635  1.00 14.93 ? 355  PHE A CE1 1 
ATOM   1290 C  CE2 . PHE A 1 203 ? 33.841  -7.042  -8.731  1.00 14.45 ? 355  PHE A CE2 1 
ATOM   1291 C  CZ  . PHE A 1 203 ? 32.678  -7.474  -9.353  1.00 14.68 ? 355  PHE A CZ  1 
ATOM   1292 N  N   . GLY A 1 204 ? 35.037  -6.190  -4.058  1.00 17.79 ? 356  GLY A N   1 
ATOM   1293 C  CA  . GLY A 1 204 ? 35.982  -5.152  -4.388  1.00 18.30 ? 356  GLY A CA  1 
ATOM   1294 C  C   . GLY A 1 204 ? 36.481  -4.415  -3.175  1.00 19.17 ? 356  GLY A C   1 
ATOM   1295 O  O   . GLY A 1 204 ? 36.165  -4.794  -2.038  1.00 19.12 ? 356  GLY A O   1 
ATOM   1296 N  N   . ARG A 1 205 ? 37.245  -3.343  -3.426  1.00 19.59 ? 357  ARG A N   1 
ATOM   1297 C  CA  . ARG A 1 205 ? 37.970  -2.621  -2.380  1.00 20.11 ? 357  ARG A CA  1 
ATOM   1298 C  C   . ARG A 1 205 ? 37.054  -1.982  -1.335  1.00 19.74 ? 357  ARG A C   1 
ATOM   1299 O  O   . ARG A 1 205 ? 37.504  -1.631  -0.242  1.00 19.59 ? 357  ARG A O   1 
ATOM   1300 C  CB  . ARG A 1 205 ? 38.893  -1.575  -2.991  1.00 20.22 ? 357  ARG A CB  1 
ATOM   1301 C  CG  . ARG A 1 205 ? 38.177  -0.546  -3.817  1.00 23.80 ? 357  ARG A CG  1 
ATOM   1302 C  CD  . ARG A 1 205 ? 39.164  0.377   -4.529  1.00 30.74 ? 357  ARG A CD  1 
ATOM   1303 N  NE  . ARG A 1 205 ? 38.491  1.239   -5.506  1.00 35.19 ? 357  ARG A NE  1 
ATOM   1304 C  CZ  . ARG A 1 205 ? 37.975  2.434   -5.220  1.00 37.35 ? 357  ARG A CZ  1 
ATOM   1305 N  NH1 . ARG A 1 205 ? 38.061  2.916   -3.970  1.00 37.87 ? 357  ARG A NH1 1 
ATOM   1306 N  NH2 . ARG A 1 205 ? 37.376  3.143   -6.180  1.00 36.53 ? 357  ARG A NH2 1 
ATOM   1307 N  N   . CYS A 1 206 ? 35.776  -1.850  -1.670  1.00 19.46 ? 358  CYS A N   1 
ATOM   1308 C  CA  . CYS A 1 206 ? 34.832  -1.223  -0.770  1.00 19.75 ? 358  CYS A CA  1 
ATOM   1309 C  C   . CYS A 1 206 ? 34.252  -2.168  0.273   1.00 20.21 ? 358  CYS A C   1 
ATOM   1310 O  O   . CYS A 1 206 ? 33.597  -1.716  1.222   1.00 20.67 ? 358  CYS A O   1 
ATOM   1311 C  CB  . CYS A 1 206 ? 33.737  -0.479  -1.543  1.00 19.68 ? 358  CYS A CB  1 
ATOM   1312 S  SG  . CYS A 1 206 ? 34.309  1.144   -2.132  1.00 18.46 ? 358  CYS A SG  1 
ATOM   1313 N  N   . VAL A 1 207 ? 34.523  -3.466  0.112   1.00 20.35 ? 359  VAL A N   1 
ATOM   1314 C  CA  . VAL A 1 207 ? 34.018  -4.508  1.010   1.00 20.20 ? 359  VAL A CA  1 
ATOM   1315 C  C   . VAL A 1 207 ? 35.052  -4.758  2.101   1.00 20.98 ? 359  VAL A C   1 
ATOM   1316 O  O   . VAL A 1 207 ? 36.163  -5.212  1.822   1.00 21.19 ? 359  VAL A O   1 
ATOM   1317 C  CB  . VAL A 1 207 ? 33.712  -5.811  0.243   1.00 19.87 ? 359  VAL A CB  1 
ATOM   1318 C  CG1 . VAL A 1 207 ? 33.262  -6.909  1.180   1.00 19.36 ? 359  VAL A CG1 1 
ATOM   1319 C  CG2 . VAL A 1 207 ? 32.670  -5.558  -0.832  1.00 18.96 ? 359  VAL A CG2 1 
ATOM   1320 N  N   . ASP A 1 208 ? 34.691  -4.461  3.345   1.00 21.53 ? 360  ASP A N   1 
ATOM   1321 C  CA  . ASP A 1 208 ? 35.649  -4.550  4.433   1.00 22.27 ? 360  ASP A CA  1 
ATOM   1322 C  C   . ASP A 1 208 ? 35.814  -5.967  4.955   1.00 22.25 ? 360  ASP A C   1 
ATOM   1323 O  O   . ASP A 1 208 ? 36.879  -6.352  5.416   1.00 22.22 ? 360  ASP A O   1 
ATOM   1324 C  CB  . ASP A 1 208 ? 35.267  -3.592  5.560   1.00 22.73 ? 360  ASP A CB  1 
ATOM   1325 C  CG  . ASP A 1 208 ? 35.078  -2.158  5.068   1.00 24.15 ? 360  ASP A CG  1 
ATOM   1326 O  OD1 . ASP A 1 208 ? 36.089  -1.439  4.894   1.00 24.71 ? 360  ASP A OD1 1 
ATOM   1327 O  OD2 . ASP A 1 208 ? 33.908  -1.754  4.860   1.00 24.51 ? 360  ASP A OD2 1 
ATOM   1328 N  N   . LEU A 1 209 ? 34.754  -6.748  4.901   1.00 22.67 ? 361  LEU A N   1 
ATOM   1329 C  CA  . LEU A 1 209 ? 34.866  -8.145  5.297   1.00 23.01 ? 361  LEU A CA  1 
ATOM   1330 C  C   . LEU A 1 209 ? 33.704  -8.967  4.759   1.00 22.52 ? 361  LEU A C   1 
ATOM   1331 O  O   . LEU A 1 209 ? 32.697  -8.419  4.280   1.00 22.75 ? 361  LEU A O   1 
ATOM   1332 C  CB  . LEU A 1 209 ? 35.012  -8.297  6.827   1.00 23.54 ? 361  LEU A CB  1 
ATOM   1333 C  CG  . LEU A 1 209 ? 33.944  -7.814  7.813   1.00 24.79 ? 361  LEU A CG  1 
ATOM   1334 C  CD1 . LEU A 1 209 ? 34.071  -8.556  9.139   1.00 26.42 ? 361  LEU A CD1 1 
ATOM   1335 C  CD2 . LEU A 1 209 ? 34.099  -6.341  8.070   1.00 26.75 ? 361  LEU A CD2 1 
ATOM   1336 N  N   . PHE A 1 210 ? 33.865  -10.283 4.813   1.00 21.47 ? 362  PHE A N   1 
ATOM   1337 C  CA  . PHE A 1 210 ? 32.798  -11.184 4.441   1.00 20.56 ? 362  PHE A CA  1 
ATOM   1338 C  C   . PHE A 1 210 ? 32.310  -11.936 5.671   1.00 20.65 ? 362  PHE A C   1 
ATOM   1339 O  O   . PHE A 1 210 ? 33.036  -12.096 6.656   1.00 20.46 ? 362  PHE A O   1 
ATOM   1340 C  CB  . PHE A 1 210 ? 33.275  -12.142 3.365   1.00 19.69 ? 362  PHE A CB  1 
ATOM   1341 C  CG  . PHE A 1 210 ? 33.415  -11.516 2.009   1.00 18.55 ? 362  PHE A CG  1 
ATOM   1342 C  CD1 . PHE A 1 210 ? 32.428  -11.697 1.044   1.00 16.56 ? 362  PHE A CD1 1 
ATOM   1343 C  CD2 . PHE A 1 210 ? 34.537  -10.753 1.687   1.00 16.83 ? 362  PHE A CD2 1 
ATOM   1344 C  CE1 . PHE A 1 210 ? 32.566  -11.138 -0.208  1.00 15.51 ? 362  PHE A CE1 1 
ATOM   1345 C  CE2 . PHE A 1 210 ? 34.678  -10.195 0.434   1.00 14.79 ? 362  PHE A CE2 1 
ATOM   1346 C  CZ  . PHE A 1 210 ? 33.695  -10.385 -0.513  1.00 15.69 ? 362  PHE A CZ  1 
ATOM   1347 N  N   . ALA A 1 211 ? 31.060  -12.370 5.612   1.00 20.87 ? 363  ALA A N   1 
ATOM   1348 C  CA  . ALA A 1 211 ? 30.435  -13.113 6.701   1.00 21.04 ? 363  ALA A CA  1 
ATOM   1349 C  C   . ALA A 1 211 ? 29.387  -14.044 6.103   1.00 21.37 ? 363  ALA A C   1 
ATOM   1350 O  O   . ALA A 1 211 ? 28.985  -13.865 4.954   1.00 21.23 ? 363  ALA A O   1 
ATOM   1351 C  CB  . ALA A 1 211 ? 29.810  -12.162 7.693   1.00 20.83 ? 363  ALA A CB  1 
ATOM   1352 N  N   . PRO A 1 212 ? 28.958  -15.063 6.867   1.00 22.06 ? 364  PRO A N   1 
ATOM   1353 C  CA  . PRO A 1 212 ? 27.952  -16.020 6.364   1.00 21.99 ? 364  PRO A CA  1 
ATOM   1354 C  C   . PRO A 1 212 ? 26.676  -15.340 5.881   1.00 22.35 ? 364  PRO A C   1 
ATOM   1355 O  O   . PRO A 1 212 ? 26.038  -14.629 6.662   1.00 23.28 ? 364  PRO A O   1 
ATOM   1356 C  CB  . PRO A 1 212 ? 27.639  -16.860 7.597   1.00 21.60 ? 364  PRO A CB  1 
ATOM   1357 C  CG  . PRO A 1 212 ? 28.869  -16.802 8.415   1.00 21.99 ? 364  PRO A CG  1 
ATOM   1358 C  CD  . PRO A 1 212 ? 29.403  -15.404 8.236   1.00 21.95 ? 364  PRO A CD  1 
ATOM   1359 N  N   . GLY A 1 213 ? 26.301  -15.550 4.618   1.00 22.29 ? 365  GLY A N   1 
ATOM   1360 C  CA  . GLY A 1 213 ? 25.064  -14.984 4.082   1.00 22.19 ? 365  GLY A CA  1 
ATOM   1361 C  C   . GLY A 1 213 ? 24.240  -15.919 3.206   1.00 22.85 ? 365  GLY A C   1 
ATOM   1362 O  O   . GLY A 1 213 ? 23.448  -15.460 2.375   1.00 22.45 ? 365  GLY A O   1 
ATOM   1363 N  N   . GLU A 1 214 ? 24.417  -17.227 3.378   1.00 23.28 ? 366  GLU A N   1 
ATOM   1364 C  CA  . GLU A 1 214 ? 23.576  -18.192 2.675   1.00 24.36 ? 366  GLU A CA  1 
ATOM   1365 C  C   . GLU A 1 214 ? 22.737  -19.103 3.596   1.00 24.57 ? 366  GLU A C   1 
ATOM   1366 O  O   . GLU A 1 214 ? 23.254  -19.723 4.536   1.00 24.23 ? 366  GLU A O   1 
ATOM   1367 C  CB  . GLU A 1 214 ? 24.398  -19.021 1.699   1.00 24.49 ? 366  GLU A CB  1 
ATOM   1368 C  CG  . GLU A 1 214 ? 23.547  -19.684 0.633   1.00 26.30 ? 366  GLU A CG  1 
ATOM   1369 C  CD  . GLU A 1 214 ? 24.333  -20.706 -0.154  1.00 30.27 ? 366  GLU A CD  1 
ATOM   1370 O  OE1 . GLU A 1 214 ? 24.393  -20.578 -1.394  1.00 31.43 ? 366  GLU A OE1 1 
ATOM   1371 O  OE2 . GLU A 1 214 ? 24.913  -21.630 0.471   1.00 32.01 ? 366  GLU A OE2 1 
ATOM   1372 N  N   . ASP A 1 215 ? 21.440  -19.184 3.298   1.00 24.97 ? 367  ASP A N   1 
ATOM   1373 C  CA  . ASP A 1 215 ? 20.489  -19.966 4.105   1.00 25.74 ? 367  ASP A CA  1 
ATOM   1374 C  C   . ASP A 1 215 ? 20.680  -19.719 5.600   1.00 25.40 ? 367  ASP A C   1 
ATOM   1375 O  O   . ASP A 1 215 ? 21.014  -20.631 6.352   1.00 26.22 ? 367  ASP A O   1 
ATOM   1376 C  CB  . ASP A 1 215 ? 20.599  -21.470 3.805   1.00 25.93 ? 367  ASP A CB  1 
ATOM   1377 C  CG  . ASP A 1 215 ? 20.500  -21.783 2.319   1.00 28.30 ? 367  ASP A CG  1 
ATOM   1378 O  OD1 . ASP A 1 215 ? 19.538  -21.325 1.648   1.00 28.57 ? 367  ASP A OD1 1 
ATOM   1379 O  OD2 . ASP A 1 215 ? 21.399  -22.502 1.822   1.00 31.66 ? 367  ASP A OD2 1 
ATOM   1380 N  N   . ILE A 1 216 ? 20.496  -18.475 6.020   1.00 24.89 ? 368  ILE A N   1 
ATOM   1381 C  CA  . ILE A 1 216 ? 20.624  -18.119 7.424   1.00 24.07 ? 368  ILE A CA  1 
ATOM   1382 C  C   . ILE A 1 216 ? 19.274  -18.285 8.123   1.00 24.06 ? 368  ILE A C   1 
ATOM   1383 O  O   . ILE A 1 216 ? 18.266  -17.689 7.719   1.00 24.05 ? 368  ILE A O   1 
ATOM   1384 C  CB  . ILE A 1 216 ? 21.190  -16.689 7.606   1.00 23.74 ? 368  ILE A CB  1 
ATOM   1385 C  CG1 . ILE A 1 216 ? 22.530  -16.544 6.873   1.00 23.21 ? 368  ILE A CG1 1 
ATOM   1386 C  CG2 . ILE A 1 216 ? 21.301  -16.321 9.091   1.00 22.60 ? 368  ILE A CG2 1 
ATOM   1387 C  CD1 . ILE A 1 216 ? 23.562  -17.619 7.200   1.00 21.77 ? 368  ILE A CD1 1 
ATOM   1388 N  N   . ILE A 1 217 ? 19.274  -19.121 9.157   1.00 23.66 ? 369  ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 217 ? 18.071  -19.453 9.902   1.00 23.45 ? 369  ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 217 ? 17.796  -18.321 10.875  1.00 22.55 ? 369  ILE A C   1 
ATOM   1391 O  O   . ILE A 1 217 ? 18.699  -17.856 11.554  1.00 22.29 ? 369  ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 217 ? 18.242  -20.814 10.638  1.00 23.58 ? 369  ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 217 ? 18.231  -21.958 9.624   1.00 24.77 ? 369  ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 217 ? 17.125  -21.049 11.620  1.00 24.09 ? 369  ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 217 ? 19.318  -23.047 9.841   1.00 26.78 ? 369  ILE A CD1 1 
ATOM   1396 N  N   . GLY A 1 218 ? 16.547  -17.880 10.916  1.00 22.08 ? 370  GLY A N   1 
ATOM   1397 C  CA  . GLY A 1 218 ? 16.099  -16.831 11.837  1.00 21.63 ? 370  GLY A CA  1 
ATOM   1398 C  C   . GLY A 1 218 ? 14.600  -16.624 11.750  1.00 21.18 ? 370  GLY A C   1 
ATOM   1399 O  O   . GLY A 1 218 ? 13.951  -17.161 10.851  1.00 21.16 ? 370  GLY A O   1 
ATOM   1400 N  N   . ALA A 1 219 ? 14.056  -15.842 12.680  1.00 21.13 ? 371  ALA A N   1 
ATOM   1401 C  CA  . ALA A 1 219 ? 12.596  -15.621 12.813  1.00 21.08 ? 371  ALA A CA  1 
ATOM   1402 C  C   . ALA A 1 219 ? 11.883  -15.333 11.504  1.00 20.79 ? 371  ALA A C   1 
ATOM   1403 O  O   . ALA A 1 219 ? 12.268  -14.425 10.792  1.00 21.08 ? 371  ALA A O   1 
ATOM   1404 C  CB  . ALA A 1 219 ? 12.321  -14.486 13.799  1.00 21.21 ? 371  ALA A CB  1 
ATOM   1405 N  N   . SER A 1 220 ? 10.863  -16.125 11.186  1.00 20.77 ? 372  SER A N   1 
ATOM   1406 C  CA  . SER A 1 220 ? 9.946   -15.831 10.081  1.00 20.50 ? 372  SER A CA  1 
ATOM   1407 C  C   . SER A 1 220 ? 8.737   -15.131 10.657  1.00 20.58 ? 372  SER A C   1 
ATOM   1408 O  O   . SER A 1 220 ? 8.297   -15.465 11.762  1.00 20.64 ? 372  SER A O   1 
ATOM   1409 C  CB  . SER A 1 220 ? 9.482   -17.112 9.387   1.00 20.61 ? 372  SER A CB  1 
ATOM   1410 O  OG  . SER A 1 220 ? 8.488   -16.845 8.398   1.00 19.92 ? 372  SER A OG  1 
ATOM   1411 N  N   . SER A 1 221 ? 8.201   -14.161 9.920   1.00 20.58 ? 373  SER A N   1 
ATOM   1412 C  CA  . SER A 1 221 ? 7.008   -13.441 10.375  1.00 20.34 ? 373  SER A CA  1 
ATOM   1413 C  C   . SER A 1 221 ? 5.745   -14.087 9.834   1.00 20.29 ? 373  SER A C   1 
ATOM   1414 O  O   . SER A 1 221 ? 4.660   -13.510 9.928   1.00 20.34 ? 373  SER A O   1 
ATOM   1415 C  CB  . SER A 1 221 ? 7.068   -11.954 9.995   1.00 20.24 ? 373  SER A CB  1 
ATOM   1416 O  OG  . SER A 1 221 ? 6.967   -11.774 8.594   1.00 19.84 ? 373  SER A OG  1 
ATOM   1417 N  N   . ASP A 1 222 ? 5.887   -15.284 9.266   1.00 20.24 ? 374  ASP A N   1 
ATOM   1418 C  CA  . ASP A 1 222 ? 4.737   -16.042 8.780   1.00 20.27 ? 374  ASP A CA  1 
ATOM   1419 C  C   . ASP A 1 222 ? 3.866   -16.415 9.967   1.00 19.96 ? 374  ASP A C   1 
ATOM   1420 O  O   . ASP A 1 222 ? 2.638   -16.343 9.900   1.00 19.76 ? 374  ASP A O   1 
ATOM   1421 C  CB  . ASP A 1 222 ? 5.179   -17.291 8.022   1.00 20.75 ? 374  ASP A CB  1 
ATOM   1422 C  CG  . ASP A 1 222 ? 5.431   -17.030 6.541   1.00 22.19 ? 374  ASP A CG  1 
ATOM   1423 O  OD1 . ASP A 1 222 ? 5.403   -15.857 6.108   1.00 24.21 ? 374  ASP A OD1 1 
ATOM   1424 O  OD2 . ASP A 1 222 ? 5.655   -18.013 5.794   1.00 24.39 ? 374  ASP A OD2 1 
ATOM   1425 N  N   . CYS A 1 223 ? 4.514   -16.776 11.065  1.00 19.59 ? 375  CYS A N   1 
ATOM   1426 C  CA  . CYS A 1 223 ? 3.819   -17.037 12.311  1.00 19.99 ? 375  CYS A CA  1 
ATOM   1427 C  C   . CYS A 1 223 ? 4.841   -16.856 13.402  1.00 19.58 ? 375  CYS A C   1 
ATOM   1428 O  O   . CYS A 1 223 ? 6.038   -16.964 13.158  1.00 19.37 ? 375  CYS A O   1 
ATOM   1429 C  CB  . CYS A 1 223 ? 3.240   -18.458 12.329  1.00 20.35 ? 375  CYS A CB  1 
ATOM   1430 S  SG  . CYS A 1 223 ? 4.419   -19.758 12.797  1.00 23.36 ? 375  CYS A SG  1 
ATOM   1431 N  N   . SER A 1 224 ? 4.387   -16.607 14.616  1.00 19.80 ? 376  SER A N   1 
ATOM   1432 C  CA  . SER A 1 224 ? 5.319   -16.213 15.652  1.00 20.47 ? 376  SER A CA  1 
ATOM   1433 C  C   . SER A 1 224 ? 6.125   -17.352 16.270  1.00 20.85 ? 376  SER A C   1 
ATOM   1434 O  O   . SER A 1 224 ? 6.916   -17.135 17.191  1.00 21.12 ? 376  SER A O   1 
ATOM   1435 C  CB  . SER A 1 224 ? 4.608   -15.405 16.708  1.00 20.15 ? 376  SER A CB  1 
ATOM   1436 O  OG  . SER A 1 224 ? 3.865   -16.296 17.459  1.00 22.18 ? 376  SER A OG  1 
ATOM   1437 N  N   . THR A 1 225 ? 5.947   -18.559 15.742  1.00 21.68 ? 377  THR A N   1 
ATOM   1438 C  CA  . THR A 1 225 ? 6.858   -19.670 16.017  1.00 22.25 ? 377  THR A CA  1 
ATOM   1439 C  C   . THR A 1 225 ? 7.446   -20.244 14.730  1.00 22.66 ? 377  THR A C   1 
ATOM   1440 O  O   . THR A 1 225 ? 7.904   -21.400 14.722  1.00 23.08 ? 377  THR A O   1 
ATOM   1441 C  CB  . THR A 1 225 ? 6.167   -20.841 16.761  1.00 22.56 ? 377  THR A CB  1 
ATOM   1442 O  OG1 . THR A 1 225 ? 5.089   -21.367 15.963  1.00 23.27 ? 377  THR A OG1 1 
ATOM   1443 C  CG2 . THR A 1 225 ? 5.659   -20.410 18.140  1.00 22.69 ? 377  THR A CG2 1 
ATOM   1444 N  N   . CYS A 1 226 ? 7.424   -19.458 13.650  1.00 22.73 ? 378  CYS A N   1 
ATOM   1445 C  CA  . CYS A 1 226 ? 7.996   -19.873 12.359  1.00 23.08 ? 378  CYS A CA  1 
ATOM   1446 C  C   . CYS A 1 226 ? 9.432   -19.349 12.144  1.00 23.23 ? 378  CYS A C   1 
ATOM   1447 O  O   . CYS A 1 226 ? 9.781   -18.267 12.617  1.00 23.46 ? 378  CYS A O   1 
ATOM   1448 C  CB  . CYS A 1 226 ? 7.109   -19.406 11.220  1.00 22.75 ? 378  CYS A CB  1 
ATOM   1449 S  SG  . CYS A 1 226 ? 5.504   -20.219 11.108  1.00 24.58 ? 378  CYS A SG  1 
ATOM   1450 N  N   . PHE A 1 227 ? 10.251  -20.130 11.437  1.00 23.11 ? 379  PHE A N   1 
ATOM   1451 C  CA  . PHE A 1 227 ? 11.636  -19.786 11.126  1.00 22.84 ? 379  PHE A CA  1 
ATOM   1452 C  C   . PHE A 1 227 ? 11.855  -19.904 9.621   1.00 23.35 ? 379  PHE A C   1 
ATOM   1453 O  O   . PHE A 1 227 ? 11.263  -20.757 8.965   1.00 23.86 ? 379  PHE A O   1 
ATOM   1454 C  CB  . PHE A 1 227 ? 12.597  -20.729 11.845  1.00 22.70 ? 379  PHE A CB  1 
ATOM   1455 C  CG  . PHE A 1 227 ? 12.759  -20.441 13.319  1.00 22.27 ? 379  PHE A CG  1 
ATOM   1456 C  CD1 . PHE A 1 227 ? 13.878  -19.758 13.785  1.00 20.64 ? 379  PHE A CD1 1 
ATOM   1457 C  CD2 . PHE A 1 227 ? 11.800  -20.871 14.243  1.00 21.62 ? 379  PHE A CD2 1 
ATOM   1458 C  CE1 . PHE A 1 227 ? 14.037  -19.499 15.136  1.00 21.28 ? 379  PHE A CE1 1 
ATOM   1459 C  CE2 . PHE A 1 227 ? 11.948  -20.610 15.604  1.00 21.19 ? 379  PHE A CE2 1 
ATOM   1460 C  CZ  . PHE A 1 227 ? 13.067  -19.930 16.054  1.00 21.59 ? 379  PHE A CZ  1 
ATOM   1461 N  N   . VAL A 1 228 ? 12.709  -19.053 9.068   1.00 23.37 ? 380  VAL A N   1 
ATOM   1462 C  CA  . VAL A 1 228 ? 12.897  -19.017 7.630   1.00 23.18 ? 380  VAL A CA  1 
ATOM   1463 C  C   . VAL A 1 228 ? 14.370  -18.936 7.332   1.00 23.38 ? 380  VAL A C   1 
ATOM   1464 O  O   . VAL A 1 228 ? 15.144  -18.381 8.119   1.00 23.25 ? 380  VAL A O   1 
ATOM   1465 C  CB  . VAL A 1 228 ? 12.119  -17.838 6.952   1.00 23.55 ? 380  VAL A CB  1 
ATOM   1466 C  CG1 . VAL A 1 228 ? 12.480  -16.483 7.567   1.00 22.28 ? 380  VAL A CG1 1 
ATOM   1467 C  CG2 . VAL A 1 228 ? 12.333  -17.836 5.426   1.00 23.87 ? 380  VAL A CG2 1 
ATOM   1468 N  N   . SER A 1 229 ? 14.746  -19.519 6.200   1.00 23.53 ? 381  SER A N   1 
ATOM   1469 C  CA  . SER A 1 229 ? 16.107  -19.486 5.723   1.00 23.89 ? 381  SER A CA  1 
ATOM   1470 C  C   . SER A 1 229 ? 16.176  -18.426 4.637   1.00 23.69 ? 381  SER A C   1 
ATOM   1471 O  O   . SER A 1 229 ? 15.368  -18.459 3.703   1.00 23.97 ? 381  SER A O   1 
ATOM   1472 C  CB  . SER A 1 229 ? 16.459  -20.846 5.145   1.00 24.23 ? 381  SER A CB  1 
ATOM   1473 O  OG  . SER A 1 229 ? 17.845  -21.096 5.274   1.00 26.69 ? 381  SER A OG  1 
ATOM   1474 N  N   . GLN A 1 230 ? 17.106  -17.477 4.774   1.00 23.11 ? 382  GLN A N   1 
ATOM   1475 C  CA  . GLN A 1 230 ? 17.247  -16.358 3.826   1.00 22.93 ? 382  GLN A CA  1 
ATOM   1476 C  C   . GLN A 1 230 ? 18.704  -16.162 3.450   1.00 22.63 ? 382  GLN A C   1 
ATOM   1477 O  O   . GLN A 1 230 ? 19.600  -16.438 4.246   1.00 22.50 ? 382  GLN A O   1 
ATOM   1478 C  CB  . GLN A 1 230 ? 16.772  -15.033 4.430   1.00 23.02 ? 382  GLN A CB  1 
ATOM   1479 C  CG  . GLN A 1 230 ? 15.313  -14.887 4.662   1.00 24.67 ? 382  GLN A CG  1 
ATOM   1480 C  CD  . GLN A 1 230 ? 14.545  -14.597 3.396   1.00 28.79 ? 382  GLN A CD  1 
ATOM   1481 O  OE1 . GLN A 1 230 ? 13.358  -14.270 3.446   1.00 30.77 ? 382  GLN A OE1 1 
ATOM   1482 N  NE2 . GLN A 1 230 ? 15.208  -14.719 2.248   1.00 30.04 ? 382  GLN A NE2 1 
ATOM   1483 N  N   . SER A 1 231 ? 18.927  -15.644 2.246   1.00 22.42 ? 383  SER A N   1 
ATOM   1484 C  CA  . SER A 1 231 ? 20.268  -15.386 1.721   1.00 21.87 ? 383  SER A CA  1 
ATOM   1485 C  C   . SER A 1 231 ? 20.445  -13.915 1.355   1.00 21.98 ? 383  SER A C   1 
ATOM   1486 O  O   . SER A 1 231 ? 19.491  -13.240 0.971   1.00 22.12 ? 383  SER A O   1 
ATOM   1487 C  CB  . SER A 1 231 ? 20.525  -16.257 0.499   1.00 21.32 ? 383  SER A CB  1 
ATOM   1488 O  OG  . SER A 1 231 ? 20.537  -17.616 0.858   1.00 20.85 ? 383  SER A OG  1 
ATOM   1489 N  N   . GLY A 1 232 ? 21.664  -13.412 1.495   1.00 22.00 ? 384  GLY A N   1 
ATOM   1490 C  CA  . GLY A 1 232 ? 21.977  -12.065 1.034   1.00 21.65 ? 384  GLY A CA  1 
ATOM   1491 C  C   . GLY A 1 232 ? 23.022  -11.360 1.873   1.00 21.62 ? 384  GLY A C   1 
ATOM   1492 O  O   . GLY A 1 232 ? 23.440  -11.861 2.933   1.00 21.30 ? 384  GLY A O   1 
ATOM   1493 N  N   . THR A 1 233 ? 23.436  -10.184 1.404   1.00 21.47 ? 385  THR A N   1 
ATOM   1494 C  CA  . THR A 1 233 ? 24.390  -9.371  2.155   1.00 21.18 ? 385  THR A CA  1 
ATOM   1495 C  C   . THR A 1 233 ? 23.777  -8.712  3.412   1.00 20.72 ? 385  THR A C   1 
ATOM   1496 O  O   . THR A 1 233 ? 24.512  -8.341  4.316   1.00 20.74 ? 385  THR A O   1 
ATOM   1497 C  CB  . THR A 1 233 ? 25.152  -8.378  1.244   1.00 21.36 ? 385  THR A CB  1 
ATOM   1498 O  OG1 . THR A 1 233 ? 24.223  -7.548  0.532   1.00 21.40 ? 385  THR A OG1 1 
ATOM   1499 C  CG2 . THR A 1 233 ? 26.003  -9.153  0.239   1.00 20.58 ? 385  THR A CG2 1 
ATOM   1500 N  N   . SER A 1 234 ? 22.449  -8.611  3.486   1.00 20.19 ? 386  SER A N   1 
ATOM   1501 C  CA  . SER A 1 234 ? 21.764  -8.251  4.743   1.00 20.41 ? 386  SER A CA  1 
ATOM   1502 C  C   . SER A 1 234 ? 22.136  -9.176  5.884   1.00 20.48 ? 386  SER A C   1 
ATOM   1503 O  O   . SER A 1 234 ? 22.489  -8.727  6.990   1.00 20.58 ? 386  SER A O   1 
ATOM   1504 C  CB  . SER A 1 234 ? 20.251  -8.354  4.598   1.00 20.33 ? 386  SER A CB  1 
ATOM   1505 O  OG  . SER A 1 234 ? 19.771  -7.385  3.707   1.00 21.12 ? 386  SER A OG  1 
ATOM   1506 N  N   . GLN A 1 235 ? 22.017  -10.474 5.608   1.00 20.35 ? 387  GLN A N   1 
ATOM   1507 C  CA  . GLN A 1 235 ? 22.298  -11.515 6.577   1.00 20.21 ? 387  GLN A CA  1 
ATOM   1508 C  C   . GLN A 1 235 ? 23.720  -11.457 7.097   1.00 19.79 ? 387  GLN A C   1 
ATOM   1509 O  O   . GLN A 1 235 ? 23.928  -11.459 8.318   1.00 19.64 ? 387  GLN A O   1 
ATOM   1510 C  CB  . GLN A 1 235 ? 21.989  -12.881 5.982   1.00 20.65 ? 387  GLN A CB  1 
ATOM   1511 C  CG  . GLN A 1 235 ? 20.558  -13.330 6.228   1.00 22.12 ? 387  GLN A CG  1 
ATOM   1512 C  CD  . GLN A 1 235 ? 19.548  -12.458 5.540   1.00 24.00 ? 387  GLN A CD  1 
ATOM   1513 O  OE1 . GLN A 1 235 ? 19.725  -12.068 4.390   1.00 27.60 ? 387  GLN A OE1 1 
ATOM   1514 N  NE2 . GLN A 1 235 ? 18.486  -12.135 6.241   1.00 25.02 ? 387  GLN A NE2 1 
ATOM   1515 N  N   . ALA A 1 236 ? 24.685  -11.375 6.177   1.00 19.28 ? 388  ALA A N   1 
ATOM   1516 C  CA  . ALA A 1 236 ? 26.091  -11.238 6.547   1.00 19.31 ? 388  ALA A CA  1 
ATOM   1517 C  C   . ALA A 1 236 ? 26.292  -10.018 7.442   1.00 19.59 ? 388  ALA A C   1 
ATOM   1518 O  O   . ALA A 1 236 ? 26.983  -10.094 8.454   1.00 20.04 ? 388  ALA A O   1 
ATOM   1519 C  CB  . ALA A 1 236 ? 26.967  -11.154 5.317   1.00 18.98 ? 388  ALA A CB  1 
ATOM   1520 N  N   . ALA A 1 237 ? 25.660  -8.904  7.085   1.00 19.40 ? 389  ALA A N   1 
ATOM   1521 C  CA  . ALA A 1 237 ? 25.781  -7.693  7.855   1.00 19.31 ? 389  ALA A CA  1 
ATOM   1522 C  C   . ALA A 1 237 ? 25.216  -7.881  9.254   1.00 19.50 ? 389  ALA A C   1 
ATOM   1523 O  O   . ALA A 1 237 ? 25.862  -7.528  10.245  1.00 19.49 ? 389  ALA A O   1 
ATOM   1524 C  CB  . ALA A 1 237 ? 25.093  -6.573  7.154   1.00 19.83 ? 389  ALA A CB  1 
ATOM   1525 N  N   . ALA A 1 238 ? 24.021  -8.457  9.332   1.00 19.66 ? 390  ALA A N   1 
ATOM   1526 C  CA  . ALA A 1 238 ? 23.383  -8.765  10.613  1.00 19.86 ? 390  ALA A CA  1 
ATOM   1527 C  C   . ALA A 1 238 ? 24.294  -9.596  11.537  1.00 20.50 ? 390  ALA A C   1 
ATOM   1528 O  O   . ALA A 1 238 ? 24.336  -9.383  12.760  1.00 20.38 ? 390  ALA A O   1 
ATOM   1529 C  CB  . ALA A 1 238 ? 22.082  -9.474  10.370  1.00 19.66 ? 390  ALA A CB  1 
ATOM   1530 N  N   . HIS A 1 239 ? 25.034  -10.531 10.935  1.00 20.98 ? 391  HIS A N   1 
ATOM   1531 C  CA  . HIS A 1 239 ? 25.974  -11.388 11.649  1.00 21.06 ? 391  HIS A CA  1 
ATOM   1532 C  C   . HIS A 1 239 ? 27.108  -10.554 12.241  1.00 20.41 ? 391  HIS A C   1 
ATOM   1533 O  O   . HIS A 1 239 ? 27.405  -10.663 13.424  1.00 20.26 ? 391  HIS A O   1 
ATOM   1534 C  CB  . HIS A 1 239 ? 26.512  -12.459 10.696  1.00 21.70 ? 391  HIS A CB  1 
ATOM   1535 C  CG  . HIS A 1 239 ? 27.404  -13.469 11.349  1.00 24.86 ? 391  HIS A CG  1 
ATOM   1536 N  ND1 . HIS A 1 239 ? 26.944  -14.688 11.799  1.00 27.11 ? 391  HIS A ND1 1 
ATOM   1537 C  CD2 . HIS A 1 239 ? 28.734  -13.446 11.619  1.00 28.56 ? 391  HIS A CD2 1 
ATOM   1538 C  CE1 . HIS A 1 239 ? 27.949  -15.372 12.323  1.00 29.03 ? 391  HIS A CE1 1 
ATOM   1539 N  NE2 . HIS A 1 239 ? 29.048  -14.643 12.224  1.00 29.69 ? 391  HIS A NE2 1 
ATOM   1540 N  N   . VAL A 1 240 ? 27.725  -9.712  11.415  1.00 19.91 ? 392  VAL A N   1 
ATOM   1541 C  CA  . VAL A 1 240 ? 28.791  -8.828  11.873  1.00 19.24 ? 392  VAL A CA  1 
ATOM   1542 C  C   . VAL A 1 240 ? 28.282  -7.882  12.972  1.00 19.32 ? 392  VAL A C   1 
ATOM   1543 O  O   . VAL A 1 240 ? 29.002  -7.633  13.938  1.00 19.56 ? 392  VAL A O   1 
ATOM   1544 C  CB  . VAL A 1 240 ? 29.469  -8.059  10.693  1.00 19.20 ? 392  VAL A CB  1 
ATOM   1545 C  CG1 . VAL A 1 240 ? 30.341  -6.917  11.192  1.00 18.33 ? 392  VAL A CG1 1 
ATOM   1546 C  CG2 . VAL A 1 240 ? 30.304  -8.997  9.856   1.00 17.89 ? 392  VAL A CG2 1 
ATOM   1547 N  N   . ALA A 1 241 ? 27.047  -7.393  12.846  1.00 19.10 ? 393  ALA A N   1 
ATOM   1548 C  CA  . ALA A 1 241 ? 26.452  -6.514  13.865  1.00 19.41 ? 393  ALA A CA  1 
ATOM   1549 C  C   . ALA A 1 241 ? 26.321  -7.207  15.225  1.00 20.00 ? 393  ALA A C   1 
ATOM   1550 O  O   . ALA A 1 241 ? 26.663  -6.630  16.266  1.00 19.80 ? 393  ALA A O   1 
ATOM   1551 C  CB  . ALA A 1 241 ? 25.106  -5.992  13.409  1.00 19.02 ? 393  ALA A CB  1 
ATOM   1552 N  N   . GLY A 1 242 ? 25.825  -8.444  15.197  1.00 20.50 ? 394  GLY A N   1 
ATOM   1553 C  CA  . GLY A 1 242 ? 25.788  -9.307  16.365  1.00 20.81 ? 394  GLY A CA  1 
ATOM   1554 C  C   . GLY A 1 242 ? 27.138  -9.499  17.036  1.00 21.24 ? 394  GLY A C   1 
ATOM   1555 O  O   . GLY A 1 242 ? 27.247  -9.335  18.256  1.00 21.46 ? 394  GLY A O   1 
ATOM   1556 N  N   . ILE A 1 243 ? 28.171  -9.837  16.262  1.00 21.57 ? 395  ILE A N   1 
ATOM   1557 C  CA  . ILE A 1 243 ? 29.532  -9.969  16.828  1.00 22.06 ? 395  ILE A CA  1 
ATOM   1558 C  C   . ILE A 1 243 ? 30.095  -8.640  17.365  1.00 22.43 ? 395  ILE A C   1 
ATOM   1559 O  O   . ILE A 1 243 ? 30.621  -8.596  18.489  1.00 22.60 ? 395  ILE A O   1 
ATOM   1560 C  CB  . ILE A 1 243 ? 30.508  -10.622 15.851  1.00 21.90 ? 395  ILE A CB  1 
ATOM   1561 C  CG1 . ILE A 1 243 ? 30.100  -12.063 15.607  1.00 22.30 ? 395  ILE A CG1 1 
ATOM   1562 C  CG2 . ILE A 1 243 ? 31.929  -10.607 16.399  1.00 22.10 ? 395  ILE A CG2 1 
ATOM   1563 C  CD1 . ILE A 1 243 ? 30.446  -12.517 14.214  1.00 25.03 ? 395  ILE A CD1 1 
ATOM   1564 N  N   . ALA A 1 244 ? 29.968  -7.565  16.587  1.00 22.48 ? 396  ALA A N   1 
ATOM   1565 C  CA  . ALA A 1 244 ? 30.267  -6.222  17.113  1.00 23.00 ? 396  ALA A CA  1 
ATOM   1566 C  C   . ALA A 1 244 ? 29.566  -5.915  18.458  1.00 23.19 ? 396  ALA A C   1 
ATOM   1567 O  O   . ALA A 1 244 ? 30.192  -5.362  19.362  1.00 23.25 ? 396  ALA A O   1 
ATOM   1568 C  CB  . ALA A 1 244 ? 29.977  -5.126  16.064  1.00 22.70 ? 396  ALA A CB  1 
ATOM   1569 N  N   . ALA A 1 245 ? 28.295  -6.299  18.597  1.00 23.40 ? 397  ALA A N   1 
ATOM   1570 C  CA  . ALA A 1 245 ? 27.545  -6.085  19.838  1.00 23.91 ? 397  ALA A CA  1 
ATOM   1571 C  C   . ALA A 1 245 ? 28.117  -6.876  21.021  1.00 24.85 ? 397  ALA A C   1 
ATOM   1572 O  O   . ALA A 1 245 ? 28.192  -6.372  22.146  1.00 24.98 ? 397  ALA A O   1 
ATOM   1573 C  CB  . ALA A 1 245 ? 26.087  -6.430  19.640  1.00 23.49 ? 397  ALA A CB  1 
ATOM   1574 N  N   . MET A 1 246 ? 28.526  -8.118  20.784  1.00 25.72 ? 398  MET A N   1 
ATOM   1575 C  CA  . MET A 1 246 ? 29.096  -8.909  21.868  1.00 26.59 ? 398  MET A CA  1 
ATOM   1576 C  C   . MET A 1 246 ? 30.474  -8.436  22.275  1.00 26.88 ? 398  MET A C   1 
ATOM   1577 O  O   . MET A 1 246 ? 30.735  -8.270  23.465  1.00 27.18 ? 398  MET A O   1 
ATOM   1578 C  CB  . MET A 1 246 ? 29.101  -10.386 21.536  1.00 26.42 ? 398  MET A CB  1 
ATOM   1579 C  CG  . MET A 1 246 ? 27.720  -10.988 21.617  1.00 26.69 ? 398  MET A CG  1 
ATOM   1580 S  SD  . MET A 1 246 ? 27.801  -12.703 21.115  1.00 27.91 ? 398  MET A SD  1 
ATOM   1581 C  CE  . MET A 1 246 ? 28.271  -12.578 19.391  1.00 27.48 ? 398  MET A CE  1 
ATOM   1582 N  N   . MET A 1 247 ? 31.345  -8.195  21.302  1.00 27.43 ? 399  MET A N   1 
ATOM   1583 C  CA  . MET A 1 247 ? 32.634  -7.567  21.581  1.00 28.64 ? 399  MET A CA  1 
ATOM   1584 C  C   . MET A 1 247 ? 32.486  -6.282  22.405  1.00 29.25 ? 399  MET A C   1 
ATOM   1585 O  O   . MET A 1 247 ? 33.253  -6.045  23.339  1.00 29.13 ? 399  MET A O   1 
ATOM   1586 C  CB  . MET A 1 247 ? 33.370  -7.254  20.287  1.00 28.34 ? 399  MET A CB  1 
ATOM   1587 C  CG  . MET A 1 247 ? 33.820  -8.482  19.537  1.00 29.11 ? 399  MET A CG  1 
ATOM   1588 S  SD  . MET A 1 247 ? 34.570  -8.055  17.956  1.00 29.86 ? 399  MET A SD  1 
ATOM   1589 C  CE  . MET A 1 247 ? 35.508  -9.555  17.615  1.00 28.45 ? 399  MET A CE  1 
ATOM   1590 N  N   . LEU A 1 248 ? 31.495  -5.457  22.070  1.00 30.02 ? 400  LEU A N   1 
ATOM   1591 C  CA  . LEU A 1 248 ? 31.317  -4.203  22.783  1.00 30.86 ? 400  LEU A CA  1 
ATOM   1592 C  C   . LEU A 1 248 ? 30.748  -4.364  24.194  1.00 31.95 ? 400  LEU A C   1 
ATOM   1593 O  O   . LEU A 1 248 ? 31.005  -3.528  25.048  1.00 32.38 ? 400  LEU A O   1 
ATOM   1594 C  CB  . LEU A 1 248 ? 30.529  -3.183  21.953  1.00 30.53 ? 400  LEU A CB  1 
ATOM   1595 C  CG  . LEU A 1 248 ? 31.246  -2.593  20.731  1.00 29.29 ? 400  LEU A CG  1 
ATOM   1596 C  CD1 . LEU A 1 248 ? 30.293  -1.715  19.984  1.00 28.82 ? 400  LEU A CD1 1 
ATOM   1597 C  CD2 . LEU A 1 248 ? 32.502  -1.818  21.084  1.00 28.23 ? 400  LEU A CD2 1 
ATOM   1598 N  N   . SER A 1 249 ? 29.991  -5.433  24.447  1.00 33.26 ? 401  SER A N   1 
ATOM   1599 C  CA  . SER A 1 249 ? 29.647  -5.800  25.831  1.00 34.37 ? 401  SER A CA  1 
ATOM   1600 C  C   . SER A 1 249 ? 30.923  -6.020  26.649  1.00 34.68 ? 401  SER A C   1 
ATOM   1601 O  O   . SER A 1 249 ? 31.165  -5.311  27.623  1.00 35.05 ? 401  SER A O   1 
ATOM   1602 C  CB  . SER A 1 249 ? 28.767  -7.054  25.887  1.00 34.47 ? 401  SER A CB  1 
ATOM   1603 O  OG  . SER A 1 249 ? 27.397  -6.709  25.829  1.00 35.77 ? 401  SER A OG  1 
ATOM   1604 N  N   . ALA A 1 250 ? 31.742  -6.982  26.225  1.00 34.88 ? 402  ALA A N   1 
ATOM   1605 C  CA  . ALA A 1 250 ? 32.982  -7.325  26.919  1.00 35.27 ? 402  ALA A CA  1 
ATOM   1606 C  C   . ALA A 1 250 ? 33.957  -6.159  27.093  1.00 35.94 ? 402  ALA A C   1 
ATOM   1607 O  O   . ALA A 1 250 ? 34.611  -6.059  28.130  1.00 36.33 ? 402  ALA A O   1 
ATOM   1608 C  CB  . ALA A 1 250 ? 33.665  -8.479  26.225  1.00 34.95 ? 402  ALA A CB  1 
ATOM   1609 N  N   . GLU A 1 251 ? 34.051  -5.287  26.087  1.00 36.62 ? 403  GLU A N   1 
ATOM   1610 C  CA  . GLU A 1 251 ? 34.988  -4.152  26.089  1.00 37.23 ? 403  GLU A CA  1 
ATOM   1611 C  C   . GLU A 1 251 ? 34.359  -2.893  25.468  1.00 36.98 ? 403  GLU A C   1 
ATOM   1612 O  O   . GLU A 1 251 ? 34.648  -2.546  24.310  1.00 37.18 ? 403  GLU A O   1 
ATOM   1613 C  CB  . GLU A 1 251 ? 36.258  -4.509  25.316  1.00 37.12 ? 403  GLU A CB  1 
ATOM   1614 C  CG  . GLU A 1 251 ? 37.036  -5.703  25.833  1.00 38.13 ? 403  GLU A CG  1 
ATOM   1615 C  CD  . GLU A 1 251 ? 38.351  -5.879  25.088  1.00 38.89 ? 403  GLU A CD  1 
ATOM   1616 O  OE1 . GLU A 1 251 ? 38.533  -6.934  24.440  1.00 40.65 ? 403  GLU A OE1 1 
ATOM   1617 O  OE2 . GLU A 1 251 ? 39.201  -4.951  25.131  1.00 41.47 ? 403  GLU A OE2 1 
ATOM   1618 N  N   . PRO A 1 252 ? 33.500  -2.197  26.228  1.00 36.78 ? 404  PRO A N   1 
ATOM   1619 C  CA  . PRO A 1 252 ? 32.745  -1.062  25.673  1.00 36.61 ? 404  PRO A CA  1 
ATOM   1620 C  C   . PRO A 1 252 ? 33.577  0.179   25.315  1.00 36.53 ? 404  PRO A C   1 
ATOM   1621 O  O   . PRO A 1 252 ? 33.008  1.250   25.087  1.00 36.13 ? 404  PRO A O   1 
ATOM   1622 C  CB  . PRO A 1 252 ? 31.739  -0.734  26.786  1.00 36.57 ? 404  PRO A CB  1 
ATOM   1623 C  CG  . PRO A 1 252 ? 32.363  -1.257  28.033  1.00 36.43 ? 404  PRO A CG  1 
ATOM   1624 C  CD  . PRO A 1 252 ? 33.172  -2.449  27.643  1.00 36.72 ? 404  PRO A CD  1 
ATOM   1625 N  N   . GLU A 1 253 ? 34.901  0.039   25.244  1.00 36.48 ? 405  GLU A N   1 
ATOM   1626 C  CA  . GLU A 1 253 ? 35.763  1.200   25.029  1.00 36.64 ? 405  GLU A CA  1 
ATOM   1627 C  C   . GLU A 1 253 ? 36.665  1.075   23.819  1.00 35.73 ? 405  GLU A C   1 
ATOM   1628 O  O   . GLU A 1 253 ? 37.538  1.927   23.583  1.00 35.58 ? 405  GLU A O   1 
ATOM   1629 C  CB  . GLU A 1 253 ? 36.591  1.491   26.273  1.00 37.32 ? 405  GLU A CB  1 
ATOM   1630 C  CG  . GLU A 1 253 ? 35.759  1.612   27.517  1.00 40.37 ? 405  GLU A CG  1 
ATOM   1631 C  CD  . GLU A 1 253 ? 36.283  2.669   28.438  1.00 45.67 ? 405  GLU A CD  1 
ATOM   1632 O  OE1 . GLU A 1 253 ? 37.511  2.669   28.712  1.00 47.61 ? 405  GLU A OE1 1 
ATOM   1633 O  OE2 . GLU A 1 253 ? 35.459  3.503   28.883  1.00 48.24 ? 405  GLU A OE2 1 
ATOM   1634 N  N   . LEU A 1 254 ? 36.447  0.012   23.052  1.00 34.78 ? 406  LEU A N   1 
ATOM   1635 C  CA  . LEU A 1 254 ? 37.107  -0.149  21.759  1.00 33.72 ? 406  LEU A CA  1 
ATOM   1636 C  C   . LEU A 1 254 ? 36.799  1.034   20.856  1.00 32.81 ? 406  LEU A C   1 
ATOM   1637 O  O   . LEU A 1 254 ? 35.673  1.519   20.803  1.00 32.47 ? 406  LEU A O   1 
ATOM   1638 C  CB  . LEU A 1 254 ? 36.672  -1.444  21.078  1.00 33.63 ? 406  LEU A CB  1 
ATOM   1639 C  CG  . LEU A 1 254 ? 37.008  -2.735  21.821  1.00 33.85 ? 406  LEU A CG  1 
ATOM   1640 C  CD1 . LEU A 1 254 ? 36.277  -3.914  21.174  1.00 33.81 ? 406  LEU A CD1 1 
ATOM   1641 C  CD2 . LEU A 1 254 ? 38.516  -2.962  21.860  1.00 32.31 ? 406  LEU A CD2 1 
ATOM   1642 N  N   . THR A 1 255 ? 37.830  1.512   20.180  1.00 32.07 ? 407  THR A N   1 
ATOM   1643 C  CA  . THR A 1 255 ? 37.670  2.534   19.167  1.00 31.21 ? 407  THR A CA  1 
ATOM   1644 C  C   . THR A 1 255 ? 37.284  1.836   17.871  1.00 30.49 ? 407  THR A C   1 
ATOM   1645 O  O   . THR A 1 255 ? 37.620  0.676   17.657  1.00 30.29 ? 407  THR A O   1 
ATOM   1646 C  CB  . THR A 1 255 ? 38.975  3.344   18.973  1.00 31.34 ? 407  THR A CB  1 
ATOM   1647 O  OG1 . THR A 1 255 ? 40.014  2.481   18.490  1.00 31.41 ? 407  THR A OG1 1 
ATOM   1648 C  CG2 . THR A 1 255 ? 39.419  3.987   20.287  1.00 30.72 ? 407  THR A CG2 1 
ATOM   1649 N  N   . LEU A 1 256 ? 36.570  2.546   17.013  1.00 29.94 ? 408  LEU A N   1 
ATOM   1650 C  CA  . LEU A 1 256 ? 36.164  2.021   15.720  1.00 29.34 ? 408  LEU A CA  1 
ATOM   1651 C  C   . LEU A 1 256 ? 37.288  1.246   15.021  1.00 29.30 ? 408  LEU A C   1 
ATOM   1652 O  O   . LEU A 1 256 ? 37.075  0.128   14.539  1.00 29.15 ? 408  LEU A O   1 
ATOM   1653 C  CB  . LEU A 1 256 ? 35.654  3.162   14.849  1.00 29.17 ? 408  LEU A CB  1 
ATOM   1654 C  CG  . LEU A 1 256 ? 34.155  3.479   14.803  1.00 28.83 ? 408  LEU A CG  1 
ATOM   1655 C  CD1 . LEU A 1 256 ? 33.309  2.739   15.853  1.00 29.87 ? 408  LEU A CD1 1 
ATOM   1656 C  CD2 . LEU A 1 256 ? 33.948  4.967   14.886  1.00 27.05 ? 408  LEU A CD2 1 
ATOM   1657 N  N   . ALA A 1 257 ? 38.487  1.824   15.001  1.00 29.24 ? 409  ALA A N   1 
ATOM   1658 C  CA  . ALA A 1 257 ? 39.634  1.183   14.356  1.00 29.23 ? 409  ALA A CA  1 
ATOM   1659 C  C   . ALA A 1 257 ? 40.057  -0.105  15.074  1.00 29.23 ? 409  ALA A C   1 
ATOM   1660 O  O   . ALA A 1 257 ? 40.401  -1.097  14.425  1.00 29.39 ? 409  ALA A O   1 
ATOM   1661 C  CB  . ALA A 1 257 ? 40.793  2.153   14.224  1.00 28.94 ? 409  ALA A CB  1 
ATOM   1662 N  N   . GLU A 1 258 ? 40.007  -0.093  16.403  1.00 29.22 ? 410  GLU A N   1 
ATOM   1663 C  CA  . GLU A 1 258 ? 40.213  -1.307  17.190  1.00 29.46 ? 410  GLU A CA  1 
ATOM   1664 C  C   . GLU A 1 258 ? 39.126  -2.354  16.916  1.00 29.55 ? 410  GLU A C   1 
ATOM   1665 O  O   . GLU A 1 258 ? 39.427  -3.524  16.656  1.00 29.33 ? 410  GLU A O   1 
ATOM   1666 C  CB  . GLU A 1 258 ? 40.259  -0.980  18.677  1.00 29.43 ? 410  GLU A CB  1 
ATOM   1667 C  CG  . GLU A 1 258 ? 41.584  -0.424  19.140  1.00 30.39 ? 410  GLU A CG  1 
ATOM   1668 C  CD  . GLU A 1 258 ? 41.497  0.252   20.487  1.00 31.13 ? 410  GLU A CD  1 
ATOM   1669 O  OE1 . GLU A 1 258 ? 40.424  0.185   21.128  1.00 31.80 ? 410  GLU A OE1 1 
ATOM   1670 O  OE2 . GLU A 1 258 ? 42.509  0.859   20.904  1.00 32.04 ? 410  GLU A OE2 1 
ATOM   1671 N  N   . LEU A 1 259 ? 37.866  -1.928  16.953  1.00 29.68 ? 411  LEU A N   1 
ATOM   1672 C  CA  . LEU A 1 259 ? 36.768  -2.833  16.681  1.00 30.07 ? 411  LEU A CA  1 
ATOM   1673 C  C   . LEU A 1 259 ? 36.951  -3.506  15.335  1.00 31.37 ? 411  LEU A C   1 
ATOM   1674 O  O   . LEU A 1 259 ? 36.731  -4.712  15.205  1.00 31.51 ? 411  LEU A O   1 
ATOM   1675 C  CB  . LEU A 1 259 ? 35.423  -2.106  16.721  1.00 29.81 ? 411  LEU A CB  1 
ATOM   1676 C  CG  . LEU A 1 259 ? 34.196  -2.995  16.477  1.00 28.62 ? 411  LEU A CG  1 
ATOM   1677 C  CD1 . LEU A 1 259 ? 34.215  -4.241  17.367  1.00 27.72 ? 411  LEU A CD1 1 
ATOM   1678 C  CD2 . LEU A 1 259 ? 32.913  -2.213  16.673  1.00 29.19 ? 411  LEU A CD2 1 
ATOM   1679 N  N   . ARG A 1 260 ? 37.355  -2.714  14.342  1.00 32.67 ? 412  ARG A N   1 
ATOM   1680 C  CA  . ARG A 1 260 ? 37.493  -3.180  12.978  1.00 33.61 ? 412  ARG A CA  1 
ATOM   1681 C  C   . ARG A 1 260 ? 38.664  -4.123  12.850  1.00 34.73 ? 412  ARG A C   1 
ATOM   1682 O  O   . ARG A 1 260 ? 38.598  -5.087  12.088  1.00 35.06 ? 412  ARG A O   1 
ATOM   1683 C  CB  . ARG A 1 260 ? 37.661  -2.004  12.024  1.00 33.61 ? 412  ARG A CB  1 
ATOM   1684 C  CG  . ARG A 1 260 ? 36.361  -1.295  11.634  1.00 33.36 ? 412  ARG A CG  1 
ATOM   1685 C  CD  . ARG A 1 260 ? 36.684  -0.051  10.826  1.00 32.81 ? 412  ARG A CD  1 
ATOM   1686 N  NE  . ARG A 1 260 ? 35.966  -0.022  9.551   1.00 32.92 ? 412  ARG A NE  1 
ATOM   1687 C  CZ  . ARG A 1 260 ? 34.928  0.768   9.298   1.00 33.53 ? 412  ARG A CZ  1 
ATOM   1688 N  NH1 . ARG A 1 260 ? 34.471  1.612   10.227  1.00 35.52 ? 412  ARG A NH1 1 
ATOM   1689 N  NH2 . ARG A 1 260 ? 34.343  0.718   8.116   1.00 32.84 ? 412  ARG A NH2 1 
ATOM   1690 N  N   . GLN A 1 261 ? 39.742  -3.871  13.587  1.00 36.22 ? 413  GLN A N   1 
ATOM   1691 C  CA  . GLN A 1 261 ? 40.885  -4.781  13.484  1.00 37.75 ? 413  GLN A CA  1 
ATOM   1692 C  C   . GLN A 1 261 ? 40.516  -6.113  14.131  1.00 37.73 ? 413  GLN A C   1 
ATOM   1693 O  O   . GLN A 1 261 ? 40.917  -7.170  13.654  1.00 37.92 ? 413  GLN A O   1 
ATOM   1694 C  CB  . GLN A 1 261 ? 42.198  -4.175  14.024  1.00 38.08 ? 413  GLN A CB  1 
ATOM   1695 C  CG  . GLN A 1 261 ? 43.424  -4.312  13.035  1.00 41.51 ? 413  GLN A CG  1 
ATOM   1696 C  CD  . GLN A 1 261 ? 43.311  -3.460  11.702  1.00 45.81 ? 413  GLN A CD  1 
ATOM   1697 O  OE1 . GLN A 1 261 ? 42.546  -2.477  11.614  1.00 47.03 ? 413  GLN A OE1 1 
ATOM   1698 N  NE2 . GLN A 1 261 ? 44.088  -3.854  10.679  1.00 45.78 ? 413  GLN A NE2 1 
ATOM   1699 N  N   . ARG A 1 262 ? 39.693  -6.048  15.171  1.00 37.92 ? 414  ARG A N   1 
ATOM   1700 C  CA  . ARG A 1 262 ? 39.192  -7.235  15.848  1.00 38.47 ? 414  ARG A CA  1 
ATOM   1701 C  C   . ARG A 1 262 ? 38.234  -8.065  14.979  1.00 38.78 ? 414  ARG A C   1 
ATOM   1702 O  O   . ARG A 1 262 ? 38.350  -9.284  14.918  1.00 38.96 ? 414  ARG A O   1 
ATOM   1703 C  CB  . ARG A 1 262 ? 38.490  -6.831  17.137  1.00 38.51 ? 414  ARG A CB  1 
ATOM   1704 C  CG  . ARG A 1 262 ? 38.984  -7.538  18.349  1.00 39.26 ? 414  ARG A CG  1 
ATOM   1705 C  CD  . ARG A 1 262 ? 40.112  -6.773  18.992  1.00 41.10 ? 414  ARG A CD  1 
ATOM   1706 N  NE  . ARG A 1 262 ? 39.989  -6.820  20.450  1.00 43.46 ? 414  ARG A NE  1 
ATOM   1707 C  CZ  . ARG A 1 262 ? 40.640  -6.023  21.298  1.00 44.85 ? 414  ARG A CZ  1 
ATOM   1708 N  NH1 . ARG A 1 262 ? 40.431  -6.155  22.601  1.00 45.02 ? 414  ARG A NH1 1 
ATOM   1709 N  NH2 . ARG A 1 262 ? 41.493  -5.094  20.854  1.00 45.20 ? 414  ARG A NH2 1 
ATOM   1710 N  N   . LEU A 1 263 ? 37.286  -7.407  14.319  1.00 39.39 ? 415  LEU A N   1 
ATOM   1711 C  CA  . LEU A 1 263 ? 36.320  -8.088  13.451  1.00 39.98 ? 415  LEU A CA  1 
ATOM   1712 C  C   . LEU A 1 263 ? 36.977  -8.779  12.258  1.00 41.07 ? 415  LEU A C   1 
ATOM   1713 O  O   . LEU A 1 263 ? 36.572  -9.879  11.859  1.00 41.06 ? 415  LEU A O   1 
ATOM   1714 C  CB  . LEU A 1 263 ? 35.243  -7.115  12.974  1.00 39.44 ? 415  LEU A CB  1 
ATOM   1715 C  CG  . LEU A 1 263 ? 34.178  -6.794  14.015  1.00 37.98 ? 415  LEU A CG  1 
ATOM   1716 C  CD1 . LEU A 1 263 ? 33.424  -5.540  13.646  1.00 36.94 ? 415  LEU A CD1 1 
ATOM   1717 C  CD2 . LEU A 1 263 ? 33.231  -7.949  14.170  1.00 37.04 ? 415  LEU A CD2 1 
ATOM   1718 N  N   . ILE A 1 264 ? 37.988  -8.123  11.696  1.00 42.57 ? 416  ILE A N   1 
ATOM   1719 C  CA  . ILE A 1 264 ? 38.767  -8.686  10.598  1.00 44.17 ? 416  ILE A CA  1 
ATOM   1720 C  C   . ILE A 1 264 ? 39.468  -9.976  11.052  1.00 45.69 ? 416  ILE A C   1 
ATOM   1721 O  O   . ILE A 1 264 ? 39.324  -11.021 10.407  1.00 45.63 ? 416  ILE A O   1 
ATOM   1722 C  CB  . ILE A 1 264 ? 39.756  -7.639  10.020  1.00 43.91 ? 416  ILE A CB  1 
ATOM   1723 C  CG1 . ILE A 1 264 ? 38.978  -6.591  9.218   1.00 43.76 ? 416  ILE A CG1 1 
ATOM   1724 C  CG2 . ILE A 1 264 ? 40.827  -8.301  9.148   1.00 43.77 ? 416  ILE A CG2 1 
ATOM   1725 C  CD1 . ILE A 1 264 ? 39.778  -5.392  8.804   1.00 43.55 ? 416  ILE A CD1 1 
ATOM   1726 N  N   . LEU A 1 265 ? 40.192  -9.889  12.174  1.00 47.44 ? 417  LEU A N   1 
ATOM   1727 C  CA  . LEU A 1 265 ? 40.875  -11.027 12.784  1.00 49.29 ? 417  LEU A CA  1 
ATOM   1728 C  C   . LEU A 1 265 ? 39.891  -12.126 13.195  1.00 50.39 ? 417  LEU A C   1 
ATOM   1729 O  O   . LEU A 1 265 ? 40.171  -13.309 12.980  1.00 50.89 ? 417  LEU A O   1 
ATOM   1730 C  CB  . LEU A 1 265 ? 41.727  -10.584 13.988  1.00 49.36 ? 417  LEU A CB  1 
ATOM   1731 C  CG  . LEU A 1 265 ? 43.223  -10.187 13.872  1.00 50.61 ? 417  LEU A CG  1 
ATOM   1732 C  CD1 . LEU A 1 265 ? 43.572  -9.208  12.700  1.00 50.52 ? 417  LEU A CD1 1 
ATOM   1733 C  CD2 . LEU A 1 265 ? 43.769  -9.644  15.227  1.00 49.79 ? 417  LEU A CD2 1 
ATOM   1734 N  N   . PHE A 1 266 ? 38.744  -11.742 13.765  1.00 51.59 ? 418  PHE A N   1 
ATOM   1735 C  CA  . PHE A 1 266 ? 37.686  -12.710 14.132  1.00 52.75 ? 418  PHE A CA  1 
ATOM   1736 C  C   . PHE A 1 266 ? 37.179  -13.542 12.942  1.00 53.67 ? 418  PHE A C   1 
ATOM   1737 O  O   . PHE A 1 266 ? 37.102  -14.771 13.041  1.00 53.62 ? 418  PHE A O   1 
ATOM   1738 C  CB  . PHE A 1 266 ? 36.499  -12.034 14.852  1.00 52.51 ? 418  PHE A CB  1 
ATOM   1739 C  CG  . PHE A 1 266 ? 35.488  -13.014 15.412  1.00 52.68 ? 418  PHE A CG  1 
ATOM   1740 C  CD1 . PHE A 1 266 ? 35.738  -13.687 16.617  1.00 52.44 ? 418  PHE A CD1 1 
ATOM   1741 C  CD2 . PHE A 1 266 ? 34.293  -13.275 14.733  1.00 52.14 ? 418  PHE A CD2 1 
ATOM   1742 C  CE1 . PHE A 1 266 ? 34.814  -14.604 17.138  1.00 51.53 ? 418  PHE A CE1 1 
ATOM   1743 C  CE2 . PHE A 1 266 ? 33.368  -14.187 15.244  1.00 51.61 ? 418  PHE A CE2 1 
ATOM   1744 C  CZ  . PHE A 1 266 ? 33.631  -14.852 16.453  1.00 51.67 ? 418  PHE A CZ  1 
ATOM   1745 N  N   . SER A 1 267 ? 36.850  -12.874 11.831  1.00 54.86 ? 419  SER A N   1 
ATOM   1746 C  CA  . SER A 1 267 ? 36.370  -13.549 10.620  1.00 56.10 ? 419  SER A CA  1 
ATOM   1747 C  C   . SER A 1 267 ? 37.425  -14.467 9.950   1.00 57.18 ? 419  SER A C   1 
ATOM   1748 O  O   . SER A 1 267 ? 37.250  -14.906 8.813   1.00 57.17 ? 419  SER A O   1 
ATOM   1749 C  CB  . SER A 1 267 ? 35.802  -12.526 9.626   1.00 56.01 ? 419  SER A CB  1 
ATOM   1750 O  OG  . SER A 1 267 ? 36.806  -12.029 8.759   1.00 55.73 ? 419  SER A OG  1 
ATOM   1751 N  N   . ALA A 1 268 ? 38.506  -14.757 10.671  1.00 58.73 ? 420  ALA A N   1 
ATOM   1752 C  CA  . ALA A 1 268 ? 39.545  -15.665 10.202  1.00 60.22 ? 420  ALA A CA  1 
ATOM   1753 C  C   . ALA A 1 268 ? 39.730  -16.874 11.132  1.00 61.42 ? 420  ALA A C   1 
ATOM   1754 O  O   . ALA A 1 268 ? 39.697  -16.757 12.364  1.00 61.52 ? 420  ALA A O   1 
ATOM   1755 C  CB  . ALA A 1 268 ? 40.858  -14.919 10.020  1.00 60.01 ? 420  ALA A CB  1 
ATOM   1756 N  N   . LYS A 1 269 ? 39.878  -18.039 10.503  1.00 62.95 ? 421  LYS A N   1 
ATOM   1757 C  CA  . LYS A 1 269 ? 40.318  -19.308 11.128  1.00 64.23 ? 421  LYS A CA  1 
ATOM   1758 C  C   . LYS A 1 269 ? 40.600  -20.323 9.989   1.00 64.80 ? 421  LYS A C   1 
ATOM   1759 O  O   . LYS A 1 269 ? 39.782  -21.209 9.696   1.00 65.00 ? 421  LYS A O   1 
ATOM   1760 C  CB  . LYS A 1 269 ? 39.312  -19.852 12.170  1.00 64.26 ? 421  LYS A CB  1 
ATOM   1761 C  CG  . LYS A 1 269 ? 37.834  -19.622 11.844  1.00 65.02 ? 421  LYS A CG  1 
ATOM   1762 C  CD  . LYS A 1 269 ? 36.954  -20.724 12.427  1.00 66.05 ? 421  LYS A CD  1 
ATOM   1763 C  CE  . LYS A 1 269 ? 35.486  -20.506 12.052  1.00 66.57 ? 421  LYS A CE  1 
ATOM   1764 N  NZ  . LYS A 1 269 ? 34.678  -21.755 12.156  1.00 65.88 ? 421  LYS A NZ  1 
ATOM   1765 N  N   . ASP A 1 270 ? 41.764  -20.168 9.348   1.00 65.34 ? 422  ASP A N   1 
ATOM   1766 C  CA  . ASP A 1 270 ? 42.043  -20.797 8.052   1.00 65.80 ? 422  ASP A CA  1 
ATOM   1767 C  C   . ASP A 1 270 ? 43.353  -21.587 8.032   1.00 65.73 ? 422  ASP A C   1 
ATOM   1768 O  O   . ASP A 1 270 ? 43.599  -22.383 7.120   1.00 65.50 ? 422  ASP A O   1 
ATOM   1769 C  CB  . ASP A 1 270 ? 42.049  -19.725 6.950   1.00 66.19 ? 422  ASP A CB  1 
ATOM   1770 C  CG  . ASP A 1 270 ? 40.721  -18.966 6.860   1.00 67.34 ? 422  ASP A CG  1 
ATOM   1771 O  OD1 . ASP A 1 270 ? 39.726  -19.550 6.371   1.00 68.58 ? 422  ASP A OD1 1 
ATOM   1772 O  OD2 . ASP A 1 270 ? 40.672  -17.787 7.278   1.00 68.41 ? 422  ASP A OD2 1 
ATOM   1773 N  N   . ASP B 2 1   ? 4.626   -14.869 28.554  1.00 37.57 ? 1    ASP B N   1 
ATOM   1774 C  CA  . ASP B 2 1   ? 4.489   -15.028 27.078  1.00 37.90 ? 1    ASP B CA  1 
ATOM   1775 C  C   . ASP B 2 1   ? 3.077   -14.583 26.691  1.00 37.32 ? 1    ASP B C   1 
ATOM   1776 O  O   . ASP B 2 1   ? 2.792   -13.388 26.686  1.00 37.45 ? 1    ASP B O   1 
ATOM   1777 C  CB  . ASP B 2 1   ? 4.743   -16.493 26.670  1.00 38.42 ? 1    ASP B CB  1 
ATOM   1778 C  CG  . ASP B 2 1   ? 5.775   -17.198 27.564  1.00 39.75 ? 1    ASP B CG  1 
ATOM   1779 O  OD1 . ASP B 2 1   ? 6.859   -17.564 27.051  1.00 40.43 ? 1    ASP B OD1 1 
ATOM   1780 O  OD2 . ASP B 2 1   ? 5.501   -17.385 28.777  1.00 40.84 ? 1    ASP B OD2 1 
ATOM   1781 N  N   . ILE B 2 2   ? 2.202   -15.538 26.373  1.00 36.45 ? 2    ILE B N   1 
ATOM   1782 C  CA  . ILE B 2 2   ? 0.759   -15.291 26.255  1.00 35.27 ? 2    ILE B CA  1 
ATOM   1783 C  C   . ILE B 2 2   ? 0.104   -15.993 27.435  1.00 35.30 ? 2    ILE B C   1 
ATOM   1784 O  O   . ILE B 2 2   ? 0.485   -17.110 27.766  1.00 35.25 ? 2    ILE B O   1 
ATOM   1785 C  CB  . ILE B 2 2   ? 0.181   -15.856 24.940  1.00 34.77 ? 2    ILE B CB  1 
ATOM   1786 C  CG1 . ILE B 2 2   ? 0.831   -15.168 23.733  1.00 34.70 ? 2    ILE B CG1 1 
ATOM   1787 C  CG2 . ILE B 2 2   ? -1.308  -15.680 24.914  1.00 33.72 ? 2    ILE B CG2 1 
ATOM   1788 C  CD1 . ILE B 2 2   ? 0.370   -15.669 22.369  1.00 34.47 ? 2    ILE B CD1 1 
ATOM   1789 N  N   . GLN B 2 3   ? -0.857  -15.358 28.091  1.00 35.13 ? 3    GLN B N   1 
ATOM   1790 C  CA  . GLN B 2 3   ? -1.497  -16.030 29.224  1.00 35.18 ? 3    GLN B CA  1 
ATOM   1791 C  C   . GLN B 2 3   ? -2.917  -16.460 28.928  1.00 34.76 ? 3    GLN B C   1 
ATOM   1792 O  O   . GLN B 2 3   ? -3.661  -15.785 28.213  1.00 34.93 ? 3    GLN B O   1 
ATOM   1793 C  CB  . GLN B 2 3   ? -1.413  -15.223 30.525  1.00 35.44 ? 3    GLN B CB  1 
ATOM   1794 C  CG  . GLN B 2 3   ? 0.005   -15.103 31.076  1.00 36.83 ? 3    GLN B CG  1 
ATOM   1795 C  CD  . GLN B 2 3   ? 0.811   -14.007 30.377  1.00 39.49 ? 3    GLN B CD  1 
ATOM   1796 O  OE1 . GLN B 2 3   ? 0.297   -12.917 30.094  1.00 40.17 ? 3    GLN B OE1 1 
ATOM   1797 N  NE2 . GLN B 2 3   ? 2.079   -14.292 30.098  1.00 40.41 ? 3    GLN B NE2 1 
ATOM   1798 N  N   . MET B 2 4   ? -3.266  -17.611 29.488  1.00 34.37 ? 4    MET B N   1 
ATOM   1799 C  CA  . MET B 2 4   ? -4.504  -18.299 29.202  1.00 33.82 ? 4    MET B CA  1 
ATOM   1800 C  C   . MET B 2 4   ? -5.266  -18.413 30.509  1.00 33.89 ? 4    MET B C   1 
ATOM   1801 O  O   . MET B 2 4   ? -4.726  -18.879 31.516  1.00 34.07 ? 4    MET B O   1 
ATOM   1802 C  CB  . MET B 2 4   ? -4.177  -19.685 28.640  1.00 33.65 ? 4    MET B CB  1 
ATOM   1803 C  CG  . MET B 2 4   ? -4.985  -20.111 27.410  1.00 32.79 ? 4    MET B CG  1 
ATOM   1804 S  SD  . MET B 2 4   ? -4.785  -19.091 25.933  1.00 29.32 ? 4    MET B SD  1 
ATOM   1805 C  CE  . MET B 2 4   ? -3.081  -18.644 26.119  1.00 28.71 ? 4    MET B CE  1 
ATOM   1806 N  N   . THR B 2 5   ? -6.512  -17.963 30.505  1.00 33.82 ? 5    THR B N   1 
ATOM   1807 C  CA  . THR B 2 5   ? -7.329  -18.016 31.703  1.00 34.07 ? 5    THR B CA  1 
ATOM   1808 C  C   . THR B 2 5   ? -8.522  -18.926 31.449  1.00 34.08 ? 5    THR B C   1 
ATOM   1809 O  O   . THR B 2 5   ? -9.268  -18.739 30.492  1.00 34.49 ? 5    THR B O   1 
ATOM   1810 C  CB  . THR B 2 5   ? -7.769  -16.603 32.131  1.00 34.29 ? 5    THR B CB  1 
ATOM   1811 O  OG1 . THR B 2 5   ? -6.643  -15.718 32.062  1.00 34.38 ? 5    THR B OG1 1 
ATOM   1812 C  CG2 . THR B 2 5   ? -8.297  -16.606 33.556  1.00 34.43 ? 5    THR B CG2 1 
ATOM   1813 N  N   . GLN B 2 6   ? -8.681  -19.929 32.297  1.00 34.02 ? 6    GLN B N   1 
ATOM   1814 C  CA  . GLN B 2 6   ? -9.679  -20.966 32.082  1.00 34.05 ? 6    GLN B CA  1 
ATOM   1815 C  C   . GLN B 2 6   ? -10.805 -20.827 33.124  1.00 34.71 ? 6    GLN B C   1 
ATOM   1816 O  O   . GLN B 2 6   ? -10.547 -20.480 34.278  1.00 34.67 ? 6    GLN B O   1 
ATOM   1817 C  CB  . GLN B 2 6   ? -8.990  -22.340 32.157  1.00 33.92 ? 6    GLN B CB  1 
ATOM   1818 C  CG  . GLN B 2 6   ? -9.740  -23.504 31.508  1.00 33.15 ? 6    GLN B CG  1 
ATOM   1819 C  CD  . GLN B 2 6   ? -8.896  -24.777 31.394  1.00 33.11 ? 6    GLN B CD  1 
ATOM   1820 O  OE1 . GLN B 2 6   ? -7.674  -24.725 31.269  1.00 32.20 ? 6    GLN B OE1 1 
ATOM   1821 N  NE2 . GLN B 2 6   ? -9.554  -25.921 31.425  1.00 31.74 ? 6    GLN B NE2 1 
ATOM   1822 N  N   . SER B 2 7   ? -12.045 -21.085 32.712  1.00 35.22 ? 7    SER B N   1 
ATOM   1823 C  CA  . SER B 2 7   ? -13.209 -20.943 33.590  1.00 36.10 ? 7    SER B CA  1 
ATOM   1824 C  C   . SER B 2 7   ? -14.221 -22.075 33.398  1.00 36.68 ? 7    SER B C   1 
ATOM   1825 O  O   . SER B 2 7   ? -14.476 -22.483 32.263  1.00 36.73 ? 7    SER B O   1 
ATOM   1826 C  CB  . SER B 2 7   ? -13.916 -19.610 33.333  1.00 36.26 ? 7    SER B CB  1 
ATOM   1827 O  OG  . SER B 2 7   ? -13.259 -18.539 33.980  1.00 36.46 ? 7    SER B OG  1 
ATOM   1828 N  N   . PRO B 2 8   ? -14.788 -22.600 34.507  1.00 37.12 ? 8    PRO B N   1 
ATOM   1829 C  CA  . PRO B 2 8   ? -14.408 -22.342 35.905  1.00 37.63 ? 8    PRO B CA  1 
ATOM   1830 C  C   . PRO B 2 8   ? -13.313 -23.303 36.368  1.00 38.32 ? 8    PRO B C   1 
ATOM   1831 O  O   . PRO B 2 8   ? -12.738 -24.006 35.543  1.00 38.78 ? 8    PRO B O   1 
ATOM   1832 C  CB  . PRO B 2 8   ? -15.705 -22.600 36.677  1.00 37.48 ? 8    PRO B CB  1 
ATOM   1833 C  CG  . PRO B 2 8   ? -16.631 -23.310 35.717  1.00 37.19 ? 8    PRO B CG  1 
ATOM   1834 C  CD  . PRO B 2 8   ? -15.933 -23.517 34.415  1.00 36.85 ? 8    PRO B CD  1 
ATOM   1835 N  N   . SER B 2 9   ? -13.023 -23.340 37.666  1.00 38.99 ? 9    SER B N   1 
ATOM   1836 C  CA  . SER B 2 9   ? -12.060 -24.305 38.205  1.00 39.58 ? 9    SER B CA  1 
ATOM   1837 C  C   . SER B 2 9   ? -12.669 -25.698 38.243  1.00 39.84 ? 9    SER B C   1 
ATOM   1838 O  O   . SER B 2 9   ? -11.964 -26.713 38.138  1.00 40.02 ? 9    SER B O   1 
ATOM   1839 C  CB  . SER B 2 9   ? -11.663 -23.939 39.638  1.00 39.68 ? 9    SER B CB  1 
ATOM   1840 O  OG  . SER B 2 9   ? -11.570 -22.540 39.817  1.00 41.29 ? 9    SER B OG  1 
ATOM   1841 N  N   . SER B 2 10  ? -13.989 -25.726 38.402  1.00 40.08 ? 10   SER B N   1 
ATOM   1842 C  CA  . SER B 2 10  ? -14.700 -26.902 38.866  1.00 40.32 ? 10   SER B CA  1 
ATOM   1843 C  C   . SER B 2 10  ? -16.084 -26.922 38.238  1.00 40.26 ? 10   SER B C   1 
ATOM   1844 O  O   . SER B 2 10  ? -16.646 -25.878 37.947  1.00 40.26 ? 10   SER B O   1 
ATOM   1845 C  CB  . SER B 2 10  ? -14.821 -26.827 40.392  1.00 40.42 ? 10   SER B CB  1 
ATOM   1846 O  OG  . SER B 2 10  ? -14.877 -28.110 40.982  1.00 40.87 ? 10   SER B OG  1 
ATOM   1847 N  N   . LEU B 2 11  ? -16.622 -28.116 38.033  1.00 40.52 ? 11   LEU B N   1 
ATOM   1848 C  CA  . LEU B 2 11  ? -17.931 -28.297 37.424  1.00 40.99 ? 11   LEU B CA  1 
ATOM   1849 C  C   . LEU B 2 11  ? -18.611 -29.526 37.986  1.00 41.25 ? 11   LEU B C   1 
ATOM   1850 O  O   . LEU B 2 11  ? -17.978 -30.577 38.141  1.00 41.54 ? 11   LEU B O   1 
ATOM   1851 C  CB  . LEU B 2 11  ? -17.780 -28.530 35.923  1.00 41.32 ? 11   LEU B CB  1 
ATOM   1852 C  CG  . LEU B 2 11  ? -18.264 -27.540 34.871  1.00 41.80 ? 11   LEU B CG  1 
ATOM   1853 C  CD1 . LEU B 2 11  ? -18.174 -28.226 33.506  1.00 41.84 ? 11   LEU B CD1 1 
ATOM   1854 C  CD2 . LEU B 2 11  ? -19.690 -27.094 35.157  1.00 42.32 ? 11   LEU B CD2 1 
ATOM   1855 N  N   . SER B 2 12  ? -19.905 -29.423 38.257  1.00 41.28 ? 12   SER B N   1 
ATOM   1856 C  CA  . SER B 2 12  ? -20.673 -30.619 38.566  1.00 41.30 ? 12   SER B CA  1 
ATOM   1857 C  C   . SER B 2 12  ? -21.715 -30.890 37.492  1.00 41.19 ? 12   SER B C   1 
ATOM   1858 O  O   . SER B 2 12  ? -22.422 -29.980 37.059  1.00 40.99 ? 12   SER B O   1 
ATOM   1859 C  CB  . SER B 2 12  ? -21.299 -30.513 39.949  1.00 41.53 ? 12   SER B CB  1 
ATOM   1860 O  OG  . SER B 2 12  ? -20.277 -30.507 40.935  1.00 42.23 ? 12   SER B OG  1 
ATOM   1861 N  N   . ALA B 2 13  ? -21.791 -32.144 37.056  1.00 41.22 ? 13   ALA B N   1 
ATOM   1862 C  CA  . ALA B 2 13  ? -22.720 -32.535 35.999  1.00 41.50 ? 13   ALA B CA  1 
ATOM   1863 C  C   . ALA B 2 13  ? -23.061 -34.017 36.055  1.00 41.67 ? 13   ALA B C   1 
ATOM   1864 O  O   . ALA B 2 13  ? -22.328 -34.815 36.662  1.00 41.67 ? 13   ALA B O   1 
ATOM   1865 C  CB  . ALA B 2 13  ? -22.144 -32.182 34.634  1.00 41.58 ? 13   ALA B CB  1 
ATOM   1866 N  N   . SER B 2 14  ? -24.179 -34.370 35.418  1.00 41.65 ? 14   SER B N   1 
ATOM   1867 C  CA  . SER B 2 14  ? -24.645 -35.755 35.342  1.00 41.66 ? 14   SER B CA  1 
ATOM   1868 C  C   . SER B 2 14  ? -24.500 -36.261 33.922  1.00 41.38 ? 14   SER B C   1 
ATOM   1869 O  O   . SER B 2 14  ? -24.514 -35.460 32.977  1.00 41.25 ? 14   SER B O   1 
ATOM   1870 C  CB  . SER B 2 14  ? -26.117 -35.849 35.764  1.00 41.74 ? 14   SER B CB  1 
ATOM   1871 O  OG  . SER B 2 14  ? -26.273 -35.520 37.128  1.00 41.85 ? 14   SER B OG  1 
ATOM   1872 N  N   . VAL B 2 15  ? -24.381 -37.579 33.757  1.00 40.92 ? 15   VAL B N   1 
ATOM   1873 C  CA  . VAL B 2 15  ? -24.303 -38.136 32.407  1.00 40.74 ? 15   VAL B CA  1 
ATOM   1874 C  C   . VAL B 2 15  ? -25.526 -37.664 31.619  1.00 40.75 ? 15   VAL B C   1 
ATOM   1875 O  O   . VAL B 2 15  ? -26.638 -37.654 32.154  1.00 40.98 ? 15   VAL B O   1 
ATOM   1876 C  CB  . VAL B 2 15  ? -24.138 -39.681 32.373  1.00 40.57 ? 15   VAL B CB  1 
ATOM   1877 C  CG1 . VAL B 2 15  ? -23.297 -40.167 33.559  1.00 40.45 ? 15   VAL B CG1 1 
ATOM   1878 C  CG2 . VAL B 2 15  ? -25.475 -40.377 32.317  1.00 40.21 ? 15   VAL B CG2 1 
ATOM   1879 N  N   . GLY B 2 16  ? -25.309 -37.228 30.377  1.00 40.48 ? 16   GLY B N   1 
ATOM   1880 C  CA  . GLY B 2 16  ? -26.381 -36.663 29.549  1.00 40.14 ? 16   GLY B CA  1 
ATOM   1881 C  C   . GLY B 2 16  ? -26.386 -35.140 29.499  1.00 40.08 ? 16   GLY B C   1 
ATOM   1882 O  O   . GLY B 2 16  ? -26.998 -34.547 28.608  1.00 40.09 ? 16   GLY B O   1 
ATOM   1883 N  N   . ASP B 2 17  ? -25.699 -34.505 30.448  1.00 39.93 ? 17   ASP B N   1 
ATOM   1884 C  CA  . ASP B 2 17  ? -25.556 -33.044 30.463  1.00 39.68 ? 17   ASP B CA  1 
ATOM   1885 C  C   . ASP B 2 17  ? -24.772 -32.509 29.276  1.00 39.48 ? 17   ASP B C   1 
ATOM   1886 O  O   . ASP B 2 17  ? -23.893 -33.186 28.721  1.00 39.02 ? 17   ASP B O   1 
ATOM   1887 C  CB  . ASP B 2 17  ? -24.847 -32.570 31.736  1.00 39.74 ? 17   ASP B CB  1 
ATOM   1888 C  CG  . ASP B 2 17  ? -25.746 -32.573 32.955  1.00 39.76 ? 17   ASP B CG  1 
ATOM   1889 O  OD1 . ASP B 2 17  ? -26.852 -33.148 32.888  1.00 39.96 ? 17   ASP B OD1 1 
ATOM   1890 O  OD2 . ASP B 2 17  ? -25.334 -31.995 33.984  1.00 39.60 ? 17   ASP B OD2 1 
ATOM   1891 N  N   . ARG B 2 18  ? -25.105 -31.282 28.897  1.00 39.33 ? 18   ARG B N   1 
ATOM   1892 C  CA  . ARG B 2 18  ? -24.255 -30.501 28.026  1.00 39.68 ? 18   ARG B CA  1 
ATOM   1893 C  C   . ARG B 2 18  ? -23.358 -29.622 28.904  1.00 39.14 ? 18   ARG B C   1 
ATOM   1894 O  O   . ARG B 2 18  ? -23.840 -28.731 29.613  1.00 39.38 ? 18   ARG B O   1 
ATOM   1895 C  CB  . ARG B 2 18  ? -25.095 -29.673 27.054  1.00 39.46 ? 18   ARG B CB  1 
ATOM   1896 C  CG  . ARG B 2 18  ? -24.472 -28.329 26.675  1.00 40.83 ? 18   ARG B CG  1 
ATOM   1897 C  CD  . ARG B 2 18  ? -25.303 -27.588 25.651  1.00 41.09 ? 18   ARG B CD  1 
ATOM   1898 N  NE  . ARG B 2 18  ? -25.342 -28.322 24.389  1.00 44.32 ? 18   ARG B NE  1 
ATOM   1899 C  CZ  . ARG B 2 18  ? -24.717 -27.943 23.279  1.00 45.40 ? 18   ARG B CZ  1 
ATOM   1900 N  NH1 . ARG B 2 18  ? -24.007 -26.818 23.259  1.00 45.88 ? 18   ARG B NH1 1 
ATOM   1901 N  NH2 . ARG B 2 18  ? -24.818 -28.686 22.183  1.00 46.51 ? 18   ARG B NH2 1 
ATOM   1902 N  N   . VAL B 2 19  ? -22.057 -29.889 28.888  1.00 38.59 ? 19   VAL B N   1 
ATOM   1903 C  CA  . VAL B 2 19  ? -21.134 -29.064 29.656  1.00 38.18 ? 19   VAL B CA  1 
ATOM   1904 C  C   . VAL B 2 19  ? -20.238 -28.236 28.732  1.00 37.98 ? 19   VAL B C   1 
ATOM   1905 O  O   . VAL B 2 19  ? -19.815 -28.705 27.663  1.00 37.85 ? 19   VAL B O   1 
ATOM   1906 C  CB  . VAL B 2 19  ? -20.304 -29.878 30.683  1.00 38.09 ? 19   VAL B CB  1 
ATOM   1907 C  CG1 . VAL B 2 19  ? -21.162 -30.930 31.354  1.00 38.20 ? 19   VAL B CG1 1 
ATOM   1908 C  CG2 . VAL B 2 19  ? -19.116 -30.526 30.035  1.00 37.98 ? 19   VAL B CG2 1 
ATOM   1909 N  N   . THR B 2 20  ? -19.988 -26.994 29.144  1.00 37.42 ? 20   THR B N   1 
ATOM   1910 C  CA  . THR B 2 20  ? -19.126 -26.090 28.402  1.00 37.19 ? 20   THR B CA  1 
ATOM   1911 C  C   . THR B 2 20  ? -18.061 -25.493 29.313  1.00 36.86 ? 20   THR B C   1 
ATOM   1912 O  O   . THR B 2 20  ? -18.372 -24.853 30.303  1.00 36.71 ? 20   THR B O   1 
ATOM   1913 C  CB  . THR B 2 20  ? -19.925 -24.940 27.730  1.00 37.39 ? 20   THR B CB  1 
ATOM   1914 O  OG1 . THR B 2 20  ? -20.692 -24.246 28.720  1.00 37.44 ? 20   THR B OG1 1 
ATOM   1915 C  CG2 . THR B 2 20  ? -20.860 -25.475 26.644  1.00 36.99 ? 20   THR B CG2 1 
ATOM   1916 N  N   . ILE B 2 21  ? -16.802 -25.738 28.977  1.00 36.66 ? 21   ILE B N   1 
ATOM   1917 C  CA  . ILE B 2 21  ? -15.663 -25.100 29.633  1.00 36.19 ? 21   ILE B CA  1 
ATOM   1918 C  C   . ILE B 2 21  ? -15.270 -23.913 28.766  1.00 36.14 ? 21   ILE B C   1 
ATOM   1919 O  O   . ILE B 2 21  ? -15.447 -23.940 27.541  1.00 36.48 ? 21   ILE B O   1 
ATOM   1920 C  CB  . ILE B 2 21  ? -14.480 -26.086 29.746  1.00 36.17 ? 21   ILE B CB  1 
ATOM   1921 C  CG1 . ILE B 2 21  ? -14.888 -27.279 30.614  1.00 35.73 ? 21   ILE B CG1 1 
ATOM   1922 C  CG2 . ILE B 2 21  ? -13.202 -25.393 30.277  1.00 35.33 ? 21   ILE B CG2 1 
ATOM   1923 C  CD1 . ILE B 2 21  ? -14.253 -28.584 30.182  1.00 35.70 ? 21   ILE B CD1 1 
ATOM   1924 N  N   . THR B 2 22  ? -14.748 -22.864 29.374  1.00 35.72 ? 22   THR B N   1 
ATOM   1925 C  CA  . THR B 2 22  ? -14.406 -21.693 28.579  1.00 35.94 ? 22   THR B CA  1 
ATOM   1926 C  C   . THR B 2 22  ? -12.991 -21.214 28.870  1.00 35.83 ? 22   THR B C   1 
ATOM   1927 O  O   . THR B 2 22  ? -12.526 -21.287 30.003  1.00 35.98 ? 22   THR B O   1 
ATOM   1928 C  CB  . THR B 2 22  ? -15.503 -20.574 28.658  1.00 35.76 ? 22   THR B CB  1 
ATOM   1929 O  OG1 . THR B 2 22  ? -14.890 -19.309 28.907  1.00 36.39 ? 22   THR B OG1 1 
ATOM   1930 C  CG2 . THR B 2 22  ? -16.508 -20.857 29.770  1.00 36.01 ? 22   THR B CG2 1 
ATOM   1931 N  N   . CYS B 2 23  ? -12.305 -20.739 27.837  1.00 36.04 ? 23   CYS B N   1 
ATOM   1932 C  CA  . CYS B 2 23  ? -10.885 -20.400 27.959  1.00 36.17 ? 23   CYS B CA  1 
ATOM   1933 C  C   . CYS B 2 23  ? -10.553 -19.100 27.217  1.00 36.04 ? 23   CYS B C   1 
ATOM   1934 O  O   . CYS B 2 23  ? -11.030 -18.861 26.116  1.00 36.05 ? 23   CYS B O   1 
ATOM   1935 C  CB  . CYS B 2 23  ? -10.012 -21.593 27.510  1.00 35.74 ? 23   CYS B CB  1 
ATOM   1936 S  SG  . CYS B 2 23  ? -8.255  -21.231 27.256  1.00 36.89 ? 23   CYS B SG  1 
ATOM   1937 N  N   . ARG B 2 24  ? -9.734  -18.264 27.837  1.00 36.26 ? 24   ARG B N   1 
ATOM   1938 C  CA  . ARG B 2 24  ? -9.539  -16.892 27.376  1.00 36.77 ? 24   ARG B CA  1 
ATOM   1939 C  C   . ARG B 2 24  ? -8.061  -16.513 27.253  1.00 36.01 ? 24   ARG B C   1 
ATOM   1940 O  O   . ARG B 2 24  ? -7.274  -16.731 28.176  1.00 36.39 ? 24   ARG B O   1 
ATOM   1941 C  CB  . ARG B 2 24  ? -10.239 -15.930 28.336  1.00 37.27 ? 24   ARG B CB  1 
ATOM   1942 C  CG  . ARG B 2 24  ? -10.478 -14.551 27.763  1.00 41.22 ? 24   ARG B CG  1 
ATOM   1943 C  CD  . ARG B 2 24  ? -10.862 -13.530 28.833  1.00 46.95 ? 24   ARG B CD  1 
ATOM   1944 N  NE  . ARG B 2 24  ? -11.559 -12.385 28.243  1.00 52.16 ? 24   ARG B NE  1 
ATOM   1945 C  CZ  . ARG B 2 24  ? -11.513 -11.133 28.713  1.00 55.94 ? 24   ARG B CZ  1 
ATOM   1946 N  NH1 . ARG B 2 24  ? -10.785 -10.832 29.792  1.00 56.78 ? 24   ARG B NH1 1 
ATOM   1947 N  NH2 . ARG B 2 24  ? -12.194 -10.166 28.094  1.00 56.90 ? 24   ARG B NH2 1 
ATOM   1948 N  N   . ALA B 2 25  ? -7.697  -15.929 26.118  1.00 35.15 ? 25   ALA B N   1 
ATOM   1949 C  CA  . ALA B 2 25  ? -6.314  -15.547 25.837  1.00 34.38 ? 25   ALA B CA  1 
ATOM   1950 C  C   . ALA B 2 25  ? -6.051  -14.074 26.132  1.00 33.87 ? 25   ALA B C   1 
ATOM   1951 O  O   . ALA B 2 25  ? -6.918  -13.229 25.932  1.00 33.86 ? 25   ALA B O   1 
ATOM   1952 C  CB  . ALA B 2 25  ? -5.977  -15.855 24.380  1.00 34.23 ? 25   ALA B CB  1 
ATOM   1953 N  N   . SER B 2 26  ? -4.839  -13.765 26.575  1.00 33.26 ? 26   SER B N   1 
ATOM   1954 C  CA  . SER B 2 26  ? -4.450  -12.386 26.849  1.00 32.62 ? 26   SER B CA  1 
ATOM   1955 C  C   . SER B 2 26  ? -4.306  -11.547 25.574  1.00 32.16 ? 26   SER B C   1 
ATOM   1956 O  O   . SER B 2 26  ? -4.152  -10.340 25.644  1.00 32.30 ? 26   SER B O   1 
ATOM   1957 C  CB  . SER B 2 26  ? -3.158  -12.352 27.666  1.00 32.55 ? 26   SER B CB  1 
ATOM   1958 O  OG  . SER B 2 26  ? -2.047  -12.725 26.873  1.00 32.98 ? 26   SER B OG  1 
ATOM   1959 N  N   . GLN B 2 27  ? -4.350  -12.187 24.415  1.00 31.71 ? 27   GLN B N   1 
ATOM   1960 C  CA  . GLN B 2 27  ? -4.358  -11.475 23.136  1.00 31.56 ? 27   GLN B CA  1 
ATOM   1961 C  C   . GLN B 2 27  ? -4.908  -12.372 22.028  1.00 31.34 ? 27   GLN B C   1 
ATOM   1962 O  O   . GLN B 2 27  ? -5.108  -13.571 22.243  1.00 31.73 ? 27   GLN B O   1 
ATOM   1963 C  CB  . GLN B 2 27  ? -2.956  -10.999 22.769  1.00 31.62 ? 27   GLN B CB  1 
ATOM   1964 C  CG  . GLN B 2 27  ? -2.014  -12.118 22.365  1.00 32.20 ? 27   GLN B CG  1 
ATOM   1965 C  CD  . GLN B 2 27  ? -0.578  -11.680 22.380  1.00 32.56 ? 27   GLN B CD  1 
ATOM   1966 O  OE1 . GLN B 2 27  ? 0.046   -11.553 21.328  1.00 33.19 ? 27   GLN B OE1 1 
ATOM   1967 N  NE2 . GLN B 2 27  ? -0.042  -11.428 23.573  1.00 31.87 ? 27   GLN B NE2 1 
ATOM   1968 N  N   . GLY B 2 28  ? -5.148  -11.795 20.850  1.00 30.77 ? 28   GLY B N   1 
ATOM   1969 C  CA  . GLY B 2 28  ? -5.644  -12.552 19.698  1.00 30.36 ? 28   GLY B CA  1 
ATOM   1970 C  C   . GLY B 2 28  ? -4.701  -13.672 19.277  1.00 30.11 ? 28   GLY B C   1 
ATOM   1971 O  O   . GLY B 2 28  ? -3.478  -13.491 19.220  1.00 30.36 ? 28   GLY B O   1 
ATOM   1972 N  N   . ILE B 2 29  ? -5.264  -14.843 19.007  1.00 29.59 ? 29   ILE B N   1 
ATOM   1973 C  CA  . ILE B 2 29  ? -4.470  -16.005 18.595  1.00 28.90 ? 29   ILE B CA  1 
ATOM   1974 C  C   . ILE B 2 29  ? -5.134  -16.748 17.427  1.00 28.94 ? 29   ILE B C   1 
ATOM   1975 O  O   . ILE B 2 29  ? -4.936  -17.955 17.235  1.00 28.77 ? 29   ILE B O   1 
ATOM   1976 C  CB  . ILE B 2 29  ? -4.203  -16.969 19.771  1.00 28.58 ? 29   ILE B CB  1 
ATOM   1977 C  CG1 . ILE B 2 29  ? -5.513  -17.495 20.357  1.00 27.43 ? 29   ILE B CG1 1 
ATOM   1978 C  CG2 . ILE B 2 29  ? -3.355  -16.291 20.831  1.00 28.25 ? 29   ILE B CG2 1 
ATOM   1979 C  CD1 . ILE B 2 29  ? -5.324  -18.654 21.285  1.00 25.32 ? 29   ILE B CD1 1 
ATOM   1980 N  N   . ARG B 2 30  ? -5.891  -15.997 16.630  1.00 28.79 ? 30   ARG B N   1 
ATOM   1981 C  CA  . ARG B 2 30  ? -6.738  -16.561 15.597  1.00 28.71 ? 30   ARG B CA  1 
ATOM   1982 C  C   . ARG B 2 30  ? -7.466  -17.731 16.244  1.00 28.02 ? 30   ARG B C   1 
ATOM   1983 O  O   . ARG B 2 30  ? -8.255  -17.505 17.150  1.00 28.49 ? 30   ARG B O   1 
ATOM   1984 C  CB  . ARG B 2 30  ? -5.915  -16.932 14.361  1.00 28.82 ? 30   ARG B CB  1 
ATOM   1985 C  CG  . ARG B 2 30  ? -5.334  -15.696 13.632  1.00 29.59 ? 30   ARG B CG  1 
ATOM   1986 C  CD  . ARG B 2 30  ? -4.175  -16.061 12.697  1.00 29.91 ? 30   ARG B CD  1 
ATOM   1987 N  NE  . ARG B 2 30  ? -3.384  -17.157 13.253  1.00 33.11 ? 30   ARG B NE  1 
ATOM   1988 C  CZ  . ARG B 2 30  ? -2.475  -17.026 14.219  1.00 33.37 ? 30   ARG B CZ  1 
ATOM   1989 N  NH1 . ARG B 2 30  ? -2.210  -15.825 14.733  1.00 32.80 ? 30   ARG B NH1 1 
ATOM   1990 N  NH2 . ARG B 2 30  ? -1.829  -18.105 14.665  1.00 32.75 ? 30   ARG B NH2 1 
ATOM   1991 N  N   . SER B 2 31  ? -7.174  -18.967 15.849  1.00 27.13 ? 31   SER B N   1 
ATOM   1992 C  CA  . SER B 2 31  ? -7.782  -20.123 16.503  1.00 25.97 ? 31   SER B CA  1 
ATOM   1993 C  C   . SER B 2 31  ? -6.741  -21.159 16.946  1.00 25.10 ? 31   SER B C   1 
ATOM   1994 O  O   . SER B 2 31  ? -7.039  -22.347 17.076  1.00 24.51 ? 31   SER B O   1 
ATOM   1995 C  CB  . SER B 2 31  ? -8.821  -20.753 15.584  1.00 26.29 ? 31   SER B CB  1 
ATOM   1996 O  OG  . SER B 2 31  ? -9.903  -19.866 15.384  1.00 28.03 ? 31   SER B OG  1 
ATOM   1997 N  N   . ALA B 2 32  ? -5.517  -20.701 17.186  1.00 23.95 ? 32   ALA B N   1 
ATOM   1998 C  CA  . ALA B 2 32  ? -4.442  -21.593 17.575  1.00 22.96 ? 32   ALA B CA  1 
ATOM   1999 C  C   . ALA B 2 32  ? -4.577  -22.032 19.047  1.00 22.70 ? 32   ALA B C   1 
ATOM   2000 O  O   . ALA B 2 32  ? -3.746  -21.703 19.923  1.00 22.52 ? 32   ALA B O   1 
ATOM   2001 C  CB  . ALA B 2 32  ? -3.086  -20.974 17.267  1.00 22.39 ? 32   ALA B CB  1 
ATOM   2002 N  N   . LEU B 2 33  ? -5.645  -22.791 19.294  1.00 22.21 ? 33   LEU B N   1 
ATOM   2003 C  CA  . LEU B 2 33  ? -5.947  -23.357 20.613  1.00 21.55 ? 33   LEU B CA  1 
ATOM   2004 C  C   . LEU B 2 33  ? -6.204  -24.878 20.574  1.00 21.17 ? 33   LEU B C   1 
ATOM   2005 O  O   . LEU B 2 33  ? -6.877  -25.392 19.675  1.00 21.29 ? 33   LEU B O   1 
ATOM   2006 C  CB  . LEU B 2 33  ? -7.142  -22.636 21.233  1.00 21.20 ? 33   LEU B CB  1 
ATOM   2007 C  CG  . LEU B 2 33  ? -7.256  -22.912 22.730  1.00 21.61 ? 33   LEU B CG  1 
ATOM   2008 C  CD1 . LEU B 2 33  ? -6.262  -22.079 23.526  1.00 22.13 ? 33   LEU B CD1 1 
ATOM   2009 C  CD2 . LEU B 2 33  ? -8.654  -22.703 23.226  1.00 21.34 ? 33   LEU B CD2 1 
ATOM   2010 N  N   . ASN B 2 34  ? -5.658  -25.575 21.563  1.00 20.65 ? 34   ASN B N   1 
ATOM   2011 C  CA  . ASN B 2 34  ? -5.766  -27.016 21.693  1.00 20.27 ? 34   ASN B CA  1 
ATOM   2012 C  C   . ASN B 2 34  ? -6.505  -27.331 22.970  1.00 20.57 ? 34   ASN B C   1 
ATOM   2013 O  O   . ASN B 2 34  ? -6.394  -26.591 23.940  1.00 20.46 ? 34   ASN B O   1 
ATOM   2014 C  CB  . ASN B 2 34  ? -4.366  -27.659 21.746  1.00 20.06 ? 34   ASN B CB  1 
ATOM   2015 C  CG  . ASN B 2 34  ? -3.617  -27.559 20.421  1.00 19.64 ? 34   ASN B CG  1 
ATOM   2016 O  OD1 . ASN B 2 34  ? -4.235  -27.521 19.358  1.00 21.28 ? 34   ASN B OD1 1 
ATOM   2017 N  ND2 . ASN B 2 34  ? -2.288  -27.511 20.477  1.00 16.54 ? 34   ASN B ND2 1 
ATOM   2018 N  N   . TRP B 2 35  ? -7.255  -28.429 22.980  1.00 21.19 ? 35   TRP B N   1 
ATOM   2019 C  CA  . TRP B 2 35  ? -7.905  -28.897 24.209  1.00 21.77 ? 35   TRP B CA  1 
ATOM   2020 C  C   . TRP B 2 35  ? -7.427  -30.292 24.592  1.00 21.97 ? 35   TRP B C   1 
ATOM   2021 O  O   . TRP B 2 35  ? -7.315  -31.178 23.735  1.00 22.32 ? 35   TRP B O   1 
ATOM   2022 C  CB  . TRP B 2 35  ? -9.406  -28.909 24.051  1.00 22.05 ? 35   TRP B CB  1 
ATOM   2023 C  CG  . TRP B 2 35  ? -10.014 -27.560 23.935  1.00 22.84 ? 35   TRP B CG  1 
ATOM   2024 C  CD1 . TRP B 2 35  ? -10.387 -26.927 22.784  1.00 23.23 ? 35   TRP B CD1 1 
ATOM   2025 C  CD2 . TRP B 2 35  ? -10.362 -26.679 25.009  1.00 23.58 ? 35   TRP B CD2 1 
ATOM   2026 N  NE1 . TRP B 2 35  ? -10.943 -25.706 23.073  1.00 23.62 ? 35   TRP B NE1 1 
ATOM   2027 C  CE2 . TRP B 2 35  ? -10.942 -25.527 24.433  1.00 23.96 ? 35   TRP B CE2 1 
ATOM   2028 C  CE3 . TRP B 2 35  ? -10.253 -26.756 26.406  1.00 24.00 ? 35   TRP B CE3 1 
ATOM   2029 C  CZ2 . TRP B 2 35  ? -11.402 -24.445 25.207  1.00 23.20 ? 35   TRP B CZ2 1 
ATOM   2030 C  CZ3 . TRP B 2 35  ? -10.718 -25.681 27.174  1.00 23.50 ? 35   TRP B CZ3 1 
ATOM   2031 C  CH2 . TRP B 2 35  ? -11.280 -24.542 26.569  1.00 22.49 ? 35   TRP B CH2 1 
ATOM   2032 N  N   . TYR B 2 36  ? -7.139  -30.480 25.878  1.00 21.80 ? 36   TYR B N   1 
ATOM   2033 C  CA  . TYR B 2 36  ? -6.667  -31.762 26.381  1.00 21.64 ? 36   TYR B CA  1 
ATOM   2034 C  C   . TYR B 2 36  ? -7.559  -32.254 27.499  1.00 22.03 ? 36   TYR B C   1 
ATOM   2035 O  O   . TYR B 2 36  ? -8.149  -31.459 28.232  1.00 22.15 ? 36   TYR B O   1 
ATOM   2036 C  CB  . TYR B 2 36  ? -5.243  -31.645 26.915  1.00 21.16 ? 36   TYR B CB  1 
ATOM   2037 C  CG  . TYR B 2 36  ? -4.227  -31.247 25.884  1.00 20.90 ? 36   TYR B CG  1 
ATOM   2038 C  CD1 . TYR B 2 36  ? -3.528  -32.211 25.170  1.00 20.64 ? 36   TYR B CD1 1 
ATOM   2039 C  CD2 . TYR B 2 36  ? -3.952  -29.905 25.624  1.00 19.97 ? 36   TYR B CD2 1 
ATOM   2040 C  CE1 . TYR B 2 36  ? -2.583  -31.856 24.215  1.00 20.21 ? 36   TYR B CE1 1 
ATOM   2041 C  CE2 . TYR B 2 36  ? -3.010  -29.548 24.667  1.00 20.19 ? 36   TYR B CE2 1 
ATOM   2042 C  CZ  . TYR B 2 36  ? -2.329  -30.527 23.966  1.00 19.62 ? 36   TYR B CZ  1 
ATOM   2043 O  OH  . TYR B 2 36  ? -1.393  -30.188 23.016  1.00 19.11 ? 36   TYR B OH  1 
ATOM   2044 N  N   . GLN B 2 37  ? -7.648  -33.573 27.617  1.00 22.42 ? 37   GLN B N   1 
ATOM   2045 C  CA  . GLN B 2 37  ? -8.269  -34.226 28.751  1.00 22.69 ? 37   GLN B CA  1 
ATOM   2046 C  C   . GLN B 2 37  ? -7.154  -34.924 29.508  1.00 23.04 ? 37   GLN B C   1 
ATOM   2047 O  O   . GLN B 2 37  ? -6.242  -35.489 28.892  1.00 22.97 ? 37   GLN B O   1 
ATOM   2048 C  CB  . GLN B 2 37  ? -9.279  -35.242 28.248  1.00 22.66 ? 37   GLN B CB  1 
ATOM   2049 C  CG  . GLN B 2 37  ? -10.038 -36.011 29.300  1.00 23.35 ? 37   GLN B CG  1 
ATOM   2050 C  CD  . GLN B 2 37  ? -10.727 -37.217 28.705  1.00 23.50 ? 37   GLN B CD  1 
ATOM   2051 O  OE1 . GLN B 2 37  ? -10.074 -38.205 28.383  1.00 24.97 ? 37   GLN B OE1 1 
ATOM   2052 N  NE2 . GLN B 2 37  ? -12.048 -37.139 28.540  1.00 22.77 ? 37   GLN B NE2 1 
ATOM   2053 N  N   . GLN B 2 38  ? -7.213  -34.852 30.835  1.00 23.46 ? 38   GLN B N   1 
ATOM   2054 C  CA  . GLN B 2 38  ? -6.275  -35.563 31.706  1.00 24.21 ? 38   GLN B CA  1 
ATOM   2055 C  C   . GLN B 2 38  ? -7.010  -36.270 32.836  1.00 24.75 ? 38   GLN B C   1 
ATOM   2056 O  O   . GLN B 2 38  ? -7.842  -35.674 33.536  1.00 24.84 ? 38   GLN B O   1 
ATOM   2057 C  CB  . GLN B 2 38  ? -5.205  -34.638 32.298  1.00 24.03 ? 38   GLN B CB  1 
ATOM   2058 C  CG  . GLN B 2 38  ? -4.106  -35.378 33.063  1.00 23.67 ? 38   GLN B CG  1 
ATOM   2059 C  CD  . GLN B 2 38  ? -2.917  -34.491 33.415  1.00 24.64 ? 38   GLN B CD  1 
ATOM   2060 O  OE1 . GLN B 2 38  ? -3.078  -33.394 33.956  1.00 25.15 ? 38   GLN B OE1 1 
ATOM   2061 N  NE2 . GLN B 2 38  ? -1.709  -34.971 33.116  1.00 25.24 ? 38   GLN B NE2 1 
ATOM   2062 N  N   . LYS B 2 39  ? -6.684  -37.546 32.990  1.00 25.13 ? 39   LYS B N   1 
ATOM   2063 C  CA  . LYS B 2 39  ? -7.213  -38.381 34.039  1.00 26.02 ? 39   LYS B CA  1 
ATOM   2064 C  C   . LYS B 2 39  ? -6.064  -38.655 35.012  1.00 26.77 ? 39   LYS B C   1 
ATOM   2065 O  O   . LYS B 2 39  ? -4.901  -38.573 34.610  1.00 27.37 ? 39   LYS B O   1 
ATOM   2066 C  CB  . LYS B 2 39  ? -7.752  -39.675 33.430  1.00 25.77 ? 39   LYS B CB  1 
ATOM   2067 C  CG  . LYS B 2 39  ? -8.943  -39.448 32.545  1.00 25.92 ? 39   LYS B CG  1 
ATOM   2068 C  CD  . LYS B 2 39  ? -9.572  -40.727 32.103  1.00 27.85 ? 39   LYS B CD  1 
ATOM   2069 C  CE  . LYS B 2 39  ? -11.024 -40.489 31.753  1.00 30.30 ? 39   LYS B CE  1 
ATOM   2070 N  NZ  . LYS B 2 39  ? -11.646 -41.688 31.118  1.00 32.92 ? 39   LYS B NZ  1 
ATOM   2071 N  N   . PRO B 2 40  ? -6.375  -39.000 36.281  1.00 27.16 ? 40   PRO B N   1 
ATOM   2072 C  CA  . PRO B 2 40  ? -5.343  -39.195 37.326  1.00 27.16 ? 40   PRO B CA  1 
ATOM   2073 C  C   . PRO B 2 40  ? -4.201  -40.139 36.926  1.00 27.26 ? 40   PRO B C   1 
ATOM   2074 O  O   . PRO B 2 40  ? -4.446  -41.257 36.490  1.00 27.25 ? 40   PRO B O   1 
ATOM   2075 C  CB  . PRO B 2 40  ? -6.137  -39.800 38.486  1.00 27.43 ? 40   PRO B CB  1 
ATOM   2076 C  CG  . PRO B 2 40  ? -7.553  -39.289 38.286  1.00 27.44 ? 40   PRO B CG  1 
ATOM   2077 C  CD  . PRO B 2 40  ? -7.740  -39.242 36.794  1.00 27.11 ? 40   PRO B CD  1 
ATOM   2078 N  N   . GLY B 2 41  ? -2.963  -39.675 37.064  1.00 27.63 ? 41   GLY B N   1 
ATOM   2079 C  CA  . GLY B 2 41  ? -1.789  -40.502 36.808  1.00 28.06 ? 41   GLY B CA  1 
ATOM   2080 C  C   . GLY B 2 41  ? -1.460  -40.783 35.350  1.00 28.77 ? 41   GLY B C   1 
ATOM   2081 O  O   . GLY B 2 41  ? -0.572  -41.598 35.060  1.00 28.97 ? 41   GLY B O   1 
ATOM   2082 N  N   . LYS B 2 42  ? -2.160  -40.126 34.424  1.00 28.80 ? 42   LYS B N   1 
ATOM   2083 C  CA  . LYS B 2 42  ? -1.867  -40.300 33.000  1.00 28.82 ? 42   LYS B CA  1 
ATOM   2084 C  C   . LYS B 2 42  ? -1.382  -39.007 32.357  1.00 28.37 ? 42   LYS B C   1 
ATOM   2085 O  O   . LYS B 2 42  ? -1.548  -37.919 32.918  1.00 28.83 ? 42   LYS B O   1 
ATOM   2086 C  CB  . LYS B 2 42  ? -3.079  -40.840 32.240  1.00 29.48 ? 42   LYS B CB  1 
ATOM   2087 C  CG  . LYS B 2 42  ? -3.674  -42.159 32.771  1.00 31.10 ? 42   LYS B CG  1 
ATOM   2088 C  CD  . LYS B 2 42  ? -2.627  -43.259 32.995  1.00 33.45 ? 42   LYS B CD  1 
ATOM   2089 C  CE  . LYS B 2 42  ? -3.260  -44.558 33.538  1.00 33.64 ? 42   LYS B CE  1 
ATOM   2090 N  NZ  . LYS B 2 42  ? -2.305  -45.349 34.393  1.00 33.90 ? 42   LYS B NZ  1 
ATOM   2091 N  N   . ALA B 2 43  ? -0.772  -39.129 31.182  1.00 27.29 ? 43   ALA B N   1 
ATOM   2092 C  CA  . ALA B 2 43  ? -0.392  -37.969 30.390  1.00 26.25 ? 43   ALA B CA  1 
ATOM   2093 C  C   . ALA B 2 43  ? -1.662  -37.305 29.844  1.00 25.60 ? 43   ALA B C   1 
ATOM   2094 O  O   . ALA B 2 43  ? -2.661  -37.976 29.651  1.00 25.81 ? 43   ALA B O   1 
ATOM   2095 C  CB  . ALA B 2 43  ? 0.494   -38.407 29.258  1.00 26.08 ? 43   ALA B CB  1 
ATOM   2096 N  N   . PRO B 2 44  ? -1.634  -35.982 29.594  1.00 25.07 ? 44   PRO B N   1 
ATOM   2097 C  CA  . PRO B 2 44  ? -2.786  -35.385 28.913  1.00 24.46 ? 44   PRO B CA  1 
ATOM   2098 C  C   . PRO B 2 44  ? -3.074  -36.066 27.581  1.00 23.89 ? 44   PRO B C   1 
ATOM   2099 O  O   . PRO B 2 44  ? -2.213  -36.740 27.022  1.00 23.64 ? 44   PRO B O   1 
ATOM   2100 C  CB  . PRO B 2 44  ? -2.335  -33.942 28.674  1.00 24.44 ? 44   PRO B CB  1 
ATOM   2101 C  CG  . PRO B 2 44  ? -1.359  -33.687 29.755  1.00 24.31 ? 44   PRO B CG  1 
ATOM   2102 C  CD  . PRO B 2 44  ? -0.608  -34.969 29.906  1.00 24.78 ? 44   PRO B CD  1 
ATOM   2103 N  N   . LYS B 2 45  ? -4.293  -35.897 27.092  1.00 23.72 ? 45   LYS B N   1 
ATOM   2104 C  CA  . LYS B 2 45  ? -4.705  -36.508 25.839  1.00 23.45 ? 45   LYS B CA  1 
ATOM   2105 C  C   . LYS B 2 45  ? -5.361  -35.453 24.978  1.00 22.99 ? 45   LYS B C   1 
ATOM   2106 O  O   . LYS B 2 45  ? -6.309  -34.787 25.410  1.00 23.28 ? 45   LYS B O   1 
ATOM   2107 C  CB  . LYS B 2 45  ? -5.690  -37.659 26.087  1.00 23.34 ? 45   LYS B CB  1 
ATOM   2108 C  CG  . LYS B 2 45  ? -6.113  -38.365 24.819  1.00 24.11 ? 45   LYS B CG  1 
ATOM   2109 C  CD  . LYS B 2 45  ? -7.481  -39.027 24.945  1.00 26.63 ? 45   LYS B CD  1 
ATOM   2110 C  CE  . LYS B 2 45  ? -7.994  -39.546 23.586  1.00 26.54 ? 45   LYS B CE  1 
ATOM   2111 N  NZ  . LYS B 2 45  ? -9.354  -40.167 23.718  1.00 27.45 ? 45   LYS B NZ  1 
ATOM   2112 N  N   . LEU B 2 46  ? -4.854  -35.314 23.759  1.00 22.19 ? 46   LEU B N   1 
ATOM   2113 C  CA  . LEU B 2 46  ? -5.376  -34.356 22.797  1.00 21.55 ? 46   LEU B CA  1 
ATOM   2114 C  C   . LEU B 2 46  ? -6.765  -34.722 22.261  1.00 21.31 ? 46   LEU B C   1 
ATOM   2115 O  O   . LEU B 2 46  ? -6.983  -35.825 21.746  1.00 20.88 ? 46   LEU B O   1 
ATOM   2116 C  CB  . LEU B 2 46  ? -4.382  -34.170 21.653  1.00 21.40 ? 46   LEU B CB  1 
ATOM   2117 C  CG  . LEU B 2 46  ? -4.726  -33.139 20.582  1.00 21.54 ? 46   LEU B CG  1 
ATOM   2118 C  CD1 . LEU B 2 46  ? -4.753  -31.698 21.120  1.00 20.10 ? 46   LEU B CD1 1 
ATOM   2119 C  CD2 . LEU B 2 46  ? -3.750  -33.297 19.419  1.00 22.31 ? 46   LEU B CD2 1 
ATOM   2120 N  N   . LEU B 2 47  ? -7.681  -33.759 22.378  1.00 21.08 ? 47   LEU B N   1 
ATOM   2121 C  CA  . LEU B 2 47  ? -9.063  -33.891 21.950  1.00 20.79 ? 47   LEU B CA  1 
ATOM   2122 C  C   . LEU B 2 47  ? -9.346  -33.033 20.718  1.00 20.66 ? 47   LEU B C   1 
ATOM   2123 O  O   . LEU B 2 47  ? -9.929  -33.505 19.737  1.00 20.37 ? 47   LEU B O   1 
ATOM   2124 C  CB  . LEU B 2 47  ? -9.998  -33.444 23.079  1.00 20.83 ? 47   LEU B CB  1 
ATOM   2125 C  CG  . LEU B 2 47  ? -9.962  -34.215 24.396  1.00 21.34 ? 47   LEU B CG  1 
ATOM   2126 C  CD1 . LEU B 2 47  ? -10.669 -33.424 25.444  1.00 21.75 ? 47   LEU B CD1 1 
ATOM   2127 C  CD2 . LEU B 2 47  ? -10.615 -35.580 24.259  1.00 22.08 ? 47   LEU B CD2 1 
ATOM   2128 N  N   . ILE B 2 48  ? -8.959  -31.761 20.795  1.00 20.57 ? 48   ILE B N   1 
ATOM   2129 C  CA  . ILE B 2 48  ? -9.264  -30.772 19.756  1.00 20.46 ? 48   ILE B CA  1 
ATOM   2130 C  C   . ILE B 2 48  ? -8.076  -29.858 19.495  1.00 20.21 ? 48   ILE B C   1 
ATOM   2131 O  O   . ILE B 2 48  ? -7.474  -29.330 20.426  1.00 19.97 ? 48   ILE B O   1 
ATOM   2132 C  CB  . ILE B 2 48  ? -10.457 -29.879 20.146  1.00 20.64 ? 48   ILE B CB  1 
ATOM   2133 C  CG1 . ILE B 2 48  ? -11.703 -30.727 20.372  1.00 20.71 ? 48   ILE B CG1 1 
ATOM   2134 C  CG2 . ILE B 2 48  ? -10.696 -28.791 19.082  1.00 20.85 ? 48   ILE B CG2 1 
ATOM   2135 C  CD1 . ILE B 2 48  ? -12.963 -30.078 19.883  1.00 22.36 ? 48   ILE B CD1 1 
ATOM   2136 N  N   . TYR B 2 49  ? -7.746  -29.688 18.222  1.00 20.02 ? 49   TYR B N   1 
ATOM   2137 C  CA  . TYR B 2 49  ? -6.740  -28.735 17.821  1.00 20.11 ? 49   TYR B CA  1 
ATOM   2138 C  C   . TYR B 2 49  ? -7.296  -27.661 16.875  1.00 20.71 ? 49   TYR B C   1 
ATOM   2139 O  O   . TYR B 2 49  ? -8.342  -27.859 16.233  1.00 20.98 ? 49   TYR B O   1 
ATOM   2140 C  CB  . TYR B 2 49  ? -5.539  -29.449 17.215  1.00 19.95 ? 49   TYR B CB  1 
ATOM   2141 C  CG  . TYR B 2 49  ? -5.795  -30.243 15.950  1.00 20.01 ? 49   TYR B CG  1 
ATOM   2142 C  CD1 . TYR B 2 49  ? -5.927  -31.642 15.988  1.00 19.49 ? 49   TYR B CD1 1 
ATOM   2143 C  CD2 . TYR B 2 49  ? -5.855  -29.610 14.708  1.00 19.83 ? 49   TYR B CD2 1 
ATOM   2144 C  CE1 . TYR B 2 49  ? -6.133  -32.377 14.818  1.00 18.13 ? 49   TYR B CE1 1 
ATOM   2145 C  CE2 . TYR B 2 49  ? -6.051  -30.345 13.527  1.00 19.44 ? 49   TYR B CE2 1 
ATOM   2146 C  CZ  . TYR B 2 49  ? -6.189  -31.715 13.595  1.00 18.89 ? 49   TYR B CZ  1 
ATOM   2147 O  OH  . TYR B 2 49  ? -6.382  -32.412 12.435  1.00 19.36 ? 49   TYR B OH  1 
ATOM   2148 N  N   . ASN B 2 50  ? -6.590  -26.532 16.804  1.00 20.88 ? 50   ASN B N   1 
ATOM   2149 C  CA  . ASN B 2 50  ? -7.016  -25.367 16.024  1.00 21.51 ? 50   ASN B CA  1 
ATOM   2150 C  C   . ASN B 2 50  ? -8.458  -24.952 16.294  1.00 20.95 ? 50   ASN B C   1 
ATOM   2151 O  O   . ASN B 2 50  ? -9.226  -24.676 15.368  1.00 20.82 ? 50   ASN B O   1 
ATOM   2152 C  CB  . ASN B 2 50  ? -6.695  -25.489 14.515  1.00 21.79 ? 50   ASN B CB  1 
ATOM   2153 C  CG  . ASN B 2 50  ? -5.615  -24.478 14.062  1.00 25.30 ? 50   ASN B CG  1 
ATOM   2154 O  OD1 . ASN B 2 50  ? -5.796  -23.257 14.197  1.00 27.06 ? 50   ASN B OD1 1 
ATOM   2155 N  ND2 . ASN B 2 50  ? -4.477  -24.985 13.546  1.00 28.62 ? 50   ASN B ND2 1 
ATOM   2156 N  N   . GLY B 2 51  ? -8.802  -24.931 17.583  1.00 20.47 ? 51   GLY B N   1 
ATOM   2157 C  CA  . GLY B 2 51  ? -10.083 -24.436 18.048  1.00 19.90 ? 51   GLY B CA  1 
ATOM   2158 C  C   . GLY B 2 51  ? -11.251 -25.385 17.896  1.00 19.84 ? 51   GLY B C   1 
ATOM   2159 O  O   . GLY B 2 51  ? -12.001 -25.585 18.839  1.00 19.93 ? 51   GLY B O   1 
ATOM   2160 N  N   . SER B 2 52  ? -11.408 -25.990 16.724  1.00 19.83 ? 52   SER B N   1 
ATOM   2161 C  CA  . SER B 2 52  ? -12.666 -26.664 16.401  1.00 19.94 ? 52   SER B CA  1 
ATOM   2162 C  C   . SER B 2 52  ? -12.558 -28.046 15.751  1.00 20.16 ? 52   SER B C   1 
ATOM   2163 O  O   . SER B 2 52  ? -13.582 -28.716 15.607  1.00 19.36 ? 52   SER B O   1 
ATOM   2164 C  CB  . SER B 2 52  ? -13.504 -25.770 15.495  1.00 19.98 ? 52   SER B CB  1 
ATOM   2165 O  OG  . SER B 2 52  ? -12.861 -25.617 14.235  1.00 20.81 ? 52   SER B OG  1 
ATOM   2166 N  N   . THR B 2 53  ? -11.351 -28.473 15.351  1.00 20.52 ? 53   THR B N   1 
ATOM   2167 C  CA  . THR B 2 53  ? -11.238 -29.765 14.666  1.00 20.99 ? 53   THR B CA  1 
ATOM   2168 C  C   . THR B 2 53  ? -10.815 -30.911 15.595  1.00 21.51 ? 53   THR B C   1 
ATOM   2169 O  O   . THR B 2 53  ? -9.915  -30.762 16.439  1.00 21.77 ? 53   THR B O   1 
ATOM   2170 C  CB  . THR B 2 53  ? -10.390 -29.738 13.328  1.00 21.12 ? 53   THR B CB  1 
ATOM   2171 O  OG1 . THR B 2 53  ? -9.310  -30.676 13.406  1.00 22.19 ? 53   THR B OG1 1 
ATOM   2172 C  CG2 . THR B 2 53  ? -9.879  -28.354 12.951  1.00 19.41 ? 53   THR B CG2 1 
ATOM   2173 N  N   . LEU B 2 54  ? -11.476 -32.057 15.430  1.00 21.71 ? 54   LEU B N   1 
ATOM   2174 C  CA  . LEU B 2 54  ? -11.259 -33.216 16.309  1.00 21.65 ? 54   LEU B CA  1 
ATOM   2175 C  C   . LEU B 2 54  ? -9.969  -33.970 16.039  1.00 21.79 ? 54   LEU B C   1 
ATOM   2176 O  O   . LEU B 2 54  ? -9.635  -34.287 14.896  1.00 21.88 ? 54   LEU B O   1 
ATOM   2177 C  CB  . LEU B 2 54  ? -12.429 -34.187 16.209  1.00 21.41 ? 54   LEU B CB  1 
ATOM   2178 C  CG  . LEU B 2 54  ? -13.694 -33.715 16.908  1.00 21.78 ? 54   LEU B CG  1 
ATOM   2179 C  CD1 . LEU B 2 54  ? -14.861 -34.449 16.335  1.00 22.92 ? 54   LEU B CD1 1 
ATOM   2180 C  CD2 . LEU B 2 54  ? -13.620 -33.935 18.417  1.00 21.43 ? 54   LEU B CD2 1 
ATOM   2181 N  N   . GLN B 2 55  ? -9.256  -34.284 17.108  1.00 22.22 ? 55   GLN B N   1 
ATOM   2182 C  CA  . GLN B 2 55  ? -8.085  -35.134 16.999  1.00 22.67 ? 55   GLN B CA  1 
ATOM   2183 C  C   . GLN B 2 55  ? -8.537  -36.492 16.515  1.00 23.38 ? 55   GLN B C   1 
ATOM   2184 O  O   . GLN B 2 55  ? -9.694  -36.884 16.728  1.00 23.23 ? 55   GLN B O   1 
ATOM   2185 C  CB  . GLN B 2 55  ? -7.366  -35.263 18.346  1.00 22.35 ? 55   GLN B CB  1 
ATOM   2186 C  CG  . GLN B 2 55  ? -6.323  -36.378 18.418  1.00 22.17 ? 55   GLN B CG  1 
ATOM   2187 C  CD  . GLN B 2 55  ? -5.132  -36.148 17.509  1.00 22.32 ? 55   GLN B CD  1 
ATOM   2188 O  OE1 . GLN B 2 55  ? -5.091  -35.186 16.750  1.00 23.14 ? 55   GLN B OE1 1 
ATOM   2189 N  NE2 . GLN B 2 55  ? -4.154  -37.042 17.578  1.00 22.18 ? 55   GLN B NE2 1 
ATOM   2190 N  N   . SER B 2 56  ? -7.621  -37.186 15.844  1.00 24.06 ? 56   SER B N   1 
ATOM   2191 C  CA  . SER B 2 56  ? -7.819  -38.557 15.397  1.00 24.67 ? 56   SER B CA  1 
ATOM   2192 C  C   . SER B 2 56  ? -8.548  -39.406 16.442  1.00 24.80 ? 56   SER B C   1 
ATOM   2193 O  O   . SER B 2 56  ? -8.164  -39.423 17.609  1.00 25.09 ? 56   SER B O   1 
ATOM   2194 C  CB  . SER B 2 56  ? -6.459  -39.160 15.081  1.00 24.39 ? 56   SER B CB  1 
ATOM   2195 O  OG  . SER B 2 56  ? -6.601  -40.512 14.730  1.00 26.98 ? 56   SER B OG  1 
ATOM   2196 N  N   . GLY B 2 57  ? -9.625  -40.064 16.020  1.00 25.20 ? 57   GLY B N   1 
ATOM   2197 C  CA  . GLY B 2 57  ? -10.368 -41.028 16.848  1.00 25.63 ? 57   GLY B CA  1 
ATOM   2198 C  C   . GLY B 2 57  ? -11.094 -40.564 18.103  1.00 26.28 ? 57   GLY B C   1 
ATOM   2199 O  O   . GLY B 2 57  ? -11.502 -41.385 18.911  1.00 26.71 ? 57   GLY B O   1 
ATOM   2200 N  N   . VAL B 2 58  ? -11.267 -39.259 18.269  1.00 26.85 ? 58   VAL B N   1 
ATOM   2201 C  CA  . VAL B 2 58  ? -11.974 -38.680 19.416  1.00 26.85 ? 58   VAL B CA  1 
ATOM   2202 C  C   . VAL B 2 58  ? -13.462 -38.578 19.104  1.00 27.42 ? 58   VAL B C   1 
ATOM   2203 O  O   . VAL B 2 58  ? -13.821 -38.170 18.010  1.00 27.53 ? 58   VAL B O   1 
ATOM   2204 C  CB  . VAL B 2 58  ? -11.381 -37.289 19.754  1.00 26.43 ? 58   VAL B CB  1 
ATOM   2205 C  CG1 . VAL B 2 58  ? -12.218 -36.543 20.774  1.00 25.75 ? 58   VAL B CG1 1 
ATOM   2206 C  CG2 . VAL B 2 58  ? -9.976  -37.456 20.252  1.00 26.39 ? 58   VAL B CG2 1 
ATOM   2207 N  N   . PRO B 2 59  ? -14.334 -38.945 20.066  1.00 28.26 ? 59   PRO B N   1 
ATOM   2208 C  CA  . PRO B 2 59  ? -15.792 -38.995 19.831  1.00 28.53 ? 59   PRO B CA  1 
ATOM   2209 C  C   . PRO B 2 59  ? -16.395 -37.651 19.503  1.00 29.12 ? 59   PRO B C   1 
ATOM   2210 O  O   . PRO B 2 59  ? -15.997 -36.648 20.088  1.00 29.69 ? 59   PRO B O   1 
ATOM   2211 C  CB  . PRO B 2 59  ? -16.347 -39.481 21.175  1.00 28.43 ? 59   PRO B CB  1 
ATOM   2212 C  CG  . PRO B 2 59  ? -15.195 -40.169 21.844  1.00 28.52 ? 59   PRO B CG  1 
ATOM   2213 C  CD  . PRO B 2 59  ? -13.994 -39.363 21.442  1.00 28.26 ? 59   PRO B CD  1 
ATOM   2214 N  N   . SER B 2 60  ? -17.380 -37.639 18.606  1.00 29.93 ? 60   SER B N   1 
ATOM   2215 C  CA  . SER B 2 60  ? -17.991 -36.388 18.126  1.00 30.42 ? 60   SER B CA  1 
ATOM   2216 C  C   . SER B 2 60  ? -18.816 -35.628 19.142  1.00 30.47 ? 60   SER B C   1 
ATOM   2217 O  O   . SER B 2 60  ? -19.258 -34.517 18.860  1.00 30.83 ? 60   SER B O   1 
ATOM   2218 C  CB  . SER B 2 60  ? -18.809 -36.594 16.843  1.00 30.58 ? 60   SER B CB  1 
ATOM   2219 O  OG  . SER B 2 60  ? -19.272 -37.923 16.709  1.00 31.90 ? 60   SER B OG  1 
ATOM   2220 N  N   . ARG B 2 61  ? -19.014 -36.203 20.323  1.00 30.80 ? 61   ARG B N   1 
ATOM   2221 C  CA  . ARG B 2 61  ? -19.722 -35.487 21.383  1.00 31.03 ? 61   ARG B CA  1 
ATOM   2222 C  C   . ARG B 2 61  ? -18.912 -34.255 21.804  1.00 31.44 ? 61   ARG B C   1 
ATOM   2223 O  O   . ARG B 2 61  ? -19.469 -33.285 22.325  1.00 31.65 ? 61   ARG B O   1 
ATOM   2224 C  CB  . ARG B 2 61  ? -20.050 -36.410 22.572  1.00 31.02 ? 61   ARG B CB  1 
ATOM   2225 C  CG  . ARG B 2 61  ? -19.046 -36.437 23.734  1.00 31.33 ? 61   ARG B CG  1 
ATOM   2226 C  CD  . ARG B 2 61  ? -19.372 -37.548 24.733  1.00 30.36 ? 61   ARG B CD  1 
ATOM   2227 N  NE  . ARG B 2 61  ? -19.007 -38.829 24.148  1.00 29.66 ? 61   ARG B NE  1 
ATOM   2228 C  CZ  . ARG B 2 61  ? -18.023 -39.613 24.573  1.00 29.11 ? 61   ARG B CZ  1 
ATOM   2229 N  NH1 . ARG B 2 61  ? -17.314 -39.295 25.643  1.00 28.58 ? 61   ARG B NH1 1 
ATOM   2230 N  NH2 . ARG B 2 61  ? -17.774 -40.746 23.935  1.00 29.35 ? 61   ARG B NH2 1 
ATOM   2231 N  N   . PHE B 2 62  ? -17.600 -34.305 21.553  1.00 31.64 ? 62   PHE B N   1 
ATOM   2232 C  CA  . PHE B 2 62  ? -16.685 -33.200 21.850  1.00 31.60 ? 62   PHE B CA  1 
ATOM   2233 C  C   . PHE B 2 62  ? -16.647 -32.202 20.716  1.00 31.44 ? 62   PHE B C   1 
ATOM   2234 O  O   . PHE B 2 62  ? -16.524 -32.572 19.560  1.00 31.66 ? 62   PHE B O   1 
ATOM   2235 C  CB  . PHE B 2 62  ? -15.279 -33.732 22.079  1.00 31.44 ? 62   PHE B CB  1 
ATOM   2236 C  CG  . PHE B 2 62  ? -15.121 -34.450 23.365  1.00 31.43 ? 62   PHE B CG  1 
ATOM   2237 C  CD1 . PHE B 2 62  ? -14.963 -33.739 24.557  1.00 31.25 ? 62   PHE B CD1 1 
ATOM   2238 C  CD2 . PHE B 2 62  ? -15.137 -35.839 23.402  1.00 31.68 ? 62   PHE B CD2 1 
ATOM   2239 C  CE1 . PHE B 2 62  ? -14.809 -34.412 25.773  1.00 31.34 ? 62   PHE B CE1 1 
ATOM   2240 C  CE2 . PHE B 2 62  ? -14.988 -36.528 24.618  1.00 31.60 ? 62   PHE B CE2 1 
ATOM   2241 C  CZ  . PHE B 2 62  ? -14.822 -35.813 25.801  1.00 31.62 ? 62   PHE B CZ  1 
ATOM   2242 N  N   . SER B 2 63  ? -16.755 -30.931 21.044  1.00 31.40 ? 63   SER B N   1 
ATOM   2243 C  CA  . SER B 2 63  ? -16.681 -29.920 20.014  1.00 31.68 ? 63   SER B CA  1 
ATOM   2244 C  C   . SER B 2 63  ? -16.073 -28.637 20.551  1.00 31.78 ? 63   SER B C   1 
ATOM   2245 O  O   . SER B 2 63  ? -16.256 -28.286 21.715  1.00 31.63 ? 63   SER B O   1 
ATOM   2246 C  CB  . SER B 2 63  ? -18.057 -29.654 19.397  1.00 31.29 ? 63   SER B CB  1 
ATOM   2247 O  OG  . SER B 2 63  ? -18.832 -28.841 20.242  1.00 31.11 ? 63   SER B OG  1 
ATOM   2248 N  N   . GLY B 2 64  ? -15.353 -27.945 19.679  1.00 31.93 ? 64   GLY B N   1 
ATOM   2249 C  CA  . GLY B 2 64  ? -14.713 -26.699 20.033  1.00 32.31 ? 64   GLY B CA  1 
ATOM   2250 C  C   . GLY B 2 64  ? -15.203 -25.581 19.151  1.00 32.55 ? 64   GLY B C   1 
ATOM   2251 O  O   . GLY B 2 64  ? -15.552 -25.793 17.987  1.00 32.94 ? 64   GLY B O   1 
ATOM   2252 N  N   . SER B 2 65  ? -15.220 -24.382 19.715  1.00 32.72 ? 65   SER B N   1 
ATOM   2253 C  CA  . SER B 2 65  ? -15.714 -23.204 19.031  1.00 32.78 ? 65   SER B CA  1 
ATOM   2254 C  C   . SER B 2 65  ? -14.932 -22.006 19.534  1.00 32.89 ? 65   SER B C   1 
ATOM   2255 O  O   . SER B 2 65  ? -14.366 -22.050 20.630  1.00 33.06 ? 65   SER B O   1 
ATOM   2256 C  CB  . SER B 2 65  ? -17.211 -23.054 19.297  1.00 32.69 ? 65   SER B CB  1 
ATOM   2257 O  OG  . SER B 2 65  ? -17.634 -21.718 19.152  1.00 33.51 ? 65   SER B OG  1 
ATOM   2258 N  N   . GLY B 2 66  ? -14.866 -20.950 18.732  1.00 33.06 ? 66   GLY B N   1 
ATOM   2259 C  CA  . GLY B 2 66  ? -14.175 -19.738 19.166  1.00 33.64 ? 66   GLY B CA  1 
ATOM   2260 C  C   . GLY B 2 66  ? -13.066 -19.230 18.262  1.00 34.04 ? 66   GLY B C   1 
ATOM   2261 O  O   . GLY B 2 66  ? -12.428 -19.998 17.523  1.00 34.27 ? 66   GLY B O   1 
ATOM   2262 N  N   . SER B 2 67  ? -12.823 -17.924 18.350  1.00 34.19 ? 67   SER B N   1 
ATOM   2263 C  CA  . SER B 2 67  ? -11.908 -17.230 17.461  1.00 34.34 ? 67   SER B CA  1 
ATOM   2264 C  C   . SER B 2 67  ? -11.489 -15.925 18.099  1.00 34.28 ? 67   SER B C   1 
ATOM   2265 O  O   . SER B 2 67  ? -12.303 -15.260 18.747  1.00 34.31 ? 67   SER B O   1 
ATOM   2266 C  CB  . SER B 2 67  ? -12.615 -16.907 16.149  1.00 34.55 ? 67   SER B CB  1 
ATOM   2267 O  OG  . SER B 2 67  ? -11.716 -16.292 15.250  1.00 35.39 ? 67   SER B OG  1 
ATOM   2268 N  N   . GLY B 2 68  ? -10.228 -15.558 17.898  1.00 33.91 ? 68   GLY B N   1 
ATOM   2269 C  CA  . GLY B 2 68  ? -9.677  -14.339 18.458  1.00 34.08 ? 68   GLY B CA  1 
ATOM   2270 C  C   . GLY B 2 68  ? -9.170  -14.475 19.885  1.00 34.51 ? 68   GLY B C   1 
ATOM   2271 O  O   . GLY B 2 68  ? -7.962  -14.605 20.117  1.00 34.62 ? 68   GLY B O   1 
ATOM   2272 N  N   . THR B 2 69  ? -10.086 -14.447 20.847  1.00 34.55 ? 69   THR B N   1 
ATOM   2273 C  CA  . THR B 2 69  ? -9.686  -14.340 22.241  1.00 34.82 ? 69   THR B CA  1 
ATOM   2274 C  C   . THR B 2 69  ? -10.471 -15.252 23.183  1.00 34.80 ? 69   THR B C   1 
ATOM   2275 O  O   . THR B 2 69  ? -9.886  -15.819 24.096  1.00 35.33 ? 69   THR B O   1 
ATOM   2276 C  CB  . THR B 2 69  ? -9.708  -12.836 22.716  1.00 35.06 ? 69   THR B CB  1 
ATOM   2277 O  OG1 . THR B 2 69  ? -8.412  -12.451 23.189  1.00 34.87 ? 69   THR B OG1 1 
ATOM   2278 C  CG2 . THR B 2 69  ? -10.756 -12.571 23.801  1.00 35.23 ? 69   THR B CG2 1 
ATOM   2279 N  N   . ASP B 2 70  ? -11.774 -15.401 22.956  1.00 34.69 ? 70   ASP B N   1 
ATOM   2280 C  CA  . ASP B 2 70  ? -12.623 -16.238 23.806  1.00 34.82 ? 70   ASP B CA  1 
ATOM   2281 C  C   . ASP B 2 70  ? -12.950 -17.545 23.098  1.00 34.22 ? 70   ASP B C   1 
ATOM   2282 O  O   . ASP B 2 70  ? -13.410 -17.541 21.953  1.00 34.14 ? 70   ASP B O   1 
ATOM   2283 C  CB  . ASP B 2 70  ? -13.925 -15.511 24.182  1.00 35.51 ? 70   ASP B CB  1 
ATOM   2284 C  CG  . ASP B 2 70  ? -13.683 -14.090 24.742  1.00 38.00 ? 70   ASP B CG  1 
ATOM   2285 O  OD1 . ASP B 2 70  ? -13.088 -13.950 25.841  1.00 39.33 ? 70   ASP B OD1 1 
ATOM   2286 O  OD2 . ASP B 2 70  ? -14.099 -13.107 24.076  1.00 40.19 ? 70   ASP B OD2 1 
ATOM   2287 N  N   . PHE B 2 71  ? -12.710 -18.660 23.792  1.00 33.59 ? 71   PHE B N   1 
ATOM   2288 C  CA  . PHE B 2 71  ? -12.909 -20.008 23.244  1.00 32.61 ? 71   PHE B CA  1 
ATOM   2289 C  C   . PHE B 2 71  ? -13.806 -20.879 24.114  1.00 32.57 ? 71   PHE B C   1 
ATOM   2290 O  O   . PHE B 2 71  ? -13.958 -20.625 25.310  1.00 32.45 ? 71   PHE B O   1 
ATOM   2291 C  CB  . PHE B 2 71  ? -11.562 -20.693 23.047  1.00 32.12 ? 71   PHE B CB  1 
ATOM   2292 C  CG  . PHE B 2 71  ? -10.692 -20.012 22.047  1.00 31.29 ? 71   PHE B CG  1 
ATOM   2293 C  CD1 . PHE B 2 71  ? -9.762  -19.063 22.452  1.00 30.29 ? 71   PHE B CD1 1 
ATOM   2294 C  CD2 . PHE B 2 71  ? -10.813 -20.303 20.691  1.00 30.82 ? 71   PHE B CD2 1 
ATOM   2295 C  CE1 . PHE B 2 71  ? -8.955  -18.406 21.526  1.00 30.74 ? 71   PHE B CE1 1 
ATOM   2296 C  CE2 . PHE B 2 71  ? -10.009 -19.655 19.753  1.00 31.53 ? 71   PHE B CE2 1 
ATOM   2297 C  CZ  . PHE B 2 71  ? -9.076  -18.697 20.174  1.00 31.06 ? 71   PHE B CZ  1 
ATOM   2298 N  N   . THR B 2 72  ? -14.390 -21.909 23.504  1.00 32.61 ? 72   THR B N   1 
ATOM   2299 C  CA  . THR B 2 72  ? -15.269 -22.840 24.214  1.00 32.93 ? 72   THR B CA  1 
ATOM   2300 C  C   . THR B 2 72  ? -15.051 -24.302 23.811  1.00 32.76 ? 72   THR B C   1 
ATOM   2301 O  O   . THR B 2 72  ? -14.977 -24.630 22.611  1.00 32.81 ? 72   THR B O   1 
ATOM   2302 C  CB  . THR B 2 72  ? -16.751 -22.491 23.979  1.00 33.07 ? 72   THR B CB  1 
ATOM   2303 O  OG1 . THR B 2 72  ? -16.961 -21.107 24.280  1.00 34.59 ? 72   THR B OG1 1 
ATOM   2304 C  CG2 . THR B 2 72  ? -17.663 -23.330 24.867  1.00 33.26 ? 72   THR B CG2 1 
ATOM   2305 N  N   . LEU B 2 73  ? -14.950 -25.164 24.825  1.00 32.11 ? 73   LEU B N   1 
ATOM   2306 C  CA  . LEU B 2 73  ? -15.036 -26.602 24.637  1.00 31.56 ? 73   LEU B CA  1 
ATOM   2307 C  C   . LEU B 2 73  ? -16.393 -27.072 25.141  1.00 31.90 ? 73   LEU B C   1 
ATOM   2308 O  O   . LEU B 2 73  ? -16.784 -26.777 26.270  1.00 32.23 ? 73   LEU B O   1 
ATOM   2309 C  CB  . LEU B 2 73  ? -13.909 -27.328 25.378  1.00 31.52 ? 73   LEU B CB  1 
ATOM   2310 C  CG  . LEU B 2 73  ? -13.950 -28.866 25.407  1.00 30.66 ? 73   LEU B CG  1 
ATOM   2311 C  CD1 . LEU B 2 73  ? -13.649 -29.444 24.046  1.00 28.92 ? 73   LEU B CD1 1 
ATOM   2312 C  CD2 . LEU B 2 73  ? -12.989 -29.433 26.443  1.00 30.77 ? 73   LEU B CD2 1 
ATOM   2313 N  N   . THR B 2 74  ? -17.109 -27.802 24.300  1.00 32.06 ? 74   THR B N   1 
ATOM   2314 C  CA  . THR B 2 74  ? -18.407 -28.335 24.666  1.00 32.32 ? 74   THR B CA  1 
ATOM   2315 C  C   . THR B 2 74  ? -18.398 -29.859 24.653  1.00 32.74 ? 74   THR B C   1 
ATOM   2316 O  O   . THR B 2 74  ? -17.997 -30.480 23.662  1.00 32.57 ? 74   THR B O   1 
ATOM   2317 C  CB  . THR B 2 74  ? -19.480 -27.821 23.703  1.00 32.38 ? 74   THR B CB  1 
ATOM   2318 O  OG1 . THR B 2 74  ? -19.568 -26.396 23.816  1.00 32.67 ? 74   THR B OG1 1 
ATOM   2319 C  CG2 . THR B 2 74  ? -20.840 -28.444 23.992  1.00 32.25 ? 74   THR B CG2 1 
ATOM   2320 N  N   . ILE B 2 75  ? -18.823 -30.459 25.761  1.00 33.14 ? 75   ILE B N   1 
ATOM   2321 C  CA  . ILE B 2 75  ? -19.184 -31.867 25.731  1.00 34.04 ? 75   ILE B CA  1 
ATOM   2322 C  C   . ILE B 2 75  ? -20.710 -31.956 25.680  1.00 34.79 ? 75   ILE B C   1 
ATOM   2323 O  O   . ILE B 2 75  ? -21.390 -31.506 26.598  1.00 35.39 ? 75   ILE B O   1 
ATOM   2324 C  CB  . ILE B 2 75  ? -18.610 -32.659 26.912  1.00 33.79 ? 75   ILE B CB  1 
ATOM   2325 C  CG1 . ILE B 2 75  ? -17.159 -32.237 27.172  1.00 33.51 ? 75   ILE B CG1 1 
ATOM   2326 C  CG2 . ILE B 2 75  ? -18.714 -34.148 26.608  1.00 33.53 ? 75   ILE B CG2 1 
ATOM   2327 C  CD1 . ILE B 2 75  ? -16.575 -32.699 28.505  1.00 33.01 ? 75   ILE B CD1 1 
ATOM   2328 N  N   . SER B 2 76  ? -21.238 -32.514 24.595  1.00 35.57 ? 76   SER B N   1 
ATOM   2329 C  CA  . SER B 2 76  ? -22.668 -32.366 24.274  1.00 36.32 ? 76   SER B CA  1 
ATOM   2330 C  C   . SER B 2 76  ? -23.574 -33.274 25.101  1.00 36.59 ? 76   SER B C   1 
ATOM   2331 O  O   . SER B 2 76  ? -24.691 -32.888 25.450  1.00 36.79 ? 76   SER B O   1 
ATOM   2332 C  CB  . SER B 2 76  ? -22.937 -32.565 22.769  1.00 36.10 ? 76   SER B CB  1 
ATOM   2333 O  OG  . SER B 2 76  ? -22.660 -33.898 22.367  1.00 35.96 ? 76   SER B OG  1 
ATOM   2334 N  N   . SER B 2 77  ? -23.088 -34.473 25.404  1.00 36.78 ? 77   SER B N   1 
ATOM   2335 C  CA  . SER B 2 77  ? -23.852 -35.444 26.164  1.00 37.03 ? 77   SER B CA  1 
ATOM   2336 C  C   . SER B 2 77  ? -22.864 -36.308 26.945  1.00 37.14 ? 77   SER B C   1 
ATOM   2337 O  O   . SER B 2 77  ? -22.367 -37.314 26.442  1.00 37.29 ? 77   SER B O   1 
ATOM   2338 C  CB  . SER B 2 77  ? -24.715 -36.267 25.207  1.00 37.22 ? 77   SER B CB  1 
ATOM   2339 O  OG  . SER B 2 77  ? -25.238 -37.433 25.815  1.00 38.38 ? 77   SER B OG  1 
ATOM   2340 N  N   . LEU B 2 78  ? -22.589 -35.880 28.176  1.00 37.34 ? 78   LEU B N   1 
ATOM   2341 C  CA  . LEU B 2 78  ? -21.501 -36.386 29.030  1.00 37.57 ? 78   LEU B CA  1 
ATOM   2342 C  C   . LEU B 2 78  ? -21.572 -37.891 29.359  1.00 37.74 ? 78   LEU B C   1 
ATOM   2343 O  O   . LEU B 2 78  ? -22.594 -38.376 29.836  1.00 37.96 ? 78   LEU B O   1 
ATOM   2344 C  CB  . LEU B 2 78  ? -21.498 -35.566 30.327  1.00 37.47 ? 78   LEU B CB  1 
ATOM   2345 C  CG  . LEU B 2 78  ? -20.190 -35.261 31.060  1.00 38.02 ? 78   LEU B CG  1 
ATOM   2346 C  CD1 . LEU B 2 78  ? -19.277 -34.409 30.223  1.00 37.82 ? 78   LEU B CD1 1 
ATOM   2347 C  CD2 . LEU B 2 78  ? -20.472 -34.561 32.377  1.00 37.79 ? 78   LEU B CD2 1 
ATOM   2348 N  N   . GLN B 2 79  ? -20.489 -38.623 29.099  1.00 37.72 ? 79   GLN B N   1 
ATOM   2349 C  CA  . GLN B 2 79  ? -20.417 -40.062 29.401  1.00 37.69 ? 79   GLN B CA  1 
ATOM   2350 C  C   . GLN B 2 79  ? -19.656 -40.293 30.705  1.00 37.35 ? 79   GLN B C   1 
ATOM   2351 O  O   . GLN B 2 79  ? -18.972 -39.386 31.180  1.00 37.42 ? 79   GLN B O   1 
ATOM   2352 C  CB  . GLN B 2 79  ? -19.740 -40.829 28.260  1.00 37.96 ? 79   GLN B CB  1 
ATOM   2353 C  CG  . GLN B 2 79  ? -20.364 -40.619 26.887  1.00 39.95 ? 79   GLN B CG  1 
ATOM   2354 C  CD  . GLN B 2 79  ? -21.853 -40.915 26.864  1.00 42.79 ? 79   GLN B CD  1 
ATOM   2355 O  OE1 . GLN B 2 79  ? -22.270 -42.065 27.048  1.00 45.12 ? 79   GLN B OE1 1 
ATOM   2356 N  NE2 . GLN B 2 79  ? -22.667 -39.879 26.643  1.00 41.76 ? 79   GLN B NE2 1 
ATOM   2357 N  N   . PRO B 2 80  ? -19.776 -41.498 31.303  1.00 37.09 ? 80   PRO B N   1 
ATOM   2358 C  CA  . PRO B 2 80  ? -19.061 -41.754 32.559  1.00 36.60 ? 80   PRO B CA  1 
ATOM   2359 C  C   . PRO B 2 80  ? -17.556 -41.495 32.469  1.00 36.33 ? 80   PRO B C   1 
ATOM   2360 O  O   . PRO B 2 80  ? -16.961 -41.015 33.442  1.00 36.22 ? 80   PRO B O   1 
ATOM   2361 C  CB  . PRO B 2 80  ? -19.338 -43.239 32.828  1.00 36.40 ? 80   PRO B CB  1 
ATOM   2362 C  CG  . PRO B 2 80  ? -20.603 -43.517 32.123  1.00 36.57 ? 80   PRO B CG  1 
ATOM   2363 C  CD  . PRO B 2 80  ? -20.588 -42.664 30.895  1.00 37.17 ? 80   PRO B CD  1 
ATOM   2364 N  N   . GLU B 2 81  ? -16.951 -41.787 31.315  1.00 35.79 ? 81   GLU B N   1 
ATOM   2365 C  CA  . GLU B 2 81  ? -15.508 -41.591 31.152  1.00 35.56 ? 81   GLU B CA  1 
ATOM   2366 C  C   . GLU B 2 81  ? -15.075 -40.161 30.739  1.00 34.78 ? 81   GLU B C   1 
ATOM   2367 O  O   . GLU B 2 81  ? -13.896 -39.921 30.471  1.00 35.06 ? 81   GLU B O   1 
ATOM   2368 C  CB  . GLU B 2 81  ? -14.909 -42.655 30.222  1.00 36.01 ? 81   GLU B CB  1 
ATOM   2369 C  CG  . GLU B 2 81  ? -15.187 -42.449 28.732  1.00 38.00 ? 81   GLU B CG  1 
ATOM   2370 C  CD  . GLU B 2 81  ? -16.515 -43.046 28.274  1.00 41.57 ? 81   GLU B CD  1 
ATOM   2371 O  OE1 . GLU B 2 81  ? -17.466 -43.173 29.101  1.00 41.35 ? 81   GLU B OE1 1 
ATOM   2372 O  OE2 . GLU B 2 81  ? -16.596 -43.382 27.064  1.00 42.93 ? 81   GLU B OE2 1 
ATOM   2373 N  N   . ASP B 2 82  ? -16.017 -39.220 30.705  1.00 33.52 ? 82   ASP B N   1 
ATOM   2374 C  CA  . ASP B 2 82  ? -15.706 -37.825 30.421  1.00 32.36 ? 82   ASP B CA  1 
ATOM   2375 C  C   . ASP B 2 82  ? -15.416 -37.019 31.673  1.00 31.91 ? 82   ASP B C   1 
ATOM   2376 O  O   . ASP B 2 82  ? -15.076 -35.838 31.587  1.00 32.21 ? 82   ASP B O   1 
ATOM   2377 C  CB  . ASP B 2 82  ? -16.849 -37.175 29.656  1.00 32.16 ? 82   ASP B CB  1 
ATOM   2378 C  CG  . ASP B 2 82  ? -17.069 -37.814 28.330  1.00 32.40 ? 82   ASP B CG  1 
ATOM   2379 O  OD1 . ASP B 2 82  ? -16.181 -38.578 27.906  1.00 33.16 ? 82   ASP B OD1 1 
ATOM   2380 O  OD2 . ASP B 2 82  ? -18.126 -37.581 27.709  1.00 33.28 ? 82   ASP B OD2 1 
ATOM   2381 N  N   . PHE B 2 83  ? -15.574 -37.634 32.838  1.00 30.95 ? 83   PHE B N   1 
ATOM   2382 C  CA  . PHE B 2 83  ? -15.248 -36.958 34.086  1.00 30.11 ? 83   PHE B CA  1 
ATOM   2383 C  C   . PHE B 2 83  ? -13.752 -36.980 34.271  1.00 29.24 ? 83   PHE B C   1 
ATOM   2384 O  O   . PHE B 2 83  ? -13.166 -38.033 34.490  1.00 29.19 ? 83   PHE B O   1 
ATOM   2385 C  CB  . PHE B 2 83  ? -15.965 -37.608 35.272  1.00 30.40 ? 83   PHE B CB  1 
ATOM   2386 C  CG  . PHE B 2 83  ? -17.452 -37.478 35.204  1.00 30.31 ? 83   PHE B CG  1 
ATOM   2387 C  CD1 . PHE B 2 83  ? -18.064 -36.249 35.446  1.00 30.55 ? 83   PHE B CD1 1 
ATOM   2388 C  CD2 . PHE B 2 83  ? -18.240 -38.567 34.862  1.00 29.48 ? 83   PHE B CD2 1 
ATOM   2389 C  CE1 . PHE B 2 83  ? -19.447 -36.112 35.360  1.00 31.11 ? 83   PHE B CE1 1 
ATOM   2390 C  CE2 . PHE B 2 83  ? -19.616 -38.437 34.773  1.00 30.17 ? 83   PHE B CE2 1 
ATOM   2391 C  CZ  . PHE B 2 83  ? -20.224 -37.207 35.023  1.00 29.91 ? 83   PHE B CZ  1 
ATOM   2392 N  N   . ALA B 2 84  ? -13.141 -35.808 34.156  1.00 28.31 ? 84   ALA B N   1 
ATOM   2393 C  CA  . ALA B 2 84  ? -11.689 -35.684 34.172  1.00 27.66 ? 84   ALA B CA  1 
ATOM   2394 C  C   . ALA B 2 84  ? -11.315 -34.219 34.237  1.00 26.93 ? 84   ALA B C   1 
ATOM   2395 O  O   . ALA B 2 84  ? -12.193 -33.364 34.323  1.00 26.78 ? 84   ALA B O   1 
ATOM   2396 C  CB  . ALA B 2 84  ? -11.086 -36.339 32.922  1.00 27.85 ? 84   ALA B CB  1 
ATOM   2397 N  N   . VAL B 2 85  ? -10.021 -33.923 34.197  1.00 26.24 ? 85   VAL B N   1 
ATOM   2398 C  CA  . VAL B 2 85  ? -9.586  -32.528 34.069  1.00 25.92 ? 85   VAL B CA  1 
ATOM   2399 C  C   . VAL B 2 85  ? -9.376  -32.167 32.591  1.00 25.81 ? 85   VAL B C   1 
ATOM   2400 O  O   . VAL B 2 85  ? -8.892  -32.984 31.801  1.00 25.43 ? 85   VAL B O   1 
ATOM   2401 C  CB  . VAL B 2 85  ? -8.324  -32.210 34.921  1.00 25.75 ? 85   VAL B CB  1 
ATOM   2402 C  CG1 . VAL B 2 85  ? -8.089  -30.724 34.991  1.00 25.75 ? 85   VAL B CG1 1 
ATOM   2403 C  CG2 . VAL B 2 85  ? -8.472  -32.762 36.337  1.00 25.41 ? 85   VAL B CG2 1 
ATOM   2404 N  N   . TYR B 2 86  ? -9.778  -30.951 32.222  1.00 25.86 ? 86   TYR B N   1 
ATOM   2405 C  CA  . TYR B 2 86  ? -9.582  -30.445 30.860  1.00 25.86 ? 86   TYR B CA  1 
ATOM   2406 C  C   . TYR B 2 86  ? -8.688  -29.210 30.856  1.00 26.00 ? 86   TYR B C   1 
ATOM   2407 O  O   . TYR B 2 86  ? -8.825  -28.333 31.721  1.00 26.21 ? 86   TYR B O   1 
ATOM   2408 C  CB  . TYR B 2 86  ? -10.925 -30.178 30.183  1.00 25.66 ? 86   TYR B CB  1 
ATOM   2409 C  CG  . TYR B 2 86  ? -11.732 -31.448 30.004  1.00 26.55 ? 86   TYR B CG  1 
ATOM   2410 C  CD1 . TYR B 2 86  ? -12.456 -32.005 31.077  1.00 27.02 ? 86   TYR B CD1 1 
ATOM   2411 C  CD2 . TYR B 2 86  ? -11.754 -32.117 28.775  1.00 26.48 ? 86   TYR B CD2 1 
ATOM   2412 C  CE1 . TYR B 2 86  ? -13.187 -33.191 30.932  1.00 26.88 ? 86   TYR B CE1 1 
ATOM   2413 C  CE2 . TYR B 2 86  ? -12.480 -33.302 28.615  1.00 26.94 ? 86   TYR B CE2 1 
ATOM   2414 C  CZ  . TYR B 2 86  ? -13.196 -33.836 29.698  1.00 27.18 ? 86   TYR B CZ  1 
ATOM   2415 O  OH  . TYR B 2 86  ? -13.920 -35.004 29.538  1.00 26.27 ? 86   TYR B OH  1 
ATOM   2416 N  N   . TYR B 2 87  ? -7.761  -29.160 29.896  1.00 25.80 ? 87   TYR B N   1 
ATOM   2417 C  CA  . TYR B 2 87  ? -6.857  -28.024 29.719  1.00 25.42 ? 87   TYR B CA  1 
ATOM   2418 C  C   . TYR B 2 87  ? -6.936  -27.454 28.308  1.00 25.34 ? 87   TYR B C   1 
ATOM   2419 O  O   . TYR B 2 87  ? -6.970  -28.212 27.332  1.00 25.36 ? 87   TYR B O   1 
ATOM   2420 C  CB  . TYR B 2 87  ? -5.423  -28.463 29.930  1.00 25.51 ? 87   TYR B CB  1 
ATOM   2421 C  CG  . TYR B 2 87  ? -5.040  -28.798 31.342  1.00 26.35 ? 87   TYR B CG  1 
ATOM   2422 C  CD1 . TYR B 2 87  ? -4.708  -27.793 32.253  1.00 26.40 ? 87   TYR B CD1 1 
ATOM   2423 C  CD2 . TYR B 2 87  ? -4.965  -30.128 31.761  1.00 26.51 ? 87   TYR B CD2 1 
ATOM   2424 C  CE1 . TYR B 2 87  ? -4.335  -28.103 33.546  1.00 26.82 ? 87   TYR B CE1 1 
ATOM   2425 C  CE2 . TYR B 2 87  ? -4.592  -30.449 33.055  1.00 26.26 ? 87   TYR B CE2 1 
ATOM   2426 C  CZ  . TYR B 2 87  ? -4.279  -29.437 33.940  1.00 26.46 ? 87   TYR B CZ  1 
ATOM   2427 O  OH  . TYR B 2 87  ? -3.901  -29.759 35.217  1.00 26.27 ? 87   TYR B OH  1 
ATOM   2428 N  N   . CYS B 2 88  ? -6.947  -26.124 28.200  1.00 24.90 ? 88   CYS B N   1 
ATOM   2429 C  CA  . CYS B 2 88  ? -6.725  -25.457 26.922  1.00 24.46 ? 88   CYS B CA  1 
ATOM   2430 C  C   . CYS B 2 88  ? -5.242  -25.097 26.775  1.00 23.41 ? 88   CYS B C   1 
ATOM   2431 O  O   . CYS B 2 88  ? -4.581  -24.817 27.771  1.00 23.29 ? 88   CYS B O   1 
ATOM   2432 C  CB  . CYS B 2 88  ? -7.591  -24.204 26.811  1.00 24.90 ? 88   CYS B CB  1 
ATOM   2433 S  SG  . CYS B 2 88  ? -7.166  -22.850 27.942  1.00 28.05 ? 88   CYS B SG  1 
ATOM   2434 N  N   . GLN B 2 89  ? -4.706  -25.126 25.552  1.00 22.05 ? 89   GLN B N   1 
ATOM   2435 C  CA  . GLN B 2 89  ? -3.368  -24.560 25.323  1.00 20.99 ? 89   GLN B CA  1 
ATOM   2436 C  C   . GLN B 2 89  ? -3.233  -23.834 24.001  1.00 20.45 ? 89   GLN B C   1 
ATOM   2437 O  O   . GLN B 2 89  ? -3.715  -24.309 22.965  1.00 19.95 ? 89   GLN B O   1 
ATOM   2438 C  CB  . GLN B 2 89  ? -2.226  -25.569 25.524  1.00 20.93 ? 89   GLN B CB  1 
ATOM   2439 C  CG  . GLN B 2 89  ? -2.176  -26.718 24.557  1.00 21.00 ? 89   GLN B CG  1 
ATOM   2440 C  CD  . GLN B 2 89  ? -1.084  -26.610 23.516  1.00 20.70 ? 89   GLN B CD  1 
ATOM   2441 O  OE1 . GLN B 2 89  ? -0.314  -25.665 23.486  1.00 22.03 ? 89   GLN B OE1 1 
ATOM   2442 N  NE2 . GLN B 2 89  ? -1.012  -27.596 22.662  1.00 20.84 ? 89   GLN B NE2 1 
ATOM   2443 N  N   . GLN B 2 90  ? -2.605  -22.658 24.057  1.00 19.51 ? 90   GLN B N   1 
ATOM   2444 C  CA  . GLN B 2 90  ? -2.372  -21.900 22.846  1.00 19.07 ? 90   GLN B CA  1 
ATOM   2445 C  C   . GLN B 2 90  ? -1.021  -22.290 22.263  1.00 18.64 ? 90   GLN B C   1 
ATOM   2446 O  O   . GLN B 2 90  ? -0.091  -22.619 23.002  1.00 18.28 ? 90   GLN B O   1 
ATOM   2447 C  CB  . GLN B 2 90  ? -2.547  -20.384 23.038  1.00 18.57 ? 90   GLN B CB  1 
ATOM   2448 C  CG  . GLN B 2 90  ? -1.506  -19.687 23.894  1.00 17.92 ? 90   GLN B CG  1 
ATOM   2449 C  CD  . GLN B 2 90  ? -0.164  -19.548 23.215  1.00 17.66 ? 90   GLN B CD  1 
ATOM   2450 O  OE1 . GLN B 2 90  ? -0.094  -19.369 21.992  1.00 17.37 ? 90   GLN B OE1 1 
ATOM   2451 N  NE2 . GLN B 2 90  ? 0.924   -19.641 24.006  1.00 16.31 ? 90   GLN B NE2 1 
ATOM   2452 N  N   . PHE B 2 91  ? -0.957  -22.276 20.933  1.00 18.59 ? 91   PHE B N   1 
ATOM   2453 C  CA  . PHE B 2 91  ? 0.261   -22.571 20.168  1.00 18.50 ? 91   PHE B CA  1 
ATOM   2454 C  C   . PHE B 2 91  ? 0.542   -21.502 19.107  1.00 18.92 ? 91   PHE B C   1 
ATOM   2455 O  O   . PHE B 2 91  ? 1.023   -21.802 18.009  1.00 18.46 ? 91   PHE B O   1 
ATOM   2456 C  CB  . PHE B 2 91  ? 0.193   -23.965 19.531  1.00 17.92 ? 91   PHE B CB  1 
ATOM   2457 C  CG  . PHE B 2 91  ? -0.915  -24.141 18.519  1.00 16.89 ? 91   PHE B CG  1 
ATOM   2458 C  CD1 . PHE B 2 91  ? -2.227  -24.393 18.935  1.00 15.52 ? 91   PHE B CD1 1 
ATOM   2459 C  CD2 . PHE B 2 91  ? -0.630  -24.118 17.149  1.00 15.52 ? 91   PHE B CD2 1 
ATOM   2460 C  CE1 . PHE B 2 91  ? -3.235  -24.595 18.010  1.00 15.69 ? 91   PHE B CE1 1 
ATOM   2461 C  CE2 . PHE B 2 91  ? -1.627  -24.306 16.206  1.00 14.69 ? 91   PHE B CE2 1 
ATOM   2462 C  CZ  . PHE B 2 91  ? -2.938  -24.544 16.625  1.00 16.42 ? 91   PHE B CZ  1 
ATOM   2463 N  N   . ASP B 2 92  ? 0.244   -20.253 19.464  1.00 19.57 ? 92   ASP B N   1 
ATOM   2464 C  CA  . ASP B 2 92  ? 0.426   -19.138 18.569  1.00 20.23 ? 92   ASP B CA  1 
ATOM   2465 C  C   . ASP B 2 92  ? 1.875   -18.673 18.343  1.00 20.13 ? 92   ASP B C   1 
ATOM   2466 O  O   . ASP B 2 92  ? 2.313   -18.689 17.193  1.00 21.01 ? 92   ASP B O   1 
ATOM   2467 C  CB  . ASP B 2 92  ? -0.462  -17.963 18.959  1.00 21.08 ? 92   ASP B CB  1 
ATOM   2468 C  CG  . ASP B 2 92  ? -0.363  -16.815 17.963  1.00 22.54 ? 92   ASP B CG  1 
ATOM   2469 O  OD1 . ASP B 2 92  ? -0.580  -17.068 16.751  1.00 23.98 ? 92   ASP B OD1 1 
ATOM   2470 O  OD2 . ASP B 2 92  ? -0.045  -15.682 18.391  1.00 22.92 ? 92   ASP B OD2 1 
ATOM   2471 N  N   . GLY B 2 93  ? 2.667   -18.358 19.367  1.00 19.50 ? 93   GLY B N   1 
ATOM   2472 C  CA  . GLY B 2 93  ? 2.567   -18.890 20.701  1.00 20.01 ? 93   GLY B CA  1 
ATOM   2473 C  C   . GLY B 2 93  ? 3.939   -18.955 21.379  1.00 20.56 ? 93   GLY B C   1 
ATOM   2474 O  O   . GLY B 2 93  ? 4.485   -17.902 21.776  1.00 21.74 ? 93   GLY B O   1 
ATOM   2475 N  N   . ASP B 2 94  ? 4.530   -20.155 21.450  1.00 19.56 ? 94   ASP B N   1 
ATOM   2476 C  CA  . ASP B 2 94  ? 5.440   -20.575 22.558  1.00 19.28 ? 94   ASP B CA  1 
ATOM   2477 C  C   . ASP B 2 94  ? 4.446   -21.067 23.597  1.00 19.65 ? 94   ASP B C   1 
ATOM   2478 O  O   . ASP B 2 94  ? 3.801   -20.269 24.301  1.00 19.49 ? 94   ASP B O   1 
ATOM   2479 C  CB  . ASP B 2 94  ? 6.375   -19.497 23.129  1.00 18.48 ? 94   ASP B CB  1 
ATOM   2480 C  CG  . ASP B 2 94  ? 7.886   -19.807 22.904  1.00 19.01 ? 94   ASP B CG  1 
ATOM   2481 O  OD1 . ASP B 2 94  ? 8.301   -20.253 21.812  1.00 17.49 ? 94   ASP B OD1 1 
ATOM   2482 O  OD2 . ASP B 2 94  ? 8.695   -19.560 23.826  1.00 18.58 ? 94   ASP B OD2 1 
ATOM   2483 N  N   . PRO B 2 95  ? 4.254   -22.394 23.637  1.00 19.75 ? 95   PRO B N   1 
ATOM   2484 C  CA  . PRO B 2 95  ? 2.993   -22.903 24.147  1.00 19.87 ? 95   PRO B CA  1 
ATOM   2485 C  C   . PRO B 2 95  ? 2.786   -22.624 25.619  1.00 20.10 ? 95   PRO B C   1 
ATOM   2486 O  O   . PRO B 2 95  ? 3.752   -22.546 26.387  1.00 20.14 ? 95   PRO B O   1 
ATOM   2487 C  CB  . PRO B 2 95  ? 3.061   -24.393 23.842  1.00 19.88 ? 95   PRO B CB  1 
ATOM   2488 C  CG  . PRO B 2 95  ? 4.495   -24.678 23.676  1.00 19.88 ? 95   PRO B CG  1 
ATOM   2489 C  CD  . PRO B 2 95  ? 5.158   -23.465 23.197  1.00 19.31 ? 95   PRO B CD  1 
ATOM   2490 N  N   . THR B 2 96  ? 1.510   -22.466 25.973  1.00 20.13 ? 96   THR B N   1 
ATOM   2491 C  CA  . THR B 2 96  ? 1.071   -21.965 27.268  1.00 19.90 ? 96   THR B CA  1 
ATOM   2492 C  C   . THR B 2 96  ? -0.309  -22.544 27.568  1.00 19.96 ? 96   THR B C   1 
ATOM   2493 O  O   . THR B 2 96  ? -1.140  -22.636 26.670  1.00 20.17 ? 96   THR B O   1 
ATOM   2494 C  CB  . THR B 2 96  ? 1.063   -20.433 27.221  1.00 19.70 ? 96   THR B CB  1 
ATOM   2495 O  OG1 . THR B 2 96  ? 2.091   -19.943 28.075  1.00 19.58 ? 96   THR B OG1 1 
ATOM   2496 C  CG2 . THR B 2 96  ? -0.214  -19.873 27.667  1.00 20.14 ? 96   THR B CG2 1 
ATOM   2497 N  N   . PHE B 2 97  ? -0.556  -22.942 28.812  1.00 20.05 ? 97   PHE B N   1 
ATOM   2498 C  CA  . PHE B 2 97  ? -1.779  -23.673 29.144  1.00 20.30 ? 97   PHE B CA  1 
ATOM   2499 C  C   . PHE B 2 97  ? -2.723  -22.907 30.075  1.00 21.06 ? 97   PHE B C   1 
ATOM   2500 O  O   . PHE B 2 97  ? -2.292  -22.041 30.837  1.00 21.48 ? 97   PHE B O   1 
ATOM   2501 C  CB  . PHE B 2 97  ? -1.419  -24.984 29.833  1.00 20.16 ? 97   PHE B CB  1 
ATOM   2502 C  CG  . PHE B 2 97  ? -0.670  -25.975 28.969  1.00 19.45 ? 97   PHE B CG  1 
ATOM   2503 C  CD1 . PHE B 2 97  ? -1.336  -27.063 28.407  1.00 17.50 ? 97   PHE B CD1 1 
ATOM   2504 C  CD2 . PHE B 2 97  ? 0.710   -25.855 28.768  1.00 19.14 ? 97   PHE B CD2 1 
ATOM   2505 C  CE1 . PHE B 2 97  ? -0.645  -28.000 27.627  1.00 18.50 ? 97   PHE B CE1 1 
ATOM   2506 C  CE2 . PHE B 2 97  ? 1.418   -26.798 27.990  1.00 19.10 ? 97   PHE B CE2 1 
ATOM   2507 C  CZ  . PHE B 2 97  ? 0.743   -27.868 27.421  1.00 18.37 ? 97   PHE B CZ  1 
ATOM   2508 N  N   . GLY B 2 98  ? -4.011  -23.239 30.033  1.00 21.72 ? 98   GLY B N   1 
ATOM   2509 C  CA  . GLY B 2 98  ? -4.958  -22.774 31.056  1.00 22.47 ? 98   GLY B CA  1 
ATOM   2510 C  C   . GLY B 2 98  ? -4.681  -23.531 32.350  1.00 22.92 ? 98   GLY B C   1 
ATOM   2511 O  O   . GLY B 2 98  ? -3.987  -24.559 32.324  1.00 23.29 ? 98   GLY B O   1 
ATOM   2512 N  N   A GLN B 2 99  ? -5.174  -23.038 33.493  0.50 23.03 ? 99   GLN B N   1 
ATOM   2513 N  N   B GLN B 2 99  ? -5.248  -23.023 33.440  0.50 23.10 ? 99   GLN B N   1 
ATOM   2514 C  CA  A GLN B 2 99  ? -4.951  -23.729 34.789  0.50 23.28 ? 99   GLN B CA  1 
ATOM   2515 C  CA  B GLN B 2 99  ? -5.093  -23.571 34.783  0.50 23.37 ? 99   GLN B CA  1 
ATOM   2516 C  C   A GLN B 2 99  ? -6.015  -24.791 35.125  0.50 23.86 ? 99   GLN B C   1 
ATOM   2517 C  C   B GLN B 2 99  ? -5.710  -24.973 34.909  0.50 23.93 ? 99   GLN B C   1 
ATOM   2518 O  O   A GLN B 2 99  ? -6.182  -25.176 36.281  0.50 23.86 ? 99   GLN B O   1 
ATOM   2519 O  O   B GLN B 2 99  ? -5.241  -25.789 35.702  0.50 23.94 ? 99   GLN B O   1 
ATOM   2520 C  CB  A GLN B 2 99  ? -4.777  -22.753 35.967  0.50 22.88 ? 99   GLN B CB  1 
ATOM   2521 C  CB  B GLN B 2 99  ? -5.736  -22.620 35.800  0.50 23.14 ? 99   GLN B CB  1 
ATOM   2522 C  CG  A GLN B 2 99  ? -3.486  -21.908 35.980  0.50 22.67 ? 99   GLN B CG  1 
ATOM   2523 C  CG  B GLN B 2 99  ? -5.125  -21.202 35.871  0.50 22.77 ? 99   GLN B CG  1 
ATOM   2524 C  CD  A GLN B 2 99  ? -2.185  -22.715 35.977  0.50 21.71 ? 99   GLN B CD  1 
ATOM   2525 C  CD  B GLN B 2 99  ? -5.385  -20.323 34.638  0.50 21.43 ? 99   GLN B CD  1 
ATOM   2526 O  OE1 A GLN B 2 99  ? -1.321  -22.501 35.122  0.50 20.95 ? 99   GLN B OE1 1 
ATOM   2527 O  OE1 B GLN B 2 99  ? -6.328  -20.541 33.879  0.50 20.94 ? 99   GLN B OE1 1 
ATOM   2528 N  NE2 A GLN B 2 99  ? -2.038  -23.632 36.932  0.50 20.94 ? 99   GLN B NE2 1 
ATOM   2529 N  NE2 B GLN B 2 99  ? -4.535  -19.325 34.443  0.50 20.97 ? 99   GLN B NE2 1 
ATOM   2530 N  N   . GLY B 2 100 ? -6.744  -25.243 34.110  1.00 24.27 ? 100  GLY B N   1 
ATOM   2531 C  CA  . GLY B 2 100 ? -7.518  -26.477 34.202  1.00 25.63 ? 100  GLY B CA  1 
ATOM   2532 C  C   . GLY B 2 100 ? -8.962  -26.316 34.623  1.00 27.01 ? 100  GLY B C   1 
ATOM   2533 O  O   . GLY B 2 100 ? -9.333  -25.313 35.234  1.00 27.48 ? 100  GLY B O   1 
ATOM   2534 N  N   . THR B 2 101 ? -9.780  -27.313 34.296  1.00 28.02 ? 101  THR B N   1 
ATOM   2535 C  CA  . THR B 2 101 ? -11.156 -27.392 34.782  1.00 29.23 ? 101  THR B CA  1 
ATOM   2536 C  C   . THR B 2 101 ? -11.467 -28.847 35.101  1.00 30.28 ? 101  THR B C   1 
ATOM   2537 O  O   . THR B 2 101 ? -11.227 -29.741 34.274  1.00 30.53 ? 101  THR B O   1 
ATOM   2538 C  CB  . THR B 2 101 ? -12.157 -26.833 33.752  1.00 29.13 ? 101  THR B CB  1 
ATOM   2539 O  OG1 . THR B 2 101 ? -11.850 -25.458 33.503  1.00 29.82 ? 101  THR B OG1 1 
ATOM   2540 C  CG2 . THR B 2 101 ? -13.588 -26.926 34.254  1.00 29.00 ? 101  THR B CG2 1 
ATOM   2541 N  N   . LYS B 2 102 ? -11.973 -29.078 36.312  1.00 31.32 ? 102  LYS B N   1 
ATOM   2542 C  CA  . LYS B 2 102 ? -12.326 -30.413 36.774  1.00 32.40 ? 102  LYS B CA  1 
ATOM   2543 C  C   . LYS B 2 102 ? -13.809 -30.628 36.557  1.00 33.04 ? 102  LYS B C   1 
ATOM   2544 O  O   . LYS B 2 102 ? -14.637 -29.838 37.034  1.00 32.87 ? 102  LYS B O   1 
ATOM   2545 C  CB  . LYS B 2 102 ? -11.984 -30.567 38.249  1.00 32.50 ? 102  LYS B CB  1 
ATOM   2546 C  CG  . LYS B 2 102 ? -11.879 -31.995 38.726  1.00 34.03 ? 102  LYS B CG  1 
ATOM   2547 C  CD  . LYS B 2 102 ? -11.363 -32.031 40.165  1.00 36.90 ? 102  LYS B CD  1 
ATOM   2548 C  CE  . LYS B 2 102 ? -10.854 -33.421 40.564  1.00 38.39 ? 102  LYS B CE  1 
ATOM   2549 N  NZ  . LYS B 2 102 ? -10.570 -33.523 42.043  1.00 39.48 ? 102  LYS B NZ  1 
ATOM   2550 N  N   . VAL B 2 103 ? -14.131 -31.682 35.810  1.00 34.05 ? 103  VAL B N   1 
ATOM   2551 C  CA  . VAL B 2 103 ? -15.509 -32.059 35.537  1.00 35.32 ? 103  VAL B CA  1 
ATOM   2552 C  C   . VAL B 2 103 ? -15.827 -33.190 36.496  1.00 36.70 ? 103  VAL B C   1 
ATOM   2553 O  O   . VAL B 2 103 ? -15.283 -34.294 36.376  1.00 36.76 ? 103  VAL B O   1 
ATOM   2554 C  CB  . VAL B 2 103 ? -15.720 -32.476 34.050  1.00 35.22 ? 103  VAL B CB  1 
ATOM   2555 C  CG1 . VAL B 2 103 ? -17.126 -32.985 33.811  1.00 35.13 ? 103  VAL B CG1 1 
ATOM   2556 C  CG2 . VAL B 2 103 ? -15.449 -31.312 33.118  1.00 34.85 ? 103  VAL B CG2 1 
ATOM   2557 N  N   . GLU B 2 104 ? -16.688 -32.889 37.469  1.00 38.43 ? 104  GLU B N   1 
ATOM   2558 C  CA  . GLU B 2 104 ? -17.030 -33.818 38.553  1.00 40.18 ? 104  GLU B CA  1 
ATOM   2559 C  C   . GLU B 2 104 ? -18.488 -34.267 38.482  1.00 40.33 ? 104  GLU B C   1 
ATOM   2560 O  O   . GLU B 2 104 ? -19.313 -33.615 37.834  1.00 40.57 ? 104  GLU B O   1 
ATOM   2561 C  CB  . GLU B 2 104 ? -16.681 -33.209 39.914  1.00 39.83 ? 104  GLU B CB  1 
ATOM   2562 C  CG  . GLU B 2 104 ? -15.173 -33.259 40.185  1.00 41.89 ? 104  GLU B CG  1 
ATOM   2563 C  CD  . GLU B 2 104 ? -14.710 -32.519 41.458  1.00 42.61 ? 104  GLU B CD  1 
ATOM   2564 O  OE1 . GLU B 2 104 ? -15.136 -31.351 41.697  1.00 44.65 ? 104  GLU B OE1 1 
ATOM   2565 O  OE2 . GLU B 2 104 ? -13.883 -33.112 42.209  1.00 45.30 ? 104  GLU B OE2 1 
ATOM   2566 N  N   . ILE B 2 105 ? -18.783 -35.400 39.122  1.00 41.01 ? 105  ILE B N   1 
ATOM   2567 C  CA  . ILE B 2 105 ? -20.106 -36.028 39.065  1.00 41.54 ? 105  ILE B CA  1 
ATOM   2568 C  C   . ILE B 2 105 ? -21.081 -35.331 40.011  1.00 42.10 ? 105  ILE B C   1 
ATOM   2569 O  O   . ILE B 2 105 ? -20.814 -35.179 41.200  1.00 41.77 ? 105  ILE B O   1 
ATOM   2570 C  CB  . ILE B 2 105 ? -20.050 -37.557 39.383  1.00 41.58 ? 105  ILE B CB  1 
ATOM   2571 C  CG1 . ILE B 2 105 ? -19.060 -38.279 38.459  1.00 41.19 ? 105  ILE B CG1 1 
ATOM   2572 C  CG2 . ILE B 2 105 ? -21.444 -38.189 39.279  1.00 41.36 ? 105  ILE B CG2 1 
ATOM   2573 C  CD1 . ILE B 2 105 ? -18.745 -39.716 38.876  1.00 41.25 ? 105  ILE B CD1 1 
ATOM   2574 N  N   . LYS B 2 106 ? -22.204 -34.891 39.456  1.00 43.12 ? 106  LYS B N   1 
ATOM   2575 C  CA  . LYS B 2 106 ? -23.265 -34.273 40.239  1.00 44.32 ? 106  LYS B CA  1 
ATOM   2576 C  C   . LYS B 2 106 ? -23.921 -35.306 41.163  1.00 44.66 ? 106  LYS B C   1 
ATOM   2577 O  O   . LYS B 2 106 ? -23.980 -36.503 40.855  1.00 44.77 ? 106  LYS B O   1 
ATOM   2578 C  CB  . LYS B 2 106 ? -24.296 -33.626 39.313  1.00 44.56 ? 106  LYS B CB  1 
ATOM   2579 C  CG  . LYS B 2 106 ? -25.523 -33.055 40.001  1.00 46.33 ? 106  LYS B CG  1 
ATOM   2580 C  CD  . LYS B 2 106 ? -25.314 -31.638 40.488  1.00 49.00 ? 106  LYS B CD  1 
ATOM   2581 C  CE  . LYS B 2 106 ? -26.671 -30.977 40.737  1.00 51.17 ? 106  LYS B CE  1 
ATOM   2582 N  NZ  . LYS B 2 106 ? -26.615 -29.475 40.726  1.00 52.78 ? 106  LYS B NZ  1 
ATOM   2583 N  N   . ARG B 2 107 ? -24.404 -34.816 42.298  1.00 45.06 ? 107  ARG B N   1 
ATOM   2584 C  CA  . ARG B 2 107 ? -24.873 -35.637 43.404  1.00 45.24 ? 107  ARG B CA  1 
ATOM   2585 C  C   . ARG B 2 107 ? -25.083 -34.714 44.604  1.00 45.30 ? 107  ARG B C   1 
ATOM   2586 O  O   . ARG B 2 107 ? -25.840 -33.740 44.552  1.00 45.25 ? 107  ARG B O   1 
ATOM   2587 C  CB  . ARG B 2 107 ? -23.821 -36.675 43.776  1.00 45.25 ? 107  ARG B CB  1 
ATOM   2588 C  CG  . ARG B 2 107 ? -24.301 -37.686 44.756  1.00 45.56 ? 107  ARG B CG  1 
ATOM   2589 C  CD  . ARG B 2 107 ? -23.308 -37.867 45.878  1.00 45.57 ? 107  ARG B CD  1 
ATOM   2590 N  NE  . ARG B 2 107 ? -23.457 -39.199 46.463  1.00 45.57 ? 107  ARG B NE  1 
ATOM   2591 C  CZ  . ARG B 2 107 ? -24.370 -39.535 47.366  1.00 44.39 ? 107  ARG B CZ  1 
ATOM   2592 N  NH1 . ARG B 2 107 ? -25.237 -38.641 47.819  1.00 44.33 ? 107  ARG B NH1 1 
ATOM   2593 N  NH2 . ARG B 2 107 ? -24.415 -40.779 47.811  1.00 45.17 ? 107  ARG B NH2 1 
ATOM   2594 N  N   . THR C 3 1   ? -26.953 -36.067 45.139  1.00 43.96 ? 108  THR C N   1 
ATOM   2595 C  CA  . THR C 3 1   ? -27.535 -35.461 46.377  1.00 44.10 ? 108  THR C CA  1 
ATOM   2596 C  C   . THR C 3 1   ? -26.439 -35.133 47.417  1.00 43.95 ? 108  THR C C   1 
ATOM   2597 O  O   . THR C 3 1   ? -25.442 -35.863 47.538  1.00 43.92 ? 108  THR C O   1 
ATOM   2598 C  CB  . THR C 3 1   ? -28.595 -36.405 46.978  1.00 44.01 ? 108  THR C CB  1 
ATOM   2599 O  OG1 . THR C 3 1   ? -27.977 -37.654 47.316  1.00 44.85 ? 108  THR C OG1 1 
ATOM   2600 C  CG2 . THR C 3 1   ? -29.700 -36.680 45.969  1.00 43.58 ? 108  THR C CG2 1 
ATOM   2601 N  N   . VAL C 3 2   ? -26.615 -34.026 48.143  1.00 43.62 ? 109  VAL C N   1 
ATOM   2602 C  CA  . VAL C 3 2   ? -25.767 -33.710 49.314  1.00 43.57 ? 109  VAL C CA  1 
ATOM   2603 C  C   . VAL C 3 2   ? -25.735 -34.877 50.315  1.00 43.04 ? 109  VAL C C   1 
ATOM   2604 O  O   . VAL C 3 2   ? -26.730 -35.568 50.491  1.00 43.01 ? 109  VAL C O   1 
ATOM   2605 C  CB  . VAL C 3 2   ? -26.205 -32.375 50.007  1.00 43.69 ? 109  VAL C CB  1 
ATOM   2606 C  CG1 . VAL C 3 2   ? -27.734 -32.244 50.042  1.00 44.62 ? 109  VAL C CG1 1 
ATOM   2607 C  CG2 . VAL C 3 2   ? -25.602 -32.233 51.406  1.00 43.16 ? 109  VAL C CG2 1 
ATOM   2608 N  N   . ALA C 3 3   ? -24.585 -35.111 50.937  1.00 42.78 ? 110  ALA C N   1 
ATOM   2609 C  CA  . ALA C 3 3   ? -24.420 -36.249 51.841  1.00 42.60 ? 110  ALA C CA  1 
ATOM   2610 C  C   . ALA C 3 3   ? -23.469 -35.929 52.992  1.00 42.67 ? 110  ALA C C   1 
ATOM   2611 O  O   . ALA C 3 3   ? -22.274 -35.683 52.777  1.00 43.01 ? 110  ALA C O   1 
ATOM   2612 C  CB  . ALA C 3 3   ? -23.942 -37.469 51.081  1.00 42.47 ? 110  ALA C CB  1 
ATOM   2613 N  N   . ALA C 3 4   ? -24.015 -35.928 54.207  1.00 42.20 ? 111  ALA C N   1 
ATOM   2614 C  CA  . ALA C 3 4   ? -23.271 -35.583 55.417  1.00 41.69 ? 111  ALA C CA  1 
ATOM   2615 C  C   . ALA C 3 4   ? -22.134 -36.574 55.692  1.00 41.31 ? 111  ALA C C   1 
ATOM   2616 O  O   . ALA C 3 4   ? -22.311 -37.773 55.516  1.00 41.28 ? 111  ALA C O   1 
ATOM   2617 C  CB  . ALA C 3 4   ? -24.221 -35.511 56.608  1.00 41.55 ? 111  ALA C CB  1 
ATOM   2618 N  N   . PRO C 3 5   ? -20.960 -36.073 56.115  1.00 41.15 ? 112  PRO C N   1 
ATOM   2619 C  CA  . PRO C 3 5   ? -19.841 -36.962 56.445  1.00 41.24 ? 112  PRO C CA  1 
ATOM   2620 C  C   . PRO C 3 5   ? -20.105 -37.783 57.703  1.00 41.26 ? 112  PRO C C   1 
ATOM   2621 O  O   . PRO C 3 5   ? -20.922 -37.387 58.530  1.00 41.22 ? 112  PRO C O   1 
ATOM   2622 C  CB  . PRO C 3 5   ? -18.689 -35.984 56.714  1.00 41.12 ? 112  PRO C CB  1 
ATOM   2623 C  CG  . PRO C 3 5   ? -19.351 -34.720 57.129  1.00 40.94 ? 112  PRO C CG  1 
ATOM   2624 C  CD  . PRO C 3 5   ? -20.608 -34.654 56.314  1.00 41.12 ? 112  PRO C CD  1 
ATOM   2625 N  N   . SER C 3 6   ? -19.420 -38.912 57.835  1.00 41.39 ? 113  SER C N   1 
ATOM   2626 C  CA  . SER C 3 6   ? -19.430 -39.691 59.065  1.00 41.76 ? 113  SER C CA  1 
ATOM   2627 C  C   . SER C 3 6   ? -18.056 -39.533 59.675  1.00 42.07 ? 113  SER C C   1 
ATOM   2628 O  O   . SER C 3 6   ? -17.082 -40.038 59.123  1.00 42.49 ? 113  SER C O   1 
ATOM   2629 C  CB  . SER C 3 6   ? -19.709 -41.162 58.772  1.00 41.75 ? 113  SER C CB  1 
ATOM   2630 O  OG  . SER C 3 6   ? -20.985 -41.318 58.174  1.00 42.14 ? 113  SER C OG  1 
ATOM   2631 N  N   . VAL C 3 7   ? -17.972 -38.817 60.796  1.00 42.22 ? 114  VAL C N   1 
ATOM   2632 C  CA  . VAL C 3 7   ? -16.681 -38.460 61.394  1.00 42.13 ? 114  VAL C CA  1 
ATOM   2633 C  C   . VAL C 3 7   ? -16.199 -39.589 62.284  1.00 42.31 ? 114  VAL C C   1 
ATOM   2634 O  O   . VAL C 3 7   ? -16.994 -40.186 62.986  1.00 42.78 ? 114  VAL C O   1 
ATOM   2635 C  CB  . VAL C 3 7   ? -16.770 -37.146 62.215  1.00 42.06 ? 114  VAL C CB  1 
ATOM   2636 C  CG1 . VAL C 3 7   ? -15.387 -36.668 62.649  1.00 41.63 ? 114  VAL C CG1 1 
ATOM   2637 C  CG2 . VAL C 3 7   ? -17.466 -36.062 61.416  1.00 41.82 ? 114  VAL C CG2 1 
ATOM   2638 N  N   . PHE C 3 8   ? -14.904 -39.886 62.234  1.00 42.64 ? 115  PHE C N   1 
ATOM   2639 C  CA  . PHE C 3 8   ? -14.275 -40.885 63.102  1.00 43.03 ? 115  PHE C CA  1 
ATOM   2640 C  C   . PHE C 3 8   ? -12.903 -40.382 63.562  1.00 43.07 ? 115  PHE C C   1 
ATOM   2641 O  O   . PHE C 3 8   ? -12.152 -39.798 62.770  1.00 43.48 ? 115  PHE C O   1 
ATOM   2642 C  CB  . PHE C 3 8   ? -14.146 -42.234 62.382  1.00 43.41 ? 115  PHE C CB  1 
ATOM   2643 C  CG  . PHE C 3 8   ? -15.458 -42.774 61.851  1.00 44.40 ? 115  PHE C CG  1 
ATOM   2644 C  CD1 . PHE C 3 8   ? -15.729 -42.767 60.483  1.00 44.70 ? 115  PHE C CD1 1 
ATOM   2645 C  CD2 . PHE C 3 8   ? -16.429 -43.275 62.720  1.00 45.22 ? 115  PHE C CD2 1 
ATOM   2646 C  CE1 . PHE C 3 8   ? -16.942 -43.262 59.979  1.00 44.97 ? 115  PHE C CE1 1 
ATOM   2647 C  CE2 . PHE C 3 8   ? -17.648 -43.774 62.232  1.00 46.02 ? 115  PHE C CE2 1 
ATOM   2648 C  CZ  . PHE C 3 8   ? -17.902 -43.769 60.855  1.00 45.81 ? 115  PHE C CZ  1 
ATOM   2649 N  N   . ILE C 3 9   ? -12.576 -40.589 64.835  1.00 42.74 ? 116  ILE C N   1 
ATOM   2650 C  CA  . ILE C 3 9   ? -11.306 -40.098 65.379  1.00 42.35 ? 116  ILE C CA  1 
ATOM   2651 C  C   . ILE C 3 9   ? -10.418 -41.237 65.876  1.00 42.44 ? 116  ILE C C   1 
ATOM   2652 O  O   . ILE C 3 9   ? -10.903 -42.215 66.440  1.00 42.82 ? 116  ILE C O   1 
ATOM   2653 C  CB  . ILE C 3 9   ? -11.518 -38.999 66.464  1.00 42.30 ? 116  ILE C CB  1 
ATOM   2654 C  CG1 . ILE C 3 9   ? -10.176 -38.417 66.931  1.00 41.77 ? 116  ILE C CG1 1 
ATOM   2655 C  CG2 . ILE C 3 9   ? -12.365 -39.523 67.628  1.00 42.06 ? 116  ILE C CG2 1 
ATOM   2656 C  CD1 . ILE C 3 9   ? -10.252 -36.986 67.391  1.00 40.49 ? 116  ILE C CD1 1 
ATOM   2657 N  N   . PHE C 3 10  ? -9.116  -41.106 65.646  1.00 42.44 ? 117  PHE C N   1 
ATOM   2658 C  CA  . PHE C 3 10  ? -8.156  -42.153 65.977  1.00 42.26 ? 117  PHE C CA  1 
ATOM   2659 C  C   . PHE C 3 10  ? -7.034  -41.630 66.871  1.00 42.41 ? 117  PHE C C   1 
ATOM   2660 O  O   . PHE C 3 10  ? -6.282  -40.747 66.465  1.00 42.55 ? 117  PHE C O   1 
ATOM   2661 C  CB  . PHE C 3 10  ? -7.563  -42.738 64.697  1.00 41.93 ? 117  PHE C CB  1 
ATOM   2662 C  CG  . PHE C 3 10  ? -8.558  -43.472 63.850  1.00 41.64 ? 117  PHE C CG  1 
ATOM   2663 C  CD1 . PHE C 3 10  ? -8.827  -44.818 64.081  1.00 41.33 ? 117  PHE C CD1 1 
ATOM   2664 C  CD2 . PHE C 3 10  ? -9.222  -42.825 62.816  1.00 40.94 ? 117  PHE C CD2 1 
ATOM   2665 C  CE1 . PHE C 3 10  ? -9.745  -45.510 63.297  1.00 41.05 ? 117  PHE C CE1 1 
ATOM   2666 C  CE2 . PHE C 3 10  ? -10.141 -43.503 62.029  1.00 40.81 ? 117  PHE C CE2 1 
ATOM   2667 C  CZ  . PHE C 3 10  ? -10.401 -44.851 62.268  1.00 41.40 ? 117  PHE C CZ  1 
ATOM   2668 N  N   . PRO C 3 11  ? -6.917  -42.168 68.095  1.00 42.46 ? 118  PRO C N   1 
ATOM   2669 C  CA  . PRO C 3 11  ? -5.786  -41.788 68.934  1.00 42.84 ? 118  PRO C CA  1 
ATOM   2670 C  C   . PRO C 3 11  ? -4.493  -42.374 68.375  1.00 43.43 ? 118  PRO C C   1 
ATOM   2671 O  O   . PRO C 3 11  ? -4.545  -43.319 67.588  1.00 43.62 ? 118  PRO C O   1 
ATOM   2672 C  CB  . PRO C 3 11  ? -6.115  -42.441 70.286  1.00 42.79 ? 118  PRO C CB  1 
ATOM   2673 C  CG  . PRO C 3 11  ? -7.550  -42.847 70.204  1.00 42.33 ? 118  PRO C CG  1 
ATOM   2674 C  CD  . PRO C 3 11  ? -7.800  -43.132 68.768  1.00 42.27 ? 118  PRO C CD  1 
ATOM   2675 N  N   . PRO C 3 12  ? -3.335  -41.815 68.755  1.00 43.97 ? 119  PRO C N   1 
ATOM   2676 C  CA  . PRO C 3 12  ? -2.075  -42.466 68.414  1.00 44.70 ? 119  PRO C CA  1 
ATOM   2677 C  C   . PRO C 3 12  ? -2.026  -43.923 68.885  1.00 45.52 ? 119  PRO C C   1 
ATOM   2678 O  O   . PRO C 3 12  ? -2.417  -44.228 70.017  1.00 45.58 ? 119  PRO C O   1 
ATOM   2679 C  CB  . PRO C 3 12  ? -1.035  -41.639 69.178  1.00 44.53 ? 119  PRO C CB  1 
ATOM   2680 C  CG  . PRO C 3 12  ? -1.649  -40.313 69.326  1.00 44.21 ? 119  PRO C CG  1 
ATOM   2681 C  CD  . PRO C 3 12  ? -3.120  -40.555 69.484  1.00 44.12 ? 119  PRO C CD  1 
ATOM   2682 N  N   . SER C 3 13  ? -1.556  -44.806 68.007  1.00 46.47 ? 120  SER C N   1 
ATOM   2683 C  CA  . SER C 3 13  ? -1.263  -46.187 68.352  1.00 47.41 ? 120  SER C CA  1 
ATOM   2684 C  C   . SER C 3 13  ? -0.178  -46.240 69.432  1.00 48.36 ? 120  SER C C   1 
ATOM   2685 O  O   . SER C 3 13  ? 0.621   -45.307 69.570  1.00 48.41 ? 120  SER C O   1 
ATOM   2686 C  CB  . SER C 3 13  ? -0.772  -46.928 67.112  1.00 47.28 ? 120  SER C CB  1 
ATOM   2687 O  OG  . SER C 3 13  ? 0.569   -46.569 66.805  1.00 47.37 ? 120  SER C OG  1 
ATOM   2688 N  N   . ASP C 3 14  ? -0.141  -47.338 70.182  1.00 49.59 ? 121  ASP C N   1 
ATOM   2689 C  CA  . ASP C 3 14  ? 0.883   -47.530 71.211  1.00 50.69 ? 121  ASP C CA  1 
ATOM   2690 C  C   . ASP C 3 14  ? 2.260   -47.871 70.622  1.00 51.09 ? 121  ASP C C   1 
ATOM   2691 O  O   . ASP C 3 14  ? 3.289   -47.566 71.235  1.00 50.87 ? 121  ASP C O   1 
ATOM   2692 C  CB  . ASP C 3 14  ? 0.415   -48.564 72.245  1.00 51.09 ? 121  ASP C CB  1 
ATOM   2693 C  CG  . ASP C 3 14  ? -0.775  -48.060 73.078  1.00 52.35 ? 121  ASP C CG  1 
ATOM   2694 O  OD1 . ASP C 3 14  ? -0.647  -46.995 73.730  1.00 53.41 ? 121  ASP C OD1 1 
ATOM   2695 O  OD2 . ASP C 3 14  ? -1.841  -48.719 73.076  1.00 53.20 ? 121  ASP C OD2 1 
ATOM   2696 N  N   . GLU C 3 15  ? 2.270   -48.474 69.426  1.00 51.77 ? 122  GLU C N   1 
ATOM   2697 C  CA  . GLU C 3 15  ? 3.515   -48.706 68.679  1.00 52.55 ? 122  GLU C CA  1 
ATOM   2698 C  C   . GLU C 3 15  ? 4.163   -47.381 68.279  1.00 52.90 ? 122  GLU C C   1 
ATOM   2699 O  O   . GLU C 3 15  ? 5.371   -47.202 68.455  1.00 53.10 ? 122  GLU C O   1 
ATOM   2700 C  CB  . GLU C 3 15  ? 3.294   -49.564 67.424  1.00 52.58 ? 122  GLU C CB  1 
ATOM   2701 C  CG  . GLU C 3 15  ? 2.892   -51.019 67.673  1.00 53.72 ? 122  GLU C CG  1 
ATOM   2702 C  CD  . GLU C 3 15  ? 1.381   -51.247 67.596  1.00 54.62 ? 122  GLU C CD  1 
ATOM   2703 O  OE1 . GLU C 3 15  ? 0.951   -52.140 66.825  1.00 54.35 ? 122  GLU C OE1 1 
ATOM   2704 O  OE2 . GLU C 3 15  ? 0.627   -50.531 68.299  1.00 54.63 ? 122  GLU C OE2 1 
ATOM   2705 N  N   . GLN C 3 16  ? 3.362   -46.459 67.739  1.00 53.26 ? 123  GLN C N   1 
ATOM   2706 C  CA  . GLN C 3 16  ? 3.867   -45.136 67.359  1.00 53.49 ? 123  GLN C CA  1 
ATOM   2707 C  C   . GLN C 3 16  ? 4.321   -44.340 68.577  1.00 53.78 ? 123  GLN C C   1 
ATOM   2708 O  O   . GLN C 3 16  ? 5.400   -43.731 68.557  1.00 53.52 ? 123  GLN C O   1 
ATOM   2709 C  CB  . GLN C 3 16  ? 2.830   -44.332 66.567  1.00 53.37 ? 123  GLN C CB  1 
ATOM   2710 C  CG  . GLN C 3 16  ? 3.393   -43.019 66.029  1.00 52.67 ? 123  GLN C CG  1 
ATOM   2711 C  CD  . GLN C 3 16  ? 2.336   -42.024 65.585  1.00 52.23 ? 123  GLN C CD  1 
ATOM   2712 O  OE1 . GLN C 3 16  ? 2.667   -40.900 65.193  1.00 51.67 ? 123  GLN C OE1 1 
ATOM   2713 N  NE2 . GLN C 3 16  ? 1.063   -42.425 65.640  1.00 52.30 ? 123  GLN C NE2 1 
ATOM   2714 N  N   . LEU C 3 17  ? 3.494   -44.355 69.627  1.00 54.15 ? 124  LEU C N   1 
ATOM   2715 C  CA  . LEU C 3 17  ? 3.815   -43.666 70.878  1.00 54.64 ? 124  LEU C CA  1 
ATOM   2716 C  C   . LEU C 3 17  ? 5.153   -44.139 71.407  1.00 54.97 ? 124  LEU C C   1 
ATOM   2717 O  O   . LEU C 3 17  ? 5.952   -43.329 71.880  1.00 55.34 ? 124  LEU C O   1 
ATOM   2718 C  CB  . LEU C 3 17  ? 2.723   -43.858 71.931  1.00 54.49 ? 124  LEU C CB  1 
ATOM   2719 C  CG  . LEU C 3 17  ? 1.438   -43.039 71.766  1.00 54.81 ? 124  LEU C CG  1 
ATOM   2720 C  CD1 . LEU C 3 17  ? 0.451   -43.351 72.876  1.00 54.64 ? 124  LEU C CD1 1 
ATOM   2721 C  CD2 . LEU C 3 17  ? 1.716   -41.536 71.698  1.00 55.45 ? 124  LEU C CD2 1 
ATOM   2722 N  N   . LYS C 3 18  ? 5.388   -45.447 71.303  1.00 55.22 ? 125  LYS C N   1 
ATOM   2723 C  CA  . LYS C 3 18  ? 6.680   -46.050 71.610  1.00 55.59 ? 125  LYS C CA  1 
ATOM   2724 C  C   . LYS C 3 18  ? 7.826   -45.287 70.935  1.00 55.69 ? 125  LYS C C   1 
ATOM   2725 O  O   . LYS C 3 18  ? 8.687   -44.721 71.617  1.00 55.71 ? 125  LYS C O   1 
ATOM   2726 C  CB  . LYS C 3 18  ? 6.677   -47.525 71.176  1.00 55.79 ? 125  LYS C CB  1 
ATOM   2727 C  CG  . LYS C 3 18  ? 7.923   -48.361 71.537  1.00 56.19 ? 125  LYS C CG  1 
ATOM   2728 C  CD  . LYS C 3 18  ? 8.024   -48.737 73.035  1.00 57.12 ? 125  LYS C CD  1 
ATOM   2729 C  CE  . LYS C 3 18  ? 6.678   -49.100 73.697  1.00 57.50 ? 125  LYS C CE  1 
ATOM   2730 N  NZ  . LYS C 3 18  ? 5.792   -49.974 72.876  1.00 57.09 ? 125  LYS C NZ  1 
ATOM   2731 N  N   . SER C 3 19  ? 7.798   -45.242 69.602  1.00 55.82 ? 126  SER C N   1 
ATOM   2732 C  CA  . SER C 3 19  ? 8.893   -44.687 68.786  1.00 55.86 ? 126  SER C CA  1 
ATOM   2733 C  C   . SER C 3 19  ? 9.209   -43.194 68.986  1.00 55.69 ? 126  SER C C   1 
ATOM   2734 O  O   . SER C 3 19  ? 10.269  -42.735 68.551  1.00 55.95 ? 126  SER C O   1 
ATOM   2735 C  CB  . SER C 3 19  ? 8.669   -44.985 67.292  1.00 55.96 ? 126  SER C CB  1 
ATOM   2736 O  OG  . SER C 3 19  ? 7.364   -44.609 66.870  1.00 56.38 ? 126  SER C OG  1 
ATOM   2737 N  N   . GLY C 3 20  ? 8.308   -42.438 69.618  1.00 55.23 ? 127  GLY C N   1 
ATOM   2738 C  CA  . GLY C 3 20  ? 8.613   -41.046 69.969  1.00 54.59 ? 127  GLY C CA  1 
ATOM   2739 C  C   . GLY C 3 20  ? 7.658   -39.930 69.566  1.00 54.18 ? 127  GLY C C   1 
ATOM   2740 O  O   . GLY C 3 20  ? 7.720   -38.838 70.135  1.00 54.29 ? 127  GLY C O   1 
ATOM   2741 N  N   . THR C 3 21  ? 6.782   -40.176 68.593  1.00 53.58 ? 128  THR C N   1 
ATOM   2742 C  CA  . THR C 3 21  ? 5.837   -39.137 68.139  1.00 53.11 ? 128  THR C CA  1 
ATOM   2743 C  C   . THR C 3 21  ? 4.378   -39.583 68.168  1.00 52.25 ? 128  THR C C   1 
ATOM   2744 O  O   . THR C 3 21  ? 4.086   -40.781 68.269  1.00 52.42 ? 128  THR C O   1 
ATOM   2745 C  CB  . THR C 3 21  ? 6.163   -38.630 66.714  1.00 53.40 ? 128  THR C CB  1 
ATOM   2746 O  OG1 . THR C 3 21  ? 6.540   -39.742 65.886  1.00 54.16 ? 128  THR C OG1 1 
ATOM   2747 C  CG2 . THR C 3 21  ? 7.286   -37.576 66.746  1.00 53.69 ? 128  THR C CG2 1 
ATOM   2748 N  N   . ALA C 3 22  ? 3.471   -38.613 68.065  1.00 50.91 ? 129  ALA C N   1 
ATOM   2749 C  CA  . ALA C 3 22  ? 2.045   -38.880 68.153  1.00 49.77 ? 129  ALA C CA  1 
ATOM   2750 C  C   . ALA C 3 22  ? 1.269   -38.250 67.007  1.00 49.11 ? 129  ALA C C   1 
ATOM   2751 O  O   . ALA C 3 22  ? 1.432   -37.068 66.706  1.00 49.03 ? 129  ALA C O   1 
ATOM   2752 C  CB  . ALA C 3 22  ? 1.503   -38.400 69.484  1.00 49.84 ? 129  ALA C CB  1 
ATOM   2753 N  N   . SER C 3 23  ? 0.422   -39.057 66.375  1.00 48.39 ? 130  SER C N   1 
ATOM   2754 C  CA  . SER C 3 23  ? -0.457  -38.597 65.306  1.00 47.64 ? 130  SER C CA  1 
ATOM   2755 C  C   . SER C 3 23  ? -1.910  -38.919 65.642  1.00 47.18 ? 130  SER C C   1 
ATOM   2756 O  O   . SER C 3 23  ? -2.275  -40.077 65.841  1.00 46.89 ? 130  SER C O   1 
ATOM   2757 C  CB  . SER C 3 23  ? -0.073  -39.225 63.957  1.00 47.63 ? 130  SER C CB  1 
ATOM   2758 O  OG  . SER C 3 23  ? 1.267   -38.926 63.595  1.00 47.18 ? 130  SER C OG  1 
ATOM   2759 N  N   . VAL C 3 24  ? -2.726  -37.876 65.727  1.00 46.81 ? 131  VAL C N   1 
ATOM   2760 C  CA  . VAL C 3 24  ? -4.158  -38.034 65.913  1.00 46.47 ? 131  VAL C CA  1 
ATOM   2761 C  C   . VAL C 3 24  ? -4.768  -37.853 64.544  1.00 46.45 ? 131  VAL C C   1 
ATOM   2762 O  O   . VAL C 3 24  ? -4.468  -36.877 63.860  1.00 46.77 ? 131  VAL C O   1 
ATOM   2763 C  CB  . VAL C 3 24  ? -4.753  -36.991 66.891  1.00 46.34 ? 131  VAL C CB  1 
ATOM   2764 C  CG1 . VAL C 3 24  ? -6.139  -37.410 67.321  1.00 46.10 ? 131  VAL C CG1 1 
ATOM   2765 C  CG2 . VAL C 3 24  ? -3.864  -36.821 68.113  1.00 46.14 ? 131  VAL C CG2 1 
ATOM   2766 N  N   . VAL C 3 25  ? -5.607  -38.801 64.141  1.00 46.28 ? 132  VAL C N   1 
ATOM   2767 C  CA  . VAL C 3 25  ? -6.185  -38.818 62.807  1.00 45.93 ? 132  VAL C CA  1 
ATOM   2768 C  C   . VAL C 3 25  ? -7.694  -38.632 62.885  1.00 46.32 ? 132  VAL C C   1 
ATOM   2769 O  O   . VAL C 3 25  ? -8.390  -39.408 63.541  1.00 46.72 ? 132  VAL C O   1 
ATOM   2770 C  CB  . VAL C 3 25  ? -5.859  -40.139 62.086  1.00 45.53 ? 132  VAL C CB  1 
ATOM   2771 C  CG1 . VAL C 3 25  ? -6.642  -40.264 60.788  1.00 45.19 ? 132  VAL C CG1 1 
ATOM   2772 C  CG2 . VAL C 3 25  ? -4.380  -40.238 61.823  1.00 45.07 ? 132  VAL C CG2 1 
ATOM   2773 N  N   . CYS C 3 26  ? -8.197  -37.594 62.228  1.00 46.58 ? 133  CYS C N   1 
ATOM   2774 C  CA  . CYS C 3 26  ? -9.627  -37.449 62.052  1.00 46.32 ? 133  CYS C CA  1 
ATOM   2775 C  C   . CYS C 3 26  ? -9.991  -37.909 60.644  1.00 45.97 ? 133  CYS C C   1 
ATOM   2776 O  O   . CYS C 3 26  ? -9.257  -37.639 59.694  1.00 45.82 ? 133  CYS C O   1 
ATOM   2777 C  CB  . CYS C 3 26  ? -10.076 -36.005 62.287  1.00 46.60 ? 133  CYS C CB  1 
ATOM   2778 S  SG  . CYS C 3 26  ? -11.857 -35.916 62.479  1.00 48.13 ? 133  CYS C SG  1 
ATOM   2779 N  N   . LEU C 3 27  ? -11.112 -38.620 60.523  1.00 45.48 ? 134  LEU C N   1 
ATOM   2780 C  CA  . LEU C 3 27  ? -11.588 -39.130 59.234  1.00 44.87 ? 134  LEU C CA  1 
ATOM   2781 C  C   . LEU C 3 27  ? -13.014 -38.686 58.933  1.00 44.46 ? 134  LEU C C   1 
ATOM   2782 O  O   . LEU C 3 27  ? -13.920 -38.913 59.725  1.00 44.40 ? 134  LEU C O   1 
ATOM   2783 C  CB  . LEU C 3 27  ? -11.496 -40.657 59.188  1.00 44.69 ? 134  LEU C CB  1 
ATOM   2784 C  CG  . LEU C 3 27  ? -12.295 -41.383 58.096  1.00 45.00 ? 134  LEU C CG  1 
ATOM   2785 C  CD1 . LEU C 3 27  ? -11.835 -40.993 56.697  1.00 44.34 ? 134  LEU C CD1 1 
ATOM   2786 C  CD2 . LEU C 3 27  ? -12.232 -42.903 58.286  1.00 44.92 ? 134  LEU C CD2 1 
ATOM   2787 N  N   . LEU C 3 28  ? -13.206 -38.052 57.785  1.00 44.03 ? 135  LEU C N   1 
ATOM   2788 C  CA  . LEU C 3 28  ? -14.539 -37.658 57.353  1.00 43.68 ? 135  LEU C CA  1 
ATOM   2789 C  C   . LEU C 3 28  ? -14.873 -38.533 56.169  1.00 43.84 ? 135  LEU C C   1 
ATOM   2790 O  O   . LEU C 3 28  ? -14.172 -38.512 55.167  1.00 44.16 ? 135  LEU C O   1 
ATOM   2791 C  CB  . LEU C 3 28  ? -14.585 -36.178 56.969  1.00 43.52 ? 135  LEU C CB  1 
ATOM   2792 C  CG  . LEU C 3 28  ? -14.485 -35.079 58.037  1.00 43.17 ? 135  LEU C CG  1 
ATOM   2793 C  CD1 . LEU C 3 28  ? -13.194 -35.153 58.861  1.00 42.74 ? 135  LEU C CD1 1 
ATOM   2794 C  CD2 . LEU C 3 28  ? -14.607 -33.715 57.375  1.00 43.05 ? 135  LEU C CD2 1 
ATOM   2795 N  N   . ASN C 3 29  ? -15.942 -39.307 56.292  1.00 43.80 ? 136  ASN C N   1 
ATOM   2796 C  CA  . ASN C 3 29  ? -16.176 -40.421 55.399  1.00 43.82 ? 136  ASN C CA  1 
ATOM   2797 C  C   . ASN C 3 29  ? -17.387 -40.222 54.499  1.00 43.87 ? 136  ASN C C   1 
ATOM   2798 O  O   . ASN C 3 29  ? -18.469 -39.834 54.971  1.00 43.99 ? 136  ASN C O   1 
ATOM   2799 C  CB  . ASN C 3 29  ? -16.347 -41.689 56.231  1.00 44.16 ? 136  ASN C CB  1 
ATOM   2800 C  CG  . ASN C 3 29  ? -15.897 -42.935 55.506  1.00 44.72 ? 136  ASN C CG  1 
ATOM   2801 O  OD1 . ASN C 3 29  ? -14.764 -43.021 55.032  1.00 46.05 ? 136  ASN C OD1 1 
ATOM   2802 N  ND2 . ASN C 3 29  ? -16.781 -43.924 55.435  1.00 45.26 ? 136  ASN C ND2 1 
ATOM   2803 N  N   . ASN C 3 30  ? -17.182 -40.480 53.203  1.00 43.47 ? 137  ASN C N   1 
ATOM   2804 C  CA  . ASN C 3 30  ? -18.231 -40.457 52.183  1.00 43.13 ? 137  ASN C CA  1 
ATOM   2805 C  C   . ASN C 3 30  ? -19.176 -39.253 52.202  1.00 43.40 ? 137  ASN C C   1 
ATOM   2806 O  O   . ASN C 3 30  ? -20.382 -39.415 52.336  1.00 43.62 ? 137  ASN C O   1 
ATOM   2807 C  CB  . ASN C 3 30  ? -19.016 -41.769 52.213  1.00 42.93 ? 137  ASN C CB  1 
ATOM   2808 C  CG  . ASN C 3 30  ? -18.156 -42.960 51.849  1.00 42.66 ? 137  ASN C CG  1 
ATOM   2809 O  OD1 . ASN C 3 30  ? -17.112 -43.194 52.452  1.00 42.00 ? 137  ASN C OD1 1 
ATOM   2810 N  ND2 . ASN C 3 30  ? -18.579 -43.706 50.843  1.00 42.58 ? 137  ASN C ND2 1 
ATOM   2811 N  N   . PHE C 3 31  ? -18.627 -38.049 52.053  1.00 43.67 ? 138  PHE C N   1 
ATOM   2812 C  CA  . PHE C 3 31  ? -19.448 -36.832 51.983  1.00 43.69 ? 138  PHE C CA  1 
ATOM   2813 C  C   . PHE C 3 31  ? -19.518 -36.189 50.586  1.00 44.14 ? 138  PHE C C   1 
ATOM   2814 O  O   . PHE C 3 31  ? -18.735 -36.523 49.692  1.00 43.82 ? 138  PHE C O   1 
ATOM   2815 C  CB  . PHE C 3 31  ? -19.000 -35.800 53.023  1.00 43.26 ? 138  PHE C CB  1 
ATOM   2816 C  CG  . PHE C 3 31  ? -17.581 -35.342 52.863  1.00 42.47 ? 138  PHE C CG  1 
ATOM   2817 C  CD1 . PHE C 3 31  ? -17.291 -34.167 52.185  1.00 42.46 ? 138  PHE C CD1 1 
ATOM   2818 C  CD2 . PHE C 3 31  ? -16.534 -36.072 53.410  1.00 41.53 ? 138  PHE C CD2 1 
ATOM   2819 C  CE1 . PHE C 3 31  ? -15.979 -33.731 52.042  1.00 41.66 ? 138  PHE C CE1 1 
ATOM   2820 C  CE2 . PHE C 3 31  ? -15.221 -35.644 53.278  1.00 41.34 ? 138  PHE C CE2 1 
ATOM   2821 C  CZ  . PHE C 3 31  ? -14.944 -34.473 52.590  1.00 42.14 ? 138  PHE C CZ  1 
ATOM   2822 N  N   . TYR C 3 32  ? -20.479 -35.277 50.424  1.00 44.70 ? 139  TYR C N   1 
ATOM   2823 C  CA  . TYR C 3 32  ? -20.650 -34.488 49.210  1.00 45.31 ? 139  TYR C CA  1 
ATOM   2824 C  C   . TYR C 3 32  ? -21.451 -33.220 49.534  1.00 45.94 ? 139  TYR C C   1 
ATOM   2825 O  O   . TYR C 3 32  ? -22.439 -33.295 50.268  1.00 45.99 ? 139  TYR C O   1 
ATOM   2826 C  CB  . TYR C 3 32  ? -21.355 -35.293 48.110  1.00 45.09 ? 139  TYR C CB  1 
ATOM   2827 C  CG  . TYR C 3 32  ? -21.364 -34.570 46.776  1.00 45.27 ? 139  TYR C CG  1 
ATOM   2828 C  CD1 . TYR C 3 32  ? -20.365 -34.794 45.835  1.00 45.36 ? 139  TYR C CD1 1 
ATOM   2829 C  CD2 . TYR C 3 32  ? -22.356 -33.636 46.468  1.00 45.35 ? 139  TYR C CD2 1 
ATOM   2830 C  CE1 . TYR C 3 32  ? -20.364 -34.119 44.619  1.00 45.33 ? 139  TYR C CE1 1 
ATOM   2831 C  CE2 . TYR C 3 32  ? -22.356 -32.952 45.259  1.00 44.50 ? 139  TYR C CE2 1 
ATOM   2832 C  CZ  . TYR C 3 32  ? -21.366 -33.204 44.342  1.00 44.48 ? 139  TYR C CZ  1 
ATOM   2833 O  OH  . TYR C 3 32  ? -21.366 -32.545 43.143  1.00 44.69 ? 139  TYR C OH  1 
ATOM   2834 N  N   . PRO C 3 33  ? -21.048 -32.056 48.976  1.00 46.43 ? 140  PRO C N   1 
ATOM   2835 C  CA  . PRO C 3 33  ? -19.939 -31.801 48.056  1.00 46.91 ? 140  PRO C CA  1 
ATOM   2836 C  C   . PRO C 3 33  ? -18.591 -31.799 48.766  1.00 47.56 ? 140  PRO C C   1 
ATOM   2837 O  O   . PRO C 3 33  ? -18.527 -32.139 49.951  1.00 47.48 ? 140  PRO C O   1 
ATOM   2838 C  CB  . PRO C 3 33  ? -20.261 -30.412 47.509  1.00 46.78 ? 140  PRO C CB  1 
ATOM   2839 C  CG  . PRO C 3 33  ? -20.949 -29.747 48.614  1.00 46.34 ? 140  PRO C CG  1 
ATOM   2840 C  CD  . PRO C 3 33  ? -21.785 -30.813 49.270  1.00 46.55 ? 140  PRO C CD  1 
ATOM   2841 N  N   . ARG C 3 34  ? -17.537 -31.411 48.044  1.00 48.29 ? 141  ARG C N   1 
ATOM   2842 C  CA  . ARG C 3 34  ? -16.167 -31.517 48.545  1.00 49.13 ? 141  ARG C CA  1 
ATOM   2843 C  C   . ARG C 3 34  ? -15.859 -30.598 49.717  1.00 49.59 ? 141  ARG C C   1 
ATOM   2844 O  O   . ARG C 3 34  ? -15.024 -30.929 50.558  1.00 49.98 ? 141  ARG C O   1 
ATOM   2845 C  CB  . ARG C 3 34  ? -15.160 -31.266 47.431  1.00 49.21 ? 141  ARG C CB  1 
ATOM   2846 C  CG  . ARG C 3 34  ? -13.716 -31.319 47.906  1.00 50.38 ? 141  ARG C CG  1 
ATOM   2847 C  CD  . ARG C 3 34  ? -12.776 -30.698 46.887  1.00 52.58 ? 141  ARG C CD  1 
ATOM   2848 N  NE  . ARG C 3 34  ? -12.314 -31.688 45.918  1.00 53.33 ? 141  ARG C NE  1 
ATOM   2849 C  CZ  . ARG C 3 34  ? -11.121 -32.269 45.957  1.00 53.65 ? 141  ARG C CZ  1 
ATOM   2850 N  NH1 . ARG C 3 34  ? -10.252 -31.952 46.912  1.00 53.38 ? 141  ARG C NH1 1 
ATOM   2851 N  NH2 . ARG C 3 34  ? -10.796 -33.161 45.030  1.00 54.21 ? 141  ARG C NH2 1 
ATOM   2852 N  N   . GLU C 3 35  ? -16.520 -29.449 49.771  1.00 50.07 ? 142  GLU C N   1 
ATOM   2853 C  CA  . GLU C 3 35  ? -16.234 -28.464 50.804  1.00 50.78 ? 142  GLU C CA  1 
ATOM   2854 C  C   . GLU C 3 35  ? -16.504 -29.021 52.193  1.00 50.86 ? 142  GLU C C   1 
ATOM   2855 O  O   . GLU C 3 35  ? -17.591 -29.537 52.469  1.00 51.01 ? 142  GLU C O   1 
ATOM   2856 C  CB  . GLU C 3 35  ? -17.036 -27.178 50.577  1.00 51.10 ? 142  GLU C CB  1 
ATOM   2857 C  CG  . GLU C 3 35  ? -16.476 -26.250 49.483  1.00 53.03 ? 142  GLU C CG  1 
ATOM   2858 C  CD  . GLU C 3 35  ? -16.398 -26.901 48.087  1.00 55.09 ? 142  GLU C CD  1 
ATOM   2859 O  OE1 . GLU C 3 35  ? -17.325 -27.669 47.698  1.00 55.31 ? 142  GLU C OE1 1 
ATOM   2860 O  OE2 . GLU C 3 35  ? -15.397 -26.632 47.381  1.00 54.89 ? 142  GLU C OE2 1 
ATOM   2861 N  N   . ALA C 3 36  ? -15.489 -28.936 53.047  1.00 50.85 ? 143  ALA C N   1 
ATOM   2862 C  CA  . ALA C 3 36  ? -15.601 -29.318 54.445  1.00 50.92 ? 143  ALA C CA  1 
ATOM   2863 C  C   . ALA C 3 36  ? -14.554 -28.560 55.247  1.00 51.21 ? 143  ALA C C   1 
ATOM   2864 O  O   . ALA C 3 36  ? -13.438 -28.334 54.776  1.00 51.22 ? 143  ALA C O   1 
ATOM   2865 C  CB  . ALA C 3 36  ? -15.420 -30.813 54.606  1.00 50.83 ? 143  ALA C CB  1 
ATOM   2866 N  N   . LYS C 3 37  ? -14.936 -28.154 56.450  1.00 51.47 ? 144  LYS C N   1 
ATOM   2867 C  CA  . LYS C 3 37  ? -14.052 -27.460 57.372  1.00 51.87 ? 144  LYS C CA  1 
ATOM   2868 C  C   . LYS C 3 37  ? -13.703 -28.473 58.452  1.00 51.72 ? 144  LYS C C   1 
ATOM   2869 O  O   . LYS C 3 37  ? -14.565 -29.233 58.870  1.00 51.91 ? 144  LYS C O   1 
ATOM   2870 C  CB  . LYS C 3 37  ? -14.779 -26.227 57.952  1.00 52.09 ? 144  LYS C CB  1 
ATOM   2871 C  CG  . LYS C 3 37  ? -14.192 -25.573 59.234  1.00 53.43 ? 144  LYS C CG  1 
ATOM   2872 C  CD  . LYS C 3 37  ? -13.099 -24.512 58.961  1.00 54.34 ? 144  LYS C CD  1 
ATOM   2873 C  CE  . LYS C 3 37  ? -11.678 -25.090 59.090  1.00 54.78 ? 144  LYS C CE  1 
ATOM   2874 N  NZ  . LYS C 3 37  ? -10.606 -24.151 58.638  1.00 54.53 ? 144  LYS C NZ  1 
ATOM   2875 N  N   . VAL C 3 38  ? -12.442 -28.503 58.875  1.00 51.65 ? 145  VAL C N   1 
ATOM   2876 C  CA  . VAL C 3 38  ? -12.012 -29.366 59.976  1.00 51.69 ? 145  VAL C CA  1 
ATOM   2877 C  C   . VAL C 3 38  ? -11.193 -28.580 61.000  1.00 52.12 ? 145  VAL C C   1 
ATOM   2878 O  O   . VAL C 3 38  ? -10.122 -28.061 60.695  1.00 52.17 ? 145  VAL C O   1 
ATOM   2879 C  CB  . VAL C 3 38  ? -11.212 -30.591 59.483  1.00 51.58 ? 145  VAL C CB  1 
ATOM   2880 C  CG1 . VAL C 3 38  ? -10.546 -31.311 60.649  1.00 51.36 ? 145  VAL C CG1 1 
ATOM   2881 C  CG2 . VAL C 3 38  ? -12.111 -31.537 58.737  1.00 50.91 ? 145  VAL C CG2 1 
ATOM   2882 N  N   . GLN C 3 39  ? -11.718 -28.509 62.217  1.00 52.55 ? 146  GLN C N   1 
ATOM   2883 C  CA  . GLN C 3 39  ? -11.129 -27.741 63.296  1.00 52.95 ? 146  GLN C CA  1 
ATOM   2884 C  C   . GLN C 3 39  ? -10.651 -28.716 64.367  1.00 52.58 ? 146  GLN C C   1 
ATOM   2885 O  O   . GLN C 3 39  ? -11.432 -29.538 64.845  1.00 52.58 ? 146  GLN C O   1 
ATOM   2886 C  CB  . GLN C 3 39  ? -12.205 -26.826 63.883  1.00 53.50 ? 146  GLN C CB  1 
ATOM   2887 C  CG  . GLN C 3 39  ? -11.699 -25.579 64.590  1.00 55.71 ? 146  GLN C CG  1 
ATOM   2888 C  CD  . GLN C 3 39  ? -11.623 -24.364 63.661  1.00 58.66 ? 146  GLN C CD  1 
ATOM   2889 O  OE1 . GLN C 3 39  ? -12.398 -23.412 63.804  1.00 58.66 ? 146  GLN C OE1 1 
ATOM   2890 N  NE2 . GLN C 3 39  ? -10.692 -24.399 62.701  1.00 59.21 ? 146  GLN C NE2 1 
ATOM   2891 N  N   . TRP C 3 40  ? -9.374  -28.631 64.726  1.00 52.18 ? 147  TRP C N   1 
ATOM   2892 C  CA  . TRP C 3 40  ? -8.829  -29.394 65.844  1.00 52.02 ? 147  TRP C CA  1 
ATOM   2893 C  C   . TRP C 3 40  ? -8.837  -28.531 67.103  1.00 52.27 ? 147  TRP C C   1 
ATOM   2894 O  O   . TRP C 3 40  ? -8.561  -27.332 67.041  1.00 52.25 ? 147  TRP C O   1 
ATOM   2895 C  CB  . TRP C 3 40  ? -7.386  -29.796 65.574  1.00 51.81 ? 147  TRP C CB  1 
ATOM   2896 C  CG  . TRP C 3 40  ? -7.172  -30.971 64.672  1.00 51.68 ? 147  TRP C CG  1 
ATOM   2897 C  CD1 . TRP C 3 40  ? -6.683  -30.942 63.400  1.00 51.33 ? 147  TRP C CD1 1 
ATOM   2898 C  CD2 . TRP C 3 40  ? -7.386  -32.351 64.986  1.00 51.69 ? 147  TRP C CD2 1 
ATOM   2899 N  NE1 . TRP C 3 40  ? -6.594  -32.211 62.896  1.00 51.21 ? 147  TRP C NE1 1 
ATOM   2900 C  CE2 . TRP C 3 40  ? -7.020  -33.098 63.846  1.00 51.48 ? 147  TRP C CE2 1 
ATOM   2901 C  CE3 . TRP C 3 40  ? -7.857  -33.031 66.117  1.00 51.62 ? 147  TRP C CE3 1 
ATOM   2902 C  CZ2 . TRP C 3 40  ? -7.116  -34.490 63.801  1.00 51.66 ? 147  TRP C CZ2 1 
ATOM   2903 C  CZ3 . TRP C 3 40  ? -7.949  -34.419 66.073  1.00 51.30 ? 147  TRP C CZ3 1 
ATOM   2904 C  CH2 . TRP C 3 40  ? -7.582  -35.131 64.922  1.00 51.58 ? 147  TRP C CH2 1 
ATOM   2905 N  N   . LYS C 3 41  ? -9.141  -29.145 68.244  1.00 52.55 ? 148  LYS C N   1 
ATOM   2906 C  CA  . LYS C 3 41  ? -8.997  -28.485 69.548  1.00 52.99 ? 148  LYS C CA  1 
ATOM   2907 C  C   . LYS C 3 41  ? -8.363  -29.423 70.574  1.00 52.67 ? 148  LYS C C   1 
ATOM   2908 O  O   . LYS C 3 41  ? -8.846  -30.532 70.788  1.00 52.84 ? 148  LYS C O   1 
ATOM   2909 C  CB  . LYS C 3 41  ? -10.345 -27.951 70.056  1.00 52.96 ? 148  LYS C CB  1 
ATOM   2910 C  CG  . LYS C 3 41  ? -10.861 -26.725 69.297  1.00 53.67 ? 148  LYS C CG  1 
ATOM   2911 C  CD  . LYS C 3 41  ? -11.907 -25.931 70.091  1.00 53.95 ? 148  LYS C CD  1 
ATOM   2912 C  CE  . LYS C 3 41  ? -12.112 -24.521 69.500  1.00 54.55 ? 148  LYS C CE  1 
ATOM   2913 N  NZ  . LYS C 3 41  ? -12.919 -23.619 70.382  1.00 53.86 ? 148  LYS C NZ  1 
ATOM   2914 N  N   . VAL C 3 42  ? -7.274  -28.979 71.190  1.00 52.52 ? 149  VAL C N   1 
ATOM   2915 C  CA  . VAL C 3 42  ? -6.593  -29.759 72.226  1.00 52.60 ? 149  VAL C CA  1 
ATOM   2916 C  C   . VAL C 3 42  ? -6.811  -29.101 73.594  1.00 52.74 ? 149  VAL C C   1 
ATOM   2917 O  O   . VAL C 3 42  ? -6.342  -27.982 73.832  1.00 52.68 ? 149  VAL C O   1 
ATOM   2918 C  CB  . VAL C 3 42  ? -5.075  -29.889 71.940  1.00 52.55 ? 149  VAL C CB  1 
ATOM   2919 C  CG1 . VAL C 3 42  ? -4.399  -30.778 72.975  1.00 52.39 ? 149  VAL C CG1 1 
ATOM   2920 C  CG2 . VAL C 3 42  ? -4.837  -30.437 70.547  1.00 52.76 ? 149  VAL C CG2 1 
ATOM   2921 N  N   . ASP C 3 43  ? -7.512  -29.804 74.488  1.00 52.91 ? 150  ASP C N   1 
ATOM   2922 C  CA  . ASP C 3 43  ? -7.956  -29.245 75.774  1.00 53.11 ? 150  ASP C CA  1 
ATOM   2923 C  C   . ASP C 3 43  ? -8.633  -27.897 75.537  1.00 53.21 ? 150  ASP C C   1 
ATOM   2924 O  O   . ASP C 3 43  ? -8.378  -26.929 76.255  1.00 53.32 ? 150  ASP C O   1 
ATOM   2925 C  CB  . ASP C 3 43  ? -6.790  -29.101 76.773  1.00 53.05 ? 150  ASP C CB  1 
ATOM   2926 C  CG  . ASP C 3 43  ? -6.483  -30.395 77.538  1.00 53.35 ? 150  ASP C CG  1 
ATOM   2927 O  OD1 . ASP C 3 43  ? -7.347  -31.302 77.606  1.00 52.76 ? 150  ASP C OD1 1 
ATOM   2928 O  OD2 . ASP C 3 43  ? -5.364  -30.490 78.092  1.00 53.31 ? 150  ASP C OD2 1 
ATOM   2929 N  N   . ASN C 3 44  ? -9.465  -27.847 74.496  1.00 53.39 ? 151  ASN C N   1 
ATOM   2930 C  CA  . ASN C 3 44  ? -10.236 -26.654 74.110  1.00 53.64 ? 151  ASN C CA  1 
ATOM   2931 C  C   . ASN C 3 44  ? -9.425  -25.505 73.456  1.00 53.36 ? 151  ASN C C   1 
ATOM   2932 O  O   . ASN C 3 44  ? -9.980  -24.437 73.144  1.00 53.44 ? 151  ASN C O   1 
ATOM   2933 C  CB  . ASN C 3 44  ? -11.074 -26.144 75.294  1.00 53.97 ? 151  ASN C CB  1 
ATOM   2934 C  CG  . ASN C 3 44  ? -12.511 -25.846 74.907  1.00 55.05 ? 151  ASN C CG  1 
ATOM   2935 O  OD1 . ASN C 3 44  ? -13.346 -26.754 74.808  1.00 55.66 ? 151  ASN C OD1 1 
ATOM   2936 N  ND2 . ASN C 3 44  ? -12.812 -24.565 74.699  1.00 55.91 ? 151  ASN C ND2 1 
ATOM   2937 N  N   . ALA C 3 45  ? -8.126  -25.730 73.252  1.00 52.79 ? 152  ALA C N   1 
ATOM   2938 C  CA  . ALA C 3 45  ? -7.273  -24.817 72.484  1.00 52.23 ? 152  ALA C CA  1 
ATOM   2939 C  C   . ALA C 3 45  ? -7.303  -25.155 70.989  1.00 52.00 ? 152  ALA C C   1 
ATOM   2940 O  O   . ALA C 3 45  ? -6.857  -26.232 70.577  1.00 51.72 ? 152  ALA C O   1 
ATOM   2941 C  CB  . ALA C 3 45  ? -5.838  -24.852 73.008  1.00 52.12 ? 152  ALA C CB  1 
ATOM   2942 N  N   . LEU C 3 46  ? -7.833  -24.228 70.189  1.00 51.83 ? 153  LEU C N   1 
ATOM   2943 C  CA  . LEU C 3 46  ? -7.888  -24.370 68.732  1.00 51.63 ? 153  LEU C CA  1 
ATOM   2944 C  C   . LEU C 3 46  ? -6.490  -24.460 68.131  1.00 51.34 ? 153  LEU C C   1 
ATOM   2945 O  O   . LEU C 3 46  ? -5.624  -23.619 68.395  1.00 51.49 ? 153  LEU C O   1 
ATOM   2946 C  CB  . LEU C 3 46  ? -8.677  -23.219 68.100  1.00 51.69 ? 153  LEU C CB  1 
ATOM   2947 C  CG  . LEU C 3 46  ? -8.509  -22.889 66.604  1.00 51.99 ? 153  LEU C CG  1 
ATOM   2948 C  CD1 . LEU C 3 46  ? -8.868  -24.049 65.668  1.00 51.35 ? 153  LEU C CD1 1 
ATOM   2949 C  CD2 . LEU C 3 46  ? -9.317  -21.635 66.245  1.00 52.00 ? 153  LEU C CD2 1 
ATOM   2950 N  N   . GLN C 3 47  ? -6.286  -25.493 67.324  1.00 50.86 ? 154  GLN C N   1 
ATOM   2951 C  CA  . GLN C 3 47  ? -4.981  -25.787 66.760  1.00 50.39 ? 154  GLN C CA  1 
ATOM   2952 C  C   . GLN C 3 47  ? -4.895  -25.221 65.335  1.00 50.19 ? 154  GLN C C   1 
ATOM   2953 O  O   . GLN C 3 47  ? -5.813  -25.402 64.526  1.00 50.03 ? 154  GLN C O   1 
ATOM   2954 C  CB  . GLN C 3 47  ? -4.750  -27.296 66.791  1.00 50.22 ? 154  GLN C CB  1 
ATOM   2955 C  CG  . GLN C 3 47  ? -3.406  -27.717 67.359  1.00 50.15 ? 154  GLN C CG  1 
ATOM   2956 C  CD  . GLN C 3 47  ? -3.281  -27.532 68.868  1.00 50.36 ? 154  GLN C CD  1 
ATOM   2957 O  OE1 . GLN C 3 47  ? -4.223  -27.117 69.552  1.00 50.51 ? 154  GLN C OE1 1 
ATOM   2958 N  NE2 . GLN C 3 47  ? -2.103  -27.846 69.393  1.00 49.99 ? 154  GLN C NE2 1 
ATOM   2959 N  N   . SER C 3 48  ? -3.799  -24.521 65.043  1.00 49.82 ? 155  SER C N   1 
ATOM   2960 C  CA  . SER C 3 48  ? -3.683  -23.761 63.798  1.00 49.37 ? 155  SER C CA  1 
ATOM   2961 C  C   . SER C 3 48  ? -2.324  -23.914 63.122  1.00 48.82 ? 155  SER C C   1 
ATOM   2962 O  O   . SER C 3 48  ? -1.292  -23.559 63.692  1.00 48.44 ? 155  SER C O   1 
ATOM   2963 C  CB  . SER C 3 48  ? -3.979  -22.282 64.055  1.00 49.52 ? 155  SER C CB  1 
ATOM   2964 O  OG  . SER C 3 48  ? -4.242  -21.604 62.838  1.00 50.30 ? 155  SER C OG  1 
ATOM   2965 N  N   . GLY C 3 49  ? -2.346  -24.440 61.898  1.00 48.52 ? 156  GLY C N   1 
ATOM   2966 C  CA  . GLY C 3 49  ? -1.138  -24.648 61.095  1.00 48.08 ? 156  GLY C CA  1 
ATOM   2967 C  C   . GLY C 3 49  ? -0.231  -25.813 61.491  1.00 47.70 ? 156  GLY C C   1 
ATOM   2968 O  O   . GLY C 3 49  ? 0.924   -25.865 61.065  1.00 47.78 ? 156  GLY C O   1 
ATOM   2969 N  N   . ASN C 3 50  ? -0.729  -26.741 62.310  1.00 47.11 ? 157  ASN C N   1 
ATOM   2970 C  CA  . ASN C 3 50  ? 0.022   -27.965 62.625  1.00 46.57 ? 157  ASN C CA  1 
ATOM   2971 C  C   . ASN C 3 50  ? -0.785  -29.246 62.379  1.00 45.89 ? 157  ASN C C   1 
ATOM   2972 O  O   . ASN C 3 50  ? -0.496  -30.308 62.941  1.00 45.73 ? 157  ASN C O   1 
ATOM   2973 C  CB  . ASN C 3 50  ? 0.588   -27.923 64.042  1.00 46.80 ? 157  ASN C CB  1 
ATOM   2974 C  CG  . ASN C 3 50  ? -0.490  -27.970 65.096  1.00 47.92 ? 157  ASN C CG  1 
ATOM   2975 O  OD1 . ASN C 3 50  ? -1.588  -27.439 64.903  1.00 49.04 ? 157  ASN C OD1 1 
ATOM   2976 N  ND2 . ASN C 3 50  ? -0.189  -28.613 66.221  1.00 49.14 ? 157  ASN C ND2 1 
ATOM   2977 N  N   . SER C 3 51  ? -1.804  -29.119 61.536  1.00 45.20 ? 158  SER C N   1 
ATOM   2978 C  CA  . SER C 3 51  ? -2.484  -30.264 60.952  1.00 44.57 ? 158  SER C CA  1 
ATOM   2979 C  C   . SER C 3 51  ? -2.275  -30.273 59.435  1.00 44.12 ? 158  SER C C   1 
ATOM   2980 O  O   . SER C 3 51  ? -1.780  -29.299 58.868  1.00 43.90 ? 158  SER C O   1 
ATOM   2981 C  CB  . SER C 3 51  ? -3.971  -30.264 61.306  1.00 44.42 ? 158  SER C CB  1 
ATOM   2982 O  OG  . SER C 3 51  ? -4.519  -28.964 61.211  1.00 44.60 ? 158  SER C OG  1 
ATOM   2983 N  N   . GLN C 3 52  ? -2.635  -31.393 58.804  1.00 43.73 ? 159  GLN C N   1 
ATOM   2984 C  CA  . GLN C 3 52  ? -2.521  -31.601 57.356  1.00 42.97 ? 159  GLN C CA  1 
ATOM   2985 C  C   . GLN C 3 52  ? -3.687  -32.451 56.876  1.00 42.58 ? 159  GLN C C   1 
ATOM   2986 O  O   . GLN C 3 52  ? -4.290  -33.179 57.660  1.00 42.34 ? 159  GLN C O   1 
ATOM   2987 C  CB  . GLN C 3 52  ? -1.191  -32.268 56.997  1.00 42.82 ? 159  GLN C CB  1 
ATOM   2988 C  CG  . GLN C 3 52  ? 0.006   -31.375 57.243  1.00 42.50 ? 159  GLN C CG  1 
ATOM   2989 C  CD  . GLN C 3 52  ? 1.302   -31.954 56.740  1.00 43.12 ? 159  GLN C CD  1 
ATOM   2990 O  OE1 . GLN C 3 52  ? 1.923   -31.397 55.836  1.00 42.93 ? 159  GLN C OE1 1 
ATOM   2991 N  NE2 . GLN C 3 52  ? 1.728   -33.075 57.326  1.00 43.70 ? 159  GLN C NE2 1 
ATOM   2992 N  N   . GLU C 3 53  ? -4.007  -32.350 55.588  1.00 42.19 ? 160  GLU C N   1 
ATOM   2993 C  CA  . GLU C 3 53  ? -5.209  -32.983 55.058  1.00 41.91 ? 160  GLU C CA  1 
ATOM   2994 C  C   . GLU C 3 53  ? -5.014  -33.596 53.685  1.00 41.65 ? 160  GLU C C   1 
ATOM   2995 O  O   . GLU C 3 53  ? -4.132  -33.191 52.928  1.00 41.63 ? 160  GLU C O   1 
ATOM   2996 C  CB  . GLU C 3 53  ? -6.354  -31.979 54.963  1.00 42.05 ? 160  GLU C CB  1 
ATOM   2997 C  CG  . GLU C 3 53  ? -6.435  -30.998 56.099  1.00 42.79 ? 160  GLU C CG  1 
ATOM   2998 C  CD  . GLU C 3 53  ? -7.762  -30.302 56.155  1.00 43.66 ? 160  GLU C CD  1 
ATOM   2999 O  OE1 . GLU C 3 53  ? -8.436  -30.218 55.103  1.00 42.73 ? 160  GLU C OE1 1 
ATOM   3000 O  OE2 . GLU C 3 53  ? -8.128  -29.849 57.265  1.00 45.43 ? 160  GLU C OE2 1 
ATOM   3001 N  N   . SER C 3 54  ? -5.874  -34.567 53.380  1.00 41.23 ? 161  SER C N   1 
ATOM   3002 C  CA  . SER C 3 54  ? -5.948  -35.214 52.085  1.00 40.73 ? 161  SER C CA  1 
ATOM   3003 C  C   . SER C 3 54  ? -7.398  -35.517 51.822  1.00 40.67 ? 161  SER C C   1 
ATOM   3004 O  O   . SER C 3 54  ? -8.143  -35.853 52.743  1.00 40.53 ? 161  SER C O   1 
ATOM   3005 C  CB  . SER C 3 54  ? -5.181  -36.535 52.090  1.00 40.91 ? 161  SER C CB  1 
ATOM   3006 O  OG  . SER C 3 54  ? -3.943  -36.425 51.420  1.00 40.60 ? 161  SER C OG  1 
ATOM   3007 N  N   . VAL C 3 55  ? -7.793  -35.392 50.560  1.00 40.70 ? 162  VAL C N   1 
ATOM   3008 C  CA  . VAL C 3 55  ? -9.141  -35.727 50.120  1.00 40.60 ? 162  VAL C CA  1 
ATOM   3009 C  C   . VAL C 3 55  ? -9.031  -36.764 49.012  1.00 40.82 ? 162  VAL C C   1 
ATOM   3010 O  O   . VAL C 3 55  ? -8.154  -36.671 48.166  1.00 40.81 ? 162  VAL C O   1 
ATOM   3011 C  CB  . VAL C 3 55  ? -9.897  -34.478 49.623  1.00 40.39 ? 162  VAL C CB  1 
ATOM   3012 C  CG1 . VAL C 3 55  ? -11.312 -34.836 49.207  1.00 40.35 ? 162  VAL C CG1 1 
ATOM   3013 C  CG2 . VAL C 3 55  ? -9.928  -33.420 50.705  1.00 39.78 ? 162  VAL C CG2 1 
ATOM   3014 N  N   . THR C 3 56  ? -9.897  -37.770 49.032  1.00 41.41 ? 163  THR C N   1 
ATOM   3015 C  CA  . THR C 3 56  ? -9.887  -38.772 47.973  1.00 42.13 ? 163  THR C CA  1 
ATOM   3016 C  C   . THR C 3 56  ? -10.516 -38.189 46.733  1.00 42.75 ? 163  THR C C   1 
ATOM   3017 O  O   . THR C 3 56  ? -11.264 -37.206 46.807  1.00 42.95 ? 163  THR C O   1 
ATOM   3018 C  CB  . THR C 3 56  ? -10.660 -40.056 48.343  1.00 42.19 ? 163  THR C CB  1 
ATOM   3019 O  OG1 . THR C 3 56  ? -11.948 -39.724 48.892  1.00 42.33 ? 163  THR C OG1 1 
ATOM   3020 C  CG2 . THR C 3 56  ? -9.867  -40.885 49.327  1.00 41.95 ? 163  THR C CG2 1 
ATOM   3021 N  N   . GLU C 3 57  ? -10.202 -38.787 45.589  1.00 43.36 ? 164  GLU C N   1 
ATOM   3022 C  CA  . GLU C 3 57  ? -10.924 -38.481 44.370  1.00 44.16 ? 164  GLU C CA  1 
ATOM   3023 C  C   . GLU C 3 57  ? -12.325 -39.071 44.513  1.00 44.47 ? 164  GLU C C   1 
ATOM   3024 O  O   . GLU C 3 57  ? -12.532 -40.031 45.268  1.00 44.51 ? 164  GLU C O   1 
ATOM   3025 C  CB  . GLU C 3 57  ? -10.185 -39.032 43.147  1.00 44.20 ? 164  GLU C CB  1 
ATOM   3026 C  CG  . GLU C 3 57  ? -8.853  -38.306 42.847  1.00 45.29 ? 164  GLU C CG  1 
ATOM   3027 C  CD  . GLU C 3 57  ? -9.043  -36.851 42.394  1.00 46.38 ? 164  GLU C CD  1 
ATOM   3028 O  OE1 . GLU C 3 57  ? -9.724  -36.628 41.367  1.00 47.70 ? 164  GLU C OE1 1 
ATOM   3029 O  OE2 . GLU C 3 57  ? -8.510  -35.932 43.056  1.00 46.37 ? 164  GLU C OE2 1 
ATOM   3030 N  N   . GLN C 3 58  ? -13.284 -38.472 43.819  1.00 44.84 ? 165  GLN C N   1 
ATOM   3031 C  CA  . GLN C 3 58  ? -14.684 -38.866 43.917  1.00 45.33 ? 165  GLN C CA  1 
ATOM   3032 C  C   . GLN C 3 58  ? -14.856 -40.365 43.712  1.00 46.10 ? 165  GLN C C   1 
ATOM   3033 O  O   . GLN C 3 58  ? -14.171 -40.956 42.884  1.00 46.39 ? 165  GLN C O   1 
ATOM   3034 C  CB  . GLN C 3 58  ? -15.490 -38.109 42.879  1.00 45.14 ? 165  GLN C CB  1 
ATOM   3035 C  CG  . GLN C 3 58  ? -16.793 -37.575 43.387  1.00 43.80 ? 165  GLN C CG  1 
ATOM   3036 C  CD  . GLN C 3 58  ? -17.529 -36.792 42.334  1.00 42.71 ? 165  GLN C CD  1 
ATOM   3037 O  OE1 . GLN C 3 58  ? -17.026 -36.591 41.229  1.00 42.71 ? 165  GLN C OE1 1 
ATOM   3038 N  NE2 . GLN C 3 58  ? -18.732 -36.342 42.666  1.00 42.68 ? 165  GLN C NE2 1 
ATOM   3039 N  N   . ASP C 3 59  ? -15.778 -40.969 44.458  1.00 47.20 ? 166  ASP C N   1 
ATOM   3040 C  CA  . ASP C 3 59  ? -15.898 -42.435 44.538  1.00 48.32 ? 166  ASP C CA  1 
ATOM   3041 C  C   . ASP C 3 59  ? -16.485 -43.121 43.305  1.00 48.62 ? 166  ASP C C   1 
ATOM   3042 O  O   . ASP C 3 59  ? -17.443 -42.631 42.691  1.00 48.95 ? 166  ASP C O   1 
ATOM   3043 C  CB  . ASP C 3 59  ? -16.707 -42.836 45.776  1.00 48.72 ? 166  ASP C CB  1 
ATOM   3044 C  CG  . ASP C 3 59  ? -16.722 -44.342 46.007  1.00 49.84 ? 166  ASP C CG  1 
ATOM   3045 O  OD1 . ASP C 3 59  ? -16.037 -44.794 46.952  1.00 50.78 ? 166  ASP C OD1 1 
ATOM   3046 O  OD2 . ASP C 3 59  ? -17.417 -45.068 45.248  1.00 50.52 ? 166  ASP C OD2 1 
ATOM   3047 N  N   . SER C 3 60  ? -15.924 -44.288 42.990  1.00 48.89 ? 167  SER C N   1 
ATOM   3048 C  CA  . SER C 3 60  ? -16.295 -45.064 41.801  1.00 49.04 ? 167  SER C CA  1 
ATOM   3049 C  C   . SER C 3 60  ? -17.761 -45.502 41.779  1.00 49.13 ? 167  SER C C   1 
ATOM   3050 O  O   . SER C 3 60  ? -18.356 -45.603 40.701  1.00 49.29 ? 167  SER C O   1 
ATOM   3051 C  CB  . SER C 3 60  ? -15.376 -46.286 41.651  1.00 49.02 ? 167  SER C CB  1 
ATOM   3052 O  OG  . SER C 3 60  ? -15.520 -47.180 42.744  1.00 48.73 ? 167  SER C OG  1 
ATOM   3053 N  N   . LYS C 3 61  ? -18.325 -45.758 42.965  1.00 49.08 ? 168  LYS C N   1 
ATOM   3054 C  CA  . LYS C 3 61  ? -19.684 -46.315 43.110  1.00 48.86 ? 168  LYS C CA  1 
ATOM   3055 C  C   . LYS C 3 61  ? -20.739 -45.303 43.587  1.00 48.59 ? 168  LYS C C   1 
ATOM   3056 O  O   . LYS C 3 61  ? -21.876 -45.315 43.105  1.00 48.49 ? 168  LYS C O   1 
ATOM   3057 C  CB  . LYS C 3 61  ? -19.666 -47.545 44.034  1.00 48.81 ? 168  LYS C CB  1 
ATOM   3058 N  N   . ASP C 3 62  ? -20.370 -44.436 44.529  1.00 48.02 ? 169  ASP C N   1 
ATOM   3059 C  CA  . ASP C 3 62  ? -21.344 -43.518 45.125  1.00 47.57 ? 169  ASP C CA  1 
ATOM   3060 C  C   . ASP C 3 62  ? -20.993 -42.028 44.971  1.00 47.01 ? 169  ASP C C   1 
ATOM   3061 O  O   . ASP C 3 62  ? -21.710 -41.162 45.482  1.00 46.43 ? 169  ASP C O   1 
ATOM   3062 C  CB  . ASP C 3 62  ? -21.561 -43.868 46.598  1.00 47.63 ? 169  ASP C CB  1 
ATOM   3063 C  CG  . ASP C 3 62  ? -20.393 -43.456 47.468  1.00 48.37 ? 169  ASP C CG  1 
ATOM   3064 O  OD1 . ASP C 3 62  ? -19.272 -43.969 47.272  1.00 48.14 ? 169  ASP C OD1 1 
ATOM   3065 O  OD2 . ASP C 3 62  ? -20.602 -42.609 48.356  1.00 49.93 ? 169  ASP C OD2 1 
ATOM   3066 N  N   . SER C 3 63  ? -19.882 -41.752 44.286  1.00 46.47 ? 170  SER C N   1 
ATOM   3067 C  CA  . SER C 3 63  ? -19.491 -40.389 43.902  1.00 45.76 ? 170  SER C CA  1 
ATOM   3068 C  C   . SER C 3 63  ? -19.310 -39.412 45.080  1.00 45.36 ? 170  SER C C   1 
ATOM   3069 O  O   . SER C 3 63  ? -19.710 -38.241 45.007  1.00 45.12 ? 170  SER C O   1 
ATOM   3070 C  CB  . SER C 3 63  ? -20.481 -39.829 42.872  1.00 45.73 ? 170  SER C CB  1 
ATOM   3071 O  OG  . SER C 3 63  ? -20.644 -40.719 41.784  1.00 45.43 ? 170  SER C OG  1 
ATOM   3072 N  N   . THR C 3 64  ? -18.698 -39.889 46.157  1.00 44.86 ? 171  THR C N   1 
ATOM   3073 C  CA  . THR C 3 64  ? -18.440 -39.037 47.313  1.00 44.64 ? 171  THR C CA  1 
ATOM   3074 C  C   . THR C 3 64  ? -16.961 -38.900 47.562  1.00 44.49 ? 171  THR C C   1 
ATOM   3075 O  O   . THR C 3 64  ? -16.163 -39.692 47.059  1.00 44.71 ? 171  THR C O   1 
ATOM   3076 C  CB  . THR C 3 64  ? -19.059 -39.588 48.618  1.00 44.63 ? 171  THR C CB  1 
ATOM   3077 O  OG1 . THR C 3 64  ? -18.669 -40.952 48.799  1.00 44.31 ? 171  THR C OG1 1 
ATOM   3078 C  CG2 . THR C 3 64  ? -20.579 -39.469 48.614  1.00 44.81 ? 171  THR C CG2 1 
ATOM   3079 N  N   . TYR C 3 65  ? -16.611 -37.901 48.364  1.00 44.21 ? 172  TYR C N   1 
ATOM   3080 C  CA  . TYR C 3 65  ? -15.244 -37.707 48.814  1.00 43.96 ? 172  TYR C CA  1 
ATOM   3081 C  C   . TYR C 3 65  ? -15.096 -38.197 50.248  1.00 43.74 ? 172  TYR C C   1 
ATOM   3082 O  O   . TYR C 3 65  ? -16.074 -38.384 50.964  1.00 43.59 ? 172  TYR C O   1 
ATOM   3083 C  CB  . TYR C 3 65  ? -14.838 -36.229 48.711  1.00 44.03 ? 172  TYR C CB  1 
ATOM   3084 C  CG  . TYR C 3 65  ? -15.100 -35.631 47.353  1.00 44.20 ? 172  TYR C CG  1 
ATOM   3085 C  CD1 . TYR C 3 65  ? -14.204 -35.817 46.301  1.00 43.73 ? 172  TYR C CD1 1 
ATOM   3086 C  CD2 . TYR C 3 65  ? -16.259 -34.898 47.113  1.00 45.00 ? 172  TYR C CD2 1 
ATOM   3087 C  CE1 . TYR C 3 65  ? -14.451 -35.282 45.047  1.00 43.45 ? 172  TYR C CE1 1 
ATOM   3088 C  CE2 . TYR C 3 65  ? -16.516 -34.354 45.861  1.00 45.29 ? 172  TYR C CE2 1 
ATOM   3089 C  CZ  . TYR C 3 65  ? -15.604 -34.549 44.833  1.00 44.56 ? 172  TYR C CZ  1 
ATOM   3090 O  OH  . TYR C 3 65  ? -15.874 -34.016 43.593  1.00 44.33 ? 172  TYR C OH  1 
ATOM   3091 N  N   . SER C 3 66  ? -13.858 -38.426 50.648  1.00 43.65 ? 173  SER C N   1 
ATOM   3092 C  CA  . SER C 3 66  ? -13.542 -38.683 52.033  1.00 43.58 ? 173  SER C CA  1 
ATOM   3093 C  C   . SER C 3 66  ? -12.246 -37.959 52.364  1.00 43.48 ? 173  SER C C   1 
ATOM   3094 O  O   . SER C 3 66  ? -11.336 -37.878 51.526  1.00 43.47 ? 173  SER C O   1 
ATOM   3095 C  CB  . SER C 3 66  ? -13.442 -40.182 52.301  1.00 43.58 ? 173  SER C CB  1 
ATOM   3096 O  OG  . SER C 3 66  ? -14.689 -40.811 52.037  1.00 44.21 ? 173  SER C OG  1 
ATOM   3097 N  N   . LEU C 3 67  ? -12.182 -37.417 53.577  1.00 43.02 ? 174  LEU C N   1 
ATOM   3098 C  CA  . LEU C 3 67  ? -11.074 -36.574 53.997  1.00 42.63 ? 174  LEU C CA  1 
ATOM   3099 C  C   . LEU C 3 67  ? -10.402 -37.173 55.215  1.00 42.33 ? 174  LEU C C   1 
ATOM   3100 O  O   . LEU C 3 67  ? -11.078 -37.620 56.138  1.00 42.31 ? 174  LEU C O   1 
ATOM   3101 C  CB  . LEU C 3 67  ? -11.584 -35.154 54.313  1.00 42.54 ? 174  LEU C CB  1 
ATOM   3102 C  CG  . LEU C 3 67  ? -10.586 -34.042 54.676  1.00 42.44 ? 174  LEU C CG  1 
ATOM   3103 C  CD1 . LEU C 3 67  ? -11.145 -32.669 54.321  1.00 42.09 ? 174  LEU C CD1 1 
ATOM   3104 C  CD2 . LEU C 3 67  ? -10.153 -34.085 56.147  1.00 41.63 ? 174  LEU C CD2 1 
ATOM   3105 N  N   . SER C 3 68  ? -9.075  -37.183 55.218  1.00 42.09 ? 175  SER C N   1 
ATOM   3106 C  CA  . SER C 3 68  ? -8.349  -37.484 56.437  1.00 42.00 ? 175  SER C CA  1 
ATOM   3107 C  C   . SER C 3 68  ? -7.517  -36.290 56.887  1.00 42.25 ? 175  SER C C   1 
ATOM   3108 O  O   . SER C 3 68  ? -6.761  -35.710 56.104  1.00 42.25 ? 175  SER C O   1 
ATOM   3109 C  CB  . SER C 3 68  ? -7.496  -38.747 56.296  1.00 41.83 ? 175  SER C CB  1 
ATOM   3110 O  OG  . SER C 3 68  ? -6.269  -38.496 55.647  1.00 41.84 ? 175  SER C OG  1 
ATOM   3111 N  N   . SER C 3 69  ? -7.699  -35.904 58.145  1.00 42.43 ? 176  SER C N   1 
ATOM   3112 C  CA  . SER C 3 69  ? -6.861  -34.897 58.774  1.00 42.57 ? 176  SER C CA  1 
ATOM   3113 C  C   . SER C 3 69  ? -5.977  -35.543 59.830  1.00 43.02 ? 176  SER C C   1 
ATOM   3114 O  O   . SER C 3 69  ? -6.419  -36.439 60.545  1.00 43.02 ? 176  SER C O   1 
ATOM   3115 C  CB  . SER C 3 69  ? -7.703  -33.793 59.404  1.00 42.17 ? 176  SER C CB  1 
ATOM   3116 O  OG  . SER C 3 69  ? -6.866  -32.732 59.818  1.00 41.25 ? 176  SER C OG  1 
ATOM   3117 N  N   . THR C 3 70  ? -4.734  -35.076 59.916  1.00 43.64 ? 177  THR C N   1 
ATOM   3118 C  CA  . THR C 3 70  ? -3.749  -35.595 60.853  1.00 44.10 ? 177  THR C CA  1 
ATOM   3119 C  C   . THR C 3 70  ? -3.137  -34.462 61.667  1.00 44.91 ? 177  THR C C   1 
ATOM   3120 O  O   . THR C 3 70  ? -2.478  -33.577 61.120  1.00 44.98 ? 177  THR C O   1 
ATOM   3121 C  CB  . THR C 3 70  ? -2.632  -36.333 60.105  1.00 44.00 ? 177  THR C CB  1 
ATOM   3122 O  OG1 . THR C 3 70  ? -3.198  -37.431 59.389  1.00 43.85 ? 177  THR C OG1 1 
ATOM   3123 C  CG2 . THR C 3 70  ? -1.565  -36.849 61.065  1.00 43.75 ? 177  THR C CG2 1 
ATOM   3124 N  N   . LEU C 3 71  ? -3.360  -34.495 62.976  1.00 45.95 ? 178  LEU C N   1 
ATOM   3125 C  CA  . LEU C 3 71  ? -2.694  -33.579 63.896  1.00 46.85 ? 178  LEU C CA  1 
ATOM   3126 C  C   . LEU C 3 71  ? -1.407  -34.211 64.408  1.00 47.63 ? 178  LEU C C   1 
ATOM   3127 O  O   . LEU C 3 71  ? -1.395  -35.378 64.793  1.00 47.76 ? 178  LEU C O   1 
ATOM   3128 C  CB  . LEU C 3 71  ? -3.617  -33.227 65.060  1.00 46.70 ? 178  LEU C CB  1 
ATOM   3129 C  CG  . LEU C 3 71  ? -3.052  -32.418 66.225  1.00 46.64 ? 178  LEU C CG  1 
ATOM   3130 C  CD1 . LEU C 3 71  ? -2.584  -31.046 65.768  1.00 47.21 ? 178  LEU C CD1 1 
ATOM   3131 C  CD2 . LEU C 3 71  ? -4.106  -32.291 67.302  1.00 46.82 ? 178  LEU C CD2 1 
ATOM   3132 N  N   . THR C 3 72  ? -0.327  -33.436 64.401  1.00 48.74 ? 179  THR C N   1 
ATOM   3133 C  CA  . THR C 3 72  ? 0.976   -33.911 64.866  1.00 49.74 ? 179  THR C CA  1 
ATOM   3134 C  C   . THR C 3 72  ? 1.403   -33.220 66.161  1.00 50.41 ? 179  THR C C   1 
ATOM   3135 O  O   . THR C 3 72  ? 1.309   -31.990 66.282  1.00 50.78 ? 179  THR C O   1 
ATOM   3136 C  CB  . THR C 3 72  ? 2.057   -33.757 63.758  1.00 49.86 ? 179  THR C CB  1 
ATOM   3137 O  OG1 . THR C 3 72  ? 2.035   -34.919 62.912  1.00 50.43 ? 179  THR C OG1 1 
ATOM   3138 C  CG2 . THR C 3 72  ? 3.473   -33.577 64.351  1.00 49.55 ? 179  THR C CG2 1 
ATOM   3139 N  N   . LEU C 3 73  ? 1.844   -34.026 67.129  1.00 51.00 ? 180  LEU C N   1 
ATOM   3140 C  CA  . LEU C 3 73  ? 2.410   -33.529 68.382  1.00 51.42 ? 180  LEU C CA  1 
ATOM   3141 C  C   . LEU C 3 73  ? 3.572   -34.411 68.767  1.00 51.80 ? 180  LEU C C   1 
ATOM   3142 O  O   . LEU C 3 73  ? 3.724   -35.509 68.236  1.00 51.73 ? 180  LEU C O   1 
ATOM   3143 C  CB  . LEU C 3 73  ? 1.381   -33.578 69.506  1.00 51.45 ? 180  LEU C CB  1 
ATOM   3144 C  CG  . LEU C 3 73  ? 0.075   -32.806 69.356  1.00 51.45 ? 180  LEU C CG  1 
ATOM   3145 C  CD1 . LEU C 3 73  ? -1.006  -33.510 70.141  1.00 51.13 ? 180  LEU C CD1 1 
ATOM   3146 C  CD2 . LEU C 3 73  ? 0.233   -31.353 69.796  1.00 52.30 ? 180  LEU C CD2 1 
ATOM   3147 N  N   . SER C 3 74  ? 4.394   -33.919 69.689  1.00 52.57 ? 181  SER C N   1 
ATOM   3148 C  CA  . SER C 3 74  ? 5.421   -34.742 70.325  1.00 53.38 ? 181  SER C CA  1 
ATOM   3149 C  C   . SER C 3 74  ? 4.793   -35.586 71.441  1.00 53.93 ? 181  SER C C   1 
ATOM   3150 O  O   . SER C 3 74  ? 3.789   -35.184 72.042  1.00 54.02 ? 181  SER C O   1 
ATOM   3151 C  CB  . SER C 3 74  ? 6.545   -33.865 70.882  1.00 53.24 ? 181  SER C CB  1 
ATOM   3152 O  OG  . SER C 3 74  ? 6.028   -32.818 71.687  1.00 53.17 ? 181  SER C OG  1 
ATOM   3153 N  N   . LYS C 3 75  ? 5.377   -36.757 71.703  1.00 54.54 ? 182  LYS C N   1 
ATOM   3154 C  CA  . LYS C 3 75  ? 4.929   -37.627 72.793  1.00 55.03 ? 182  LYS C CA  1 
ATOM   3155 C  C   . LYS C 3 75  ? 4.835   -36.839 74.104  1.00 55.21 ? 182  LYS C C   1 
ATOM   3156 O  O   . LYS C 3 75  ? 3.862   -36.972 74.844  1.00 55.25 ? 182  LYS C O   1 
ATOM   3157 C  CB  . LYS C 3 75  ? 5.878   -38.816 72.964  1.00 55.10 ? 182  LYS C CB  1 
ATOM   3158 C  CG  . LYS C 3 75  ? 5.297   -39.988 73.754  1.00 55.79 ? 182  LYS C CG  1 
ATOM   3159 C  CD  . LYS C 3 75  ? 6.206   -40.348 74.932  1.00 57.23 ? 182  LYS C CD  1 
ATOM   3160 C  CE  . LYS C 3 75  ? 6.348   -41.854 75.126  1.00 57.28 ? 182  LYS C CE  1 
ATOM   3161 N  NZ  . LYS C 3 75  ? 7.361   -42.429 74.188  1.00 57.34 ? 182  LYS C NZ  1 
ATOM   3162 N  N   . ALA C 3 76  ? 5.845   -36.015 74.378  1.00 55.45 ? 183  ALA C N   1 
ATOM   3163 C  CA  . ALA C 3 76  ? 5.836   -35.149 75.556  1.00 55.82 ? 183  ALA C CA  1 
ATOM   3164 C  C   . ALA C 3 76  ? 4.635   -34.186 75.586  1.00 56.10 ? 183  ALA C C   1 
ATOM   3165 O  O   . ALA C 3 76  ? 4.035   -33.978 76.641  1.00 56.12 ? 183  ALA C O   1 
ATOM   3166 C  CB  . ALA C 3 76  ? 7.149   -34.385 75.667  1.00 55.84 ? 183  ALA C CB  1 
ATOM   3167 N  N   . ASP C 3 77  ? 4.279   -33.613 74.436  1.00 56.42 ? 184  ASP C N   1 
ATOM   3168 C  CA  . ASP C 3 77  ? 3.133   -32.703 74.364  1.00 56.59 ? 184  ASP C CA  1 
ATOM   3169 C  C   . ASP C 3 77  ? 1.813   -33.437 74.435  1.00 56.73 ? 184  ASP C C   1 
ATOM   3170 O  O   . ASP C 3 77  ? 0.875   -32.967 75.077  1.00 56.92 ? 184  ASP C O   1 
ATOM   3171 C  CB  . ASP C 3 77  ? 3.173   -31.838 73.106  1.00 56.78 ? 184  ASP C CB  1 
ATOM   3172 C  CG  . ASP C 3 77  ? 3.608   -30.408 73.393  1.00 57.07 ? 184  ASP C CG  1 
ATOM   3173 O  OD1 . ASP C 3 77  ? 3.637   -30.005 74.577  1.00 57.89 ? 184  ASP C OD1 1 
ATOM   3174 O  OD2 . ASP C 3 77  ? 3.918   -29.681 72.431  1.00 56.65 ? 184  ASP C OD2 1 
ATOM   3175 N  N   . TYR C 3 78  ? 1.743   -34.585 73.769  1.00 56.73 ? 185  TYR C N   1 
ATOM   3176 C  CA  . TYR C 3 78  ? 0.551   -35.409 73.799  1.00 56.71 ? 185  TYR C CA  1 
ATOM   3177 C  C   . TYR C 3 78  ? 0.234   -35.833 75.230  1.00 57.16 ? 185  TYR C C   1 
ATOM   3178 O  O   . TYR C 3 78  ? -0.914  -35.755 75.668  1.00 57.37 ? 185  TYR C O   1 
ATOM   3179 C  CB  . TYR C 3 78  ? 0.713   -36.632 72.888  1.00 56.34 ? 185  TYR C CB  1 
ATOM   3180 C  CG  . TYR C 3 78  ? -0.493  -37.550 72.848  1.00 55.57 ? 185  TYR C CG  1 
ATOM   3181 C  CD1 . TYR C 3 78  ? -1.685  -37.139 72.260  1.00 54.98 ? 185  TYR C CD1 1 
ATOM   3182 C  CD2 . TYR C 3 78  ? -0.437  -38.833 73.390  1.00 55.02 ? 185  TYR C CD2 1 
ATOM   3183 C  CE1 . TYR C 3 78  ? -2.799  -37.979 72.221  1.00 55.28 ? 185  TYR C CE1 1 
ATOM   3184 C  CE2 . TYR C 3 78  ? -1.544  -39.687 73.349  1.00 54.84 ? 185  TYR C CE2 1 
ATOM   3185 C  CZ  . TYR C 3 78  ? -2.721  -39.253 72.762  1.00 55.27 ? 185  TYR C CZ  1 
ATOM   3186 O  OH  . TYR C 3 78  ? -3.825  -40.083 72.713  1.00 55.50 ? 185  TYR C OH  1 
ATOM   3187 N  N   . GLU C 3 79  ? 1.260   -36.262 75.961  1.00 57.66 ? 186  GLU C N   1 
ATOM   3188 C  CA  . GLU C 3 79  ? 1.087   -36.718 77.340  1.00 58.10 ? 186  GLU C CA  1 
ATOM   3189 C  C   . GLU C 3 79  ? 1.063   -35.565 78.335  1.00 58.13 ? 186  GLU C C   1 
ATOM   3190 O  O   . GLU C 3 79  ? 1.356   -35.741 79.521  1.00 58.49 ? 186  GLU C O   1 
ATOM   3191 C  CB  . GLU C 3 79  ? 2.149   -37.758 77.708  1.00 58.15 ? 186  GLU C CB  1 
ATOM   3192 C  CG  . GLU C 3 79  ? 1.680   -39.184 77.459  1.00 59.18 ? 186  GLU C CG  1 
ATOM   3193 C  CD  . GLU C 3 79  ? 2.805   -40.136 77.089  1.00 60.67 ? 186  GLU C CD  1 
ATOM   3194 O  OE1 . GLU C 3 79  ? 3.939   -39.975 77.607  1.00 60.62 ? 186  GLU C OE1 1 
ATOM   3195 O  OE2 . GLU C 3 79  ? 2.541   -41.054 76.273  1.00 61.27 ? 186  GLU C OE2 1 
ATOM   3196 N  N   . LYS C 3 80  ? 0.702   -34.386 77.836  1.00 58.04 ? 187  LYS C N   1 
ATOM   3197 C  CA  . LYS C 3 80  ? 0.511   -33.200 78.660  1.00 57.85 ? 187  LYS C CA  1 
ATOM   3198 C  C   . LYS C 3 80  ? -0.957  -32.734 78.613  1.00 57.44 ? 187  LYS C C   1 
ATOM   3199 O  O   . LYS C 3 80  ? -1.361  -31.855 79.378  1.00 57.48 ? 187  LYS C O   1 
ATOM   3200 C  CB  . LYS C 3 80  ? 1.497   -32.095 78.235  1.00 57.96 ? 187  LYS C CB  1 
ATOM   3201 C  CG  . LYS C 3 80  ? 1.354   -30.748 78.980  1.00 59.28 ? 187  LYS C CG  1 
ATOM   3202 C  CD  . LYS C 3 80  ? 2.694   -30.121 79.418  1.00 60.26 ? 187  LYS C CD  1 
ATOM   3203 C  CE  . LYS C 3 80  ? 3.443   -29.450 78.272  1.00 60.11 ? 187  LYS C CE  1 
ATOM   3204 N  NZ  . LYS C 3 80  ? 4.242   -30.432 77.482  1.00 60.17 ? 187  LYS C NZ  1 
ATOM   3205 N  N   . HIS C 3 81  ? -1.761  -33.343 77.741  1.00 56.78 ? 188  HIS C N   1 
ATOM   3206 C  CA  . HIS C 3 81  ? -3.148  -32.913 77.561  1.00 56.24 ? 188  HIS C CA  1 
ATOM   3207 C  C   . HIS C 3 81  ? -4.137  -34.070 77.603  1.00 55.78 ? 188  HIS C C   1 
ATOM   3208 O  O   . HIS C 3 81  ? -3.762  -35.217 77.387  1.00 55.58 ? 188  HIS C O   1 
ATOM   3209 C  CB  . HIS C 3 81  ? -3.294  -32.098 76.274  1.00 56.34 ? 188  HIS C CB  1 
ATOM   3210 C  CG  . HIS C 3 81  ? -2.465  -30.848 76.254  1.00 56.72 ? 188  HIS C CG  1 
ATOM   3211 N  ND1 . HIS C 3 81  ? -1.175  -30.816 75.766  1.00 56.56 ? 188  HIS C ND1 1 
ATOM   3212 C  CD2 . HIS C 3 81  ? -2.738  -29.589 76.674  1.00 56.92 ? 188  HIS C CD2 1 
ATOM   3213 C  CE1 . HIS C 3 81  ? -0.691  -29.592 75.881  1.00 56.37 ? 188  HIS C CE1 1 
ATOM   3214 N  NE2 . HIS C 3 81  ? -1.619  -28.829 76.430  1.00 56.73 ? 188  HIS C NE2 1 
ATOM   3215 N  N   . LYS C 3 82  ? -5.400  -33.754 77.882  1.00 55.59 ? 189  LYS C N   1 
ATOM   3216 C  CA  . LYS C 3 82  ? -6.422  -34.769 78.156  1.00 55.24 ? 189  LYS C CA  1 
ATOM   3217 C  C   . LYS C 3 82  ? -7.470  -34.909 77.039  1.00 54.71 ? 189  LYS C C   1 
ATOM   3218 O  O   . LYS C 3 82  ? -7.731  -36.022 76.575  1.00 54.71 ? 189  LYS C O   1 
ATOM   3219 C  CB  . LYS C 3 82  ? -7.073  -34.513 79.536  1.00 55.52 ? 189  LYS C CB  1 
ATOM   3220 C  CG  . LYS C 3 82  ? -8.180  -35.507 80.010  1.00 56.24 ? 189  LYS C CG  1 
ATOM   3221 C  CD  . LYS C 3 82  ? -7.795  -37.022 79.978  1.00 59.18 ? 189  LYS C CD  1 
ATOM   3222 C  CE  . LYS C 3 82  ? -6.665  -37.424 80.966  1.00 60.58 ? 189  LYS C CE  1 
ATOM   3223 N  NZ  . LYS C 3 82  ? -7.082  -37.599 82.396  1.00 60.01 ? 189  LYS C NZ  1 
ATOM   3224 N  N   . VAL C 3 83  ? -8.055  -33.790 76.609  1.00 53.93 ? 190  VAL C N   1 
ATOM   3225 C  CA  . VAL C 3 83  ? -9.113  -33.804 75.584  1.00 53.16 ? 190  VAL C CA  1 
ATOM   3226 C  C   . VAL C 3 83  ? -8.572  -33.467 74.182  1.00 52.60 ? 190  VAL C C   1 
ATOM   3227 O  O   . VAL C 3 83  ? -7.878  -32.465 73.986  1.00 52.50 ? 190  VAL C O   1 
ATOM   3228 C  CB  . VAL C 3 83  ? -10.304 -32.858 75.959  1.00 53.36 ? 190  VAL C CB  1 
ATOM   3229 C  CG1 . VAL C 3 83  ? -11.386 -32.858 74.869  1.00 53.02 ? 190  VAL C CG1 1 
ATOM   3230 C  CG2 . VAL C 3 83  ? -10.909 -33.244 77.313  1.00 53.26 ? 190  VAL C CG2 1 
ATOM   3231 N  N   . TYR C 3 84  ? -8.895  -34.326 73.219  1.00 51.71 ? 191  TYR C N   1 
ATOM   3232 C  CA  . TYR C 3 84  ? -8.473  -34.163 71.835  1.00 50.70 ? 191  TYR C CA  1 
ATOM   3233 C  C   . TYR C 3 84  ? -9.700  -34.233 70.953  1.00 50.39 ? 191  TYR C C   1 
ATOM   3234 O  O   . TYR C 3 84  ? -10.342 -35.280 70.857  1.00 50.26 ? 191  TYR C O   1 
ATOM   3235 C  CB  . TYR C 3 84  ? -7.468  -35.250 71.463  1.00 50.33 ? 191  TYR C CB  1 
ATOM   3236 C  CG  . TYR C 3 84  ? -6.119  -35.034 72.105  1.00 50.09 ? 191  TYR C CG  1 
ATOM   3237 C  CD1 . TYR C 3 84  ? -5.070  -34.467 71.385  1.00 49.71 ? 191  TYR C CD1 1 
ATOM   3238 C  CD2 . TYR C 3 84  ? -5.894  -35.377 73.438  1.00 49.73 ? 191  TYR C CD2 1 
ATOM   3239 C  CE1 . TYR C 3 84  ? -3.830  -34.261 71.975  1.00 49.75 ? 191  TYR C CE1 1 
ATOM   3240 C  CE2 . TYR C 3 84  ? -4.659  -35.167 74.035  1.00 49.67 ? 191  TYR C CE2 1 
ATOM   3241 C  CZ  . TYR C 3 84  ? -3.634  -34.608 73.299  1.00 49.52 ? 191  TYR C CZ  1 
ATOM   3242 O  OH  . TYR C 3 84  ? -2.411  -34.401 73.884  1.00 49.23 ? 191  TYR C OH  1 
ATOM   3243 N  N   . ALA C 3 85  ? -10.017 -33.105 70.321  1.00 50.09 ? 192  ALA C N   1 
ATOM   3244 C  CA  . ALA C 3 85  ? -11.315 -32.898 69.675  1.00 49.94 ? 192  ALA C CA  1 
ATOM   3245 C  C   . ALA C 3 85  ? -11.223 -32.585 68.187  1.00 49.77 ? 192  ALA C C   1 
ATOM   3246 O  O   . ALA C 3 85  ? -10.489 -31.685 67.778  1.00 49.86 ? 192  ALA C O   1 
ATOM   3247 C  CB  . ALA C 3 85  ? -12.086 -31.793 70.396  1.00 49.70 ? 192  ALA C CB  1 
ATOM   3248 N  N   . CYS C 3 86  ? -11.981 -33.332 67.389  1.00 49.59 ? 193  CYS C N   1 
ATOM   3249 C  CA  . CYS C 3 86  ? -12.094 -33.085 65.955  1.00 49.38 ? 193  CYS C CA  1 
ATOM   3250 C  C   . CYS C 3 86  ? -13.486 -32.554 65.638  1.00 49.31 ? 193  CYS C C   1 
ATOM   3251 O  O   . CYS C 3 86  ? -14.481 -33.266 65.792  1.00 49.11 ? 193  CYS C O   1 
ATOM   3252 C  CB  . CYS C 3 86  ? -11.816 -34.359 65.139  1.00 49.34 ? 193  CYS C CB  1 
ATOM   3253 S  SG  . CYS C 3 86  ? -12.256 -34.154 63.394  1.00 49.71 ? 193  CYS C SG  1 
ATOM   3254 N  N   . GLU C 3 87  ? -13.547 -31.304 65.186  1.00 49.42 ? 194  GLU C N   1 
ATOM   3255 C  CA  . GLU C 3 87  ? -14.817 -30.643 64.888  1.00 49.46 ? 194  GLU C CA  1 
ATOM   3256 C  C   . GLU C 3 87  ? -14.998 -30.441 63.383  1.00 49.18 ? 194  GLU C C   1 
ATOM   3257 O  O   . GLU C 3 87  ? -14.089 -29.961 62.701  1.00 49.08 ? 194  GLU C O   1 
ATOM   3258 C  CB  . GLU C 3 87  ? -14.889 -29.309 65.624  1.00 49.56 ? 194  GLU C CB  1 
ATOM   3259 C  CG  . GLU C 3 87  ? -16.264 -28.674 65.633  1.00 50.64 ? 194  GLU C CG  1 
ATOM   3260 C  CD  . GLU C 3 87  ? -16.214 -27.191 65.932  1.00 51.82 ? 194  GLU C CD  1 
ATOM   3261 O  OE1 . GLU C 3 87  ? -15.099 -26.634 66.041  1.00 52.45 ? 194  GLU C OE1 1 
ATOM   3262 O  OE2 . GLU C 3 87  ? -17.294 -26.579 66.052  1.00 53.17 ? 194  GLU C OE2 1 
ATOM   3263 N  N   . VAL C 3 88  ? -16.179 -30.801 62.877  1.00 48.89 ? 195  VAL C N   1 
ATOM   3264 C  CA  . VAL C 3 88  ? -16.423 -30.855 61.432  1.00 48.58 ? 195  VAL C CA  1 
ATOM   3265 C  C   . VAL C 3 88  ? -17.637 -30.045 60.969  1.00 48.78 ? 195  VAL C C   1 
ATOM   3266 O  O   . VAL C 3 88  ? -18.768 -30.285 61.395  1.00 48.92 ? 195  VAL C O   1 
ATOM   3267 C  CB  . VAL C 3 88  ? -16.547 -32.308 60.944  1.00 48.34 ? 195  VAL C CB  1 
ATOM   3268 C  CG1 . VAL C 3 88  ? -16.973 -32.358 59.489  1.00 47.94 ? 195  VAL C CG1 1 
ATOM   3269 C  CG2 . VAL C 3 88  ? -15.233 -33.035 61.143  1.00 47.94 ? 195  VAL C CG2 1 
ATOM   3270 N  N   . THR C 3 89  ? -17.382 -29.092 60.081  1.00 48.92 ? 196  THR C N   1 
ATOM   3271 C  CA  . THR C 3 89  ? -18.435 -28.294 59.481  1.00 48.97 ? 196  THR C CA  1 
ATOM   3272 C  C   . THR C 3 89  ? -18.563 -28.713 58.030  1.00 49.10 ? 196  THR C C   1 
ATOM   3273 O  O   . THR C 3 89  ? -17.562 -28.958 57.354  1.00 49.19 ? 196  THR C O   1 
ATOM   3274 C  CB  . THR C 3 89  ? -18.126 -26.796 59.570  1.00 49.00 ? 196  THR C CB  1 
ATOM   3275 O  OG1 . THR C 3 89  ? -17.465 -26.527 60.813  1.00 48.82 ? 196  THR C OG1 1 
ATOM   3276 C  CG2 . THR C 3 89  ? -19.408 -25.973 59.480  1.00 48.69 ? 196  THR C CG2 1 
ATOM   3277 N  N   . HIS C 3 90  ? -19.806 -28.814 57.572  1.00 49.13 ? 197  HIS C N   1 
ATOM   3278 C  CA  . HIS C 3 90  ? -20.126 -29.267 56.232  1.00 49.22 ? 197  HIS C CA  1 
ATOM   3279 C  C   . HIS C 3 90  ? -21.596 -28.986 55.980  1.00 49.51 ? 197  HIS C C   1 
ATOM   3280 O  O   . HIS C 3 90  ? -22.424 -29.177 56.866  1.00 49.72 ? 197  HIS C O   1 
ATOM   3281 C  CB  . HIS C 3 90  ? -19.860 -30.766 56.093  1.00 49.10 ? 197  HIS C CB  1 
ATOM   3282 C  CG  . HIS C 3 90  ? -20.243 -31.322 54.759  1.00 48.88 ? 197  HIS C CG  1 
ATOM   3283 N  ND1 . HIS C 3 90  ? -19.356 -31.415 53.709  1.00 48.63 ? 197  HIS C ND1 1 
ATOM   3284 C  CD2 . HIS C 3 90  ? -21.421 -31.801 54.299  1.00 48.78 ? 197  HIS C CD2 1 
ATOM   3285 C  CE1 . HIS C 3 90  ? -19.970 -31.934 52.662  1.00 49.26 ? 197  HIS C CE1 1 
ATOM   3286 N  NE2 . HIS C 3 90  ? -21.225 -32.177 52.994  1.00 49.37 ? 197  HIS C NE2 1 
ATOM   3287 N  N   . GLN C 3 91  ? -21.924 -28.550 54.770  1.00 49.77 ? 198  GLN C N   1 
ATOM   3288 C  CA  . GLN C 3 91  ? -23.281 -28.108 54.467  1.00 50.09 ? 198  GLN C CA  1 
ATOM   3289 C  C   . GLN C 3 91  ? -24.371 -29.185 54.642  1.00 50.21 ? 198  GLN C C   1 
ATOM   3290 O  O   . GLN C 3 91  ? -25.565 -28.877 54.585  1.00 50.31 ? 198  GLN C O   1 
ATOM   3291 C  CB  . GLN C 3 91  ? -23.348 -27.474 53.072  1.00 50.12 ? 198  GLN C CB  1 
ATOM   3292 C  CG  . GLN C 3 91  ? -23.238 -28.455 51.912  1.00 50.15 ? 198  GLN C CG  1 
ATOM   3293 C  CD  . GLN C 3 91  ? -23.993 -27.972 50.687  1.00 50.02 ? 198  GLN C CD  1 
ATOM   3294 O  OE1 . GLN C 3 91  ? -25.227 -28.016 50.643  1.00 49.93 ? 198  GLN C OE1 1 
ATOM   3295 N  NE2 . GLN C 3 91  ? -23.257 -27.508 49.688  1.00 48.90 ? 198  GLN C NE2 1 
ATOM   3296 N  N   . GLY C 3 92  ? -23.961 -30.431 54.863  1.00 50.19 ? 199  GLY C N   1 
ATOM   3297 C  CA  . GLY C 3 92  ? -24.905 -31.538 55.049  1.00 50.51 ? 199  GLY C CA  1 
ATOM   3298 C  C   . GLY C 3 92  ? -25.273 -31.787 56.504  1.00 50.71 ? 199  GLY C C   1 
ATOM   3299 O  O   . GLY C 3 92  ? -26.061 -32.686 56.814  1.00 50.79 ? 199  GLY C O   1 
ATOM   3300 N  N   . LEU C 3 93  ? -24.689 -30.989 57.392  1.00 50.67 ? 200  LEU C N   1 
ATOM   3301 C  CA  . LEU C 3 93  ? -24.950 -31.072 58.811  1.00 50.73 ? 200  LEU C CA  1 
ATOM   3302 C  C   . LEU C 3 93  ? -25.572 -29.762 59.258  1.00 51.18 ? 200  LEU C C   1 
ATOM   3303 O  O   . LEU C 3 93  ? -25.084 -28.677 58.901  1.00 51.13 ? 200  LEU C O   1 
ATOM   3304 C  CB  . LEU C 3 93  ? -23.650 -31.284 59.584  1.00 50.56 ? 200  LEU C CB  1 
ATOM   3305 C  CG  . LEU C 3 93  ? -22.698 -32.448 59.312  1.00 50.23 ? 200  LEU C CG  1 
ATOM   3306 C  CD1 . LEU C 3 93  ? -21.398 -32.199 60.061  1.00 50.18 ? 200  LEU C CD1 1 
ATOM   3307 C  CD2 . LEU C 3 93  ? -23.287 -33.783 59.718  1.00 49.67 ? 200  LEU C CD2 1 
ATOM   3308 N  N   . SER C 3 94  ? -26.639 -29.867 60.050  1.00 51.61 ? 201  SER C N   1 
ATOM   3309 C  CA  . SER C 3 94  ? -27.345 -28.692 60.582  1.00 52.00 ? 201  SER C CA  1 
ATOM   3310 C  C   . SER C 3 94  ? -26.438 -27.783 61.431  1.00 52.14 ? 201  SER C C   1 
ATOM   3311 O  O   . SER C 3 94  ? -26.637 -26.565 61.477  1.00 52.10 ? 201  SER C O   1 
ATOM   3312 C  CB  . SER C 3 94  ? -28.580 -29.124 61.375  1.00 51.94 ? 201  SER C CB  1 
ATOM   3313 O  OG  . SER C 3 94  ? -28.310 -30.291 62.134  1.00 52.36 ? 201  SER C OG  1 
ATOM   3314 N  N   . SER C 3 95  ? -25.449 -28.390 62.090  1.00 52.28 ? 202  SER C N   1 
ATOM   3315 C  CA  . SER C 3 95  ? -24.437 -27.672 62.877  1.00 52.36 ? 202  SER C CA  1 
ATOM   3316 C  C   . SER C 3 95  ? -23.194 -28.553 63.082  1.00 52.45 ? 202  SER C C   1 
ATOM   3317 O  O   . SER C 3 95  ? -23.285 -29.780 62.983  1.00 52.33 ? 202  SER C O   1 
ATOM   3318 C  CB  . SER C 3 95  ? -25.009 -27.209 64.228  1.00 52.39 ? 202  SER C CB  1 
ATOM   3319 O  OG  . SER C 3 95  ? -25.420 -28.306 65.025  1.00 52.23 ? 202  SER C OG  1 
ATOM   3320 N  N   . PRO C 3 96  ? -22.030 -27.927 63.358  1.00 52.55 ? 203  PRO C N   1 
ATOM   3321 C  CA  . PRO C 3 96  ? -20.760 -28.637 63.512  1.00 52.59 ? 203  PRO C CA  1 
ATOM   3322 C  C   . PRO C 3 96  ? -20.820 -29.815 64.475  1.00 52.64 ? 203  PRO C C   1 
ATOM   3323 O  O   . PRO C 3 96  ? -21.095 -29.639 65.666  1.00 52.98 ? 203  PRO C O   1 
ATOM   3324 C  CB  . PRO C 3 96  ? -19.823 -27.558 64.061  1.00 52.60 ? 203  PRO C CB  1 
ATOM   3325 C  CG  . PRO C 3 96  ? -20.354 -26.302 63.502  1.00 52.72 ? 203  PRO C CG  1 
ATOM   3326 C  CD  . PRO C 3 96  ? -21.850 -26.471 63.519  1.00 52.81 ? 203  PRO C CD  1 
ATOM   3327 N  N   . VAL C 3 97  ? -20.565 -31.006 63.947  1.00 52.40 ? 204  VAL C N   1 
ATOM   3328 C  CA  . VAL C 3 97  ? -20.480 -32.208 64.753  1.00 52.20 ? 204  VAL C CA  1 
ATOM   3329 C  C   . VAL C 3 97  ? -19.058 -32.345 65.280  1.00 52.16 ? 204  VAL C C   1 
ATOM   3330 O  O   . VAL C 3 97  ? -18.098 -32.153 64.532  1.00 52.41 ? 204  VAL C O   1 
ATOM   3331 C  CB  . VAL C 3 97  ? -20.910 -33.440 63.931  1.00 52.19 ? 204  VAL C CB  1 
ATOM   3332 C  CG1 . VAL C 3 97  ? -20.133 -34.687 64.333  1.00 52.09 ? 204  VAL C CG1 1 
ATOM   3333 C  CG2 . VAL C 3 97  ? -22.416 -33.651 64.062  1.00 52.25 ? 204  VAL C CG2 1 
ATOM   3334 N  N   . THR C 3 98  ? -18.934 -32.659 66.568  1.00 51.88 ? 205  THR C N   1 
ATOM   3335 C  CA  . THR C 3 98  ? -17.638 -32.820 67.218  1.00 51.71 ? 205  THR C CA  1 
ATOM   3336 C  C   . THR C 3 98  ? -17.391 -34.281 67.581  1.00 51.73 ? 205  THR C C   1 
ATOM   3337 O  O   . THR C 3 98  ? -18.291 -34.964 68.045  1.00 51.82 ? 205  THR C O   1 
ATOM   3338 C  CB  . THR C 3 98  ? -17.566 -31.956 68.481  1.00 51.67 ? 205  THR C CB  1 
ATOM   3339 O  OG1 . THR C 3 98  ? -17.907 -30.608 68.141  1.00 51.83 ? 205  THR C OG1 1 
ATOM   3340 C  CG2 . THR C 3 98  ? -16.171 -31.987 69.100  1.00 51.44 ? 205  THR C CG2 1 
ATOM   3341 N  N   . LYS C 3 99  ? -16.174 -34.760 67.347  1.00 51.93 ? 206  LYS C N   1 
ATOM   3342 C  CA  . LYS C 3 99  ? -15.784 -36.120 67.721  1.00 52.30 ? 206  LYS C CA  1 
ATOM   3343 C  C   . LYS C 3 99  ? -14.479 -36.075 68.491  1.00 52.43 ? 206  LYS C C   1 
ATOM   3344 O  O   . LYS C 3 99  ? -13.487 -35.538 68.002  1.00 52.46 ? 206  LYS C O   1 
ATOM   3345 C  CB  . LYS C 3 99  ? -15.644 -37.021 66.493  1.00 52.22 ? 206  LYS C CB  1 
ATOM   3346 C  CG  . LYS C 3 99  ? -16.871 -37.873 66.197  1.00 53.09 ? 206  LYS C CG  1 
ATOM   3347 C  CD  . LYS C 3 99  ? -16.835 -39.195 66.965  1.00 55.23 ? 206  LYS C CD  1 
ATOM   3348 C  CE  . LYS C 3 99  ? -18.103 -40.027 66.737  1.00 56.07 ? 206  LYS C CE  1 
ATOM   3349 N  NZ  . LYS C 3 99  ? -17.999 -41.372 67.380  1.00 56.27 ? 206  LYS C NZ  1 
ATOM   3350 N  N   . SER C 3 100 ? -14.480 -36.639 69.696  1.00 52.53 ? 207  SER C N   1 
ATOM   3351 C  CA  . SER C 3 100 ? -13.339 -36.503 70.590  1.00 52.56 ? 207  SER C CA  1 
ATOM   3352 C  C   . SER C 3 100 ? -13.066 -37.748 71.409  1.00 52.79 ? 207  SER C C   1 
ATOM   3353 O  O   . SER C 3 100 ? -13.833 -38.712 71.380  1.00 52.52 ? 207  SER C O   1 
ATOM   3354 C  CB  . SER C 3 100 ? -13.543 -35.307 71.525  1.00 52.51 ? 207  SER C CB  1 
ATOM   3355 O  OG  . SER C 3 100 ? -14.828 -35.331 72.120  1.00 52.38 ? 207  SER C OG  1 
ATOM   3356 N  N   . PHE C 3 101 ? -11.951 -37.707 72.134  1.00 53.27 ? 208  PHE C N   1 
ATOM   3357 C  CA  . PHE C 3 101 ? -11.607 -38.725 73.119  1.00 53.68 ? 208  PHE C CA  1 
ATOM   3358 C  C   . PHE C 3 101 ? -10.782 -38.121 74.256  1.00 54.14 ? 208  PHE C C   1 
ATOM   3359 O  O   . PHE C 3 101 ? -10.144 -37.086 74.083  1.00 54.21 ? 208  PHE C O   1 
ATOM   3360 C  CB  . PHE C 3 101 ? -10.858 -39.893 72.461  1.00 53.39 ? 208  PHE C CB  1 
ATOM   3361 C  CG  . PHE C 3 101 ? -9.465  -39.554 72.012  1.00 53.12 ? 208  PHE C CG  1 
ATOM   3362 C  CD1 . PHE C 3 101 ? -8.376  -39.787 72.844  1.00 52.43 ? 208  PHE C CD1 1 
ATOM   3363 C  CD2 . PHE C 3 101 ? -9.238  -39.012 70.749  1.00 53.06 ? 208  PHE C CD2 1 
ATOM   3364 C  CE1 . PHE C 3 101 ? -7.078  -39.478 72.433  1.00 52.46 ? 208  PHE C CE1 1 
ATOM   3365 C  CE2 . PHE C 3 101 ? -7.946  -38.699 70.329  1.00 52.63 ? 208  PHE C CE2 1 
ATOM   3366 C  CZ  . PHE C 3 101 ? -6.863  -38.934 71.173  1.00 52.74 ? 208  PHE C CZ  1 
ATOM   3367 N  N   . ASN C 3 102 ? -10.819 -38.761 75.421  1.00 54.97 ? 209  ASN C N   1 
ATOM   3368 C  CA  . ASN C 3 102 ? -9.911  -38.426 76.512  1.00 55.72 ? 209  ASN C CA  1 
ATOM   3369 C  C   . ASN C 3 102 ? -8.729  -39.368 76.481  1.00 56.47 ? 209  ASN C C   1 
ATOM   3370 O  O   . ASN C 3 102 ? -8.906  -40.577 76.311  1.00 56.63 ? 209  ASN C O   1 
ATOM   3371 C  CB  . ASN C 3 102 ? -10.612 -38.535 77.861  1.00 55.61 ? 209  ASN C CB  1 
ATOM   3372 C  CG  . ASN C 3 102 ? -11.650 -37.468 78.056  1.00 55.47 ? 209  ASN C CG  1 
ATOM   3373 O  OD1 . ASN C 3 102 ? -12.739 -37.536 77.494  1.00 55.66 ? 209  ASN C OD1 1 
ATOM   3374 N  ND2 . ASN C 3 102 ? -11.319 -36.467 78.855  1.00 55.77 ? 209  ASN C ND2 1 
ATOM   3375 N  N   . ARG C 3 103 ? -7.526  -38.824 76.641  1.00 57.46 ? 210  ARG C N   1 
ATOM   3376 C  CA  . ARG C 3 103 ? -6.316  -39.644 76.623  1.00 58.60 ? 210  ARG C CA  1 
ATOM   3377 C  C   . ARG C 3 103 ? -6.329  -40.628 77.795  1.00 59.36 ? 210  ARG C C   1 
ATOM   3378 O  O   . ARG C 3 103 ? -6.419  -40.211 78.966  1.00 59.64 ? 210  ARG C O   1 
ATOM   3379 C  CB  . ARG C 3 103 ? -5.068  -38.770 76.672  1.00 58.58 ? 210  ARG C CB  1 
ATOM   3380 C  CG  . ARG C 3 103 ? -3.811  -39.487 76.220  1.00 59.18 ? 210  ARG C CG  1 
ATOM   3381 C  CD  . ARG C 3 103 ? -2.702  -39.364 77.251  1.00 60.69 ? 210  ARG C CD  1 
ATOM   3382 N  NE  . ARG C 3 103 ? -2.771  -38.100 77.976  1.00 61.57 ? 210  ARG C NE  1 
ATOM   3383 C  CZ  . ARG C 3 103 ? -1.964  -37.759 78.975  1.00 62.08 ? 210  ARG C CZ  1 
ATOM   3384 N  NH1 . ARG C 3 103 ? -1.008  -38.590 79.372  1.00 62.24 ? 210  ARG C NH1 1 
ATOM   3385 N  NH2 . ARG C 3 103 ? -2.110  -36.582 79.573  1.00 62.33 ? 210  ARG C NH2 1 
ATOM   3386 N  N   . GLY C 3 104 ? -6.254  -41.923 77.464  1.00 60.06 ? 211  GLY C N   1 
ATOM   3387 C  CA  . GLY C 3 104 ? -6.406  -43.026 78.430  1.00 60.75 ? 211  GLY C CA  1 
ATOM   3388 C  C   . GLY C 3 104 ? -7.865  -43.411 78.685  1.00 61.22 ? 211  GLY C C   1 
ATOM   3389 O  O   . GLY C 3 104 ? -8.411  -43.102 79.750  1.00 61.27 ? 211  GLY C O   1 
ATOM   3390 N  N   . GLU C 3 105 ? -8.477  -44.090 77.705  1.00 61.59 ? 212  GLU C N   1 
ATOM   3391 C  CA  . GLU C 3 105 ? -9.906  -44.505 77.708  1.00 61.80 ? 212  GLU C CA  1 
ATOM   3392 C  C   . GLU C 3 105 ? -10.810 -43.823 78.751  1.00 61.91 ? 212  GLU C C   1 
ATOM   3393 O  O   . GLU C 3 105 ? -11.041 -42.607 78.709  1.00 61.85 ? 212  GLU C O   1 
ATOM   3394 C  CB  . GLU C 3 105 ? -10.034 -46.046 77.795  1.00 61.71 ? 212  GLU C CB  1 
ATOM   3395 N  N   . GLN D 4 1   ? 1.277   -48.462 18.881  1.00 41.84 ? 1    GLN D N   1 
ATOM   3396 C  CA  . GLN D 4 1   ? 2.609   -49.145 18.878  1.00 41.31 ? 1    GLN D CA  1 
ATOM   3397 C  C   . GLN D 4 1   ? 3.735   -48.141 18.547  1.00 40.40 ? 1    GLN D C   1 
ATOM   3398 O  O   . GLN D 4 1   ? 4.928   -48.446 18.742  1.00 40.38 ? 1    GLN D O   1 
ATOM   3399 C  CB  . GLN D 4 1   ? 2.591   -50.373 17.942  1.00 41.85 ? 1    GLN D CB  1 
ATOM   3400 C  CG  . GLN D 4 1   ? 3.879   -51.227 17.924  1.00 43.08 ? 1    GLN D CG  1 
ATOM   3401 C  CD  . GLN D 4 1   ? 4.696   -51.052 16.627  1.00 47.53 ? 1    GLN D CD  1 
ATOM   3402 O  OE1 . GLN D 4 1   ? 4.267   -50.350 15.690  1.00 47.64 ? 1    GLN D OE1 1 
ATOM   3403 N  NE2 . GLN D 4 1   ? 5.873   -51.703 16.565  1.00 47.81 ? 1    GLN D NE2 1 
ATOM   3404 N  N   . VAL D 4 2   ? 3.337   -46.960 18.048  1.00 38.69 ? 2    VAL D N   1 
ATOM   3405 C  CA  . VAL D 4 2   ? 4.182   -45.760 18.059  1.00 36.80 ? 2    VAL D CA  1 
ATOM   3406 C  C   . VAL D 4 2   ? 4.074   -45.151 19.448  1.00 35.80 ? 2    VAL D C   1 
ATOM   3407 O  O   . VAL D 4 2   ? 2.971   -44.826 19.915  1.00 35.56 ? 2    VAL D O   1 
ATOM   3408 C  CB  . VAL D 4 2   ? 3.735   -44.699 17.021  1.00 36.97 ? 2    VAL D CB  1 
ATOM   3409 C  CG1 . VAL D 4 2   ? 4.499   -43.376 17.220  1.00 35.59 ? 2    VAL D CG1 1 
ATOM   3410 C  CG2 . VAL D 4 2   ? 3.911   -45.222 15.596  1.00 36.99 ? 2    VAL D CG2 1 
ATOM   3411 N  N   . GLN D 4 3   ? 5.214   -44.996 20.110  1.00 34.25 ? 3    GLN D N   1 
ATOM   3412 C  CA  . GLN D 4 3   ? 5.214   -44.545 21.496  1.00 33.33 ? 3    GLN D CA  1 
ATOM   3413 C  C   . GLN D 4 3   ? 6.472   -43.773 21.895  1.00 31.89 ? 3    GLN D C   1 
ATOM   3414 O  O   . GLN D 4 3   ? 7.498   -43.848 21.220  1.00 31.98 ? 3    GLN D O   1 
ATOM   3415 C  CB  . GLN D 4 3   ? 4.961   -45.731 22.456  1.00 33.34 ? 3    GLN D CB  1 
ATOM   3416 C  CG  . GLN D 4 3   ? 5.708   -47.036 22.122  1.00 33.53 ? 3    GLN D CG  1 
ATOM   3417 C  CD  . GLN D 4 3   ? 5.841   -47.990 23.323  1.00 34.57 ? 3    GLN D CD  1 
ATOM   3418 O  OE1 . GLN D 4 3   ? 6.602   -48.955 23.270  1.00 36.76 ? 3    GLN D OE1 1 
ATOM   3419 N  NE2 . GLN D 4 3   ? 5.114   -47.711 24.409  1.00 35.95 ? 3    GLN D NE2 1 
ATOM   3420 N  N   . LEU D 4 4   ? 6.369   -43.025 22.990  1.00 30.18 ? 4    LEU D N   1 
ATOM   3421 C  CA  . LEU D 4 4   ? 7.506   -42.354 23.592  1.00 28.71 ? 4    LEU D CA  1 
ATOM   3422 C  C   . LEU D 4 4   ? 7.692   -42.866 25.016  1.00 28.16 ? 4    LEU D C   1 
ATOM   3423 O  O   . LEU D 4 4   ? 6.800   -42.732 25.853  1.00 28.14 ? 4    LEU D O   1 
ATOM   3424 C  CB  . LEU D 4 4   ? 7.288   -40.845 23.623  1.00 28.65 ? 4    LEU D CB  1 
ATOM   3425 C  CG  . LEU D 4 4   ? 7.089   -40.099 22.308  1.00 28.16 ? 4    LEU D CG  1 
ATOM   3426 C  CD1 . LEU D 4 4   ? 6.357   -38.807 22.570  1.00 27.45 ? 4    LEU D CD1 1 
ATOM   3427 C  CD2 . LEU D 4 4   ? 8.414   -39.865 21.597  1.00 26.76 ? 4    LEU D CD2 1 
ATOM   3428 N  N   . VAL D 4 5   ? 8.858   -43.442 25.287  1.00 27.12 ? 5    VAL D N   1 
ATOM   3429 C  CA  . VAL D 4 5   ? 9.118   -44.084 26.565  1.00 26.35 ? 5    VAL D CA  1 
ATOM   3430 C  C   . VAL D 4 5   ? 10.230  -43.346 27.303  1.00 25.98 ? 5    VAL D C   1 
ATOM   3431 O  O   . VAL D 4 5   ? 11.335  -43.174 26.785  1.00 26.00 ? 5    VAL D O   1 
ATOM   3432 C  CB  . VAL D 4 5   ? 9.457   -45.612 26.381  1.00 26.55 ? 5    VAL D CB  1 
ATOM   3433 C  CG1 . VAL D 4 5   ? 9.866   -46.264 27.715  1.00 24.84 ? 5    VAL D CG1 1 
ATOM   3434 C  CG2 . VAL D 4 5   ? 8.287   -46.338 25.732  1.00 25.03 ? 5    VAL D CG2 1 
ATOM   3435 N  N   . GLN D 4 6   ? 9.931   -42.917 28.519  1.00 25.48 ? 6    GLN D N   1 
ATOM   3436 C  CA  . GLN D 4 6   ? 10.868  -42.101 29.283  1.00 25.30 ? 6    GLN D CA  1 
ATOM   3437 C  C   . GLN D 4 6   ? 11.642  -42.928 30.288  1.00 25.16 ? 6    GLN D C   1 
ATOM   3438 O  O   . GLN D 4 6   ? 11.166  -43.978 30.712  1.00 25.14 ? 6    GLN D O   1 
ATOM   3439 C  CB  . GLN D 4 6   ? 10.127  -40.977 30.003  1.00 24.84 ? 6    GLN D CB  1 
ATOM   3440 C  CG  . GLN D 4 6   ? 9.662   -39.892 29.083  1.00 24.23 ? 6    GLN D CG  1 
ATOM   3441 C  CD  . GLN D 4 6   ? 8.725   -38.910 29.748  1.00 24.35 ? 6    GLN D CD  1 
ATOM   3442 O  OE1 . GLN D 4 6   ? 7.602   -38.701 29.278  1.00 24.07 ? 6    GLN D OE1 1 
ATOM   3443 N  NE2 . GLN D 4 6   ? 9.175   -38.297 30.844  1.00 23.19 ? 6    GLN D NE2 1 
ATOM   3444 N  N   . SER D 4 7   ? 12.827  -42.439 30.661  1.00 25.01 ? 7    SER D N   1 
ATOM   3445 C  CA  . SER D 4 7   ? 13.610  -42.985 31.779  1.00 24.77 ? 7    SER D CA  1 
ATOM   3446 C  C   . SER D 4 7   ? 12.833  -42.884 33.099  1.00 24.83 ? 7    SER D C   1 
ATOM   3447 O  O   . SER D 4 7   ? 11.803  -42.221 33.167  1.00 24.52 ? 7    SER D O   1 
ATOM   3448 C  CB  . SER D 4 7   ? 14.951  -42.255 31.895  1.00 24.70 ? 7    SER D CB  1 
ATOM   3449 O  OG  . SER D 4 7   ? 14.778  -40.893 32.263  1.00 23.91 ? 7    SER D OG  1 
ATOM   3450 N  N   . GLY D 4 8   ? 13.330  -43.541 34.141  1.00 25.07 ? 8    GLY D N   1 
ATOM   3451 C  CA  . GLY D 4 8   ? 12.556  -43.719 35.369  1.00 25.71 ? 8    GLY D CA  1 
ATOM   3452 C  C   . GLY D 4 8   ? 12.680  -42.593 36.374  1.00 26.36 ? 8    GLY D C   1 
ATOM   3453 O  O   . GLY D 4 8   ? 13.468  -41.652 36.180  1.00 26.79 ? 8    GLY D O   1 
ATOM   3454 N  N   . ALA D 4 9   ? 11.905  -42.699 37.456  1.00 26.50 ? 9    ALA D N   1 
ATOM   3455 C  CA  . ALA D 4 9   ? 11.912  -41.726 38.547  1.00 26.75 ? 9    ALA D CA  1 
ATOM   3456 C  C   . ALA D 4 9   ? 13.317  -41.384 39.062  1.00 27.22 ? 9    ALA D C   1 
ATOM   3457 O  O   . ALA D 4 9   ? 14.186  -42.255 39.136  1.00 27.05 ? 9    ALA D O   1 
ATOM   3458 C  CB  . ALA D 4 9   ? 11.054  -42.229 39.671  1.00 26.55 ? 9    ALA D CB  1 
ATOM   3459 N  N   . GLU D 4 10  ? 13.529  -40.113 39.408  1.00 28.03 ? 10   GLU D N   1 
ATOM   3460 C  CA  . GLU D 4 10  ? 14.796  -39.648 40.016  1.00 28.82 ? 10   GLU D CA  1 
ATOM   3461 C  C   . GLU D 4 10  ? 14.565  -38.966 41.369  1.00 28.99 ? 10   GLU D C   1 
ATOM   3462 O  O   . GLU D 4 10  ? 13.465  -38.452 41.640  1.00 28.96 ? 10   GLU D O   1 
ATOM   3463 C  CB  . GLU D 4 10  ? 15.498  -38.639 39.106  1.00 28.92 ? 10   GLU D CB  1 
ATOM   3464 C  CG  . GLU D 4 10  ? 15.668  -39.077 37.666  1.00 30.18 ? 10   GLU D CG  1 
ATOM   3465 C  CD  . GLU D 4 10  ? 17.068  -39.552 37.343  1.00 31.66 ? 10   GLU D CD  1 
ATOM   3466 O  OE1 . GLU D 4 10  ? 17.998  -39.334 38.152  1.00 32.15 ? 10   GLU D OE1 1 
ATOM   3467 O  OE2 . GLU D 4 10  ? 17.242  -40.141 36.259  1.00 33.02 ? 10   GLU D OE2 1 
ATOM   3468 N  N   . VAL D 4 11  ? 15.602  -38.959 42.209  1.00 29.02 ? 11   VAL D N   1 
ATOM   3469 C  CA  . VAL D 4 11  ? 15.621  -38.100 43.391  1.00 29.37 ? 11   VAL D CA  1 
ATOM   3470 C  C   . VAL D 4 11  ? 16.951  -37.351 43.431  1.00 29.91 ? 11   VAL D C   1 
ATOM   3471 O  O   . VAL D 4 11  ? 18.023  -37.954 43.265  1.00 29.88 ? 11   VAL D O   1 
ATOM   3472 C  CB  . VAL D 4 11  ? 15.344  -38.864 44.732  1.00 29.43 ? 11   VAL D CB  1 
ATOM   3473 C  CG1 . VAL D 4 11  ? 14.229  -39.897 44.570  1.00 28.97 ? 11   VAL D CG1 1 
ATOM   3474 C  CG2 . VAL D 4 11  ? 16.587  -39.525 45.259  1.00 29.80 ? 11   VAL D CG2 1 
ATOM   3475 N  N   . LYS D 4 12  ? 16.881  -36.036 43.630  1.00 30.43 ? 12   LYS D N   1 
ATOM   3476 C  CA  . LYS D 4 12  ? 18.070  -35.185 43.566  1.00 31.17 ? 12   LYS D CA  1 
ATOM   3477 C  C   . LYS D 4 12  ? 18.155  -34.229 44.745  1.00 31.86 ? 12   LYS D C   1 
ATOM   3478 O  O   . LYS D 4 12  ? 17.132  -33.737 45.225  1.00 32.17 ? 12   LYS D O   1 
ATOM   3479 C  CB  . LYS D 4 12  ? 18.080  -34.390 42.260  1.00 31.19 ? 12   LYS D CB  1 
ATOM   3480 C  CG  . LYS D 4 12  ? 18.207  -35.244 40.989  1.00 31.76 ? 12   LYS D CG  1 
ATOM   3481 C  CD  . LYS D 4 12  ? 19.627  -35.771 40.848  1.00 33.49 ? 12   LYS D CD  1 
ATOM   3482 C  CE  . LYS D 4 12  ? 19.769  -36.752 39.700  1.00 33.19 ? 12   LYS D CE  1 
ATOM   3483 N  NZ  . LYS D 4 12  ? 21.205  -37.077 39.485  1.00 32.22 ? 12   LYS D NZ  1 
ATOM   3484 N  N   . LYS D 4 13  ? 19.372  -33.978 45.221  1.00 32.61 ? 13   LYS D N   1 
ATOM   3485 C  CA  . LYS D 4 13  ? 19.599  -32.955 46.253  1.00 33.27 ? 13   LYS D CA  1 
ATOM   3486 C  C   . LYS D 4 13  ? 19.537  -31.579 45.592  1.00 32.98 ? 13   LYS D C   1 
ATOM   3487 O  O   . LYS D 4 13  ? 20.005  -31.425 44.455  1.00 33.08 ? 13   LYS D O   1 
ATOM   3488 C  CB  . LYS D 4 13  ? 20.963  -33.144 46.931  1.00 33.91 ? 13   LYS D CB  1 
ATOM   3489 C  CG  . LYS D 4 13  ? 21.125  -34.454 47.719  1.00 35.22 ? 13   LYS D CG  1 
ATOM   3490 C  CD  . LYS D 4 13  ? 20.771  -34.289 49.211  1.00 38.17 ? 13   LYS D CD  1 
ATOM   3491 C  CE  . LYS D 4 13  ? 20.823  -35.633 49.973  1.00 38.19 ? 13   LYS D CE  1 
ATOM   3492 N  NZ  . LYS D 4 13  ? 19.624  -36.498 49.704  1.00 39.60 ? 13   LYS D NZ  1 
ATOM   3493 N  N   . PRO D 4 14  ? 18.957  -30.579 46.286  1.00 32.65 ? 14   PRO D N   1 
ATOM   3494 C  CA  . PRO D 4 14  ? 18.911  -29.206 45.764  1.00 32.61 ? 14   PRO D CA  1 
ATOM   3495 C  C   . PRO D 4 14  ? 20.286  -28.705 45.324  1.00 32.71 ? 14   PRO D C   1 
ATOM   3496 O  O   . PRO D 4 14  ? 21.278  -28.893 46.038  1.00 33.08 ? 14   PRO D O   1 
ATOM   3497 C  CB  . PRO D 4 14  ? 18.435  -28.395 46.968  1.00 32.24 ? 14   PRO D CB  1 
ATOM   3498 C  CG  . PRO D 4 14  ? 17.637  -29.336 47.748  1.00 32.14 ? 14   PRO D CG  1 
ATOM   3499 C  CD  . PRO D 4 14  ? 18.308  -30.674 47.604  1.00 32.42 ? 14   PRO D CD  1 
ATOM   3500 N  N   . GLY D 4 15  ? 20.350  -28.093 44.152  1.00 32.47 ? 15   GLY D N   1 
ATOM   3501 C  CA  . GLY D 4 15  ? 21.608  -27.557 43.662  1.00 32.28 ? 15   GLY D CA  1 
ATOM   3502 C  C   . GLY D 4 15  ? 22.285  -28.426 42.626  1.00 32.42 ? 15   GLY D C   1 
ATOM   3503 O  O   . GLY D 4 15  ? 23.199  -27.964 41.949  1.00 32.57 ? 15   GLY D O   1 
ATOM   3504 N  N   . SER D 4 16  ? 21.853  -29.683 42.504  1.00 32.36 ? 16   SER D N   1 
ATOM   3505 C  CA  . SER D 4 16  ? 22.372  -30.577 41.465  1.00 32.24 ? 16   SER D CA  1 
ATOM   3506 C  C   . SER D 4 16  ? 21.529  -30.509 40.189  1.00 32.03 ? 16   SER D C   1 
ATOM   3507 O  O   . SER D 4 16  ? 20.662  -29.628 40.043  1.00 31.84 ? 16   SER D O   1 
ATOM   3508 C  CB  . SER D 4 16  ? 22.480  -32.023 41.971  1.00 32.52 ? 16   SER D CB  1 
ATOM   3509 O  OG  . SER D 4 16  ? 21.205  -32.637 42.075  1.00 33.63 ? 16   SER D OG  1 
ATOM   3510 N  N   . SER D 4 17  ? 21.794  -31.436 39.268  1.00 31.71 ? 17   SER D N   1 
ATOM   3511 C  CA  . SER D 4 17  ? 21.076  -31.491 37.998  1.00 31.26 ? 17   SER D CA  1 
ATOM   3512 C  C   . SER D 4 17  ? 20.452  -32.871 37.730  1.00 31.07 ? 17   SER D C   1 
ATOM   3513 O  O   . SER D 4 17  ? 20.935  -33.894 38.223  1.00 31.08 ? 17   SER D O   1 
ATOM   3514 C  CB  . SER D 4 17  ? 22.023  -31.128 36.862  1.00 31.23 ? 17   SER D CB  1 
ATOM   3515 O  OG  . SER D 4 17  ? 23.043  -32.102 36.752  1.00 30.96 ? 17   SER D OG  1 
ATOM   3516 N  N   . VAL D 4 18  ? 19.379  -32.882 36.946  1.00 30.60 ? 18   VAL D N   1 
ATOM   3517 C  CA  . VAL D 4 18  ? 18.778  -34.118 36.455  1.00 30.32 ? 18   VAL D CA  1 
ATOM   3518 C  C   . VAL D 4 18  ? 18.836  -34.176 34.919  1.00 29.97 ? 18   VAL D C   1 
ATOM   3519 O  O   . VAL D 4 18  ? 18.778  -33.146 34.265  1.00 30.01 ? 18   VAL D O   1 
ATOM   3520 C  CB  . VAL D 4 18  ? 17.315  -34.291 36.971  1.00 30.20 ? 18   VAL D CB  1 
ATOM   3521 C  CG1 . VAL D 4 18  ? 16.395  -33.201 36.439  1.00 30.08 ? 18   VAL D CG1 1 
ATOM   3522 C  CG2 . VAL D 4 18  ? 16.770  -35.664 36.620  1.00 30.52 ? 18   VAL D CG2 1 
ATOM   3523 N  N   . LYS D 4 19  ? 18.985  -35.378 34.365  1.00 29.54 ? 19   LYS D N   1 
ATOM   3524 C  CA  . LYS D 4 19  ? 18.897  -35.599 32.927  1.00 29.13 ? 19   LYS D CA  1 
ATOM   3525 C  C   . LYS D 4 19  ? 17.901  -36.731 32.680  1.00 28.66 ? 19   LYS D C   1 
ATOM   3526 O  O   . LYS D 4 19  ? 18.139  -37.875 33.085  1.00 29.17 ? 19   LYS D O   1 
ATOM   3527 C  CB  . LYS D 4 19  ? 20.262  -35.957 32.342  1.00 28.85 ? 19   LYS D CB  1 
ATOM   3528 C  CG  . LYS D 4 19  ? 20.341  -35.819 30.824  1.00 29.76 ? 19   LYS D CG  1 
ATOM   3529 C  CD  . LYS D 4 19  ? 21.728  -36.200 30.247  1.00 29.72 ? 19   LYS D CD  1 
ATOM   3530 C  CE  . LYS D 4 19  ? 22.055  -35.362 29.001  1.00 30.11 ? 19   LYS D CE  1 
ATOM   3531 N  NZ  . LYS D 4 19  ? 23.155  -35.928 28.159  1.00 30.83 ? 19   LYS D NZ  1 
ATOM   3532 N  N   . VAL D 4 20  ? 16.783  -36.397 32.030  1.00 27.78 ? 20   VAL D N   1 
ATOM   3533 C  CA  . VAL D 4 20  ? 15.697  -37.339 31.766  1.00 26.36 ? 20   VAL D CA  1 
ATOM   3534 C  C   . VAL D 4 20  ? 15.676  -37.617 30.270  1.00 26.42 ? 20   VAL D C   1 
ATOM   3535 O  O   . VAL D 4 20  ? 15.822  -36.697 29.469  1.00 26.56 ? 20   VAL D O   1 
ATOM   3536 C  CB  . VAL D 4 20  ? 14.314  -36.783 32.212  1.00 25.95 ? 20   VAL D CB  1 
ATOM   3537 C  CG1 . VAL D 4 20  ? 13.266  -37.853 32.094  1.00 25.33 ? 20   VAL D CG1 1 
ATOM   3538 C  CG2 . VAL D 4 20  ? 14.341  -36.273 33.638  1.00 24.25 ? 20   VAL D CG2 1 
ATOM   3539 N  N   . SER D 4 21  ? 15.492  -38.878 29.886  1.00 26.10 ? 21   SER D N   1 
ATOM   3540 C  CA  . SER D 4 21  ? 15.495  -39.238 28.471  1.00 25.80 ? 21   SER D CA  1 
ATOM   3541 C  C   . SER D 4 21  ? 14.101  -39.543 27.948  1.00 25.64 ? 21   SER D C   1 
ATOM   3542 O  O   . SER D 4 21  ? 13.186  -39.807 28.724  1.00 25.66 ? 21   SER D O   1 
ATOM   3543 C  CB  . SER D 4 21  ? 16.423  -40.426 28.225  1.00 25.95 ? 21   SER D CB  1 
ATOM   3544 O  OG  . SER D 4 21  ? 15.893  -41.603 28.790  1.00 26.07 ? 21   SER D OG  1 
ATOM   3545 N  N   . CYS D 4 22  ? 13.957  -39.521 26.625  1.00 25.53 ? 22   CYS D N   1 
ATOM   3546 C  CA  . CYS D 4 22  ? 12.686  -39.782 25.950  1.00 25.49 ? 22   CYS D CA  1 
ATOM   3547 C  C   . CYS D 4 22  ? 12.978  -40.501 24.632  1.00 25.97 ? 22   CYS D C   1 
ATOM   3548 O  O   . CYS D 4 22  ? 13.480  -39.882 23.669  1.00 26.04 ? 22   CYS D O   1 
ATOM   3549 C  CB  . CYS D 4 22  ? 11.976  -38.455 25.694  1.00 25.52 ? 22   CYS D CB  1 
ATOM   3550 S  SG  . CYS D 4 22  ? 10.455  -38.504 24.740  1.00 25.64 ? 22   CYS D SG  1 
ATOM   3551 N  N   . LYS D 4 23  ? 12.691  -41.807 24.594  1.00 25.87 ? 23   LYS D N   1 
ATOM   3552 C  CA  . LYS D 4 23  ? 12.993  -42.631 23.425  1.00 26.22 ? 23   LYS D CA  1 
ATOM   3553 C  C   . LYS D 4 23  ? 11.763  -42.843 22.555  1.00 25.74 ? 23   LYS D C   1 
ATOM   3554 O  O   . LYS D 4 23  ? 10.708  -43.220 23.055  1.00 26.02 ? 23   LYS D O   1 
ATOM   3555 C  CB  . LYS D 4 23  ? 13.575  -43.980 23.853  1.00 26.44 ? 23   LYS D CB  1 
ATOM   3556 C  CG  . LYS D 4 23  ? 13.891  -44.933 22.699  1.00 26.92 ? 23   LYS D CG  1 
ATOM   3557 C  CD  . LYS D 4 23  ? 14.353  -46.296 23.225  1.00 27.88 ? 23   LYS D CD  1 
ATOM   3558 C  CE  . LYS D 4 23  ? 14.695  -47.308 22.103  1.00 29.34 ? 23   LYS D CE  1 
ATOM   3559 N  NZ  . LYS D 4 23  ? 15.702  -46.781 21.110  1.00 30.11 ? 23   LYS D NZ  1 
ATOM   3560 N  N   . ALA D 4 24  ? 11.915  -42.608 21.253  1.00 25.35 ? 24   ALA D N   1 
ATOM   3561 C  CA  . ALA D 4 24  ? 10.840  -42.783 20.282  1.00 24.86 ? 24   ALA D CA  1 
ATOM   3562 C  C   . ALA D 4 24  ? 10.930  -44.164 19.650  1.00 24.98 ? 24   ALA D C   1 
ATOM   3563 O  O   . ALA D 4 24  ? 12.030  -44.644 19.357  1.00 24.69 ? 24   ALA D O   1 
ATOM   3564 C  CB  . ALA D 4 24  ? 10.914  -41.709 19.221  1.00 24.38 ? 24   ALA D CB  1 
ATOM   3565 N  N   . SER D 4 25  ? 9.769   -44.776 19.402  1.00 25.39 ? 25   SER D N   1 
ATOM   3566 C  CA  . SER D 4 25  ? 9.687   -46.203 19.103  1.00 25.86 ? 25   SER D CA  1 
ATOM   3567 C  C   . SER D 4 25  ? 8.480   -46.630 18.275  1.00 25.98 ? 25   SER D C   1 
ATOM   3568 O  O   . SER D 4 25  ? 7.369   -46.171 18.514  1.00 26.11 ? 25   SER D O   1 
ATOM   3569 C  CB  . SER D 4 25  ? 9.591   -46.946 20.419  1.00 26.05 ? 25   SER D CB  1 
ATOM   3570 O  OG  . SER D 4 25  ? 10.077  -48.249 20.285  1.00 27.59 ? 25   SER D OG  1 
ATOM   3571 N  N   . GLY D 4 26  ? 8.702   -47.540 17.326  1.00 26.15 ? 26   GLY D N   1 
ATOM   3572 C  CA  . GLY D 4 26  ? 7.616   -48.237 16.639  1.00 25.84 ? 26   GLY D CA  1 
ATOM   3573 C  C   . GLY D 4 26  ? 7.005   -47.598 15.402  1.00 25.94 ? 26   GLY D C   1 
ATOM   3574 O  O   . GLY D 4 26  ? 5.952   -48.037 14.929  1.00 26.47 ? 26   GLY D O   1 
ATOM   3575 N  N   . GLY D 4 27  ? 7.628   -46.554 14.872  1.00 25.41 ? 27   GLY D N   1 
ATOM   3576 C  CA  . GLY D 4 27  ? 7.203   -46.016 13.579  1.00 24.61 ? 27   GLY D CA  1 
ATOM   3577 C  C   . GLY D 4 27  ? 8.325   -46.281 12.602  1.00 24.23 ? 27   GLY D C   1 
ATOM   3578 O  O   . GLY D 4 27  ? 9.406   -46.684 13.018  1.00 24.28 ? 27   GLY D O   1 
ATOM   3579 N  N   . THR D 4 28  ? 8.088   -46.068 11.313  1.00 23.84 ? 28   THR D N   1 
ATOM   3580 C  CA  . THR D 4 28  ? 9.169   -46.148 10.338  1.00 23.55 ? 28   THR D CA  1 
ATOM   3581 C  C   . THR D 4 28  ? 10.254  -45.096 10.634  1.00 23.92 ? 28   THR D C   1 
ATOM   3582 O  O   . THR D 4 28  ? 11.453  -45.386 10.537  1.00 24.26 ? 28   THR D O   1 
ATOM   3583 C  CB  . THR D 4 28  ? 8.642   -45.966 8.928   1.00 23.60 ? 28   THR D CB  1 
ATOM   3584 O  OG1 . THR D 4 28  ? 7.535   -46.851 8.724   1.00 23.44 ? 28   THR D OG1 1 
ATOM   3585 C  CG2 . THR D 4 28  ? 9.729   -46.241 7.906   1.00 22.45 ? 28   THR D CG2 1 
ATOM   3586 N  N   . PHE D 4 29  ? 9.838   -43.881 10.994  1.00 23.93 ? 29   PHE D N   1 
ATOM   3587 C  CA  . PHE D 4 29  ? 10.783  -42.847 11.463  1.00 23.69 ? 29   PHE D CA  1 
ATOM   3588 C  C   . PHE D 4 29  ? 10.601  -42.642 12.977  1.00 23.74 ? 29   PHE D C   1 
ATOM   3589 O  O   . PHE D 4 29  ? 9.494   -42.787 13.499  1.00 24.02 ? 29   PHE D O   1 
ATOM   3590 C  CB  . PHE D 4 29  ? 10.573  -41.523 10.711  1.00 23.11 ? 29   PHE D CB  1 
ATOM   3591 C  CG  . PHE D 4 29  ? 10.623  -41.644 9.211   1.00 22.34 ? 29   PHE D CG  1 
ATOM   3592 C  CD1 . PHE D 4 29  ? 11.810  -41.435 8.521   1.00 21.73 ? 29   PHE D CD1 1 
ATOM   3593 C  CD2 . PHE D 4 29  ? 9.475   -41.947 8.478   1.00 22.58 ? 29   PHE D CD2 1 
ATOM   3594 C  CE1 . PHE D 4 29  ? 11.866  -41.539 7.129   1.00 21.06 ? 29   PHE D CE1 1 
ATOM   3595 C  CE2 . PHE D 4 29  ? 9.525   -42.051 7.073   1.00 21.58 ? 29   PHE D CE2 1 
ATOM   3596 C  CZ  . PHE D 4 29  ? 10.725  -41.850 6.408   1.00 21.44 ? 29   PHE D CZ  1 
ATOM   3597 N  N   . ASN D 4 30  ? 11.672  -42.316 13.687  1.00 23.78 ? 30   ASN D N   1 
ATOM   3598 C  CA  . ASN D 4 30  ? 11.573  -42.122 15.136  1.00 23.96 ? 30   ASN D CA  1 
ATOM   3599 C  C   . ASN D 4 30  ? 12.392  -40.931 15.598  1.00 24.24 ? 30   ASN D C   1 
ATOM   3600 O  O   . ASN D 4 30  ? 12.513  -40.653 16.800  1.00 24.14 ? 30   ASN D O   1 
ATOM   3601 C  CB  . ASN D 4 30  ? 12.003  -43.382 15.894  1.00 23.84 ? 30   ASN D CB  1 
ATOM   3602 C  CG  . ASN D 4 30  ? 11.171  -44.597 15.531  1.00 23.79 ? 30   ASN D CG  1 
ATOM   3603 O  OD1 . ASN D 4 30  ? 10.133  -44.878 16.157  1.00 23.01 ? 30   ASN D OD1 1 
ATOM   3604 N  ND2 . ASN D 4 30  ? 11.602  -45.312 14.496  1.00 22.02 ? 30   ASN D ND2 1 
ATOM   3605 N  N   . SER D 4 31  ? 12.979  -40.239 14.631  1.00 24.59 ? 31   SER D N   1 
ATOM   3606 C  CA  . SER D 4 31  ? 13.630  -38.970 14.914  1.00 25.12 ? 31   SER D CA  1 
ATOM   3607 C  C   . SER D 4 31  ? 12.612  -37.824 14.802  1.00 24.83 ? 31   SER D C   1 
ATOM   3608 O  O   . SER D 4 31  ? 12.246  -37.421 13.708  1.00 25.09 ? 31   SER D O   1 
ATOM   3609 C  CB  . SER D 4 31  ? 14.805  -38.749 13.978  1.00 24.69 ? 31   SER D CB  1 
ATOM   3610 O  OG  . SER D 4 31  ? 15.417  -37.524 14.303  1.00 26.40 ? 31   SER D OG  1 
ATOM   3611 N  N   . HIS D 4 32  ? 12.149  -37.324 15.943  1.00 24.70 ? 32   HIS D N   1 
ATOM   3612 C  CA  . HIS D 4 32  ? 11.075  -36.343 15.957  1.00 24.58 ? 32   HIS D CA  1 
ATOM   3613 C  C   . HIS D 4 32  ? 11.445  -35.085 16.722  1.00 24.40 ? 32   HIS D C   1 
ATOM   3614 O  O   . HIS D 4 32  ? 12.371  -35.098 17.536  1.00 24.89 ? 32   HIS D O   1 
ATOM   3615 C  CB  . HIS D 4 32  ? 9.822   -36.943 16.593  1.00 24.82 ? 32   HIS D CB  1 
ATOM   3616 C  CG  . HIS D 4 32  ? 9.334   -38.191 15.925  1.00 24.93 ? 32   HIS D CG  1 
ATOM   3617 N  ND1 . HIS D 4 32  ? 9.023   -38.248 14.584  1.00 25.37 ? 32   HIS D ND1 1 
ATOM   3618 C  CD2 . HIS D 4 32  ? 9.083   -39.425 16.421  1.00 24.44 ? 32   HIS D CD2 1 
ATOM   3619 C  CE1 . HIS D 4 32  ? 8.611   -39.465 14.279  1.00 24.98 ? 32   HIS D CE1 1 
ATOM   3620 N  NE2 . HIS D 4 32  ? 8.635   -40.198 15.377  1.00 25.45 ? 32   HIS D NE2 1 
ATOM   3621 N  N   . ALA D 4 33  ? 10.721  -34.000 16.452  1.00 23.70 ? 33   ALA D N   1 
ATOM   3622 C  CA  . ALA D 4 33  ? 10.747  -32.821 17.320  1.00 22.87 ? 33   ALA D CA  1 
ATOM   3623 C  C   . ALA D 4 33  ? 10.061  -33.149 18.654  1.00 22.06 ? 33   ALA D C   1 
ATOM   3624 O  O   . ALA D 4 33  ? 8.928   -33.625 18.676  1.00 22.08 ? 33   ALA D O   1 
ATOM   3625 C  CB  . ALA D 4 33  ? 10.075  -31.636 16.636  1.00 22.67 ? 33   ALA D CB  1 
ATOM   3626 N  N   . ILE D 4 34  ? 10.754  -32.894 19.757  1.00 21.19 ? 34   ILE D N   1 
ATOM   3627 C  CA  . ILE D 4 34  ? 10.280  -33.280 21.085  1.00 20.58 ? 34   ILE D CA  1 
ATOM   3628 C  C   . ILE D 4 34  ? 10.190  -32.052 22.013  1.00 20.53 ? 34   ILE D C   1 
ATOM   3629 O  O   . ILE D 4 34  ? 11.117  -31.244 22.054  1.00 20.55 ? 34   ILE D O   1 
ATOM   3630 C  CB  . ILE D 4 34  ? 11.232  -34.355 21.685  1.00 20.44 ? 34   ILE D CB  1 
ATOM   3631 C  CG1 . ILE D 4 34  ? 11.245  -35.624 20.815  1.00 20.44 ? 34   ILE D CG1 1 
ATOM   3632 C  CG2 . ILE D 4 34  ? 10.919  -34.656 23.160  1.00 20.38 ? 34   ILE D CG2 1 
ATOM   3633 C  CD1 . ILE D 4 34  ? 9.953   -36.494 20.862  1.00 19.51 ? 34   ILE D CD1 1 
ATOM   3634 N  N   . SER D 4 35  ? 9.075   -31.915 22.735  1.00 20.12 ? 35   SER D N   1 
ATOM   3635 C  CA  . SER D 4 35  ? 8.921   -30.899 23.783  1.00 20.11 ? 35   SER D CA  1 
ATOM   3636 C  C   . SER D 4 35  ? 8.975   -31.541 25.151  1.00 19.99 ? 35   SER D C   1 
ATOM   3637 O  O   . SER D 4 35  ? 8.608   -32.700 25.297  1.00 20.27 ? 35   SER D O   1 
ATOM   3638 C  CB  . SER D 4 35  ? 7.560   -30.211 23.692  1.00 19.88 ? 35   SER D CB  1 
ATOM   3639 O  OG  . SER D 4 35  ? 7.507   -29.302 22.631  1.00 20.14 ? 35   SER D OG  1 
ATOM   3640 N  N   . TRP D 4 36  ? 9.383   -30.769 26.155  1.00 19.54 ? 36   TRP D N   1 
ATOM   3641 C  CA  . TRP D 4 36  ? 9.247   -31.181 27.538  1.00 19.21 ? 36   TRP D CA  1 
ATOM   3642 C  C   . TRP D 4 36  ? 8.273   -30.267 28.277  1.00 19.45 ? 36   TRP D C   1 
ATOM   3643 O  O   . TRP D 4 36  ? 8.359   -29.043 28.186  1.00 19.76 ? 36   TRP D O   1 
ATOM   3644 C  CB  . TRP D 4 36  ? 10.599  -31.206 28.213  1.00 18.98 ? 36   TRP D CB  1 
ATOM   3645 C  CG  . TRP D 4 36  ? 11.527  -32.244 27.633  1.00 19.50 ? 36   TRP D CG  1 
ATOM   3646 C  CD1 . TRP D 4 36  ? 12.378  -32.092 26.562  1.00 20.10 ? 36   TRP D CD1 1 
ATOM   3647 C  CD2 . TRP D 4 36  ? 11.702  -33.588 28.089  1.00 18.41 ? 36   TRP D CD2 1 
ATOM   3648 N  NE1 . TRP D 4 36  ? 13.071  -33.259 26.337  1.00 19.48 ? 36   TRP D NE1 1 
ATOM   3649 C  CE2 . TRP D 4 36  ? 12.668  -34.193 27.258  1.00 18.81 ? 36   TRP D CE2 1 
ATOM   3650 C  CE3 . TRP D 4 36  ? 11.145  -34.336 29.126  1.00 18.84 ? 36   TRP D CE3 1 
ATOM   3651 C  CZ2 . TRP D 4 36  ? 13.086  -35.514 27.436  1.00 19.13 ? 36   TRP D CZ2 1 
ATOM   3652 C  CZ3 . TRP D 4 36  ? 11.562  -35.651 29.299  1.00 19.56 ? 36   TRP D CZ3 1 
ATOM   3653 C  CH2 . TRP D 4 36  ? 12.523  -36.223 28.459  1.00 18.85 ? 36   TRP D CH2 1 
ATOM   3654 N  N   . VAL D 4 37  ? 7.329   -30.877 28.983  1.00 19.43 ? 37   VAL D N   1 
ATOM   3655 C  CA  . VAL D 4 37  ? 6.255   -30.179 29.670  1.00 19.37 ? 37   VAL D CA  1 
ATOM   3656 C  C   . VAL D 4 37  ? 6.113   -30.802 31.057  1.00 20.16 ? 37   VAL D C   1 
ATOM   3657 O  O   . VAL D 4 37  ? 5.879   -32.008 31.167  1.00 20.54 ? 37   VAL D O   1 
ATOM   3658 C  CB  . VAL D 4 37  ? 4.919   -30.366 28.922  1.00 19.42 ? 37   VAL D CB  1 
ATOM   3659 C  CG1 . VAL D 4 37  ? 3.726   -29.909 29.804  1.00 18.96 ? 37   VAL D CG1 1 
ATOM   3660 C  CG2 . VAL D 4 37  ? 4.943   -29.672 27.553  1.00 17.72 ? 37   VAL D CG2 1 
ATOM   3661 N  N   . ARG D 4 38  ? 6.251   -29.987 32.105  1.00 20.70 ? 38   ARG D N   1 
ATOM   3662 C  CA  . ARG D 4 38  ? 6.308   -30.462 33.489  1.00 21.07 ? 38   ARG D CA  1 
ATOM   3663 C  C   . ARG D 4 38  ? 4.999   -30.179 34.191  1.00 21.19 ? 38   ARG D C   1 
ATOM   3664 O  O   . ARG D 4 38  ? 4.283   -29.271 33.811  1.00 21.08 ? 38   ARG D O   1 
ATOM   3665 C  CB  . ARG D 4 38  ? 7.455   -29.770 34.242  1.00 21.46 ? 38   ARG D CB  1 
ATOM   3666 C  CG  . ARG D 4 38  ? 7.000   -28.792 35.337  1.00 22.66 ? 38   ARG D CG  1 
ATOM   3667 C  CD  . ARG D 4 38  ? 7.806   -27.504 35.416  1.00 23.74 ? 38   ARG D CD  1 
ATOM   3668 N  NE  . ARG D 4 38  ? 9.038   -27.645 36.182  1.00 25.60 ? 38   ARG D NE  1 
ATOM   3669 C  CZ  . ARG D 4 38  ? 9.588   -26.682 36.924  1.00 25.71 ? 38   ARG D CZ  1 
ATOM   3670 N  NH1 . ARG D 4 38  ? 9.024   -25.483 37.034  1.00 24.85 ? 38   ARG D NH1 1 
ATOM   3671 N  NH2 . ARG D 4 38  ? 10.717  -26.928 37.563  1.00 26.00 ? 38   ARG D NH2 1 
ATOM   3672 N  N   . GLN D 4 39  ? 4.692   -30.962 35.221  1.00 22.12 ? 39   GLN D N   1 
ATOM   3673 C  CA  . GLN D 4 39  ? 3.502   -30.738 36.054  1.00 22.61 ? 39   GLN D CA  1 
ATOM   3674 C  C   . GLN D 4 39  ? 3.823   -31.004 37.521  1.00 23.21 ? 39   GLN D C   1 
ATOM   3675 O  O   . GLN D 4 39  ? 4.043   -32.148 37.910  1.00 23.71 ? 39   GLN D O   1 
ATOM   3676 C  CB  . GLN D 4 39  ? 2.360   -31.644 35.597  1.00 22.06 ? 39   GLN D CB  1 
ATOM   3677 C  CG  . GLN D 4 39  ? 1.074   -31.454 36.378  1.00 21.50 ? 39   GLN D CG  1 
ATOM   3678 C  CD  . GLN D 4 39  ? -0.108  -32.144 35.727  1.00 20.93 ? 39   GLN D CD  1 
ATOM   3679 O  OE1 . GLN D 4 39  ? -0.037  -33.323 35.363  1.00 21.05 ? 39   GLN D OE1 1 
ATOM   3680 N  NE2 . GLN D 4 39  ? -1.205  -31.412 35.572  1.00 19.58 ? 39   GLN D NE2 1 
ATOM   3681 N  N   . ALA D 4 40  ? 3.873   -29.955 38.330  1.00 24.16 ? 40   ALA D N   1 
ATOM   3682 C  CA  . ALA D 4 40  ? 4.076   -30.130 39.780  1.00 25.16 ? 40   ALA D CA  1 
ATOM   3683 C  C   . ALA D 4 40  ? 2.813   -30.731 40.386  1.00 25.87 ? 40   ALA D C   1 
ATOM   3684 O  O   . ALA D 4 40  ? 1.724   -30.539 39.836  1.00 26.13 ? 40   ALA D O   1 
ATOM   3685 C  CB  . ALA D 4 40  ? 4.447   -28.809 40.453  1.00 24.84 ? 40   ALA D CB  1 
ATOM   3686 N  N   . PRO D 4 41  ? 2.937   -31.466 41.514  1.00 26.80 ? 41   PRO D N   1 
ATOM   3687 C  CA  . PRO D 4 41  ? 1.796   -32.319 41.915  1.00 26.95 ? 41   PRO D CA  1 
ATOM   3688 C  C   . PRO D 4 41  ? 0.602   -31.482 42.342  1.00 27.39 ? 41   PRO D C   1 
ATOM   3689 O  O   . PRO D 4 41  ? 0.749   -30.556 43.144  1.00 27.36 ? 41   PRO D O   1 
ATOM   3690 C  CB  . PRO D 4 41  ? 2.354   -33.134 43.092  1.00 27.19 ? 41   PRO D CB  1 
ATOM   3691 C  CG  . PRO D 4 41  ? 3.888   -32.930 43.052  1.00 27.14 ? 41   PRO D CG  1 
ATOM   3692 C  CD  . PRO D 4 41  ? 4.052   -31.549 42.480  1.00 26.95 ? 41   PRO D CD  1 
ATOM   3693 N  N   . GLY D 4 42  ? -0.563  -31.773 41.777  1.00 27.89 ? 42   GLY D N   1 
ATOM   3694 C  CA  . GLY D 4 42  ? -1.745  -30.960 42.040  1.00 28.87 ? 42   GLY D CA  1 
ATOM   3695 C  C   . GLY D 4 42  ? -1.869  -29.713 41.168  1.00 30.00 ? 42   GLY D C   1 
ATOM   3696 O  O   . GLY D 4 42  ? -2.963  -29.142 41.061  1.00 30.16 ? 42   GLY D O   1 
ATOM   3697 N  N   . GLN D 4 43  ? -0.762  -29.295 40.541  1.00 30.51 ? 43   GLN D N   1 
ATOM   3698 C  CA  . GLN D 4 43  ? -0.737  -28.116 39.658  1.00 31.05 ? 43   GLN D CA  1 
ATOM   3699 C  C   . GLN D 4 43  ? -1.060  -28.508 38.222  1.00 30.51 ? 43   GLN D C   1 
ATOM   3700 O  O   . GLN D 4 43  ? -1.400  -29.660 37.952  1.00 30.69 ? 43   GLN D O   1 
ATOM   3701 C  CB  . GLN D 4 43  ? 0.640   -27.431 39.664  1.00 31.71 ? 43   GLN D CB  1 
ATOM   3702 C  CG  . GLN D 4 43  ? 1.386   -27.462 40.969  1.00 34.34 ? 43   GLN D CG  1 
ATOM   3703 C  CD  . GLN D 4 43  ? 0.675   -26.697 42.027  1.00 38.05 ? 43   GLN D CD  1 
ATOM   3704 O  OE1 . GLN D 4 43  ? 0.758   -25.468 42.066  1.00 40.59 ? 43   GLN D OE1 1 
ATOM   3705 N  NE2 . GLN D 4 43  ? -0.047  -27.410 42.902  1.00 38.58 ? 43   GLN D NE2 1 
ATOM   3706 N  N   . GLY D 4 44  ? -0.915  -27.545 37.311  1.00 29.79 ? 44   GLY D N   1 
ATOM   3707 C  CA  . GLY D 4 44  ? -1.212  -27.744 35.897  1.00 29.41 ? 44   GLY D CA  1 
ATOM   3708 C  C   . GLY D 4 44  ? 0.034   -27.911 35.050  1.00 28.84 ? 44   GLY D C   1 
ATOM   3709 O  O   . GLY D 4 44  ? 1.073   -28.338 35.546  1.00 29.31 ? 44   GLY D O   1 
ATOM   3710 N  N   . LEU D 4 45  ? -0.065  -27.551 33.775  1.00 28.00 ? 45   LEU D N   1 
ATOM   3711 C  CA  . LEU D 4 45  ? 0.972   -27.878 32.793  1.00 27.24 ? 45   LEU D CA  1 
ATOM   3712 C  C   . LEU D 4 45  ? 1.880   -26.697 32.394  1.00 26.86 ? 45   LEU D C   1 
ATOM   3713 O  O   . LEU D 4 45  ? 1.419   -25.568 32.261  1.00 27.26 ? 45   LEU D O   1 
ATOM   3714 C  CB  . LEU D 4 45  ? 0.311   -28.492 31.556  1.00 26.91 ? 45   LEU D CB  1 
ATOM   3715 C  CG  . LEU D 4 45  ? -0.433  -29.818 31.787  1.00 26.70 ? 45   LEU D CG  1 
ATOM   3716 C  CD1 . LEU D 4 45  ? -1.492  -30.011 30.720  1.00 26.17 ? 45   LEU D CD1 1 
ATOM   3717 C  CD2 . LEU D 4 45  ? 0.507   -31.028 31.857  1.00 24.29 ? 45   LEU D CD2 1 
ATOM   3718 N  N   . GLU D 4 46  ? 3.159   -26.973 32.174  1.00 26.11 ? 46   GLU D N   1 
ATOM   3719 C  CA  . GLU D 4 46  ? 4.136   -25.934 31.893  1.00 26.34 ? 46   GLU D CA  1 
ATOM   3720 C  C   . GLU D 4 46  ? 5.220   -26.374 30.883  1.00 25.68 ? 46   GLU D C   1 
ATOM   3721 O  O   . GLU D 4 46  ? 6.042   -27.242 31.179  1.00 25.24 ? 46   GLU D O   1 
ATOM   3722 C  CB  . GLU D 4 46  ? 4.780   -25.520 33.209  1.00 26.20 ? 46   GLU D CB  1 
ATOM   3723 C  CG  . GLU D 4 46  ? 5.671   -24.310 33.145  1.00 27.30 ? 46   GLU D CG  1 
ATOM   3724 C  CD  . GLU D 4 46  ? 6.256   -23.959 34.513  1.00 28.50 ? 46   GLU D CD  1 
ATOM   3725 O  OE1 . GLU D 4 46  ? 6.391   -24.860 35.383  1.00 30.72 ? 46   GLU D OE1 1 
ATOM   3726 O  OE2 . GLU D 4 46  ? 6.590   -22.771 34.719  1.00 32.06 ? 46   GLU D OE2 1 
ATOM   3727 N  N   . TRP D 4 47  ? 5.218   -25.755 29.703  1.00 25.14 ? 47   TRP D N   1 
ATOM   3728 C  CA  . TRP D 4 47  ? 6.192   -26.038 28.646  1.00 24.60 ? 47   TRP D CA  1 
ATOM   3729 C  C   . TRP D 4 47  ? 7.573   -25.516 29.001  1.00 24.46 ? 47   TRP D C   1 
ATOM   3730 O  O   . TRP D 4 47  ? 7.723   -24.404 29.496  1.00 24.25 ? 47   TRP D O   1 
ATOM   3731 C  CB  . TRP D 4 47  ? 5.728   -25.396 27.336  1.00 24.41 ? 47   TRP D CB  1 
ATOM   3732 C  CG  . TRP D 4 47  ? 6.546   -25.728 26.106  1.00 23.81 ? 47   TRP D CG  1 
ATOM   3733 C  CD1 . TRP D 4 47  ? 6.534   -26.895 25.413  1.00 23.02 ? 47   TRP D CD1 1 
ATOM   3734 C  CD2 . TRP D 4 47  ? 7.455   -24.859 25.412  1.00 24.13 ? 47   TRP D CD2 1 
ATOM   3735 N  NE1 . TRP D 4 47  ? 7.385   -26.823 24.341  1.00 23.48 ? 47   TRP D NE1 1 
ATOM   3736 C  CE2 . TRP D 4 47  ? 7.961   -25.582 24.310  1.00 23.74 ? 47   TRP D CE2 1 
ATOM   3737 C  CE3 . TRP D 4 47  ? 7.890   -23.536 25.611  1.00 24.19 ? 47   TRP D CE3 1 
ATOM   3738 C  CZ2 . TRP D 4 47  ? 8.876   -25.030 23.404  1.00 23.73 ? 47   TRP D CZ2 1 
ATOM   3739 C  CZ3 . TRP D 4 47  ? 8.805   -22.985 24.704  1.00 23.18 ? 47   TRP D CZ3 1 
ATOM   3740 C  CH2 . TRP D 4 47  ? 9.284   -23.733 23.620  1.00 23.13 ? 47   TRP D CH2 1 
ATOM   3741 N  N   . MET D 4 48  ? 8.588   -26.315 28.720  1.00 24.63 ? 48   MET D N   1 
ATOM   3742 C  CA  . MET D 4 48  ? 9.951   -25.932 29.060  1.00 25.44 ? 48   MET D CA  1 
ATOM   3743 C  C   . MET D 4 48  ? 10.802  -25.608 27.854  1.00 25.10 ? 48   MET D C   1 
ATOM   3744 O  O   . MET D 4 48  ? 11.736  -24.816 27.941  1.00 24.92 ? 48   MET D O   1 
ATOM   3745 C  CB  . MET D 4 48  ? 10.630  -27.038 29.840  1.00 25.10 ? 48   MET D CB  1 
ATOM   3746 C  CG  . MET D 4 48  ? 9.947   -27.368 31.130  1.00 26.13 ? 48   MET D CG  1 
ATOM   3747 S  SD  . MET D 4 48  ? 10.854  -28.729 31.818  1.00 27.81 ? 48   MET D SD  1 
ATOM   3748 C  CE  . MET D 4 48  ? 12.170  -27.849 32.655  1.00 28.35 ? 48   MET D CE  1 
ATOM   3749 N  N   . GLY D 4 49  ? 10.482  -26.235 26.732  1.00 25.22 ? 49   GLY D N   1 
ATOM   3750 C  CA  . GLY D 4 49  ? 11.350  -26.174 25.586  1.00 25.38 ? 49   GLY D CA  1 
ATOM   3751 C  C   . GLY D 4 49  ? 11.125  -27.316 24.627  1.00 25.37 ? 49   GLY D C   1 
ATOM   3752 O  O   . GLY D 4 49  ? 10.266  -28.166 24.851  1.00 25.72 ? 49   GLY D O   1 
ATOM   3753 N  N   . GLY D 4 50  ? 11.904  -27.314 23.552  1.00 24.95 ? 50   GLY D N   1 
ATOM   3754 C  CA  . GLY D 4 50  ? 11.792  -28.288 22.496  1.00 24.60 ? 50   GLY D CA  1 
ATOM   3755 C  C   . GLY D 4 50  ? 13.077  -28.308 21.697  1.00 24.76 ? 50   GLY D C   1 
ATOM   3756 O  O   . GLY D 4 50  ? 13.785  -27.304 21.608  1.00 24.85 ? 50   GLY D O   1 
ATOM   3757 N  N   . ILE D 4 51  ? 13.387  -29.471 21.137  1.00 24.61 ? 51   ILE D N   1 
ATOM   3758 C  CA  . ILE D 4 51  ? 14.514  -29.649 20.231  1.00 24.16 ? 51   ILE D CA  1 
ATOM   3759 C  C   . ILE D 4 51  ? 13.891  -29.891 18.857  1.00 24.02 ? 51   ILE D C   1 
ATOM   3760 O  O   . ILE D 4 51  ? 12.902  -30.620 18.736  1.00 24.33 ? 51   ILE D O   1 
ATOM   3761 C  CB  . ILE D 4 51  ? 15.410  -30.836 20.702  1.00 24.19 ? 51   ILE D CB  1 
ATOM   3762 C  CG1 . ILE D 4 51  ? 16.522  -31.157 19.708  1.00 23.88 ? 51   ILE D CG1 1 
ATOM   3763 C  CG2 . ILE D 4 51  ? 14.579  -32.069 20.990  1.00 23.91 ? 51   ILE D CG2 1 
ATOM   3764 C  CD1 . ILE D 4 51  ? 17.824  -30.434 20.002  1.00 25.37 ? 51   ILE D CD1 1 
ATOM   3765 N  N   . ASN D 4 52  ? 14.439  -29.249 17.835  1.00 23.69 ? 52   ASN D N   1 
ATOM   3766 C  CA  . ASN D 4 52  ? 13.877  -29.313 16.487  1.00 23.62 ? 52   ASN D CA  1 
ATOM   3767 C  C   . ASN D 4 52  ? 14.942  -29.813 15.526  1.00 24.23 ? 52   ASN D C   1 
ATOM   3768 O  O   . ASN D 4 52  ? 15.740  -29.037 15.028  1.00 24.35 ? 52   ASN D O   1 
ATOM   3769 C  CB  . ASN D 4 52  ? 13.358  -27.936 16.086  1.00 23.00 ? 52   ASN D CB  1 
ATOM   3770 C  CG  . ASN D 4 52  ? 12.531  -27.296 17.184  1.00 22.13 ? 52   ASN D CG  1 
ATOM   3771 O  OD1 . ASN D 4 52  ? 13.050  -26.536 17.998  1.00 21.63 ? 52   ASN D OD1 1 
ATOM   3772 N  ND2 . ASN D 4 52  ? 11.249  -27.634 17.240  1.00 20.77 ? 52   ASN D ND2 1 
ATOM   3773 N  N   . PRO D 4 53  ? 14.987  -31.137 15.299  1.00 25.02 ? 53   PRO D N   1 
ATOM   3774 C  CA  . PRO D 4 53  ? 16.112  -31.734 14.583  1.00 25.07 ? 53   PRO D CA  1 
ATOM   3775 C  C   . PRO D 4 53  ? 16.247  -31.299 13.125  1.00 25.16 ? 53   PRO D C   1 
ATOM   3776 O  O   . PRO D 4 53  ? 17.353  -31.324 12.604  1.00 25.16 ? 53   PRO D O   1 
ATOM   3777 C  CB  . PRO D 4 53  ? 15.830  -33.235 14.678  1.00 24.90 ? 53   PRO D CB  1 
ATOM   3778 C  CG  . PRO D 4 53  ? 14.353  -33.319 14.803  1.00 25.33 ? 53   PRO D CG  1 
ATOM   3779 C  CD  . PRO D 4 53  ? 14.003  -32.162 15.701  1.00 25.23 ? 53   PRO D CD  1 
ATOM   3780 N  N   . ILE D 4 54  ? 15.159  -30.915 12.464  1.00 25.50 ? 54   ILE D N   1 
ATOM   3781 C  CA  . ILE D 4 54  ? 15.295  -30.379 11.093  1.00 26.15 ? 54   ILE D CA  1 
ATOM   3782 C  C   . ILE D 4 54  ? 15.893  -28.960 11.100  1.00 25.84 ? 54   ILE D C   1 
ATOM   3783 O  O   . ILE D 4 54  ? 16.869  -28.676 10.412  1.00 25.95 ? 54   ILE D O   1 
ATOM   3784 C  CB  . ILE D 4 54  ? 13.976  -30.414 10.268  1.00 26.09 ? 54   ILE D CB  1 
ATOM   3785 C  CG1 . ILE D 4 54  ? 13.317  -31.794 10.347  1.00 26.20 ? 54   ILE D CG1 1 
ATOM   3786 C  CG2 . ILE D 4 54  ? 14.263  -30.047 8.816   1.00 25.65 ? 54   ILE D CG2 1 
ATOM   3787 C  CD1 . ILE D 4 54  ? 11.920  -31.870 9.693   1.00 26.83 ? 54   ILE D CD1 1 
ATOM   3788 N  N   . LEU D 4 55  ? 15.310  -28.085 11.897  1.00 25.54 ? 55   LEU D N   1 
ATOM   3789 C  CA  . LEU D 4 55  ? 15.826  -26.750 12.065  1.00 25.69 ? 55   LEU D CA  1 
ATOM   3790 C  C   . LEU D 4 55  ? 17.233  -26.769 12.654  1.00 25.59 ? 55   LEU D C   1 
ATOM   3791 O  O   . LEU D 4 55  ? 18.013  -25.834 12.454  1.00 25.98 ? 55   LEU D O   1 
ATOM   3792 C  CB  . LEU D 4 55  ? 14.907  -25.997 13.009  1.00 26.00 ? 55   LEU D CB  1 
ATOM   3793 C  CG  . LEU D 4 55  ? 14.750  -24.500 12.822  1.00 26.98 ? 55   LEU D CG  1 
ATOM   3794 C  CD1 . LEU D 4 55  ? 14.292  -24.192 11.397  1.00 27.04 ? 55   LEU D CD1 1 
ATOM   3795 C  CD2 . LEU D 4 55  ? 13.744  -24.000 13.865  1.00 26.35 ? 55   LEU D CD2 1 
ATOM   3796 N  N   . GLY D 4 56  ? 17.545  -27.830 13.390  1.00 25.13 ? 56   GLY D N   1 
ATOM   3797 C  CA  . GLY D 4 56  ? 18.831  -27.971 14.038  1.00 24.55 ? 56   GLY D CA  1 
ATOM   3798 C  C   . GLY D 4 56  ? 19.051  -27.113 15.270  1.00 24.56 ? 56   GLY D C   1 
ATOM   3799 O  O   . GLY D 4 56  ? 20.186  -26.959 15.699  1.00 24.77 ? 56   GLY D O   1 
ATOM   3800 N  N   . ILE D 4 57  ? 17.989  -26.554 15.859  1.00 24.44 ? 57   ILE D N   1 
ATOM   3801 C  CA  . ILE D 4 57  ? 18.126  -25.777 17.116  1.00 23.92 ? 57   ILE D CA  1 
ATOM   3802 C  C   . ILE D 4 57  ? 17.089  -26.186 18.170  1.00 23.86 ? 57   ILE D C   1 
ATOM   3803 O  O   . ILE D 4 57  ? 16.091  -26.806 17.837  1.00 23.99 ? 57   ILE D O   1 
ATOM   3804 C  CB  . ILE D 4 57  ? 18.034  -24.220 16.886  1.00 23.82 ? 57   ILE D CB  1 
ATOM   3805 C  CG1 . ILE D 4 57  ? 16.643  -23.819 16.377  1.00 23.56 ? 57   ILE D CG1 1 
ATOM   3806 C  CG2 . ILE D 4 57  ? 19.120  -23.743 15.934  1.00 23.86 ? 57   ILE D CG2 1 
ATOM   3807 C  CD1 . ILE D 4 57  ? 16.413  -22.336 16.228  1.00 23.28 ? 57   ILE D CD1 1 
ATOM   3808 N  N   . ALA D 4 58  ? 17.328  -25.818 19.428  1.00 23.67 ? 58   ALA D N   1 
ATOM   3809 C  CA  . ALA D 4 58  ? 16.315  -25.902 20.482  1.00 23.64 ? 58   ALA D CA  1 
ATOM   3810 C  C   . ALA D 4 58  ? 15.616  -24.549 20.654  1.00 23.72 ? 58   ALA D C   1 
ATOM   3811 O  O   . ALA D 4 58  ? 16.191  -23.503 20.326  1.00 23.98 ? 58   ALA D O   1 
ATOM   3812 C  CB  . ALA D 4 58  ? 16.952  -26.333 21.809  1.00 23.43 ? 58   ALA D CB  1 
ATOM   3813 N  N   . ASN D 4 59  ? 14.376  -24.575 21.141  1.00 23.27 ? 59   ASN D N   1 
ATOM   3814 C  CA  . ASN D 4 59  ? 13.708  -23.376 21.640  1.00 22.99 ? 59   ASN D CA  1 
ATOM   3815 C  C   . ASN D 4 59  ? 13.426  -23.552 23.126  1.00 23.17 ? 59   ASN D C   1 
ATOM   3816 O  O   . ASN D 4 59  ? 12.799  -24.527 23.533  1.00 22.98 ? 59   ASN D O   1 
ATOM   3817 C  CB  . ASN D 4 59  ? 12.398  -23.090 20.892  1.00 22.82 ? 59   ASN D CB  1 
ATOM   3818 C  CG  . ASN D 4 59  ? 12.613  -22.493 19.497  1.00 22.92 ? 59   ASN D CG  1 
ATOM   3819 O  OD1 . ASN D 4 59  ? 13.724  -22.515 18.947  1.00 22.83 ? 59   ASN D OD1 1 
ATOM   3820 N  ND2 . ASN D 4 59  ? 11.537  -21.961 18.917  1.00 21.02 ? 59   ASN D ND2 1 
ATOM   3821 N  N   . TYR D 4 60  ? 13.894  -22.612 23.939  1.00 23.43 ? 60   TYR D N   1 
ATOM   3822 C  CA  . TYR D 4 60  ? 13.684  -22.687 25.375  1.00 23.48 ? 60   TYR D CA  1 
ATOM   3823 C  C   . TYR D 4 60  ? 12.639  -21.686 25.851  1.00 23.98 ? 60   TYR D C   1 
ATOM   3824 O  O   . TYR D 4 60  ? 12.491  -20.604 25.295  1.00 23.61 ? 60   TYR D O   1 
ATOM   3825 C  CB  . TYR D 4 60  ? 14.999  -22.483 26.108  1.00 23.24 ? 60   TYR D CB  1 
ATOM   3826 C  CG  . TYR D 4 60  ? 16.048  -23.520 25.764  1.00 23.54 ? 60   TYR D CG  1 
ATOM   3827 C  CD1 . TYR D 4 60  ? 15.903  -24.852 26.156  1.00 23.58 ? 60   TYR D CD1 1 
ATOM   3828 C  CD2 . TYR D 4 60  ? 17.195  -23.168 25.056  1.00 23.25 ? 60   TYR D CD2 1 
ATOM   3829 C  CE1 . TYR D 4 60  ? 16.864  -25.799 25.841  1.00 22.88 ? 60   TYR D CE1 1 
ATOM   3830 C  CE2 . TYR D 4 60  ? 18.160  -24.104 24.741  1.00 22.28 ? 60   TYR D CE2 1 
ATOM   3831 C  CZ  . TYR D 4 60  ? 17.992  -25.415 25.133  1.00 23.48 ? 60   TYR D CZ  1 
ATOM   3832 O  OH  . TYR D 4 60  ? 18.962  -26.345 24.814  1.00 23.93 ? 60   TYR D OH  1 
ATOM   3833 N  N   . ALA D 4 61  ? 11.896  -22.081 26.876  1.00 25.00 ? 61   ALA D N   1 
ATOM   3834 C  CA  . ALA D 4 61  ? 10.913  -21.223 27.493  1.00 25.89 ? 61   ALA D CA  1 
ATOM   3835 C  C   . ALA D 4 61  ? 11.659  -20.195 28.300  1.00 26.80 ? 61   ALA D C   1 
ATOM   3836 O  O   . ALA D 4 61  ? 12.636  -20.522 28.975  1.00 26.92 ? 61   ALA D O   1 
ATOM   3837 C  CB  . ALA D 4 61  ? 9.991   -22.027 28.385  1.00 25.73 ? 61   ALA D CB  1 
ATOM   3838 N  N   . GLN D 4 62  ? 11.196  -18.951 28.220  1.00 28.03 ? 62   GLN D N   1 
ATOM   3839 C  CA  . GLN D 4 62  ? 11.832  -17.819 28.895  1.00 29.47 ? 62   GLN D CA  1 
ATOM   3840 C  C   . GLN D 4 62  ? 12.093  -18.054 30.390  1.00 30.03 ? 62   GLN D C   1 
ATOM   3841 O  O   . GLN D 4 62  ? 13.184  -17.748 30.887  1.00 29.64 ? 62   GLN D O   1 
ATOM   3842 C  CB  . GLN D 4 62  ? 11.013  -16.550 28.674  1.00 29.41 ? 62   GLN D CB  1 
ATOM   3843 C  CG  . GLN D 4 62  ? 11.032  -16.036 27.230  1.00 30.00 ? 62   GLN D CG  1 
ATOM   3844 C  CD  . GLN D 4 62  ? 10.099  -14.854 27.023  1.00 30.32 ? 62   GLN D CD  1 
ATOM   3845 O  OE1 . GLN D 4 62  ? 9.678   -14.204 27.986  1.00 31.90 ? 62   GLN D OE1 1 
ATOM   3846 N  NE2 . GLN D 4 62  ? 9.770   -14.568 25.763  1.00 30.91 ? 62   GLN D NE2 1 
ATOM   3847 N  N   . LYS D 4 63  ? 11.102  -18.624 31.080  1.00 30.99 ? 63   LYS D N   1 
ATOM   3848 C  CA  . LYS D 4 63  ? 11.223  -19.011 32.501  1.00 32.09 ? 63   LYS D CA  1 
ATOM   3849 C  C   . LYS D 4 63  ? 12.312  -20.051 32.782  1.00 31.97 ? 63   LYS D C   1 
ATOM   3850 O  O   . LYS D 4 63  ? 12.666  -20.262 33.931  1.00 32.32 ? 63   LYS D O   1 
ATOM   3851 C  CB  . LYS D 4 63  ? 9.874   -19.518 33.062  1.00 32.19 ? 63   LYS D CB  1 
ATOM   3852 C  CG  . LYS D 4 63  ? 9.956   -20.021 34.524  1.00 33.11 ? 63   LYS D CG  1 
ATOM   3853 C  CD  . LYS D 4 63  ? 8.621   -20.546 35.075  1.00 33.22 ? 63   LYS D CD  1 
ATOM   3854 C  CE  . LYS D 4 63  ? 8.784   -21.160 36.494  1.00 33.96 ? 63   LYS D CE  1 
ATOM   3855 N  NZ  . LYS D 4 63  ? 7.545   -21.877 36.999  1.00 32.58 ? 63   LYS D NZ  1 
ATOM   3856 N  N   . PHE D 4 64  ? 12.840  -20.702 31.754  1.00 32.17 ? 64   PHE D N   1 
ATOM   3857 C  CA  . PHE D 4 64  ? 13.820  -21.764 31.974  1.00 32.64 ? 64   PHE D CA  1 
ATOM   3858 C  C   . PHE D 4 64  ? 15.141  -21.510 31.261  1.00 33.13 ? 64   PHE D C   1 
ATOM   3859 O  O   . PHE D 4 64  ? 16.075  -22.302 31.367  1.00 33.17 ? 64   PHE D O   1 
ATOM   3860 C  CB  . PHE D 4 64  ? 13.246  -23.140 31.584  1.00 32.45 ? 64   PHE D CB  1 
ATOM   3861 C  CG  . PHE D 4 64  ? 12.085  -23.584 32.434  1.00 32.23 ? 64   PHE D CG  1 
ATOM   3862 C  CD1 . PHE D 4 64  ? 12.297  -24.163 33.685  1.00 31.49 ? 64   PHE D CD1 1 
ATOM   3863 C  CD2 . PHE D 4 64  ? 10.774  -23.412 31.987  1.00 32.23 ? 64   PHE D CD2 1 
ATOM   3864 C  CE1 . PHE D 4 64  ? 11.221  -24.567 34.483  1.00 31.69 ? 64   PHE D CE1 1 
ATOM   3865 C  CE2 . PHE D 4 64  ? 9.686   -23.816 32.770  1.00 32.83 ? 64   PHE D CE2 1 
ATOM   3866 C  CZ  . PHE D 4 64  ? 9.914   -24.397 34.028  1.00 32.71 ? 64   PHE D CZ  1 
ATOM   3867 N  N   . GLN D 4 65  ? 15.226  -20.398 30.542  1.00 34.01 ? 65   GLN D N   1 
ATOM   3868 C  CA  . GLN D 4 65  ? 16.447  -20.071 29.816  1.00 34.66 ? 65   GLN D CA  1 
ATOM   3869 C  C   . GLN D 4 65  ? 17.632  -20.001 30.771  1.00 34.44 ? 65   GLN D C   1 
ATOM   3870 O  O   . GLN D 4 65  ? 17.592  -19.292 31.774  1.00 34.47 ? 65   GLN D O   1 
ATOM   3871 C  CB  . GLN D 4 65  ? 16.292  -18.763 29.040  1.00 34.92 ? 65   GLN D CB  1 
ATOM   3872 C  CG  . GLN D 4 65  ? 17.400  -18.512 27.993  1.00 37.30 ? 65   GLN D CG  1 
ATOM   3873 C  CD  . GLN D 4 65  ? 18.714  -18.028 28.614  1.00 38.85 ? 65   GLN D CD  1 
ATOM   3874 O  OE1 . GLN D 4 65  ? 18.719  -17.147 29.471  1.00 39.37 ? 65   GLN D OE1 1 
ATOM   3875 N  NE2 . GLN D 4 65  ? 19.827  -18.616 28.186  1.00 39.57 ? 65   GLN D NE2 1 
ATOM   3876 N  N   . GLY D 4 66  ? 18.676  -20.760 30.461  1.00 34.43 ? 66   GLY D N   1 
ATOM   3877 C  CA  . GLY D 4 66  ? 19.846  -20.805 31.316  1.00 34.45 ? 66   GLY D CA  1 
ATOM   3878 C  C   . GLY D 4 66  ? 19.905  -21.996 32.263  1.00 34.43 ? 66   GLY D C   1 
ATOM   3879 O  O   . GLY D 4 66  ? 20.983  -22.301 32.774  1.00 35.11 ? 66   GLY D O   1 
ATOM   3880 N  N   . ARG D 4 67  ? 18.767  -22.662 32.501  1.00 33.62 ? 67   ARG D N   1 
ATOM   3881 C  CA  . ARG D 4 67  ? 18.707  -23.838 33.382  1.00 32.81 ? 67   ARG D CA  1 
ATOM   3882 C  C   . ARG D 4 67  ? 18.478  -25.149 32.632  1.00 32.43 ? 67   ARG D C   1 
ATOM   3883 O  O   . ARG D 4 67  ? 18.963  -26.194 33.073  1.00 32.46 ? 67   ARG D O   1 
ATOM   3884 C  CB  . ARG D 4 67  ? 17.636  -23.681 34.459  1.00 32.68 ? 67   ARG D CB  1 
ATOM   3885 C  CG  . ARG D 4 67  ? 18.010  -22.695 35.530  1.00 33.05 ? 67   ARG D CG  1 
ATOM   3886 C  CD  . ARG D 4 67  ? 17.499  -23.076 36.921  1.00 32.21 ? 67   ARG D CD  1 
ATOM   3887 N  NE  . ARG D 4 67  ? 16.043  -23.140 37.025  1.00 31.42 ? 67   ARG D NE  1 
ATOM   3888 C  CZ  . ARG D 4 67  ? 15.380  -24.200 37.479  1.00 31.92 ? 67   ARG D CZ  1 
ATOM   3889 N  NH1 . ARG D 4 67  ? 16.050  -25.280 37.882  1.00 31.48 ? 67   ARG D NH1 1 
ATOM   3890 N  NH2 . ARG D 4 67  ? 14.050  -24.180 37.547  1.00 30.99 ? 67   ARG D NH2 1 
ATOM   3891 N  N   . VAL D 4 68  ? 17.723  -25.096 31.529  1.00 31.39 ? 68   VAL D N   1 
ATOM   3892 C  CA  . VAL D 4 68  ? 17.504  -26.262 30.683  1.00 30.60 ? 68   VAL D CA  1 
ATOM   3893 C  C   . VAL D 4 68  ? 18.335  -26.238 29.441  1.00 30.07 ? 68   VAL D C   1 
ATOM   3894 O  O   . VAL D 4 68  ? 18.355  -25.257 28.701  1.00 30.63 ? 68   VAL D O   1 
ATOM   3895 C  CB  . VAL D 4 68  ? 16.053  -26.422 30.162  1.00 30.63 ? 68   VAL D CB  1 
ATOM   3896 C  CG1 . VAL D 4 68  ? 15.338  -27.559 30.854  1.00 30.89 ? 68   VAL D CG1 1 
ATOM   3897 C  CG2 . VAL D 4 68  ? 15.296  -25.151 30.254  1.00 31.13 ? 68   VAL D CG2 1 
ATOM   3898 N  N   . THR D 4 69  ? 19.004  -27.349 29.201  1.00 29.38 ? 69   THR D N   1 
ATOM   3899 C  CA  . THR D 4 69  ? 19.500  -27.647 27.885  1.00 28.45 ? 69   THR D CA  1 
ATOM   3900 C  C   . THR D 4 69  ? 18.802  -28.934 27.420  1.00 28.12 ? 69   THR D C   1 
ATOM   3901 O  O   . THR D 4 69  ? 18.571  -29.851 28.214  1.00 27.90 ? 69   THR D O   1 
ATOM   3902 C  CB  . THR D 4 69  ? 21.062  -27.641 27.817  1.00 28.52 ? 69   THR D CB  1 
ATOM   3903 O  OG1 . THR D 4 69  ? 21.531  -28.833 27.191  1.00 28.62 ? 69   THR D OG1 1 
ATOM   3904 C  CG2 . THR D 4 69  ? 21.704  -27.526 29.202  1.00 27.99 ? 69   THR D CG2 1 
ATOM   3905 N  N   . ILE D 4 70  ? 18.404  -28.953 26.150  1.00 27.83 ? 70   ILE D N   1 
ATOM   3906 C  CA  . ILE D 4 70  ? 17.662  -30.057 25.557  1.00 27.66 ? 70   ILE D CA  1 
ATOM   3907 C  C   . ILE D 4 70  ? 18.388  -30.532 24.306  1.00 27.99 ? 70   ILE D C   1 
ATOM   3908 O  O   . ILE D 4 70  ? 18.579  -29.778 23.349  1.00 27.65 ? 70   ILE D O   1 
ATOM   3909 C  CB  . ILE D 4 70  ? 16.218  -29.654 25.177  1.00 27.43 ? 70   ILE D CB  1 
ATOM   3910 C  CG1 . ILE D 4 70  ? 15.396  -29.327 26.420  1.00 27.28 ? 70   ILE D CG1 1 
ATOM   3911 C  CG2 . ILE D 4 70  ? 15.538  -30.762 24.395  1.00 26.69 ? 70   ILE D CG2 1 
ATOM   3912 C  CD1 . ILE D 4 70  ? 13.987  -28.854 26.100  1.00 27.97 ? 70   ILE D CD1 1 
ATOM   3913 N  N   . THR D 4 71  ? 18.780  -31.800 24.321  1.00 28.61 ? 71   THR D N   1 
ATOM   3914 C  CA  . THR D 4 71  ? 19.579  -32.379 23.251  1.00 28.60 ? 71   THR D CA  1 
ATOM   3915 C  C   . THR D 4 71  ? 18.887  -33.599 22.663  1.00 29.01 ? 71   THR D C   1 
ATOM   3916 O  O   . THR D 4 71  ? 17.817  -33.999 23.130  1.00 28.51 ? 71   THR D O   1 
ATOM   3917 C  CB  . THR D 4 71  ? 20.969  -32.759 23.773  1.00 28.72 ? 71   THR D CB  1 
ATOM   3918 O  OG1 . THR D 4 71  ? 20.823  -33.564 24.946  1.00 28.21 ? 71   THR D OG1 1 
ATOM   3919 C  CG2 . THR D 4 71  ? 21.781  -31.498 24.126  1.00 27.88 ? 71   THR D CG2 1 
ATOM   3920 N  N   . ALA D 4 72  ? 19.491  -34.161 21.614  1.00 29.82 ? 72   ALA D N   1 
ATOM   3921 C  CA  . ALA D 4 72  ? 19.016  -35.399 20.980  1.00 30.59 ? 72   ALA D CA  1 
ATOM   3922 C  C   . ALA D 4 72  ? 20.205  -36.224 20.501  1.00 31.51 ? 72   ALA D C   1 
ATOM   3923 O  O   . ALA D 4 72  ? 21.072  -35.710 19.794  1.00 31.61 ? 72   ALA D O   1 
ATOM   3924 C  CB  . ALA D 4 72  ? 18.086  -35.089 19.817  1.00 29.88 ? 72   ALA D CB  1 
ATOM   3925 N  N   . ASP D 4 73  ? 20.254  -37.496 20.905  1.00 32.95 ? 73   ASP D N   1 
ATOM   3926 C  CA  . ASP D 4 73  ? 21.263  -38.444 20.407  1.00 33.89 ? 73   ASP D CA  1 
ATOM   3927 C  C   . ASP D 4 73  ? 20.850  -38.916 19.007  1.00 34.57 ? 73   ASP D C   1 
ATOM   3928 O  O   . ASP D 4 73  ? 19.858  -39.631 18.852  1.00 34.30 ? 73   ASP D O   1 
ATOM   3929 C  CB  . ASP D 4 73  ? 21.405  -39.627 21.374  1.00 33.86 ? 73   ASP D CB  1 
ATOM   3930 C  CG  . ASP D 4 73  ? 22.583  -40.560 21.031  1.00 34.96 ? 73   ASP D CG  1 
ATOM   3931 O  OD1 . ASP D 4 73  ? 22.799  -40.894 19.837  1.00 35.67 ? 73   ASP D OD1 1 
ATOM   3932 O  OD2 . ASP D 4 73  ? 23.288  -40.986 21.978  1.00 35.34 ? 73   ASP D OD2 1 
ATOM   3933 N  N   . GLU D 4 74  ? 21.626  -38.517 18.001  1.00 35.51 ? 74   GLU D N   1 
ATOM   3934 C  CA  . GLU D 4 74  ? 21.299  -38.773 16.592  1.00 37.08 ? 74   GLU D CA  1 
ATOM   3935 C  C   . GLU D 4 74  ? 21.234  -40.249 16.216  1.00 36.71 ? 74   GLU D C   1 
ATOM   3936 O  O   . GLU D 4 74  ? 20.597  -40.605 15.223  1.00 37.10 ? 74   GLU D O   1 
ATOM   3937 C  CB  . GLU D 4 74  ? 22.285  -38.048 15.671  1.00 36.94 ? 74   GLU D CB  1 
ATOM   3938 C  CG  . GLU D 4 74  ? 22.064  -36.547 15.605  1.00 38.83 ? 74   GLU D CG  1 
ATOM   3939 C  CD  . GLU D 4 74  ? 23.048  -35.827 14.680  1.00 40.03 ? 74   GLU D CD  1 
ATOM   3940 O  OE1 . GLU D 4 74  ? 23.420  -36.384 13.606  1.00 44.11 ? 74   GLU D OE1 1 
ATOM   3941 O  OE2 . GLU D 4 74  ? 23.434  -34.680 15.026  1.00 43.59 ? 74   GLU D OE2 1 
ATOM   3942 N  N   . SER D 4 75  ? 21.881  -41.097 17.016  1.00 36.53 ? 75   SER D N   1 
ATOM   3943 C  CA  . SER D 4 75  ? 21.940  -42.538 16.763  1.00 36.26 ? 75   SER D CA  1 
ATOM   3944 C  C   . SER D 4 75  ? 20.793  -43.368 17.337  1.00 35.68 ? 75   SER D C   1 
ATOM   3945 O  O   . SER D 4 75  ? 20.539  -44.477 16.861  1.00 36.10 ? 75   SER D O   1 
ATOM   3946 C  CB  . SER D 4 75  ? 23.246  -43.097 17.306  1.00 36.20 ? 75   SER D CB  1 
ATOM   3947 O  OG  . SER D 4 75  ? 24.333  -42.522 16.614  1.00 38.19 ? 75   SER D OG  1 
ATOM   3948 N  N   . THR D 4 76  ? 20.115  -42.857 18.360  1.00 34.70 ? 76   THR D N   1 
ATOM   3949 C  CA  . THR D 4 76  ? 19.300  -43.728 19.213  1.00 33.69 ? 76   THR D CA  1 
ATOM   3950 C  C   . THR D 4 76  ? 17.844  -43.312 19.355  1.00 32.80 ? 76   THR D C   1 
ATOM   3951 O  O   . THR D 4 76  ? 17.160  -43.812 20.250  1.00 32.82 ? 76   THR D O   1 
ATOM   3952 C  CB  . THR D 4 76  ? 19.883  -43.825 20.643  1.00 33.49 ? 76   THR D CB  1 
ATOM   3953 O  OG1 . THR D 4 76  ? 19.940  -42.514 21.205  1.00 34.34 ? 76   THR D OG1 1 
ATOM   3954 C  CG2 . THR D 4 76  ? 21.285  -44.422 20.647  1.00 33.70 ? 76   THR D CG2 1 
ATOM   3955 N  N   . SER D 4 77  ? 17.381  -42.401 18.495  1.00 31.65 ? 77   SER D N   1 
ATOM   3956 C  CA  . SER D 4 77  ? 15.999  -41.888 18.536  1.00 30.25 ? 77   SER D CA  1 
ATOM   3957 C  C   . SER D 4 77  ? 15.602  -41.370 19.927  1.00 29.84 ? 77   SER D C   1 
ATOM   3958 O  O   . SER D 4 77  ? 14.429  -41.447 20.314  1.00 29.33 ? 77   SER D O   1 
ATOM   3959 C  CB  . SER D 4 77  ? 14.995  -42.957 18.065  1.00 30.35 ? 77   SER D CB  1 
ATOM   3960 O  OG  . SER D 4 77  ? 15.477  -43.731 16.973  1.00 28.96 ? 77   SER D OG  1 
ATOM   3961 N  N   . THR D 4 78  ? 16.582  -40.841 20.665  1.00 29.48 ? 78   THR D N   1 
ATOM   3962 C  CA  . THR D 4 78  ? 16.392  -40.426 22.060  1.00 29.31 ? 78   THR D CA  1 
ATOM   3963 C  C   . THR D 4 78  ? 16.674  -38.936 22.267  1.00 29.07 ? 78   THR D C   1 
ATOM   3964 O  O   . THR D 4 78  ? 17.738  -38.438 21.889  1.00 28.94 ? 78   THR D O   1 
ATOM   3965 C  CB  . THR D 4 78  ? 17.295  -41.258 23.023  1.00 29.43 ? 78   THR D CB  1 
ATOM   3966 O  OG1 . THR D 4 78  ? 17.105  -42.657 22.778  1.00 30.04 ? 78   THR D OG1 1 
ATOM   3967 C  CG2 . THR D 4 78  ? 16.976  -40.971 24.488  1.00 29.14 ? 78   THR D CG2 1 
ATOM   3968 N  N   . ALA D 4 79  ? 15.722  -38.240 22.888  1.00 28.71 ? 79   ALA D N   1 
ATOM   3969 C  CA  . ALA D 4 79  ? 15.897  -36.844 23.277  1.00 28.40 ? 79   ALA D CA  1 
ATOM   3970 C  C   . ALA D 4 79  ? 16.031  -36.686 24.793  1.00 28.67 ? 79   ALA D C   1 
ATOM   3971 O  O   . ALA D 4 79  ? 15.326  -37.333 25.568  1.00 28.94 ? 79   ALA D O   1 
ATOM   3972 C  CB  . ALA D 4 79  ? 14.759  -36.018 22.764  1.00 28.31 ? 79   ALA D CB  1 
ATOM   3973 N  N   . TYR D 4 80  ? 16.934  -35.807 25.208  1.00 28.80 ? 80   TYR D N   1 
ATOM   3974 C  CA  . TYR D 4 80  ? 17.228  -35.595 26.616  1.00 28.67 ? 80   TYR D CA  1 
ATOM   3975 C  C   . TYR D 4 80  ? 16.804  -34.214 27.079  1.00 28.75 ? 80   TYR D C   1 
ATOM   3976 O  O   . TYR D 4 80  ? 16.815  -33.260 26.303  1.00 28.95 ? 80   TYR D O   1 
ATOM   3977 C  CB  . TYR D 4 80  ? 18.722  -35.761 26.857  1.00 28.79 ? 80   TYR D CB  1 
ATOM   3978 C  CG  . TYR D 4 80  ? 19.210  -37.145 26.553  1.00 29.07 ? 80   TYR D CG  1 
ATOM   3979 C  CD1 . TYR D 4 80  ? 19.558  -37.513 25.248  1.00 28.99 ? 80   TYR D CD1 1 
ATOM   3980 C  CD2 . TYR D 4 80  ? 19.320  -38.100 27.567  1.00 28.39 ? 80   TYR D CD2 1 
ATOM   3981 C  CE1 . TYR D 4 80  ? 20.001  -38.802 24.964  1.00 28.86 ? 80   TYR D CE1 1 
ATOM   3982 C  CE2 . TYR D 4 80  ? 19.763  -39.383 27.293  1.00 27.80 ? 80   TYR D CE2 1 
ATOM   3983 C  CZ  . TYR D 4 80  ? 20.098  -39.725 25.992  1.00 28.55 ? 80   TYR D CZ  1 
ATOM   3984 O  OH  . TYR D 4 80  ? 20.531  -40.997 25.722  1.00 30.14 ? 80   TYR D OH  1 
ATOM   3985 N  N   . MET D 4 81  ? 16.435  -34.122 28.352  1.00 28.71 ? 81   MET D N   1 
ATOM   3986 C  CA  . MET D 4 81  ? 16.119  -32.857 29.000  1.00 28.86 ? 81   MET D CA  1 
ATOM   3987 C  C   . MET D 4 81  ? 16.971  -32.787 30.247  1.00 28.90 ? 81   MET D C   1 
ATOM   3988 O  O   . MET D 4 81  ? 16.850  -33.632 31.142  1.00 28.49 ? 81   MET D O   1 
ATOM   3989 C  CB  . MET D 4 81  ? 14.636  -32.799 29.368  1.00 29.05 ? 81   MET D CB  1 
ATOM   3990 C  CG  . MET D 4 81  ? 14.119  -31.479 29.921  1.00 29.80 ? 81   MET D CG  1 
ATOM   3991 S  SD  . MET D 4 81  ? 14.448  -31.154 31.673  1.00 32.66 ? 81   MET D SD  1 
ATOM   3992 C  CE  . MET D 4 81  ? 13.714  -32.560 32.506  1.00 30.30 ? 81   MET D CE  1 
ATOM   3993 N  N   . GLU D 4 82  ? 17.852  -31.791 30.295  1.00 28.93 ? 82   GLU D N   1 
ATOM   3994 C  CA  . GLU D 4 82  ? 18.697  -31.614 31.463  1.00 28.80 ? 82   GLU D CA  1 
ATOM   3995 C  C   . GLU D 4 82  ? 18.391  -30.311 32.191  1.00 28.36 ? 82   GLU D C   1 
ATOM   3996 O  O   . GLU D 4 82  ? 18.573  -29.228 31.641  1.00 28.20 ? 82   GLU D O   1 
ATOM   3997 C  CB  . GLU D 4 82  ? 20.168  -31.731 31.093  1.00 28.96 ? 82   GLU D CB  1 
ATOM   3998 C  CG  . GLU D 4 82  ? 21.111  -31.288 32.192  1.00 30.31 ? 82   GLU D CG  1 
ATOM   3999 C  CD  . GLU D 4 82  ? 22.482  -31.892 32.054  1.00 32.82 ? 82   GLU D CD  1 
ATOM   4000 O  OE1 . GLU D 4 82  ? 22.914  -32.203 30.920  1.00 33.72 ? 82   GLU D OE1 1 
ATOM   4001 O  OE2 . GLU D 4 82  ? 23.133  -32.064 33.101  1.00 35.47 ? 82   GLU D OE2 1 
ATOM   4002 N  N   . LEU D 4 83  ? 17.905  -30.439 33.424  1.00 27.89 ? 83   LEU D N   1 
ATOM   4003 C  CA  . LEU D 4 83  ? 17.594  -29.300 34.267  1.00 27.73 ? 83   LEU D CA  1 
ATOM   4004 C  C   . LEU D 4 83  ? 18.576  -29.242 35.415  1.00 28.08 ? 83   LEU D C   1 
ATOM   4005 O  O   . LEU D 4 83  ? 18.788  -30.241 36.091  1.00 28.14 ? 83   LEU D O   1 
ATOM   4006 C  CB  . LEU D 4 83  ? 16.175  -29.406 34.809  1.00 27.22 ? 83   LEU D CB  1 
ATOM   4007 C  CG  . LEU D 4 83  ? 15.665  -28.171 35.546  1.00 26.41 ? 83   LEU D CG  1 
ATOM   4008 C  CD1 . LEU D 4 83  ? 15.428  -27.031 34.570  1.00 25.88 ? 83   LEU D CD1 1 
ATOM   4009 C  CD2 . LEU D 4 83  ? 14.388  -28.484 36.315  1.00 25.90 ? 83   LEU D CD2 1 
ATOM   4010 N  N   . SER D 4 84  ? 19.180  -28.076 35.625  1.00 28.66 ? 84   SER D N   1 
ATOM   4011 C  CA  . SER D 4 84  ? 20.156  -27.904 36.698  1.00 29.35 ? 84   SER D CA  1 
ATOM   4012 C  C   . SER D 4 84  ? 19.780  -26.802 37.685  1.00 29.49 ? 84   SER D C   1 
ATOM   4013 O  O   . SER D 4 84  ? 18.807  -26.083 37.476  1.00 29.22 ? 84   SER D O   1 
ATOM   4014 C  CB  . SER D 4 84  ? 21.550  -27.673 36.128  1.00 29.23 ? 84   SER D CB  1 
ATOM   4015 O  OG  . SER D 4 84  ? 21.583  -26.455 35.425  1.00 31.09 ? 84   SER D OG  1 
ATOM   4016 N  N   . SER D 4 85  ? 20.569  -26.694 38.758  1.00 30.42 ? 85   SER D N   1 
ATOM   4017 C  CA  . SER D 4 85  ? 20.295  -25.823 39.902  1.00 31.38 ? 85   SER D CA  1 
ATOM   4018 C  C   . SER D 4 85  ? 18.946  -26.160 40.497  1.00 32.39 ? 85   SER D C   1 
ATOM   4019 O  O   . SER D 4 85  ? 18.123  -25.273 40.759  1.00 32.69 ? 85   SER D O   1 
ATOM   4020 C  CB  . SER D 4 85  ? 20.367  -24.341 39.529  1.00 31.14 ? 85   SER D CB  1 
ATOM   4021 O  OG  . SER D 4 85  ? 21.713  -23.921 39.437  1.00 30.96 ? 85   SER D OG  1 
ATOM   4022 N  N   . LEU D 4 86  ? 18.730  -27.454 40.706  1.00 33.31 ? 86   LEU D N   1 
ATOM   4023 C  CA  . LEU D 4 86  ? 17.446  -27.944 41.184  1.00 34.26 ? 86   LEU D CA  1 
ATOM   4024 C  C   . LEU D 4 86  ? 17.083  -27.315 42.517  1.00 35.05 ? 86   LEU D C   1 
ATOM   4025 O  O   . LEU D 4 86  ? 17.954  -27.002 43.323  1.00 35.56 ? 86   LEU D O   1 
ATOM   4026 C  CB  . LEU D 4 86  ? 17.443  -29.476 41.260  1.00 34.01 ? 86   LEU D CB  1 
ATOM   4027 C  CG  . LEU D 4 86  ? 17.610  -30.151 39.890  1.00 33.50 ? 86   LEU D CG  1 
ATOM   4028 C  CD1 . LEU D 4 86  ? 17.919  -31.628 40.030  1.00 32.28 ? 86   LEU D CD1 1 
ATOM   4029 C  CD2 . LEU D 4 86  ? 16.390  -29.912 38.997  1.00 32.21 ? 86   LEU D CD2 1 
ATOM   4030 N  N   . ARG D 4 87  ? 15.795  -27.091 42.714  1.00 35.86 ? 87   ARG D N   1 
ATOM   4031 C  CA  . ARG D 4 87  ? 15.272  -26.578 43.964  1.00 37.15 ? 87   ARG D CA  1 
ATOM   4032 C  C   . ARG D 4 87  ? 13.993  -27.353 44.234  1.00 36.94 ? 87   ARG D C   1 
ATOM   4033 O  O   . ARG D 4 87  ? 13.467  -27.989 43.322  1.00 37.47 ? 87   ARG D O   1 
ATOM   4034 C  CB  . ARG D 4 87  ? 14.970  -25.091 43.831  1.00 37.06 ? 87   ARG D CB  1 
ATOM   4035 C  CG  . ARG D 4 87  ? 16.195  -24.208 43.627  1.00 38.85 ? 87   ARG D CG  1 
ATOM   4036 C  CD  . ARG D 4 87  ? 15.816  -22.728 43.591  1.00 39.79 ? 87   ARG D CD  1 
ATOM   4037 N  NE  . ARG D 4 87  ? 14.904  -22.406 42.479  1.00 45.53 ? 87   ARG D NE  1 
ATOM   4038 C  CZ  . ARG D 4 87  ? 15.284  -22.111 41.228  1.00 46.72 ? 87   ARG D CZ  1 
ATOM   4039 N  NH1 . ARG D 4 87  ? 16.580  -22.101 40.890  1.00 46.33 ? 87   ARG D NH1 1 
ATOM   4040 N  NH2 . ARG D 4 87  ? 14.360  -21.827 40.309  1.00 46.73 ? 87   ARG D NH2 1 
ATOM   4041 N  N   . SER D 4 88  ? 13.488  -27.303 45.467  1.00 36.86 ? 88   SER D N   1 
ATOM   4042 C  CA  . SER D 4 88  ? 12.243  -28.001 45.835  1.00 36.53 ? 88   SER D CA  1 
ATOM   4043 C  C   . SER D 4 88  ? 11.129  -27.816 44.803  1.00 36.22 ? 88   SER D C   1 
ATOM   4044 O  O   . SER D 4 88  ? 10.429  -28.769 44.447  1.00 36.10 ? 88   SER D O   1 
ATOM   4045 C  CB  . SER D 4 88  ? 11.743  -27.514 47.195  1.00 36.53 ? 88   SER D CB  1 
ATOM   4046 O  OG  . SER D 4 88  ? 12.658  -27.858 48.211  1.00 37.16 ? 88   SER D OG  1 
ATOM   4047 N  N   . GLU D 4 89  ? 10.996  -26.576 44.332  1.00 35.71 ? 89   GLU D N   1 
ATOM   4048 C  CA  . GLU D 4 89  ? 9.969   -26.150 43.387  1.00 35.42 ? 89   GLU D CA  1 
ATOM   4049 C  C   . GLU D 4 89  ? 10.018  -26.931 42.066  1.00 34.41 ? 89   GLU D C   1 
ATOM   4050 O  O   . GLU D 4 89  ? 9.028   -26.990 41.346  1.00 34.51 ? 89   GLU D O   1 
ATOM   4051 C  CB  . GLU D 4 89  ? 10.104  -24.636 43.125  1.00 36.05 ? 89   GLU D CB  1 
ATOM   4052 C  CG  . GLU D 4 89  ? 9.835   -23.706 44.357  1.00 39.22 ? 89   GLU D CG  1 
ATOM   4053 C  CD  . GLU D 4 89  ? 10.934  -23.750 45.467  1.00 42.96 ? 89   GLU D CD  1 
ATOM   4054 O  OE1 . GLU D 4 89  ? 12.138  -23.909 45.148  1.00 43.65 ? 89   GLU D OE1 1 
ATOM   4055 O  OE2 . GLU D 4 89  ? 10.588  -23.613 46.671  1.00 44.39 ? 89   GLU D OE2 1 
ATOM   4056 N  N   . ASP D 4 90  ? 11.169  -27.523 41.754  1.00 33.23 ? 90   ASP D N   1 
ATOM   4057 C  CA  . ASP D 4 90  ? 11.342  -28.331 40.547  1.00 32.09 ? 90   ASP D CA  1 
ATOM   4058 C  C   . ASP D 4 90  ? 10.772  -29.753 40.659  1.00 31.07 ? 90   ASP D C   1 
ATOM   4059 O  O   . ASP D 4 90  ? 10.766  -30.495 39.672  1.00 30.70 ? 90   ASP D O   1 
ATOM   4060 C  CB  . ASP D 4 90  ? 12.823  -28.412 40.171  1.00 32.56 ? 90   ASP D CB  1 
ATOM   4061 C  CG  . ASP D 4 90  ? 13.403  -27.073 39.763  1.00 33.56 ? 90   ASP D CG  1 
ATOM   4062 O  OD1 . ASP D 4 90  ? 12.657  -26.206 39.275  1.00 35.12 ? 90   ASP D OD1 1 
ATOM   4063 O  OD2 . ASP D 4 90  ? 14.628  -26.886 39.913  1.00 36.16 ? 90   ASP D OD2 1 
ATOM   4064 N  N   . THR D 4 91  ? 10.324  -30.134 41.856  1.00 29.74 ? 91   THR D N   1 
ATOM   4065 C  CA  . THR D 4 91  ? 9.646   -31.413 42.067  1.00 28.71 ? 91   THR D CA  1 
ATOM   4066 C  C   . THR D 4 91  ? 8.409   -31.409 41.190  1.00 28.01 ? 91   THR D C   1 
ATOM   4067 O  O   . THR D 4 91  ? 7.563   -30.530 41.320  1.00 28.10 ? 91   THR D O   1 
ATOM   4068 C  CB  . THR D 4 91  ? 9.270   -31.625 43.564  1.00 28.61 ? 91   THR D CB  1 
ATOM   4069 O  OG1 . THR D 4 91  ? 10.464  -31.793 44.335  1.00 29.25 ? 91   THR D OG1 1 
ATOM   4070 C  CG2 . THR D 4 91  ? 8.404   -32.850 43.761  1.00 28.15 ? 91   THR D CG2 1 
ATOM   4071 N  N   . ALA D 4 92  ? 8.331   -32.364 40.271  1.00 27.24 ? 92   ALA D N   1 
ATOM   4072 C  CA  . ALA D 4 92  ? 7.235   -32.426 39.294  1.00 26.83 ? 92   ALA D CA  1 
ATOM   4073 C  C   . ALA D 4 92  ? 7.298   -33.721 38.519  1.00 26.43 ? 92   ALA D C   1 
ATOM   4074 O  O   . ALA D 4 92  ? 8.320   -34.406 38.550  1.00 26.68 ? 92   ALA D O   1 
ATOM   4075 C  CB  . ALA D 4 92  ? 7.325   -31.260 38.318  1.00 27.01 ? 92   ALA D CB  1 
ATOM   4076 N  N   . VAL D 4 93  ? 6.218   -34.056 37.817  1.00 25.73 ? 93   VAL D N   1 
ATOM   4077 C  CA  . VAL D 4 93  ? 6.312   -35.064 36.757  1.00 25.37 ? 93   VAL D CA  1 
ATOM   4078 C  C   . VAL D 4 93  ? 6.746   -34.359 35.452  1.00 25.17 ? 93   VAL D C   1 
ATOM   4079 O  O   . VAL D 4 93  ? 6.103   -33.401 35.015  1.00 25.43 ? 93   VAL D O   1 
ATOM   4080 C  CB  . VAL D 4 93  ? 4.983   -35.850 36.553  1.00 25.33 ? 93   VAL D CB  1 
ATOM   4081 C  CG1 . VAL D 4 93  ? 5.114   -36.828 35.384  1.00 25.11 ? 93   VAL D CG1 1 
ATOM   4082 C  CG2 . VAL D 4 93  ? 4.581   -36.592 37.816  1.00 23.78 ? 93   VAL D CG2 1 
ATOM   4083 N  N   . TYR D 4 94  ? 7.842   -34.805 34.855  1.00 24.43 ? 94   TYR D N   1 
ATOM   4084 C  CA  . TYR D 4 94  ? 8.304   -34.217 33.599  1.00 24.47 ? 94   TYR D CA  1 
ATOM   4085 C  C   . TYR D 4 94  ? 7.859   -35.078 32.425  1.00 24.06 ? 94   TYR D C   1 
ATOM   4086 O  O   . TYR D 4 94  ? 8.199   -36.254 32.351  1.00 24.11 ? 94   TYR D O   1 
ATOM   4087 C  CB  . TYR D 4 94  ? 9.842   -34.005 33.611  1.00 24.87 ? 94   TYR D CB  1 
ATOM   4088 C  CG  . TYR D 4 94  ? 10.272  -32.896 34.565  1.00 25.20 ? 94   TYR D CG  1 
ATOM   4089 C  CD1 . TYR D 4 94  ? 10.443  -33.151 35.929  1.00 25.84 ? 94   TYR D CD1 1 
ATOM   4090 C  CD2 . TYR D 4 94  ? 10.452  -31.587 34.115  1.00 25.05 ? 94   TYR D CD2 1 
ATOM   4091 C  CE1 . TYR D 4 94  ? 10.795  -32.143 36.818  1.00 25.62 ? 94   TYR D CE1 1 
ATOM   4092 C  CE2 . TYR D 4 94  ? 10.802  -30.570 35.000  1.00 25.83 ? 94   TYR D CE2 1 
ATOM   4093 C  CZ  . TYR D 4 94  ? 10.973  -30.864 36.347  1.00 25.66 ? 94   TYR D CZ  1 
ATOM   4094 O  OH  . TYR D 4 94  ? 11.323  -29.880 37.227  1.00 26.00 ? 94   TYR D OH  1 
ATOM   4095 N  N   . TYR D 4 95  ? 7.084   -34.496 31.518  1.00 23.82 ? 95   TYR D N   1 
ATOM   4096 C  CA  . TYR D 4 95  ? 6.617   -35.207 30.329  1.00 23.78 ? 95   TYR D CA  1 
ATOM   4097 C  C   . TYR D 4 95  ? 7.393   -34.800 29.094  1.00 23.47 ? 95   TYR D C   1 
ATOM   4098 O  O   . TYR D 4 95  ? 7.756   -33.642 28.943  1.00 23.84 ? 95   TYR D O   1 
ATOM   4099 C  CB  . TYR D 4 95  ? 5.146   -34.891 30.054  1.00 24.24 ? 95   TYR D CB  1 
ATOM   4100 C  CG  . TYR D 4 95  ? 4.178   -35.461 31.037  1.00 24.03 ? 95   TYR D CG  1 
ATOM   4101 C  CD1 . TYR D 4 95  ? 3.929   -36.825 31.072  1.00 25.24 ? 95   TYR D CD1 1 
ATOM   4102 C  CD2 . TYR D 4 95  ? 3.487   -34.638 31.916  1.00 24.15 ? 95   TYR D CD2 1 
ATOM   4103 C  CE1 . TYR D 4 95  ? 3.030   -37.370 31.983  1.00 26.18 ? 95   TYR D CE1 1 
ATOM   4104 C  CE2 . TYR D 4 95  ? 2.577   -35.168 32.829  1.00 25.88 ? 95   TYR D CE2 1 
ATOM   4105 C  CZ  . TYR D 4 95  ? 2.356   -36.539 32.857  1.00 25.60 ? 95   TYR D CZ  1 
ATOM   4106 O  OH  . TYR D 4 95  ? 1.466   -37.087 33.748  1.00 25.14 ? 95   TYR D OH  1 
ATOM   4107 N  N   . CYS D 4 96  ? 7.628   -35.740 28.194  1.00 22.94 ? 96   CYS D N   1 
ATOM   4108 C  CA  . CYS D 4 96  ? 8.000   -35.361 26.844  1.00 22.82 ? 96   CYS D CA  1 
ATOM   4109 C  C   . CYS D 4 96  ? 6.783   -35.510 25.958  1.00 22.38 ? 96   CYS D C   1 
ATOM   4110 O  O   . CYS D 4 96  ? 5.938   -36.361 26.194  1.00 22.67 ? 96   CYS D O   1 
ATOM   4111 C  CB  . CYS D 4 96  ? 9.215   -36.149 26.309  1.00 22.99 ? 96   CYS D CB  1 
ATOM   4112 S  SG  . CYS D 4 96  ? 8.998   -37.925 26.096  1.00 23.99 ? 96   CYS D SG  1 
ATOM   4113 N  N   . ALA D 4 97  ? 6.673   -34.655 24.953  1.00 22.14 ? 97   ALA D N   1 
ATOM   4114 C  CA  . ALA D 4 97  ? 5.624   -34.789 23.958  1.00 21.81 ? 97   ALA D CA  1 
ATOM   4115 C  C   . ALA D 4 97  ? 6.195   -34.355 22.630  1.00 21.82 ? 97   ALA D C   1 
ATOM   4116 O  O   . ALA D 4 97  ? 7.024   -33.446 22.570  1.00 22.36 ? 97   ALA D O   1 
ATOM   4117 C  CB  . ALA D 4 97  ? 4.422   -33.943 24.328  1.00 21.67 ? 97   ALA D CB  1 
ATOM   4118 N  N   . ARG D 4 98  ? 5.771   -35.018 21.569  1.00 21.45 ? 98   ARG D N   1 
ATOM   4119 C  CA  . ARG D 4 98  ? 6.177   -34.647 20.225  1.00 21.22 ? 98   ARG D CA  1 
ATOM   4120 C  C   . ARG D 4 98  ? 5.397   -33.425 19.702  1.00 21.06 ? 98   ARG D C   1 
ATOM   4121 O  O   . ARG D 4 98  ? 4.167   -33.344 19.843  1.00 20.62 ? 98   ARG D O   1 
ATOM   4122 C  CB  . ARG D 4 98  ? 5.966   -35.843 19.291  1.00 21.28 ? 98   ARG D CB  1 
ATOM   4123 C  CG  . ARG D 4 98  ? 6.408   -35.648 17.855  1.00 21.10 ? 98   ARG D CG  1 
ATOM   4124 C  CD  . ARG D 4 98  ? 5.674   -36.646 17.029  1.00 21.85 ? 98   ARG D CD  1 
ATOM   4125 N  NE  . ARG D 4 98  ? 6.091   -36.717 15.631  1.00 23.98 ? 98   ARG D NE  1 
ATOM   4126 C  CZ  . ARG D 4 98  ? 5.713   -37.691 14.804  1.00 23.75 ? 98   ARG D CZ  1 
ATOM   4127 N  NH1 . ARG D 4 98  ? 4.928   -38.677 15.237  1.00 24.54 ? 98   ARG D NH1 1 
ATOM   4128 N  NH2 . ARG D 4 98  ? 6.119   -37.687 13.551  1.00 23.23 ? 98   ARG D NH2 1 
ATOM   4129 N  N   . HIS D 4 99  ? 6.130   -32.479 19.108  1.00 20.88 ? 99   HIS D N   1 
ATOM   4130 C  CA  . HIS D 4 99  ? 5.532   -31.435 18.266  1.00 20.83 ? 99   HIS D CA  1 
ATOM   4131 C  C   . HIS D 4 99  ? 6.070   -31.558 16.827  1.00 21.09 ? 99   HIS D C   1 
ATOM   4132 O  O   . HIS D 4 99  ? 6.769   -32.529 16.508  1.00 21.23 ? 99   HIS D O   1 
ATOM   4133 C  CB  . HIS D 4 99  ? 5.749   -30.053 18.865  1.00 20.32 ? 99   HIS D CB  1 
ATOM   4134 C  CG  . HIS D 4 99  ? 7.167   -29.597 18.832  1.00 20.08 ? 99   HIS D CG  1 
ATOM   4135 N  ND1 . HIS D 4 99  ? 8.051   -29.847 19.856  1.00 20.18 ? 99   HIS D ND1 1 
ATOM   4136 C  CD2 . HIS D 4 99  ? 7.855   -28.898 17.899  1.00 19.88 ? 99   HIS D CD2 1 
ATOM   4137 C  CE1 . HIS D 4 99  ? 9.227   -29.325 19.554  1.00 20.95 ? 99   HIS D CE1 1 
ATOM   4138 N  NE2 . HIS D 4 99  ? 9.134   -28.743 18.371  1.00 20.33 ? 99   HIS D NE2 1 
ATOM   4139 N  N   . TYR D 4 100 ? 5.745   -30.618 15.947  1.00 21.07 ? 100  TYR D N   1 
ATOM   4140 C  CA  . TYR D 4 100 ? 6.109   -30.805 14.531  1.00 21.51 ? 100  TYR D CA  1 
ATOM   4141 C  C   . TYR D 4 100 ? 6.873   -29.626 13.956  1.00 22.04 ? 100  TYR D C   1 
ATOM   4142 O  O   . TYR D 4 100 ? 6.690   -28.483 14.385  1.00 22.40 ? 100  TYR D O   1 
ATOM   4143 C  CB  . TYR D 4 100 ? 4.878   -31.156 13.665  1.00 21.13 ? 100  TYR D CB  1 
ATOM   4144 C  CG  . TYR D 4 100 ? 4.062   -32.289 14.257  1.00 20.91 ? 100  TYR D CG  1 
ATOM   4145 C  CD1 . TYR D 4 100 ? 4.322   -33.615 13.907  1.00 21.01 ? 100  TYR D CD1 1 
ATOM   4146 C  CD2 . TYR D 4 100 ? 3.071   -32.038 15.217  1.00 18.95 ? 100  TYR D CD2 1 
ATOM   4147 C  CE1 . TYR D 4 100 ? 3.601   -34.669 14.485  1.00 20.61 ? 100  TYR D CE1 1 
ATOM   4148 C  CE2 . TYR D 4 100 ? 2.359   -33.072 15.801  1.00 19.05 ? 100  TYR D CE2 1 
ATOM   4149 C  CZ  . TYR D 4 100 ? 2.629   -34.385 15.427  1.00 20.29 ? 100  TYR D CZ  1 
ATOM   4150 O  OH  . TYR D 4 100 ? 1.929   -35.418 15.985  1.00 20.61 ? 100  TYR D OH  1 
ATOM   4151 N  N   . GLU D 4 101 ? 7.765   -29.918 13.016  1.00 22.34 ? 101  GLU D N   1 
ATOM   4152 C  CA  . GLU D 4 101 ? 8.383   -28.885 12.221  1.00 22.72 ? 101  GLU D CA  1 
ATOM   4153 C  C   . GLU D 4 101 ? 7.876   -29.083 10.809  1.00 22.10 ? 101  GLU D C   1 
ATOM   4154 O  O   . GLU D 4 101 ? 8.450   -29.846 10.047  1.00 21.83 ? 101  GLU D O   1 
ATOM   4155 C  CB  . GLU D 4 101 ? 9.912   -28.972 12.235  1.00 22.73 ? 101  GLU D CB  1 
ATOM   4156 C  CG  . GLU D 4 101 ? 10.581  -29.564 13.465  1.00 23.55 ? 101  GLU D CG  1 
ATOM   4157 C  CD  . GLU D 4 101 ? 12.107  -29.672 13.274  1.00 24.88 ? 101  GLU D CD  1 
ATOM   4158 O  OE1 . GLU D 4 101 ? 12.652  -30.811 13.326  1.00 25.66 ? 101  GLU D OE1 1 
ATOM   4159 O  OE2 . GLU D 4 101 ? 12.751  -28.609 13.041  1.00 26.99 ? 101  GLU D OE2 1 
ATOM   4160 N  N   . ILE D 4 102 ? 6.804   -28.381 10.473  1.00 22.29 ? 102  ILE D N   1 
ATOM   4161 C  CA  . ILE D 4 102 ? 6.179   -28.463 9.160   1.00 23.00 ? 102  ILE D CA  1 
ATOM   4162 C  C   . ILE D 4 102 ? 6.813   -27.495 8.163   1.00 23.63 ? 102  ILE D C   1 
ATOM   4163 O  O   . ILE D 4 102 ? 6.906   -26.300 8.451   1.00 24.37 ? 102  ILE D O   1 
ATOM   4164 C  CB  . ILE D 4 102 ? 4.656   -28.132 9.250   1.00 22.89 ? 102  ILE D CB  1 
ATOM   4165 C  CG1 . ILE D 4 102 ? 3.959   -28.965 10.342  1.00 23.08 ? 102  ILE D CG1 1 
ATOM   4166 C  CG2 . ILE D 4 102 ? 3.977   -28.293 7.884   1.00 22.21 ? 102  ILE D CG2 1 
ATOM   4167 C  CD1 . ILE D 4 102 ? 4.085   -30.502 10.166  1.00 25.08 ? 102  ILE D CD1 1 
ATOM   4168 N  N   . GLN D 4 103 ? 7.229   -28.001 6.997   1.00 24.15 ? 103  GLN D N   1 
ATOM   4169 C  CA  . GLN D 4 103 ? 7.658   -27.146 5.873   1.00 24.48 ? 103  GLN D CA  1 
ATOM   4170 C  C   . GLN D 4 103 ? 6.469   -26.428 5.230   1.00 24.92 ? 103  GLN D C   1 
ATOM   4171 O  O   . GLN D 4 103 ? 5.693   -27.052 4.493   1.00 25.31 ? 103  GLN D O   1 
ATOM   4172 C  CB  . GLN D 4 103 ? 8.425   -27.964 4.813   1.00 24.48 ? 103  GLN D CB  1 
ATOM   4173 C  CG  . GLN D 4 103 ? 8.833   -27.205 3.513   1.00 24.70 ? 103  GLN D CG  1 
ATOM   4174 C  CD  . GLN D 4 103 ? 9.745   -25.981 3.745   1.00 25.80 ? 103  GLN D CD  1 
ATOM   4175 O  OE1 . GLN D 4 103 ? 10.905  -26.124 4.126   1.00 29.00 ? 103  GLN D OE1 1 
ATOM   4176 N  NE2 . GLN D 4 103 ? 9.220   -24.785 3.501   1.00 21.92 ? 103  GLN D NE2 1 
ATOM   4177 N  N   . ILE D 4 104 ? 6.340   -25.123 5.501   1.00 25.35 ? 104  ILE D N   1 
ATOM   4178 C  CA  . ILE D 4 104 ? 5.261   -24.285 4.934   1.00 25.75 ? 104  ILE D CA  1 
ATOM   4179 C  C   . ILE D 4 104 ? 5.740   -23.257 3.902   1.00 26.85 ? 104  ILE D C   1 
ATOM   4180 O  O   . ILE D 4 104 ? 5.007   -22.342 3.537   1.00 26.60 ? 104  ILE D O   1 
ATOM   4181 C  CB  . ILE D 4 104 ? 4.445   -23.556 6.029   1.00 25.17 ? 104  ILE D CB  1 
ATOM   4182 C  CG1 . ILE D 4 104 ? 5.351   -22.611 6.830   1.00 23.80 ? 104  ILE D CG1 1 
ATOM   4183 C  CG2 . ILE D 4 104 ? 3.717   -24.572 6.904   1.00 24.45 ? 104  ILE D CG2 1 
ATOM   4184 C  CD1 . ILE D 4 104 ? 4.641   -21.570 7.659   1.00 20.07 ? 104  ILE D CD1 1 
ATOM   4185 N  N   . GLY D 4 105 ? 6.959   -23.422 3.417   1.00 28.47 ? 105  GLY D N   1 
ATOM   4186 C  CA  . GLY D 4 105 ? 7.543   -22.456 2.486   1.00 30.87 ? 105  GLY D CA  1 
ATOM   4187 C  C   . GLY D 4 105 ? 7.060   -22.610 1.061   1.00 32.21 ? 105  GLY D C   1 
ATOM   4188 O  O   . GLY D 4 105 ? 6.825   -23.723 0.602   1.00 32.46 ? 105  GLY D O   1 
ATOM   4189 N  N   . ARG D 4 106 ? 6.908   -21.478 0.378   1.00 33.97 ? 106  ARG D N   1 
ATOM   4190 C  CA  . ARG D 4 106 ? 6.525   -21.409 -1.034  1.00 35.91 ? 106  ARG D CA  1 
ATOM   4191 C  C   . ARG D 4 106 ? 7.694   -20.877 -1.861  1.00 37.33 ? 106  ARG D C   1 
ATOM   4192 O  O   . ARG D 4 106 ? 8.494   -20.075 -1.377  1.00 37.84 ? 106  ARG D O   1 
ATOM   4193 C  CB  . ARG D 4 106 ? 5.339   -20.463 -1.217  1.00 35.58 ? 106  ARG D CB  1 
ATOM   4194 C  CG  . ARG D 4 106 ? 4.004   -21.035 -0.838  1.00 36.50 ? 106  ARG D CG  1 
ATOM   4195 C  CD  . ARG D 4 106 ? 3.062   -19.982 -0.271  1.00 38.42 ? 106  ARG D CD  1 
ATOM   4196 N  NE  . ARG D 4 106 ? 3.236   -19.859 1.179   1.00 42.10 ? 106  ARG D NE  1 
ATOM   4197 C  CZ  . ARG D 4 106 ? 3.422   -18.713 1.847   1.00 43.83 ? 106  ARG D CZ  1 
ATOM   4198 N  NH1 . ARG D 4 106 ? 3.580   -18.736 3.175   1.00 43.76 ? 106  ARG D NH1 1 
ATOM   4199 N  NH2 . ARG D 4 106 ? 3.437   -17.544 1.205   1.00 43.48 ? 106  ARG D NH2 1 
ATOM   4200 N  N   . TYR D 4 107 ? 7.803   -21.347 -3.098  1.00 38.83 ? 107  TYR D N   1 
ATOM   4201 C  CA  . TYR D 4 107 ? 8.683   -20.751 -4.118  1.00 40.28 ? 107  TYR D CA  1 
ATOM   4202 C  C   . TYR D 4 107 ? 10.178  -21.137 -4.267  1.00 40.91 ? 107  TYR D C   1 
ATOM   4203 O  O   . TYR D 4 107 ? 10.765  -20.709 -5.260  1.00 41.78 ? 107  TYR D O   1 
ATOM   4204 C  CB  . TYR D 4 107 ? 8.446   -19.234 -4.284  1.00 40.96 ? 107  TYR D CB  1 
ATOM   4205 C  CG  . TYR D 4 107 ? 6.979   -18.909 -4.509  1.00 42.41 ? 107  TYR D CG  1 
ATOM   4206 C  CD1 . TYR D 4 107 ? 6.313   -17.997 -3.687  1.00 42.74 ? 107  TYR D CD1 1 
ATOM   4207 C  CD2 . TYR D 4 107 ? 6.242   -19.554 -5.520  1.00 43.19 ? 107  TYR D CD2 1 
ATOM   4208 C  CE1 . TYR D 4 107 ? 4.958   -17.716 -3.871  1.00 43.25 ? 107  TYR D CE1 1 
ATOM   4209 C  CE2 . TYR D 4 107 ? 4.883   -19.280 -5.713  1.00 43.43 ? 107  TYR D CE2 1 
ATOM   4210 C  CZ  . TYR D 4 107 ? 4.250   -18.358 -4.882  1.00 43.39 ? 107  TYR D CZ  1 
ATOM   4211 O  OH  . TYR D 4 107 ? 2.912   -18.080 -5.050  1.00 43.46 ? 107  TYR D OH  1 
ATOM   4212 N  N   . GLY D 4 108 ? 10.860  -21.808 -3.334  1.00 41.08 ? 108  GLY D N   1 
ATOM   4213 C  CA  . GLY D 4 108 ? 10.755  -21.688 -1.885  1.00 41.17 ? 108  GLY D CA  1 
ATOM   4214 C  C   . GLY D 4 108 ? 12.202  -21.775 -1.375  1.00 41.17 ? 108  GLY D C   1 
ATOM   4215 O  O   . GLY D 4 108 ? 13.042  -22.326 -2.082  1.00 41.29 ? 108  GLY D O   1 
ATOM   4216 N  N   . MET D 4 109 ? 12.543  -21.320 -0.160  1.00 41.07 ? 109  MET D N   1 
ATOM   4217 C  CA  . MET D 4 109 ? 11.664  -21.061 0.984   1.00 40.92 ? 109  MET D CA  1 
ATOM   4218 C  C   . MET D 4 109 ? 10.938  -22.374 1.240   1.00 39.63 ? 109  MET D C   1 
ATOM   4219 O  O   . MET D 4 109 ? 10.031  -22.733 0.485   1.00 40.36 ? 109  MET D O   1 
ATOM   4220 C  CB  . MET D 4 109 ? 10.686  -19.897 0.733   1.00 40.88 ? 109  MET D CB  1 
ATOM   4221 C  CG  . MET D 4 109 ? 11.234  -18.726 -0.106  1.00 42.03 ? 109  MET D CG  1 
ATOM   4222 S  SD  . MET D 4 109 ? 10.614  -17.075 0.382   1.00 43.66 ? 109  MET D SD  1 
ATOM   4223 C  CE  . MET D 4 109 ? 8.835   -17.139 0.074   1.00 43.99 ? 109  MET D CE  1 
ATOM   4224 N  N   . ASN D 4 110 ? 11.290  -23.140 2.263   1.00 38.02 ? 110  ASN D N   1 
ATOM   4225 C  CA  . ASN D 4 110 ? 12.201  -22.873 3.378   1.00 35.79 ? 110  ASN D CA  1 
ATOM   4226 C  C   . ASN D 4 110 ? 11.791  -22.189 4.647   1.00 33.90 ? 110  ASN D C   1 
ATOM   4227 O  O   . ASN D 4 110 ? 12.592  -21.565 5.334   1.00 33.69 ? 110  ASN D O   1 
ATOM   4228 C  CB  . ASN D 4 110 ? 13.668  -22.839 3.036   1.00 36.15 ? 110  ASN D CB  1 
ATOM   4229 C  CG  . ASN D 4 110 ? 14.296  -24.177 3.305   1.00 37.22 ? 110  ASN D CG  1 
ATOM   4230 O  OD1 . ASN D 4 110 ? 14.270  -24.658 4.443   1.00 38.39 ? 110  ASN D OD1 1 
ATOM   4231 N  ND2 . ASN D 4 110 ? 14.779  -24.835 2.256   1.00 38.97 ? 110  ASN D ND2 1 
ATOM   4232 N  N   . VAL D 4 111 ? 10.519  -22.363 4.967   1.00 31.85 ? 111  VAL D N   1 
ATOM   4233 C  CA  . VAL D 4 111 ? 9.943   -21.841 6.182   1.00 29.75 ? 111  VAL D CA  1 
ATOM   4234 C  C   . VAL D 4 111 ? 9.562   -23.025 7.053   1.00 28.52 ? 111  VAL D C   1 
ATOM   4235 O  O   . VAL D 4 111 ? 8.767   -23.868 6.667   1.00 28.28 ? 111  VAL D O   1 
ATOM   4236 C  CB  . VAL D 4 111 ? 8.718   -20.950 5.876   1.00 29.59 ? 111  VAL D CB  1 
ATOM   4237 C  CG1 . VAL D 4 111 ? 8.213   -20.298 7.148   1.00 29.02 ? 111  VAL D CG1 1 
ATOM   4238 C  CG2 . VAL D 4 111 ? 9.076   -19.904 4.835   1.00 28.06 ? 111  VAL D CG2 1 
ATOM   4239 N  N   . TYR D 4 112 ? 10.161  -23.106 8.223   1.00 27.41 ? 112  TYR D N   1 
ATOM   4240 C  CA  . TYR D 4 112 ? 9.824   -24.174 9.135   1.00 26.47 ? 112  TYR D CA  1 
ATOM   4241 C  C   . TYR D 4 112 ? 8.906   -23.647 10.215  1.00 24.81 ? 112  TYR D C   1 
ATOM   4242 O  O   . TYR D 4 112 ? 9.282   -22.759 10.972  1.00 24.50 ? 112  TYR D O   1 
ATOM   4243 C  CB  . TYR D 4 112 ? 11.090  -24.826 9.701   1.00 27.80 ? 112  TYR D CB  1 
ATOM   4244 C  CG  . TYR D 4 112 ? 11.807  -25.679 8.673   1.00 29.24 ? 112  TYR D CG  1 
ATOM   4245 C  CD1 . TYR D 4 112 ? 11.238  -26.878 8.216   1.00 31.65 ? 112  TYR D CD1 1 
ATOM   4246 C  CD2 . TYR D 4 112 ? 13.032  -25.283 8.136   1.00 30.31 ? 112  TYR D CD2 1 
ATOM   4247 C  CE1 . TYR D 4 112 ? 11.878  -27.668 7.251   1.00 31.68 ? 112  TYR D CE1 1 
ATOM   4248 C  CE2 . TYR D 4 112 ? 13.689  -26.062 7.169   1.00 31.45 ? 112  TYR D CE2 1 
ATOM   4249 C  CZ  . TYR D 4 112 ? 13.106  -27.256 6.729   1.00 31.73 ? 112  TYR D CZ  1 
ATOM   4250 O  OH  . TYR D 4 112 ? 13.749  -28.045 5.774   1.00 31.54 ? 112  TYR D OH  1 
ATOM   4251 N  N   . TYR D 4 113 ? 7.681   -24.175 10.236  1.00 22.95 ? 113  TYR D N   1 
ATOM   4252 C  CA  . TYR D 4 113 ? 6.665   -23.836 11.236  1.00 21.20 ? 113  TYR D CA  1 
ATOM   4253 C  C   . TYR D 4 113 ? 6.752   -24.820 12.394  1.00 20.36 ? 113  TYR D C   1 
ATOM   4254 O  O   . TYR D 4 113 ? 6.623   -26.027 12.195  1.00 20.05 ? 113  TYR D O   1 
ATOM   4255 C  CB  . TYR D 4 113 ? 5.276   -23.877 10.579  1.00 20.68 ? 113  TYR D CB  1 
ATOM   4256 C  CG  . TYR D 4 113 ? 4.069   -23.780 11.507  1.00 19.99 ? 113  TYR D CG  1 
ATOM   4257 C  CD1 . TYR D 4 113 ? 4.132   -23.085 12.711  1.00 18.82 ? 113  TYR D CD1 1 
ATOM   4258 C  CD2 . TYR D 4 113 ? 2.845   -24.371 11.153  1.00 18.68 ? 113  TYR D CD2 1 
ATOM   4259 C  CE1 . TYR D 4 113 ? 3.022   -23.000 13.543  1.00 18.86 ? 113  TYR D CE1 1 
ATOM   4260 C  CE2 . TYR D 4 113 ? 1.725   -24.277 11.977  1.00 17.00 ? 113  TYR D CE2 1 
ATOM   4261 C  CZ  . TYR D 4 113 ? 1.823   -23.588 13.160  1.00 18.60 ? 113  TYR D CZ  1 
ATOM   4262 O  OH  . TYR D 4 113 ? 0.736   -23.477 13.989  1.00 19.95 ? 113  TYR D OH  1 
ATOM   4263 N  N   . LEU D 4 114 ? 7.011   -24.320 13.596  1.00 19.65 ? 114  LEU D N   1 
ATOM   4264 C  CA  . LEU D 4 114 ? 6.988   -25.190 14.770  1.00 19.30 ? 114  LEU D CA  1 
ATOM   4265 C  C   . LEU D 4 114 ? 5.586   -25.162 15.344  1.00 19.37 ? 114  LEU D C   1 
ATOM   4266 O  O   . LEU D 4 114 ? 5.142   -24.157 15.929  1.00 19.45 ? 114  LEU D O   1 
ATOM   4267 C  CB  . LEU D 4 114 ? 8.025   -24.791 15.811  1.00 19.12 ? 114  LEU D CB  1 
ATOM   4268 C  CG  . LEU D 4 114 ? 9.458   -24.553 15.329  1.00 19.90 ? 114  LEU D CG  1 
ATOM   4269 C  CD1 . LEU D 4 114 ? 10.269  -23.913 16.448  1.00 21.26 ? 114  LEU D CD1 1 
ATOM   4270 C  CD2 . LEU D 4 114 ? 10.133  -25.827 14.820  1.00 19.59 ? 114  LEU D CD2 1 
ATOM   4271 N  N   . MET D 4 115 ? 4.883   -26.271 15.126  1.00 19.16 ? 115  MET D N   1 
ATOM   4272 C  CA  . MET D 4 115 ? 3.494   -26.408 15.500  1.00 19.16 ? 115  MET D CA  1 
ATOM   4273 C  C   . MET D 4 115 ? 3.377   -27.244 16.767  1.00 18.32 ? 115  MET D C   1 
ATOM   4274 O  O   . MET D 4 115 ? 3.639   -28.441 16.756  1.00 18.27 ? 115  MET D O   1 
ATOM   4275 C  CB  . MET D 4 115 ? 2.703   -27.029 14.350  1.00 19.02 ? 115  MET D CB  1 
ATOM   4276 C  CG  . MET D 4 115 ? 1.188   -26.893 14.492  1.00 19.35 ? 115  MET D CG  1 
ATOM   4277 S  SD  . MET D 4 115 ? 0.282   -27.792 13.228  1.00 21.17 ? 115  MET D SD  1 
ATOM   4278 C  CE  . MET D 4 115 ? 0.708   -29.512 13.617  1.00 18.76 ? 115  MET D CE  1 
ATOM   4279 N  N   . TYR D 4 116 ? 2.988   -26.593 17.857  1.00 17.95 ? 116  TYR D N   1 
ATOM   4280 C  CA  . TYR D 4 116 ? 2.926   -27.231 19.174  1.00 17.46 ? 116  TYR D CA  1 
ATOM   4281 C  C   . TYR D 4 116 ? 1.581   -27.937 19.403  1.00 17.51 ? 116  TYR D C   1 
ATOM   4282 O  O   . TYR D 4 116 ? 0.727   -27.474 20.162  1.00 17.27 ? 116  TYR D O   1 
ATOM   4283 C  CB  . TYR D 4 116 ? 3.292   -26.217 20.279  1.00 16.67 ? 116  TYR D CB  1 
ATOM   4284 C  CG  . TYR D 4 116 ? 4.738   -25.769 20.190  1.00 16.04 ? 116  TYR D CG  1 
ATOM   4285 C  CD1 . TYR D 4 116 ? 5.783   -26.667 20.451  1.00 15.89 ? 116  TYR D CD1 1 
ATOM   4286 C  CD2 . TYR D 4 116 ? 5.071   -24.463 19.821  1.00 14.85 ? 116  TYR D CD2 1 
ATOM   4287 C  CE1 . TYR D 4 116 ? 7.121   -26.280 20.360  1.00 15.43 ? 116  TYR D CE1 1 
ATOM   4288 C  CE2 . TYR D 4 116 ? 6.407   -24.048 19.735  1.00 14.03 ? 116  TYR D CE2 1 
ATOM   4289 C  CZ  . TYR D 4 116 ? 7.431   -24.967 20.000  1.00 16.35 ? 116  TYR D CZ  1 
ATOM   4290 O  OH  . TYR D 4 116 ? 8.763   -24.591 19.911  1.00 15.64 ? 116  TYR D OH  1 
ATOM   4291 N  N   . ARG D 4 117 ? 1.402   -29.054 18.699  1.00 17.94 ? 117  ARG D N   1 
ATOM   4292 C  CA  . ARG D 4 117 ? 0.184   -29.862 18.783  1.00 18.24 ? 117  ARG D CA  1 
ATOM   4293 C  C   . ARG D 4 117 ? 0.533   -31.180 19.445  1.00 18.57 ? 117  ARG D C   1 
ATOM   4294 O  O   . ARG D 4 117 ? 1.042   -32.087 18.782  1.00 18.70 ? 117  ARG D O   1 
ATOM   4295 C  CB  . ARG D 4 117 ? -0.370  -30.125 17.394  1.00 17.87 ? 117  ARG D CB  1 
ATOM   4296 C  CG  . ARG D 4 117 ? -1.731  -30.788 17.396  1.00 19.05 ? 117  ARG D CG  1 
ATOM   4297 C  CD  . ARG D 4 117 ? -2.117  -31.291 16.011  1.00 20.25 ? 117  ARG D CD  1 
ATOM   4298 N  NE  . ARG D 4 117 ? -2.317  -30.203 15.060  1.00 21.35 ? 117  ARG D NE  1 
ATOM   4299 C  CZ  . ARG D 4 117 ? -2.685  -30.376 13.797  1.00 22.24 ? 117  ARG D CZ  1 
ATOM   4300 N  NH1 . ARG D 4 117 ? -2.900  -31.600 13.326  1.00 23.73 ? 117  ARG D NH1 1 
ATOM   4301 N  NH2 . ARG D 4 117 ? -2.851  -29.325 13.009  1.00 20.96 ? 117  ARG D NH2 1 
ATOM   4302 N  N   . PHE D 4 118 ? 0.276   -31.279 20.751  1.00 18.64 ? 118  PHE D N   1 
ATOM   4303 C  CA  . PHE D 4 118 ? 0.817   -32.390 21.541  1.00 18.63 ? 118  PHE D CA  1 
ATOM   4304 C  C   . PHE D 4 118 ? -0.071  -33.642 21.507  1.00 18.81 ? 118  PHE D C   1 
ATOM   4305 O  O   . PHE D 4 118 ? -0.797  -33.940 22.468  1.00 18.87 ? 118  PHE D O   1 
ATOM   4306 C  CB  . PHE D 4 118 ? 1.096   -31.945 22.976  1.00 18.10 ? 118  PHE D CB  1 
ATOM   4307 C  CG  . PHE D 4 118 ? 2.042   -30.787 23.085  1.00 17.93 ? 118  PHE D CG  1 
ATOM   4308 C  CD1 . PHE D 4 118 ? 3.318   -30.850 22.521  1.00 17.71 ? 118  PHE D CD1 1 
ATOM   4309 C  CD2 . PHE D 4 118 ? 1.677   -29.642 23.790  1.00 18.15 ? 118  PHE D CD2 1 
ATOM   4310 C  CE1 . PHE D 4 118 ? 4.215   -29.783 22.640  1.00 16.63 ? 118  PHE D CE1 1 
ATOM   4311 C  CE2 . PHE D 4 118 ? 2.560   -28.560 23.919  1.00 16.86 ? 118  PHE D CE2 1 
ATOM   4312 C  CZ  . PHE D 4 118 ? 3.834   -28.634 23.339  1.00 17.41 ? 118  PHE D CZ  1 
ATOM   4313 N  N   . ALA D 4 119 ? -0.007  -34.366 20.392  1.00 18.84 ? 119  ALA D N   1 
ATOM   4314 C  CA  . ALA D 4 119 ? -0.819  -35.564 20.209  1.00 19.17 ? 119  ALA D CA  1 
ATOM   4315 C  C   . ALA D 4 119 ? -0.221  -36.767 20.939  1.00 19.60 ? 119  ALA D C   1 
ATOM   4316 O  O   . ALA D 4 119 ? -0.948  -37.620 21.433  1.00 19.92 ? 119  ALA D O   1 
ATOM   4317 C  CB  . ALA D 4 119 ? -0.988  -35.867 18.745  1.00 18.56 ? 119  ALA D CB  1 
ATOM   4318 N  N   . SER D 4 120 ? 1.099   -36.818 21.032  1.00 19.84 ? 120  SER D N   1 
ATOM   4319 C  CA  . SER D 4 120 ? 1.771   -38.002 21.514  1.00 20.31 ? 120  SER D CA  1 
ATOM   4320 C  C   . SER D 4 120 ? 2.709   -37.697 22.708  1.00 20.49 ? 120  SER D C   1 
ATOM   4321 O  O   . SER D 4 120 ? 3.610   -36.868 22.594  1.00 20.91 ? 120  SER D O   1 
ATOM   4322 C  CB  . SER D 4 120 ? 2.504   -38.630 20.329  1.00 20.29 ? 120  SER D CB  1 
ATOM   4323 O  OG  . SER D 4 120 ? 3.475   -39.584 20.723  1.00 22.69 ? 120  SER D OG  1 
ATOM   4324 N  N   . TRP D 4 121 ? 2.445   -38.336 23.852  1.00 20.62 ? 121  TRP D N   1 
ATOM   4325 C  CA  . TRP D 4 121 ? 3.266   -38.279 25.087  1.00 21.01 ? 121  TRP D CA  1 
ATOM   4326 C  C   . TRP D 4 121 ? 3.663   -39.753 25.333  1.00 21.99 ? 121  TRP D C   1 
ATOM   4327 O  O   . TRP D 4 121 ? 2.838   -40.626 25.076  1.00 23.10 ? 121  TRP D O   1 
ATOM   4328 C  CB  . TRP D 4 121 ? 2.415   -37.739 26.237  1.00 20.15 ? 121  TRP D CB  1 
ATOM   4329 C  CG  . TRP D 4 121 ? 1.609   -36.460 25.923  1.00 19.20 ? 121  TRP D CG  1 
ATOM   4330 C  CD1 . TRP D 4 121 ? 0.667   -36.300 24.955  1.00 17.85 ? 121  TRP D CD1 1 
ATOM   4331 C  CD2 . TRP D 4 121 ? 1.683   -35.201 26.611  1.00 17.51 ? 121  TRP D CD2 1 
ATOM   4332 N  NE1 . TRP D 4 121 ? 0.157   -35.025 24.987  1.00 16.90 ? 121  TRP D NE1 1 
ATOM   4333 C  CE2 . TRP D 4 121 ? 0.758   -34.334 26.000  1.00 17.44 ? 121  TRP D CE2 1 
ATOM   4334 C  CE3 . TRP D 4 121 ? 2.442   -34.726 27.683  1.00 17.59 ? 121  TRP D CE3 1 
ATOM   4335 C  CZ2 . TRP D 4 121 ? 0.581   -33.009 26.414  1.00 19.12 ? 121  TRP D CZ2 1 
ATOM   4336 C  CZ3 . TRP D 4 121 ? 2.266   -33.409 28.099  1.00 18.14 ? 121  TRP D CZ3 1 
ATOM   4337 C  CH2 . TRP D 4 121 ? 1.344   -32.565 27.464  1.00 18.29 ? 121  TRP D CH2 1 
ATOM   4338 N  N   . GLY D 4 122 ? 4.820   -40.100 25.895  1.00 22.63 ? 122  GLY D N   1 
ATOM   4339 C  CA  . GLY D 4 122 ? 5.453   -39.474 27.030  1.00 23.42 ? 122  GLY D CA  1 
ATOM   4340 C  C   . GLY D 4 122 ? 4.724   -40.118 28.206  1.00 24.04 ? 122  GLY D C   1 
ATOM   4341 O  O   . GLY D 4 122 ? 3.556   -39.781 28.455  1.00 24.72 ? 122  GLY D O   1 
ATOM   4342 N  N   . GLN D 4 123 ? 5.336   -41.069 28.915  1.00 23.88 ? 123  GLN D N   1 
ATOM   4343 C  CA  . GLN D 4 123 ? 4.629   -41.593 30.118  1.00 24.21 ? 123  GLN D CA  1 
ATOM   4344 C  C   . GLN D 4 123 ? 4.822   -40.746 31.390  1.00 24.49 ? 123  GLN D C   1 
ATOM   4345 O  O   . GLN D 4 123 ? 4.041   -40.857 32.332  1.00 24.89 ? 123  GLN D O   1 
ATOM   4346 C  CB  . GLN D 4 123 ? 4.893   -43.088 30.395  1.00 23.71 ? 123  GLN D CB  1 
ATOM   4347 C  CG  . GLN D 4 123 ? 6.023   -43.392 31.368  1.00 23.08 ? 123  GLN D CG  1 
ATOM   4348 C  CD  . GLN D 4 123 ? 7.391   -43.512 30.686  1.00 24.53 ? 123  GLN D CD  1 
ATOM   4349 O  OE1 . GLN D 4 123 ? 7.597   -43.005 29.568  1.00 24.49 ? 123  GLN D OE1 1 
ATOM   4350 N  NE2 . GLN D 4 123 ? 8.335   -44.195 31.357  1.00 22.14 ? 123  GLN D NE2 1 
ATOM   4351 N  N   . GLY D 4 124 ? 5.844   -39.894 31.408  1.00 24.41 ? 124  GLY D N   1 
ATOM   4352 C  CA  . GLY D 4 124 ? 6.137   -39.103 32.585  1.00 24.47 ? 124  GLY D CA  1 
ATOM   4353 C  C   . GLY D 4 124 ? 7.259   -39.673 33.427  1.00 24.85 ? 124  GLY D C   1 
ATOM   4354 O  O   . GLY D 4 124 ? 7.447   -40.894 33.518  1.00 24.96 ? 124  GLY D O   1 
ATOM   4355 N  N   . THR D 4 125 ? 8.013   -38.765 34.033  1.00 24.80 ? 125  THR D N   1 
ATOM   4356 C  CA  . THR D 4 125 ? 9.108   -39.097 34.915  1.00 24.89 ? 125  THR D CA  1 
ATOM   4357 C  C   . THR D 4 125 ? 8.965   -38.211 36.139  1.00 25.56 ? 125  THR D C   1 
ATOM   4358 O  O   . THR D 4 125 ? 8.933   -36.980 36.015  1.00 25.61 ? 125  THR D O   1 
ATOM   4359 C  CB  . THR D 4 125 ? 10.439  -38.802 34.244  1.00 24.57 ? 125  THR D CB  1 
ATOM   4360 O  OG1 . THR D 4 125 ? 10.479  -39.478 32.986  1.00 25.19 ? 125  THR D OG1 1 
ATOM   4361 C  CG2 . THR D 4 125 ? 11.607  -39.258 35.107  1.00 23.25 ? 125  THR D CG2 1 
ATOM   4362 N  N   . LEU D 4 126 ? 8.850   -38.836 37.310  1.00 25.91 ? 126  LEU D N   1 
ATOM   4363 C  CA  . LEU D 4 126 ? 8.788   -38.096 38.552  1.00 26.37 ? 126  LEU D CA  1 
ATOM   4364 C  C   . LEU D 4 126 ? 10.193  -37.761 38.982  1.00 26.64 ? 126  LEU D C   1 
ATOM   4365 O  O   . LEU D 4 126 ? 11.040  -38.647 39.133  1.00 26.65 ? 126  LEU D O   1 
ATOM   4366 C  CB  . LEU D 4 126 ? 8.078   -38.895 39.642  1.00 26.56 ? 126  LEU D CB  1 
ATOM   4367 C  CG  . LEU D 4 126 ? 7.887   -38.163 40.976  1.00 27.50 ? 126  LEU D CG  1 
ATOM   4368 C  CD1 . LEU D 4 126 ? 6.937   -36.963 40.849  1.00 27.97 ? 126  LEU D CD1 1 
ATOM   4369 C  CD2 . LEU D 4 126 ? 7.389   -39.124 42.044  1.00 28.26 ? 126  LEU D CD2 1 
ATOM   4370 N  N   . VAL D 4 127 ? 10.444  -36.471 39.144  1.00 27.14 ? 127  VAL D N   1 
ATOM   4371 C  CA  . VAL D 4 127 ? 11.712  -36.008 39.672  1.00 27.86 ? 127  VAL D CA  1 
ATOM   4372 C  C   . VAL D 4 127 ? 11.398  -35.334 40.995  1.00 28.97 ? 127  VAL D C   1 
ATOM   4373 O  O   . VAL D 4 127 ? 10.595  -34.387 41.050  1.00 29.15 ? 127  VAL D O   1 
ATOM   4374 C  CB  . VAL D 4 127 ? 12.453  -35.045 38.710  1.00 27.51 ? 127  VAL D CB  1 
ATOM   4375 C  CG1 . VAL D 4 127 ? 13.811  -34.671 39.280  1.00 27.10 ? 127  VAL D CG1 1 
ATOM   4376 C  CG2 . VAL D 4 127 ? 12.639  -35.678 37.340  1.00 26.69 ? 127  VAL D CG2 1 
ATOM   4377 N  N   . THR D 4 128 ? 11.997  -35.857 42.065  1.00 30.09 ? 128  THR D N   1 
ATOM   4378 C  CA  . THR D 4 128 ? 11.816  -35.307 43.404  1.00 30.91 ? 128  THR D CA  1 
ATOM   4379 C  C   . THR D 4 128 ? 13.102  -34.588 43.819  1.00 31.57 ? 128  THR D C   1 
ATOM   4380 O  O   . THR D 4 128 ? 14.195  -35.139 43.662  1.00 31.86 ? 128  THR D O   1 
ATOM   4381 C  CB  . THR D 4 128 ? 11.464  -36.404 44.430  1.00 30.84 ? 128  THR D CB  1 
ATOM   4382 O  OG1 . THR D 4 128 ? 10.401  -37.229 43.929  1.00 30.25 ? 128  THR D OG1 1 
ATOM   4383 C  CG2 . THR D 4 128 ? 11.025  -35.776 45.743  1.00 31.34 ? 128  THR D CG2 1 
ATOM   4384 N  N   . VAL D 4 129 ? 12.966  -33.361 44.323  1.00 32.13 ? 129  VAL D N   1 
ATOM   4385 C  CA  . VAL D 4 129 ? 14.107  -32.588 44.804  1.00 32.97 ? 129  VAL D CA  1 
ATOM   4386 C  C   . VAL D 4 129 ? 13.954  -32.299 46.292  1.00 33.52 ? 129  VAL D C   1 
ATOM   4387 O  O   . VAL D 4 129 ? 13.007  -31.622 46.701  1.00 33.98 ? 129  VAL D O   1 
ATOM   4388 C  CB  . VAL D 4 129 ? 14.247  -31.262 44.055  1.00 33.12 ? 129  VAL D CB  1 
ATOM   4389 C  CG1 . VAL D 4 129 ? 15.651  -30.675 44.267  1.00 32.84 ? 129  VAL D CG1 1 
ATOM   4390 C  CG2 . VAL D 4 129 ? 13.961  -31.460 42.573  1.00 33.91 ? 129  VAL D CG2 1 
ATOM   4391 N  N   . SER D 4 130 ? 14.892  -32.797 47.096  1.00 33.86 ? 130  SER D N   1 
ATOM   4392 C  CA  . SER D 4 130 ? 14.759  -32.765 48.551  1.00 34.42 ? 130  SER D CA  1 
ATOM   4393 C  C   . SER D 4 130 ? 16.108  -33.013 49.219  1.00 34.81 ? 130  SER D C   1 
ATOM   4394 O  O   . SER D 4 130 ? 16.920  -33.801 48.722  1.00 34.90 ? 130  SER D O   1 
ATOM   4395 C  CB  . SER D 4 130 ? 13.755  -33.834 48.992  1.00 34.53 ? 130  SER D CB  1 
ATOM   4396 O  OG  . SER D 4 130 ? 13.329  -33.645 50.327  1.00 35.13 ? 130  SER D OG  1 
ATOM   4397 N  N   . SER D 4 131 ? 16.345  -32.357 50.352  1.00 35.18 ? 131  SER D N   1 
ATOM   4398 C  CA  . SER D 4 131 ? 17.659  -32.436 51.009  1.00 35.67 ? 131  SER D CA  1 
ATOM   4399 C  C   . SER D 4 131 ? 17.727  -33.506 52.097  1.00 35.43 ? 131  SER D C   1 
ATOM   4400 O  O   . SER D 4 131 ? 18.082  -34.659 51.826  1.00 35.08 ? 131  SER D O   1 
ATOM   4401 C  CB  . SER D 4 131 ? 18.065  -31.075 51.567  1.00 35.63 ? 131  SER D CB  1 
ATOM   4402 O  OG  . SER D 4 131 ? 17.025  -30.554 52.373  1.00 37.17 ? 131  SER D OG  1 
ATOM   4403 N  N   . ALA E 5 1   ? 15.544  -34.828 51.742  1.00 45.44 ? 132  ALA E N   1 
ATOM   4404 C  CA  . ALA E 5 1   ? 15.573  -36.085 52.523  1.00 45.52 ? 132  ALA E CA  1 
ATOM   4405 C  C   . ALA E 5 1   ? 16.409  -37.150 51.813  1.00 45.59 ? 132  ALA E C   1 
ATOM   4406 O  O   . ALA E 5 1   ? 16.876  -36.944 50.692  1.00 45.52 ? 132  ALA E O   1 
ATOM   4407 C  CB  . ALA E 5 1   ? 14.159  -36.576 52.752  1.00 45.63 ? 132  ALA E CB  1 
ATOM   4408 N  N   . SER E 5 2   ? 16.612  -38.273 52.492  1.00 45.76 ? 133  SER E N   1 
ATOM   4409 C  CA  . SER E 5 2   ? 17.241  -39.438 51.898  1.00 45.99 ? 133  SER E CA  1 
ATOM   4410 C  C   . SER E 5 2   ? 16.197  -40.511 51.746  1.00 46.04 ? 133  SER E C   1 
ATOM   4411 O  O   . SER E 5 2   ? 15.197  -40.517 52.463  1.00 46.07 ? 133  SER E O   1 
ATOM   4412 C  CB  . SER E 5 2   ? 18.367  -39.959 52.780  1.00 46.08 ? 133  SER E CB  1 
ATOM   4413 O  OG  . SER E 5 2   ? 19.556  -39.242 52.533  1.00 46.54 ? 133  SER E OG  1 
ATOM   4414 N  N   . THR E 5 3   ? 16.432  -41.419 50.806  1.00 46.17 ? 134  THR E N   1 
ATOM   4415 C  CA  . THR E 5 3   ? 15.550  -42.555 50.600  1.00 46.14 ? 134  THR E CA  1 
ATOM   4416 C  C   . THR E 5 3   ? 15.328  -43.223 51.964  1.00 46.22 ? 134  THR E C   1 
ATOM   4417 O  O   . THR E 5 3   ? 16.272  -43.369 52.752  1.00 46.31 ? 134  THR E O   1 
ATOM   4418 C  CB  . THR E 5 3   ? 16.119  -43.517 49.519  1.00 46.01 ? 134  THR E CB  1 
ATOM   4419 O  OG1 . THR E 5 3   ? 16.235  -42.811 48.276  1.00 45.89 ? 134  THR E OG1 1 
ATOM   4420 C  CG2 . THR E 5 3   ? 15.206  -44.699 49.295  1.00 46.18 ? 134  THR E CG2 1 
ATOM   4421 N  N   . LYS E 5 4   ? 14.069  -43.564 52.255  1.00 46.19 ? 135  LYS E N   1 
ATOM   4422 C  CA  . LYS E 5 4   ? 13.676  -44.131 53.549  1.00 45.87 ? 135  LYS E CA  1 
ATOM   4423 C  C   . LYS E 5 4   ? 12.335  -44.856 53.481  1.00 45.50 ? 135  LYS E C   1 
ATOM   4424 O  O   . LYS E 5 4   ? 11.371  -44.363 52.888  1.00 45.26 ? 135  LYS E O   1 
ATOM   4425 C  CB  . LYS E 5 4   ? 13.608  -43.035 54.622  1.00 46.08 ? 135  LYS E CB  1 
ATOM   4426 C  CG  . LYS E 5 4   ? 13.260  -43.552 56.006  1.00 46.43 ? 135  LYS E CG  1 
ATOM   4427 C  CD  . LYS E 5 4   ? 12.831  -42.429 56.914  1.00 47.66 ? 135  LYS E CD  1 
ATOM   4428 C  CE  . LYS E 5 4   ? 12.430  -42.961 58.277  1.00 48.50 ? 135  LYS E CE  1 
ATOM   4429 N  NZ  . LYS E 5 4   ? 11.166  -43.751 58.223  1.00 48.53 ? 135  LYS E NZ  1 
ATOM   4430 N  N   . GLY E 5 5   ? 12.287  -46.022 54.116  1.00 45.28 ? 136  GLY E N   1 
ATOM   4431 C  CA  . GLY E 5 5   ? 11.061  -46.795 54.238  1.00 45.00 ? 136  GLY E CA  1 
ATOM   4432 C  C   . GLY E 5 5   ? 10.124  -46.253 55.309  1.00 44.82 ? 136  GLY E C   1 
ATOM   4433 O  O   . GLY E 5 5   ? 10.560  -45.594 56.259  1.00 44.73 ? 136  GLY E O   1 
ATOM   4434 N  N   . PRO E 5 6   ? 8.821   -46.528 55.164  1.00 44.54 ? 137  PRO E N   1 
ATOM   4435 C  CA  . PRO E 5 6   ? 7.891   -46.033 56.152  1.00 44.58 ? 137  PRO E CA  1 
ATOM   4436 C  C   . PRO E 5 6   ? 7.801   -46.932 57.386  1.00 44.79 ? 137  PRO E C   1 
ATOM   4437 O  O   . PRO E 5 6   ? 8.277   -48.075 57.375  1.00 44.58 ? 137  PRO E O   1 
ATOM   4438 C  CB  . PRO E 5 6   ? 6.560   -46.059 55.397  1.00 44.45 ? 137  PRO E CB  1 
ATOM   4439 C  CG  . PRO E 5 6   ? 6.693   -47.200 54.455  1.00 44.18 ? 137  PRO E CG  1 
ATOM   4440 C  CD  . PRO E 5 6   ? 8.146   -47.292 54.097  1.00 44.40 ? 137  PRO E CD  1 
ATOM   4441 N  N   . SER E 5 7   ? 7.206   -46.390 58.442  1.00 44.98 ? 138  SER E N   1 
ATOM   4442 C  CA  . SER E 5 7   ? 6.670   -47.187 59.528  1.00 45.28 ? 138  SER E CA  1 
ATOM   4443 C  C   . SER E 5 7   ? 5.175   -47.348 59.264  1.00 45.77 ? 138  SER E C   1 
ATOM   4444 O  O   . SER E 5 7   ? 4.538   -46.442 58.726  1.00 45.83 ? 138  SER E O   1 
ATOM   4445 C  CB  . SER E 5 7   ? 6.898   -46.486 60.863  1.00 45.17 ? 138  SER E CB  1 
ATOM   4446 O  OG  . SER E 5 7   ? 8.262   -46.527 61.232  1.00 44.71 ? 138  SER E OG  1 
ATOM   4447 N  N   . VAL E 5 8   ? 4.612   -48.498 59.621  1.00 46.29 ? 139  VAL E N   1 
ATOM   4448 C  CA  . VAL E 5 8   ? 3.177   -48.700 59.465  1.00 46.90 ? 139  VAL E CA  1 
ATOM   4449 C  C   . VAL E 5 8   ? 2.541   -48.907 60.829  1.00 47.44 ? 139  VAL E C   1 
ATOM   4450 O  O   . VAL E 5 8   ? 2.861   -49.864 61.531  1.00 47.75 ? 139  VAL E O   1 
ATOM   4451 C  CB  . VAL E 5 8   ? 2.840   -49.889 58.540  1.00 46.90 ? 139  VAL E CB  1 
ATOM   4452 C  CG1 . VAL E 5 8   ? 1.323   -50.014 58.360  1.00 46.57 ? 139  VAL E CG1 1 
ATOM   4453 C  CG2 . VAL E 5 8   ? 3.531   -49.735 57.186  1.00 47.05 ? 139  VAL E CG2 1 
ATOM   4454 N  N   . PHE E 5 9   ? 1.638   -47.997 61.189  1.00 48.05 ? 140  PHE E N   1 
ATOM   4455 C  CA  . PHE E 5 9   ? 0.955   -48.021 62.480  1.00 48.14 ? 140  PHE E CA  1 
ATOM   4456 C  C   . PHE E 5 9   ? -0.510  -48.376 62.309  1.00 48.50 ? 140  PHE E C   1 
ATOM   4457 O  O   . PHE E 5 9   ? -1.102  -48.022 61.293  1.00 48.57 ? 140  PHE E O   1 
ATOM   4458 C  CB  . PHE E 5 9   ? 1.101   -46.668 63.164  1.00 47.72 ? 140  PHE E CB  1 
ATOM   4459 C  CG  . PHE E 5 9   ? 2.519   -46.295 63.426  1.00 47.69 ? 140  PHE E CG  1 
ATOM   4460 C  CD1 . PHE E 5 9   ? 3.323   -47.100 64.225  1.00 47.49 ? 140  PHE E CD1 1 
ATOM   4461 C  CD2 . PHE E 5 9   ? 3.064   -45.147 62.868  1.00 47.95 ? 140  PHE E CD2 1 
ATOM   4462 C  CE1 . PHE E 5 9   ? 4.654   -46.764 64.466  1.00 47.97 ? 140  PHE E CE1 1 
ATOM   4463 C  CE2 . PHE E 5 9   ? 4.404   -44.799 63.107  1.00 47.91 ? 140  PHE E CE2 1 
ATOM   4464 C  CZ  . PHE E 5 9   ? 5.196   -45.605 63.911  1.00 47.48 ? 140  PHE E CZ  1 
ATOM   4465 N  N   . PRO E 5 10  ? -1.106  -49.076 63.300  1.00 48.96 ? 141  PRO E N   1 
ATOM   4466 C  CA  . PRO E 5 10  ? -2.504  -49.446 63.113  1.00 49.11 ? 141  PRO E CA  1 
ATOM   4467 C  C   . PRO E 5 10  ? -3.429  -48.280 63.420  1.00 49.43 ? 141  PRO E C   1 
ATOM   4468 O  O   . PRO E 5 10  ? -3.163  -47.495 64.333  1.00 49.24 ? 141  PRO E O   1 
ATOM   4469 C  CB  . PRO E 5 10  ? -2.720  -50.584 64.124  1.00 48.92 ? 141  PRO E CB  1 
ATOM   4470 C  CG  . PRO E 5 10  ? -1.421  -50.761 64.858  1.00 48.96 ? 141  PRO E CG  1 
ATOM   4471 C  CD  . PRO E 5 10  ? -0.587  -49.551 64.595  1.00 48.87 ? 141  PRO E CD  1 
ATOM   4472 N  N   . LEU E 5 11  ? -4.485  -48.149 62.629  1.00 49.92 ? 142  LEU E N   1 
ATOM   4473 C  CA  . LEU E 5 11  ? -5.586  -47.285 62.999  1.00 50.60 ? 142  LEU E CA  1 
ATOM   4474 C  C   . LEU E 5 11  ? -6.698  -48.201 63.459  1.00 51.27 ? 142  LEU E C   1 
ATOM   4475 O  O   . LEU E 5 11  ? -7.546  -48.621 62.666  1.00 51.27 ? 142  LEU E O   1 
ATOM   4476 C  CB  . LEU E 5 11  ? -6.013  -46.379 61.843  1.00 50.51 ? 142  LEU E CB  1 
ATOM   4477 C  CG  . LEU E 5 11  ? -5.031  -45.258 61.478  1.00 50.00 ? 142  LEU E CG  1 
ATOM   4478 C  CD1 . LEU E 5 11  ? -5.461  -44.566 60.207  1.00 49.84 ? 142  LEU E CD1 1 
ATOM   4479 C  CD2 . LEU E 5 11  ? -4.881  -44.251 62.608  1.00 49.71 ? 142  LEU E CD2 1 
ATOM   4480 N  N   . ALA E 5 12  ? -6.650  -48.518 64.755  1.00 52.22 ? 143  ALA E N   1 
ATOM   4481 C  CA  . ALA E 5 12  ? -7.497  -49.532 65.387  1.00 52.86 ? 143  ALA E CA  1 
ATOM   4482 C  C   . ALA E 5 12  ? -8.975  -49.145 65.413  1.00 53.47 ? 143  ALA E C   1 
ATOM   4483 O  O   . ALA E 5 12  ? -9.303  -47.993 65.699  1.00 53.36 ? 143  ALA E O   1 
ATOM   4484 C  CB  . ALA E 5 12  ? -6.996  -49.815 66.794  1.00 52.72 ? 143  ALA E CB  1 
ATOM   4485 N  N   . PRO E 5 13  ? -9.869  -50.103 65.096  1.00 54.23 ? 144  PRO E N   1 
ATOM   4486 C  CA  . PRO E 5 13  ? -11.309 -49.866 65.232  1.00 55.15 ? 144  PRO E CA  1 
ATOM   4487 C  C   . PRO E 5 13  ? -11.720 -49.750 66.700  1.00 56.27 ? 144  PRO E C   1 
ATOM   4488 O  O   . PRO E 5 13  ? -11.053 -50.327 67.563  1.00 56.49 ? 144  PRO E O   1 
ATOM   4489 C  CB  . PRO E 5 13  ? -11.938 -51.107 64.597  1.00 54.94 ? 144  PRO E CB  1 
ATOM   4490 C  CG  . PRO E 5 13  ? -10.894 -52.149 64.663  1.00 54.62 ? 144  PRO E CG  1 
ATOM   4491 C  CD  . PRO E 5 13  ? -9.577  -51.449 64.572  1.00 54.12 ? 144  PRO E CD  1 
ATOM   4492 N  N   . SER E 5 14  ? -12.790 -49.001 66.979  1.00 57.52 ? 145  SER E N   1 
ATOM   4493 C  CA  . SER E 5 14  ? -13.279 -48.803 68.355  1.00 58.72 ? 145  SER E CA  1 
ATOM   4494 C  C   . SER E 5 14  ? -14.685 -48.187 68.430  1.00 59.44 ? 145  SER E C   1 
ATOM   4495 O  O   . SER E 5 14  ? -15.486 -48.335 67.505  1.00 59.39 ? 145  SER E O   1 
ATOM   4496 C  CB  . SER E 5 14  ? -12.285 -47.968 69.171  1.00 58.77 ? 145  SER E CB  1 
ATOM   4497 O  OG  . SER E 5 14  ? -12.093 -46.697 68.575  1.00 59.51 ? 145  SER E OG  1 
ATOM   4498 N  N   . SER E 5 15  ? -14.958 -47.489 69.534  1.00 60.47 ? 146  SER E N   1 
ATOM   4499 C  CA  . SER E 5 15  ? -16.303 -46.997 69.892  1.00 61.50 ? 146  SER E CA  1 
ATOM   4500 C  C   . SER E 5 15  ? -17.182 -46.317 68.819  1.00 62.11 ? 146  SER E C   1 
ATOM   4501 O  O   . SER E 5 15  ? -18.227 -46.892 68.519  1.00 62.31 ? 146  SER E O   1 
ATOM   4502 C  CB  . SER E 5 15  ? -16.293 -46.177 71.194  1.00 61.38 ? 146  SER E CB  1 
ATOM   4503 O  OG  . SER E 5 15  ? -15.974 -46.996 72.299  1.00 62.01 ? 146  SER E OG  1 
ATOM   4504 N  N   . LYS E 5 16  ? -16.868 -45.149 68.225  1.00 62.86 ? 147  LYS E N   1 
ATOM   4505 C  CA  . LYS E 5 16  ? -15.651 -44.278 68.243  1.00 63.51 ? 147  LYS E CA  1 
ATOM   4506 C  C   . LYS E 5 16  ? -15.107 -44.180 66.815  1.00 64.07 ? 147  LYS E C   1 
ATOM   4507 O  O   . LYS E 5 16  ? -14.827 -43.083 66.306  1.00 64.03 ? 147  LYS E O   1 
ATOM   4508 C  CB  . LYS E 5 16  ? -14.544 -44.658 69.235  1.00 63.42 ? 147  LYS E CB  1 
ATOM   4509 C  CG  . LYS E 5 16  ? -13.563 -43.512 69.561  1.00 63.27 ? 147  LYS E CG  1 
ATOM   4510 C  CD  . LYS E 5 16  ? -14.082 -42.569 70.667  1.00 63.70 ? 147  LYS E CD  1 
ATOM   4511 C  CE  . LYS E 5 16  ? -15.145 -41.578 70.169  1.00 63.97 ? 147  LYS E CE  1 
ATOM   4512 N  NZ  . LYS E 5 16  ? -15.718 -40.720 71.258  1.00 64.07 ? 147  LYS E NZ  1 
ATOM   4513 N  N   . SER E 5 17  ? -14.953 -45.349 66.195  1.00 64.72 ? 148  SER E N   1 
ATOM   4514 C  CA  . SER E 5 17  ? -14.844 -45.475 64.748  1.00 65.23 ? 148  SER E CA  1 
ATOM   4515 C  C   . SER E 5 17  ? -16.055 -46.274 64.243  1.00 65.60 ? 148  SER E C   1 
ATOM   4516 O  O   . SER E 5 17  ? -16.146 -46.608 63.051  1.00 65.83 ? 148  SER E O   1 
ATOM   4517 C  CB  . SER E 5 17  ? -13.514 -46.127 64.344  1.00 65.23 ? 148  SER E CB  1 
ATOM   4518 O  OG  . SER E 5 17  ? -13.415 -47.456 64.819  1.00 65.24 ? 148  SER E OG  1 
ATOM   4519 N  N   . THR E 5 18  ? -16.989 -46.547 65.161  1.00 65.94 ? 149  THR E N   1 
ATOM   4520 C  CA  . THR E 5 18  ? -18.226 -47.287 64.863  1.00 66.28 ? 149  THR E CA  1 
ATOM   4521 C  C   . THR E 5 18  ? -19.442 -46.354 64.747  1.00 66.33 ? 149  THR E C   1 
ATOM   4522 O  O   . THR E 5 18  ? -19.590 -45.392 65.513  1.00 66.45 ? 149  THR E O   1 
ATOM   4523 C  CB  . THR E 5 18  ? -18.503 -48.414 65.907  1.00 66.42 ? 149  THR E CB  1 
ATOM   4524 O  OG1 . THR E 5 18  ? -17.308 -49.175 66.127  1.00 66.67 ? 149  THR E OG1 1 
ATOM   4525 C  CG2 . THR E 5 18  ? -19.624 -49.356 65.445  1.00 66.38 ? 149  THR E CG2 1 
ATOM   4526 N  N   . SER E 5 19  ? -20.298 -46.666 63.771  1.00 66.24 ? 150  SER E N   1 
ATOM   4527 C  CA  . SER E 5 19  ? -21.484 -45.887 63.428  1.00 65.89 ? 150  SER E CA  1 
ATOM   4528 C  C   . SER E 5 19  ? -22.461 -46.803 62.685  1.00 65.61 ? 150  SER E C   1 
ATOM   4529 O  O   . SER E 5 19  ? -22.081 -47.463 61.707  1.00 65.46 ? 150  SER E O   1 
ATOM   4530 C  CB  . SER E 5 19  ? -21.092 -44.687 62.559  1.00 65.93 ? 150  SER E CB  1 
ATOM   4531 O  OG  . SER E 5 19  ? -22.159 -44.272 61.725  1.00 66.37 ? 150  SER E OG  1 
ATOM   4532 N  N   . GLY E 5 20  ? -23.712 -46.836 63.154  1.00 65.25 ? 151  GLY E N   1 
ATOM   4533 C  CA  . GLY E 5 20  ? -24.714 -47.773 62.644  1.00 64.56 ? 151  GLY E CA  1 
ATOM   4534 C  C   . GLY E 5 20  ? -24.207 -49.176 62.905  1.00 64.11 ? 151  GLY E C   1 
ATOM   4535 O  O   . GLY E 5 20  ? -23.878 -49.514 64.046  1.00 64.33 ? 151  GLY E O   1 
ATOM   4536 N  N   . GLY E 5 21  ? -24.112 -49.982 61.852  1.00 63.49 ? 152  GLY E N   1 
ATOM   4537 C  CA  . GLY E 5 21  ? -23.460 -51.291 61.948  1.00 62.73 ? 152  GLY E CA  1 
ATOM   4538 C  C   . GLY E 5 21  ? -22.023 -51.303 61.434  1.00 62.20 ? 152  GLY E C   1 
ATOM   4539 O  O   . GLY E 5 21  ? -21.419 -52.370 61.293  1.00 62.23 ? 152  GLY E O   1 
ATOM   4540 N  N   . THR E 5 22  ? -21.467 -50.119 61.169  1.00 61.49 ? 153  THR E N   1 
ATOM   4541 C  CA  . THR E 5 22  ? -20.192 -50.003 60.456  1.00 60.73 ? 153  THR E CA  1 
ATOM   4542 C  C   . THR E 5 22  ? -19.046 -49.588 61.375  1.00 60.05 ? 153  THR E C   1 
ATOM   4543 O  O   . THR E 5 22  ? -19.213 -48.700 62.210  1.00 60.16 ? 153  THR E O   1 
ATOM   4544 C  CB  . THR E 5 22  ? -20.277 -48.970 59.297  1.00 60.90 ? 153  THR E CB  1 
ATOM   4545 O  OG1 . THR E 5 22  ? -21.646 -48.696 58.974  1.00 60.84 ? 153  THR E OG1 1 
ATOM   4546 C  CG2 . THR E 5 22  ? -19.548 -49.483 58.057  1.00 60.92 ? 153  THR E CG2 1 
ATOM   4547 N  N   . ALA E 5 23  ? -17.885 -50.225 61.212  1.00 58.90 ? 154  ALA E N   1 
ATOM   4548 C  CA  . ALA E 5 23  ? -16.663 -49.797 61.905  1.00 57.71 ? 154  ALA E CA  1 
ATOM   4549 C  C   . ALA E 5 23  ? -15.524 -49.465 60.931  1.00 56.90 ? 154  ALA E C   1 
ATOM   4550 O  O   . ALA E 5 23  ? -15.235 -50.230 59.994  1.00 56.63 ? 154  ALA E O   1 
ATOM   4551 C  CB  . ALA E 5 23  ? -16.218 -50.841 62.926  1.00 57.69 ? 154  ALA E CB  1 
ATOM   4552 N  N   . ALA E 5 24  ? -14.888 -48.318 61.166  1.00 55.70 ? 155  ALA E N   1 
ATOM   4553 C  CA  . ALA E 5 24  ? -13.760 -47.856 60.359  1.00 54.68 ? 155  ALA E CA  1 
ATOM   4554 C  C   . ALA E 5 24  ? -12.430 -48.253 60.991  1.00 53.86 ? 155  ALA E C   1 
ATOM   4555 O  O   . ALA E 5 24  ? -12.225 -48.052 62.185  1.00 54.06 ? 155  ALA E O   1 
ATOM   4556 C  CB  . ALA E 5 24  ? -13.826 -46.341 60.174  1.00 54.63 ? 155  ALA E CB  1 
ATOM   4557 N  N   . LEU E 5 25  ? -11.537 -48.821 60.190  1.00 52.72 ? 156  LEU E N   1 
ATOM   4558 C  CA  . LEU E 5 25  ? -10.182 -49.146 60.633  1.00 51.73 ? 156  LEU E CA  1 
ATOM   4559 C  C   . LEU E 5 25  ? -9.193  -48.783 59.527  1.00 51.29 ? 156  LEU E C   1 
ATOM   4560 O  O   . LEU E 5 25  ? -9.607  -48.509 58.404  1.00 51.38 ? 156  LEU E O   1 
ATOM   4561 C  CB  . LEU E 5 25  ? -10.080 -50.628 60.997  1.00 51.75 ? 156  LEU E CB  1 
ATOM   4562 C  CG  . LEU E 5 25  ? -10.265 -51.673 59.892  1.00 51.09 ? 156  LEU E CG  1 
ATOM   4563 C  CD1 . LEU E 5 25  ? -8.928  -52.248 59.474  1.00 50.11 ? 156  LEU E CD1 1 
ATOM   4564 C  CD2 . LEU E 5 25  ? -11.176 -52.776 60.372  1.00 50.81 ? 156  LEU E CD2 1 
ATOM   4565 N  N   . GLY E 5 26  ? -7.896  -48.779 59.832  1.00 50.63 ? 157  GLY E N   1 
ATOM   4566 C  CA  . GLY E 5 26  ? -6.892  -48.435 58.828  1.00 49.68 ? 157  GLY E CA  1 
ATOM   4567 C  C   . GLY E 5 26  ? -5.433  -48.549 59.221  1.00 49.15 ? 157  GLY E C   1 
ATOM   4568 O  O   . GLY E 5 26  ? -5.094  -49.156 60.237  1.00 49.16 ? 157  GLY E O   1 
ATOM   4569 N  N   . CYS E 5 27  ? -4.572  -47.962 58.391  1.00 48.60 ? 158  CYS E N   1 
ATOM   4570 C  CA  . CYS E 5 27  ? -3.125  -47.930 58.621  1.00 48.11 ? 158  CYS E CA  1 
ATOM   4571 C  C   . CYS E 5 27  ? -2.542  -46.536 58.381  1.00 47.11 ? 158  CYS E C   1 
ATOM   4572 O  O   . CYS E 5 27  ? -2.980  -45.807 57.486  1.00 46.92 ? 158  CYS E O   1 
ATOM   4573 C  CB  . CYS E 5 27  ? -2.402  -48.932 57.719  1.00 48.40 ? 158  CYS E CB  1 
ATOM   4574 S  SG  . CYS E 5 27  ? -2.751  -50.668 58.068  1.00 51.13 ? 158  CYS E SG  1 
ATOM   4575 N  N   . LEU E 5 28  ? -1.546  -46.186 59.189  1.00 45.95 ? 159  LEU E N   1 
ATOM   4576 C  CA  . LEU E 5 28  ? -0.808  -44.949 59.030  1.00 44.72 ? 159  LEU E CA  1 
ATOM   4577 C  C   . LEU E 5 28  ? 0.600   -45.237 58.509  1.00 44.17 ? 159  LEU E C   1 
ATOM   4578 O  O   . LEU E 5 28  ? 1.472   -45.714 59.242  1.00 43.64 ? 159  LEU E O   1 
ATOM   4579 C  CB  . LEU E 5 28  ? -0.762  -44.193 60.352  1.00 44.67 ? 159  LEU E CB  1 
ATOM   4580 C  CG  . LEU E 5 28  ? -0.173  -42.786 60.355  1.00 44.34 ? 159  LEU E CG  1 
ATOM   4581 C  CD1 . LEU E 5 28  ? -1.067  -41.806 59.580  1.00 43.99 ? 159  LEU E CD1 1 
ATOM   4582 C  CD2 . LEU E 5 28  ? 0.018   -42.345 61.795  1.00 43.64 ? 159  LEU E CD2 1 
ATOM   4583 N  N   . VAL E 5 29  ? 0.792   -44.949 57.224  1.00 43.68 ? 160  VAL E N   1 
ATOM   4584 C  CA  . VAL E 5 29  ? 2.064   -45.139 56.533  1.00 43.18 ? 160  VAL E CA  1 
ATOM   4585 C  C   . VAL E 5 29  ? 2.887   -43.868 56.686  1.00 43.04 ? 160  VAL E C   1 
ATOM   4586 O  O   . VAL E 5 29  ? 2.663   -42.890 55.976  1.00 43.10 ? 160  VAL E O   1 
ATOM   4587 C  CB  . VAL E 5 29  ? 1.845   -45.465 55.043  1.00 42.96 ? 160  VAL E CB  1 
ATOM   4588 C  CG1 . VAL E 5 29  ? 3.145   -45.852 54.388  1.00 42.67 ? 160  VAL E CG1 1 
ATOM   4589 C  CG2 . VAL E 5 29  ? 0.842   -46.592 54.895  1.00 43.07 ? 160  VAL E CG2 1 
ATOM   4590 N  N   . LYS E 5 30  ? 3.841   -43.890 57.616  1.00 42.87 ? 161  LYS E N   1 
ATOM   4591 C  CA  . LYS E 5 30  ? 4.458   -42.664 58.094  1.00 42.67 ? 161  LYS E CA  1 
ATOM   4592 C  C   . LYS E 5 30  ? 5.955   -42.573 57.859  1.00 42.59 ? 161  LYS E C   1 
ATOM   4593 O  O   . LYS E 5 30  ? 6.683   -43.564 57.948  1.00 42.36 ? 161  LYS E O   1 
ATOM   4594 C  CB  . LYS E 5 30  ? 4.165   -42.474 59.580  1.00 42.63 ? 161  LYS E CB  1 
ATOM   4595 C  CG  . LYS E 5 30  ? 4.091   -41.024 59.991  1.00 43.47 ? 161  LYS E CG  1 
ATOM   4596 C  CD  . LYS E 5 30  ? 4.210   -40.844 61.497  1.00 44.71 ? 161  LYS E CD  1 
ATOM   4597 C  CE  . LYS E 5 30  ? 4.106   -39.365 61.880  1.00 45.42 ? 161  LYS E CE  1 
ATOM   4598 N  NZ  . LYS E 5 30  ? 5.281   -38.570 61.411  1.00 45.38 ? 161  LYS E NZ  1 
ATOM   4599 N  N   . ASP E 5 31  ? 6.390   -41.351 57.564  1.00 42.71 ? 162  ASP E N   1 
ATOM   4600 C  CA  . ASP E 5 31  ? 7.799   -40.990 57.466  1.00 42.71 ? 162  ASP E CA  1 
ATOM   4601 C  C   . ASP E 5 31  ? 8.570   -41.796 56.407  1.00 42.37 ? 162  ASP E C   1 
ATOM   4602 O  O   . ASP E 5 31  ? 9.537   -42.489 56.731  1.00 42.78 ? 162  ASP E O   1 
ATOM   4603 C  CB  . ASP E 5 31  ? 8.473   -41.085 58.853  1.00 42.86 ? 162  ASP E CB  1 
ATOM   4604 C  CG  . ASP E 5 31  ? 8.010   -39.993 59.821  1.00 43.50 ? 162  ASP E CG  1 
ATOM   4605 O  OD1 . ASP E 5 31  ? 7.443   -38.969 59.379  1.00 43.98 ? 162  ASP E OD1 1 
ATOM   4606 O  OD2 . ASP E 5 31  ? 8.227   -40.160 61.039  1.00 44.58 ? 162  ASP E OD2 1 
ATOM   4607 N  N   . TYR E 5 32  ? 8.144   -41.706 55.147  1.00 41.57 ? 163  TYR E N   1 
ATOM   4608 C  CA  . TYR E 5 32  ? 8.911   -42.308 54.040  1.00 40.96 ? 163  TYR E CA  1 
ATOM   4609 C  C   . TYR E 5 32  ? 9.364   -41.286 52.988  1.00 40.79 ? 163  TYR E C   1 
ATOM   4610 O  O   . TYR E 5 32  ? 8.796   -40.186 52.878  1.00 40.93 ? 163  TYR E O   1 
ATOM   4611 C  CB  . TYR E 5 32  ? 8.113   -43.422 53.363  1.00 40.46 ? 163  TYR E CB  1 
ATOM   4612 C  CG  . TYR E 5 32  ? 6.918   -42.924 52.607  1.00 39.67 ? 163  TYR E CG  1 
ATOM   4613 C  CD1 . TYR E 5 32  ? 7.007   -42.637 51.250  1.00 38.97 ? 163  TYR E CD1 1 
ATOM   4614 C  CD2 . TYR E 5 32  ? 5.697   -42.727 53.247  1.00 39.07 ? 163  TYR E CD2 1 
ATOM   4615 C  CE1 . TYR E 5 32  ? 5.910   -42.176 50.546  1.00 39.05 ? 163  TYR E CE1 1 
ATOM   4616 C  CE2 . TYR E 5 32  ? 4.590   -42.265 52.552  1.00 38.78 ? 163  TYR E CE2 1 
ATOM   4617 C  CZ  . TYR E 5 32  ? 4.705   -41.994 51.201  1.00 39.25 ? 163  TYR E CZ  1 
ATOM   4618 O  OH  . TYR E 5 32  ? 3.618   -41.533 50.496  1.00 39.99 ? 163  TYR E OH  1 
ATOM   4619 N  N   . PHE E 5 33  ? 10.373  -41.665 52.205  1.00 40.24 ? 164  PHE E N   1 
ATOM   4620 C  CA  . PHE E 5 33  ? 10.839  -40.833 51.096  1.00 39.54 ? 164  PHE E CA  1 
ATOM   4621 C  C   . PHE E 5 33  ? 11.499  -41.687 50.016  1.00 39.24 ? 164  PHE E C   1 
ATOM   4622 O  O   . PHE E 5 33  ? 12.267  -42.587 50.347  1.00 39.11 ? 164  PHE E O   1 
ATOM   4623 C  CB  . PHE E 5 33  ? 11.828  -39.770 51.601  1.00 39.47 ? 164  PHE E CB  1 
ATOM   4624 C  CG  . PHE E 5 33  ? 12.356  -38.891 50.517  1.00 39.20 ? 164  PHE E CG  1 
ATOM   4625 C  CD1 . PHE E 5 33  ? 11.632  -37.783 50.095  1.00 38.90 ? 164  PHE E CD1 1 
ATOM   4626 C  CD2 . PHE E 5 33  ? 13.556  -39.194 49.884  1.00 39.08 ? 164  PHE E CD2 1 
ATOM   4627 C  CE1 . PHE E 5 33  ? 12.099  -36.991 49.074  1.00 39.27 ? 164  PHE E CE1 1 
ATOM   4628 C  CE2 . PHE E 5 33  ? 14.033  -38.408 48.857  1.00 38.75 ? 164  PHE E CE2 1 
ATOM   4629 C  CZ  . PHE E 5 33  ? 13.306  -37.303 48.451  1.00 39.66 ? 164  PHE E CZ  1 
ATOM   4630 N  N   . PRO E 5 34  ? 11.221  -41.407 48.722  1.00 39.06 ? 165  PRO E N   1 
ATOM   4631 C  CA  . PRO E 5 34  ? 10.227  -40.496 48.133  1.00 39.03 ? 165  PRO E CA  1 
ATOM   4632 C  C   . PRO E 5 34  ? 8.895   -41.175 47.872  1.00 39.12 ? 165  PRO E C   1 
ATOM   4633 O  O   . PRO E 5 34  ? 8.657   -42.268 48.371  1.00 39.25 ? 165  PRO E O   1 
ATOM   4634 C  CB  . PRO E 5 34  ? 10.855  -40.159 46.785  1.00 38.97 ? 165  PRO E CB  1 
ATOM   4635 C  CG  . PRO E 5 34  ? 11.541  -41.433 46.395  1.00 38.64 ? 165  PRO E CG  1 
ATOM   4636 C  CD  . PRO E 5 34  ? 12.069  -42.019 47.677  1.00 38.70 ? 165  PRO E CD  1 
ATOM   4637 N  N   . GLU E 5 35  ? 8.042   -40.527 47.086  1.00 39.26 ? 166  GLU E N   1 
ATOM   4638 C  CA  . GLU E 5 35  ? 6.881   -41.184 46.490  1.00 39.68 ? 166  GLU E CA  1 
ATOM   4639 C  C   . GLU E 5 35  ? 7.378   -42.206 45.469  1.00 39.78 ? 166  GLU E C   1 
ATOM   4640 O  O   . GLU E 5 35  ? 8.507   -42.079 44.984  1.00 40.02 ? 166  GLU E O   1 
ATOM   4641 C  CB  . GLU E 5 35  ? 5.988   -40.163 45.785  1.00 39.56 ? 166  GLU E CB  1 
ATOM   4642 C  CG  . GLU E 5 35  ? 5.354   -39.126 46.701  1.00 40.67 ? 166  GLU E CG  1 
ATOM   4643 C  CD  . GLU E 5 35  ? 4.025   -39.569 47.279  1.00 41.93 ? 166  GLU E CD  1 
ATOM   4644 O  OE1 . GLU E 5 35  ? 3.939   -40.696 47.826  1.00 42.34 ? 166  GLU E OE1 1 
ATOM   4645 O  OE2 . GLU E 5 35  ? 3.063   -38.773 47.195  1.00 42.50 ? 166  GLU E OE2 1 
ATOM   4646 N  N   . PRO E 5 36  ? 6.542   -43.210 45.119  1.00 39.82 ? 167  PRO E N   1 
ATOM   4647 C  CA  . PRO E 5 36  ? 5.200   -43.455 45.625  1.00 39.94 ? 167  PRO E CA  1 
ATOM   4648 C  C   . PRO E 5 36  ? 5.163   -44.574 46.661  1.00 40.14 ? 167  PRO E C   1 
ATOM   4649 O  O   . PRO E 5 36  ? 6.186   -45.202 46.931  1.00 40.24 ? 167  PRO E O   1 
ATOM   4650 C  CB  . PRO E 5 36  ? 4.452   -43.895 44.363  1.00 39.71 ? 167  PRO E CB  1 
ATOM   4651 C  CG  . PRO E 5 36  ? 5.514   -44.596 43.529  1.00 39.79 ? 167  PRO E CG  1 
ATOM   4652 C  CD  . PRO E 5 36  ? 6.880   -44.195 44.075  1.00 39.74 ? 167  PRO E CD  1 
ATOM   4653 N  N   . VAL E 5 37  ? 3.986   -44.793 47.241  1.00 40.40 ? 168  VAL E N   1 
ATOM   4654 C  CA  . VAL E 5 37  ? 3.704   -45.968 48.065  1.00 40.66 ? 168  VAL E CA  1 
ATOM   4655 C  C   . VAL E 5 37  ? 2.362   -46.547 47.616  1.00 40.74 ? 168  VAL E C   1 
ATOM   4656 O  O   . VAL E 5 37  ? 1.414   -45.804 47.347  1.00 40.84 ? 168  VAL E O   1 
ATOM   4657 C  CB  . VAL E 5 37  ? 3.671   -45.638 49.602  1.00 40.83 ? 168  VAL E CB  1 
ATOM   4658 C  CG1 . VAL E 5 37  ? 2.636   -44.574 49.928  1.00 41.01 ? 168  VAL E CG1 1 
ATOM   4659 C  CG2 . VAL E 5 37  ? 3.377   -46.884 50.428  1.00 40.60 ? 168  VAL E CG2 1 
ATOM   4660 N  N   . THR E 5 38  ? 2.282   -47.866 47.522  1.00 40.78 ? 169  THR E N   1 
ATOM   4661 C  CA  . THR E 5 38  ? 1.002   -48.519 47.274  1.00 40.79 ? 169  THR E CA  1 
ATOM   4662 C  C   . THR E 5 38  ? 0.528   -49.203 48.544  1.00 40.62 ? 169  THR E C   1 
ATOM   4663 O  O   . THR E 5 38  ? 1.330   -49.771 49.286  1.00 40.53 ? 169  THR E O   1 
ATOM   4664 C  CB  . THR E 5 38  ? 1.095   -49.554 46.141  1.00 40.92 ? 169  THR E CB  1 
ATOM   4665 O  OG1 . THR E 5 38  ? 2.236   -50.398 46.357  1.00 41.10 ? 169  THR E OG1 1 
ATOM   4666 C  CG2 . THR E 5 38  ? 1.218   -48.859 44.786  1.00 41.18 ? 169  THR E CG2 1 
ATOM   4667 N  N   . VAL E 5 39  ? -0.773  -49.122 48.795  1.00 40.72 ? 170  VAL E N   1 
ATOM   4668 C  CA  . VAL E 5 39  ? -1.395  -49.850 49.892  1.00 41.14 ? 170  VAL E CA  1 
ATOM   4669 C  C   . VAL E 5 39  ? -2.613  -50.623 49.390  1.00 41.56 ? 170  VAL E C   1 
ATOM   4670 O  O   . VAL E 5 39  ? -3.471  -50.065 48.704  1.00 41.25 ? 170  VAL E O   1 
ATOM   4671 C  CB  . VAL E 5 39  ? -1.802  -48.915 51.069  1.00 41.14 ? 170  VAL E CB  1 
ATOM   4672 C  CG1 . VAL E 5 39  ? -2.588  -49.683 52.134  1.00 40.77 ? 170  VAL E CG1 1 
ATOM   4673 C  CG2 . VAL E 5 39  ? -0.579  -48.272 51.694  1.00 40.72 ? 170  VAL E CG2 1 
ATOM   4674 N  N   . SER E 5 40  ? -2.673  -51.909 49.732  1.00 42.36 ? 171  SER E N   1 
ATOM   4675 C  CA  . SER E 5 40  ? -3.874  -52.727 49.490  1.00 43.24 ? 171  SER E CA  1 
ATOM   4676 C  C   . SER E 5 40  ? -4.323  -53.484 50.753  1.00 43.63 ? 171  SER E C   1 
ATOM   4677 O  O   . SER E 5 40  ? -3.574  -53.582 51.735  1.00 43.61 ? 171  SER E O   1 
ATOM   4678 C  CB  . SER E 5 40  ? -3.653  -53.704 48.329  1.00 43.08 ? 171  SER E CB  1 
ATOM   4679 O  OG  . SER E 5 40  ? -2.882  -54.804 48.768  1.00 43.02 ? 171  SER E OG  1 
ATOM   4680 N  N   . TRP E 5 41  ? -5.546  -54.011 50.718  1.00 44.22 ? 172  TRP E N   1 
ATOM   4681 C  CA  . TRP E 5 41  ? -6.096  -54.763 51.847  1.00 44.91 ? 172  TRP E CA  1 
ATOM   4682 C  C   . TRP E 5 41  ? -6.308  -56.244 51.537  1.00 45.39 ? 172  TRP E C   1 
ATOM   4683 O  O   . TRP E 5 41  ? -6.801  -56.601 50.462  1.00 45.51 ? 172  TRP E O   1 
ATOM   4684 C  CB  . TRP E 5 41  ? -7.386  -54.107 52.347  1.00 44.80 ? 172  TRP E CB  1 
ATOM   4685 C  CG  . TRP E 5 41  ? -7.111  -52.820 53.064  1.00 44.78 ? 172  TRP E CG  1 
ATOM   4686 C  CD1 . TRP E 5 41  ? -7.055  -51.571 52.516  1.00 44.57 ? 172  TRP E CD1 1 
ATOM   4687 C  CD2 . TRP E 5 41  ? -6.822  -52.659 54.459  1.00 44.92 ? 172  TRP E CD2 1 
ATOM   4688 N  NE1 . TRP E 5 41  ? -6.757  -50.641 53.480  1.00 44.12 ? 172  TRP E NE1 1 
ATOM   4689 C  CE2 . TRP E 5 41  ? -6.610  -51.280 54.684  1.00 44.97 ? 172  TRP E CE2 1 
ATOM   4690 C  CE3 . TRP E 5 41  ? -6.728  -53.548 55.545  1.00 45.13 ? 172  TRP E CE3 1 
ATOM   4691 C  CZ2 . TRP E 5 41  ? -6.308  -50.760 55.958  1.00 44.94 ? 172  TRP E CZ2 1 
ATOM   4692 C  CZ3 . TRP E 5 41  ? -6.427  -53.034 56.811  1.00 44.79 ? 172  TRP E CZ3 1 
ATOM   4693 C  CH2 . TRP E 5 41  ? -6.221  -51.649 57.003  1.00 44.94 ? 172  TRP E CH2 1 
ATOM   4694 N  N   . ASN E 5 42  ? -5.917  -57.091 52.491  1.00 46.03 ? 173  ASN E N   1 
ATOM   4695 C  CA  . ASN E 5 42  ? -6.054  -58.555 52.387  1.00 46.69 ? 173  ASN E CA  1 
ATOM   4696 C  C   . ASN E 5 42  ? -5.557  -59.096 51.055  1.00 47.01 ? 173  ASN E C   1 
ATOM   4697 O  O   . ASN E 5 42  ? -6.272  -59.811 50.353  1.00 47.12 ? 173  ASN E O   1 
ATOM   4698 C  CB  . ASN E 5 42  ? -7.504  -58.995 52.644  1.00 46.72 ? 173  ASN E CB  1 
ATOM   4699 C  CG  . ASN E 5 42  ? -7.998  -58.611 54.030  1.00 46.70 ? 173  ASN E CG  1 
ATOM   4700 O  OD1 . ASN E 5 42  ? -7.206  -58.325 54.934  1.00 46.58 ? 173  ASN E OD1 1 
ATOM   4701 N  ND2 . ASN E 5 42  ? -9.316  -58.605 54.202  1.00 46.30 ? 173  ASN E ND2 1 
ATOM   4702 N  N   . SER E 5 43  ? -4.327  -58.721 50.716  1.00 47.57 ? 174  SER E N   1 
ATOM   4703 C  CA  . SER E 5 43  ? -3.690  -59.051 49.436  1.00 48.01 ? 174  SER E CA  1 
ATOM   4704 C  C   . SER E 5 43  ? -4.569  -58.852 48.186  1.00 48.18 ? 174  SER E C   1 
ATOM   4705 O  O   . SER E 5 43  ? -4.372  -59.532 47.175  1.00 48.43 ? 174  SER E O   1 
ATOM   4706 C  CB  . SER E 5 43  ? -3.086  -60.456 49.479  1.00 48.05 ? 174  SER E CB  1 
ATOM   4707 O  OG  . SER E 5 43  ? -2.063  -60.533 50.461  1.00 48.43 ? 174  SER E OG  1 
ATOM   4708 N  N   . GLY E 5 44  ? -5.525  -57.926 48.252  1.00 48.17 ? 175  GLY E N   1 
ATOM   4709 C  CA  . GLY E 5 44  ? -6.349  -57.609 47.093  1.00 48.35 ? 175  GLY E CA  1 
ATOM   4710 C  C   . GLY E 5 44  ? -7.810  -58.012 47.181  1.00 48.75 ? 175  GLY E C   1 
ATOM   4711 O  O   . GLY E 5 44  ? -8.645  -57.467 46.453  1.00 49.04 ? 175  GLY E O   1 
ATOM   4712 N  N   . ALA E 5 45  ? -8.137  -58.949 48.071  1.00 48.87 ? 176  ALA E N   1 
ATOM   4713 C  CA  . ALA E 5 45  ? -9.517  -59.456 48.186  1.00 48.84 ? 176  ALA E CA  1 
ATOM   4714 C  C   . ALA E 5 45  ? -10.463 -58.532 48.971  1.00 48.76 ? 176  ALA E C   1 
ATOM   4715 O  O   . ALA E 5 45  ? -11.588 -58.917 49.294  1.00 48.62 ? 176  ALA E O   1 
ATOM   4716 C  CB  . ALA E 5 45  ? -9.521  -60.867 48.779  1.00 48.87 ? 176  ALA E CB  1 
ATOM   4717 N  N   . LEU E 5 46  ? -9.997  -57.322 49.278  1.00 48.71 ? 177  LEU E N   1 
ATOM   4718 C  CA  . LEU E 5 46  ? -10.794 -56.334 50.002  1.00 48.64 ? 177  LEU E CA  1 
ATOM   4719 C  C   . LEU E 5 46  ? -10.636 -54.965 49.367  1.00 48.51 ? 177  LEU E C   1 
ATOM   4720 O  O   . LEU E 5 46  ? -9.627  -54.286 49.584  1.00 48.55 ? 177  LEU E O   1 
ATOM   4721 C  CB  . LEU E 5 46  ? -10.395 -56.277 51.485  1.00 48.84 ? 177  LEU E CB  1 
ATOM   4722 C  CG  . LEU E 5 46  ? -11.050 -55.228 52.409  1.00 48.80 ? 177  LEU E CG  1 
ATOM   4723 C  CD1 . LEU E 5 46  ? -12.584 -55.213 52.313  1.00 48.07 ? 177  LEU E CD1 1 
ATOM   4724 C  CD2 . LEU E 5 46  ? -10.592 -55.425 53.861  1.00 48.64 ? 177  LEU E CD2 1 
ATOM   4725 N  N   . THR E 5 47  ? -11.638 -54.561 48.589  1.00 48.16 ? 178  THR E N   1 
ATOM   4726 C  CA  . THR E 5 47  ? -11.573 -53.297 47.854  1.00 47.78 ? 178  THR E CA  1 
ATOM   4727 C  C   . THR E 5 47  ? -12.771 -52.391 48.160  1.00 47.56 ? 178  THR E C   1 
ATOM   4728 O  O   . THR E 5 47  ? -12.662 -51.157 48.121  1.00 47.51 ? 178  THR E O   1 
ATOM   4729 C  CB  . THR E 5 47  ? -11.456 -53.522 46.320  1.00 47.80 ? 178  THR E CB  1 
ATOM   4730 O  OG1 . THR E 5 47  ? -12.682 -54.066 45.821  1.00 47.68 ? 178  THR E OG1 1 
ATOM   4731 C  CG2 . THR E 5 47  ? -10.290 -54.466 45.976  1.00 47.17 ? 178  THR E CG2 1 
ATOM   4732 N  N   . SER E 5 48  ? -13.904 -53.018 48.464  1.00 47.10 ? 179  SER E N   1 
ATOM   4733 C  CA  . SER E 5 48  ? -15.147 -52.317 48.771  1.00 46.72 ? 179  SER E CA  1 
ATOM   4734 C  C   . SER E 5 48  ? -15.059 -51.506 50.082  1.00 46.31 ? 179  SER E C   1 
ATOM   4735 O  O   . SER E 5 48  ? -14.782 -52.058 51.150  1.00 46.30 ? 179  SER E O   1 
ATOM   4736 C  CB  . SER E 5 48  ? -16.298 -53.328 48.815  1.00 46.63 ? 179  SER E CB  1 
ATOM   4737 O  OG  . SER E 5 48  ? -17.493 -52.726 49.275  1.00 47.44 ? 179  SER E OG  1 
ATOM   4738 N  N   . GLY E 5 49  ? -15.283 -50.196 49.983  1.00 45.76 ? 180  GLY E N   1 
ATOM   4739 C  CA  . GLY E 5 49  ? -15.228 -49.295 51.138  1.00 45.22 ? 180  GLY E CA  1 
ATOM   4740 C  C   . GLY E 5 49  ? -13.836 -48.821 51.543  1.00 45.00 ? 180  GLY E C   1 
ATOM   4741 O  O   . GLY E 5 49  ? -13.676 -48.155 52.578  1.00 45.12 ? 180  GLY E O   1 
ATOM   4742 N  N   . VAL E 5 50  ? -12.829 -49.163 50.736  1.00 44.35 ? 181  VAL E N   1 
ATOM   4743 C  CA  . VAL E 5 50  ? -11.440 -48.751 50.981  1.00 43.50 ? 181  VAL E CA  1 
ATOM   4744 C  C   . VAL E 5 50  ? -11.187 -47.331 50.476  1.00 43.09 ? 181  VAL E C   1 
ATOM   4745 O  O   . VAL E 5 50  ? -11.617 -46.960 49.379  1.00 43.10 ? 181  VAL E O   1 
ATOM   4746 C  CB  . VAL E 5 50  ? -10.438 -49.710 50.303  1.00 43.44 ? 181  VAL E CB  1 
ATOM   4747 C  CG1 . VAL E 5 50  ? -9.009  -49.278 50.559  1.00 42.99 ? 181  VAL E CG1 1 
ATOM   4748 C  CG2 . VAL E 5 50  ? -10.648 -51.127 50.794  1.00 43.88 ? 181  VAL E CG2 1 
ATOM   4749 N  N   . HIS E 5 51  ? -10.499 -46.537 51.289  1.00 42.35 ? 182  HIS E N   1 
ATOM   4750 C  CA  . HIS E 5 51  ? -10.047 -45.222 50.876  1.00 41.53 ? 182  HIS E CA  1 
ATOM   4751 C  C   . HIS E 5 51  ? -8.567  -45.106 51.166  1.00 41.28 ? 182  HIS E C   1 
ATOM   4752 O  O   . HIS E 5 51  ? -8.168  -45.050 52.334  1.00 41.35 ? 182  HIS E O   1 
ATOM   4753 C  CB  . HIS E 5 51  ? -10.805 -44.127 51.617  1.00 41.36 ? 182  HIS E CB  1 
ATOM   4754 C  CG  . HIS E 5 51  ? -12.268 -44.082 51.303  1.00 41.30 ? 182  HIS E CG  1 
ATOM   4755 N  ND1 . HIS E 5 51  ? -12.765 -44.293 50.035  1.00 41.35 ? 182  HIS E ND1 1 
ATOM   4756 C  CD2 . HIS E 5 51  ? -13.341 -43.826 52.089  1.00 41.01 ? 182  HIS E CD2 1 
ATOM   4757 C  CE1 . HIS E 5 51  ? -14.081 -44.184 50.057  1.00 41.61 ? 182  HIS E CE1 1 
ATOM   4758 N  NE2 . HIS E 5 51  ? -14.455 -43.895 51.290  1.00 41.52 ? 182  HIS E NE2 1 
ATOM   4759 N  N   . THR E 5 52  ? -7.750  -45.107 50.112  1.00 40.70 ? 183  THR E N   1 
ATOM   4760 C  CA  . THR E 5 52  ? -6.329  -44.806 50.271  1.00 40.10 ? 183  THR E CA  1 
ATOM   4761 C  C   . THR E 5 52  ? -6.133  -43.352 49.899  1.00 39.96 ? 183  THR E C   1 
ATOM   4762 O  O   . THR E 5 52  ? -6.517  -42.936 48.805  1.00 40.35 ? 183  THR E O   1 
ATOM   4763 C  CB  . THR E 5 52  ? -5.433  -45.706 49.426  1.00 39.80 ? 183  THR E CB  1 
ATOM   4764 O  OG1 . THR E 5 52  ? -5.768  -47.070 49.684  1.00 39.44 ? 183  THR E OG1 1 
ATOM   4765 C  CG2 . THR E 5 52  ? -3.970  -45.486 49.791  1.00 39.75 ? 183  THR E CG2 1 
ATOM   4766 N  N   . PHE E 5 53  ? -5.560  -42.579 50.818  1.00 39.43 ? 184  PHE E N   1 
ATOM   4767 C  CA  . PHE E 5 53  ? -5.491  -41.118 50.671  1.00 39.01 ? 184  PHE E CA  1 
ATOM   4768 C  C   . PHE E 5 53  ? -4.222  -40.646 49.959  1.00 38.52 ? 184  PHE E C   1 
ATOM   4769 O  O   . PHE E 5 53  ? -3.236  -41.378 49.896  1.00 38.71 ? 184  PHE E O   1 
ATOM   4770 C  CB  . PHE E 5 53  ? -5.636  -40.428 52.041  1.00 39.08 ? 184  PHE E CB  1 
ATOM   4771 C  CG  . PHE E 5 53  ? -7.008  -40.546 52.632  1.00 38.54 ? 184  PHE E CG  1 
ATOM   4772 C  CD1 . PHE E 5 53  ? -7.359  -41.646 53.395  1.00 38.13 ? 184  PHE E CD1 1 
ATOM   4773 C  CD2 . PHE E 5 53  ? -7.954  -39.560 52.416  1.00 39.18 ? 184  PHE E CD2 1 
ATOM   4774 C  CE1 . PHE E 5 53  ? -8.628  -41.762 53.933  1.00 37.86 ? 184  PHE E CE1 1 
ATOM   4775 C  CE2 . PHE E 5 53  ? -9.235  -39.668 52.958  1.00 39.26 ? 184  PHE E CE2 1 
ATOM   4776 C  CZ  . PHE E 5 53  ? -9.568  -40.770 53.715  1.00 38.65 ? 184  PHE E CZ  1 
ATOM   4777 N  N   . PRO E 5 54  ? -4.252  -39.428 49.393  1.00 38.15 ? 185  PRO E N   1 
ATOM   4778 C  CA  . PRO E 5 54  ? -3.023  -38.855 48.845  1.00 37.73 ? 185  PRO E CA  1 
ATOM   4779 C  C   . PRO E 5 54  ? -2.034  -38.638 49.976  1.00 37.41 ? 185  PRO E C   1 
ATOM   4780 O  O   . PRO E 5 54  ? -2.448  -38.370 51.104  1.00 37.66 ? 185  PRO E O   1 
ATOM   4781 C  CB  . PRO E 5 54  ? -3.482  -37.498 48.305  1.00 37.48 ? 185  PRO E CB  1 
ATOM   4782 C  CG  . PRO E 5 54  ? -4.951  -37.609 48.152  1.00 37.61 ? 185  PRO E CG  1 
ATOM   4783 C  CD  . PRO E 5 54  ? -5.412  -38.533 49.210  1.00 38.04 ? 185  PRO E CD  1 
ATOM   4784 N  N   . ALA E 5 55  ? -0.745  -38.758 49.701  1.00 37.06 ? 186  ALA E N   1 
ATOM   4785 C  CA  . ALA E 5 55  ? 0.244   -38.486 50.737  1.00 37.16 ? 186  ALA E CA  1 
ATOM   4786 C  C   . ALA E 5 55  ? 0.289   -36.993 51.029  1.00 37.27 ? 186  ALA E C   1 
ATOM   4787 O  O   . ALA E 5 55  ? -0.194  -36.189 50.237  1.00 37.03 ? 186  ALA E O   1 
ATOM   4788 C  CB  . ALA E 5 55  ? 1.616   -38.993 50.326  1.00 37.12 ? 186  ALA E CB  1 
ATOM   4789 N  N   . VAL E 5 56  ? 0.828   -36.627 52.188  1.00 37.47 ? 187  VAL E N   1 
ATOM   4790 C  CA  . VAL E 5 56  ? 1.174   -35.238 52.442  1.00 37.58 ? 187  VAL E CA  1 
ATOM   4791 C  C   . VAL E 5 56  ? 2.660   -35.168 52.709  1.00 37.96 ? 187  VAL E C   1 
ATOM   4792 O  O   . VAL E 5 56  ? 3.254   -36.148 53.155  1.00 37.74 ? 187  VAL E O   1 
ATOM   4793 C  CB  . VAL E 5 56  ? 0.352   -34.579 53.581  1.00 37.49 ? 187  VAL E CB  1 
ATOM   4794 C  CG1 . VAL E 5 56  ? -1.115  -34.513 53.202  1.00 37.48 ? 187  VAL E CG1 1 
ATOM   4795 C  CG2 . VAL E 5 56  ? 0.540   -35.294 54.920  1.00 37.76 ? 187  VAL E CG2 1 
ATOM   4796 N  N   . LEU E 5 57  ? 3.256   -34.021 52.380  1.00 38.81 ? 188  LEU E N   1 
ATOM   4797 C  CA  . LEU E 5 57  ? 4.674   -33.764 52.618  1.00 39.28 ? 188  LEU E CA  1 
ATOM   4798 C  C   . LEU E 5 57  ? 4.801   -32.958 53.896  1.00 40.33 ? 188  LEU E C   1 
ATOM   4799 O  O   . LEU E 5 57  ? 4.208   -31.886 54.030  1.00 40.73 ? 188  LEU E O   1 
ATOM   4800 C  CB  . LEU E 5 57  ? 5.292   -33.010 51.439  1.00 39.18 ? 188  LEU E CB  1 
ATOM   4801 C  CG  . LEU E 5 57  ? 6.797   -32.722 51.508  1.00 39.30 ? 188  LEU E CG  1 
ATOM   4802 C  CD1 . LEU E 5 57  ? 7.614   -34.027 51.655  1.00 38.66 ? 188  LEU E CD1 1 
ATOM   4803 C  CD2 . LEU E 5 57  ? 7.271   -31.885 50.307  1.00 38.14 ? 188  LEU E CD2 1 
ATOM   4804 N  N   . GLN E 5 58  ? 5.562   -33.482 54.844  1.00 41.35 ? 189  GLN E N   1 
ATOM   4805 C  CA  . GLN E 5 58  ? 5.655   -32.875 56.163  1.00 42.46 ? 189  GLN E CA  1 
ATOM   4806 C  C   . GLN E 5 58  ? 6.802   -31.867 56.224  1.00 42.95 ? 189  GLN E C   1 
ATOM   4807 O  O   . GLN E 5 58  ? 7.691   -31.871 55.368  1.00 43.13 ? 189  GLN E O   1 
ATOM   4808 C  CB  . GLN E 5 58  ? 5.796   -33.968 57.231  1.00 42.35 ? 189  GLN E CB  1 
ATOM   4809 C  CG  . GLN E 5 58  ? 4.570   -34.899 57.302  1.00 43.11 ? 189  GLN E CG  1 
ATOM   4810 C  CD  . GLN E 5 58  ? 4.842   -36.240 57.987  1.00 43.24 ? 189  GLN E CD  1 
ATOM   4811 O  OE1 . GLN E 5 58  ? 4.079   -36.666 58.861  1.00 44.93 ? 189  GLN E OE1 1 
ATOM   4812 N  NE2 . GLN E 5 58  ? 5.920   -36.912 57.588  1.00 43.74 ? 189  GLN E NE2 1 
ATOM   4813 N  N   . SER E 5 59  ? 6.768   -30.999 57.233  1.00 43.63 ? 190  SER E N   1 
ATOM   4814 C  CA  . SER E 5 59  ? 7.833   -30.024 57.479  1.00 44.31 ? 190  SER E CA  1 
ATOM   4815 C  C   . SER E 5 59  ? 9.202   -30.691 57.575  1.00 44.62 ? 190  SER E C   1 
ATOM   4816 O  O   . SER E 5 59  ? 10.231  -30.033 57.396  1.00 45.08 ? 190  SER E O   1 
ATOM   4817 C  CB  . SER E 5 59  ? 7.565   -29.260 58.778  1.00 44.47 ? 190  SER E CB  1 
ATOM   4818 O  OG  . SER E 5 59  ? 6.192   -29.327 59.143  1.00 45.84 ? 190  SER E OG  1 
ATOM   4819 N  N   . SER E 5 60  ? 9.205   -31.991 57.875  1.00 44.68 ? 191  SER E N   1 
ATOM   4820 C  CA  . SER E 5 60  ? 10.433  -32.767 58.041  1.00 44.64 ? 191  SER E CA  1 
ATOM   4821 C  C   . SER E 5 60  ? 11.054  -33.174 56.705  1.00 44.52 ? 191  SER E C   1 
ATOM   4822 O  O   . SER E 5 60  ? 12.222  -33.570 56.652  1.00 44.61 ? 191  SER E O   1 
ATOM   4823 C  CB  . SER E 5 60  ? 10.157  -34.012 58.890  1.00 44.68 ? 191  SER E CB  1 
ATOM   4824 O  OG  . SER E 5 60  ? 9.118   -34.805 58.328  1.00 45.30 ? 191  SER E OG  1 
ATOM   4825 N  N   . GLY E 5 61  ? 10.268  -33.078 55.634  1.00 44.33 ? 192  GLY E N   1 
ATOM   4826 C  CA  . GLY E 5 61  ? 10.699  -33.523 54.312  1.00 44.07 ? 192  GLY E CA  1 
ATOM   4827 C  C   . GLY E 5 61  ? 10.289  -34.953 53.980  1.00 44.09 ? 192  GLY E C   1 
ATOM   4828 O  O   . GLY E 5 61  ? 10.516  -35.423 52.863  1.00 44.49 ? 192  GLY E O   1 
ATOM   4829 N  N   . LEU E 5 62  ? 9.688   -35.656 54.938  1.00 43.60 ? 193  LEU E N   1 
ATOM   4830 C  CA  . LEU E 5 62  ? 9.247   -37.029 54.698  1.00 42.97 ? 193  LEU E CA  1 
ATOM   4831 C  C   . LEU E 5 62  ? 7.751   -37.050 54.388  1.00 42.56 ? 193  LEU E C   1 
ATOM   4832 O  O   . LEU E 5 62  ? 7.022   -36.136 54.766  1.00 42.58 ? 193  LEU E O   1 
ATOM   4833 C  CB  . LEU E 5 62  ? 9.593   -37.941 55.886  1.00 42.96 ? 193  LEU E CB  1 
ATOM   4834 C  CG  . LEU E 5 62  ? 11.008  -37.923 56.506  1.00 43.24 ? 193  LEU E CG  1 
ATOM   4835 C  CD1 . LEU E 5 62  ? 11.174  -39.045 57.529  1.00 42.93 ? 193  LEU E CD1 1 
ATOM   4836 C  CD2 . LEU E 5 62  ? 12.138  -37.995 55.476  1.00 43.17 ? 193  LEU E CD2 1 
ATOM   4837 N  N   . TYR E 5 63  ? 7.304   -38.078 53.675  1.00 42.06 ? 194  TYR E N   1 
ATOM   4838 C  CA  . TYR E 5 63  ? 5.898   -38.198 53.295  1.00 41.75 ? 194  TYR E CA  1 
ATOM   4839 C  C   . TYR E 5 63  ? 5.125   -39.061 54.289  1.00 41.74 ? 194  TYR E C   1 
ATOM   4840 O  O   . TYR E 5 63  ? 5.705   -39.926 54.955  1.00 41.73 ? 194  TYR E O   1 
ATOM   4841 C  CB  . TYR E 5 63  ? 5.766   -38.781 51.883  1.00 41.45 ? 194  TYR E CB  1 
ATOM   4842 C  CG  . TYR E 5 63  ? 6.225   -37.862 50.779  1.00 40.93 ? 194  TYR E CG  1 
ATOM   4843 C  CD1 . TYR E 5 63  ? 5.342   -36.961 50.189  1.00 40.60 ? 194  TYR E CD1 1 
ATOM   4844 C  CD2 . TYR E 5 63  ? 7.542   -37.897 50.314  1.00 40.76 ? 194  TYR E CD2 1 
ATOM   4845 C  CE1 . TYR E 5 63  ? 5.757   -36.106 49.166  1.00 40.85 ? 194  TYR E CE1 1 
ATOM   4846 C  CE2 . TYR E 5 63  ? 7.971   -37.048 49.284  1.00 40.78 ? 194  TYR E CE2 1 
ATOM   4847 C  CZ  . TYR E 5 63  ? 7.070   -36.157 48.717  1.00 40.95 ? 194  TYR E CZ  1 
ATOM   4848 O  OH  . TYR E 5 63  ? 7.473   -35.312 47.709  1.00 40.46 ? 194  TYR E OH  1 
ATOM   4849 N  N   . SER E 5 64  ? 3.818   -38.822 54.380  1.00 41.64 ? 195  SER E N   1 
ATOM   4850 C  CA  . SER E 5 64  ? 2.945   -39.584 55.269  1.00 41.91 ? 195  SER E CA  1 
ATOM   4851 C  C   . SER E 5 64  ? 1.537   -39.738 54.688  1.00 41.88 ? 195  SER E C   1 
ATOM   4852 O  O   . SER E 5 64  ? 0.904   -38.755 54.308  1.00 42.29 ? 195  SER E O   1 
ATOM   4853 C  CB  . SER E 5 64  ? 2.890   -38.931 56.655  1.00 41.96 ? 195  SER E CB  1 
ATOM   4854 O  OG  . SER E 5 64  ? 1.991   -39.612 57.513  1.00 42.64 ? 195  SER E OG  1 
ATOM   4855 N  N   . LEU E 5 65  ? 1.054   -40.973 54.604  1.00 41.64 ? 196  LEU E N   1 
ATOM   4856 C  CA  . LEU E 5 65  ? -0.312  -41.203 54.150  1.00 41.66 ? 196  LEU E CA  1 
ATOM   4857 C  C   . LEU E 5 65  ? -1.093  -42.190 55.021  1.00 41.85 ? 196  LEU E C   1 
ATOM   4858 O  O   . LEU E 5 65  ? -0.518  -42.972 55.773  1.00 41.71 ? 196  LEU E O   1 
ATOM   4859 C  CB  . LEU E 5 65  ? -0.361  -41.601 52.659  1.00 41.70 ? 196  LEU E CB  1 
ATOM   4860 C  CG  . LEU E 5 65  ? -0.145  -42.989 52.032  1.00 40.93 ? 196  LEU E CG  1 
ATOM   4861 C  CD1 . LEU E 5 65  ? -1.046  -44.083 52.582  1.00 40.16 ? 196  LEU E CD1 1 
ATOM   4862 C  CD2 . LEU E 5 65  ? -0.388  -42.853 50.545  1.00 41.26 ? 196  LEU E CD2 1 
ATOM   4863 N  N   . SER E 5 66  ? -2.413  -42.133 54.898  1.00 42.04 ? 197  SER E N   1 
ATOM   4864 C  CA  . SER E 5 66  ? -3.294  -43.043 55.593  1.00 42.59 ? 197  SER E CA  1 
ATOM   4865 C  C   . SER E 5 66  ? -4.166  -43.801 54.601  1.00 42.77 ? 197  SER E C   1 
ATOM   4866 O  O   . SER E 5 66  ? -4.502  -43.289 53.527  1.00 42.72 ? 197  SER E O   1 
ATOM   4867 C  CB  . SER E 5 66  ? -4.160  -42.282 56.604  1.00 42.70 ? 197  SER E CB  1 
ATOM   4868 O  OG  . SER E 5 66  ? -4.573  -41.021 56.087  1.00 43.67 ? 197  SER E OG  1 
ATOM   4869 N  N   . SER E 5 67  ? -4.505  -45.034 54.964  1.00 43.01 ? 198  SER E N   1 
ATOM   4870 C  CA  . SER E 5 67  ? -5.442  -45.844 54.200  1.00 43.17 ? 198  SER E CA  1 
ATOM   4871 C  C   . SER E 5 67  ? -6.443  -46.452 55.169  1.00 43.44 ? 198  SER E C   1 
ATOM   4872 O  O   . SER E 5 67  ? -6.049  -47.088 56.142  1.00 43.50 ? 198  SER E O   1 
ATOM   4873 C  CB  . SER E 5 67  ? -4.701  -46.940 53.429  1.00 43.02 ? 198  SER E CB  1 
ATOM   4874 O  OG  . SER E 5 67  ? -5.578  -47.636 52.558  1.00 42.52 ? 198  SER E OG  1 
ATOM   4875 N  N   . VAL E 5 68  ? -7.730  -46.234 54.909  1.00 43.80 ? 199  VAL E N   1 
ATOM   4876 C  CA  . VAL E 5 68  ? -8.798  -46.719 55.785  1.00 44.23 ? 199  VAL E CA  1 
ATOM   4877 C  C   . VAL E 5 68  ? -9.824  -47.587 55.059  1.00 44.83 ? 199  VAL E C   1 
ATOM   4878 O  O   . VAL E 5 68  ? -9.932  -47.552 53.833  1.00 45.09 ? 199  VAL E O   1 
ATOM   4879 C  CB  . VAL E 5 68  ? -9.556  -45.556 56.470  1.00 44.28 ? 199  VAL E CB  1 
ATOM   4880 C  CG1 . VAL E 5 68  ? -8.614  -44.720 57.332  1.00 43.67 ? 199  VAL E CG1 1 
ATOM   4881 C  CG2 . VAL E 5 68  ? -10.302 -44.690 55.432  1.00 44.08 ? 199  VAL E CG2 1 
ATOM   4882 N  N   . VAL E 5 69  ? -10.584 -48.356 55.831  1.00 45.49 ? 200  VAL E N   1 
ATOM   4883 C  CA  . VAL E 5 69  ? -11.681 -49.159 55.298  1.00 46.36 ? 200  VAL E CA  1 
ATOM   4884 C  C   . VAL E 5 69  ? -12.817 -49.239 56.321  1.00 46.94 ? 200  VAL E C   1 
ATOM   4885 O  O   . VAL E 5 69  ? -12.572 -49.259 57.529  1.00 47.12 ? 200  VAL E O   1 
ATOM   4886 C  CB  . VAL E 5 69  ? -11.188 -50.571 54.859  1.00 46.34 ? 200  VAL E CB  1 
ATOM   4887 C  CG1 . VAL E 5 69  ? -10.393 -51.245 55.971  1.00 46.37 ? 200  VAL E CG1 1 
ATOM   4888 C  CG2 . VAL E 5 69  ? -12.344 -51.450 54.369  1.00 46.28 ? 200  VAL E CG2 1 
ATOM   4889 N  N   . THR E 5 70  ? -14.056 -49.237 55.842  1.00 47.69 ? 201  THR E N   1 
ATOM   4890 C  CA  . THR E 5 70  ? -15.203 -49.469 56.717  1.00 48.45 ? 201  THR E CA  1 
ATOM   4891 C  C   . THR E 5 70  ? -15.697 -50.876 56.472  1.00 49.19 ? 201  THR E C   1 
ATOM   4892 O  O   . THR E 5 70  ? -15.643 -51.361 55.344  1.00 49.39 ? 201  THR E O   1 
ATOM   4893 C  CB  . THR E 5 70  ? -16.373 -48.477 56.476  1.00 48.35 ? 201  THR E CB  1 
ATOM   4894 O  OG1 . THR E 5 70  ? -16.645 -48.378 55.073  1.00 47.64 ? 201  THR E OG1 1 
ATOM   4895 C  CG2 . THR E 5 70  ? -16.055 -47.098 57.050  1.00 47.68 ? 201  THR E CG2 1 
ATOM   4896 N  N   . VAL E 5 71  ? -16.165 -51.526 57.532  1.00 50.29 ? 202  VAL E N   1 
ATOM   4897 C  CA  . VAL E 5 71  ? -16.678 -52.904 57.466  1.00 51.32 ? 202  VAL E CA  1 
ATOM   4898 C  C   . VAL E 5 71  ? -17.820 -53.091 58.475  1.00 52.14 ? 202  VAL E C   1 
ATOM   4899 O  O   . VAL E 5 71  ? -18.041 -52.210 59.323  1.00 52.44 ? 202  VAL E O   1 
ATOM   4900 C  CB  . VAL E 5 71  ? -15.560 -53.957 57.743  1.00 51.28 ? 202  VAL E CB  1 
ATOM   4901 C  CG1 . VAL E 5 71  ? -14.647 -54.130 56.528  1.00 51.15 ? 202  VAL E CG1 1 
ATOM   4902 C  CG2 . VAL E 5 71  ? -14.759 -53.601 59.005  1.00 51.27 ? 202  VAL E CG2 1 
ATOM   4903 N  N   . PRO E 5 72  ? -18.555 -54.227 58.393  1.00 52.70 ? 203  PRO E N   1 
ATOM   4904 C  CA  . PRO E 5 72  ? -19.522 -54.526 59.461  1.00 52.93 ? 203  PRO E CA  1 
ATOM   4905 C  C   . PRO E 5 72  ? -18.794 -54.783 60.785  1.00 53.28 ? 203  PRO E C   1 
ATOM   4906 O  O   . PRO E 5 72  ? -17.816 -55.537 60.805  1.00 53.18 ? 203  PRO E O   1 
ATOM   4907 C  CB  . PRO E 5 72  ? -20.205 -55.810 58.971  1.00 52.98 ? 203  PRO E CB  1 
ATOM   4908 C  CG  . PRO E 5 72  ? -19.892 -55.895 57.501  1.00 52.72 ? 203  PRO E CG  1 
ATOM   4909 C  CD  . PRO E 5 72  ? -18.553 -55.269 57.347  1.00 52.63 ? 203  PRO E CD  1 
ATOM   4910 N  N   . SER E 5 73  ? -19.249 -54.148 61.868  1.00 53.69 ? 204  SER E N   1 
ATOM   4911 C  CA  . SER E 5 73  ? -18.630 -54.342 63.191  1.00 54.32 ? 204  SER E CA  1 
ATOM   4912 C  C   . SER E 5 73  ? -18.787 -55.778 63.687  1.00 54.84 ? 204  SER E C   1 
ATOM   4913 O  O   . SER E 5 73  ? -17.925 -56.295 64.412  1.00 54.87 ? 204  SER E O   1 
ATOM   4914 C  CB  . SER E 5 73  ? -19.149 -53.334 64.229  1.00 54.16 ? 204  SER E CB  1 
ATOM   4915 O  OG  . SER E 5 73  ? -20.473 -52.921 63.945  1.00 54.09 ? 204  SER E OG  1 
ATOM   4916 N  N   . SER E 5 74  ? -19.878 -56.418 63.264  1.00 55.36 ? 205  SER E N   1 
ATOM   4917 C  CA  . SER E 5 74  ? -20.111 -57.839 63.517  1.00 55.90 ? 205  SER E CA  1 
ATOM   4918 C  C   . SER E 5 74  ? -18.906 -58.718 63.156  1.00 56.41 ? 205  SER E C   1 
ATOM   4919 O  O   . SER E 5 74  ? -18.627 -59.695 63.844  1.00 56.75 ? 205  SER E O   1 
ATOM   4920 C  CB  . SER E 5 74  ? -21.361 -58.322 62.770  1.00 55.79 ? 205  SER E CB  1 
ATOM   4921 O  OG  . SER E 5 74  ? -21.123 -58.460 61.378  1.00 55.81 ? 205  SER E OG  1 
ATOM   4922 N  N   . SER E 5 75  ? -18.188 -58.363 62.091  1.00 56.93 ? 206  SER E N   1 
ATOM   4923 C  CA  . SER E 5 75  ? -17.084 -59.190 61.587  1.00 57.23 ? 206  SER E CA  1 
ATOM   4924 C  C   . SER E 5 75  ? -15.745 -58.978 62.303  1.00 57.31 ? 206  SER E C   1 
ATOM   4925 O  O   . SER E 5 75  ? -14.778 -59.690 62.023  1.00 57.19 ? 206  SER E O   1 
ATOM   4926 C  CB  . SER E 5 75  ? -16.909 -58.990 60.070  1.00 57.36 ? 206  SER E CB  1 
ATOM   4927 O  OG  . SER E 5 75  ? -16.259 -57.763 59.771  1.00 57.46 ? 206  SER E OG  1 
ATOM   4928 N  N   . LEU E 5 76  ? -15.695 -58.023 63.230  1.00 57.58 ? 207  LEU E N   1 
ATOM   4929 C  CA  . LEU E 5 76  ? -14.423 -57.593 63.830  1.00 57.94 ? 207  LEU E CA  1 
ATOM   4930 C  C   . LEU E 5 76  ? -13.563 -58.678 64.483  1.00 58.32 ? 207  LEU E C   1 
ATOM   4931 O  O   . LEU E 5 76  ? -12.368 -58.760 64.194  1.00 58.50 ? 207  LEU E O   1 
ATOM   4932 C  CB  . LEU E 5 76  ? -14.632 -56.440 64.809  1.00 57.82 ? 207  LEU E CB  1 
ATOM   4933 C  CG  . LEU E 5 76  ? -14.966 -55.081 64.201  1.00 57.63 ? 207  LEU E CG  1 
ATOM   4934 C  CD1 . LEU E 5 76  ? -14.940 -54.017 65.286  1.00 56.81 ? 207  LEU E CD1 1 
ATOM   4935 C  CD2 . LEU E 5 76  ? -14.009 -54.732 63.059  1.00 57.57 ? 207  LEU E CD2 1 
ATOM   4936 N  N   . GLY E 5 77  ? -14.163 -59.491 65.357  1.00 58.70 ? 208  GLY E N   1 
ATOM   4937 C  CA  . GLY E 5 77  ? -13.444 -60.569 66.059  1.00 58.79 ? 208  GLY E CA  1 
ATOM   4938 C  C   . GLY E 5 77  ? -13.113 -61.782 65.194  1.00 58.86 ? 208  GLY E C   1 
ATOM   4939 O  O   . GLY E 5 77  ? -12.089 -62.448 65.410  1.00 58.98 ? 208  GLY E O   1 
ATOM   4940 N  N   . THR E 5 78  ? -13.975 -62.067 64.217  1.00 58.65 ? 209  THR E N   1 
ATOM   4941 C  CA  . THR E 5 78  ? -13.820 -63.236 63.343  1.00 58.72 ? 209  THR E CA  1 
ATOM   4942 C  C   . THR E 5 78  ? -12.883 -62.939 62.160  1.00 58.48 ? 209  THR E C   1 
ATOM   4943 O  O   . THR E 5 78  ? -11.788 -63.507 62.062  1.00 58.59 ? 209  THR E O   1 
ATOM   4944 C  CB  . THR E 5 78  ? -15.207 -63.810 62.834  1.00 58.92 ? 209  THR E CB  1 
ATOM   4945 O  OG1 . THR E 5 78  ? -15.884 -62.839 62.022  1.00 59.44 ? 209  THR E OG1 1 
ATOM   4946 C  CG2 . THR E 5 78  ? -16.125 -64.222 64.000  1.00 58.38 ? 209  THR E CG2 1 
ATOM   4947 N  N   . GLN E 5 79  ? -13.314 -62.029 61.287  1.00 57.95 ? 210  GLN E N   1 
ATOM   4948 C  CA  . GLN E 5 79  ? -12.580 -61.656 60.071  1.00 57.38 ? 210  GLN E CA  1 
ATOM   4949 C  C   . GLN E 5 79  ? -11.257 -60.901 60.345  1.00 57.07 ? 210  GLN E C   1 
ATOM   4950 O  O   . GLN E 5 79  ? -11.218 -59.962 61.146  1.00 57.16 ? 210  GLN E O   1 
ATOM   4951 C  CB  . GLN E 5 79  ? -13.515 -60.850 59.146  1.00 57.25 ? 210  GLN E CB  1 
ATOM   4952 C  CG  . GLN E 5 79  ? -12.879 -60.234 57.904  1.00 56.78 ? 210  GLN E CG  1 
ATOM   4953 C  CD  . GLN E 5 79  ? -12.485 -61.247 56.853  1.00 56.00 ? 210  GLN E CD  1 
ATOM   4954 O  OE1 . GLN E 5 79  ? -13.233 -61.485 55.910  1.00 56.17 ? 210  GLN E OE1 1 
ATOM   4955 N  NE2 . GLN E 5 79  ? -11.303 -61.846 57.004  1.00 54.88 ? 210  GLN E NE2 1 
ATOM   4956 N  N   . THR E 5 80  ? -10.185 -61.318 59.669  1.00 56.50 ? 211  THR E N   1 
ATOM   4957 C  CA  . THR E 5 80  ? -8.869  -60.681 59.799  1.00 56.00 ? 211  THR E CA  1 
ATOM   4958 C  C   . THR E 5 80  ? -8.624  -59.577 58.750  1.00 55.61 ? 211  THR E C   1 
ATOM   4959 O  O   . THR E 5 80  ? -9.068  -59.683 57.602  1.00 55.50 ? 211  THR E O   1 
ATOM   4960 C  CB  . THR E 5 80  ? -7.744  -61.739 59.772  1.00 55.99 ? 211  THR E CB  1 
ATOM   4961 O  OG1 . THR E 5 80  ? -7.788  -62.495 60.984  1.00 56.35 ? 211  THR E OG1 1 
ATOM   4962 C  CG2 . THR E 5 80  ? -6.366  -61.096 59.654  1.00 56.14 ? 211  THR E CG2 1 
ATOM   4963 N  N   . TYR E 5 81  ? -7.910  -58.526 59.162  1.00 55.15 ? 212  TYR E N   1 
ATOM   4964 C  CA  . TYR E 5 81  ? -7.657  -57.352 58.312  1.00 54.52 ? 212  TYR E CA  1 
ATOM   4965 C  C   . TYR E 5 81  ? -6.178  -56.954 58.241  1.00 54.16 ? 212  TYR E C   1 
ATOM   4966 O  O   . TYR E 5 81  ? -5.589  -56.506 59.237  1.00 54.28 ? 212  TYR E O   1 
ATOM   4967 C  CB  . TYR E 5 81  ? -8.525  -56.170 58.763  1.00 54.22 ? 212  TYR E CB  1 
ATOM   4968 C  CG  . TYR E 5 81  ? -10.008 -56.415 58.589  1.00 53.91 ? 212  TYR E CG  1 
ATOM   4969 C  CD1 . TYR E 5 81  ? -10.538 -56.723 57.333  1.00 53.73 ? 212  TYR E CD1 1 
ATOM   4970 C  CD2 . TYR E 5 81  ? -10.884 -56.337 59.674  1.00 53.71 ? 212  TYR E CD2 1 
ATOM   4971 C  CE1 . TYR E 5 81  ? -11.902 -56.950 57.156  1.00 53.61 ? 212  TYR E CE1 1 
ATOM   4972 C  CE2 . TYR E 5 81  ? -12.258 -56.563 59.508  1.00 53.97 ? 212  TYR E CE2 1 
ATOM   4973 C  CZ  . TYR E 5 81  ? -12.756 -56.867 58.242  1.00 53.68 ? 212  TYR E CZ  1 
ATOM   4974 O  OH  . TYR E 5 81  ? -14.099 -57.094 58.052  1.00 53.31 ? 212  TYR E OH  1 
ATOM   4975 N  N   . ILE E 5 82  ? -5.595  -57.125 57.053  1.00 53.56 ? 213  ILE E N   1 
ATOM   4976 C  CA  . ILE E 5 82  ? -4.178  -56.833 56.811  1.00 53.20 ? 213  ILE E CA  1 
ATOM   4977 C  C   . ILE E 5 82  ? -3.993  -55.792 55.693  1.00 52.87 ? 213  ILE E C   1 
ATOM   4978 O  O   . ILE E 5 82  ? -4.502  -55.960 54.570  1.00 52.68 ? 213  ILE E O   1 
ATOM   4979 C  CB  . ILE E 5 82  ? -3.367  -58.124 56.463  1.00 53.21 ? 213  ILE E CB  1 
ATOM   4980 C  CG1 . ILE E 5 82  ? -3.540  -59.195 57.544  1.00 53.06 ? 213  ILE E CG1 1 
ATOM   4981 C  CG2 . ILE E 5 82  ? -1.882  -57.802 56.265  1.00 52.78 ? 213  ILE E CG2 1 
ATOM   4982 C  CD1 . ILE E 5 82  ? -3.321  -60.618 57.046  1.00 53.29 ? 213  ILE E CD1 1 
ATOM   4983 N  N   . CYS E 5 83  ? -3.267  -54.720 56.004  1.00 52.29 ? 214  CYS E N   1 
ATOM   4984 C  CA  . CYS E 5 83  ? -2.911  -53.735 54.986  1.00 51.83 ? 214  CYS E CA  1 
ATOM   4985 C  C   . CYS E 5 83  ? -1.517  -54.032 54.462  1.00 51.22 ? 214  CYS E C   1 
ATOM   4986 O  O   . CYS E 5 83  ? -0.566  -54.142 55.230  1.00 50.80 ? 214  CYS E O   1 
ATOM   4987 C  CB  . CYS E 5 83  ? -3.048  -52.291 55.498  1.00 51.88 ? 214  CYS E CB  1 
ATOM   4988 S  SG  . CYS E 5 83  ? -1.745  -51.676 56.601  1.00 52.66 ? 214  CYS E SG  1 
ATOM   4989 N  N   . ASN E 5 84  ? -1.422  -54.195 53.148  1.00 50.96 ? 215  ASN E N   1 
ATOM   4990 C  CA  . ASN E 5 84  ? -0.166  -54.530 52.484  1.00 50.83 ? 215  ASN E CA  1 
ATOM   4991 C  C   . ASN E 5 84  ? 0.470   -53.265 51.941  1.00 50.67 ? 215  ASN E C   1 
ATOM   4992 O  O   . ASN E 5 84  ? -0.094  -52.592 51.079  1.00 50.75 ? 215  ASN E O   1 
ATOM   4993 C  CB  . ASN E 5 84  ? -0.407  -55.541 51.364  1.00 50.79 ? 215  ASN E CB  1 
ATOM   4994 C  CG  . ASN E 5 84  ? -1.493  -56.547 51.716  1.00 51.07 ? 215  ASN E CG  1 
ATOM   4995 O  OD1 . ASN E 5 84  ? -2.624  -56.441 51.250  1.00 51.62 ? 215  ASN E OD1 1 
ATOM   4996 N  ND2 . ASN E 5 84  ? -1.160  -57.509 52.564  1.00 51.41 ? 215  ASN E ND2 1 
ATOM   4997 N  N   . VAL E 5 85  ? 1.636   -52.933 52.474  1.00 50.51 ? 216  VAL E N   1 
ATOM   4998 C  CA  . VAL E 5 85  ? 2.286   -51.669 52.176  1.00 50.49 ? 216  VAL E CA  1 
ATOM   4999 C  C   . VAL E 5 85  ? 3.544   -51.926 51.352  1.00 50.54 ? 216  VAL E C   1 
ATOM   5000 O  O   . VAL E 5 85  ? 4.396   -52.735 51.731  1.00 50.30 ? 216  VAL E O   1 
ATOM   5001 C  CB  . VAL E 5 85  ? 2.586   -50.880 53.487  1.00 50.46 ? 216  VAL E CB  1 
ATOM   5002 C  CG1 . VAL E 5 85  ? 3.532   -49.718 53.254  1.00 50.41 ? 216  VAL E CG1 1 
ATOM   5003 C  CG2 . VAL E 5 85  ? 1.289   -50.373 54.101  1.00 50.81 ? 216  VAL E CG2 1 
ATOM   5004 N  N   . ASN E 5 86  ? 3.637   -51.252 50.209  1.00 50.65 ? 217  ASN E N   1 
ATOM   5005 C  CA  . ASN E 5 86  ? 4.828   -51.342 49.372  1.00 50.82 ? 217  ASN E CA  1 
ATOM   5006 C  C   . ASN E 5 86  ? 5.464   -49.973 49.117  1.00 50.62 ? 217  ASN E C   1 
ATOM   5007 O  O   . ASN E 5 86  ? 4.823   -49.065 48.584  1.00 50.70 ? 217  ASN E O   1 
ATOM   5008 C  CB  . ASN E 5 86  ? 4.507   -52.054 48.049  1.00 50.99 ? 217  ASN E CB  1 
ATOM   5009 C  CG  . ASN E 5 86  ? 5.746   -52.608 47.359  1.00 51.47 ? 217  ASN E CG  1 
ATOM   5010 O  OD1 . ASN E 5 86  ? 6.847   -52.577 47.910  1.00 53.04 ? 217  ASN E OD1 1 
ATOM   5011 N  ND2 . ASN E 5 86  ? 5.568   -53.118 46.144  1.00 51.55 ? 217  ASN E ND2 1 
ATOM   5012 N  N   . HIS E 5 87  ? 6.715   -49.827 49.534  1.00 50.34 ? 218  HIS E N   1 
ATOM   5013 C  CA  . HIS E 5 87  ? 7.501   -48.671 49.164  1.00 50.34 ? 218  HIS E CA  1 
ATOM   5014 C  C   . HIS E 5 87  ? 8.642   -49.139 48.273  1.00 50.92 ? 218  HIS E C   1 
ATOM   5015 O  O   . HIS E 5 87  ? 9.773   -49.351 48.740  1.00 51.01 ? 218  HIS E O   1 
ATOM   5016 C  CB  . HIS E 5 87  ? 8.024   -47.932 50.395  1.00 50.05 ? 218  HIS E CB  1 
ATOM   5017 C  CG  . HIS E 5 87  ? 8.690   -46.627 50.075  1.00 48.99 ? 218  HIS E CG  1 
ATOM   5018 N  ND1 . HIS E 5 87  ? 10.015  -46.377 50.363  1.00 47.73 ? 218  HIS E ND1 1 
ATOM   5019 C  CD2 . HIS E 5 87  ? 8.218   -45.506 49.480  1.00 47.60 ? 218  HIS E CD2 1 
ATOM   5020 C  CE1 . HIS E 5 87  ? 10.328  -45.156 49.968  1.00 46.86 ? 218  HIS E CE1 1 
ATOM   5021 N  NE2 . HIS E 5 87  ? 9.256   -44.607 49.426  1.00 46.98 ? 218  HIS E NE2 1 
ATOM   5022 N  N   . LYS E 5 88  ? 8.327   -49.301 46.987  1.00 51.36 ? 219  LYS E N   1 
ATOM   5023 C  CA  . LYS E 5 88  ? 9.282   -49.791 45.990  1.00 51.84 ? 219  LYS E CA  1 
ATOM   5024 C  C   . LYS E 5 88  ? 10.643  -49.062 45.971  1.00 51.94 ? 219  LYS E C   1 
ATOM   5025 O  O   . LYS E 5 88  ? 11.679  -49.718 45.835  1.00 52.32 ? 219  LYS E O   1 
ATOM   5026 C  CB  . LYS E 5 88  ? 8.646   -49.822 44.597  1.00 51.95 ? 219  LYS E CB  1 
ATOM   5027 C  CG  . LYS E 5 88  ? 7.899   -51.109 44.270  1.00 52.72 ? 219  LYS E CG  1 
ATOM   5028 C  CD  . LYS E 5 88  ? 7.000   -50.902 43.054  1.00 54.74 ? 219  LYS E CD  1 
ATOM   5029 C  CE  . LYS E 5 88  ? 7.030   -52.097 42.093  1.00 56.04 ? 219  LYS E CE  1 
ATOM   5030 N  NZ  . LYS E 5 88  ? 6.250   -53.269 42.589  1.00 56.63 ? 219  LYS E NZ  1 
ATOM   5031 N  N   . PRO E 5 89  ? 10.653  -47.715 46.108  1.00 51.96 ? 220  PRO E N   1 
ATOM   5032 C  CA  . PRO E 5 89  ? 11.938  -47.005 46.200  1.00 51.93 ? 220  PRO E CA  1 
ATOM   5033 C  C   . PRO E 5 89  ? 12.904  -47.496 47.290  1.00 52.26 ? 220  PRO E C   1 
ATOM   5034 O  O   . PRO E 5 89  ? 14.114  -47.471 47.077  1.00 52.48 ? 220  PRO E O   1 
ATOM   5035 C  CB  . PRO E 5 89  ? 11.519  -45.566 46.485  1.00 51.88 ? 220  PRO E CB  1 
ATOM   5036 C  CG  . PRO E 5 89  ? 10.145  -45.453 45.908  1.00 51.77 ? 220  PRO E CG  1 
ATOM   5037 C  CD  . PRO E 5 89  ? 9.509   -46.777 46.132  1.00 51.81 ? 220  PRO E CD  1 
ATOM   5038 N  N   . SER E 5 90  ? 12.395  -47.938 48.437  1.00 52.48 ? 221  SER E N   1 
ATOM   5039 C  CA  . SER E 5 90  ? 13.277  -48.389 49.514  1.00 52.78 ? 221  SER E CA  1 
ATOM   5040 C  C   . SER E 5 90  ? 13.324  -49.903 49.680  1.00 53.30 ? 221  SER E C   1 
ATOM   5041 O  O   . SER E 5 90  ? 14.030  -50.405 50.565  1.00 53.22 ? 221  SER E O   1 
ATOM   5042 C  CB  . SER E 5 90  ? 12.868  -47.761 50.838  1.00 52.67 ? 221  SER E CB  1 
ATOM   5043 O  OG  . SER E 5 90  ? 11.637  -48.301 51.270  1.00 52.18 ? 221  SER E OG  1 
ATOM   5044 N  N   . ASN E 5 91  ? 12.592  -50.624 48.826  1.00 53.95 ? 222  ASN E N   1 
ATOM   5045 C  CA  . ASN E 5 91  ? 12.390  -52.070 48.989  1.00 54.74 ? 222  ASN E CA  1 
ATOM   5046 C  C   . ASN E 5 91  ? 11.872  -52.360 50.388  1.00 54.84 ? 222  ASN E C   1 
ATOM   5047 O  O   . ASN E 5 91  ? 12.517  -53.062 51.175  1.00 55.13 ? 222  ASN E O   1 
ATOM   5048 C  CB  . ASN E 5 91  ? 13.682  -52.865 48.730  1.00 54.99 ? 222  ASN E CB  1 
ATOM   5049 C  CG  . ASN E 5 91  ? 14.090  -52.856 47.274  1.00 55.96 ? 222  ASN E CG  1 
ATOM   5050 O  OD1 . ASN E 5 91  ? 13.595  -53.652 46.475  1.00 57.29 ? 222  ASN E OD1 1 
ATOM   5051 N  ND2 . ASN E 5 91  ? 15.003  -51.955 46.919  1.00 56.59 ? 222  ASN E ND2 1 
ATOM   5052 N  N   . THR E 5 92  ? 10.731  -51.761 50.709  1.00 54.86 ? 223  THR E N   1 
ATOM   5053 C  CA  . THR E 5 92  ? 10.063  -51.998 51.981  1.00 54.66 ? 223  THR E CA  1 
ATOM   5054 C  C   . THR E 5 92  ? 8.683   -52.560 51.662  1.00 54.51 ? 223  THR E C   1 
ATOM   5055 O  O   . THR E 5 92  ? 7.864   -51.898 51.016  1.00 54.42 ? 223  THR E O   1 
ATOM   5056 C  CB  . THR E 5 92  ? 9.973   -50.708 52.868  1.00 54.70 ? 223  THR E CB  1 
ATOM   5057 O  OG1 . THR E 5 92  ? 11.288  -50.198 53.126  1.00 54.66 ? 223  THR E OG1 1 
ATOM   5058 C  CG2 . THR E 5 92  ? 9.294   -50.991 54.211  1.00 54.56 ? 223  THR E CG2 1 
ATOM   5059 N  N   . LYS E 5 93  ? 8.462   -53.804 52.073  1.00 54.22 ? 224  LYS E N   1 
ATOM   5060 C  CA  . LYS E 5 93  ? 7.143   -54.402 52.035  1.00 54.01 ? 224  LYS E CA  1 
ATOM   5061 C  C   . LYS E 5 93  ? 6.748   -54.759 53.464  1.00 53.82 ? 224  LYS E C   1 
ATOM   5062 O  O   . LYS E 5 93  ? 7.523   -55.376 54.192  1.00 53.87 ? 224  LYS E O   1 
ATOM   5063 C  CB  . LYS E 5 93  ? 7.115   -55.634 51.124  1.00 54.17 ? 224  LYS E CB  1 
ATOM   5064 C  CG  . LYS E 5 93  ? 7.275   -55.352 49.622  1.00 54.37 ? 224  LYS E CG  1 
ATOM   5065 C  CD  . LYS E 5 93  ? 6.452   -56.319 48.740  1.00 54.81 ? 224  LYS E CD  1 
ATOM   5066 C  CE  . LYS E 5 93  ? 6.999   -57.756 48.709  1.00 54.98 ? 224  LYS E CE  1 
ATOM   5067 N  NZ  . LYS E 5 93  ? 8.159   -57.938 47.788  1.00 55.01 ? 224  LYS E NZ  1 
ATOM   5068 N  N   . VAL E 5 94  ? 5.556   -54.342 53.874  1.00 53.75 ? 225  VAL E N   1 
ATOM   5069 C  CA  . VAL E 5 94  ? 5.064   -54.619 55.221  1.00 53.81 ? 225  VAL E CA  1 
ATOM   5070 C  C   . VAL E 5 94  ? 3.603   -55.055 55.189  1.00 54.08 ? 225  VAL E C   1 
ATOM   5071 O  O   . VAL E 5 94  ? 2.758   -54.395 54.586  1.00 53.92 ? 225  VAL E O   1 
ATOM   5072 C  CB  . VAL E 5 94  ? 5.249   -53.399 56.173  1.00 53.67 ? 225  VAL E CB  1 
ATOM   5073 C  CG1 . VAL E 5 94  ? 4.357   -53.513 57.400  1.00 53.54 ? 225  VAL E CG1 1 
ATOM   5074 C  CG2 . VAL E 5 94  ? 6.706   -53.261 56.606  1.00 53.48 ? 225  VAL E CG2 1 
ATOM   5075 N  N   . ASP E 5 95  ? 3.320   -56.183 55.830  1.00 54.62 ? 226  ASP E N   1 
ATOM   5076 C  CA  . ASP E 5 95  ? 1.948   -56.626 56.024  1.00 55.31 ? 226  ASP E CA  1 
ATOM   5077 C  C   . ASP E 5 95  ? 1.576   -56.448 57.489  1.00 55.66 ? 226  ASP E C   1 
ATOM   5078 O  O   . ASP E 5 95  ? 2.145   -57.105 58.363  1.00 55.74 ? 226  ASP E O   1 
ATOM   5079 C  CB  . ASP E 5 95  ? 1.772   -58.079 55.562  1.00 55.39 ? 226  ASP E CB  1 
ATOM   5080 C  CG  . ASP E 5 95  ? 1.855   -58.224 54.044  1.00 55.56 ? 226  ASP E CG  1 
ATOM   5081 O  OD1 . ASP E 5 95  ? 1.125   -57.506 53.334  1.00 55.32 ? 226  ASP E OD1 1 
ATOM   5082 O  OD2 . ASP E 5 95  ? 2.651   -59.054 53.557  1.00 56.08 ? 226  ASP E OD2 1 
ATOM   5083 N  N   . LYS E 5 96  ? 0.641   -55.536 57.747  1.00 56.26 ? 227  LYS E N   1 
ATOM   5084 C  CA  . LYS E 5 96  ? 0.260   -55.173 59.107  1.00 57.05 ? 227  LYS E CA  1 
ATOM   5085 C  C   . LYS E 5 96  ? -1.163  -55.608 59.426  1.00 58.01 ? 227  LYS E C   1 
ATOM   5086 O  O   . LYS E 5 96  ? -2.113  -55.214 58.748  1.00 57.92 ? 227  LYS E O   1 
ATOM   5087 C  CB  . LYS E 5 96  ? 0.421   -53.663 59.335  1.00 56.73 ? 227  LYS E CB  1 
ATOM   5088 C  CG  . LYS E 5 96  ? 0.185   -53.204 60.772  1.00 56.41 ? 227  LYS E CG  1 
ATOM   5089 C  CD  . LYS E 5 96  ? 1.431   -53.313 61.650  1.00 56.54 ? 227  LYS E CD  1 
ATOM   5090 C  CE  . LYS E 5 96  ? 1.077   -53.095 63.126  1.00 57.25 ? 227  LYS E CE  1 
ATOM   5091 N  NZ  . LYS E 5 96  ? 2.170   -52.449 63.928  1.00 57.10 ? 227  LYS E NZ  1 
ATOM   5092 N  N   . LYS E 5 97  ? -1.292  -56.440 60.457  1.00 59.39 ? 228  LYS E N   1 
ATOM   5093 C  CA  . LYS E 5 97  ? -2.595  -56.816 60.987  1.00 60.72 ? 228  LYS E CA  1 
ATOM   5094 C  C   . LYS E 5 97  ? -3.085  -55.692 61.883  1.00 61.55 ? 228  LYS E C   1 
ATOM   5095 O  O   . LYS E 5 97  ? -2.304  -55.102 62.635  1.00 61.51 ? 228  LYS E O   1 
ATOM   5096 C  CB  . LYS E 5 97  ? -2.519  -58.134 61.771  1.00 60.69 ? 228  LYS E CB  1 
ATOM   5097 C  CG  . LYS E 5 97  ? -3.887  -58.664 62.225  1.00 60.86 ? 228  LYS E CG  1 
ATOM   5098 C  CD  . LYS E 5 97  ? -3.816  -60.080 62.783  1.00 60.74 ? 228  LYS E CD  1 
ATOM   5099 C  CE  . LYS E 5 97  ? -5.173  -60.525 63.305  1.00 60.10 ? 228  LYS E CE  1 
ATOM   5100 N  NZ  . LYS E 5 97  ? -5.048  -61.639 64.279  1.00 60.01 ? 228  LYS E NZ  1 
ATOM   5101 N  N   . VAL E 5 98  ? -4.376  -55.396 61.790  1.00 62.82 ? 229  VAL E N   1 
ATOM   5102 C  CA  . VAL E 5 98  ? -4.973  -54.345 62.603  1.00 64.29 ? 229  VAL E CA  1 
ATOM   5103 C  C   . VAL E 5 98  ? -6.053  -54.925 63.532  1.00 65.19 ? 229  VAL E C   1 
ATOM   5104 O  O   . VAL E 5 98  ? -7.099  -55.399 63.080  1.00 65.16 ? 229  VAL E O   1 
ATOM   5105 C  CB  . VAL E 5 98  ? -5.471  -53.159 61.717  1.00 64.28 ? 229  VAL E CB  1 
ATOM   5106 C  CG1 . VAL E 5 98  ? -6.389  -52.218 62.490  1.00 64.83 ? 229  VAL E CG1 1 
ATOM   5107 C  CG2 . VAL E 5 98  ? -4.286  -52.380 61.164  1.00 64.12 ? 229  VAL E CG2 1 
ATOM   5108 N  N   . GLU E 5 99  ? -5.764  -54.896 64.830  1.00 66.47 ? 230  GLU E N   1 
ATOM   5109 C  CA  . GLU E 5 99  ? -6.621  -55.495 65.851  1.00 67.90 ? 230  GLU E CA  1 
ATOM   5110 C  C   . GLU E 5 99  ? -7.338  -54.419 66.681  1.00 68.86 ? 230  GLU E C   1 
ATOM   5111 O  O   . GLU E 5 99  ? -6.734  -53.391 67.009  1.00 68.86 ? 230  GLU E O   1 
ATOM   5112 C  CB  . GLU E 5 99  ? -5.785  -56.379 66.796  1.00 67.91 ? 230  GLU E CB  1 
ATOM   5113 C  CG  . GLU E 5 99  ? -5.130  -57.622 66.163  1.00 68.65 ? 230  GLU E CG  1 
ATOM   5114 C  CD  . GLU E 5 99  ? -5.813  -58.945 66.538  1.00 69.66 ? 230  GLU E CD  1 
ATOM   5115 O  OE1 . GLU E 5 99  ? -5.125  -59.829 67.096  1.00 69.85 ? 230  GLU E OE1 1 
ATOM   5116 O  OE2 . GLU E 5 99  ? -7.026  -59.115 66.274  1.00 69.82 ? 230  GLU E OE2 1 
ATOM   5117 N  N   . PRO E 5 100 ? -8.629  -54.650 67.019  1.00 69.88 ? 231  PRO E N   1 
ATOM   5118 C  CA  . PRO E 5 100 ? -9.294  -53.906 68.105  1.00 70.83 ? 231  PRO E CA  1 
ATOM   5119 C  C   . PRO E 5 100 ? -8.819  -54.397 69.487  1.00 71.88 ? 231  PRO E C   1 
ATOM   5120 O  O   . PRO E 5 100 ? -8.080  -55.384 69.557  1.00 72.01 ? 231  PRO E O   1 
ATOM   5121 C  CB  . PRO E 5 100 ? -10.775 -54.242 67.894  1.00 70.66 ? 231  PRO E CB  1 
ATOM   5122 C  CG  . PRO E 5 100 ? -10.767 -55.578 67.240  1.00 70.10 ? 231  PRO E CG  1 
ATOM   5123 C  CD  . PRO E 5 100 ? -9.544  -55.609 66.368  1.00 69.79 ? 231  PRO E CD  1 
ATOM   5124 N  N   . LYS E 5 101 ? -9.224  -53.725 70.568  1.00 73.09 ? 232  LYS E N   1 
ATOM   5125 C  CA  . LYS E 5 101 ? -8.924  -54.206 71.937  1.00 74.39 ? 232  LYS E CA  1 
ATOM   5126 C  C   . LYS E 5 101 ? -9.958  -55.236 72.471  1.00 75.24 ? 232  LYS E C   1 
ATOM   5127 O  O   . LYS E 5 101 ? -9.785  -56.449 72.297  1.00 75.23 ? 232  LYS E O   1 
ATOM   5128 C  CB  . LYS E 5 101 ? -8.743  -53.028 72.908  1.00 74.19 ? 232  LYS E CB  1 
ATOM   5129 N  N   . SER E 5 102 ? -11.012 -54.747 73.129  1.00 76.47 ? 233  SER E N   1 
ATOM   5130 C  CA  . SER E 5 102 ? -12.191 -55.552 73.506  1.00 77.41 ? 233  SER E CA  1 
ATOM   5131 C  C   . SER E 5 102 ? -13.422 -54.648 73.324  1.00 78.06 ? 233  SER E C   1 
ATOM   5132 O  O   . SER E 5 102 ? -13.755 -53.915 74.261  1.00 78.17 ? 233  SER E O   1 
ATOM   5133 C  CB  . SER E 5 102 ? -12.109 -56.024 74.971  1.00 77.32 ? 233  SER E CB  1 
ATOM   5134 O  OG  . SER E 5 102 ? -10.777 -56.284 75.392  1.00 77.26 ? 233  SER E OG  1 
ATOM   5135 N  N   . GLU E 5 103 ? -14.136 -54.680 72.183  1.00 78.74 ? 234  GLU E N   1 
ATOM   5136 C  CA  . GLU E 5 103 ? -14.198 -55.745 71.146  1.00 79.38 ? 234  GLU E CA  1 
ATOM   5137 C  C   . GLU E 5 103 ? -15.314 -56.746 71.471  1.00 79.90 ? 234  GLU E C   1 
ATOM   5138 O  O   . GLU E 5 103 ? -16.071 -57.139 70.583  1.00 79.97 ? 234  GLU E O   1 
ATOM   5139 C  CB  . GLU E 5 103 ? -12.855 -56.456 70.904  1.00 79.28 ? 234  GLU E CB  1 
ATOM   5140 N  N   . PHE E 5 104 ? -15.396 -57.135 72.749  1.00 80.52 ? 235  PHE E N   1 
ATOM   5141 C  CA  . PHE E 5 104 ? -16.471 -57.966 73.339  1.00 81.06 ? 235  PHE E CA  1 
ATOM   5142 C  C   . PHE E 5 104 ? -17.737 -58.249 72.465  1.00 81.10 ? 235  PHE E C   1 
ATOM   5143 O  O   . PHE E 5 104 ? -17.739 -59.201 71.677  1.00 81.04 ? 235  PHE E O   1 
ATOM   5144 C  CB  . PHE E 5 104 ? -16.806 -57.429 74.754  1.00 81.31 ? 235  PHE E CB  1 
ATOM   5145 C  CG  . PHE E 5 104 ? -17.934 -58.155 75.457  1.00 82.33 ? 235  PHE E CG  1 
ATOM   5146 C  CD1 . PHE E 5 104 ? -18.047 -59.550 75.406  1.00 82.92 ? 235  PHE E CD1 1 
ATOM   5147 C  CD2 . PHE E 5 104 ? -18.878 -57.435 76.195  1.00 83.28 ? 235  PHE E CD2 1 
ATOM   5148 C  CE1 . PHE E 5 104 ? -19.098 -60.211 76.052  1.00 83.05 ? 235  PHE E CE1 1 
ATOM   5149 C  CE2 . PHE E 5 104 ? -19.930 -58.087 76.856  1.00 83.39 ? 235  PHE E CE2 1 
ATOM   5150 C  CZ  . PHE E 5 104 ? -20.038 -59.480 76.784  1.00 82.94 ? 235  PHE E CZ  1 
ATOM   5151 N  N   . GLU E 5 105 ? -18.797 -57.451 72.605  1.00 81.13 ? 236  GLU E N   1 
ATOM   5152 C  CA  . GLU E 5 105 ? -20.058 -57.729 71.901  1.00 81.15 ? 236  GLU E CA  1 
ATOM   5153 C  C   . GLU E 5 105 ? -20.515 -56.576 71.005  1.00 81.10 ? 236  GLU E C   1 
ATOM   5154 O  O   . GLU E 5 105 ? -20.557 -55.421 71.430  1.00 81.00 ? 236  GLU E O   1 
ATOM   5155 C  CB  . GLU E 5 105 ? -21.161 -58.116 72.897  1.00 81.10 ? 236  GLU E CB  1 
ATOM   5156 N  N   . THR F 6 23  ? 29.520  27.717  -7.986  1.00 40.69 ? 61   THR P N   1 
ATOM   5157 C  CA  . THR F 6 23  ? 30.181  26.607  -7.230  1.00 40.59 ? 61   THR P CA  1 
ATOM   5158 C  C   . THR F 6 23  ? 29.192  25.488  -6.833  1.00 40.23 ? 61   THR P C   1 
ATOM   5159 O  O   . THR F 6 23  ? 29.575  24.319  -6.733  1.00 40.40 ? 61   THR P O   1 
ATOM   5160 C  CB  . THR F 6 23  ? 30.922  27.160  -5.982  1.00 40.47 ? 61   THR P CB  1 
ATOM   5161 N  N   . ALA F 6 24  ? 27.929  25.853  -6.611  1.00 39.38 ? 62   ALA P N   1 
ATOM   5162 C  CA  . ALA F 6 24  ? 26.919  24.900  -6.141  1.00 38.25 ? 62   ALA P CA  1 
ATOM   5163 C  C   . ALA F 6 24  ? 26.590  23.872  -7.220  1.00 37.38 ? 62   ALA P C   1 
ATOM   5164 O  O   . ALA F 6 24  ? 26.239  24.217  -8.349  1.00 37.04 ? 62   ALA P O   1 
ATOM   5165 C  CB  . ALA F 6 24  ? 25.670  25.628  -5.681  1.00 38.34 ? 62   ALA P CB  1 
ATOM   5166 N  N   . THR F 6 25  ? 26.701  22.602  -6.854  1.00 36.32 ? 63   THR P N   1 
ATOM   5167 C  CA  . THR F 6 25  ? 26.696  21.517  -7.830  1.00 35.20 ? 63   THR P CA  1 
ATOM   5168 C  C   . THR F 6 25  ? 25.454  20.612  -7.676  1.00 33.99 ? 63   THR P C   1 
ATOM   5169 O  O   . THR F 6 25  ? 24.857  20.543  -6.604  1.00 33.54 ? 63   THR P O   1 
ATOM   5170 C  CB  . THR F 6 25  ? 28.086  20.764  -7.821  1.00 35.34 ? 63   THR P CB  1 
ATOM   5171 O  OG1 . THR F 6 25  ? 27.924  19.414  -8.250  1.00 37.55 ? 63   THR P OG1 1 
ATOM   5172 C  CG2 . THR F 6 25  ? 28.755  20.760  -6.422  1.00 34.91 ? 63   THR P CG2 1 
ATOM   5173 N  N   . PHE F 6 26  ? 25.047  19.950  -8.755  1.00 32.91 ? 64   PHE P N   1 
ATOM   5174 C  CA  . PHE F 6 26  ? 23.851  19.105  -8.716  1.00 32.24 ? 64   PHE P CA  1 
ATOM   5175 C  C   . PHE F 6 26  ? 24.120  17.622  -9.009  1.00 32.59 ? 64   PHE P C   1 
ATOM   5176 O  O   . PHE F 6 26  ? 24.793  17.284  -9.982  1.00 32.99 ? 64   PHE P O   1 
ATOM   5177 C  CB  . PHE F 6 26  ? 22.800  19.639  -9.671  1.00 31.21 ? 64   PHE P CB  1 
ATOM   5178 C  CG  . PHE F 6 26  ? 21.601  18.759  -9.802  1.00 30.09 ? 64   PHE P CG  1 
ATOM   5179 C  CD1 . PHE F 6 26  ? 20.748  18.554  -8.724  1.00 28.58 ? 64   PHE P CD1 1 
ATOM   5180 C  CD2 . PHE F 6 26  ? 21.301  18.153  -11.013 1.00 29.35 ? 64   PHE P CD2 1 
ATOM   5181 C  CE1 . PHE F 6 26  ? 19.621  17.748  -8.847  1.00 27.31 ? 64   PHE P CE1 1 
ATOM   5182 C  CE2 . PHE F 6 26  ? 20.174  17.347  -11.145 1.00 28.55 ? 64   PHE P CE2 1 
ATOM   5183 C  CZ  . PHE F 6 26  ? 19.336  17.148  -10.058 1.00 28.77 ? 64   PHE P CZ  1 
ATOM   5184 N  N   . HIS F 6 27  ? 23.576  16.740  -8.168  1.00 32.41 ? 65   HIS P N   1 
ATOM   5185 C  CA  . HIS F 6 27  ? 23.833  15.304  -8.279  1.00 31.93 ? 65   HIS P CA  1 
ATOM   5186 C  C   . HIS F 6 27  ? 22.550  14.486  -8.299  1.00 31.37 ? 65   HIS P C   1 
ATOM   5187 O  O   . HIS F 6 27  ? 21.608  14.783  -7.562  1.00 31.29 ? 65   HIS P O   1 
ATOM   5188 C  CB  . HIS F 6 27  ? 24.717  14.821  -7.128  1.00 31.99 ? 65   HIS P CB  1 
ATOM   5189 C  CG  . HIS F 6 27  ? 25.937  15.654  -6.910  1.00 33.63 ? 65   HIS P CG  1 
ATOM   5190 N  ND1 . HIS F 6 27  ? 26.861  15.894  -7.904  1.00 35.04 ? 65   HIS P ND1 1 
ATOM   5191 C  CD2 . HIS F 6 27  ? 26.392  16.299  -5.808  1.00 35.26 ? 65   HIS P CD2 1 
ATOM   5192 C  CE1 . HIS F 6 27  ? 27.833  16.651  -7.424  1.00 36.04 ? 65   HIS P CE1 1 
ATOM   5193 N  NE2 . HIS F 6 27  ? 27.572  16.914  -6.155  1.00 35.93 ? 65   HIS P NE2 1 
ATOM   5194 N  N   . ARG F 6 28  ? 22.522  13.462  -9.151  1.00 30.63 ? 66   ARG P N   1 
ATOM   5195 C  CA  . ARG F 6 28  ? 21.445  12.469  -9.146  1.00 30.09 ? 66   ARG P CA  1 
ATOM   5196 C  C   . ARG F 6 28  ? 22.017  11.060  -9.188  1.00 29.00 ? 66   ARG P C   1 
ATOM   5197 O  O   . ARG F 6 28  ? 23.198  10.888  -9.469  1.00 28.89 ? 66   ARG P O   1 
ATOM   5198 C  CB  . ARG F 6 28  ? 20.449  12.704  -10.280 1.00 30.62 ? 66   ARG P CB  1 
ATOM   5199 C  CG  . ARG F 6 28  ? 21.022  12.758  -11.688 1.00 33.00 ? 66   ARG P CG  1 
ATOM   5200 C  CD  . ARG F 6 28  ? 20.036  13.504  -12.593 1.00 37.94 ? 66   ARG P CD  1 
ATOM   5201 N  NE  . ARG F 6 28  ? 20.123  13.102  -14.000 1.00 42.12 ? 66   ARG P NE  1 
ATOM   5202 C  CZ  . ARG F 6 28  ? 21.012  13.583  -14.872 1.00 44.74 ? 66   ARG P CZ  1 
ATOM   5203 N  NH1 . ARG F 6 28  ? 21.914  14.495  -14.492 1.00 45.61 ? 66   ARG P NH1 1 
ATOM   5204 N  NH2 . ARG F 6 28  ? 21.006  13.150  -16.129 1.00 45.21 ? 66   ARG P NH2 1 
ATOM   5205 N  N   . CYS F 6 29  ? 21.187  10.068  -8.874  1.00 27.44 ? 67   CYS P N   1 
ATOM   5206 C  CA  . CYS F 6 29  ? 21.623  8.684   -8.822  1.00 26.56 ? 67   CYS P CA  1 
ATOM   5207 C  C   . CYS F 6 29  ? 22.046  8.240   -10.211 1.00 26.09 ? 67   CYS P C   1 
ATOM   5208 O  O   . CYS F 6 29  ? 21.405  8.595   -11.198 1.00 26.11 ? 67   CYS P O   1 
ATOM   5209 C  CB  . CYS F 6 29  ? 20.499  7.796   -8.292  1.00 26.87 ? 67   CYS P CB  1 
ATOM   5210 S  SG  . CYS F 6 29  ? 20.775  5.998   -8.371  1.00 26.44 ? 67   CYS P SG  1 
ATOM   5211 N  N   . ALA F 6 30  ? 23.134  7.475   -10.270 1.00 25.22 ? 68   ALA P N   1 
ATOM   5212 C  CA  . ALA F 6 30  ? 23.706  7.006   -11.518 1.00 24.59 ? 68   ALA P CA  1 
ATOM   5213 C  C   . ALA F 6 30  ? 22.800  5.979   -12.191 1.00 24.69 ? 68   ALA P C   1 
ATOM   5214 O  O   . ALA F 6 30  ? 22.744  5.901   -13.422 1.00 24.44 ? 68   ALA P O   1 
ATOM   5215 C  CB  . ALA F 6 30  ? 25.102  6.430   -11.278 1.00 24.29 ? 68   ALA P CB  1 
ATOM   5216 N  N   . LYS F 6 31  ? 22.091  5.192   -11.386 1.00 24.80 ? 69   LYS P N   1 
ATOM   5217 C  CA  . LYS F 6 31  ? 21.158  4.213   -11.926 1.00 25.28 ? 69   LYS P CA  1 
ATOM   5218 C  C   . LYS F 6 31  ? 19.810  4.866   -12.216 1.00 25.12 ? 69   LYS P C   1 
ATOM   5219 O  O   . LYS F 6 31  ? 19.034  5.154   -11.300 1.00 25.25 ? 69   LYS P O   1 
ATOM   5220 C  CB  . LYS F 6 31  ? 21.000  3.021   -10.974 1.00 25.57 ? 69   LYS P CB  1 
ATOM   5221 C  CG  . LYS F 6 31  ? 22.311  2.309   -10.606 1.00 27.27 ? 69   LYS P CG  1 
ATOM   5222 C  CD  . LYS F 6 31  ? 22.926  1.537   -11.779 1.00 29.41 ? 69   LYS P CD  1 
ATOM   5223 C  CE  . LYS F 6 31  ? 24.334  1.058   -11.421 1.00 30.48 ? 69   LYS P CE  1 
ATOM   5224 N  NZ  . LYS F 6 31  ? 25.147  0.671   -12.615 1.00 30.40 ? 69   LYS P NZ  1 
ATOM   5225 N  N   . ASP F 6 32  ? 19.541  5.093   -13.498 1.00 24.88 ? 70   ASP P N   1 
ATOM   5226 C  CA  . ASP F 6 32  ? 18.328  5.801   -13.953 1.00 24.82 ? 70   ASP P CA  1 
ATOM   5227 C  C   . ASP F 6 32  ? 16.987  5.446   -13.249 1.00 23.71 ? 70   ASP P C   1 
ATOM   5228 O  O   . ASP F 6 32  ? 16.274  6.336   -12.787 1.00 23.02 ? 70   ASP P O   1 
ATOM   5229 C  CB  . ASP F 6 32  ? 18.179  5.657   -15.476 1.00 25.19 ? 70   ASP P CB  1 
ATOM   5230 C  CG  . ASP F 6 32  ? 17.193  6.653   -16.061 1.00 27.70 ? 70   ASP P CG  1 
ATOM   5231 O  OD1 . ASP F 6 32  ? 17.411  7.882   -15.878 1.00 30.29 ? 70   ASP P OD1 1 
ATOM   5232 O  OD2 . ASP F 6 32  ? 16.205  6.207   -16.698 1.00 28.87 ? 70   ASP P OD2 1 
ATOM   5233 N  N   . PRO F 6 33  ? 16.636  4.147   -13.188 1.00 23.06 ? 71   PRO P N   1 
ATOM   5234 C  CA  . PRO F 6 33  ? 15.345  3.766   -12.621 1.00 22.40 ? 71   PRO P CA  1 
ATOM   5235 C  C   . PRO F 6 33  ? 15.223  4.018   -11.136 1.00 21.66 ? 71   PRO P C   1 
ATOM   5236 O  O   . PRO F 6 33  ? 14.129  3.921   -10.589 1.00 21.80 ? 71   PRO P O   1 
ATOM   5237 C  CB  . PRO F 6 33  ? 15.280  2.259   -12.875 1.00 22.32 ? 71   PRO P CB  1 
ATOM   5238 C  CG  . PRO F 6 33  ? 16.286  2.009   -13.922 1.00 22.81 ? 71   PRO P CG  1 
ATOM   5239 C  CD  . PRO F 6 33  ? 17.374  2.964   -13.661 1.00 22.86 ? 71   PRO P CD  1 
ATOM   5240 N  N   . TRP F 6 34  ? 16.330  4.338   -10.487 1.00 21.06 ? 72   TRP P N   1 
ATOM   5241 C  CA  . TRP F 6 34  ? 16.315  4.557   -9.052  1.00 20.60 ? 72   TRP P CA  1 
ATOM   5242 C  C   . TRP F 6 34  ? 16.165  6.028   -8.684  1.00 20.66 ? 72   TRP P C   1 
ATOM   5243 O  O   . TRP F 6 34  ? 15.962  6.381   -7.518  1.00 20.20 ? 72   TRP P O   1 
ATOM   5244 C  CB  . TRP F 6 34  ? 17.575  3.974   -8.427  1.00 20.39 ? 72   TRP P CB  1 
ATOM   5245 C  CG  . TRP F 6 34  ? 17.645  2.475   -8.482  1.00 19.76 ? 72   TRP P CG  1 
ATOM   5246 C  CD1 . TRP F 6 34  ? 16.691  1.613   -8.958  1.00 18.68 ? 72   TRP P CD1 1 
ATOM   5247 C  CD2 . TRP F 6 34  ? 18.714  1.664   -7.995  1.00 19.01 ? 72   TRP P CD2 1 
ATOM   5248 N  NE1 . TRP F 6 34  ? 17.114  0.317   -8.819  1.00 18.70 ? 72   TRP P NE1 1 
ATOM   5249 C  CE2 . TRP F 6 34  ? 18.356  0.315   -8.237  1.00 19.13 ? 72   TRP P CE2 1 
ATOM   5250 C  CE3 . TRP F 6 34  ? 19.952  1.947   -7.398  1.00 18.03 ? 72   TRP P CE3 1 
ATOM   5251 C  CZ2 . TRP F 6 34  ? 19.191  -0.753  -7.898  1.00 19.06 ? 72   TRP P CZ2 1 
ATOM   5252 C  CZ3 . TRP F 6 34  ? 20.775  0.896   -7.051  1.00 18.88 ? 72   TRP P CZ3 1 
ATOM   5253 C  CH2 . TRP F 6 34  ? 20.394  -0.445  -7.305  1.00 19.69 ? 72   TRP P CH2 1 
ATOM   5254 N  N   . ARG F 6 35  ? 16.274  6.880   -9.694  1.00 20.98 ? 73   ARG P N   1 
ATOM   5255 C  CA  . ARG F 6 35  ? 16.053  8.294   -9.531  1.00 21.86 ? 73   ARG P CA  1 
ATOM   5256 C  C   . ARG F 6 35  ? 14.620  8.588   -9.092  1.00 21.87 ? 73   ARG P C   1 
ATOM   5257 O  O   . ARG F 6 35  ? 13.665  7.997   -9.598  1.00 21.96 ? 73   ARG P O   1 
ATOM   5258 C  CB  . ARG F 6 35  ? 16.386  9.028   -10.817 1.00 21.72 ? 73   ARG P CB  1 
ATOM   5259 C  CG  . ARG F 6 35  ? 17.859  9.006   -11.115 1.00 24.18 ? 73   ARG P CG  1 
ATOM   5260 C  CD  . ARG F 6 35  ? 18.134  9.601   -12.462 1.00 28.84 ? 73   ARG P CD  1 
ATOM   5261 N  NE  . ARG F 6 35  ? 17.709  10.993  -12.517 1.00 34.04 ? 73   ARG P NE  1 
ATOM   5262 C  CZ  . ARG F 6 35  ? 17.321  11.630  -13.625 1.00 37.41 ? 73   ARG P CZ  1 
ATOM   5263 N  NH1 . ARG F 6 35  ? 16.956  12.911  -13.546 1.00 36.56 ? 73   ARG P NH1 1 
ATOM   5264 N  NH2 . ARG F 6 35  ? 17.305  10.997  -14.807 1.00 37.95 ? 73   ARG P NH2 1 
ATOM   5265 N  N   . LEU F 6 36  ? 14.491  9.489   -8.122  1.00 21.71 ? 74   LEU P N   1 
ATOM   5266 C  CA  . LEU F 6 36  ? 13.194  9.939   -7.659  1.00 21.16 ? 74   LEU P CA  1 
ATOM   5267 C  C   . LEU F 6 36  ? 13.035  11.450  -7.884  1.00 21.28 ? 74   LEU P C   1 
ATOM   5268 O  O   . LEU F 6 36  ? 12.950  12.209  -6.915  1.00 21.16 ? 74   LEU P O   1 
ATOM   5269 C  CB  . LEU F 6 36  ? 13.008  9.572   -6.179  1.00 21.01 ? 74   LEU P CB  1 
ATOM   5270 C  CG  . LEU F 6 36  ? 12.897  8.083   -5.821  1.00 19.66 ? 74   LEU P CG  1 
ATOM   5271 C  CD1 . LEU F 6 36  ? 12.760  7.930   -4.325  1.00 19.64 ? 74   LEU P CD1 1 
ATOM   5272 C  CD2 . LEU F 6 36  ? 11.733  7.419   -6.511  1.00 16.47 ? 74   LEU P CD2 1 
ATOM   5273 N  N   . PRO F 6 37  ? 12.986  11.895  -9.167  1.00 21.33 ? 75   PRO P N   1 
ATOM   5274 C  CA  . PRO F 6 37  ? 12.862  13.337  -9.445  1.00 21.16 ? 75   PRO P CA  1 
ATOM   5275 C  C   . PRO F 6 37  ? 11.700  14.002  -8.689  1.00 21.08 ? 75   PRO P C   1 
ATOM   5276 O  O   . PRO F 6 37  ? 10.674  13.361  -8.461  1.00 21.33 ? 75   PRO P O   1 
ATOM   5277 C  CB  . PRO F 6 37  ? 12.627  13.392  -10.967 1.00 20.89 ? 75   PRO P CB  1 
ATOM   5278 C  CG  . PRO F 6 37  ? 12.344  11.985  -11.397 1.00 20.55 ? 75   PRO P CG  1 
ATOM   5279 C  CD  . PRO F 6 37  ? 13.036  11.108  -10.417 1.00 21.14 ? 75   PRO P CD  1 
ATOM   5280 N  N   . GLY F 6 38  ? 11.875  15.260  -8.287  1.00 20.65 ? 76   GLY P N   1 
ATOM   5281 C  CA  . GLY F 6 38  ? 10.815  16.001  -7.639  1.00 20.24 ? 76   GLY P CA  1 
ATOM   5282 C  C   . GLY F 6 38  ? 10.996  16.154  -6.143  1.00 20.65 ? 76   GLY P C   1 
ATOM   5283 O  O   . GLY F 6 38  ? 10.233  16.883  -5.494  1.00 20.87 ? 76   GLY P O   1 
ATOM   5284 N  N   . THR F 6 39  ? 11.985  15.454  -5.581  1.00 20.53 ? 77   THR P N   1 
ATOM   5285 C  CA  . THR F 6 39  ? 12.341  15.609  -4.167  1.00 20.17 ? 77   THR P CA  1 
ATOM   5286 C  C   . THR F 6 39  ? 13.856  15.709  -4.061  1.00 20.18 ? 77   THR P C   1 
ATOM   5287 O  O   . THR F 6 39  ? 14.564  14.896  -4.655  1.00 20.33 ? 77   THR P O   1 
ATOM   5288 C  CB  . THR F 6 39  ? 11.846  14.437  -3.337  1.00 20.17 ? 77   THR P CB  1 
ATOM   5289 O  OG1 . THR F 6 39  ? 10.419  14.358  -3.435  1.00 20.84 ? 77   THR P OG1 1 
ATOM   5290 C  CG2 . THR F 6 39  ? 12.240  14.608  -1.882  1.00 20.02 ? 77   THR P CG2 1 
ATOM   5291 N  N   . TYR F 6 40  ? 14.353  16.708  -3.328  1.00 19.80 ? 78   TYR P N   1 
ATOM   5292 C  CA  . TYR F 6 40  ? 15.766  17.041  -3.374  1.00 19.71 ? 78   TYR P CA  1 
ATOM   5293 C  C   . TYR F 6 40  ? 16.346  17.294  -2.006  1.00 20.84 ? 78   TYR P C   1 
ATOM   5294 O  O   . TYR F 6 40  ? 15.691  17.869  -1.127  1.00 21.34 ? 78   TYR P O   1 
ATOM   5295 C  CB  . TYR F 6 40  ? 15.997  18.254  -4.273  1.00 18.93 ? 78   TYR P CB  1 
ATOM   5296 C  CG  . TYR F 6 40  ? 15.436  18.062  -5.648  1.00 17.36 ? 78   TYR P CG  1 
ATOM   5297 C  CD1 . TYR F 6 40  ? 16.201  17.484  -6.648  1.00 16.61 ? 78   TYR P CD1 1 
ATOM   5298 C  CD2 . TYR F 6 40  ? 14.126  18.430  -5.940  1.00 15.01 ? 78   TYR P CD2 1 
ATOM   5299 C  CE1 . TYR F 6 40  ? 15.680  17.276  -7.911  1.00 16.85 ? 78   TYR P CE1 1 
ATOM   5300 C  CE2 . TYR F 6 40  ? 13.593  18.232  -7.183  1.00 15.89 ? 78   TYR P CE2 1 
ATOM   5301 C  CZ  . TYR F 6 40  ? 14.370  17.644  -8.169  1.00 17.77 ? 78   TYR P CZ  1 
ATOM   5302 O  OH  . TYR F 6 40  ? 13.841  17.434  -9.428  1.00 19.09 ? 78   TYR P OH  1 
ATOM   5303 N  N   . VAL F 6 41  ? 17.582  16.853  -1.810  1.00 21.77 ? 79   VAL P N   1 
ATOM   5304 C  CA  . VAL F 6 41  ? 18.254  17.149  -0.561  1.00 22.86 ? 79   VAL P CA  1 
ATOM   5305 C  C   . VAL F 6 41  ? 19.185  18.329  -0.827  1.00 23.40 ? 79   VAL P C   1 
ATOM   5306 O  O   . VAL F 6 41  ? 20.168  18.204  -1.577  1.00 23.79 ? 79   VAL P O   1 
ATOM   5307 C  CB  . VAL F 6 41  ? 19.019  15.938  0.015   1.00 22.82 ? 79   VAL P CB  1 
ATOM   5308 C  CG1 . VAL F 6 41  ? 19.432  16.223  1.454   1.00 22.88 ? 79   VAL P CG1 1 
ATOM   5309 C  CG2 . VAL F 6 41  ? 18.172  14.680  -0.045  1.00 22.88 ? 79   VAL P CG2 1 
ATOM   5310 N  N   . VAL F 6 42  ? 18.833  19.482  -0.258  1.00 23.45 ? 80   VAL P N   1 
ATOM   5311 C  CA  . VAL F 6 42  ? 19.652  20.679  -0.374  1.00 23.60 ? 80   VAL P CA  1 
ATOM   5312 C  C   . VAL F 6 42  ? 20.653  20.645  0.777   1.00 24.24 ? 80   VAL P C   1 
ATOM   5313 O  O   . VAL F 6 42  ? 20.278  20.733  1.960   1.00 24.19 ? 80   VAL P O   1 
ATOM   5314 C  CB  . VAL F 6 42  ? 18.794  21.973  -0.356  1.00 23.32 ? 80   VAL P CB  1 
ATOM   5315 C  CG1 . VAL F 6 42  ? 19.676  23.215  -0.428  1.00 22.86 ? 80   VAL P CG1 1 
ATOM   5316 C  CG2 . VAL F 6 42  ? 17.794  21.981  -1.504  1.00 22.73 ? 80   VAL P CG2 1 
ATOM   5317 N  N   . VAL F 6 43  ? 21.923  20.487  0.429   1.00 24.84 ? 81   VAL P N   1 
ATOM   5318 C  CA  . VAL F 6 43  ? 22.963  20.300  1.436   1.00 25.92 ? 81   VAL P CA  1 
ATOM   5319 C  C   . VAL F 6 43  ? 23.824  21.539  1.464   1.00 27.11 ? 81   VAL P C   1 
ATOM   5320 O  O   . VAL F 6 43  ? 24.434  21.908  0.455   1.00 27.40 ? 81   VAL P O   1 
ATOM   5321 C  CB  . VAL F 6 43  ? 23.832  19.027  1.173   1.00 25.68 ? 81   VAL P CB  1 
ATOM   5322 C  CG1 . VAL F 6 43  ? 24.930  18.879  2.216   1.00 24.50 ? 81   VAL P CG1 1 
ATOM   5323 C  CG2 . VAL F 6 43  ? 22.965  17.787  1.160   1.00 25.05 ? 81   VAL P CG2 1 
ATOM   5324 N  N   . LEU F 6 44  ? 23.866  22.169  2.631   1.00 28.43 ? 82   LEU P N   1 
ATOM   5325 C  CA  . LEU F 6 44  ? 24.509  23.454  2.794   1.00 30.18 ? 82   LEU P CA  1 
ATOM   5326 C  C   . LEU F 6 44  ? 25.948  23.315  3.260   1.00 31.67 ? 82   LEU P C   1 
ATOM   5327 O  O   . LEU F 6 44  ? 26.363  22.252  3.720   1.00 31.87 ? 82   LEU P O   1 
ATOM   5328 C  CB  . LEU F 6 44  ? 23.711  24.325  3.769   1.00 29.94 ? 82   LEU P CB  1 
ATOM   5329 C  CG  . LEU F 6 44  ? 22.212  24.463  3.486   1.00 29.56 ? 82   LEU P CG  1 
ATOM   5330 C  CD1 . LEU F 6 44  ? 21.528  25.195  4.611   1.00 28.78 ? 82   LEU P CD1 1 
ATOM   5331 C  CD2 . LEU F 6 44  ? 21.937  25.137  2.143   1.00 29.25 ? 82   LEU P CD2 1 
ATOM   5332 N  N   . LYS F 6 45  ? 26.694  24.413  3.148   1.00 33.60 ? 83   LYS P N   1 
ATOM   5333 C  CA  . LYS F 6 45  ? 28.120  24.448  3.441   1.00 35.29 ? 83   LYS P CA  1 
ATOM   5334 C  C   . LYS F 6 45  ? 28.398  24.008  4.873   1.00 36.26 ? 83   LYS P C   1 
ATOM   5335 O  O   . LYS F 6 45  ? 27.534  24.106  5.738   1.00 36.56 ? 83   LYS P O   1 
ATOM   5336 C  CB  . LYS F 6 45  ? 28.678  25.843  3.143   1.00 35.38 ? 83   LYS P CB  1 
ATOM   5337 C  CG  . LYS F 6 45  ? 29.882  25.825  2.218   1.00 36.72 ? 83   LYS P CG  1 
ATOM   5338 C  CD  . LYS F 6 45  ? 29.721  26.790  1.044   1.00 38.66 ? 83   LYS P CD  1 
ATOM   5339 C  CE  . LYS F 6 45  ? 30.566  26.323  -0.146  1.00 39.93 ? 83   LYS P CE  1 
ATOM   5340 N  NZ  . LYS F 6 45  ? 30.296  27.079  -1.411  1.00 40.43 ? 83   LYS P NZ  1 
ATOM   5341 N  N   . GLU F 6 46  ? 29.616  23.527  5.101   1.00 37.98 ? 84   GLU P N   1 
ATOM   5342 C  CA  . GLU F 6 46  ? 29.984  22.737  6.292   1.00 39.44 ? 84   GLU P CA  1 
ATOM   5343 C  C   . GLU F 6 46  ? 29.475  23.225  7.644   1.00 39.67 ? 84   GLU P C   1 
ATOM   5344 O  O   . GLU F 6 46  ? 28.908  22.439  8.403   1.00 40.26 ? 84   GLU P O   1 
ATOM   5345 C  CB  . GLU F 6 46  ? 31.504  22.524  6.359   1.00 39.80 ? 84   GLU P CB  1 
ATOM   5346 C  CG  . GLU F 6 46  ? 31.934  21.044  6.376   1.00 43.15 ? 84   GLU P CG  1 
ATOM   5347 C  CD  . GLU F 6 46  ? 31.665  20.336  7.717   1.00 47.04 ? 84   GLU P CD  1 
ATOM   5348 O  OE1 . GLU F 6 46  ? 32.577  20.312  8.583   1.00 47.22 ? 84   GLU P OE1 1 
ATOM   5349 O  OE2 . GLU F 6 46  ? 30.550  19.782  7.891   1.00 48.82 ? 84   GLU P OE2 1 
ATOM   5350 N  N   . GLU F 6 47  ? 29.670  24.505  7.954   1.00 39.79 ? 85   GLU P N   1 
ATOM   5351 C  CA  . GLU F 6 47  ? 29.382  24.994  9.314   1.00 39.75 ? 85   GLU P CA  1 
ATOM   5352 C  C   . GLU F 6 47  ? 28.045  25.742  9.460   1.00 38.98 ? 85   GLU P C   1 
ATOM   5353 O  O   . GLU F 6 47  ? 27.809  26.413  10.472  1.00 38.98 ? 85   GLU P O   1 
ATOM   5354 C  CB  . GLU F 6 47  ? 30.549  25.848  9.844   1.00 40.23 ? 85   GLU P CB  1 
ATOM   5355 C  CG  . GLU F 6 47  ? 31.838  25.063  10.177  1.00 42.54 ? 85   GLU P CG  1 
ATOM   5356 C  CD  . GLU F 6 47  ? 31.771  24.301  11.512  1.00 46.66 ? 85   GLU P CD  1 
ATOM   5357 O  OE1 . GLU F 6 47  ? 32.130  23.092  11.530  1.00 46.98 ? 85   GLU P OE1 1 
ATOM   5358 O  OE2 . GLU F 6 47  ? 31.370  24.908  12.541  1.00 47.79 ? 85   GLU P OE2 1 
ATOM   5359 N  N   . THR F 6 48  ? 27.169  25.609  8.466   1.00 37.81 ? 86   THR P N   1 
ATOM   5360 C  CA  . THR F 6 48  ? 25.890  26.305  8.483   1.00 36.83 ? 86   THR P CA  1 
ATOM   5361 C  C   . THR F 6 48  ? 25.042  25.861  9.673   1.00 36.75 ? 86   THR P C   1 
ATOM   5362 O  O   . THR F 6 48  ? 24.850  24.667  9.885   1.00 36.84 ? 86   THR P O   1 
ATOM   5363 C  CB  . THR F 6 48  ? 25.122  26.070  7.185   1.00 36.58 ? 86   THR P CB  1 
ATOM   5364 O  OG1 . THR F 6 48  ? 25.965  26.380  6.071   1.00 35.81 ? 86   THR P OG1 1 
ATOM   5365 C  CG2 . THR F 6 48  ? 23.881  26.937  7.135   1.00 35.71 ? 86   THR P CG2 1 
ATOM   5366 N  N   . HIS F 6 49  ? 24.548  26.825  10.450  1.00 36.47 ? 87   HIS P N   1 
ATOM   5367 C  CA  . HIS F 6 49  ? 23.713  26.528  11.619  1.00 36.07 ? 87   HIS P CA  1 
ATOM   5368 C  C   . HIS F 6 49  ? 22.265  26.292  11.242  1.00 35.15 ? 87   HIS P C   1 
ATOM   5369 O  O   . HIS F 6 49  ? 21.831  26.674  10.158  1.00 34.83 ? 87   HIS P O   1 
ATOM   5370 C  CB  . HIS F 6 49  ? 23.784  27.647  12.663  1.00 36.71 ? 87   HIS P CB  1 
ATOM   5371 C  CG  . HIS F 6 49  ? 25.146  27.842  13.254  1.00 38.34 ? 87   HIS P CG  1 
ATOM   5372 N  ND1 . HIS F 6 49  ? 25.641  29.090  13.584  1.00 39.25 ? 87   HIS P ND1 1 
ATOM   5373 C  CD2 . HIS F 6 49  ? 26.120  26.952  13.568  1.00 38.50 ? 87   HIS P CD2 1 
ATOM   5374 C  CE1 . HIS F 6 49  ? 26.859  28.957  14.077  1.00 39.51 ? 87   HIS P CE1 1 
ATOM   5375 N  NE2 . HIS F 6 49  ? 27.172  27.672  14.078  1.00 39.90 ? 87   HIS P NE2 1 
ATOM   5376 N  N   . LEU F 6 50  ? 21.529  25.675  12.165  1.00 34.63 ? 88   LEU P N   1 
ATOM   5377 C  CA  . LEU F 6 50  ? 20.144  25.265  11.949  1.00 34.27 ? 88   LEU P CA  1 
ATOM   5378 C  C   . LEU F 6 50  ? 19.241  26.458  11.630  1.00 34.77 ? 88   LEU P C   1 
ATOM   5379 O  O   . LEU F 6 50  ? 18.279  26.334  10.868  1.00 34.95 ? 88   LEU P O   1 
ATOM   5380 C  CB  . LEU F 6 50  ? 19.614  24.488  13.159  1.00 33.77 ? 88   LEU P CB  1 
ATOM   5381 C  CG  . LEU F 6 50  ? 18.122  24.144  13.194  1.00 33.34 ? 88   LEU P CG  1 
ATOM   5382 C  CD1 . LEU F 6 50  ? 17.701  23.259  12.024  1.00 33.20 ? 88   LEU P CD1 1 
ATOM   5383 C  CD2 . LEU F 6 50  ? 17.755  23.493  14.509  1.00 33.62 ? 88   LEU P CD2 1 
ATOM   5384 N  N   . SER F 6 51  ? 19.560  27.615  12.200  1.00 34.80 ? 89   SER P N   1 
ATOM   5385 C  CA  . SER F 6 51  ? 18.766  28.800  11.950  1.00 34.89 ? 89   SER P CA  1 
ATOM   5386 C  C   . SER F 6 51  ? 19.044  29.329  10.547  1.00 34.58 ? 89   SER P C   1 
ATOM   5387 O  O   . SER F 6 51  ? 18.128  29.854  9.887   1.00 34.62 ? 89   SER P O   1 
ATOM   5388 C  CB  . SER F 6 51  ? 19.034  29.857  13.009  1.00 35.01 ? 89   SER P CB  1 
ATOM   5389 O  OG  . SER F 6 51  ? 20.427  30.031  13.164  1.00 36.63 ? 89   SER P OG  1 
ATOM   5390 N  N   . GLN F 6 52  ? 20.285  29.170  10.077  1.00 33.86 ? 90   GLN P N   1 
ATOM   5391 C  CA  . GLN F 6 52  ? 20.624  29.612  8.721   1.00 33.82 ? 90   GLN P CA  1 
ATOM   5392 C  C   . GLN F 6 52  ? 19.986  28.681  7.712   1.00 32.71 ? 90   GLN P C   1 
ATOM   5393 O  O   . GLN F 6 52  ? 19.682  29.098  6.590   1.00 32.68 ? 90   GLN P O   1 
ATOM   5394 C  CB  . GLN F 6 52  ? 22.130  29.674  8.468   1.00 33.74 ? 90   GLN P CB  1 
ATOM   5395 C  CG  . GLN F 6 52  ? 22.939  30.628  9.368   1.00 35.55 ? 90   GLN P CG  1 
ATOM   5396 C  CD  . GLN F 6 52  ? 24.409  30.167  9.553   1.00 35.74 ? 90   GLN P CD  1 
ATOM   5397 O  OE1 . GLN F 6 52  ? 24.817  29.797  10.661  1.00 37.15 ? 90   GLN P OE1 1 
ATOM   5398 N  NE2 . GLN F 6 52  ? 25.192  30.175  8.459   1.00 37.10 ? 90   GLN P NE2 1 
ATOM   5399 N  N   . SER F 6 53  ? 19.781  27.426  8.125   1.00 31.84 ? 91   SER P N   1 
ATOM   5400 C  CA  A SER F 6 53  ? 19.186  26.410  7.260   0.50 31.25 ? 91   SER P CA  1 
ATOM   5401 C  CA  B SER F 6 53  ? 19.193  26.416  7.256   0.50 31.27 ? 91   SER P CA  1 
ATOM   5402 C  C   . SER F 6 53  ? 17.713  26.700  7.037   1.00 30.90 ? 91   SER P C   1 
ATOM   5403 O  O   . SER F 6 53  ? 17.224  26.670  5.903   1.00 30.67 ? 91   SER P O   1 
ATOM   5404 C  CB  A SER F 6 53  ? 19.368  25.013  7.852   0.50 31.27 ? 91   SER P CB  1 
ATOM   5405 C  CB  B SER F 6 53  ? 19.400  25.019  7.841   0.50 31.29 ? 91   SER P CB  1 
ATOM   5406 O  OG  A SER F 6 53  ? 20.715  24.591  7.754   0.50 30.96 ? 91   SER P OG  1 
ATOM   5407 O  OG  B SER F 6 53  ? 19.268  24.030  6.838   0.50 31.08 ? 91   SER P OG  1 
ATOM   5408 N  N   . GLU F 6 54  ? 17.014  26.990  8.127   1.00 30.47 ? 92   GLU P N   1 
ATOM   5409 C  CA  . GLU F 6 54  ? 15.608  27.381  8.070   1.00 30.05 ? 92   GLU P CA  1 
ATOM   5410 C  C   . GLU F 6 54  ? 15.404  28.651  7.208   1.00 30.13 ? 92   GLU P C   1 
ATOM   5411 O  O   . GLU F 6 54  ? 14.488  28.706  6.386   1.00 29.59 ? 92   GLU P O   1 
ATOM   5412 C  CB  . GLU F 6 54  ? 15.038  27.528  9.489   1.00 29.84 ? 92   GLU P CB  1 
ATOM   5413 C  CG  . GLU F 6 54  ? 14.987  26.194  10.259  1.00 29.05 ? 92   GLU P CG  1 
ATOM   5414 C  CD  . GLU F 6 54  ? 14.216  26.254  11.587  1.00 29.30 ? 92   GLU P CD  1 
ATOM   5415 O  OE1 . GLU F 6 54  ? 13.337  27.137  11.754  1.00 26.68 ? 92   GLU P OE1 1 
ATOM   5416 O  OE2 . GLU F 6 54  ? 14.491  25.393  12.458  1.00 26.93 ? 92   GLU P OE2 1 
ATOM   5417 N  N   . ARG F 6 55  ? 16.286  29.639  7.373   1.00 30.57 ? 93   ARG P N   1 
ATOM   5418 C  CA  . ARG F 6 55  ? 16.261  30.856  6.552   1.00 31.32 ? 93   ARG P CA  1 
ATOM   5419 C  C   . ARG F 6 55  ? 16.402  30.558  5.060   1.00 30.27 ? 93   ARG P C   1 
ATOM   5420 O  O   . ARG F 6 55  ? 15.602  31.038  4.265   1.00 30.86 ? 93   ARG P O   1 
ATOM   5421 C  CB  . ARG F 6 55  ? 17.297  31.889  7.030   1.00 31.25 ? 93   ARG P CB  1 
ATOM   5422 C  CG  . ARG F 6 55  ? 16.668  33.089  7.759   1.00 33.19 ? 93   ARG P CG  1 
ATOM   5423 C  CD  . ARG F 6 55  ? 17.702  34.002  8.466   1.00 34.23 ? 93   ARG P CD  1 
ATOM   5424 N  NE  . ARG F 6 55  ? 17.767  33.778  9.926   1.00 39.49 ? 93   ARG P NE  1 
ATOM   5425 C  CZ  . ARG F 6 55  ? 18.845  33.351  10.605  1.00 41.32 ? 93   ARG P CZ  1 
ATOM   5426 N  NH1 . ARG F 6 55  ? 20.002  33.089  9.983   1.00 41.28 ? 93   ARG P NH1 1 
ATOM   5427 N  NH2 . ARG F 6 55  ? 18.771  33.185  11.926  1.00 41.10 ? 93   ARG P NH2 1 
ATOM   5428 N  N   . THR F 6 56  ? 17.392  29.751  4.691   1.00 29.35 ? 94   THR P N   1 
ATOM   5429 C  CA  . THR F 6 56  ? 17.602  29.337  3.297   1.00 28.40 ? 94   THR P CA  1 
ATOM   5430 C  C   . THR F 6 56  ? 16.367  28.654  2.701   1.00 27.65 ? 94   THR P C   1 
ATOM   5431 O  O   . THR F 6 56  ? 15.984  28.937  1.563   1.00 27.45 ? 94   THR P O   1 
ATOM   5432 C  CB  . THR F 6 56  ? 18.844  28.418  3.169   1.00 28.44 ? 94   THR P CB  1 
ATOM   5433 O  OG1 . THR F 6 56  ? 20.015  29.180  3.446   1.00 29.35 ? 94   THR P OG1 1 
ATOM   5434 C  CG2 . THR F 6 56  ? 18.995  27.859  1.769   1.00 28.84 ? 94   THR P CG2 1 
ATOM   5435 N  N   . ALA F 6 57  ? 15.750  27.755  3.470   1.00 26.93 ? 95   ALA P N   1 
ATOM   5436 C  CA  . ALA F 6 57  ? 14.563  27.036  3.013   1.00 25.87 ? 95   ALA P CA  1 
ATOM   5437 C  C   . ALA F 6 57  ? 13.422  28.027  2.821   1.00 25.29 ? 95   ALA P C   1 
ATOM   5438 O  O   . ALA F 6 57  ? 12.711  27.992  1.804   1.00 25.33 ? 95   ALA P O   1 
ATOM   5439 C  CB  . ALA F 6 57  ? 14.174  25.947  3.995   1.00 25.63 ? 95   ALA P CB  1 
ATOM   5440 N  N   . ARG F 6 58  ? 13.265  28.926  3.787   1.00 24.18 ? 96   ARG P N   1 
ATOM   5441 C  CA  . ARG F 6 58  ? 12.255  29.960  3.676   1.00 23.43 ? 96   ARG P CA  1 
ATOM   5442 C  C   . ARG F 6 58  ? 12.491  30.838  2.468   1.00 23.20 ? 96   ARG P C   1 
ATOM   5443 O  O   . ARG F 6 58  ? 11.560  31.159  1.728   1.00 22.69 ? 96   ARG P O   1 
ATOM   5444 C  CB  . ARG F 6 58  ? 12.149  30.763  4.959   1.00 23.05 ? 96   ARG P CB  1 
ATOM   5445 C  CG  . ARG F 6 58  ? 10.865  30.414  5.672   1.00 23.01 ? 96   ARG P CG  1 
ATOM   5446 C  CD  . ARG F 6 58  ? 10.983  30.342  7.191   1.00 22.74 ? 96   ARG P CD  1 
ATOM   5447 N  NE  . ARG F 6 58  ? 9.729   29.807  7.733   1.00 22.18 ? 96   ARG P NE  1 
ATOM   5448 C  CZ  . ARG F 6 58  ? 9.504   29.533  9.011   1.00 21.12 ? 96   ARG P CZ  1 
ATOM   5449 N  NH1 . ARG F 6 58  ? 10.453  29.731  9.923   1.00 20.64 ? 96   ARG P NH1 1 
ATOM   5450 N  NH2 . ARG F 6 58  ? 8.326   29.040  9.370   1.00 21.30 ? 96   ARG P NH2 1 
ATOM   5451 N  N   . ARG F 6 59  ? 13.748  31.183  2.235   1.00 23.40 ? 97   ARG P N   1 
ATOM   5452 C  CA  . ARG F 6 59  ? 14.094  31.943  1.048   1.00 23.71 ? 97   ARG P CA  1 
ATOM   5453 C  C   . ARG F 6 59  ? 13.683  31.186  -0.216  1.00 23.46 ? 97   ARG P C   1 
ATOM   5454 O  O   . ARG F 6 59  ? 13.096  31.782  -1.117  1.00 23.76 ? 97   ARG P O   1 
ATOM   5455 C  CB  . ARG F 6 59  ? 15.575  32.302  1.045   1.00 23.77 ? 97   ARG P CB  1 
ATOM   5456 C  CG  . ARG F 6 59  ? 15.989  33.299  -0.021  1.00 26.49 ? 97   ARG P CG  1 
ATOM   5457 C  CD  . ARG F 6 59  ? 17.111  34.168  0.530   1.00 33.11 ? 97   ARG P CD  1 
ATOM   5458 N  NE  . ARG F 6 59  ? 18.064  34.550  -0.505  1.00 37.94 ? 97   ARG P NE  1 
ATOM   5459 C  CZ  . ARG F 6 59  ? 18.084  35.731  -1.121  1.00 41.05 ? 97   ARG P CZ  1 
ATOM   5460 N  NH1 . ARG F 6 59  ? 17.198  36.677  -0.806  1.00 42.50 ? 97   ARG P NH1 1 
ATOM   5461 N  NH2 . ARG F 6 59  ? 18.997  35.968  -2.058  1.00 42.15 ? 97   ARG P NH2 1 
ATOM   5462 N  N   . LEU F 6 60  ? 13.955  29.883  -0.269  1.00 22.87 ? 98   LEU P N   1 
ATOM   5463 C  CA  . LEU F 6 60  ? 13.586  29.082  -1.427  1.00 23.00 ? 98   LEU P CA  1 
ATOM   5464 C  C   . LEU F 6 60  ? 12.096  29.157  -1.705  1.00 23.50 ? 98   LEU P C   1 
ATOM   5465 O  O   . LEU F 6 60  ? 11.667  29.352  -2.844  1.00 23.02 ? 98   LEU P O   1 
ATOM   5466 C  CB  . LEU F 6 60  ? 13.995  27.613  -1.241  1.00 22.80 ? 98   LEU P CB  1 
ATOM   5467 C  CG  . LEU F 6 60  ? 13.580  26.663  -2.374  1.00 21.77 ? 98   LEU P CG  1 
ATOM   5468 C  CD1 . LEU F 6 60  ? 14.060  27.136  -3.755  1.00 19.41 ? 98   LEU P CD1 1 
ATOM   5469 C  CD2 . LEU F 6 60  ? 14.062  25.235  -2.100  1.00 22.78 ? 98   LEU P CD2 1 
ATOM   5470 N  N   . GLN F 6 61  ? 11.337  28.985  -0.626  1.00 24.51 ? 99   GLN P N   1 
ATOM   5471 C  CA  . GLN F 6 61  ? 9.883   28.893  -0.621  1.00 25.35 ? 99   GLN P CA  1 
ATOM   5472 C  C   . GLN F 6 61  ? 9.257   30.159  -1.180  1.00 25.42 ? 99   GLN P C   1 
ATOM   5473 O  O   . GLN F 6 61  ? 8.384   30.080  -2.049  1.00 25.55 ? 99   GLN P O   1 
ATOM   5474 C  CB  . GLN F 6 61  ? 9.418   28.659  0.819   1.00 25.76 ? 99   GLN P CB  1 
ATOM   5475 C  CG  . GLN F 6 61  ? 8.102   27.931  0.995   1.00 27.77 ? 99   GLN P CG  1 
ATOM   5476 C  CD  . GLN F 6 61  ? 8.090   27.052  2.251   1.00 30.20 ? 99   GLN P CD  1 
ATOM   5477 O  OE1 . GLN F 6 61  ? 8.566   27.453  3.318   1.00 30.94 ? 99   GLN P OE1 1 
ATOM   5478 N  NE2 . GLN F 6 61  ? 7.543   25.846  2.121   1.00 30.99 ? 99   GLN P NE2 1 
ATOM   5479 N  N   . ALA F 6 62  ? 9.728   31.311  -0.681  1.00 25.72 ? 100  ALA P N   1 
ATOM   5480 C  CA  . ALA F 6 62  ? 9.231   32.653  -1.048  1.00 25.70 ? 100  ALA P CA  1 
ATOM   5481 C  C   . ALA F 6 62  ? 9.611   32.959  -2.477  1.00 25.95 ? 100  ALA P C   1 
ATOM   5482 O  O   . ALA F 6 62  ? 8.792   33.420  -3.278  1.00 26.09 ? 100  ALA P O   1 
ATOM   5483 C  CB  . ALA F 6 62  ? 9.826   33.703  -0.128  1.00 25.19 ? 100  ALA P CB  1 
ATOM   5484 N  N   . GLN F 6 63  ? 10.871  32.672  -2.779  1.00 26.02 ? 101  GLN P N   1 
ATOM   5485 C  CA  . GLN F 6 63  ? 11.439  32.838  -4.095  1.00 26.21 ? 101  GLN P CA  1 
ATOM   5486 C  C   . GLN F 6 63  ? 10.726  31.982  -5.135  1.00 26.05 ? 101  GLN P C   1 
ATOM   5487 O  O   . GLN F 6 63  ? 10.661  32.349  -6.296  1.00 26.29 ? 101  GLN P O   1 
ATOM   5488 C  CB  . GLN F 6 63  ? 12.912  32.460  -4.023  1.00 26.32 ? 101  GLN P CB  1 
ATOM   5489 C  CG  . GLN F 6 63  ? 13.839  33.288  -4.849  1.00 27.66 ? 101  GLN P CG  1 
ATOM   5490 C  CD  . GLN F 6 63  ? 15.248  33.190  -4.342  1.00 30.14 ? 101  GLN P CD  1 
ATOM   5491 O  OE1 . GLN F 6 63  ? 15.658  33.963  -3.478  1.00 32.18 ? 101  GLN P OE1 1 
ATOM   5492 N  NE2 . GLN F 6 63  ? 16.003  32.221  -4.859  1.00 30.80 ? 101  GLN P NE2 1 
ATOM   5493 N  N   . ALA F 6 64  ? 10.202  30.835  -4.722  1.00 26.34 ? 102  ALA P N   1 
ATOM   5494 C  CA  . ALA F 6 64  ? 9.482   29.951  -5.642  1.00 26.57 ? 102  ALA P CA  1 
ATOM   5495 C  C   . ALA F 6 64  ? 8.016   30.374  -5.831  1.00 26.72 ? 102  ALA P C   1 
ATOM   5496 O  O   . ALA F 6 64  ? 7.498   30.359  -6.962  1.00 26.59 ? 102  ALA P O   1 
ATOM   5497 C  CB  . ALA F 6 64  ? 9.577   28.508  -5.180  1.00 26.30 ? 102  ALA P CB  1 
ATOM   5498 N  N   . ALA F 6 65  ? 7.365   30.745  -4.720  1.00 26.66 ? 103  ALA P N   1 
ATOM   5499 C  CA  . ALA F 6 65  ? 6.007   31.295  -4.719  1.00 26.65 ? 103  ALA P CA  1 
ATOM   5500 C  C   . ALA F 6 65  ? 5.894   32.507  -5.645  1.00 27.06 ? 103  ALA P C   1 
ATOM   5501 O  O   . ALA F 6 65  ? 4.923   32.653  -6.380  1.00 26.70 ? 103  ALA P O   1 
ATOM   5502 C  CB  . ALA F 6 65  ? 5.605   31.667  -3.310  1.00 26.32 ? 103  ALA P CB  1 
ATOM   5503 N  N   . ARG F 6 66  ? 6.918   33.356  -5.608  1.00 27.91 ? 104  ARG P N   1 
ATOM   5504 C  CA  . ARG F 6 66  ? 7.043   34.532  -6.463  1.00 29.20 ? 104  ARG P CA  1 
ATOM   5505 C  C   . ARG F 6 66  ? 6.935   34.172  -7.954  1.00 28.74 ? 104  ARG P C   1 
ATOM   5506 O  O   . ARG F 6 66  ? 6.716   35.048  -8.807  1.00 29.15 ? 104  ARG P O   1 
ATOM   5507 C  CB  . ARG F 6 66  ? 8.383   35.204  -6.162  1.00 28.96 ? 104  ARG P CB  1 
ATOM   5508 C  CG  . ARG F 6 66  ? 8.702   36.448  -6.967  1.00 31.06 ? 104  ARG P CG  1 
ATOM   5509 C  CD  . ARG F 6 66  ? 10.129  36.944  -6.673  1.00 32.42 ? 104  ARG P CD  1 
ATOM   5510 N  NE  . ARG F 6 66  ? 10.496  38.117  -7.478  1.00 39.68 ? 104  ARG P NE  1 
ATOM   5511 C  CZ  . ARG F 6 66  ? 10.188  39.386  -7.175  1.00 42.96 ? 104  ARG P CZ  1 
ATOM   5512 N  NH1 . ARG F 6 66  ? 9.487   39.681  -6.072  1.00 43.01 ? 104  ARG P NH1 1 
ATOM   5513 N  NH2 . ARG F 6 66  ? 10.572  40.371  -7.992  1.00 44.37 ? 104  ARG P NH2 1 
ATOM   5514 N  N   . ARG F 6 67  ? 7.079   32.886  -8.261  1.00 27.93 ? 105  ARG P N   1 
ATOM   5515 C  CA  . ARG F 6 67  ? 7.055   32.432  -9.638  1.00 27.29 ? 105  ARG P CA  1 
ATOM   5516 C  C   . ARG F 6 67  ? 5.873   31.507  -9.920  1.00 26.51 ? 105  ARG P C   1 
ATOM   5517 O  O   . ARG F 6 67  ? 5.643   31.121  -11.065 1.00 26.22 ? 105  ARG P O   1 
ATOM   5518 C  CB  . ARG F 6 67  ? 8.377   31.746  -9.990  1.00 27.61 ? 105  ARG P CB  1 
ATOM   5519 C  CG  . ARG F 6 67  ? 9.585   32.652  -9.942  1.00 28.01 ? 105  ARG P CG  1 
ATOM   5520 C  CD  . ARG F 6 67  ? 10.844  31.839  -9.756  1.00 29.67 ? 105  ARG P CD  1 
ATOM   5521 N  NE  . ARG F 6 67  ? 12.057  32.587  -10.077 1.00 31.70 ? 105  ARG P NE  1 
ATOM   5522 C  CZ  . ARG F 6 67  ? 12.600  33.533  -9.309  1.00 34.18 ? 105  ARG P CZ  1 
ATOM   5523 N  NH1 . ARG F 6 67  ? 12.048  33.897  -8.146  1.00 33.10 ? 105  ARG P NH1 1 
ATOM   5524 N  NH2 . ARG F 6 67  ? 13.716  34.128  -9.716  1.00 35.34 ? 105  ARG P NH2 1 
ATOM   5525 N  N   . GLY F 6 68  ? 5.126   31.155  -8.881  1.00 25.70 ? 106  GLY P N   1 
ATOM   5526 C  CA  . GLY F 6 68  ? 3.934   30.329  -9.050  1.00 24.89 ? 106  GLY P CA  1 
ATOM   5527 C  C   . GLY F 6 68  ? 4.145   28.856  -8.755  1.00 24.49 ? 106  GLY P C   1 
ATOM   5528 O  O   . GLY F 6 68  ? 3.297   28.022  -9.063  1.00 23.89 ? 106  GLY P O   1 
ATOM   5529 N  N   . TYR F 6 69  ? 5.282   28.543  -8.145  1.00 24.44 ? 107  TYR P N   1 
ATOM   5530 C  CA  . TYR F 6 69  ? 5.619   27.174  -7.766  1.00 24.54 ? 107  TYR P CA  1 
ATOM   5531 C  C   . TYR F 6 69  ? 5.422   26.917  -6.256  1.00 24.70 ? 107  TYR P C   1 
ATOM   5532 O  O   . TYR F 6 69  ? 5.836   27.713  -5.414  1.00 24.21 ? 107  TYR P O   1 
ATOM   5533 C  CB  . TYR F 6 69  ? 7.069   26.867  -8.158  1.00 24.24 ? 107  TYR P CB  1 
ATOM   5534 C  CG  . TYR F 6 69  ? 7.359   26.778  -9.645  1.00 23.81 ? 107  TYR P CG  1 
ATOM   5535 C  CD1 . TYR F 6 69  ? 7.428   25.533  -10.282 1.00 25.18 ? 107  TYR P CD1 1 
ATOM   5536 C  CD2 . TYR F 6 69  ? 7.605   27.920  -10.410 1.00 22.87 ? 107  TYR P CD2 1 
ATOM   5537 C  CE1 . TYR F 6 69  ? 7.709   25.422  -11.652 1.00 24.68 ? 107  TYR P CE1 1 
ATOM   5538 C  CE2 . TYR F 6 69  ? 7.882   27.826  -11.786 1.00 23.13 ? 107  TYR P CE2 1 
ATOM   5539 C  CZ  . TYR F 6 69  ? 7.934   26.570  -12.395 1.00 24.16 ? 107  TYR P CZ  1 
ATOM   5540 O  OH  . TYR F 6 69  ? 8.219   26.440  -13.735 1.00 23.43 ? 107  TYR P OH  1 
ATOM   5541 N  N   . LEU F 6 70  ? 4.780   25.799  -5.923  1.00 25.32 ? 108  LEU P N   1 
ATOM   5542 C  CA  . LEU F 6 70  ? 4.752   25.327  -4.546  1.00 25.43 ? 108  LEU P CA  1 
ATOM   5543 C  C   . LEU F 6 70  ? 6.038   24.574  -4.279  1.00 25.33 ? 108  LEU P C   1 
ATOM   5544 O  O   . LEU F 6 70  ? 6.522   23.824  -5.123  1.00 25.45 ? 108  LEU P O   1 
ATOM   5545 C  CB  . LEU F 6 70  ? 3.539   24.429  -4.274  1.00 25.53 ? 108  LEU P CB  1 
ATOM   5546 C  CG  . LEU F 6 70  ? 3.410   23.780  -2.874  1.00 26.04 ? 108  LEU P CG  1 
ATOM   5547 C  CD1 . LEU F 6 70  ? 3.582   24.760  -1.722  1.00 26.90 ? 108  LEU P CD1 1 
ATOM   5548 C  CD2 . LEU F 6 70  ? 2.083   23.051  -2.719  1.00 25.74 ? 108  LEU P CD2 1 
ATOM   5549 N  N   . THR F 6 71  ? 6.618   24.830  -3.119  1.00 25.42 ? 109  THR P N   1 
ATOM   5550 C  CA  . THR F 6 71  ? 7.693   24.010  -2.605  1.00 25.37 ? 109  THR P CA  1 
ATOM   5551 C  C   . THR F 6 71  ? 7.196   23.520  -1.270  1.00 25.76 ? 109  THR P C   1 
ATOM   5552 O  O   . THR F 6 71  ? 6.597   24.287  -0.509  1.00 26.12 ? 109  THR P O   1 
ATOM   5553 C  CB  . THR F 6 71  ? 8.995   24.794  -2.385  1.00 25.20 ? 109  THR P CB  1 
ATOM   5554 O  OG1 . THR F 6 71  ? 8.809   25.753  -1.331  1.00 24.13 ? 109  THR P OG1 1 
ATOM   5555 C  CG2 . THR F 6 71  ? 9.437   25.464  -3.670  1.00 23.97 ? 109  THR P CG2 1 
ATOM   5556 N  N   . LYS F 6 72  ? 7.414   22.245  -0.986  1.00 25.60 ? 110  LYS P N   1 
ATOM   5557 C  CA  . LYS F 6 72  ? 7.053   21.738  0.313   1.00 25.82 ? 110  LYS P CA  1 
ATOM   5558 C  C   . LYS F 6 72  ? 8.354   21.402  1.009   1.00 25.05 ? 110  LYS P C   1 
ATOM   5559 O  O   . LYS F 6 72  ? 9.164   20.653  0.471   1.00 25.23 ? 110  LYS P O   1 
ATOM   5560 C  CB  . LYS F 6 72  ? 6.145   20.523  0.176   1.00 25.50 ? 110  LYS P CB  1 
ATOM   5561 C  CG  . LYS F 6 72  ? 4.933   20.530  1.115   1.00 27.48 ? 110  LYS P CG  1 
ATOM   5562 C  CD  . LYS F 6 72  ? 3.999   19.321  0.854   1.00 27.87 ? 110  LYS P CD  1 
ATOM   5563 C  CE  . LYS F 6 72  ? 3.294   19.430  -0.526  1.00 31.31 ? 110  LYS P CE  1 
ATOM   5564 N  NZ  . LYS F 6 72  ? 3.209   18.128  -1.285  1.00 33.05 ? 110  LYS P NZ  1 
ATOM   5565 N  N   . ILE F 6 73  ? 8.578   22.004  2.173   1.00 24.56 ? 111  ILE P N   1 
ATOM   5566 C  CA  . ILE F 6 73  ? 9.723   21.658  2.998   1.00 24.21 ? 111  ILE P CA  1 
ATOM   5567 C  C   . ILE F 6 73  ? 9.348   20.488  3.909   1.00 24.16 ? 111  ILE P C   1 
ATOM   5568 O  O   . ILE F 6 73  ? 8.692   20.658  4.934   1.00 24.12 ? 111  ILE P O   1 
ATOM   5569 C  CB  . ILE F 6 73  ? 10.255  22.844  3.842   1.00 24.00 ? 111  ILE P CB  1 
ATOM   5570 C  CG1 . ILE F 6 73  ? 10.319  24.147  3.026   1.00 24.40 ? 111  ILE P CG1 1 
ATOM   5571 C  CG2 . ILE F 6 73  ? 11.616  22.480  4.466   1.00 23.65 ? 111  ILE P CG2 1 
ATOM   5572 C  CD1 . ILE F 6 73  ? 11.205  24.123  1.762   1.00 24.38 ? 111  ILE P CD1 1 
ATOM   5573 N  N   . LEU F 6 74  ? 9.776   19.293  3.521   1.00 24.18 ? 112  LEU P N   1 
ATOM   5574 C  CA  . LEU F 6 74  ? 9.448   18.089  4.264   1.00 24.04 ? 112  LEU P CA  1 
ATOM   5575 C  C   . LEU F 6 74  ? 10.201  17.985  5.582   1.00 23.82 ? 112  LEU P C   1 
ATOM   5576 O  O   . LEU F 6 74  ? 9.652   17.519  6.567   1.00 24.01 ? 112  LEU P O   1 
ATOM   5577 C  CB  . LEU F 6 74  ? 9.688   16.855  3.407   1.00 24.00 ? 112  LEU P CB  1 
ATOM   5578 C  CG  . LEU F 6 74  ? 8.874   16.771  2.110   1.00 24.56 ? 112  LEU P CG  1 
ATOM   5579 C  CD1 . LEU F 6 74  ? 9.343   15.572  1.302   1.00 24.55 ? 112  LEU P CD1 1 
ATOM   5580 C  CD2 . LEU F 6 74  ? 7.350   16.720  2.348   1.00 24.16 ? 112  LEU P CD2 1 
ATOM   5581 N  N   . HIS F 6 75  ? 11.439  18.459  5.614   1.00 23.54 ? 113  HIS P N   1 
ATOM   5582 C  CA  . HIS F 6 75  ? 12.275  18.259  6.781   1.00 23.44 ? 113  HIS P CA  1 
ATOM   5583 C  C   . HIS F 6 75  ? 13.503  19.142  6.755   1.00 23.90 ? 113  HIS P C   1 
ATOM   5584 O  O   . HIS F 6 75  ? 14.152  19.285  5.721   1.00 23.44 ? 113  HIS P O   1 
ATOM   5585 C  CB  . HIS F 6 75  ? 12.722  16.799  6.840   1.00 23.13 ? 113  HIS P CB  1 
ATOM   5586 C  CG  . HIS F 6 75  ? 13.499  16.458  8.070   1.00 22.11 ? 113  HIS P CG  1 
ATOM   5587 N  ND1 . HIS F 6 75  ? 12.893  16.177  9.277   1.00 20.56 ? 113  HIS P ND1 1 
ATOM   5588 C  CD2 . HIS F 6 75  ? 14.831  16.354  8.281   1.00 20.79 ? 113  HIS P CD2 1 
ATOM   5589 C  CE1 . HIS F 6 75  ? 13.822  15.910  10.177  1.00 19.84 ? 113  HIS P CE1 1 
ATOM   5590 N  NE2 . HIS F 6 75  ? 15.005  16.011  9.600   1.00 19.87 ? 113  HIS P NE2 1 
ATOM   5591 N  N   . VAL F 6 76  ? 13.833  19.721  7.900   1.00 24.81 ? 114  VAL P N   1 
ATOM   5592 C  CA  . VAL F 6 76  ? 15.084  20.457  8.007   1.00 26.13 ? 114  VAL P CA  1 
ATOM   5593 C  C   . VAL F 6 76  ? 16.070  19.625  8.808   1.00 27.26 ? 114  VAL P C   1 
ATOM   5594 O  O   . VAL F 6 76  ? 15.793  19.229  9.944   1.00 27.14 ? 114  VAL P O   1 
ATOM   5595 C  CB  . VAL F 6 76  ? 14.899  21.874  8.607   1.00 26.05 ? 114  VAL P CB  1 
ATOM   5596 C  CG1 . VAL F 6 76  ? 16.219  22.642  8.582   1.00 24.96 ? 114  VAL P CG1 1 
ATOM   5597 C  CG2 . VAL F 6 76  ? 13.810  22.647  7.843   1.00 25.80 ? 114  VAL P CG2 1 
ATOM   5598 N  N   . PHE F 6 77  ? 17.210  19.336  8.190   1.00 28.95 ? 115  PHE P N   1 
ATOM   5599 C  CA  . PHE F 6 77  ? 18.235  18.528  8.834   1.00 30.83 ? 115  PHE P CA  1 
ATOM   5600 C  C   . PHE F 6 77  ? 18.975  19.311  9.897   1.00 32.40 ? 115  PHE P C   1 
ATOM   5601 O  O   . PHE F 6 77  ? 19.653  20.315  9.612   1.00 32.17 ? 115  PHE P O   1 
ATOM   5602 C  CB  . PHE F 6 77  ? 19.213  17.942  7.822   1.00 30.53 ? 115  PHE P CB  1 
ATOM   5603 C  CG  . PHE F 6 77  ? 18.596  16.928  6.928   1.00 30.38 ? 115  PHE P CG  1 
ATOM   5604 C  CD1 . PHE F 6 77  ? 18.410  15.620  7.371   1.00 29.09 ? 115  PHE P CD1 1 
ATOM   5605 C  CD2 . PHE F 6 77  ? 18.179  17.283  5.642   1.00 29.72 ? 115  PHE P CD2 1 
ATOM   5606 C  CE1 . PHE F 6 77  ? 17.821  14.680  6.547   1.00 29.45 ? 115  PHE P CE1 1 
ATOM   5607 C  CE2 . PHE F 6 77  ? 17.588  16.352  4.807   1.00 29.14 ? 115  PHE P CE2 1 
ATOM   5608 C  CZ  . PHE F 6 77  ? 17.409  15.046  5.257   1.00 30.36 ? 115  PHE P CZ  1 
ATOM   5609 N  N   . HIS F 6 78  ? 18.797  18.845  11.131  1.00 34.38 ? 116  HIS P N   1 
ATOM   5610 C  CA  . HIS F 6 78  ? 19.519  19.371  12.267  1.00 36.20 ? 116  HIS P CA  1 
ATOM   5611 C  C   . HIS F 6 78  ? 20.893  18.668  12.409  1.00 36.32 ? 116  HIS P C   1 
ATOM   5612 O  O   . HIS F 6 78  ? 21.824  18.958  11.636  1.00 36.55 ? 116  HIS P O   1 
ATOM   5613 C  CB  . HIS F 6 78  ? 18.669  19.298  13.546  1.00 36.48 ? 116  HIS P CB  1 
ATOM   5614 C  CG  . HIS F 6 78  ? 19.414  19.709  14.776  1.00 41.00 ? 116  HIS P CG  1 
ATOM   5615 N  ND1 . HIS F 6 78  ? 19.097  19.239  16.036  1.00 45.79 ? 116  HIS P ND1 1 
ATOM   5616 C  CD2 . HIS F 6 78  ? 20.486  20.527  14.939  1.00 44.24 ? 116  HIS P CD2 1 
ATOM   5617 C  CE1 . HIS F 6 78  ? 19.927  19.765  16.925  1.00 46.88 ? 116  HIS P CE1 1 
ATOM   5618 N  NE2 . HIS F 6 78  ? 20.782  20.547  16.284  1.00 47.32 ? 116  HIS P NE2 1 
ATOM   5619 N  N   . GLY F 6 79  ? 21.013  17.736  13.354  1.00 35.97 ? 117  GLY P N   1 
ATOM   5620 C  CA  . GLY F 6 79  ? 22.328  17.372  13.886  1.00 35.89 ? 117  GLY P CA  1 
ATOM   5621 C  C   . GLY F 6 79  ? 23.224  16.428  13.098  1.00 35.77 ? 117  GLY P C   1 
ATOM   5622 O  O   . GLY F 6 79  ? 24.222  15.939  13.637  1.00 35.93 ? 117  GLY P O   1 
ATOM   5623 N  N   . LEU F 6 80  ? 22.898  16.172  11.832  1.00 35.37 ? 118  LEU P N   1 
ATOM   5624 C  CA  . LEU F 6 80  ? 23.657  15.191  11.067  1.00 34.77 ? 118  LEU P CA  1 
ATOM   5625 C  C   . LEU F 6 80  ? 24.355  15.754  9.833   1.00 34.27 ? 118  LEU P C   1 
ATOM   5626 O  O   . LEU F 6 80  ? 25.417  15.281  9.441   1.00 34.33 ? 118  LEU P O   1 
ATOM   5627 C  CB  . LEU F 6 80  ? 22.764  14.012  10.695  1.00 35.06 ? 118  LEU P CB  1 
ATOM   5628 C  CG  . LEU F 6 80  ? 23.487  12.658  10.621  1.00 34.98 ? 118  LEU P CG  1 
ATOM   5629 C  CD1 . LEU F 6 80  ? 24.247  12.300  11.922  1.00 34.09 ? 118  LEU P CD1 1 
ATOM   5630 C  CD2 . LEU F 6 80  ? 22.469  11.590  10.263  1.00 34.77 ? 118  LEU P CD2 1 
ATOM   5631 N  N   . LEU F 6 81  ? 23.717  16.725  9.197   1.00 33.50 ? 119  LEU P N   1 
ATOM   5632 C  CA  . LEU F 6 81  ? 24.362  17.594  8.214   1.00 32.59 ? 119  LEU P CA  1 
ATOM   5633 C  C   . LEU F 6 81  ? 23.500  18.845  8.074   1.00 31.64 ? 119  LEU P C   1 
ATOM   5634 O  O   . LEU F 6 81  ? 22.315  18.823  8.439   1.00 31.55 ? 119  LEU P O   1 
ATOM   5635 C  CB  . LEU F 6 81  ? 24.562  16.894  6.870   1.00 32.56 ? 119  LEU P CB  1 
ATOM   5636 C  CG  . LEU F 6 81  ? 23.482  15.921  6.400   1.00 34.16 ? 119  LEU P CG  1 
ATOM   5637 C  CD1 . LEU F 6 81  ? 22.247  16.622  5.810   1.00 35.16 ? 119  LEU P CD1 1 
ATOM   5638 C  CD2 . LEU F 6 81  ? 24.111  14.991  5.390   1.00 34.95 ? 119  LEU P CD2 1 
ATOM   5639 N  N   . PRO F 6 82  ? 24.086  19.952  7.579   1.00 30.62 ? 120  PRO P N   1 
ATOM   5640 C  CA  . PRO F 6 82  ? 23.191  21.081  7.411   1.00 29.50 ? 120  PRO P CA  1 
ATOM   5641 C  C   . PRO F 6 82  ? 22.518  20.988  6.046   1.00 28.29 ? 120  PRO P C   1 
ATOM   5642 O  O   . PRO F 6 82  ? 23.182  20.728  5.039   1.00 28.14 ? 120  PRO P O   1 
ATOM   5643 C  CB  . PRO F 6 82  ? 24.128  22.296  7.508   1.00 29.66 ? 120  PRO P CB  1 
ATOM   5644 C  CG  . PRO F 6 82  ? 25.541  21.764  7.213   1.00 30.03 ? 120  PRO P CG  1 
ATOM   5645 C  CD  . PRO F 6 82  ? 25.468  20.259  7.148   1.00 30.64 ? 120  PRO P CD  1 
ATOM   5646 N  N   . GLY F 6 83  ? 21.205  21.166  6.025   1.00 26.92 ? 121  GLY P N   1 
ATOM   5647 C  CA  . GLY F 6 83  ? 20.472  21.212  4.774   1.00 25.27 ? 121  GLY P CA  1 
ATOM   5648 C  C   . GLY F 6 83  ? 19.003  20.996  5.033   1.00 24.48 ? 121  GLY P C   1 
ATOM   5649 O  O   . GLY F 6 83  ? 18.548  21.025  6.178   1.00 24.42 ? 121  GLY P O   1 
ATOM   5650 N  N   . PHE F 6 84  ? 18.243  20.770  3.975   1.00 23.41 ? 122  PHE P N   1 
ATOM   5651 C  CA  . PHE F 6 84  ? 16.830  20.509  4.165   1.00 22.50 ? 122  PHE P CA  1 
ATOM   5652 C  C   . PHE F 6 84  ? 16.291  19.639  3.031   1.00 22.15 ? 122  PHE P C   1 
ATOM   5653 O  O   . PHE F 6 84  ? 16.997  19.403  2.053   1.00 22.66 ? 122  PHE P O   1 
ATOM   5654 C  CB  . PHE F 6 84  ? 16.053  21.826  4.314   1.00 22.01 ? 122  PHE P CB  1 
ATOM   5655 C  CG  . PHE F 6 84  ? 16.214  22.760  3.153   1.00 20.38 ? 122  PHE P CG  1 
ATOM   5656 C  CD1 . PHE F 6 84  ? 17.140  23.789  3.202   1.00 19.14 ? 122  PHE P CD1 1 
ATOM   5657 C  CD2 . PHE F 6 84  ? 15.433  22.611  2.010   1.00 19.37 ? 122  PHE P CD2 1 
ATOM   5658 C  CE1 . PHE F 6 84  ? 17.293  24.664  2.119   1.00 19.54 ? 122  PHE P CE1 1 
ATOM   5659 C  CE2 . PHE F 6 84  ? 15.571  23.474  0.926   1.00 19.49 ? 122  PHE P CE2 1 
ATOM   5660 C  CZ  . PHE F 6 84  ? 16.507  24.505  0.982   1.00 20.17 ? 122  PHE P CZ  1 
ATOM   5661 N  N   . LEU F 6 85  ? 15.059  19.156  3.180   1.00 21.23 ? 123  LEU P N   1 
ATOM   5662 C  CA  . LEU F 6 85  ? 14.453  18.266  2.217   1.00 20.65 ? 123  LEU P CA  1 
ATOM   5663 C  C   . LEU F 6 85  ? 13.228  18.925  1.627   1.00 20.60 ? 123  LEU P C   1 
ATOM   5664 O  O   . LEU F 6 85  ? 12.310  19.311  2.354   1.00 20.63 ? 123  LEU P O   1 
ATOM   5665 C  CB  . LEU F 6 85  ? 14.055  16.948  2.886   1.00 20.81 ? 123  LEU P CB  1 
ATOM   5666 C  CG  . LEU F 6 85  ? 13.376  15.904  1.987   1.00 20.42 ? 123  LEU P CG  1 
ATOM   5667 C  CD1 . LEU F 6 85  ? 14.375  15.291  1.015   1.00 19.82 ? 123  LEU P CD1 1 
ATOM   5668 C  CD2 . LEU F 6 85  ? 12.703  14.841  2.818   1.00 19.20 ? 123  LEU P CD2 1 
ATOM   5669 N  N   . VAL F 6 86  ? 13.200  19.022  0.304   1.00 20.08 ? 124  VAL P N   1 
ATOM   5670 C  CA  . VAL F 6 86  ? 12.194  19.824  -0.361  1.00 19.73 ? 124  VAL P CA  1 
ATOM   5671 C  C   . VAL F 6 86  ? 11.553  19.056  -1.494  1.00 20.06 ? 124  VAL P C   1 
ATOM   5672 O  O   . VAL F 6 86  ? 12.246  18.389  -2.265  1.00 19.77 ? 124  VAL P O   1 
ATOM   5673 C  CB  . VAL F 6 86  ? 12.777  21.194  -0.863  1.00 19.50 ? 124  VAL P CB  1 
ATOM   5674 C  CG1 . VAL F 6 86  ? 14.082  20.997  -1.645  1.00 18.73 ? 124  VAL P CG1 1 
ATOM   5675 C  CG2 . VAL F 6 86  ? 11.749  21.968  -1.682  1.00 18.63 ? 124  VAL P CG2 1 
ATOM   5676 N  N   . LYS F 6 87  ? 10.228  19.158  -1.585  1.00 20.52 ? 125  LYS P N   1 
ATOM   5677 C  CA  . LYS F 6 87  ? 9.485   18.594  -2.706  1.00 21.36 ? 125  LYS P CA  1 
ATOM   5678 C  C   . LYS F 6 87  ? 9.059   19.721  -3.634  1.00 21.48 ? 125  LYS P C   1 
ATOM   5679 O  O   . LYS F 6 87  ? 8.226   20.565  -3.259  1.00 22.03 ? 125  LYS P O   1 
ATOM   5680 C  CB  . LYS F 6 87  ? 8.271   17.792  -2.224  1.00 21.44 ? 125  LYS P CB  1 
ATOM   5681 C  CG  . LYS F 6 87  ? 7.454   17.201  -3.360  1.00 23.65 ? 125  LYS P CG  1 
ATOM   5682 C  CD  . LYS F 6 87  ? 6.439   16.171  -2.876  1.00 26.67 ? 125  LYS P CD  1 
ATOM   5683 C  CE  . LYS F 6 87  ? 5.246   16.094  -3.842  1.00 28.13 ? 125  LYS P CE  1 
ATOM   5684 N  NZ  . LYS F 6 87  ? 4.080   15.359  -3.259  1.00 30.19 ? 125  LYS P NZ  1 
ATOM   5685 N  N   . MET F 6 88  ? 9.638   19.736  -4.835  1.00 21.17 ? 126  MET P N   1 
ATOM   5686 C  CA  . MET F 6 88  ? 9.407   20.810  -5.788  1.00 21.46 ? 126  MET P CA  1 
ATOM   5687 C  C   . MET F 6 88  ? 9.647   20.353  -7.220  1.00 21.54 ? 126  MET P C   1 
ATOM   5688 O  O   . MET F 6 88  ? 10.325  19.359  -7.444  1.00 21.72 ? 126  MET P O   1 
ATOM   5689 C  CB  . MET F 6 88  ? 10.332  21.992  -5.462  1.00 21.59 ? 126  MET P CB  1 
ATOM   5690 C  CG  . MET F 6 88  ? 11.683  21.969  -6.157  1.00 20.47 ? 126  MET P CG  1 
ATOM   5691 S  SD  . MET F 6 88  ? 12.861  22.880  -5.186  1.00 22.59 ? 126  MET P SD  1 
ATOM   5692 C  CE  . MET F 6 88  ? 14.342  22.612  -6.149  1.00 21.08 ? 126  MET P CE  1 
ATOM   5693 N  N   . SER F 6 89  ? 9.115   21.097  -8.186  1.00 21.77 ? 127  SER P N   1 
ATOM   5694 C  CA  . SER F 6 89  ? 9.407   20.847  -9.590  1.00 22.39 ? 127  SER P CA  1 
ATOM   5695 C  C   . SER F 6 89  ? 10.895  21.019  -9.903  1.00 22.91 ? 127  SER P C   1 
ATOM   5696 O  O   . SER F 6 89  ? 11.578  21.881  -9.325  1.00 22.47 ? 127  SER P O   1 
ATOM   5697 C  CB  . SER F 6 89  ? 8.605   21.783  -10.487 1.00 22.43 ? 127  SER P CB  1 
ATOM   5698 O  OG  . SER F 6 89  ? 9.267   21.945  -11.733 1.00 22.96 ? 127  SER P OG  1 
ATOM   5699 N  N   . GLY F 6 90  ? 11.377  20.201  -10.839 1.00 23.39 ? 128  GLY P N   1 
ATOM   5700 C  CA  . GLY F 6 90  ? 12.771  20.247  -11.283 1.00 23.83 ? 128  GLY P CA  1 
ATOM   5701 C  C   . GLY F 6 90  ? 13.110  21.566  -11.957 1.00 24.02 ? 128  GLY P C   1 
ATOM   5702 O  O   . GLY F 6 90  ? 14.291  21.918  -12.073 1.00 24.09 ? 128  GLY P O   1 
ATOM   5703 N  N   . ASP F 6 91  ? 12.069  22.285  -12.388 1.00 23.86 ? 129  ASP P N   1 
ATOM   5704 C  CA  . ASP F 6 91  ? 12.185  23.623  -12.963 1.00 24.06 ? 129  ASP P CA  1 
ATOM   5705 C  C   . ASP F 6 91  ? 12.968  24.600  -12.066 1.00 24.25 ? 129  ASP P C   1 
ATOM   5706 O  O   . ASP F 6 91  ? 13.666  25.474  -12.563 1.00 23.87 ? 129  ASP P O   1 
ATOM   5707 C  CB  . ASP F 6 91  ? 10.789  24.210  -13.207 1.00 24.35 ? 129  ASP P CB  1 
ATOM   5708 C  CG  . ASP F 6 91  ? 10.037  23.558  -14.381 1.00 25.16 ? 129  ASP P CG  1 
ATOM   5709 O  OD1 . ASP F 6 91  ? 10.526  22.581  -14.996 1.00 26.66 ? 129  ASP P OD1 1 
ATOM   5710 O  OD2 . ASP F 6 91  ? 8.929   24.045  -14.691 1.00 24.44 ? 129  ASP P OD2 1 
ATOM   5711 N  N   . LEU F 6 92  ? 12.851  24.443  -10.747 1.00 24.66 ? 130  LEU P N   1 
ATOM   5712 C  CA  . LEU F 6 92  ? 13.417  25.392  -9.786  1.00 24.87 ? 130  LEU P CA  1 
ATOM   5713 C  C   . LEU F 6 92  ? 14.839  25.066  -9.346  1.00 25.72 ? 130  LEU P C   1 
ATOM   5714 O  O   . LEU F 6 92  ? 15.360  25.691  -8.421  1.00 25.40 ? 130  LEU P O   1 
ATOM   5715 C  CB  . LEU F 6 92  ? 12.528  25.463  -8.551  1.00 24.72 ? 130  LEU P CB  1 
ATOM   5716 C  CG  . LEU F 6 92  ? 11.075  25.915  -8.704  1.00 24.68 ? 130  LEU P CG  1 
ATOM   5717 C  CD1 . LEU F 6 92  ? 10.269  25.499  -7.496  1.00 24.11 ? 130  LEU P CD1 1 
ATOM   5718 C  CD2 . LEU F 6 92  ? 10.994  27.418  -8.895  1.00 25.75 ? 130  LEU P CD2 1 
ATOM   5719 N  N   . LEU F 6 93  ? 15.469  24.085  -9.998  1.00 26.78 ? 131  LEU P N   1 
ATOM   5720 C  CA  . LEU F 6 93  ? 16.792  23.618  -9.584  1.00 27.44 ? 131  LEU P CA  1 
ATOM   5721 C  C   . LEU F 6 93  ? 17.881  24.648  -9.830  1.00 28.58 ? 131  LEU P C   1 
ATOM   5722 O  O   . LEU F 6 93  ? 18.758  24.847  -8.986  1.00 29.04 ? 131  LEU P O   1 
ATOM   5723 C  CB  . LEU F 6 93  ? 17.143  22.297  -10.266 1.00 27.12 ? 131  LEU P CB  1 
ATOM   5724 C  CG  . LEU F 6 93  ? 16.732  21.042  -9.494  1.00 26.08 ? 131  LEU P CG  1 
ATOM   5725 C  CD1 . LEU F 6 93  ? 16.759  19.831  -10.397 1.00 24.02 ? 131  LEU P CD1 1 
ATOM   5726 C  CD2 . LEU F 6 93  ? 17.630  20.843  -8.273  1.00 24.40 ? 131  LEU P CD2 1 
ATOM   5727 N  N   . GLU F 6 94  ? 17.809  25.308  -10.982 1.00 29.60 ? 132  GLU P N   1 
ATOM   5728 C  CA  . GLU F 6 94  ? 18.741  26.369  -11.333 1.00 30.81 ? 132  GLU P CA  1 
ATOM   5729 C  C   . GLU F 6 94  ? 18.663  27.490  -10.287 1.00 30.28 ? 132  GLU P C   1 
ATOM   5730 O  O   . GLU F 6 94  ? 19.681  28.024  -9.847  1.00 30.33 ? 132  GLU P O   1 
ATOM   5731 C  CB  . GLU F 6 94  ? 18.406  26.888  -12.728 1.00 31.51 ? 132  GLU P CB  1 
ATOM   5732 C  CG  . GLU F 6 94  ? 19.602  27.382  -13.528 1.00 36.31 ? 132  GLU P CG  1 
ATOM   5733 C  CD  . GLU F 6 94  ? 19.251  28.585  -14.430 1.00 42.53 ? 132  GLU P CD  1 
ATOM   5734 O  OE1 . GLU F 6 94  ? 19.779  29.698  -14.156 1.00 43.84 ? 132  GLU P OE1 1 
ATOM   5735 O  OE2 . GLU F 6 94  ? 18.439  28.421  -15.389 1.00 44.10 ? 132  GLU P OE2 1 
ATOM   5736 N  N   . LEU F 6 95  ? 17.442  27.804  -9.868  1.00 30.01 ? 133  LEU P N   1 
ATOM   5737 C  CA  . LEU F 6 95  ? 17.181  28.781  -8.816  1.00 29.90 ? 133  LEU P CA  1 
ATOM   5738 C  C   . LEU F 6 95  ? 17.781  28.395  -7.464  1.00 29.97 ? 133  LEU P C   1 
ATOM   5739 O  O   . LEU F 6 95  ? 18.491  29.186  -6.838  1.00 30.22 ? 133  LEU P O   1 
ATOM   5740 C  CB  . LEU F 6 95  ? 15.678  28.961  -8.661  1.00 29.55 ? 133  LEU P CB  1 
ATOM   5741 C  CG  . LEU F 6 95  ? 15.216  29.920  -7.582  1.00 29.55 ? 133  LEU P CG  1 
ATOM   5742 C  CD1 . LEU F 6 95  ? 15.591  31.353  -7.980  1.00 30.02 ? 133  LEU P CD1 1 
ATOM   5743 C  CD2 . LEU F 6 95  ? 13.722  29.756  -7.414  1.00 28.48 ? 133  LEU P CD2 1 
ATOM   5744 N  N   . ALA F 6 96  ? 17.485  27.168  -7.036  1.00 29.84 ? 134  ALA P N   1 
ATOM   5745 C  CA  . ALA F 6 96  ? 17.894  26.631  -5.743  1.00 29.35 ? 134  ALA P CA  1 
ATOM   5746 C  C   . ALA F 6 96  ? 19.404  26.500  -5.572  1.00 29.12 ? 134  ALA P C   1 
ATOM   5747 O  O   . ALA F 6 96  ? 19.916  26.571  -4.448  1.00 29.14 ? 134  ALA P O   1 
ATOM   5748 C  CB  . ALA F 6 96  ? 17.221  25.286  -5.513  1.00 29.54 ? 134  ALA P CB  1 
ATOM   5749 N  N   . LEU F 6 97  ? 20.110  26.286  -6.680  1.00 28.77 ? 135  LEU P N   1 
ATOM   5750 C  CA  . LEU F 6 97  ? 21.574  26.229  -6.660  1.00 28.50 ? 135  LEU P CA  1 
ATOM   5751 C  C   . LEU F 6 97  ? 22.200  27.605  -6.442  1.00 28.57 ? 135  LEU P C   1 
ATOM   5752 O  O   . LEU F 6 97  ? 23.362  27.697  -6.062  1.00 28.68 ? 135  LEU P O   1 
ATOM   5753 C  CB  . LEU F 6 97  ? 22.115  25.612  -7.952  1.00 28.28 ? 135  LEU P CB  1 
ATOM   5754 C  CG  . LEU F 6 97  ? 21.930  24.104  -8.154  1.00 27.82 ? 135  LEU P CG  1 
ATOM   5755 C  CD1 . LEU F 6 97  ? 22.272  23.707  -9.569  1.00 25.08 ? 135  LEU P CD1 1 
ATOM   5756 C  CD2 . LEU F 6 97  ? 22.763  23.302  -7.142  1.00 27.20 ? 135  LEU P CD2 1 
ATOM   5757 N  N   . LYS F 6 98  ? 21.434  28.670  -6.678  1.00 28.47 ? 136  LYS P N   1 
ATOM   5758 C  CA  . LYS F 6 98  ? 21.943  30.018  -6.452  1.00 28.70 ? 136  LYS P CA  1 
ATOM   5759 C  C   . LYS F 6 98  ? 21.719  30.506  -5.018  1.00 28.92 ? 136  LYS P C   1 
ATOM   5760 O  O   . LYS F 6 98  ? 22.151  31.596  -4.672  1.00 29.12 ? 136  LYS P O   1 
ATOM   5761 C  CB  . LYS F 6 98  ? 21.354  31.013  -7.453  1.00 28.57 ? 136  LYS P CB  1 
ATOM   5762 C  CG  . LYS F 6 98  ? 21.889  30.890  -8.872  1.00 28.80 ? 136  LYS P CG  1 
ATOM   5763 C  CD  . LYS F 6 98  ? 21.017  31.674  -9.854  1.00 29.63 ? 136  LYS P CD  1 
ATOM   5764 C  CE  . LYS F 6 98  ? 21.494  31.475  -11.295 1.00 31.53 ? 136  LYS P CE  1 
ATOM   5765 N  NZ  . LYS F 6 98  ? 20.575  32.089  -12.316 1.00 31.97 ? 136  LYS P NZ  1 
ATOM   5766 N  N   . LEU F 6 99  ? 21.059  29.702  -4.189  1.00 29.19 ? 137  LEU P N   1 
ATOM   5767 C  CA  . LEU F 6 99  ? 20.784  30.081  -2.802  1.00 29.57 ? 137  LEU P CA  1 
ATOM   5768 C  C   . LEU F 6 99  ? 22.069  30.237  -1.979  1.00 30.35 ? 137  LEU P C   1 
ATOM   5769 O  O   . LEU F 6 99  ? 23.061  29.542  -2.238  1.00 30.77 ? 137  LEU P O   1 
ATOM   5770 C  CB  . LEU F 6 99  ? 19.852  29.061  -2.143  1.00 29.29 ? 137  LEU P CB  1 
ATOM   5771 C  CG  . LEU F 6 99  ? 18.382  28.991  -2.563  1.00 29.15 ? 137  LEU P CG  1 
ATOM   5772 C  CD1 . LEU F 6 99  ? 17.781  27.680  -2.081  1.00 29.07 ? 137  LEU P CD1 1 
ATOM   5773 C  CD2 . LEU F 6 99  ? 17.588  30.165  -2.015  1.00 27.98 ? 137  LEU P CD2 1 
ATOM   5774 N  N   . PRO F 6 100 ? 22.066  31.152  -0.987  1.00 30.94 ? 138  PRO P N   1 
ATOM   5775 C  CA  . PRO F 6 100 ? 23.254  31.295  -0.144  1.00 31.15 ? 138  PRO P CA  1 
ATOM   5776 C  C   . PRO F 6 100 ? 23.545  30.011  0.620   1.00 31.11 ? 138  PRO P C   1 
ATOM   5777 O  O   . PRO F 6 100 ? 22.612  29.372  1.101   1.00 31.20 ? 138  PRO P O   1 
ATOM   5778 C  CB  . PRO F 6 100 ? 22.858  32.410  0.843   1.00 31.23 ? 138  PRO P CB  1 
ATOM   5779 C  CG  . PRO F 6 100 ? 21.350  32.394  0.867   1.00 31.18 ? 138  PRO P CG  1 
ATOM   5780 C  CD  . PRO F 6 100 ? 20.996  32.082  -0.575  1.00 31.30 ? 138  PRO P CD  1 
ATOM   5781 N  N   . HIS F 6 101 ? 24.827  29.657  0.717   1.00 31.14 ? 139  HIS P N   1 
ATOM   5782 C  CA  . HIS F 6 101 ? 25.324  28.534  1.532   1.00 31.42 ? 139  HIS P CA  1 
ATOM   5783 C  C   . HIS F 6 101 ? 25.251  27.158  0.860   1.00 30.53 ? 139  HIS P C   1 
ATOM   5784 O  O   . HIS F 6 101 ? 25.707  26.159  1.438   1.00 30.40 ? 139  HIS P O   1 
ATOM   5785 C  CB  . HIS F 6 101 ? 24.585  28.400  2.873   1.00 32.29 ? 139  HIS P CB  1 
ATOM   5786 C  CG  . HIS F 6 101 ? 24.503  29.656  3.678   1.00 35.65 ? 139  HIS P CG  1 
ATOM   5787 N  ND1 . HIS F 6 101 ? 25.615  30.397  4.028   1.00 38.63 ? 139  HIS P ND1 1 
ATOM   5788 C  CD2 . HIS F 6 101 ? 23.441  30.267  4.257   1.00 37.99 ? 139  HIS P CD2 1 
ATOM   5789 C  CE1 . HIS F 6 101 ? 25.235  31.427  4.765   1.00 39.70 ? 139  HIS P CE1 1 
ATOM   5790 N  NE2 . HIS F 6 101 ? 23.922  31.370  4.921   1.00 40.36 ? 139  HIS P NE2 1 
ATOM   5791 N  N   . VAL F 6 102 ? 24.655  27.073  -0.325  1.00 29.35 ? 140  VAL P N   1 
ATOM   5792 C  CA  . VAL F 6 102 ? 24.471  25.750  -0.925  1.00 27.94 ? 140  VAL P CA  1 
ATOM   5793 C  C   . VAL F 6 102 ? 25.808  25.134  -1.328  1.00 27.17 ? 140  VAL P C   1 
ATOM   5794 O  O   . VAL F 6 102 ? 26.612  25.764  -2.025  1.00 26.86 ? 140  VAL P O   1 
ATOM   5795 C  CB  . VAL F 6 102 ? 23.499  25.758  -2.111  1.00 27.82 ? 140  VAL P CB  1 
ATOM   5796 C  CG1 . VAL F 6 102 ? 23.426  24.360  -2.725  1.00 27.22 ? 140  VAL P CG1 1 
ATOM   5797 C  CG2 . VAL F 6 102 ? 22.125  26.217  -1.659  1.00 27.05 ? 140  VAL P CG2 1 
ATOM   5798 N  N   . ASP F 6 103 ? 26.040  23.911  -0.856  1.00 26.16 ? 141  ASP P N   1 
ATOM   5799 C  CA  . ASP F 6 103 ? 27.198  23.131  -1.262  1.00 25.06 ? 141  ASP P CA  1 
ATOM   5800 C  C   . ASP F 6 103 ? 26.848  22.395  -2.545  1.00 24.20 ? 141  ASP P C   1 
ATOM   5801 O  O   . ASP F 6 103 ? 27.507  22.573  -3.561  1.00 24.44 ? 141  ASP P O   1 
ATOM   5802 C  CB  . ASP F 6 103 ? 27.587  22.155  -0.157  1.00 25.17 ? 141  ASP P CB  1 
ATOM   5803 C  CG  . ASP F 6 103 ? 28.968  21.544  -0.356  1.00 26.22 ? 141  ASP P CG  1 
ATOM   5804 O  OD1 . ASP F 6 103 ? 29.519  21.592  -1.487  1.00 28.12 ? 141  ASP P OD1 1 
ATOM   5805 O  OD2 . ASP F 6 103 ? 29.503  20.994  0.640   1.00 26.47 ? 141  ASP P OD2 1 
ATOM   5806 N  N   . TYR F 6 104 ? 25.793  21.590  -2.494  1.00 23.31 ? 142  TYR P N   1 
ATOM   5807 C  CA  . TYR F 6 104 ? 25.331  20.792  -3.633  1.00 22.33 ? 142  TYR P CA  1 
ATOM   5808 C  C   . TYR F 6 104 ? 23.901  20.335  -3.345  1.00 22.26 ? 142  TYR P C   1 
ATOM   5809 O  O   . TYR F 6 104 ? 23.462  20.323  -2.179  1.00 22.49 ? 142  TYR P O   1 
ATOM   5810 C  CB  . TYR F 6 104 ? 26.247  19.563  -3.864  1.00 22.18 ? 142  TYR P CB  1 
ATOM   5811 C  CG  . TYR F 6 104 ? 26.301  18.590  -2.700  1.00 21.16 ? 142  TYR P CG  1 
ATOM   5812 C  CD1 . TYR F 6 104 ? 27.180  18.796  -1.636  1.00 20.71 ? 142  TYR P CD1 1 
ATOM   5813 C  CD2 . TYR F 6 104 ? 25.443  17.484  -2.643  1.00 20.49 ? 142  TYR P CD2 1 
ATOM   5814 C  CE1 . TYR F 6 104 ? 27.216  17.916  -0.538  1.00 21.01 ? 142  TYR P CE1 1 
ATOM   5815 C  CE2 . TYR F 6 104 ? 25.468  16.597  -1.556  1.00 20.39 ? 142  TYR P CE2 1 
ATOM   5816 C  CZ  . TYR F 6 104 ? 26.362  16.815  -0.517  1.00 21.40 ? 142  TYR P CZ  1 
ATOM   5817 O  OH  . TYR F 6 104 ? 26.399  15.951  0.550   1.00 21.57 ? 142  TYR P OH  1 
ATOM   5818 N  N   . ILE F 6 105 ? 23.176  19.961  -4.394  1.00 21.84 ? 143  ILE P N   1 
ATOM   5819 C  CA  . ILE F 6 105 ? 21.823  19.409  -4.246  1.00 21.58 ? 143  ILE P CA  1 
ATOM   5820 C  C   . ILE F 6 105 ? 21.783  17.989  -4.822  1.00 21.87 ? 143  ILE P C   1 
ATOM   5821 O  O   . ILE F 6 105 ? 22.297  17.748  -5.926  1.00 22.20 ? 143  ILE P O   1 
ATOM   5822 C  CB  . ILE F 6 105 ? 20.768  20.308  -4.939  1.00 21.35 ? 143  ILE P CB  1 
ATOM   5823 C  CG1 . ILE F 6 105 ? 20.666  21.652  -4.206  1.00 21.27 ? 143  ILE P CG1 1 
ATOM   5824 C  CG2 . ILE F 6 105 ? 19.412  19.616  -5.013  1.00 19.82 ? 143  ILE P CG2 1 
ATOM   5825 C  CD1 . ILE F 6 105 ? 19.847  22.712  -4.932  1.00 21.23 ? 143  ILE P CD1 1 
ATOM   5826 N  N   . GLU F 6 106 ? 21.195  17.053  -4.077  1.00 21.62 ? 144  GLU P N   1 
ATOM   5827 C  CA  . GLU F 6 106 ? 21.040  15.677  -4.553  1.00 21.43 ? 144  GLU P CA  1 
ATOM   5828 C  C   . GLU F 6 106 ? 19.563  15.306  -4.721  1.00 21.22 ? 144  GLU P C   1 
ATOM   5829 O  O   . GLU F 6 106 ? 18.767  15.436  -3.801  1.00 21.62 ? 144  GLU P O   1 
ATOM   5830 C  CB  . GLU F 6 106 ? 21.765  14.693  -3.620  1.00 21.23 ? 144  GLU P CB  1 
ATOM   5831 C  CG  . GLU F 6 106 ? 21.655  13.219  -4.030  1.00 21.77 ? 144  GLU P CG  1 
ATOM   5832 C  CD  . GLU F 6 106 ? 22.581  12.272  -3.247  1.00 21.92 ? 144  GLU P CD  1 
ATOM   5833 O  OE1 . GLU F 6 106 ? 23.752  12.631  -2.960  1.00 22.57 ? 144  GLU P OE1 1 
ATOM   5834 O  OE2 . GLU F 6 106 ? 22.137  11.142  -2.939  1.00 22.45 ? 144  GLU P OE2 1 
ATOM   5835 N  N   . GLU F 6 107 ? 19.204  14.871  -5.917  1.00 21.29 ? 145  GLU P N   1 
ATOM   5836 C  CA  . GLU F 6 107 ? 17.887  14.311  -6.199  1.00 21.38 ? 145  GLU P CA  1 
ATOM   5837 C  C   . GLU F 6 107 ? 17.730  13.047  -5.378  1.00 20.97 ? 145  GLU P C   1 
ATOM   5838 O  O   . GLU F 6 107 ? 18.640  12.233  -5.324  1.00 21.15 ? 145  GLU P O   1 
ATOM   5839 C  CB  . GLU F 6 107 ? 17.802  13.978  -7.688  1.00 21.09 ? 145  GLU P CB  1 
ATOM   5840 C  CG  . GLU F 6 107 ? 16.442  13.558  -8.184  1.00 22.11 ? 145  GLU P CG  1 
ATOM   5841 C  CD  . GLU F 6 107 ? 16.490  13.070  -9.626  1.00 22.71 ? 145  GLU P CD  1 
ATOM   5842 O  OE1 . GLU F 6 107 ? 17.247  12.115  -9.905  1.00 25.89 ? 145  GLU P OE1 1 
ATOM   5843 O  OE2 . GLU F 6 107 ? 15.773  13.624  -10.485 1.00 23.85 ? 145  GLU P OE2 1 
ATOM   5844 N  N   . ASP F 6 108 ? 16.585  12.891  -4.722  1.00 20.95 ? 146  ASP P N   1 
ATOM   5845 C  CA  . ASP F 6 108 ? 16.310  11.706  -3.907  1.00 20.52 ? 146  ASP P CA  1 
ATOM   5846 C  C   . ASP F 6 108 ? 16.394  10.470  -4.804  1.00 20.30 ? 146  ASP P C   1 
ATOM   5847 O  O   . ASP F 6 108 ? 16.251  10.565  -6.037  1.00 20.68 ? 146  ASP P O   1 
ATOM   5848 C  CB  . ASP F 6 108 ? 14.918  11.828  -3.268  1.00 20.55 ? 146  ASP P CB  1 
ATOM   5849 C  CG  . ASP F 6 108 ? 14.796  11.105  -1.907  1.00 21.13 ? 146  ASP P CG  1 
ATOM   5850 O  OD1 . ASP F 6 108 ? 15.781  10.486  -1.409  1.00 20.65 ? 146  ASP P OD1 1 
ATOM   5851 O  OD2 . ASP F 6 108 ? 13.682  11.177  -1.327  1.00 18.96 ? 146  ASP P OD2 1 
ATOM   5852 N  N   . SER F 6 109 ? 16.652  9.319   -4.198  1.00 19.72 ? 147  SER P N   1 
ATOM   5853 C  CA  . SER F 6 109 ? 16.747  8.056   -4.938  1.00 19.07 ? 147  SER P CA  1 
ATOM   5854 C  C   . SER F 6 109 ? 16.409  6.856   -4.059  1.00 18.82 ? 147  SER P C   1 
ATOM   5855 O  O   . SER F 6 109 ? 16.433  6.946   -2.819  1.00 18.74 ? 147  SER P O   1 
ATOM   5856 C  CB  . SER F 6 109 ? 18.143  7.890   -5.536  1.00 18.84 ? 147  SER P CB  1 
ATOM   5857 O  OG  . SER F 6 109 ? 19.106  7.827   -4.511  1.00 18.01 ? 147  SER P OG  1 
ATOM   5858 N  N   . SER F 6 110 ? 16.115  5.728   -4.699  1.00 18.58 ? 148  SER P N   1 
ATOM   5859 C  CA  . SER F 6 110 ? 15.616  4.548   -3.981  1.00 18.51 ? 148  SER P CA  1 
ATOM   5860 C  C   . SER F 6 110 ? 16.698  3.757   -3.243  1.00 18.27 ? 148  SER P C   1 
ATOM   5861 O  O   . SER F 6 110 ? 17.826  3.646   -3.712  1.00 18.14 ? 148  SER P O   1 
ATOM   5862 C  CB  . SER F 6 110 ? 14.888  3.617   -4.948  1.00 18.68 ? 148  SER P CB  1 
ATOM   5863 O  OG  . SER F 6 110 ? 13.759  4.255   -5.538  1.00 19.05 ? 148  SER P OG  1 
ATOM   5864 N  N   . VAL F 6 111 ? 16.346  3.235   -2.072  1.00 18.06 ? 149  VAL P N   1 
ATOM   5865 C  CA  . VAL F 6 111 ? 17.147  2.205   -1.405  1.00 17.81 ? 149  VAL P CA  1 
ATOM   5866 C  C   . VAL F 6 111 ? 16.337  0.891   -1.325  1.00 17.97 ? 149  VAL P C   1 
ATOM   5867 O  O   . VAL F 6 111 ? 15.105  0.906   -1.314  1.00 18.16 ? 149  VAL P O   1 
ATOM   5868 C  CB  . VAL F 6 111 ? 17.672  2.670   -0.021  1.00 17.44 ? 149  VAL P CB  1 
ATOM   5869 C  CG1 . VAL F 6 111 ? 18.675  3.790   -0.185  1.00 17.41 ? 149  VAL P CG1 1 
ATOM   5870 C  CG2 . VAL F 6 111 ? 16.546  3.146   0.863   1.00 17.53 ? 149  VAL P CG2 1 
ATOM   5871 N  N   . PHE F 6 112 ? 17.025  -0.241  -1.300  1.00 18.15 ? 150  PHE P N   1 
ATOM   5872 C  CA  . PHE F 6 112 ? 16.358  -1.540  -1.337  1.00 18.10 ? 150  PHE P CA  1 
ATOM   5873 C  C   . PHE F 6 112 ? 16.879  -2.486  -0.273  1.00 18.17 ? 150  PHE P C   1 
ATOM   5874 O  O   . PHE F 6 112 ? 18.083  -2.525  -0.003  1.00 18.29 ? 150  PHE P O   1 
ATOM   5875 C  CB  . PHE F 6 112 ? 16.554  -2.202  -2.707  1.00 18.05 ? 150  PHE P CB  1 
ATOM   5876 C  CG  . PHE F 6 112 ? 16.088  -1.367  -3.854  1.00 18.11 ? 150  PHE P CG  1 
ATOM   5877 C  CD1 . PHE F 6 112 ? 14.752  -1.398  -4.253  1.00 16.59 ? 150  PHE P CD1 1 
ATOM   5878 C  CD2 . PHE F 6 112 ? 16.989  -0.536  -4.537  1.00 18.40 ? 150  PHE P CD2 1 
ATOM   5879 C  CE1 . PHE F 6 112 ? 14.310  -0.621  -5.319  1.00 16.47 ? 150  PHE P CE1 1 
ATOM   5880 C  CE2 . PHE F 6 112 ? 16.562  0.253   -5.597  1.00 17.99 ? 150  PHE P CE2 1 
ATOM   5881 C  CZ  . PHE F 6 112 ? 15.216  0.204   -5.998  1.00 17.88 ? 150  PHE P CZ  1 
ATOM   5882 N  N   . ALA F 6 113 ? 15.965  -3.265  0.306   1.00 18.24 ? 151  ALA P N   1 
ATOM   5883 C  CA  . ALA F 6 113 ? 16.316  -4.389  1.177   1.00 18.55 ? 151  ALA P CA  1 
ATOM   5884 C  C   . ALA F 6 113 ? 17.313  -5.305  0.466   1.00 18.77 ? 151  ALA P C   1 
ATOM   5885 O  O   . ALA F 6 113 ? 17.139  -5.610  -0.715  1.00 18.79 ? 151  ALA P O   1 
ATOM   5886 C  CB  . ALA F 6 113 ? 15.066  -5.161  1.553   1.00 18.20 ? 151  ALA P CB  1 
ATOM   5887 N  N   . GLN F 6 114 ? 18.354  -5.725  1.180   1.00 19.14 ? 152  GLN P N   1 
ATOM   5888 C  CA  . GLN F 6 114 ? 19.429  -6.541  0.599   1.00 19.42 ? 152  GLN P CA  1 
ATOM   5889 C  C   . GLN F 6 114 ? 19.502  -7.948  1.187   1.00 20.17 ? 152  GLN P C   1 
ATOM   5890 O  O   . GLN F 6 114 ? 20.534  -8.624  1.044   1.00 20.59 ? 152  GLN P O   1 
ATOM   5891 C  CB  . GLN F 6 114 ? 20.783  -5.857  0.784   1.00 18.99 ? 152  GLN P CB  1 
ATOM   5892 C  CG  . GLN F 6 114 ? 20.996  -4.651  -0.084  1.00 18.11 ? 152  GLN P CG  1 
ATOM   5893 C  CD  . GLN F 6 114 ? 20.717  -4.907  -1.553  1.00 18.34 ? 152  GLN P CD  1 
ATOM   5894 O  OE1 . GLN F 6 114 ? 21.476  -5.585  -2.234  1.00 18.23 ? 152  GLN P OE1 1 
ATOM   5895 N  NE2 . GLN F 6 114 ? 19.635  -4.336  -2.052  1.00 18.88 ? 152  GLN P NE2 1 
ATOM   5896 O  OXT . GLN F 6 114 ? 18.556  -8.438  1.835   1.00 20.81 ? 152  GLN P OXT 1 
HETATM 5897 CA CA  . CA  G 7 .   ? 33.361  0.471   4.510   1.00 62.79 ? 1423 CA  A CA  1 
HETATM 5898 O  O   . HOH H 8 .   ? 7.665   -2.550  13.136  1.00 20.04 ? 2001 HOH A O   1 
HETATM 5899 O  O   . HOH H 8 .   ? 3.917   -6.349  15.753  1.00 37.08 ? 2002 HOH A O   1 
HETATM 5900 O  O   . HOH H 8 .   ? 7.653   -7.201  21.910  1.00 37.77 ? 2003 HOH A O   1 
HETATM 5901 O  O   . HOH H 8 .   ? 15.784  -15.528 15.094  1.00 18.22 ? 2004 HOH A O   1 
HETATM 5902 O  O   . HOH H 8 .   ? 9.039   -11.212 27.065  1.00 32.03 ? 2005 HOH A O   1 
HETATM 5903 O  O   . HOH H 8 .   ? 20.678  -5.978  26.223  1.00 50.35 ? 2006 HOH A O   1 
HETATM 5904 O  O   . HOH H 8 .   ? 8.010   -2.377  20.817  1.00 27.63 ? 2007 HOH A O   1 
HETATM 5905 O  O   . HOH H 8 .   ? 9.765   5.855   19.433  1.00 29.22 ? 2008 HOH A O   1 
HETATM 5906 O  O   . HOH H 8 .   ? 9.314   2.111   13.616  1.00 13.54 ? 2009 HOH A O   1 
HETATM 5907 O  O   . HOH H 8 .   ? 8.388   9.344   12.460  1.00 38.13 ? 2010 HOH A O   1 
HETATM 5908 O  O   . HOH H 8 .   ? 9.802   11.079  9.090   1.00 25.42 ? 2011 HOH A O   1 
HETATM 5909 O  O   . HOH H 8 .   ? 6.342   7.887   5.980   1.00 40.06 ? 2012 HOH A O   1 
HETATM 5910 O  O   . HOH H 8 .   ? 6.807   9.549   3.345   1.00 26.38 ? 2013 HOH A O   1 
HETATM 5911 O  O   . HOH H 8 .   ? 6.205   8.148   -2.190  1.00 18.61 ? 2014 HOH A O   1 
HETATM 5912 O  O   . HOH H 8 .   ? 5.544   -8.662  -10.984 1.00 36.87 ? 2015 HOH A O   1 
HETATM 5913 O  O   . HOH H 8 .   ? 2.280   -8.028  6.051   1.00 33.69 ? 2016 HOH A O   1 
HETATM 5914 O  O   . HOH H 8 .   ? 4.316   -6.643  12.167  1.00 29.97 ? 2017 HOH A O   1 
HETATM 5915 O  O   . HOH H 8 .   ? 9.795   -7.634  4.130   1.00 16.84 ? 2018 HOH A O   1 
HETATM 5916 O  O   . HOH H 8 .   ? 15.692  -11.299 22.131  1.00 38.78 ? 2019 HOH A O   1 
HETATM 5917 O  O   . HOH H 8 .   ? 18.631  -16.811 24.781  1.00 33.00 ? 2020 HOH A O   1 
HETATM 5918 O  O   . HOH H 8 .   ? 12.084  -1.484  11.504  1.00 28.54 ? 2021 HOH A O   1 
HETATM 5919 O  O   . HOH H 8 .   ? 7.692   -2.514  5.874   1.00 24.59 ? 2022 HOH A O   1 
HETATM 5920 O  O   . HOH H 8 .   ? 12.834  5.243   3.382   1.00 18.84 ? 2023 HOH A O   1 
HETATM 5921 O  O   . HOH H 8 .   ? 9.512   -7.497  1.222   1.00 18.87 ? 2024 HOH A O   1 
HETATM 5922 O  O   . HOH H 8 .   ? 10.723  4.296   -7.166  1.00 30.84 ? 2025 HOH A O   1 
HETATM 5923 O  O   . HOH H 8 .   ? 10.889  7.821   2.194   1.00 18.68 ? 2026 HOH A O   1 
HETATM 5924 O  O   . HOH H 8 .   ? 17.330  -14.869 26.017  1.00 25.88 ? 2027 HOH A O   1 
HETATM 5925 O  O   . HOH H 8 .   ? 11.797  11.397  3.076   1.00 31.23 ? 2028 HOH A O   1 
HETATM 5926 O  O   . HOH H 8 .   ? 33.077  8.121   -3.785  1.00 23.34 ? 2029 HOH A O   1 
HETATM 5927 O  O   . HOH H 8 .   ? 31.297  10.834  -0.694  1.00 6.79  ? 2030 HOH A O   1 
HETATM 5928 O  O   . HOH H 8 .   ? 29.891  11.966  1.129   1.00 22.56 ? 2031 HOH A O   1 
HETATM 5929 O  O   . HOH H 8 .   ? 32.484  12.191  3.509   1.00 31.70 ? 2032 HOH A O   1 
HETATM 5930 O  O   . HOH H 8 .   ? 30.145  14.383  7.191   1.00 33.70 ? 2033 HOH A O   1 
HETATM 5931 O  O   . HOH H 8 .   ? 32.024  16.332  12.949  1.00 42.18 ? 2034 HOH A O   1 
HETATM 5932 O  O   . HOH H 8 .   ? 34.636  8.914   18.526  1.00 36.95 ? 2035 HOH A O   1 
HETATM 5933 O  O   . HOH H 8 .   ? 31.318  3.321   12.028  1.00 13.68 ? 2036 HOH A O   1 
HETATM 5934 O  O   . HOH H 8 .   ? 26.286  -6.959  -11.993 1.00 55.51 ? 2037 HOH A O   1 
HETATM 5935 O  O   . HOH H 8 .   ? 34.029  -12.157 -5.630  1.00 15.89 ? 2038 HOH A O   1 
HETATM 5936 O  O   . HOH H 8 .   ? 34.199  -2.425  -3.987  1.00 15.58 ? 2039 HOH A O   1 
HETATM 5937 O  O   . HOH H 8 .   ? 34.428  -0.920  -10.943 1.00 23.80 ? 2040 HOH A O   1 
HETATM 5938 O  O   . HOH H 8 .   ? 30.816  5.341   -7.101  1.00 37.91 ? 2041 HOH A O   1 
HETATM 5939 O  O   . HOH H 8 .   ? 24.849  -0.583  1.132   1.00 11.21 ? 2042 HOH A O   1 
HETATM 5940 O  O   . HOH H 8 .   ? 34.641  4.454   -1.230  1.00 29.88 ? 2043 HOH A O   1 
HETATM 5941 O  O   . HOH H 8 .   ? 35.521  2.285   1.410   1.00 25.83 ? 2044 HOH A O   1 
HETATM 5942 O  O   . HOH H 8 .   ? 31.635  9.322   3.490   1.00 43.20 ? 2045 HOH A O   1 
HETATM 5943 O  O   . HOH H 8 .   ? 35.364  -19.173 8.281   1.00 36.40 ? 2046 HOH A O   1 
HETATM 5944 O  O   . HOH H 8 .   ? 34.087  -19.443 -5.997  1.00 35.39 ? 2047 HOH A O   1 
HETATM 5945 O  O   . HOH H 8 .   ? 25.923  -14.365 -10.705 1.00 34.11 ? 2048 HOH A O   1 
HETATM 5946 O  O   . HOH H 8 .   ? 37.161  -2.297  -6.549  1.00 27.08 ? 2049 HOH A O   1 
HETATM 5947 O  O   . HOH H 8 .   ? 37.780  3.058   -0.531  1.00 16.99 ? 2050 HOH A O   1 
HETATM 5948 O  O   . HOH H 8 .   ? 38.602  -2.572  4.584   1.00 20.08 ? 2051 HOH A O   1 
HETATM 5949 O  O   . HOH H 8 .   ? 0.661   -15.874 11.661  1.00 37.54 ? 2052 HOH A O   1 
HETATM 5950 O  O   . HOH H 8 .   ? 17.772  -11.197 1.985   1.00 31.27 ? 2053 HOH A O   1 
HETATM 5951 O  O   . HOH H 8 .   ? 24.859  -15.671 10.803  1.00 22.38 ? 2054 HOH A O   1 
HETATM 5952 O  O   . HOH H 8 .   ? 35.687  -7.270  23.261  1.00 30.72 ? 2055 HOH A O   1 
HETATM 5953 O  O   . HOH H 8 .   ? 31.153  3.334   25.924  1.00 32.81 ? 2056 HOH A O   1 
HETATM 5954 O  O   . HOH H 8 .   ? 33.475  2.994   21.934  1.00 27.31 ? 2057 HOH A O   1 
HETATM 5955 O  O   . HOH H 8 .   ? 42.387  3.295   17.171  1.00 38.75 ? 2058 HOH A O   1 
HETATM 5956 O  O   . HOH H 8 .   ? 35.294  4.784   18.266  1.00 50.45 ? 2059 HOH A O   1 
HETATM 5957 O  O   . HOH H 8 .   ? 44.970  -1.681  13.821  1.00 52.51 ? 2060 HOH A O   1 
HETATM 5958 O  O   . HOH H 8 .   ? 36.433  -11.875 5.931   1.00 38.56 ? 2061 HOH A O   1 
HETATM 5959 O  O   . HOH I 8 .   ? 3.444   -10.660 26.339  1.00 37.27 ? 2001 HOH B O   1 
HETATM 5960 O  O   . HOH I 8 .   ? 8.935   -18.815 26.426  1.00 20.52 ? 2002 HOH B O   1 
HETATM 5961 O  O   . HOH I 8 .   ? -4.916  -8.785  19.955  1.00 35.96 ? 2003 HOH B O   1 
HETATM 5962 O  O   . HOH I 8 .   ? -6.845  -13.075 16.730  1.00 25.70 ? 2004 HOH B O   1 
HETATM 5963 O  O   . HOH I 8 .   ? -2.547  -27.605 17.080  1.00 29.80 ? 2005 HOH B O   1 
HETATM 5964 O  O   . HOH I 8 .   ? -11.954 -23.990 21.294  1.00 24.27 ? 2006 HOH B O   1 
HETATM 5965 O  O   . HOH I 8 .   ? -13.324 -39.504 27.499  1.00 19.09 ? 2007 HOH B O   1 
HETATM 5966 O  O   . HOH I 8 .   ? -5.327  -38.415 30.793  1.00 24.35 ? 2008 HOH B O   1 
HETATM 5967 O  O   . HOH I 8 .   ? 0.905   -42.669 36.821  1.00 29.57 ? 2009 HOH B O   1 
HETATM 5968 O  O   . HOH I 8 .   ? -1.166  -45.220 31.016  1.00 39.78 ? 2010 HOH B O   1 
HETATM 5969 O  O   . HOH I 8 .   ? -5.799  -38.017 21.480  1.00 23.74 ? 2011 HOH B O   1 
HETATM 5970 O  O   . HOH I 8 .   ? -11.290 -23.275 14.299  1.00 21.51 ? 2012 HOH B O   1 
HETATM 5971 O  O   . HOH I 8 .   ? -15.612 -28.738 17.028  1.00 23.96 ? 2013 HOH B O   1 
HETATM 5972 O  O   . HOH I 8 .   ? -3.148  -34.231 14.708  1.00 25.13 ? 2014 HOH B O   1 
HETATM 5973 O  O   . HOH I 8 .   ? -10.566 -41.075 21.417  1.00 29.96 ? 2015 HOH B O   1 
HETATM 5974 O  O   . HOH I 8 .   ? -12.282 -37.713 15.858  1.00 22.83 ? 2016 HOH B O   1 
HETATM 5975 O  O   . HOH I 8 .   ? -19.799 -39.188 20.974  1.00 37.63 ? 2017 HOH B O   1 
HETATM 5976 O  O   . HOH I 8 .   ? -17.160 -31.740 17.136  1.00 32.11 ? 2018 HOH B O   1 
HETATM 5977 O  O   . HOH I 8 .   ? -13.122 -22.230 16.179  1.00 26.66 ? 2019 HOH B O   1 
HETATM 5978 O  O   . HOH I 8 .   ? -12.081 -10.834 21.847  1.00 49.71 ? 2020 HOH B O   1 
HETATM 5979 O  O   . HOH I 8 .   ? -15.162 -16.546 19.950  1.00 32.72 ? 2021 HOH B O   1 
HETATM 5980 O  O   . HOH I 8 .   ? -17.827 -25.334 22.036  1.00 23.95 ? 2022 HOH B O   1 
HETATM 5981 O  O   . HOH I 8 .   ? -16.809 -46.327 25.776  1.00 36.86 ? 2023 HOH B O   1 
HETATM 5982 O  O   . HOH I 8 .   ? -13.896 -40.796 33.705  1.00 41.39 ? 2024 HOH B O   1 
HETATM 5983 O  O   . HOH I 8 .   ? 2.261   -14.419 18.814  1.00 10.38 ? 2025 HOH B O   1 
HETATM 5984 O  O   . HOH I 8 .   ? 3.452   -17.218 24.086  1.00 25.03 ? 2026 HOH B O   1 
HETATM 5985 O  O   . HOH I 8 .   ? 6.126   -20.969 27.338  1.00 13.24 ? 2027 HOH B O   1 
HETATM 5986 O  O   . HOH I 8 .   ? -1.452  -19.560 30.455  1.00 21.07 ? 2028 HOH B O   1 
HETATM 5987 O  O   . HOH I 8 .   ? 1.538   -22.731 30.773  1.00 24.19 ? 2029 HOH B O   1 
HETATM 5988 O  O   . HOH I 8 .   ? -13.734 -35.216 38.239  1.00 41.78 ? 2030 HOH B O   1 
HETATM 5989 O  O   . HOH J 8 .   ? -21.489 -40.729 55.163  1.00 33.42 ? 2001 HOH C O   1 
HETATM 5990 O  O   . HOH J 8 .   ? -21.217 -38.453 63.489  1.00 42.95 ? 2002 HOH C O   1 
HETATM 5991 O  O   . HOH J 8 .   ? 1.879   -51.267 70.780  1.00 48.86 ? 2003 HOH C O   1 
HETATM 5992 O  O   . HOH J 8 .   ? 5.503   -46.584 74.930  1.00 60.66 ? 2004 HOH C O   1 
HETATM 5993 O  O   . HOH J 8 .   ? -19.756 -27.893 52.530  1.00 27.98 ? 2005 HOH C O   1 
HETATM 5994 O  O   . HOH J 8 .   ? -10.051 -27.003 56.882  1.00 31.52 ? 2006 HOH C O   1 
HETATM 5995 O  O   . HOH J 8 .   ? -2.795  -29.123 55.091  1.00 40.81 ? 2007 HOH C O   1 
HETATM 5996 O  O   . HOH J 8 .   ? -12.499 -36.032 41.756  1.00 27.05 ? 2008 HOH C O   1 
HETATM 5997 O  O   . HOH J 8 .   ? -8.041  -40.722 45.447  1.00 31.72 ? 2009 HOH C O   1 
HETATM 5998 O  O   . HOH J 8 .   ? -22.104 -48.147 41.302  1.00 50.99 ? 2010 HOH C O   1 
HETATM 5999 O  O   . HOH J 8 .   ? -4.237  -37.241 56.586  1.00 32.49 ? 2011 HOH C O   1 
HETATM 6000 O  O   . HOH J 8 .   ? -3.104  -33.976 80.956  1.00 42.50 ? 2012 HOH C O   1 
HETATM 6001 O  O   . HOH K 8 .   ? 4.985   -44.980 27.233  1.00 17.85 ? 2001 HOH D O   1 
HETATM 6002 O  O   . HOH K 8 .   ? 9.533   -42.838 34.384  1.00 24.99 ? 2002 HOH D O   1 
HETATM 6003 O  O   . HOH K 8 .   ? 10.038  -44.872 37.632  1.00 34.49 ? 2003 HOH D O   1 
HETATM 6004 O  O   . HOH K 8 .   ? 20.649  -39.453 38.040  1.00 28.30 ? 2004 HOH D O   1 
HETATM 6005 O  O   . HOH K 8 .   ? 15.175  -40.225 34.759  1.00 29.85 ? 2005 HOH D O   1 
HETATM 6006 O  O   . HOH K 8 .   ? 17.991  -42.891 29.498  1.00 29.09 ? 2006 HOH D O   1 
HETATM 6007 O  O   . HOH K 8 .   ? 9.890   -45.803 22.773  1.00 34.91 ? 2007 HOH D O   1 
HETATM 6008 O  O   . HOH K 8 .   ? 6.375   -43.326 10.971  1.00 29.27 ? 2008 HOH D O   1 
HETATM 6009 O  O   . HOH K 8 .   ? 15.028  -36.905 18.805  1.00 20.37 ? 2009 HOH D O   1 
HETATM 6010 O  O   . HOH K 8 .   ? 7.723   -42.950 16.269  1.00 25.56 ? 2010 HOH D O   1 
HETATM 6011 O  O   . HOH K 8 .   ? 8.255   -34.673 15.362  1.00 23.83 ? 2011 HOH D O   1 
HETATM 6012 O  O   . HOH K 8 .   ? 3.761   -23.321 29.291  1.00 30.67 ? 2012 HOH D O   1 
HETATM 6013 O  O   . HOH K 8 .   ? 6.486   -21.990 29.790  1.00 21.28 ? 2013 HOH D O   1 
HETATM 6014 O  O   . HOH K 8 .   ? 19.906  -24.803 20.383  1.00 20.31 ? 2014 HOH D O   1 
HETATM 6015 O  O   . HOH K 8 .   ? 9.061   -21.970 19.672  1.00 15.06 ? 2015 HOH D O   1 
HETATM 6016 O  O   . HOH K 8 .   ? 20.655  -26.182 22.789  1.00 19.74 ? 2016 HOH D O   1 
HETATM 6017 O  O   . HOH K 8 .   ? 8.387   -19.114 29.568  1.00 16.87 ? 2017 HOH D O   1 
HETATM 6018 O  O   . HOH K 8 .   ? 7.639   -15.535 23.888  1.00 37.71 ? 2018 HOH D O   1 
HETATM 6019 O  O   . HOH K 8 .   ? 6.776   -18.632 36.366  1.00 46.78 ? 2019 HOH D O   1 
HETATM 6020 O  O   . HOH K 8 .   ? 15.784  -15.974 29.607  1.00 35.69 ? 2020 HOH D O   1 
HETATM 6021 O  O   . HOH K 8 .   ? 20.774  -27.758 32.026  1.00 21.55 ? 2021 HOH D O   1 
HETATM 6022 O  O   . HOH K 8 .   ? 20.606  -28.668 21.769  1.00 28.47 ? 2022 HOH D O   1 
HETATM 6023 O  O   . HOH K 8 .   ? 22.945  -35.204 25.112  1.00 31.48 ? 2023 HOH D O   1 
HETATM 6024 O  O   . HOH K 8 .   ? 20.187  -32.402 27.396  1.00 17.86 ? 2024 HOH D O   1 
HETATM 6025 O  O   . HOH K 8 .   ? 25.468  -40.661 19.199  1.00 34.94 ? 2025 HOH D O   1 
HETATM 6026 O  O   . HOH K 8 .   ? 15.607  -41.698 15.039  1.00 26.68 ? 2026 HOH D O   1 
HETATM 6027 O  O   . HOH K 8 .   ? 21.047  -43.009 23.976  1.00 30.65 ? 2027 HOH D O   1 
HETATM 6028 O  O   . HOH K 8 .   ? 22.703  -27.900 39.256  1.00 26.60 ? 2028 HOH D O   1 
HETATM 6029 O  O   . HOH K 8 .   ? 19.337  -24.824 44.488  1.00 39.27 ? 2029 HOH D O   1 
HETATM 6030 O  O   . HOH K 8 .   ? 2.293   -35.106 19.149  1.00 19.80 ? 2030 HOH D O   1 
HETATM 6031 O  O   . HOH K 8 .   ? 2.050   -38.028 15.570  1.00 20.25 ? 2031 HOH D O   1 
HETATM 6032 O  O   . HOH K 8 .   ? 10.609  -32.989 13.194  1.00 32.95 ? 2032 HOH D O   1 
HETATM 6033 O  O   . HOH K 8 .   ? 2.440   -22.187 3.333   1.00 11.91 ? 2033 HOH D O   1 
HETATM 6034 O  O   . HOH K 8 .   ? 5.212   -26.263 1.281   1.00 35.40 ? 2034 HOH D O   1 
HETATM 6035 O  O   . HOH K 8 .   ? 7.182   -18.917 1.736   1.00 29.43 ? 2035 HOH D O   1 
HETATM 6036 O  O   . HOH K 8 .   ? 4.992   -23.077 -3.571  1.00 40.68 ? 2036 HOH D O   1 
HETATM 6037 O  O   . HOH K 8 .   ? 9.547   -24.828 -0.704  1.00 47.02 ? 2037 HOH D O   1 
HETATM 6038 O  O   . HOH K 8 .   ? 12.153  -30.203 6.035   1.00 32.64 ? 2038 HOH D O   1 
HETATM 6039 O  O   . HOH K 8 .   ? 11.074  -26.143 20.100  1.00 20.77 ? 2039 HOH D O   1 
HETATM 6040 O  O   . HOH K 8 .   ? 2.791   -23.864 17.384  1.00 27.02 ? 2040 HOH D O   1 
HETATM 6041 O  O   . HOH K 8 .   ? -3.123  -37.460 22.790  1.00 14.55 ? 2041 HOH D O   1 
HETATM 6042 O  O   . HOH K 8 .   ? 5.334   -40.176 18.341  1.00 36.69 ? 2042 HOH D O   1 
HETATM 6043 O  O   . HOH K 8 .   ? 2.338   -42.031 21.138  1.00 12.59 ? 2043 HOH D O   1 
HETATM 6044 O  O   . HOH K 8 .   ? 3.738   -42.369 23.607  1.00 24.98 ? 2044 HOH D O   1 
HETATM 6045 O  O   . HOH K 8 .   ? 0.759   -40.960 22.965  1.00 30.61 ? 2045 HOH D O   1 
HETATM 6046 O  O   . HOH K 8 .   ? 8.150   -45.170 34.250  1.00 32.70 ? 2046 HOH D O   1 
HETATM 6047 O  O   . HOH K 8 .   ? 8.265   -41.563 37.062  1.00 35.57 ? 2047 HOH D O   1 
HETATM 6048 O  O   . HOH K 8 .   ? 11.121  -39.167 42.608  1.00 32.35 ? 2048 HOH D O   1 
HETATM 6049 O  O   . HOH L 8 .   ? 1.840   -42.920 47.005  1.00 31.02 ? 2001 HOH E O   1 
HETATM 6050 O  O   . HOH L 8 .   ? -11.567 -59.646 52.257  1.00 35.44 ? 2002 HOH E O   1 
HETATM 6051 O  O   . HOH L 8 .   ? -15.165 -46.137 53.980  1.00 31.78 ? 2003 HOH E O   1 
HETATM 6052 O  O   . HOH L 8 .   ? -9.677  -44.201 47.710  1.00 43.00 ? 2004 HOH E O   1 
HETATM 6053 O  O   . HOH L 8 .   ? 1.407   -31.746 51.244  1.00 35.92 ? 2005 HOH E O   1 
HETATM 6054 O  O   . HOH L 8 .   ? 10.789  -33.746 50.897  1.00 28.15 ? 2006 HOH E O   1 
HETATM 6055 O  O   . HOH L 8 .   ? 5.909   -33.724 46.253  1.00 27.82 ? 2007 HOH E O   1 
HETATM 6056 O  O   . HOH L 8 .   ? 9.785   -34.194 48.435  1.00 33.22 ? 2008 HOH E O   1 
HETATM 6057 O  O   . HOH L 8 .   ? -3.134  -38.575 54.484  1.00 33.12 ? 2009 HOH E O   1 
HETATM 6058 O  O   . HOH L 8 .   ? 4.570   -55.275 40.625  1.00 46.63 ? 2010 HOH E O   1 
HETATM 6059 O  O   . HOH L 8 .   ? -3.258  -61.996 67.074  1.00 39.19 ? 2011 HOH E O   1 
HETATM 6060 O  O   . HOH M 8 .   ? 25.524  11.196  -8.299  1.00 30.72 ? 2001 HOH P O   1 
HETATM 6061 O  O   . HOH M 8 .   ? 23.968  14.375  -12.449 1.00 35.43 ? 2002 HOH P O   1 
HETATM 6062 O  O   . HOH M 8 .   ? 26.729  3.142   -11.843 1.00 45.96 ? 2003 HOH P O   1 
HETATM 6063 O  O   . HOH M 8 .   ? 19.995  8.964   -14.616 1.00 26.72 ? 2004 HOH P O   1 
HETATM 6064 O  O   . HOH M 8 .   ? 15.312  -1.841  -9.179  1.00 39.28 ? 2005 HOH P O   1 
HETATM 6065 O  O   . HOH M 8 .   ? 16.069  13.318  -16.222 1.00 38.45 ? 2006 HOH P O   1 
HETATM 6066 O  O   . HOH M 8 .   ? 28.094  20.202  4.179   1.00 22.21 ? 2007 HOH P O   1 
HETATM 6067 O  O   . HOH M 8 .   ? 21.318  23.037  9.755   1.00 35.91 ? 2008 HOH P O   1 
HETATM 6068 O  O   . HOH M 8 .   ? 13.795  22.711  12.073  1.00 24.97 ? 2009 HOH P O   1 
HETATM 6069 O  O   . HOH M 8 .   ? 6.382   27.488  10.981  1.00 13.84 ? 2010 HOH P O   1 
HETATM 6070 O  O   . HOH M 8 .   ? 9.047   32.927  7.742   1.00 26.48 ? 2011 HOH P O   1 
HETATM 6071 O  O   . HOH M 8 .   ? 4.858   28.283  9.272   1.00 26.21 ? 2012 HOH P O   1 
HETATM 6072 O  O   . HOH M 8 .   ? 6.456   23.887  3.515   1.00 16.61 ? 2013 HOH P O   1 
HETATM 6073 O  O   . HOH M 8 .   ? 6.652   27.717  -2.346  1.00 19.65 ? 2014 HOH P O   1 
HETATM 6074 O  O   . HOH M 8 .   ? 4.667   36.234  -8.277  1.00 36.01 ? 2015 HOH P O   1 
HETATM 6075 O  O   . HOH M 8 .   ? 13.535  36.164  -6.434  1.00 44.99 ? 2016 HOH P O   1 
HETATM 6076 O  O   . HOH M 8 .   ? 3.647   25.886  -12.115 1.00 20.28 ? 2017 HOH P O   1 
HETATM 6077 O  O   . HOH M 8 .   ? 3.427   24.401  -7.643  1.00 19.50 ? 2018 HOH P O   1 
HETATM 6078 O  O   . HOH M 8 .   ? 6.793   18.986  6.218   1.00 40.23 ? 2019 HOH P O   1 
HETATM 6079 O  O   . HOH M 8 .   ? 9.844   17.852  9.555   1.00 38.62 ? 2020 HOH P O   1 
HETATM 6080 O  O   . HOH M 8 .   ? 12.153  19.666  9.905   1.00 18.18 ? 2021 HOH P O   1 
HETATM 6081 O  O   . HOH M 8 .   ? 24.028  19.762  11.250  1.00 27.65 ? 2022 HOH P O   1 
HETATM 6082 O  O   . HOH M 8 .   ? 5.160   20.046  -3.426  1.00 42.05 ? 2023 HOH P O   1 
HETATM 6083 O  O   . HOH M 8 .   ? 6.959   22.905  -7.847  1.00 23.79 ? 2024 HOH P O   1 
HETATM 6084 O  O   . HOH M 8 .   ? 10.214  17.690  -11.490 1.00 27.61 ? 2025 HOH P O   1 
HETATM 6085 O  O   . HOH M 8 .   ? 15.169  27.506  -11.436 1.00 22.32 ? 2026 HOH P O   1 
HETATM 6086 O  O   . HOH M 8 .   ? 16.399  23.951  -13.123 1.00 31.66 ? 2027 HOH P O   1 
HETATM 6087 O  O   . HOH M 8 .   ? 26.644  28.442  -2.688  1.00 34.24 ? 2028 HOH P O   1 
HETATM 6088 O  O   . HOH M 8 .   ? 25.544  11.986  -5.067  1.00 28.50 ? 2029 HOH P O   1 
HETATM 6089 O  O   . HOH M 8 .   ? 19.968  10.325  -3.603  1.00 20.92 ? 2030 HOH P O   1 
HETATM 6090 O  O   . HOH M 8 .   ? 18.510  10.716  -7.909  1.00 17.32 ? 2031 HOH P O   1 
HETATM 6091 O  O   . HOH M 8 .   ? 15.552  16.150  -11.215 1.00 19.86 ? 2032 HOH P O   1 
HETATM 6092 O  O   . HOH M 8 .   ? 11.200  11.121  -1.762  1.00 14.73 ? 2033 HOH P O   1 
HETATM 6093 O  O   . HOH M 8 .   ? 19.429  4.769   -5.161  1.00 19.33 ? 2034 HOH P O   1 
HETATM 6094 O  O   . HOH M 8 .   ? 12.418  4.264   -3.557  1.00 22.26 ? 2035 HOH P O   1 
HETATM 6095 O  O   . HOH M 8 .   ? 16.175  30.272  -12.488 1.00 42.78 ? 2036 HOH P O   1 
HETATM 6096 O  O   . HOH M 8 .   ? 20.507  21.466  -13.456 1.00 36.11 ? 2037 HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   153 ?   ?   ?   A . n 
A 1 2   ILE 2   154 ?   ?   ?   A . n 
A 1 3   PRO 3   155 155 PRO PRO A . n 
A 1 4   TRP 4   156 156 TRP TRP A . n 
A 1 5   ASN 5   157 157 ASN ASN A . n 
A 1 6   LEU 6   158 ?   ?   ?   A . n 
A 1 7   GLU 7   159 ?   ?   ?   A . n 
A 1 8   ARG 8   160 ?   ?   ?   A . n 
A 1 9   ILE 9   161 ?   ?   ?   A . n 
A 1 10  THR 10  162 ?   ?   ?   A . n 
A 1 11  PRO 11  163 ?   ?   ?   A . n 
A 1 12  PRO 12  164 ?   ?   ?   A . n 
A 1 13  ARG 13  165 ?   ?   ?   A . n 
A 1 14  TYR 14  166 ?   ?   ?   A . n 
A 1 15  ARG 15  167 ?   ?   ?   A . n 
A 1 16  ALA 16  168 ?   ?   ?   A . n 
A 1 17  ASP 17  169 ?   ?   ?   A . n 
A 1 18  GLU 18  170 ?   ?   ?   A . n 
A 1 19  TYR 19  171 ?   ?   ?   A . n 
A 1 20  GLN 20  172 ?   ?   ?   A . n 
A 1 21  PRO 21  173 ?   ?   ?   A . n 
A 1 22  PRO 22  174 ?   ?   ?   A . n 
A 1 23  ASP 23  175 ?   ?   ?   A . n 
A 1 24  GLY 24  176 ?   ?   ?   A . n 
A 1 25  GLY 25  177 ?   ?   ?   A . n 
A 1 26  SER 26  178 178 SER SER A . n 
A 1 27  LEU 27  179 179 LEU LEU A . n 
A 1 28  VAL 28  180 180 VAL VAL A . n 
A 1 29  GLU 29  181 181 GLU GLU A . n 
A 1 30  VAL 30  182 182 VAL VAL A . n 
A 1 31  TYR 31  183 183 TYR TYR A . n 
A 1 32  LEU 32  184 184 LEU LEU A . n 
A 1 33  LEU 33  185 185 LEU LEU A . n 
A 1 34  ASP 34  186 186 ASP ASP A . n 
A 1 35  THR 35  187 187 THR THR A . n 
A 1 36  SER 36  188 188 SER SER A . n 
A 1 37  ILE 37  189 189 ILE ILE A . n 
A 1 38  GLN 38  190 190 GLN GLN A . n 
A 1 39  SER 39  191 191 SER SER A . n 
A 1 40  ASP 40  192 192 ASP ASP A . n 
A 1 41  HIS 41  193 193 HIS HIS A . n 
A 1 42  ARG 42  194 194 ARG ARG A . n 
A 1 43  GLU 43  195 195 GLU GLU A . n 
A 1 44  ILE 44  196 196 ILE ILE A . n 
A 1 45  GLU 45  197 197 GLU GLU A . n 
A 1 46  GLY 46  198 198 GLY GLY A . n 
A 1 47  ARG 47  199 199 ARG ARG A . n 
A 1 48  VAL 48  200 200 VAL VAL A . n 
A 1 49  MET 49  201 201 MET MET A . n 
A 1 50  VAL 50  202 202 VAL VAL A . n 
A 1 51  THR 51  203 203 THR THR A . n 
A 1 52  ASP 52  204 204 ASP ASP A . n 
A 1 53  PHE 53  205 205 PHE PHE A . n 
A 1 54  GLU 54  206 206 GLU GLU A . n 
A 1 55  ASN 55  207 207 ASN ASN A . n 
A 1 56  VAL 56  208 208 VAL VAL A . n 
A 1 57  PRO 57  209 209 PRO PRO A . n 
A 1 58  GLU 58  210 210 GLU GLU A . n 
A 1 59  GLU 59  211 211 GLU GLU A . n 
A 1 60  ASP 60  212 212 ASP ASP A . n 
A 1 61  GLY 61  213 ?   ?   ?   A . n 
A 1 62  THR 62  214 ?   ?   ?   A . n 
A 1 63  ARG 63  215 ?   ?   ?   A . n 
A 1 64  PHE 64  216 ?   ?   ?   A . n 
A 1 65  HIS 65  217 ?   ?   ?   A . n 
A 1 66  ARG 66  218 ?   ?   ?   A . n 
A 1 67  GLN 67  219 219 GLN GLN A . n 
A 1 68  ALA 68  220 220 ALA ALA A . n 
A 1 69  SER 69  221 221 SER SER A . n 
A 1 70  LYS 70  222 222 LYS LYS A . n 
A 1 71  CYS 71  223 223 CYS CYS A . n 
A 1 72  ASP 72  224 224 ASP ASP A . n 
A 1 73  SER 73  225 225 SER SER A . n 
A 1 74  HIS 74  226 226 HIS HIS A . n 
A 1 75  GLY 75  227 227 GLY GLY A . n 
A 1 76  THR 76  228 228 THR THR A . n 
A 1 77  HIS 77  229 229 HIS HIS A . n 
A 1 78  LEU 78  230 230 LEU LEU A . n 
A 1 79  ALA 79  231 231 ALA ALA A . n 
A 1 80  GLY 80  232 232 GLY GLY A . n 
A 1 81  VAL 81  233 233 VAL VAL A . n 
A 1 82  VAL 82  234 234 VAL VAL A . n 
A 1 83  SER 83  235 235 SER SER A . n 
A 1 84  GLY 84  236 236 GLY GLY A . n 
A 1 85  ARG 85  237 237 ARG ARG A . n 
A 1 86  ASP 86  238 238 ASP ASP A . n 
A 1 87  ALA 87  239 239 ALA ALA A . n 
A 1 88  GLY 88  240 240 GLY GLY A . n 
A 1 89  VAL 89  241 241 VAL VAL A . n 
A 1 90  ALA 90  242 242 ALA ALA A . n 
A 1 91  LYS 91  243 243 LYS LYS A . n 
A 1 92  GLY 92  244 244 GLY GLY A . n 
A 1 93  ALA 93  245 245 ALA ALA A . n 
A 1 94  SER 94  246 246 SER SER A . n 
A 1 95  MET 95  247 247 MET MET A . n 
A 1 96  ARG 96  248 248 ARG ARG A . n 
A 1 97  SER 97  249 249 SER SER A . n 
A 1 98  LEU 98  250 250 LEU LEU A . n 
A 1 99  ARG 99  251 251 ARG ARG A . n 
A 1 100 VAL 100 252 252 VAL VAL A . n 
A 1 101 LEU 101 253 253 LEU LEU A . n 
A 1 102 ASN 102 254 254 ASN ASN A . n 
A 1 103 CYS 103 255 255 CYS CYS A . n 
A 1 104 GLN 104 256 256 GLN GLN A . n 
A 1 105 GLY 105 257 257 GLY GLY A . n 
A 1 106 LYS 106 258 258 LYS LYS A . n 
A 1 107 GLY 107 259 259 GLY GLY A . n 
A 1 108 THR 108 260 260 THR THR A . n 
A 1 109 VAL 109 261 261 VAL VAL A . n 
A 1 110 SER 110 262 262 SER SER A . n 
A 1 111 GLY 111 263 263 GLY GLY A . n 
A 1 112 THR 112 264 264 THR THR A . n 
A 1 113 LEU 113 265 265 LEU LEU A . n 
A 1 114 ILE 114 266 266 ILE ILE A . n 
A 1 115 GLY 115 267 267 GLY GLY A . n 
A 1 116 LEU 116 268 268 LEU LEU A . n 
A 1 117 GLU 117 269 269 GLU GLU A . n 
A 1 118 PHE 118 270 270 PHE PHE A . n 
A 1 119 ILE 119 271 271 ILE ILE A . n 
A 1 120 ARG 120 272 272 ARG ARG A . n 
A 1 121 LYS 121 273 273 LYS LYS A . n 
A 1 122 SER 122 274 274 SER SER A . n 
A 1 123 GLN 123 275 275 GLN GLN A . n 
A 1 124 LEU 124 276 276 LEU LEU A . n 
A 1 125 VAL 125 277 277 VAL VAL A . n 
A 1 126 GLN 126 278 278 GLN GLN A . n 
A 1 127 PRO 127 279 279 PRO PRO A . n 
A 1 128 VAL 128 280 280 VAL VAL A . n 
A 1 129 GLY 129 281 281 GLY GLY A . n 
A 1 130 PRO 130 282 282 PRO PRO A . n 
A 1 131 LEU 131 283 283 LEU LEU A . n 
A 1 132 VAL 132 284 284 VAL VAL A . n 
A 1 133 VAL 133 285 285 VAL VAL A . n 
A 1 134 LEU 134 286 286 LEU LEU A . n 
A 1 135 LEU 135 287 287 LEU LEU A . n 
A 1 136 PRO 136 288 288 PRO PRO A . n 
A 1 137 LEU 137 289 289 LEU LEU A . n 
A 1 138 ALA 138 290 290 ALA ALA A . n 
A 1 139 GLY 139 291 291 GLY GLY A . n 
A 1 140 GLY 140 292 292 GLY GLY A . n 
A 1 141 TYR 141 293 293 TYR TYR A . n 
A 1 142 SER 142 294 294 SER SER A . n 
A 1 143 ARG 143 295 295 ARG ARG A . n 
A 1 144 VAL 144 296 296 VAL VAL A . n 
A 1 145 LEU 145 297 297 LEU LEU A . n 
A 1 146 ASN 146 298 298 ASN ASN A . n 
A 1 147 ALA 147 299 299 ALA ALA A . n 
A 1 148 ALA 148 300 300 ALA ALA A . n 
A 1 149 CYS 149 301 301 CYS CYS A . n 
A 1 150 GLN 150 302 302 GLN GLN A . n 
A 1 151 ARG 151 303 303 ARG ARG A . n 
A 1 152 LEU 152 304 304 LEU LEU A . n 
A 1 153 ALA 153 305 305 ALA ALA A . n 
A 1 154 ARG 154 306 306 ARG ARG A . n 
A 1 155 ALA 155 307 307 ALA ALA A . n 
A 1 156 GLY 156 308 308 GLY GLY A . n 
A 1 157 VAL 157 309 309 VAL VAL A . n 
A 1 158 VAL 158 310 310 VAL VAL A . n 
A 1 159 LEU 159 311 311 LEU LEU A . n 
A 1 160 VAL 160 312 312 VAL VAL A . n 
A 1 161 THR 161 313 313 THR THR A . n 
A 1 162 ALA 162 314 314 ALA ALA A . n 
A 1 163 ALA 163 315 315 ALA ALA A . n 
A 1 164 GLY 164 316 316 GLY GLY A . n 
A 1 165 ASN 165 317 317 ASN ASN A . n 
A 1 166 PHE 166 318 318 PHE PHE A . n 
A 1 167 ARG 167 319 319 ARG ARG A . n 
A 1 168 ASP 168 320 320 ASP ASP A . n 
A 1 169 ASP 169 321 321 ASP ASP A . n 
A 1 170 ALA 170 322 322 ALA ALA A . n 
A 1 171 CYS 171 323 323 CYS CYS A . n 
A 1 172 LEU 172 324 324 LEU LEU A . n 
A 1 173 TYR 173 325 325 TYR TYR A . n 
A 1 174 SER 174 326 326 SER SER A . n 
A 1 175 PRO 175 327 327 PRO PRO A . n 
A 1 176 ALA 176 328 328 ALA ALA A . n 
A 1 177 SER 177 329 329 SER SER A . n 
A 1 178 ALA 178 330 330 ALA ALA A . n 
A 1 179 PRO 179 331 331 PRO PRO A . n 
A 1 180 GLU 180 332 332 GLU GLU A . n 
A 1 181 VAL 181 333 333 VAL VAL A . n 
A 1 182 ILE 182 334 334 ILE ILE A . n 
A 1 183 THR 183 335 335 THR THR A . n 
A 1 184 VAL 184 336 336 VAL VAL A . n 
A 1 185 GLY 185 337 337 GLY GLY A . n 
A 1 186 ALA 186 338 338 ALA ALA A . n 
A 1 187 THR 187 339 339 THR THR A . n 
A 1 188 ASN 188 340 340 ASN ASN A . n 
A 1 189 ALA 189 341 341 ALA ALA A . n 
A 1 190 GLN 190 342 342 GLN GLN A . n 
A 1 191 ASP 191 343 343 ASP ASP A . n 
A 1 192 GLN 192 344 344 GLN GLN A . n 
A 1 193 PRO 193 345 345 PRO PRO A . n 
A 1 194 VAL 194 346 346 VAL VAL A . n 
A 1 195 THR 195 347 347 THR THR A . n 
A 1 196 LEU 196 348 348 LEU LEU A . n 
A 1 197 GLY 197 349 349 GLY GLY A . n 
A 1 198 THR 198 350 350 THR THR A . n 
A 1 199 LEU 199 351 351 LEU LEU A . n 
A 1 200 GLY 200 352 352 GLY GLY A . n 
A 1 201 THR 201 353 353 THR THR A . n 
A 1 202 ASN 202 354 354 ASN ASN A . n 
A 1 203 PHE 203 355 355 PHE PHE A . n 
A 1 204 GLY 204 356 356 GLY GLY A . n 
A 1 205 ARG 205 357 357 ARG ARG A . n 
A 1 206 CYS 206 358 358 CYS CYS A . n 
A 1 207 VAL 207 359 359 VAL VAL A . n 
A 1 208 ASP 208 360 360 ASP ASP A . n 
A 1 209 LEU 209 361 361 LEU LEU A . n 
A 1 210 PHE 210 362 362 PHE PHE A . n 
A 1 211 ALA 211 363 363 ALA ALA A . n 
A 1 212 PRO 212 364 364 PRO PRO A . n 
A 1 213 GLY 213 365 365 GLY GLY A . n 
A 1 214 GLU 214 366 366 GLU GLU A . n 
A 1 215 ASP 215 367 367 ASP ASP A . n 
A 1 216 ILE 216 368 368 ILE ILE A . n 
A 1 217 ILE 217 369 369 ILE ILE A . n 
A 1 218 GLY 218 370 370 GLY GLY A . n 
A 1 219 ALA 219 371 371 ALA ALA A . n 
A 1 220 SER 220 372 372 SER SER A . n 
A 1 221 SER 221 373 373 SER SER A . n 
A 1 222 ASP 222 374 374 ASP ASP A . n 
A 1 223 CYS 223 375 375 CYS CYS A . n 
A 1 224 SER 224 376 376 SER SER A . n 
A 1 225 THR 225 377 377 THR THR A . n 
A 1 226 CYS 226 378 378 CYS CYS A . n 
A 1 227 PHE 227 379 379 PHE PHE A . n 
A 1 228 VAL 228 380 380 VAL VAL A . n 
A 1 229 SER 229 381 381 SER SER A . n 
A 1 230 GLN 230 382 382 GLN GLN A . n 
A 1 231 SER 231 383 383 SER SER A . n 
A 1 232 GLY 232 384 384 GLY GLY A . n 
A 1 233 THR 233 385 385 THR THR A . n 
A 1 234 SER 234 386 386 SER SER A . n 
A 1 235 GLN 235 387 387 GLN GLN A . n 
A 1 236 ALA 236 388 388 ALA ALA A . n 
A 1 237 ALA 237 389 389 ALA ALA A . n 
A 1 238 ALA 238 390 390 ALA ALA A . n 
A 1 239 HIS 239 391 391 HIS HIS A . n 
A 1 240 VAL 240 392 392 VAL VAL A . n 
A 1 241 ALA 241 393 393 ALA ALA A . n 
A 1 242 GLY 242 394 394 GLY GLY A . n 
A 1 243 ILE 243 395 395 ILE ILE A . n 
A 1 244 ALA 244 396 396 ALA ALA A . n 
A 1 245 ALA 245 397 397 ALA ALA A . n 
A 1 246 MET 246 398 398 MET MET A . n 
A 1 247 MET 247 399 399 MET MET A . n 
A 1 248 LEU 248 400 400 LEU LEU A . n 
A 1 249 SER 249 401 401 SER SER A . n 
A 1 250 ALA 250 402 402 ALA ALA A . n 
A 1 251 GLU 251 403 403 GLU GLU A . n 
A 1 252 PRO 252 404 404 PRO PRO A . n 
A 1 253 GLU 253 405 405 GLU GLU A . n 
A 1 254 LEU 254 406 406 LEU LEU A . n 
A 1 255 THR 255 407 407 THR THR A . n 
A 1 256 LEU 256 408 408 LEU LEU A . n 
A 1 257 ALA 257 409 409 ALA ALA A . n 
A 1 258 GLU 258 410 410 GLU GLU A . n 
A 1 259 LEU 259 411 411 LEU LEU A . n 
A 1 260 ARG 260 412 412 ARG ARG A . n 
A 1 261 GLN 261 413 413 GLN GLN A . n 
A 1 262 ARG 262 414 414 ARG ARG A . n 
A 1 263 LEU 263 415 415 LEU LEU A . n 
A 1 264 ILE 264 416 416 ILE ILE A . n 
A 1 265 LEU 265 417 417 LEU LEU A . n 
A 1 266 PHE 266 418 418 PHE PHE A . n 
A 1 267 SER 267 419 419 SER SER A . n 
A 1 268 ALA 268 420 420 ALA ALA A . n 
A 1 269 LYS 269 421 421 LYS LYS A . n 
A 1 270 ASP 270 422 422 ASP ASP A . n 
A 1 271 VAL 271 423 ?   ?   ?   A . n 
A 1 272 ILE 272 424 ?   ?   ?   A . n 
A 1 273 ASN 273 425 ?   ?   ?   A . n 
A 1 274 GLU 274 426 ?   ?   ?   A . n 
A 1 275 ALA 275 427 ?   ?   ?   A . n 
A 1 276 TRP 276 428 ?   ?   ?   A . n 
A 1 277 PHE 277 429 ?   ?   ?   A . n 
A 1 278 PRO 278 430 ?   ?   ?   A . n 
A 1 279 GLU 279 431 ?   ?   ?   A . n 
A 1 280 ASP 280 432 ?   ?   ?   A . n 
A 1 281 GLN 281 433 ?   ?   ?   A . n 
A 1 282 ARG 282 434 ?   ?   ?   A . n 
A 1 283 VAL 283 435 ?   ?   ?   A . n 
A 1 284 LEU 284 436 ?   ?   ?   A . n 
A 1 285 THR 285 437 ?   ?   ?   A . n 
A 1 286 PRO 286 438 ?   ?   ?   A . n 
A 1 287 ASN 287 439 ?   ?   ?   A . n 
A 1 288 LEU 288 440 ?   ?   ?   A . n 
A 1 289 VAL 289 441 ?   ?   ?   A . n 
A 1 290 ALA 290 442 ?   ?   ?   A . n 
A 1 291 ALA 291 443 ?   ?   ?   A . n 
A 1 292 LEU 292 444 ?   ?   ?   A . n 
A 1 293 PRO 293 445 ?   ?   ?   A . n 
A 1 294 PRO 294 446 ?   ?   ?   A . n 
A 1 295 SER 295 447 ?   ?   ?   A . n 
A 1 296 THR 296 448 ?   ?   ?   A . n 
A 1 297 HIS 297 449 ?   ?   ?   A . n 
A 1 298 GLY 298 450 ?   ?   ?   A . n 
A 1 299 ALA 299 451 ?   ?   ?   A . n 
A 1 300 ALA 300 452 ?   ?   ?   A . n 
A 1 301 GLY 301 453 ?   ?   ?   A . n 
A 1 302 THR 302 454 ?   ?   ?   A . n 
A 1 303 ALA 303 455 ?   ?   ?   A . n 
A 1 304 ALA 304 456 ?   ?   ?   A . n 
A 1 305 ALA 305 457 ?   ?   ?   A . n 
A 1 306 SER 306 458 ?   ?   ?   A . n 
A 1 307 HIS 307 459 ?   ?   ?   A . n 
A 1 308 HIS 308 460 ?   ?   ?   A . n 
A 1 309 HIS 309 461 ?   ?   ?   A . n 
A 1 310 HIS 310 462 ?   ?   ?   A . n 
A 1 311 HIS 311 463 ?   ?   ?   A . n 
A 1 312 HIS 312 464 ?   ?   ?   A . n 
B 2 1   ASP 1   1   1   ASP ASP B . n 
B 2 2   ILE 2   2   2   ILE ILE B . n 
B 2 3   GLN 3   3   3   GLN GLN B . n 
B 2 4   MET 4   4   4   MET MET B . n 
B 2 5   THR 5   5   5   THR THR B . n 
B 2 6   GLN 6   6   6   GLN GLN B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   PRO 8   8   8   PRO PRO B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  SER 10  10  10  SER SER B . n 
B 2 11  LEU 11  11  11  LEU LEU B . n 
B 2 12  SER 12  12  12  SER SER B . n 
B 2 13  ALA 13  13  13  ALA ALA B . n 
B 2 14  SER 14  14  14  SER SER B . n 
B 2 15  VAL 15  15  15  VAL VAL B . n 
B 2 16  GLY 16  16  16  GLY GLY B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  ARG 18  18  18  ARG ARG B . n 
B 2 19  VAL 19  19  19  VAL VAL B . n 
B 2 20  THR 20  20  20  THR THR B . n 
B 2 21  ILE 21  21  21  ILE ILE B . n 
B 2 22  THR 22  22  22  THR THR B . n 
B 2 23  CYS 23  23  23  CYS CYS B . n 
B 2 24  ARG 24  24  24  ARG ARG B . n 
B 2 25  ALA 25  25  25  ALA ALA B . n 
B 2 26  SER 26  26  26  SER SER B . n 
B 2 27  GLN 27  27  27  GLN GLN B . n 
B 2 28  GLY 28  28  28  GLY GLY B . n 
B 2 29  ILE 29  29  29  ILE ILE B . n 
B 2 30  ARG 30  30  30  ARG ARG B . n 
B 2 31  SER 31  31  31  SER SER B . n 
B 2 32  ALA 32  32  32  ALA ALA B . n 
B 2 33  LEU 33  33  33  LEU LEU B . n 
B 2 34  ASN 34  34  34  ASN ASN B . n 
B 2 35  TRP 35  35  35  TRP TRP B . n 
B 2 36  TYR 36  36  36  TYR TYR B . n 
B 2 37  GLN 37  37  37  GLN GLN B . n 
B 2 38  GLN 38  38  38  GLN GLN B . n 
B 2 39  LYS 39  39  39  LYS LYS B . n 
B 2 40  PRO 40  40  40  PRO PRO B . n 
B 2 41  GLY 41  41  41  GLY GLY B . n 
B 2 42  LYS 42  42  42  LYS LYS B . n 
B 2 43  ALA 43  43  43  ALA ALA B . n 
B 2 44  PRO 44  44  44  PRO PRO B . n 
B 2 45  LYS 45  45  45  LYS LYS B . n 
B 2 46  LEU 46  46  46  LEU LEU B . n 
B 2 47  LEU 47  47  47  LEU LEU B . n 
B 2 48  ILE 48  48  48  ILE ILE B . n 
B 2 49  TYR 49  49  49  TYR TYR B . n 
B 2 50  ASN 50  50  50  ASN ASN B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  SER 52  52  52  SER SER B . n 
B 2 53  THR 53  53  53  THR THR B . n 
B 2 54  LEU 54  54  54  LEU LEU B . n 
B 2 55  GLN 55  55  55  GLN GLN B . n 
B 2 56  SER 56  56  56  SER SER B . n 
B 2 57  GLY 57  57  57  GLY GLY B . n 
B 2 58  VAL 58  58  58  VAL VAL B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  SER 60  60  60  SER SER B . n 
B 2 61  ARG 61  61  61  ARG ARG B . n 
B 2 62  PHE 62  62  62  PHE PHE B . n 
B 2 63  SER 63  63  63  SER SER B . n 
B 2 64  GLY 64  64  64  GLY GLY B . n 
B 2 65  SER 65  65  65  SER SER B . n 
B 2 66  GLY 66  66  66  GLY GLY B . n 
B 2 67  SER 67  67  67  SER SER B . n 
B 2 68  GLY 68  68  68  GLY GLY B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  ASP 70  70  70  ASP ASP B . n 
B 2 71  PHE 71  71  71  PHE PHE B . n 
B 2 72  THR 72  72  72  THR THR B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  THR 74  74  74  THR THR B . n 
B 2 75  ILE 75  75  75  ILE ILE B . n 
B 2 76  SER 76  76  76  SER SER B . n 
B 2 77  SER 77  77  77  SER SER B . n 
B 2 78  LEU 78  78  78  LEU LEU B . n 
B 2 79  GLN 79  79  79  GLN GLN B . n 
B 2 80  PRO 80  80  80  PRO PRO B . n 
B 2 81  GLU 81  81  81  GLU GLU B . n 
B 2 82  ASP 82  82  82  ASP ASP B . n 
B 2 83  PHE 83  83  83  PHE PHE B . n 
B 2 84  ALA 84  84  84  ALA ALA B . n 
B 2 85  VAL 85  85  85  VAL VAL B . n 
B 2 86  TYR 86  86  86  TYR TYR B . n 
B 2 87  TYR 87  87  87  TYR TYR B . n 
B 2 88  CYS 88  88  88  CYS CYS B . n 
B 2 89  GLN 89  89  89  GLN GLN B . n 
B 2 90  GLN 90  90  90  GLN GLN B . n 
B 2 91  PHE 91  91  91  PHE PHE B . n 
B 2 92  ASP 92  92  92  ASP ASP B . n 
B 2 93  GLY 93  93  93  GLY GLY B . n 
B 2 94  ASP 94  94  94  ASP ASP B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  THR 96  96  96  THR THR B . n 
B 2 97  PHE 97  97  97  PHE PHE B . n 
B 2 98  GLY 98  98  98  GLY GLY B . n 
B 2 99  GLN 99  99  99  GLN GLN B . n 
B 2 100 GLY 100 100 100 GLY GLY B . n 
B 2 101 THR 101 101 101 THR THR B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 VAL 103 103 103 VAL VAL B . n 
B 2 104 GLU 104 104 104 GLU GLU B . n 
B 2 105 ILE 105 105 105 ILE ILE B . n 
B 2 106 LYS 106 106 106 LYS LYS B . n 
B 2 107 ARG 107 107 107 ARG ARG B . n 
C 3 1   THR 1   108 108 THR THR C . n 
C 3 2   VAL 2   109 109 VAL VAL C . n 
C 3 3   ALA 3   110 110 ALA ALA C . n 
C 3 4   ALA 4   111 111 ALA ALA C . n 
C 3 5   PRO 5   112 112 PRO PRO C . n 
C 3 6   SER 6   113 113 SER SER C . n 
C 3 7   VAL 7   114 114 VAL VAL C . n 
C 3 8   PHE 8   115 115 PHE PHE C . n 
C 3 9   ILE 9   116 116 ILE ILE C . n 
C 3 10  PHE 10  117 117 PHE PHE C . n 
C 3 11  PRO 11  118 118 PRO PRO C . n 
C 3 12  PRO 12  119 119 PRO PRO C . n 
C 3 13  SER 13  120 120 SER SER C . n 
C 3 14  ASP 14  121 121 ASP ASP C . n 
C 3 15  GLU 15  122 122 GLU GLU C . n 
C 3 16  GLN 16  123 123 GLN GLN C . n 
C 3 17  LEU 17  124 124 LEU LEU C . n 
C 3 18  LYS 18  125 125 LYS LYS C . n 
C 3 19  SER 19  126 126 SER SER C . n 
C 3 20  GLY 20  127 127 GLY GLY C . n 
C 3 21  THR 21  128 128 THR THR C . n 
C 3 22  ALA 22  129 129 ALA ALA C . n 
C 3 23  SER 23  130 130 SER SER C . n 
C 3 24  VAL 24  131 131 VAL VAL C . n 
C 3 25  VAL 25  132 132 VAL VAL C . n 
C 3 26  CYS 26  133 133 CYS CYS C . n 
C 3 27  LEU 27  134 134 LEU LEU C . n 
C 3 28  LEU 28  135 135 LEU LEU C . n 
C 3 29  ASN 29  136 136 ASN ASN C . n 
C 3 30  ASN 30  137 137 ASN ASN C . n 
C 3 31  PHE 31  138 138 PHE PHE C . n 
C 3 32  TYR 32  139 139 TYR TYR C . n 
C 3 33  PRO 33  140 140 PRO PRO C . n 
C 3 34  ARG 34  141 141 ARG ARG C . n 
C 3 35  GLU 35  142 142 GLU GLU C . n 
C 3 36  ALA 36  143 143 ALA ALA C . n 
C 3 37  LYS 37  144 144 LYS LYS C . n 
C 3 38  VAL 38  145 145 VAL VAL C . n 
C 3 39  GLN 39  146 146 GLN GLN C . n 
C 3 40  TRP 40  147 147 TRP TRP C . n 
C 3 41  LYS 41  148 148 LYS LYS C . n 
C 3 42  VAL 42  149 149 VAL VAL C . n 
C 3 43  ASP 43  150 150 ASP ASP C . n 
C 3 44  ASN 44  151 151 ASN ASN C . n 
C 3 45  ALA 45  152 152 ALA ALA C . n 
C 3 46  LEU 46  153 153 LEU LEU C . n 
C 3 47  GLN 47  154 154 GLN GLN C . n 
C 3 48  SER 48  155 155 SER SER C . n 
C 3 49  GLY 49  156 156 GLY GLY C . n 
C 3 50  ASN 50  157 157 ASN ASN C . n 
C 3 51  SER 51  158 158 SER SER C . n 
C 3 52  GLN 52  159 159 GLN GLN C . n 
C 3 53  GLU 53  160 160 GLU GLU C . n 
C 3 54  SER 54  161 161 SER SER C . n 
C 3 55  VAL 55  162 162 VAL VAL C . n 
C 3 56  THR 56  163 163 THR THR C . n 
C 3 57  GLU 57  164 164 GLU GLU C . n 
C 3 58  GLN 58  165 165 GLN GLN C . n 
C 3 59  ASP 59  166 166 ASP ASP C . n 
C 3 60  SER 60  167 167 SER SER C . n 
C 3 61  LYS 61  168 168 LYS LYS C . n 
C 3 62  ASP 62  169 169 ASP ASP C . n 
C 3 63  SER 63  170 170 SER SER C . n 
C 3 64  THR 64  171 171 THR THR C . n 
C 3 65  TYR 65  172 172 TYR TYR C . n 
C 3 66  SER 66  173 173 SER SER C . n 
C 3 67  LEU 67  174 174 LEU LEU C . n 
C 3 68  SER 68  175 175 SER SER C . n 
C 3 69  SER 69  176 176 SER SER C . n 
C 3 70  THR 70  177 177 THR THR C . n 
C 3 71  LEU 71  178 178 LEU LEU C . n 
C 3 72  THR 72  179 179 THR THR C . n 
C 3 73  LEU 73  180 180 LEU LEU C . n 
C 3 74  SER 74  181 181 SER SER C . n 
C 3 75  LYS 75  182 182 LYS LYS C . n 
C 3 76  ALA 76  183 183 ALA ALA C . n 
C 3 77  ASP 77  184 184 ASP ASP C . n 
C 3 78  TYR 78  185 185 TYR TYR C . n 
C 3 79  GLU 79  186 186 GLU GLU C . n 
C 3 80  LYS 80  187 187 LYS LYS C . n 
C 3 81  HIS 81  188 188 HIS HIS C . n 
C 3 82  LYS 82  189 189 LYS LYS C . n 
C 3 83  VAL 83  190 190 VAL VAL C . n 
C 3 84  TYR 84  191 191 TYR TYR C . n 
C 3 85  ALA 85  192 192 ALA ALA C . n 
C 3 86  CYS 86  193 193 CYS CYS C . n 
C 3 87  GLU 87  194 194 GLU GLU C . n 
C 3 88  VAL 88  195 195 VAL VAL C . n 
C 3 89  THR 89  196 196 THR THR C . n 
C 3 90  HIS 90  197 197 HIS HIS C . n 
C 3 91  GLN 91  198 198 GLN GLN C . n 
C 3 92  GLY 92  199 199 GLY GLY C . n 
C 3 93  LEU 93  200 200 LEU LEU C . n 
C 3 94  SER 94  201 201 SER SER C . n 
C 3 95  SER 95  202 202 SER SER C . n 
C 3 96  PRO 96  203 203 PRO PRO C . n 
C 3 97  VAL 97  204 204 VAL VAL C . n 
C 3 98  THR 98  205 205 THR THR C . n 
C 3 99  LYS 99  206 206 LYS LYS C . n 
C 3 100 SER 100 207 207 SER SER C . n 
C 3 101 PHE 101 208 208 PHE PHE C . n 
C 3 102 ASN 102 209 209 ASN ASN C . n 
C 3 103 ARG 103 210 210 ARG ARG C . n 
C 3 104 GLY 104 211 211 GLY GLY C . n 
C 3 105 GLU 105 212 212 GLU GLU C . n 
C 3 106 ALA 106 213 ?   ?   ?   C . n 
D 4 1   GLN 1   1   1   GLN GLN D . n 
D 4 2   VAL 2   2   2   VAL VAL D . n 
D 4 3   GLN 3   3   3   GLN GLN D . n 
D 4 4   LEU 4   4   4   LEU LEU D . n 
D 4 5   VAL 5   5   5   VAL VAL D . n 
D 4 6   GLN 6   6   6   GLN GLN D . n 
D 4 7   SER 7   7   7   SER SER D . n 
D 4 8   GLY 8   8   8   GLY GLY D . n 
D 4 9   ALA 9   9   9   ALA ALA D . n 
D 4 10  GLU 10  10  10  GLU GLU D . n 
D 4 11  VAL 11  11  11  VAL VAL D . n 
D 4 12  LYS 12  12  12  LYS LYS D . n 
D 4 13  LYS 13  13  13  LYS LYS D . n 
D 4 14  PRO 14  14  14  PRO PRO D . n 
D 4 15  GLY 15  15  15  GLY GLY D . n 
D 4 16  SER 16  16  16  SER SER D . n 
D 4 17  SER 17  17  17  SER SER D . n 
D 4 18  VAL 18  18  18  VAL VAL D . n 
D 4 19  LYS 19  19  19  LYS LYS D . n 
D 4 20  VAL 20  20  20  VAL VAL D . n 
D 4 21  SER 21  21  21  SER SER D . n 
D 4 22  CYS 22  22  22  CYS CYS D . n 
D 4 23  LYS 23  23  23  LYS LYS D . n 
D 4 24  ALA 24  24  24  ALA ALA D . n 
D 4 25  SER 25  25  25  SER SER D . n 
D 4 26  GLY 26  26  26  GLY GLY D . n 
D 4 27  GLY 27  27  27  GLY GLY D . n 
D 4 28  THR 28  28  28  THR THR D . n 
D 4 29  PHE 29  29  29  PHE PHE D . n 
D 4 30  ASN 30  30  30  ASN ASN D . n 
D 4 31  SER 31  31  31  SER SER D . n 
D 4 32  HIS 32  32  32  HIS HIS D . n 
D 4 33  ALA 33  33  33  ALA ALA D . n 
D 4 34  ILE 34  34  34  ILE ILE D . n 
D 4 35  SER 35  35  35  SER SER D . n 
D 4 36  TRP 36  36  36  TRP TRP D . n 
D 4 37  VAL 37  37  37  VAL VAL D . n 
D 4 38  ARG 38  38  38  ARG ARG D . n 
D 4 39  GLN 39  39  39  GLN GLN D . n 
D 4 40  ALA 40  40  40  ALA ALA D . n 
D 4 41  PRO 41  41  41  PRO PRO D . n 
D 4 42  GLY 42  42  42  GLY GLY D . n 
D 4 43  GLN 43  43  43  GLN GLN D . n 
D 4 44  GLY 44  44  44  GLY GLY D . n 
D 4 45  LEU 45  45  45  LEU LEU D . n 
D 4 46  GLU 46  46  46  GLU GLU D . n 
D 4 47  TRP 47  47  47  TRP TRP D . n 
D 4 48  MET 48  48  48  MET MET D . n 
D 4 49  GLY 49  49  49  GLY GLY D . n 
D 4 50  GLY 50  50  50  GLY GLY D . n 
D 4 51  ILE 51  51  51  ILE ILE D . n 
D 4 52  ASN 52  52  52  ASN ASN D . n 
D 4 53  PRO 53  53  53  PRO PRO D . n 
D 4 54  ILE 54  54  54  ILE ILE D . n 
D 4 55  LEU 55  55  55  LEU LEU D . n 
D 4 56  GLY 56  56  56  GLY GLY D . n 
D 4 57  ILE 57  57  57  ILE ILE D . n 
D 4 58  ALA 58  58  58  ALA ALA D . n 
D 4 59  ASN 59  59  59  ASN ASN D . n 
D 4 60  TYR 60  60  60  TYR TYR D . n 
D 4 61  ALA 61  61  61  ALA ALA D . n 
D 4 62  GLN 62  62  62  GLN GLN D . n 
D 4 63  LYS 63  63  63  LYS LYS D . n 
D 4 64  PHE 64  64  64  PHE PHE D . n 
D 4 65  GLN 65  65  65  GLN GLN D . n 
D 4 66  GLY 66  66  66  GLY GLY D . n 
D 4 67  ARG 67  67  67  ARG ARG D . n 
D 4 68  VAL 68  68  68  VAL VAL D . n 
D 4 69  THR 69  69  69  THR THR D . n 
D 4 70  ILE 70  70  70  ILE ILE D . n 
D 4 71  THR 71  71  71  THR THR D . n 
D 4 72  ALA 72  72  72  ALA ALA D . n 
D 4 73  ASP 73  73  73  ASP ASP D . n 
D 4 74  GLU 74  74  74  GLU GLU D . n 
D 4 75  SER 75  75  75  SER SER D . n 
D 4 76  THR 76  76  76  THR THR D . n 
D 4 77  SER 77  77  77  SER SER D . n 
D 4 78  THR 78  78  78  THR THR D . n 
D 4 79  ALA 79  79  79  ALA ALA D . n 
D 4 80  TYR 80  80  80  TYR TYR D . n 
D 4 81  MET 81  81  81  MET MET D . n 
D 4 82  GLU 82  82  82  GLU GLU D . n 
D 4 83  LEU 83  83  83  LEU LEU D . n 
D 4 84  SER 84  84  84  SER SER D . n 
D 4 85  SER 85  85  85  SER SER D . n 
D 4 86  LEU 86  86  86  LEU LEU D . n 
D 4 87  ARG 87  87  87  ARG ARG D . n 
D 4 88  SER 88  88  88  SER SER D . n 
D 4 89  GLU 89  89  89  GLU GLU D . n 
D 4 90  ASP 90  90  90  ASP ASP D . n 
D 4 91  THR 91  91  91  THR THR D . n 
D 4 92  ALA 92  92  92  ALA ALA D . n 
D 4 93  VAL 93  93  93  VAL VAL D . n 
D 4 94  TYR 94  94  94  TYR TYR D . n 
D 4 95  TYR 95  95  95  TYR TYR D . n 
D 4 96  CYS 96  96  96  CYS CYS D . n 
D 4 97  ALA 97  97  97  ALA ALA D . n 
D 4 98  ARG 98  98  98  ARG ARG D . n 
D 4 99  HIS 99  99  99  HIS HIS D . n 
D 4 100 TYR 100 100 100 TYR TYR D . n 
D 4 101 GLU 101 101 101 GLU GLU D . n 
D 4 102 ILE 102 102 102 ILE ILE D . n 
D 4 103 GLN 103 103 103 GLN GLN D . n 
D 4 104 ILE 104 104 104 ILE ILE D . n 
D 4 105 GLY 105 105 105 GLY GLY D . n 
D 4 106 ARG 106 106 106 ARG ARG D . n 
D 4 107 TYR 107 107 107 TYR TYR D . n 
D 4 108 GLY 108 108 108 GLY GLY D . n 
D 4 109 MET 109 109 109 MET MET D . n 
D 4 110 ASN 110 110 110 ASN ASN D . n 
D 4 111 VAL 111 111 111 VAL VAL D . n 
D 4 112 TYR 112 112 112 TYR TYR D . n 
D 4 113 TYR 113 113 113 TYR TYR D . n 
D 4 114 LEU 114 114 114 LEU LEU D . n 
D 4 115 MET 115 115 115 MET MET D . n 
D 4 116 TYR 116 116 116 TYR TYR D . n 
D 4 117 ARG 117 117 117 ARG ARG D . n 
D 4 118 PHE 118 118 118 PHE PHE D . n 
D 4 119 ALA 119 119 119 ALA ALA D . n 
D 4 120 SER 120 120 120 SER SER D . n 
D 4 121 TRP 121 121 121 TRP TRP D . n 
D 4 122 GLY 122 122 122 GLY GLY D . n 
D 4 123 GLN 123 123 123 GLN GLN D . n 
D 4 124 GLY 124 124 124 GLY GLY D . n 
D 4 125 THR 125 125 125 THR THR D . n 
D 4 126 LEU 126 126 126 LEU LEU D . n 
D 4 127 VAL 127 127 127 VAL VAL D . n 
D 4 128 THR 128 128 128 THR THR D . n 
D 4 129 VAL 129 129 129 VAL VAL D . n 
D 4 130 SER 130 130 130 SER SER D . n 
D 4 131 SER 131 131 131 SER SER D . n 
E 5 1   ALA 1   132 132 ALA ALA E . n 
E 5 2   SER 2   133 133 SER SER E . n 
E 5 3   THR 3   134 134 THR THR E . n 
E 5 4   LYS 4   135 135 LYS LYS E . n 
E 5 5   GLY 5   136 136 GLY GLY E . n 
E 5 6   PRO 6   137 137 PRO PRO E . n 
E 5 7   SER 7   138 138 SER SER E . n 
E 5 8   VAL 8   139 139 VAL VAL E . n 
E 5 9   PHE 9   140 140 PHE PHE E . n 
E 5 10  PRO 10  141 141 PRO PRO E . n 
E 5 11  LEU 11  142 142 LEU LEU E . n 
E 5 12  ALA 12  143 143 ALA ALA E . n 
E 5 13  PRO 13  144 144 PRO PRO E . n 
E 5 14  SER 14  145 145 SER SER E . n 
E 5 15  SER 15  146 146 SER SER E . n 
E 5 16  LYS 16  147 147 LYS LYS E . n 
E 5 17  SER 17  148 148 SER SER E . n 
E 5 18  THR 18  149 149 THR THR E . n 
E 5 19  SER 19  150 150 SER SER E . n 
E 5 20  GLY 20  151 151 GLY GLY E . n 
E 5 21  GLY 21  152 152 GLY GLY E . n 
E 5 22  THR 22  153 153 THR THR E . n 
E 5 23  ALA 23  154 154 ALA ALA E . n 
E 5 24  ALA 24  155 155 ALA ALA E . n 
E 5 25  LEU 25  156 156 LEU LEU E . n 
E 5 26  GLY 26  157 157 GLY GLY E . n 
E 5 27  CYS 27  158 158 CYS CYS E . n 
E 5 28  LEU 28  159 159 LEU LEU E . n 
E 5 29  VAL 29  160 160 VAL VAL E . n 
E 5 30  LYS 30  161 161 LYS LYS E . n 
E 5 31  ASP 31  162 162 ASP ASP E . n 
E 5 32  TYR 32  163 163 TYR TYR E . n 
E 5 33  PHE 33  164 164 PHE PHE E . n 
E 5 34  PRO 34  165 165 PRO PRO E . n 
E 5 35  GLU 35  166 166 GLU GLU E . n 
E 5 36  PRO 36  167 167 PRO PRO E . n 
E 5 37  VAL 37  168 168 VAL VAL E . n 
E 5 38  THR 38  169 169 THR THR E . n 
E 5 39  VAL 39  170 170 VAL VAL E . n 
E 5 40  SER 40  171 171 SER SER E . n 
E 5 41  TRP 41  172 172 TRP TRP E . n 
E 5 42  ASN 42  173 173 ASN ASN E . n 
E 5 43  SER 43  174 174 SER SER E . n 
E 5 44  GLY 44  175 175 GLY GLY E . n 
E 5 45  ALA 45  176 176 ALA ALA E . n 
E 5 46  LEU 46  177 177 LEU LEU E . n 
E 5 47  THR 47  178 178 THR THR E . n 
E 5 48  SER 48  179 179 SER SER E . n 
E 5 49  GLY 49  180 180 GLY GLY E . n 
E 5 50  VAL 50  181 181 VAL VAL E . n 
E 5 51  HIS 51  182 182 HIS HIS E . n 
E 5 52  THR 52  183 183 THR THR E . n 
E 5 53  PHE 53  184 184 PHE PHE E . n 
E 5 54  PRO 54  185 185 PRO PRO E . n 
E 5 55  ALA 55  186 186 ALA ALA E . n 
E 5 56  VAL 56  187 187 VAL VAL E . n 
E 5 57  LEU 57  188 188 LEU LEU E . n 
E 5 58  GLN 58  189 189 GLN GLN E . n 
E 5 59  SER 59  190 190 SER SER E . n 
E 5 60  SER 60  191 191 SER SER E . n 
E 5 61  GLY 61  192 192 GLY GLY E . n 
E 5 62  LEU 62  193 193 LEU LEU E . n 
E 5 63  TYR 63  194 194 TYR TYR E . n 
E 5 64  SER 64  195 195 SER SER E . n 
E 5 65  LEU 65  196 196 LEU LEU E . n 
E 5 66  SER 66  197 197 SER SER E . n 
E 5 67  SER 67  198 198 SER SER E . n 
E 5 68  VAL 68  199 199 VAL VAL E . n 
E 5 69  VAL 69  200 200 VAL VAL E . n 
E 5 70  THR 70  201 201 THR THR E . n 
E 5 71  VAL 71  202 202 VAL VAL E . n 
E 5 72  PRO 72  203 203 PRO PRO E . n 
E 5 73  SER 73  204 204 SER SER E . n 
E 5 74  SER 74  205 205 SER SER E . n 
E 5 75  SER 75  206 206 SER SER E . n 
E 5 76  LEU 76  207 207 LEU LEU E . n 
E 5 77  GLY 77  208 208 GLY GLY E . n 
E 5 78  THR 78  209 209 THR THR E . n 
E 5 79  GLN 79  210 210 GLN GLN E . n 
E 5 80  THR 80  211 211 THR THR E . n 
E 5 81  TYR 81  212 212 TYR TYR E . n 
E 5 82  ILE 82  213 213 ILE ILE E . n 
E 5 83  CYS 83  214 214 CYS CYS E . n 
E 5 84  ASN 84  215 215 ASN ASN E . n 
E 5 85  VAL 85  216 216 VAL VAL E . n 
E 5 86  ASN 86  217 217 ASN ASN E . n 
E 5 87  HIS 87  218 218 HIS HIS E . n 
E 5 88  LYS 88  219 219 LYS LYS E . n 
E 5 89  PRO 89  220 220 PRO PRO E . n 
E 5 90  SER 90  221 221 SER SER E . n 
E 5 91  ASN 91  222 222 ASN ASN E . n 
E 5 92  THR 92  223 223 THR THR E . n 
E 5 93  LYS 93  224 224 LYS LYS E . n 
E 5 94  VAL 94  225 225 VAL VAL E . n 
E 5 95  ASP 95  226 226 ASP ASP E . n 
E 5 96  LYS 96  227 227 LYS LYS E . n 
E 5 97  LYS 97  228 228 LYS LYS E . n 
E 5 98  VAL 98  229 229 VAL VAL E . n 
E 5 99  GLU 99  230 230 GLU GLU E . n 
E 5 100 PRO 100 231 231 PRO PRO E . n 
E 5 101 LYS 101 232 232 LYS LYS E . n 
E 5 102 SER 102 233 233 SER SER E . n 
E 5 103 GLU 103 234 234 GLU GLU E . n 
E 5 104 PHE 104 235 235 PHE PHE E . n 
E 5 105 GLU 105 236 236 GLU GLU E . n 
E 5 106 GLN 106 237 ?   ?   ?   E . n 
E 5 107 LYS 107 238 ?   ?   ?   E . n 
E 5 108 LEU 108 239 ?   ?   ?   E . n 
E 5 109 ILE 109 240 ?   ?   ?   E . n 
E 5 110 SER 110 241 ?   ?   ?   E . n 
E 5 111 GLU 111 242 ?   ?   ?   E . n 
E 5 112 GLU 112 243 ?   ?   ?   E . n 
E 5 113 ASP 113 244 ?   ?   ?   E . n 
E 5 114 LEU 114 245 ?   ?   ?   E . n 
E 5 115 ASN 115 246 ?   ?   ?   E . n 
E 5 116 GLY 116 247 ?   ?   ?   E . n 
E 5 117 ALA 117 248 ?   ?   ?   E . n 
E 5 118 PRO 118 249 ?   ?   ?   E . n 
E 5 119 HIS 119 250 ?   ?   ?   E . n 
E 5 120 HIS 120 251 ?   ?   ?   E . n 
E 5 121 HIS 121 252 ?   ?   ?   E . n 
E 5 122 HIS 122 253 ?   ?   ?   E . n 
E 5 123 HIS 123 254 ?   ?   ?   E . n 
E 5 124 HIS 124 255 ?   ?   ?   E . n 
F 6 1   MET 1   39  ?   ?   ?   P . n 
F 6 2   LYS 2   40  ?   ?   ?   P . n 
F 6 3   GLY 3   41  ?   ?   ?   P . n 
F 6 4   SER 4   42  ?   ?   ?   P . n 
F 6 5   LYS 5   43  ?   ?   ?   P . n 
F 6 6   GLY 6   44  ?   ?   ?   P . n 
F 6 7   SER 7   45  ?   ?   ?   P . n 
F 6 8   LYS 8   46  ?   ?   ?   P . n 
F 6 9   GLY 9   47  ?   ?   ?   P . n 
F 6 10  SER 10  48  ?   ?   ?   P . n 
F 6 11  LYS 11  49  ?   ?   ?   P . n 
F 6 12  PRO 12  50  ?   ?   ?   P . n 
F 6 13  MET 13  51  ?   ?   ?   P . n 
F 6 14  SER 14  52  ?   ?   ?   P . n 
F 6 15  ALA 15  53  ?   ?   ?   P . n 
F 6 16  GLU 16  54  ?   ?   ?   P . n 
F 6 17  ALA 17  55  ?   ?   ?   P . n 
F 6 18  PRO 18  56  ?   ?   ?   P . n 
F 6 19  GLU 19  57  ?   ?   ?   P . n 
F 6 20  HIS 20  58  ?   ?   ?   P . n 
F 6 21  GLY 21  59  ?   ?   ?   P . n 
F 6 22  THR 22  60  ?   ?   ?   P . n 
F 6 23  THR 23  61  61  THR THR P . n 
F 6 24  ALA 24  62  62  ALA ALA P . n 
F 6 25  THR 25  63  63  THR THR P . n 
F 6 26  PHE 26  64  64  PHE PHE P . n 
F 6 27  HIS 27  65  65  HIS HIS P . n 
F 6 28  ARG 28  66  66  ARG ARG P . n 
F 6 29  CYS 29  67  67  CYS CYS P . n 
F 6 30  ALA 30  68  68  ALA ALA P . n 
F 6 31  LYS 31  69  69  LYS LYS P . n 
F 6 32  ASP 32  70  70  ASP ASP P . n 
F 6 33  PRO 33  71  71  PRO PRO P . n 
F 6 34  TRP 34  72  72  TRP TRP P . n 
F 6 35  ARG 35  73  73  ARG ARG P . n 
F 6 36  LEU 36  74  74  LEU LEU P . n 
F 6 37  PRO 37  75  75  PRO PRO P . n 
F 6 38  GLY 38  76  76  GLY GLY P . n 
F 6 39  THR 39  77  77  THR THR P . n 
F 6 40  TYR 40  78  78  TYR TYR P . n 
F 6 41  VAL 41  79  79  VAL VAL P . n 
F 6 42  VAL 42  80  80  VAL VAL P . n 
F 6 43  VAL 43  81  81  VAL VAL P . n 
F 6 44  LEU 44  82  82  LEU LEU P . n 
F 6 45  LYS 45  83  83  LYS LYS P . n 
F 6 46  GLU 46  84  84  GLU GLU P . n 
F 6 47  GLU 47  85  85  GLU GLU P . n 
F 6 48  THR 48  86  86  THR THR P . n 
F 6 49  HIS 49  87  87  HIS HIS P . n 
F 6 50  LEU 50  88  88  LEU LEU P . n 
F 6 51  SER 51  89  89  SER SER P . n 
F 6 52  GLN 52  90  90  GLN GLN P . n 
F 6 53  SER 53  91  91  SER SER P . n 
F 6 54  GLU 54  92  92  GLU GLU P . n 
F 6 55  ARG 55  93  93  ARG ARG P . n 
F 6 56  THR 56  94  94  THR THR P . n 
F 6 57  ALA 57  95  95  ALA ALA P . n 
F 6 58  ARG 58  96  96  ARG ARG P . n 
F 6 59  ARG 59  97  97  ARG ARG P . n 
F 6 60  LEU 60  98  98  LEU LEU P . n 
F 6 61  GLN 61  99  99  GLN GLN P . n 
F 6 62  ALA 62  100 100 ALA ALA P . n 
F 6 63  GLN 63  101 101 GLN GLN P . n 
F 6 64  ALA 64  102 102 ALA ALA P . n 
F 6 65  ALA 65  103 103 ALA ALA P . n 
F 6 66  ARG 66  104 104 ARG ARG P . n 
F 6 67  ARG 67  105 105 ARG ARG P . n 
F 6 68  GLY 68  106 106 GLY GLY P . n 
F 6 69  TYR 69  107 107 TYR TYR P . n 
F 6 70  LEU 70  108 108 LEU LEU P . n 
F 6 71  THR 71  109 109 THR THR P . n 
F 6 72  LYS 72  110 110 LYS LYS P . n 
F 6 73  ILE 73  111 111 ILE ILE P . n 
F 6 74  LEU 74  112 112 LEU LEU P . n 
F 6 75  HIS 75  113 113 HIS HIS P . n 
F 6 76  VAL 76  114 114 VAL VAL P . n 
F 6 77  PHE 77  115 115 PHE PHE P . n 
F 6 78  HIS 78  116 116 HIS HIS P . n 
F 6 79  GLY 79  117 117 GLY GLY P . n 
F 6 80  LEU 80  118 118 LEU LEU P . n 
F 6 81  LEU 81  119 119 LEU LEU P . n 
F 6 82  PRO 82  120 120 PRO PRO P . n 
F 6 83  GLY 83  121 121 GLY GLY P . n 
F 6 84  PHE 84  122 122 PHE PHE P . n 
F 6 85  LEU 85  123 123 LEU LEU P . n 
F 6 86  VAL 86  124 124 VAL VAL P . n 
F 6 87  LYS 87  125 125 LYS LYS P . n 
F 6 88  MET 88  126 126 MET MET P . n 
F 6 89  SER 89  127 127 SER SER P . n 
F 6 90  GLY 90  128 128 GLY GLY P . n 
F 6 91  ASP 91  129 129 ASP ASP P . n 
F 6 92  LEU 92  130 130 LEU LEU P . n 
F 6 93  LEU 93  131 131 LEU LEU P . n 
F 6 94  GLU 94  132 132 GLU GLU P . n 
F 6 95  LEU 95  133 133 LEU LEU P . n 
F 6 96  ALA 96  134 134 ALA ALA P . n 
F 6 97  LEU 97  135 135 LEU LEU P . n 
F 6 98  LYS 98  136 136 LYS LYS P . n 
F 6 99  LEU 99  137 137 LEU LEU P . n 
F 6 100 PRO 100 138 138 PRO PRO P . n 
F 6 101 HIS 101 139 139 HIS HIS P . n 
F 6 102 VAL 102 140 140 VAL VAL P . n 
F 6 103 ASP 103 141 141 ASP ASP P . n 
F 6 104 TYR 104 142 142 TYR TYR P . n 
F 6 105 ILE 105 143 143 ILE ILE P . n 
F 6 106 GLU 106 144 144 GLU GLU P . n 
F 6 107 GLU 107 145 145 GLU GLU P . n 
F 6 108 ASP 108 146 146 ASP ASP P . n 
F 6 109 SER 109 147 147 SER SER P . n 
F 6 110 SER 110 148 148 SER SER P . n 
F 6 111 VAL 111 149 149 VAL VAL P . n 
F 6 112 PHE 112 150 150 PHE PHE P . n 
F 6 113 ALA 113 151 151 ALA ALA P . n 
F 6 114 GLN 114 152 152 GLN GLN P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 7 CA  1  1423 1423 CA  CA  A . 
H 8 HOH 1  2001 2001 HOH HOH A . 
H 8 HOH 2  2002 2002 HOH HOH A . 
H 8 HOH 3  2003 2003 HOH HOH A . 
H 8 HOH 4  2004 2004 HOH HOH A . 
H 8 HOH 5  2005 2005 HOH HOH A . 
H 8 HOH 6  2006 2006 HOH HOH A . 
H 8 HOH 7  2007 2007 HOH HOH A . 
H 8 HOH 8  2008 2008 HOH HOH A . 
H 8 HOH 9  2009 2009 HOH HOH A . 
H 8 HOH 10 2010 2010 HOH HOH A . 
H 8 HOH 11 2011 2011 HOH HOH A . 
H 8 HOH 12 2012 2012 HOH HOH A . 
H 8 HOH 13 2013 2013 HOH HOH A . 
H 8 HOH 14 2014 2014 HOH HOH A . 
H 8 HOH 15 2015 2015 HOH HOH A . 
H 8 HOH 16 2016 2016 HOH HOH A . 
H 8 HOH 17 2017 2017 HOH HOH A . 
H 8 HOH 18 2018 2018 HOH HOH A . 
H 8 HOH 19 2019 2019 HOH HOH A . 
H 8 HOH 20 2020 2020 HOH HOH A . 
H 8 HOH 21 2021 2021 HOH HOH A . 
H 8 HOH 22 2022 2022 HOH HOH A . 
H 8 HOH 23 2023 2023 HOH HOH A . 
H 8 HOH 24 2024 2024 HOH HOH A . 
H 8 HOH 25 2025 2025 HOH HOH A . 
H 8 HOH 26 2026 2026 HOH HOH A . 
H 8 HOH 27 2027 2027 HOH HOH A . 
H 8 HOH 28 2028 2028 HOH HOH A . 
H 8 HOH 29 2029 2029 HOH HOH A . 
H 8 HOH 30 2030 2030 HOH HOH A . 
H 8 HOH 31 2031 2031 HOH HOH A . 
H 8 HOH 32 2032 2032 HOH HOH A . 
H 8 HOH 33 2033 2033 HOH HOH A . 
H 8 HOH 34 2034 2034 HOH HOH A . 
H 8 HOH 35 2035 2035 HOH HOH A . 
H 8 HOH 36 2036 2036 HOH HOH A . 
H 8 HOH 37 2037 2037 HOH HOH A . 
H 8 HOH 38 2038 2038 HOH HOH A . 
H 8 HOH 39 2039 2039 HOH HOH A . 
H 8 HOH 40 2040 2040 HOH HOH A . 
H 8 HOH 41 2041 2041 HOH HOH A . 
H 8 HOH 42 2042 2042 HOH HOH A . 
H 8 HOH 43 2043 2043 HOH HOH A . 
H 8 HOH 44 2044 2044 HOH HOH A . 
H 8 HOH 45 2045 2045 HOH HOH A . 
H 8 HOH 46 2046 2046 HOH HOH A . 
H 8 HOH 47 2047 2047 HOH HOH A . 
H 8 HOH 48 2048 2048 HOH HOH A . 
H 8 HOH 49 2049 2049 HOH HOH A . 
H 8 HOH 50 2050 2050 HOH HOH A . 
H 8 HOH 51 2051 2051 HOH HOH A . 
H 8 HOH 52 2052 2052 HOH HOH A . 
H 8 HOH 53 2053 2053 HOH HOH A . 
H 8 HOH 54 2054 2054 HOH HOH A . 
H 8 HOH 55 2055 2055 HOH HOH A . 
H 8 HOH 56 2056 2056 HOH HOH A . 
H 8 HOH 57 2057 2057 HOH HOH A . 
H 8 HOH 58 2058 2058 HOH HOH A . 
H 8 HOH 59 2059 2059 HOH HOH A . 
H 8 HOH 60 2060 2060 HOH HOH A . 
H 8 HOH 61 2061 2061 HOH HOH A . 
I 8 HOH 1  2001 2001 HOH HOH B . 
I 8 HOH 2  2002 2002 HOH HOH B . 
I 8 HOH 3  2003 2003 HOH HOH B . 
I 8 HOH 4  2004 2004 HOH HOH B . 
I 8 HOH 5  2005 2005 HOH HOH B . 
I 8 HOH 6  2006 2006 HOH HOH B . 
I 8 HOH 7  2007 2007 HOH HOH B . 
I 8 HOH 8  2008 2008 HOH HOH B . 
I 8 HOH 9  2009 2009 HOH HOH B . 
I 8 HOH 10 2010 2010 HOH HOH B . 
I 8 HOH 11 2011 2011 HOH HOH B . 
I 8 HOH 12 2012 2012 HOH HOH B . 
I 8 HOH 13 2013 2013 HOH HOH B . 
I 8 HOH 14 2014 2014 HOH HOH B . 
I 8 HOH 15 2015 2015 HOH HOH B . 
I 8 HOH 16 2016 2016 HOH HOH B . 
I 8 HOH 17 2017 2017 HOH HOH B . 
I 8 HOH 18 2018 2018 HOH HOH B . 
I 8 HOH 19 2019 2019 HOH HOH B . 
I 8 HOH 20 2020 2020 HOH HOH B . 
I 8 HOH 21 2021 2021 HOH HOH B . 
I 8 HOH 22 2022 2022 HOH HOH B . 
I 8 HOH 23 2023 2023 HOH HOH B . 
I 8 HOH 24 2024 2024 HOH HOH B . 
I 8 HOH 25 2025 2025 HOH HOH B . 
I 8 HOH 26 2026 2026 HOH HOH B . 
I 8 HOH 27 2027 2027 HOH HOH B . 
I 8 HOH 28 2028 2028 HOH HOH B . 
I 8 HOH 29 2029 2029 HOH HOH B . 
I 8 HOH 30 2030 2030 HOH HOH B . 
J 8 HOH 1  2001 2001 HOH HOH C . 
J 8 HOH 2  2002 2002 HOH HOH C . 
J 8 HOH 3  2003 2003 HOH HOH C . 
J 8 HOH 4  2004 2004 HOH HOH C . 
J 8 HOH 5  2005 2005 HOH HOH C . 
J 8 HOH 6  2006 2006 HOH HOH C . 
J 8 HOH 7  2007 2007 HOH HOH C . 
J 8 HOH 8  2008 2008 HOH HOH C . 
J 8 HOH 9  2009 2009 HOH HOH C . 
J 8 HOH 10 2010 2010 HOH HOH C . 
J 8 HOH 11 2011 2011 HOH HOH C . 
J 8 HOH 12 2012 2012 HOH HOH C . 
K 8 HOH 1  2001 2001 HOH HOH D . 
K 8 HOH 2  2002 2002 HOH HOH D . 
K 8 HOH 3  2003 2003 HOH HOH D . 
K 8 HOH 4  2004 2004 HOH HOH D . 
K 8 HOH 5  2005 2005 HOH HOH D . 
K 8 HOH 6  2006 2006 HOH HOH D . 
K 8 HOH 7  2007 2007 HOH HOH D . 
K 8 HOH 8  2008 2008 HOH HOH D . 
K 8 HOH 9  2009 2009 HOH HOH D . 
K 8 HOH 10 2010 2010 HOH HOH D . 
K 8 HOH 11 2011 2011 HOH HOH D . 
K 8 HOH 12 2012 2012 HOH HOH D . 
K 8 HOH 13 2013 2013 HOH HOH D . 
K 8 HOH 14 2014 2014 HOH HOH D . 
K 8 HOH 15 2015 2015 HOH HOH D . 
K 8 HOH 16 2016 2016 HOH HOH D . 
K 8 HOH 17 2017 2017 HOH HOH D . 
K 8 HOH 18 2018 2018 HOH HOH D . 
K 8 HOH 19 2019 2019 HOH HOH D . 
K 8 HOH 20 2020 2020 HOH HOH D . 
K 8 HOH 21 2021 2021 HOH HOH D . 
K 8 HOH 22 2022 2022 HOH HOH D . 
K 8 HOH 23 2023 2023 HOH HOH D . 
K 8 HOH 24 2024 2024 HOH HOH D . 
K 8 HOH 25 2025 2025 HOH HOH D . 
K 8 HOH 26 2026 2026 HOH HOH D . 
K 8 HOH 27 2027 2027 HOH HOH D . 
K 8 HOH 28 2028 2028 HOH HOH D . 
K 8 HOH 29 2029 2029 HOH HOH D . 
K 8 HOH 30 2030 2030 HOH HOH D . 
K 8 HOH 31 2031 2031 HOH HOH D . 
K 8 HOH 32 2032 2032 HOH HOH D . 
K 8 HOH 33 2033 2033 HOH HOH D . 
K 8 HOH 34 2034 2034 HOH HOH D . 
K 8 HOH 35 2035 2035 HOH HOH D . 
K 8 HOH 36 2036 2036 HOH HOH D . 
K 8 HOH 37 2037 2037 HOH HOH D . 
K 8 HOH 38 2038 2038 HOH HOH D . 
K 8 HOH 39 2039 2039 HOH HOH D . 
K 8 HOH 40 2040 2040 HOH HOH D . 
K 8 HOH 41 2041 2041 HOH HOH D . 
K 8 HOH 42 2042 2042 HOH HOH D . 
K 8 HOH 43 2043 2043 HOH HOH D . 
K 8 HOH 44 2044 2044 HOH HOH D . 
K 8 HOH 45 2045 2045 HOH HOH D . 
K 8 HOH 46 2046 2046 HOH HOH D . 
K 8 HOH 47 2047 2047 HOH HOH D . 
K 8 HOH 48 2048 2048 HOH HOH D . 
L 8 HOH 1  2001 2001 HOH HOH E . 
L 8 HOH 2  2002 2002 HOH HOH E . 
L 8 HOH 3  2003 2003 HOH HOH E . 
L 8 HOH 4  2004 2004 HOH HOH E . 
L 8 HOH 5  2005 2005 HOH HOH E . 
L 8 HOH 6  2006 2006 HOH HOH E . 
L 8 HOH 7  2007 2007 HOH HOH E . 
L 8 HOH 8  2008 2008 HOH HOH E . 
L 8 HOH 9  2009 2009 HOH HOH E . 
L 8 HOH 10 2010 2010 HOH HOH E . 
L 8 HOH 11 2011 2011 HOH HOH E . 
M 8 HOH 1  2001 2001 HOH HOH P . 
M 8 HOH 2  2002 2002 HOH HOH P . 
M 8 HOH 3  2003 2003 HOH HOH P . 
M 8 HOH 4  2004 2004 HOH HOH P . 
M 8 HOH 5  2005 2005 HOH HOH P . 
M 8 HOH 6  2006 2006 HOH HOH P . 
M 8 HOH 7  2007 2007 HOH HOH P . 
M 8 HOH 8  2008 2008 HOH HOH P . 
M 8 HOH 9  2009 2009 HOH HOH P . 
M 8 HOH 10 2010 2010 HOH HOH P . 
M 8 HOH 11 2011 2011 HOH HOH P . 
M 8 HOH 12 2012 2012 HOH HOH P . 
M 8 HOH 13 2013 2013 HOH HOH P . 
M 8 HOH 14 2014 2014 HOH HOH P . 
M 8 HOH 15 2015 2015 HOH HOH P . 
M 8 HOH 16 2016 2016 HOH HOH P . 
M 8 HOH 17 2017 2017 HOH HOH P . 
M 8 HOH 18 2018 2018 HOH HOH P . 
M 8 HOH 19 2019 2019 HOH HOH P . 
M 8 HOH 20 2020 2020 HOH HOH P . 
M 8 HOH 21 2021 2021 HOH HOH P . 
M 8 HOH 22 2022 2022 HOH HOH P . 
M 8 HOH 23 2023 2023 HOH HOH P . 
M 8 HOH 24 2024 2024 HOH HOH P . 
M 8 HOH 25 2025 2025 HOH HOH P . 
M 8 HOH 26 2026 2026 HOH HOH P . 
M 8 HOH 27 2027 2027 HOH HOH P . 
M 8 HOH 28 2028 2028 HOH HOH P . 
M 8 HOH 29 2029 2029 HOH HOH P . 
M 8 HOH 30 2030 2030 HOH HOH P . 
M 8 HOH 31 2031 2031 HOH HOH P . 
M 8 HOH 32 2032 2032 HOH HOH P . 
M 8 HOH 33 2033 2033 HOH HOH P . 
M 8 HOH 34 2034 2034 HOH HOH P . 
M 8 HOH 35 2035 2035 HOH HOH P . 
M 8 HOH 36 2036 2036 HOH HOH P . 
M 8 HOH 37 2037 2037 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10210 ? 
1 MORE         -60.9 ? 
1 'SSA (A^2)'  40980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? A ALA 178 ? A ALA 330 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 OG1 ? A THR 183 ? A THR 335 ? 1_555 91.7  ? 
2 O   ? A ALA 178 ? A ALA 330 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 O   ? A VAL 181 ? A VAL 333 ? 1_555 78.6  ? 
3 OG1 ? A THR 183 ? A THR 335 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 O   ? A VAL 181 ? A VAL 333 ? 1_555 80.6  ? 
4 O   ? A ALA 178 ? A ALA 330 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 OD2 ? A ASP 208 ? A ASP 360 ? 1_555 169.2 ? 
5 OG1 ? A THR 183 ? A THR 335 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 OD2 ? A ASP 208 ? A ASP 360 ? 1_555 78.3  ? 
6 O   ? A VAL 181 ? A VAL 333 ? 1_555 CA ? G CA . ? A CA 1423 ? 1_555 OD2 ? A ASP 208 ? A ASP 360 ? 1_555 95.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-03 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Experimental preparation'  
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_biol          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.2.0019 ? 1 ? ? ? ? 
MOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA  'data scaling'   .        ? 3 ? ? ? ? 
PHASER phasing          .        ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             2XTJ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;LEUCINE PRESENT AT A417 IN ORIGINAL CONSTRUCT. POSSIBLE
NATURAL VARIANT
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 186 ? ? -167.49 -160.24 
2  1 VAL A 234 ? ? 89.40   -74.42  
3  1 VAL A 280 ? ? 80.94   168.10  
4  1 LEU A 287 ? ? -118.20 78.61   
5  1 PRO A 288 ? ? -79.83  49.26   
6  1 ARG A 319 ? ? 39.75   53.70   
7  1 GLU A 332 ? ? 66.87   -5.63   
8  1 ASN A 340 ? ? -96.59  -157.98 
9  1 LEU A 348 ? ? -109.93 -127.85 
10 1 LEU A 351 ? ? -126.60 -133.36 
11 1 PRO A 404 ? ? -68.55  14.69   
12 1 SER A 419 ? ? -65.31  13.60   
13 1 LYS A 421 ? ? -169.65 78.22   
14 1 ARG B 30  ? ? 45.78   -111.74 
15 1 THR B 69  ? ? -137.65 -38.95  
16 1 ALA B 84  ? ? -171.33 -176.99 
17 1 ASP B 94  ? ? 84.76   98.23   
18 1 TYR D 107 ? ? 86.60   -14.64  
19 1 MET D 109 ? ? 56.11   104.45  
20 1 ASN D 110 ? ? 86.01   28.62   
21 1 SER E 145 ? ? -166.72 -153.17 
22 1 LYS E 147 ? ? 118.89  -49.98  
23 1 SER E 174 ? ? 45.27   27.90   
24 1 LYS E 232 ? ? -85.47  -89.78  
25 1 GLU E 234 ? ? 90.12   -43.87  
26 1 PHE E 235 ? ? -9.67   -94.48  
27 1 LEU P 74  ? ? -118.87 66.48   
28 1 HIS P 116 ? ? -85.52  -102.95 
29 1 HIS P 139 ? ? 83.80   -5.59   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 244 ? ? ALA A 245 ? ? -35.37  
2 1 GLY B 93  ? ? ASP B 94  ? ? -148.73 
3 1 TYR D 107 ? ? GLY D 108 ? ? -37.24  
4 1 TRP D 121 ? ? GLY D 122 ? ? 42.27   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 212 ? CG  ? A ASP 60  CG  
2  1 Y 1 A ASP 212 ? OD1 ? A ASP 60  OD1 
3  1 Y 1 A ASP 212 ? OD2 ? A ASP 60  OD2 
4  1 Y 1 A GLN 278 ? CG  ? A GLN 126 CG  
5  1 Y 1 A GLN 278 ? CD  ? A GLN 126 CD  
6  1 Y 1 A GLN 278 ? OE1 ? A GLN 126 OE1 
7  1 Y 1 A GLN 278 ? NE2 ? A GLN 126 NE2 
8  1 Y 1 C LYS 168 ? CG  ? C LYS 61  CG  
9  1 Y 1 C LYS 168 ? CD  ? C LYS 61  CD  
10 1 Y 1 C LYS 168 ? CE  ? C LYS 61  CE  
11 1 Y 1 C LYS 168 ? NZ  ? C LYS 61  NZ  
12 1 Y 1 C GLU 212 ? CG  ? C GLU 105 CG  
13 1 Y 1 C GLU 212 ? CD  ? C GLU 105 CD  
14 1 Y 1 C GLU 212 ? OE1 ? C GLU 105 OE1 
15 1 Y 1 C GLU 212 ? OE2 ? C GLU 105 OE2 
16 1 Y 1 E LYS 232 ? CG  ? E LYS 101 CG  
17 1 Y 1 E LYS 232 ? CD  ? E LYS 101 CD  
18 1 Y 1 E LYS 232 ? CE  ? E LYS 101 CE  
19 1 Y 1 E LYS 232 ? NZ  ? E LYS 101 NZ  
20 1 Y 1 E GLU 234 ? CG  ? E GLU 103 CG  
21 1 Y 1 E GLU 234 ? CD  ? E GLU 103 CD  
22 1 Y 1 E GLU 234 ? OE1 ? E GLU 103 OE1 
23 1 Y 1 E GLU 234 ? OE2 ? E GLU 103 OE2 
24 1 Y 1 E GLU 236 ? CG  ? E GLU 105 CG  
25 1 Y 1 E GLU 236 ? CD  ? E GLU 105 CD  
26 1 Y 1 E GLU 236 ? OE1 ? E GLU 105 OE1 
27 1 Y 1 E GLU 236 ? OE2 ? E GLU 105 OE2 
28 1 Y 1 P THR 61  ? OG1 ? F THR 23  OG1 
29 1 Y 1 P THR 61  ? CG2 ? F THR 23  CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A SER 153 ? A SER 1   
2   1 Y 1 A ILE 154 ? A ILE 2   
3   1 Y 1 A LEU 158 ? A LEU 6   
4   1 Y 1 A GLU 159 ? A GLU 7   
5   1 Y 1 A ARG 160 ? A ARG 8   
6   1 Y 1 A ILE 161 ? A ILE 9   
7   1 Y 1 A THR 162 ? A THR 10  
8   1 Y 1 A PRO 163 ? A PRO 11  
9   1 Y 1 A PRO 164 ? A PRO 12  
10  1 Y 1 A ARG 165 ? A ARG 13  
11  1 Y 1 A TYR 166 ? A TYR 14  
12  1 Y 1 A ARG 167 ? A ARG 15  
13  1 Y 1 A ALA 168 ? A ALA 16  
14  1 Y 1 A ASP 169 ? A ASP 17  
15  1 Y 1 A GLU 170 ? A GLU 18  
16  1 Y 1 A TYR 171 ? A TYR 19  
17  1 Y 1 A GLN 172 ? A GLN 20  
18  1 Y 1 A PRO 173 ? A PRO 21  
19  1 Y 1 A PRO 174 ? A PRO 22  
20  1 Y 1 A ASP 175 ? A ASP 23  
21  1 Y 1 A GLY 176 ? A GLY 24  
22  1 Y 1 A GLY 177 ? A GLY 25  
23  1 Y 1 A GLY 213 ? A GLY 61  
24  1 Y 1 A THR 214 ? A THR 62  
25  1 Y 1 A ARG 215 ? A ARG 63  
26  1 Y 1 A PHE 216 ? A PHE 64  
27  1 Y 1 A HIS 217 ? A HIS 65  
28  1 Y 1 A ARG 218 ? A ARG 66  
29  1 Y 1 A VAL 423 ? A VAL 271 
30  1 Y 1 A ILE 424 ? A ILE 272 
31  1 Y 1 A ASN 425 ? A ASN 273 
32  1 Y 1 A GLU 426 ? A GLU 274 
33  1 Y 1 A ALA 427 ? A ALA 275 
34  1 Y 1 A TRP 428 ? A TRP 276 
35  1 Y 1 A PHE 429 ? A PHE 277 
36  1 Y 1 A PRO 430 ? A PRO 278 
37  1 Y 1 A GLU 431 ? A GLU 279 
38  1 Y 1 A ASP 432 ? A ASP 280 
39  1 Y 1 A GLN 433 ? A GLN 281 
40  1 Y 1 A ARG 434 ? A ARG 282 
41  1 Y 1 A VAL 435 ? A VAL 283 
42  1 Y 1 A LEU 436 ? A LEU 284 
43  1 Y 1 A THR 437 ? A THR 285 
44  1 Y 1 A PRO 438 ? A PRO 286 
45  1 Y 1 A ASN 439 ? A ASN 287 
46  1 Y 1 A LEU 440 ? A LEU 288 
47  1 Y 1 A VAL 441 ? A VAL 289 
48  1 Y 1 A ALA 442 ? A ALA 290 
49  1 Y 1 A ALA 443 ? A ALA 291 
50  1 Y 1 A LEU 444 ? A LEU 292 
51  1 Y 1 A PRO 445 ? A PRO 293 
52  1 Y 1 A PRO 446 ? A PRO 294 
53  1 Y 1 A SER 447 ? A SER 295 
54  1 Y 1 A THR 448 ? A THR 296 
55  1 Y 1 A HIS 449 ? A HIS 297 
56  1 Y 1 A GLY 450 ? A GLY 298 
57  1 Y 1 A ALA 451 ? A ALA 299 
58  1 Y 1 A ALA 452 ? A ALA 300 
59  1 Y 1 A GLY 453 ? A GLY 301 
60  1 Y 1 A THR 454 ? A THR 302 
61  1 Y 1 A ALA 455 ? A ALA 303 
62  1 Y 1 A ALA 456 ? A ALA 304 
63  1 Y 1 A ALA 457 ? A ALA 305 
64  1 Y 1 A SER 458 ? A SER 306 
65  1 Y 1 A HIS 459 ? A HIS 307 
66  1 Y 1 A HIS 460 ? A HIS 308 
67  1 Y 1 A HIS 461 ? A HIS 309 
68  1 Y 1 A HIS 462 ? A HIS 310 
69  1 Y 1 A HIS 463 ? A HIS 311 
70  1 Y 1 A HIS 464 ? A HIS 312 
71  1 Y 1 C ALA 213 ? C ALA 106 
72  1 Y 1 E GLN 237 ? E GLN 106 
73  1 Y 1 E LYS 238 ? E LYS 107 
74  1 Y 1 E LEU 239 ? E LEU 108 
75  1 Y 1 E ILE 240 ? E ILE 109 
76  1 Y 1 E SER 241 ? E SER 110 
77  1 Y 1 E GLU 242 ? E GLU 111 
78  1 Y 1 E GLU 243 ? E GLU 112 
79  1 Y 1 E ASP 244 ? E ASP 113 
80  1 Y 1 E LEU 245 ? E LEU 114 
81  1 Y 1 E ASN 246 ? E ASN 115 
82  1 Y 1 E GLY 247 ? E GLY 116 
83  1 Y 1 E ALA 248 ? E ALA 117 
84  1 Y 1 E PRO 249 ? E PRO 118 
85  1 Y 1 E HIS 250 ? E HIS 119 
86  1 Y 1 E HIS 251 ? E HIS 120 
87  1 Y 1 E HIS 252 ? E HIS 121 
88  1 Y 1 E HIS 253 ? E HIS 122 
89  1 Y 1 E HIS 254 ? E HIS 123 
90  1 Y 1 E HIS 255 ? E HIS 124 
91  1 Y 1 P MET 39  ? F MET 1   
92  1 Y 1 P LYS 40  ? F LYS 2   
93  1 Y 1 P GLY 41  ? F GLY 3   
94  1 Y 1 P SER 42  ? F SER 4   
95  1 Y 1 P LYS 43  ? F LYS 5   
96  1 Y 1 P GLY 44  ? F GLY 6   
97  1 Y 1 P SER 45  ? F SER 7   
98  1 Y 1 P LYS 46  ? F LYS 8   
99  1 Y 1 P GLY 47  ? F GLY 9   
100 1 Y 1 P SER 48  ? F SER 10  
101 1 Y 1 P LYS 49  ? F LYS 11  
102 1 Y 1 P PRO 50  ? F PRO 12  
103 1 Y 1 P MET 51  ? F MET 13  
104 1 Y 1 P SER 52  ? F SER 14  
105 1 Y 1 P ALA 53  ? F ALA 15  
106 1 Y 1 P GLU 54  ? F GLU 16  
107 1 Y 1 P ALA 55  ? F ALA 17  
108 1 Y 1 P PRO 56  ? F PRO 18  
109 1 Y 1 P GLU 57  ? F GLU 19  
110 1 Y 1 P HIS 58  ? F HIS 20  
111 1 Y 1 P GLY 59  ? F GLY 21  
112 1 Y 1 P THR 60  ? F THR 22  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
7 'CALCIUM ION' CA  
8 water         HOH 
#