data_2XUG
# 
_entry.id   2XUG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XUG         
PDBE  EBI-45715    
WWPDB D_1290045715 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (10 MTH)' 
PDB 2XUJ unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (10 MTH)' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (1 MTH)' 
PDB 2XUQ unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI-SYN INHIBITORS' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XUG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'  1 
'Radic, Z.'   2 
'Taylor, P.'  3 
'Marchot, P.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Conformational Remodeling of Femtomolar Inhibitor-Acetylcholinesterase Complexes in the Crystalline State' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            132 
_citation.page_first                18292 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21090615 
_citation.pdbx_database_id_DOI      10.1021/JA106820E 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'  1 ? 
primary 'Radic, Z.'   2 ? 
primary 'Taylor, P.'  3 ? 
primary 'Marchot, P.' 4 ? 
# 
_cell.entry_id           2XUG 
_cell.length_a           79.463 
_cell.length_b           111.700 
_cell.length_c           227.463 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XUG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 59743.473 2   3.1.1.7 YES 'CATALYTIC DOMAIN, RESIDUES 32-575' ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ?   ?                                   ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331   1   ?       ?   ?                                   ? 
4 non-polymer syn 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-4-YL]HEXYL]-PHENANTHRIDINIUM' 
661.860   2   ?       ?   ?                                   ? 
5 water       nat water 18.015    266 ?       ?   ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSAFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSAFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 ALA n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BLACK6CBA CROSS F1' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                'BRAIN (CDNA)' 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       LAMBDA-ZAP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'LAMBDA-FIX CDNA, GENOMIC DNA' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XUG A 1 ? 544 ? P21836 32 ? 575 ? 1 544 
2 1 2XUG B 1 ? 544 ? P21836 32 ? 575 ? 1 544 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XUG ALA A 337 ? UNP P21836 TYR 368 'engineered mutation' 337 1 
1 2XUG ALA A 544 ? UNP P21836 LEU 575 'SEE REMARK 999'      544 2 
2 2XUG ALA B 337 ? UNP P21836 TYR 368 'engineered mutation' 337 3 
2 2XUG ALA B 544 ? UNP P21836 LEU 575 'SEE REMARK 999'      544 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
P6G non-polymer                  . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking'          y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE ? 'C9 H11 N O3'    181.189 
TZ4 non-polymer                  . 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-4-YL]HEXYL]-PHENANTHRIDINIUM' ? 
'C42 H45 N8 1'   661.860 
VAL 'L-peptide linking'          y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XUG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.08 
_exptl_crystal.density_percent_sol   69.6 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM PEG-600 25-35% (V/V) IN 50-100 MM HEPES, PH 6.0-7.0, OR WITH PEG-550 MME 30% (V/V) IN 50 MM NA ACETATE, PH 7.5
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2003-06-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XUG 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   63011 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.80 
_reflns.B_iso_Wilson_estimate        61.7 
_reflns.pdbx_redundancy              3.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.67 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.30 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XUG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59993 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    97.81 
_refine.ls_R_factor_obs                          0.19247 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19165 
_refine.ls_R_factor_R_free                       0.23267 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1250 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               51.884 
_refine.aniso_B[1][1]                            3.87 
_refine.aniso_B[2][2]                            3.00 
_refine.aniso_B[3][3]                            -6.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.302 
_refine.pdbx_overall_ESU_R_Free                  0.235 
_refine.overall_SU_ML                            0.173 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             17.704 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8328 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         147 
_refine_hist.number_atoms_solvent             266 
_refine_hist.number_atoms_total               8741 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 8822  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.491  1.975  ? 12076 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.758  5.000  ? 1083  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.022 22.857 ? 399   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.070 15.000 ? 1261  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.635 15.000 ? 74    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.106  0.200  ? 1285  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.022  ? 6974  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.550  1.500  ? 5379  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.072  2.000  ? 8677  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.715  3.000  ? 3443  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.932  4.500  ? 3393  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1942 0.10 0.50  'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 1942 0.10 0.50  'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 1824 0.40 5.00  'loose positional'  1 3 'X-RAY DIFFRACTION' ? ? ? 
2 B 1824 0.40 5.00  'loose positional'  1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 1942 0.52 2.00  'medium thermal'    1 5 'X-RAY DIFFRACTION' ? ? ? 
2 B 1942 0.52 2.00  'medium thermal'    1 6 'X-RAY DIFFRACTION' ? ? ? 
1 A 1824 0.74 10.00 'loose thermal'     1 7 'X-RAY DIFFRACTION' ? ? ? 
2 B 1824 0.74 10.00 'loose thermal'     1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.666 
_refine_ls_shell.number_reflns_R_work             4030 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               97.97 
_refine_ls_shell.R_factor_R_free                  0.376 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.725700 -0.411600 -0.551400 -0.406000 -0.903100 0.139800 -0.555500 0.122400 -0.822500 1.48900 25.12000 -13.07000 
2 given ? 0.725700 -0.411600 -0.551400 -0.406000 -0.903100 0.139800 -0.555500 0.122400 -0.822500 1.48900 25.12000 -13.07000 
3 given ? 0.725700 -0.411600 -0.551400 -0.406000 -0.903100 0.139800 -0.555500 0.122400 -0.822500 1.48900 25.12000 -13.07000 
4 given ? 0.725700 -0.411600 -0.551400 -0.406000 -0.903100 0.139800 -0.555500 0.122400 -0.822500 1.48900 25.12000 -13.07000 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 16  A 56  1 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 16  B 56  1 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 60  A 74  2 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 60  B 74  2 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 80  A 255 3 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 80  B 255 3 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 266 A 490 4 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 266 B 490 4 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 508 A 539 5 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 508 B 539 5 5 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2XUG 
_struct.title                     'Crystal structure of mAChE-Y337A-TZ2PA6 anti complex (1 wk)' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XUG 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, HYDROLASE FOLD, CLICK CHEMISTRY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? TRP A 286 ? PRO A 277 TRP A 286 1 ? 10 
HELX_P HELX_P14 14 HIS A 287 ? LEU A 289 ? HIS A 287 LEU A 289 5 ? 3  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? GLY A 342 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? LEU A 539 ? ARG A 534 LEU A 539 1 ? 6  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P41 41 GLU B 285 ? LEU B 289 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? GLY B 342 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.115 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.106 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.071 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 1542 1_555 ? ? ? ? ? ? ? 1.475 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 1543 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 3   A . ? ARG 3   A GLU 4   A ? GLU 4   A 1 -7.78 
2 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -5.25 
3 GLY 256 A . ? GLY 256 A CYS 257 A ? CYS 257 A 1 -3.65 
4 LEU 539 A . ? LEU 539 A LEU 540 A ? LEU 540 A 1 -1.46 
5 LEU 540 A . ? LEU 540 A SER 541 A ? SER 541 A 1 10.19 
6 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 0.97  
7 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 2.92  
8 ASP 494 B . ? ASP 494 B SER 495 B ? SER 495 B 1 7.22  
9 THR 543 B . ? THR 543 B ALA 544 B ? ALA 544 B 1 -1.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          2XUG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XUG 
_atom_sites.fract_transf_matrix[1][1]   0.012584 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008953 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004396 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 3   ? 27.814  18.380  57.060  1.00 71.95  ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 3   ? 26.654  17.598  56.539  1.00 71.02  ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 3   ? 25.555  18.567  56.085  1.00 70.67  ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 3   ? 25.144  19.389  56.906  1.00 71.94  ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 3   ? 26.093  16.685  57.647  1.00 72.11  ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 3   ? 27.085  15.827  58.377  1.00 72.54  ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 3   ? 27.859  14.919  57.457  1.00 73.10  ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 3   ? 29.255  15.332  57.358  1.00 74.99  ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 3   ? 30.152  14.788  56.536  1.00 75.02  ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 3   ? 29.819  13.788  55.721  1.00 73.33  ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 3   ? 31.394  15.248  56.531  1.00 75.05  ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 4   ? 25.058  18.532  54.838  1.00 68.82  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 4   ? 25.487  17.758  53.628  1.00 67.25  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 4   ? 24.466  16.735  53.106  1.00 65.99  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 4   ? 24.176  15.754  53.786  1.00 66.53  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 4   ? 26.872  17.137  53.721  1.00 67.49  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 4   ? 27.424  16.734  52.354  1.00 67.64  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 4   ? 28.948  16.776  52.322  1.00 70.61  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 4   ? 29.587  16.299  53.295  1.00 71.67  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 4   ? 29.502  17.290  51.325  1.00 70.87  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 5   ? 23.945  16.956  51.897  1.00 63.99  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 5   ? 22.845  16.138  51.375  1.00 62.96  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 5   ? 23.311  14.695  51.193  1.00 62.67  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 5   ? 24.165  14.422  50.346  1.00 61.71  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 5   ? 22.258  16.714  50.071  1.00 61.42  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 5   ? 21.051  15.907  49.538  1.00 60.52  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 5   ? 20.868  14.737  49.924  1.00 61.23  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 5   ? 20.270  16.437  48.718  1.00 57.99  ? 5    ASP A OD2 1 
ATOM   29   N N   . PRO A 1 6   ? 22.742  13.763  51.992  1.00 63.59  ? 6    PRO A N   1 
ATOM   30   C CA  . PRO A 1 6   ? 23.142  12.349  51.989  1.00 62.96  ? 6    PRO A CA  1 
ATOM   31   C C   . PRO A 1 6   ? 22.887  11.614  50.658  1.00 61.14  ? 6    PRO A C   1 
ATOM   32   O O   . PRO A 1 6   ? 23.484  10.567  50.407  1.00 60.83  ? 6    PRO A O   1 
ATOM   33   C CB  . PRO A 1 6   ? 22.288  11.750  53.113  1.00 64.81  ? 6    PRO A CB  1 
ATOM   34   C CG  . PRO A 1 6   ? 21.094  12.651  53.219  1.00 65.10  ? 6    PRO A CG  1 
ATOM   35   C CD  . PRO A 1 6   ? 21.630  14.013  52.936  1.00 65.06  ? 6    PRO A CD  1 
ATOM   36   N N   . GLN A 1 7   ? 22.036  12.175  49.812  1.00 59.54  ? 7    GLN A N   1 
ATOM   37   C CA  . GLN A 1 7   ? 21.687  11.553  48.549  1.00 57.83  ? 7    GLN A CA  1 
ATOM   38   C C   . GLN A 1 7   ? 22.687  11.892  47.423  1.00 55.16  ? 7    GLN A C   1 
ATOM   39   O O   . GLN A 1 7   ? 22.612  11.353  46.313  1.00 54.14  ? 7    GLN A O   1 
ATOM   40   C CB  . GLN A 1 7   ? 20.250  11.954  48.182  1.00 58.92  ? 7    GLN A CB  1 
ATOM   41   C CG  . GLN A 1 7   ? 19.674  11.313  46.892  1.00 60.90  ? 7    GLN A CG  1 
ATOM   42   C CD  . GLN A 1 7   ? 19.380  9.806   47.002  1.00 64.37  ? 7    GLN A CD  1 
ATOM   43   O OE1 . GLN A 1 7   ? 19.055  9.269   48.084  1.00 66.96  ? 7    GLN A OE1 1 
ATOM   44   N NE2 . GLN A 1 7   ? 19.472  9.127   45.870  1.00 63.16  ? 7    GLN A NE2 1 
ATOM   45   N N   . LEU A 1 8   ? 23.639  12.771  47.717  1.00 53.43  ? 8    LEU A N   1 
ATOM   46   C CA  . LEU A 1 8   ? 24.590  13.216  46.702  1.00 50.49  ? 8    LEU A CA  1 
ATOM   47   C C   . LEU A 1 8   ? 25.982  12.661  46.924  1.00 50.14  ? 8    LEU A C   1 
ATOM   48   O O   . LEU A 1 8   ? 26.945  13.115  46.282  1.00 50.10  ? 8    LEU A O   1 
ATOM   49   C CB  . LEU A 1 8   ? 24.621  14.744  46.611  1.00 49.62  ? 8    LEU A CB  1 
ATOM   50   C CG  . LEU A 1 8   ? 23.261  15.362  46.241  1.00 47.77  ? 8    LEU A CG  1 
ATOM   51   C CD1 . LEU A 1 8   ? 23.188  16.824  46.594  1.00 45.44  ? 8    LEU A CD1 1 
ATOM   52   C CD2 . LEU A 1 8   ? 22.899  15.132  44.770  1.00 44.22  ? 8    LEU A CD2 1 
ATOM   53   N N   . LEU A 1 9   ? 26.091  11.678  47.814  1.00 49.91  ? 9    LEU A N   1 
ATOM   54   C CA  . LEU A 1 9   ? 27.383  11.073  48.129  1.00 49.50  ? 9    LEU A CA  1 
ATOM   55   C C   . LEU A 1 9   ? 27.418  9.641   47.634  1.00 48.59  ? 9    LEU A C   1 
ATOM   56   O O   . LEU A 1 9   ? 26.611  8.830   48.053  1.00 48.51  ? 9    LEU A O   1 
ATOM   57   C CB  . LEU A 1 9   ? 27.665  11.143  49.636  1.00 50.76  ? 9    LEU A CB  1 
ATOM   58   C CG  . LEU A 1 9   ? 27.565  12.523  50.300  1.00 51.14  ? 9    LEU A CG  1 
ATOM   59   C CD1 . LEU A 1 9   ? 27.659  12.455  51.858  1.00 51.38  ? 9    LEU A CD1 1 
ATOM   60   C CD2 . LEU A 1 9   ? 28.605  13.496  49.711  1.00 49.38  ? 9    LEU A CD2 1 
ATOM   61   N N   . VAL A 1 10  ? 28.346  9.350   46.726  1.00 47.63  ? 10   VAL A N   1 
ATOM   62   C CA  . VAL A 1 10  ? 28.444  8.037   46.078  1.00 47.41  ? 10   VAL A CA  1 
ATOM   63   C C   . VAL A 1 10  ? 29.924  7.655   45.946  1.00 47.40  ? 10   VAL A C   1 
ATOM   64   O O   . VAL A 1 10  ? 30.786  8.547   45.857  1.00 46.79  ? 10   VAL A O   1 
ATOM   65   C CB  . VAL A 1 10  ? 27.764  8.075   44.682  1.00 46.57  ? 10   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 10  ? 28.109  6.863   43.846  1.00 47.14  ? 10   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 10  ? 26.260  8.135   44.836  1.00 47.22  ? 10   VAL A CG2 1 
ATOM   68   N N   . ARG A 1 11  ? 30.211  6.342   45.931  1.00 47.10  ? 11   ARG A N   1 
ATOM   69   C CA  . ARG A 1 11  ? 31.575  5.827   45.794  1.00 46.35  ? 11   ARG A CA  1 
ATOM   70   C C   . ARG A 1 11  ? 31.735  5.020   44.514  1.00 46.24  ? 11   ARG A C   1 
ATOM   71   O O   . ARG A 1 11  ? 30.850  4.240   44.160  1.00 47.03  ? 11   ARG A O   1 
ATOM   72   C CB  . ARG A 1 11  ? 31.966  4.967   46.987  1.00 47.33  ? 11   ARG A CB  1 
ATOM   73   C CG  . ARG A 1 11  ? 33.315  4.274   46.796  1.00 47.64  ? 11   ARG A CG  1 
ATOM   74   C CD  . ARG A 1 11  ? 33.819  3.507   48.007  1.00 47.73  ? 11   ARG A CD  1 
ATOM   75   N NE  . ARG A 1 11  ? 34.253  4.353   49.133  1.00 47.55  ? 11   ARG A NE  1 
ATOM   76   C CZ  . ARG A 1 11  ? 35.488  4.820   49.315  1.00 47.74  ? 11   ARG A CZ  1 
ATOM   77   N NH1 . ARG A 1 11  ? 35.755  5.563   50.395  1.00 47.74  ? 11   ARG A NH1 1 
ATOM   78   N NH2 . ARG A 1 11  ? 36.452  4.567   48.424  1.00 46.23  ? 11   ARG A NH2 1 
ATOM   79   N N   . VAL A 1 12  ? 32.862  5.216   43.826  1.00 45.62  ? 12   VAL A N   1 
ATOM   80   C CA  . VAL A 1 12  ? 33.213  4.458   42.626  1.00 45.09  ? 12   VAL A CA  1 
ATOM   81   C C   . VAL A 1 12  ? 34.599  3.820   42.814  1.00 46.00  ? 12   VAL A C   1 
ATOM   82   O O   . VAL A 1 12  ? 35.201  3.975   43.869  1.00 47.72  ? 12   VAL A O   1 
ATOM   83   C CB  . VAL A 1 12  ? 33.155  5.320   41.342  1.00 43.93  ? 12   VAL A CB  1 
ATOM   84   C CG1 . VAL A 1 12  ? 31.720  5.688   41.029  1.00 43.67  ? 12   VAL A CG1 1 
ATOM   85   C CG2 . VAL A 1 12  ? 34.040  6.581   41.459  1.00 42.41  ? 12   VAL A CG2 1 
ATOM   86   N N   . ARG A 1 13  ? 35.102  3.124   41.804  1.00 45.09  ? 13   ARG A N   1 
ATOM   87   C CA  . ARG A 1 13  ? 36.319  2.331   41.937  1.00 46.21  ? 13   ARG A CA  1 
ATOM   88   C C   . ARG A 1 13  ? 37.677  2.861   42.497  1.00 47.27  ? 13   ARG A C   1 
ATOM   89   O O   . ARG A 1 13  ? 38.290  2.144   43.264  1.00 49.24  ? 13   ARG A O   1 
ATOM   90   C CB  . ARG A 1 13  ? 36.582  1.562   40.639  1.00 45.94  ? 13   ARG A CB  1 
ATOM   91   C CG  . ARG A 1 13  ? 37.926  0.805   40.622  1.00 46.43  ? 13   ARG A CG  1 
ATOM   92   C CD  . ARG A 1 13  ? 37.925  -0.367  41.585  1.00 45.46  ? 13   ARG A CD  1 
ATOM   93   N NE  . ARG A 1 13  ? 39.200  -1.068  41.666  1.00 47.69  ? 13   ARG A NE  1 
ATOM   94   C CZ  . ARG A 1 13  ? 40.269  -0.664  42.363  1.00 49.72  ? 13   ARG A CZ  1 
ATOM   95   N NH1 . ARG A 1 13  ? 40.271  0.490   43.025  1.00 47.58  ? 13   ARG A NH1 1 
ATOM   96   N NH2 . ARG A 1 13  ? 41.363  -1.419  42.383  1.00 51.07  ? 13   ARG A NH2 1 
ATOM   97   N N   . GLY A 1 14  ? 38.187  4.050   42.220  1.00 47.04  ? 14   GLY A N   1 
ATOM   98   C CA  . GLY A 1 14  ? 37.495  5.267   41.973  1.00 47.55  ? 14   GLY A CA  1 
ATOM   99   C C   . GLY A 1 14  ? 37.822  6.057   43.249  1.00 49.37  ? 14   GLY A C   1 
ATOM   100  O O   . GLY A 1 14  ? 38.973  6.515   43.473  1.00 50.42  ? 14   GLY A O   1 
ATOM   101  N N   . GLY A 1 15  ? 36.819  6.169   44.111  1.00 49.26  ? 15   GLY A N   1 
ATOM   102  C CA  . GLY A 1 15  ? 36.921  6.921   45.346  1.00 50.21  ? 15   GLY A CA  1 
ATOM   103  C C   . GLY A 1 15  ? 35.552  7.544   45.546  1.00 49.96  ? 15   GLY A C   1 
ATOM   104  O O   . GLY A 1 15  ? 34.598  7.192   44.824  1.00 49.01  ? 15   GLY A O   1 
ATOM   105  N N   . GLN A 1 16  ? 35.458  8.480   46.491  1.00 50.21  ? 16   GLN A N   1 
ATOM   106  C CA  . GLN A 1 16  ? 34.182  9.114   46.826  1.00 50.58  ? 16   GLN A CA  1 
ATOM   107  C C   . GLN A 1 16  ? 33.824  10.285  45.912  1.00 49.02  ? 16   GLN A C   1 
ATOM   108  O O   . GLN A 1 16  ? 34.705  11.040  45.505  1.00 49.52  ? 16   GLN A O   1 
ATOM   109  C CB  . GLN A 1 16  ? 34.168  9.545   48.293  1.00 51.86  ? 16   GLN A CB  1 
ATOM   110  C CG  . GLN A 1 16  ? 33.917  8.386   49.226  1.00 53.88  ? 16   GLN A CG  1 
ATOM   111  C CD  . GLN A 1 16  ? 33.953  8.780   50.679  1.00 57.53  ? 16   GLN A CD  1 
ATOM   112  O OE1 . GLN A 1 16  ? 34.980  9.258   51.174  1.00 58.89  ? 16   GLN A OE1 1 
ATOM   113  N NE2 . GLN A 1 16  ? 32.833  8.562   51.388  1.00 57.46  ? 16   GLN A NE2 1 
ATOM   114  N N   . LEU A 1 17  ? 32.538  10.428  45.589  1.00 47.65  ? 17   LEU A N   1 
ATOM   115  C CA  . LEU A 1 17  ? 32.071  11.552  44.770  1.00 46.08  ? 17   LEU A CA  1 
ATOM   116  C C   . LEU A 1 17  ? 31.027  12.354  45.502  1.00 46.81  ? 17   LEU A C   1 
ATOM   117  O O   . LEU A 1 17  ? 30.195  11.782  46.226  1.00 47.50  ? 17   LEU A O   1 
ATOM   118  C CB  . LEU A 1 17  ? 31.491  11.072  43.443  1.00 44.17  ? 17   LEU A CB  1 
ATOM   119  C CG  . LEU A 1 17  ? 32.361  10.192  42.556  1.00 42.94  ? 17   LEU A CG  1 
ATOM   120  C CD1 . LEU A 1 17  ? 31.546  9.652   41.401  1.00 41.74  ? 17   LEU A CD1 1 
ATOM   121  C CD2 . LEU A 1 17  ? 33.572  10.950  42.061  1.00 42.70  ? 17   LEU A CD2 1 
ATOM   122  N N   . ARG A 1 18  ? 31.078  13.676  45.335  1.00 47.06  ? 18   ARG A N   1 
ATOM   123  C CA  . ARG A 1 18  ? 29.971  14.534  45.759  1.00 48.10  ? 18   ARG A CA  1 
ATOM   124  C C   . ARG A 1 18  ? 29.316  15.129  44.512  1.00 47.21  ? 18   ARG A C   1 
ATOM   125  O O   . ARG A 1 18  ? 29.975  15.819  43.733  1.00 46.97  ? 18   ARG A O   1 
ATOM   126  C CB  . ARG A 1 18  ? 30.415  15.628  46.738  1.00 48.75  ? 18   ARG A CB  1 
ATOM   127  C CG  . ARG A 1 18  ? 29.241  16.392  47.417  1.00 52.09  ? 18   ARG A CG  1 
ATOM   128  C CD  . ARG A 1 18  ? 29.694  17.511  48.388  1.00 56.54  ? 18   ARG A CD  1 
ATOM   129  N NE  . ARG A 1 18  ? 30.926  18.129  47.904  1.00 60.54  ? 18   ARG A NE  1 
ATOM   130  C CZ  . ARG A 1 18  ? 32.134  18.003  48.468  1.00 62.25  ? 18   ARG A CZ  1 
ATOM   131  N NH1 . ARG A 1 18  ? 32.315  17.315  49.600  1.00 60.06  ? 18   ARG A NH1 1 
ATOM   132  N NH2 . ARG A 1 18  ? 33.175  18.592  47.881  1.00 63.19  ? 18   ARG A NH2 1 
ATOM   133  N N   . GLY A 1 19  ? 28.028  14.840  44.330  1.00 46.85  ? 19   GLY A N   1 
ATOM   134  C CA  . GLY A 1 19  ? 27.267  15.371  43.215  1.00 46.19  ? 19   GLY A CA  1 
ATOM   135  C C   . GLY A 1 19  ? 26.415  16.559  43.607  1.00 47.14  ? 19   GLY A C   1 
ATOM   136  O O   . GLY A 1 19  ? 26.539  17.094  44.715  1.00 48.10  ? 19   GLY A O   1 
ATOM   137  N N   . ILE A 1 20  ? 25.539  16.965  42.692  1.00 46.66  ? 20   ILE A N   1 
ATOM   138  C CA  . ILE A 1 20  ? 24.739  18.170  42.861  1.00 47.68  ? 20   ILE A CA  1 
ATOM   139  C C   . ILE A 1 20  ? 23.280  17.905  42.523  1.00 48.03  ? 20   ILE A C   1 
ATOM   140  O O   . ILE A 1 20  ? 22.968  17.191  41.555  1.00 47.32  ? 20   ILE A O   1 
ATOM   141  C CB  . ILE A 1 20  ? 25.298  19.371  42.024  1.00 47.34  ? 20   ILE A CB  1 
ATOM   142  C CG1 . ILE A 1 20  ? 24.412  20.623  42.201  1.00 48.42  ? 20   ILE A CG1 1 
ATOM   143  C CG2 . ILE A 1 20  ? 25.454  18.997  40.541  1.00 45.69  ? 20   ILE A CG2 1 
ATOM   144  C CD1 . ILE A 1 20  ? 25.138  21.954  41.977  1.00 46.91  ? 20   ILE A CD1 1 
ATOM   145  N N   . ARG A 1 21  ? 22.399  18.461  43.345  1.00 49.43  ? 21   ARG A N   1 
ATOM   146  C CA  . ARG A 1 21  ? 20.966  18.347  43.141  1.00 50.97  ? 21   ARG A CA  1 
ATOM   147  C C   . ARG A 1 21  ? 20.584  19.454  42.167  1.00 50.89  ? 21   ARG A C   1 
ATOM   148  O O   . ARG A 1 21  ? 20.724  20.629  42.479  1.00 51.81  ? 21   ARG A O   1 
ATOM   149  C CB  . ARG A 1 21  ? 20.272  18.512  44.488  1.00 52.58  ? 21   ARG A CB  1 
ATOM   150  C CG  . ARG A 1 21  ? 18.743  18.444  44.536  1.00 55.70  ? 21   ARG A CG  1 
ATOM   151  C CD  . ARG A 1 21  ? 18.311  19.080  45.862  1.00 62.40  ? 21   ARG A CD  1 
ATOM   152  N NE  . ARG A 1 21  ? 16.895  18.969  46.203  1.00 68.00  ? 21   ARG A NE  1 
ATOM   153  C CZ  . ARG A 1 21  ? 15.938  19.791  45.760  1.00 72.53  ? 21   ARG A CZ  1 
ATOM   154  N NH1 . ARG A 1 21  ? 16.236  20.773  44.898  1.00 73.66  ? 21   ARG A NH1 1 
ATOM   155  N NH2 . ARG A 1 21  ? 14.672  19.620  46.151  1.00 72.68  ? 21   ARG A NH2 1 
ATOM   156  N N   . LEU A 1 22  ? 20.158  19.090  40.968  1.00 50.33  ? 22   LEU A N   1 
ATOM   157  C CA  . LEU A 1 22  ? 19.744  20.096  40.002  1.00 50.89  ? 22   LEU A CA  1 
ATOM   158  C C   . LEU A 1 22  ? 18.228  20.156  39.876  1.00 52.35  ? 22   LEU A C   1 
ATOM   159  O O   . LEU A 1 22  ? 17.535  19.204  40.209  1.00 52.84  ? 22   LEU A O   1 
ATOM   160  C CB  . LEU A 1 22  ? 20.371  19.853  38.630  1.00 49.25  ? 22   LEU A CB  1 
ATOM   161  C CG  . LEU A 1 22  ? 21.884  19.977  38.459  1.00 48.16  ? 22   LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 22  ? 22.246  19.462  37.090  1.00 47.23  ? 22   LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 22  ? 22.364  21.400  38.643  1.00 47.24  ? 22   LEU A CD2 1 
ATOM   164  N N   . LYS A 1 23  ? 17.739  21.292  39.393  1.00 53.51  ? 23   LYS A N   1 
ATOM   165  C CA  . LYS A 1 23  ? 16.326  21.511  39.141  1.00 55.21  ? 23   LYS A CA  1 
ATOM   166  C C   . LYS A 1 23  ? 15.965  21.213  37.680  1.00 53.89  ? 23   LYS A C   1 
ATOM   167  O O   . LYS A 1 23  ? 16.533  21.781  36.749  1.00 53.22  ? 23   LYS A O   1 
ATOM   168  C CB  . LYS A 1 23  ? 15.979  22.961  39.468  1.00 56.72  ? 23   LYS A CB  1 
ATOM   169  C CG  . LYS A 1 23  ? 14.737  23.136  40.326  1.00 61.90  ? 23   LYS A CG  1 
ATOM   170  C CD  . LYS A 1 23  ? 14.468  24.641  40.616  1.00 67.77  ? 23   LYS A CD  1 
ATOM   171  C CE  . LYS A 1 23  ? 13.744  25.337  39.439  1.00 68.97  ? 23   LYS A CE  1 
ATOM   172  N NZ  . LYS A 1 23  ? 12.376  24.749  39.197  1.00 70.13  ? 23   LYS A NZ  1 
ATOM   173  N N   . ALA A 1 24  ? 15.042  20.288  37.487  1.00 53.73  ? 24   ALA A N   1 
ATOM   174  C CA  . ALA A 1 24  ? 14.382  20.131  36.197  1.00 53.11  ? 24   ALA A CA  1 
ATOM   175  C C   . ALA A 1 24  ? 12.948  20.599  36.395  1.00 54.12  ? 24   ALA A C   1 
ATOM   176  O O   . ALA A 1 24  ? 12.488  20.685  37.525  1.00 55.53  ? 24   ALA A O   1 
ATOM   177  C CB  . ALA A 1 24  ? 14.427  18.683  35.736  1.00 51.90  ? 24   ALA A CB  1 
ATOM   178  N N   . PRO A 1 25  ? 12.235  20.910  35.304  1.00 54.35  ? 25   PRO A N   1 
ATOM   179  C CA  . PRO A 1 25  ? 10.853  21.429  35.426  1.00 55.32  ? 25   PRO A CA  1 
ATOM   180  C C   . PRO A 1 25  ? 9.927   20.569  36.273  1.00 56.15  ? 25   PRO A C   1 
ATOM   181  O O   . PRO A 1 25  ? 9.101   21.097  37.019  1.00 57.64  ? 25   PRO A O   1 
ATOM   182  C CB  . PRO A 1 25  ? 10.347  21.454  33.980  1.00 54.87  ? 25   PRO A CB  1 
ATOM   183  C CG  . PRO A 1 25  ? 11.596  21.527  33.124  1.00 54.10  ? 25   PRO A CG  1 
ATOM   184  C CD  . PRO A 1 25  ? 12.708  20.854  33.899  1.00 53.16  ? 25   PRO A CD  1 
ATOM   185  N N   . GLY A 1 26  ? 10.050  19.253  36.161  1.00 55.44  ? 26   GLY A N   1 
ATOM   186  C CA  . GLY A 1 26  ? 9.167   18.355  36.904  1.00 56.42  ? 26   GLY A CA  1 
ATOM   187  C C   . GLY A 1 26  ? 9.608   18.094  38.332  1.00 56.87  ? 26   GLY A C   1 
ATOM   188  O O   . GLY A 1 26  ? 8.839   17.538  39.112  1.00 58.02  ? 26   GLY A O   1 
ATOM   189  N N   . GLY A 1 27  ? 10.850  18.474  38.660  1.00 55.67  ? 27   GLY A N   1 
ATOM   190  C CA  . GLY A 1 27  ? 11.443  18.231  39.978  1.00 55.73  ? 27   GLY A CA  1 
ATOM   191  C C   . GLY A 1 27  ? 12.961  18.029  39.958  1.00 54.30  ? 27   GLY A C   1 
ATOM   192  O O   . GLY A 1 27  ? 13.607  18.261  38.933  1.00 53.31  ? 27   GLY A O   1 
ATOM   193  N N   . PRO A 1 28  ? 13.543  17.590  41.092  1.00 53.85  ? 28   PRO A N   1 
ATOM   194  C CA  . PRO A 1 28  ? 14.999  17.478  41.203  1.00 52.19  ? 28   PRO A CA  1 
ATOM   195  C C   . PRO A 1 28  ? 15.595  16.263  40.512  1.00 50.97  ? 28   PRO A C   1 
ATOM   196  O O   . PRO A 1 28  ? 14.950  15.208  40.459  1.00 51.54  ? 28   PRO A O   1 
ATOM   197  C CB  . PRO A 1 28  ? 15.228  17.381  42.703  1.00 53.20  ? 28   PRO A CB  1 
ATOM   198  C CG  . PRO A 1 28  ? 13.936  16.855  43.259  1.00 54.22  ? 28   PRO A CG  1 
ATOM   199  C CD  . PRO A 1 28  ? 12.860  17.354  42.377  1.00 55.01  ? 28   PRO A CD  1 
ATOM   200  N N   . VAL A 1 29  ? 16.806  16.432  39.970  1.00 49.22  ? 29   VAL A N   1 
ATOM   201  C CA  . VAL A 1 29  ? 17.634  15.317  39.520  1.00 48.07  ? 29   VAL A CA  1 
ATOM   202  C C   . VAL A 1 29  ? 18.992  15.332  40.210  1.00 47.28  ? 29   VAL A C   1 
ATOM   203  O O   . VAL A 1 29  ? 19.423  16.366  40.714  1.00 47.24  ? 29   VAL A O   1 
ATOM   204  C CB  . VAL A 1 29  ? 17.824  15.266  37.968  1.00 47.39  ? 29   VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 29  ? 16.536  14.895  37.294  1.00 46.87  ? 29   VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 29  ? 18.356  16.581  37.416  1.00 47.15  ? 29   VAL A CG2 1 
ATOM   207  N N   . SER A 1 30  ? 19.652  14.178  40.241  1.00 46.68  ? 30   SER A N   1 
ATOM   208  C CA  . SER A 1 30  ? 21.024  14.076  40.747  1.00 46.02  ? 30   SER A CA  1 
ATOM   209  C C   . SER A 1 30  ? 22.020  14.200  39.606  1.00 44.02  ? 30   SER A C   1 
ATOM   210  O O   . SER A 1 30  ? 21.824  13.602  38.556  1.00 43.08  ? 30   SER A O   1 
ATOM   211  C CB  . SER A 1 30  ? 21.228  12.736  41.419  1.00 46.30  ? 30   SER A CB  1 
ATOM   212  O OG  . SER A 1 30  ? 20.450  12.634  42.594  1.00 50.09  ? 30   SER A OG  1 
ATOM   213  N N   . ALA A 1 31  ? 23.093  14.960  39.801  1.00 43.21  ? 31   ALA A N   1 
ATOM   214  C CA  . ALA A 1 31  ? 24.114  15.055  38.761  1.00 41.82  ? 31   ALA A CA  1 
ATOM   215  C C   . ALA A 1 31  ? 25.516  14.915  39.317  1.00 41.93  ? 31   ALA A C   1 
ATOM   216  O O   . ALA A 1 31  ? 25.841  15.489  40.366  1.00 43.18  ? 31   ALA A O   1 
ATOM   217  C CB  . ALA A 1 31  ? 23.981  16.326  38.006  1.00 41.09  ? 31   ALA A CB  1 
ATOM   218  N N   . PHE A 1 32  ? 26.339  14.141  38.613  1.00 40.86  ? 32   PHE A N   1 
ATOM   219  C CA  . PHE A 1 32  ? 27.723  13.874  39.001  1.00 39.99  ? 32   PHE A CA  1 
ATOM   220  C C   . PHE A 1 32  ? 28.536  14.212  37.791  1.00 39.83  ? 32   PHE A C   1 
ATOM   221  O O   . PHE A 1 32  ? 28.656  13.404  36.868  1.00 39.99  ? 32   PHE A O   1 
ATOM   222  C CB  . PHE A 1 32  ? 27.889  12.411  39.389  1.00 39.57  ? 32   PHE A CB  1 
ATOM   223  C CG  . PHE A 1 32  ? 27.126  12.045  40.615  1.00 39.73  ? 32   PHE A CG  1 
ATOM   224  C CD1 . PHE A 1 32  ? 25.781  11.715  40.537  1.00 38.73  ? 32   PHE A CD1 1 
ATOM   225  C CD2 . PHE A 1 32  ? 27.736  12.082  41.868  1.00 40.21  ? 32   PHE A CD2 1 
ATOM   226  C CE1 . PHE A 1 32  ? 25.057  11.413  41.671  1.00 38.98  ? 32   PHE A CE1 1 
ATOM   227  C CE2 . PHE A 1 32  ? 27.013  11.770  43.025  1.00 39.85  ? 32   PHE A CE2 1 
ATOM   228  C CZ  . PHE A 1 32  ? 25.675  11.439  42.923  1.00 39.34  ? 32   PHE A CZ  1 
ATOM   229  N N   . LEU A 1 33  ? 29.056  15.433  37.771  1.00 39.83  ? 33   LEU A N   1 
ATOM   230  C CA  . LEU A 1 33  ? 29.706  15.976  36.585  1.00 38.60  ? 33   LEU A CA  1 
ATOM   231  C C   . LEU A 1 33  ? 31.219  16.035  36.779  1.00 38.76  ? 33   LEU A C   1 
ATOM   232  O O   . LEU A 1 33  ? 31.690  16.281  37.869  1.00 39.57  ? 33   LEU A O   1 
ATOM   233  C CB  . LEU A 1 33  ? 29.151  17.373  36.298  1.00 38.50  ? 33   LEU A CB  1 
ATOM   234  C CG  . LEU A 1 33  ? 27.624  17.515  36.205  1.00 37.99  ? 33   LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 33  ? 27.224  18.977  36.053  1.00 37.49  ? 33   LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 33  ? 27.009  16.677  35.076  1.00 34.81  ? 33   LEU A CD2 1 
ATOM   237  N N   . GLY A 1 34  ? 31.969  15.798  35.714  1.00 38.19  ? 34   GLY A N   1 
ATOM   238  C CA  . GLY A 1 34  ? 33.409  15.847  35.765  1.00 38.78  ? 34   GLY A CA  1 
ATOM   239  C C   . GLY A 1 34  ? 34.093  14.734  36.541  1.00 39.78  ? 34   GLY A C   1 
ATOM   240  O O   . GLY A 1 34  ? 35.093  14.984  37.208  1.00 40.68  ? 34   GLY A O   1 
ATOM   241  N N   . ILE A 1 35  ? 33.575  13.508  36.453  1.00 39.98  ? 35   ILE A N   1 
ATOM   242  C CA  . ILE A 1 35  ? 34.227  12.341  37.057  1.00 40.49  ? 35   ILE A CA  1 
ATOM   243  C C   . ILE A 1 35  ? 35.339  11.863  36.119  1.00 41.00  ? 35   ILE A C   1 
ATOM   244  O O   . ILE A 1 35  ? 35.047  11.492  34.980  1.00 41.14  ? 35   ILE A O   1 
ATOM   245  C CB  . ILE A 1 35  ? 33.259  11.164  37.217  1.00 40.32  ? 35   ILE A CB  1 
ATOM   246  C CG1 . ILE A 1 35  ? 31.976  11.584  37.944  1.00 38.72  ? 35   ILE A CG1 1 
ATOM   247  C CG2 . ILE A 1 35  ? 33.980  9.976   37.881  1.00 40.74  ? 35   ILE A CG2 1 
ATOM   248  C CD1 . ILE A 1 35  ? 30.838  10.627  37.730  1.00 36.10  ? 35   ILE A CD1 1 
ATOM   249  N N   . PRO A 1 36  ? 36.604  11.859  36.584  1.00 41.59  ? 36   PRO A N   1 
ATOM   250  C CA  . PRO A 1 36  ? 37.727  11.437  35.719  1.00 41.45  ? 36   PRO A CA  1 
ATOM   251  C C   . PRO A 1 36  ? 37.669  9.947   35.454  1.00 41.84  ? 36   PRO A C   1 
ATOM   252  O O   . PRO A 1 36  ? 37.428  9.189   36.384  1.00 43.40  ? 36   PRO A O   1 
ATOM   253  C CB  . PRO A 1 36  ? 38.968  11.742  36.582  1.00 42.58  ? 36   PRO A CB  1 
ATOM   254  C CG  . PRO A 1 36  ? 38.463  11.693  38.034  1.00 42.56  ? 36   PRO A CG  1 
ATOM   255  C CD  . PRO A 1 36  ? 37.049  12.251  37.940  1.00 42.04  ? 36   PRO A CD  1 
ATOM   256  N N   . PHE A 1 37  ? 37.882  9.510   34.217  1.00 41.55  ? 37   PHE A N   1 
ATOM   257  C CA  . PHE A 1 37  ? 37.927  8.077   33.937  1.00 41.66  ? 37   PHE A CA  1 
ATOM   258  C C   . PHE A 1 37  ? 39.251  7.601   33.373  1.00 42.76  ? 37   PHE A C   1 
ATOM   259  O O   . PHE A 1 37  ? 39.485  6.400   33.281  1.00 44.13  ? 37   PHE A O   1 
ATOM   260  C CB  . PHE A 1 37  ? 36.752  7.611   33.071  1.00 40.85  ? 37   PHE A CB  1 
ATOM   261  C CG  . PHE A 1 37  ? 36.717  8.209   31.696  1.00 39.95  ? 37   PHE A CG  1 
ATOM   262  C CD1 . PHE A 1 37  ? 37.321  7.546   30.613  1.00 40.20  ? 37   PHE A CD1 1 
ATOM   263  C CD2 . PHE A 1 37  ? 36.038  9.407   31.457  1.00 38.03  ? 37   PHE A CD2 1 
ATOM   264  C CE1 . PHE A 1 37  ? 37.295  8.089   29.313  1.00 38.06  ? 37   PHE A CE1 1 
ATOM   265  C CE2 . PHE A 1 37  ? 36.002  9.957   30.171  1.00 37.34  ? 37   PHE A CE2 1 
ATOM   266  C CZ  . PHE A 1 37  ? 36.641  9.288   29.090  1.00 37.58  ? 37   PHE A CZ  1 
ATOM   267  N N   . ALA A 1 38  ? 40.128  8.530   33.012  1.00 43.02  ? 38   ALA A N   1 
ATOM   268  C CA  . ALA A 1 38  ? 41.480  8.175   32.560  1.00 43.49  ? 38   ALA A CA  1 
ATOM   269  C C   . ALA A 1 38  ? 42.508  9.083   33.198  1.00 44.32  ? 38   ALA A C   1 
ATOM   270  O O   . ALA A 1 38  ? 42.169  10.187  33.657  1.00 44.04  ? 38   ALA A O   1 
ATOM   271  C CB  . ALA A 1 38  ? 41.591  8.269   31.056  1.00 42.94  ? 38   ALA A CB  1 
ATOM   272  N N   . GLU A 1 39  ? 43.755  8.614   33.228  1.00 45.00  ? 39   GLU A N   1 
ATOM   273  C CA  . GLU A 1 39  ? 44.878  9.468   33.576  1.00 46.21  ? 39   GLU A CA  1 
ATOM   274  C C   . GLU A 1 39  ? 44.981  10.572  32.512  1.00 45.70  ? 39   GLU A C   1 
ATOM   275  O O   . GLU A 1 39  ? 44.764  10.305  31.333  1.00 45.76  ? 39   GLU A O   1 
ATOM   276  C CB  . GLU A 1 39  ? 46.168  8.652   33.680  1.00 47.52  ? 39   GLU A CB  1 
ATOM   277  C CG  . GLU A 1 39  ? 46.293  7.897   35.014  1.00 49.16  ? 39   GLU A CG  1 
ATOM   278  C CD  . GLU A 1 39  ? 46.398  8.859   36.168  1.00 51.98  ? 39   GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 39  ? 47.315  9.705   36.106  1.00 55.44  ? 39   GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 39  ? 45.559  8.827   37.100  1.00 51.33  ? 39   GLU A OE2 1 
ATOM   281  N N   . PRO A 1 40  ? 45.251  11.821  32.925  1.00 45.57  ? 40   PRO A N   1 
ATOM   282  C CA  . PRO A 1 40  ? 45.335  12.893  31.934  1.00 45.28  ? 40   PRO A CA  1 
ATOM   283  C C   . PRO A 1 40  ? 46.266  12.524  30.775  1.00 45.75  ? 40   PRO A C   1 
ATOM   284  O O   . PRO A 1 40  ? 47.423  12.151  30.988  1.00 47.36  ? 40   PRO A O   1 
ATOM   285  C CB  . PRO A 1 40  ? 45.886  14.063  32.742  1.00 46.03  ? 40   PRO A CB  1 
ATOM   286  C CG  . PRO A 1 40  ? 45.373  13.800  34.127  1.00 46.19  ? 40   PRO A CG  1 
ATOM   287  C CD  . PRO A 1 40  ? 45.449  12.319  34.296  1.00 45.77  ? 40   PRO A CD  1 
ATOM   288  N N   . PRO A 1 41  ? 45.752  12.581  29.550  1.00 44.90  ? 41   PRO A N   1 
ATOM   289  C CA  . PRO A 1 41  ? 46.549  12.136  28.412  1.00 45.24  ? 41   PRO A CA  1 
ATOM   290  C C   . PRO A 1 41  ? 47.505  13.233  27.903  1.00 45.27  ? 41   PRO A C   1 
ATOM   291  O O   . PRO A 1 41  ? 47.483  13.586  26.720  1.00 44.12  ? 41   PRO A O   1 
ATOM   292  C CB  . PRO A 1 41  ? 45.478  11.778  27.369  1.00 43.94  ? 41   PRO A CB  1 
ATOM   293  C CG  . PRO A 1 41  ? 44.395  12.761  27.643  1.00 43.86  ? 41   PRO A CG  1 
ATOM   294  C CD  . PRO A 1 41  ? 44.366  12.903  29.165  1.00 43.83  ? 41   PRO A CD  1 
ATOM   295  N N   . VAL A 1 42  ? 48.363  13.723  28.798  1.00 45.88  ? 42   VAL A N   1 
ATOM   296  C CA  . VAL A 1 42  ? 49.213  14.887  28.531  1.00 46.27  ? 42   VAL A CA  1 
ATOM   297  C C   . VAL A 1 42  ? 50.710  14.524  28.502  1.00 48.30  ? 42   VAL A C   1 
ATOM   298  O O   . VAL A 1 42  ? 51.092  13.461  28.966  1.00 49.43  ? 42   VAL A O   1 
ATOM   299  C CB  . VAL A 1 42  ? 48.947  15.995  29.583  1.00 46.37  ? 42   VAL A CB  1 
ATOM   300  C CG1 . VAL A 1 42  ? 47.439  16.353  29.624  1.00 45.57  ? 42   VAL A CG1 1 
ATOM   301  C CG2 . VAL A 1 42  ? 49.409  15.574  30.957  1.00 44.93  ? 42   VAL A CG2 1 
ATOM   302  N N   . GLY A 1 43  ? 51.558  15.405  27.984  1.00 49.18  ? 43   GLY A N   1 
ATOM   303  C CA  . GLY A 1 43  ? 53.000  15.166  27.984  1.00 51.22  ? 43   GLY A CA  1 
ATOM   304  C C   . GLY A 1 43  ? 53.354  13.964  27.121  1.00 52.14  ? 43   GLY A C   1 
ATOM   305  O O   . GLY A 1 43  ? 52.903  13.876  25.974  1.00 51.52  ? 43   GLY A O   1 
ATOM   306  N N   . SER A 1 44  ? 54.130  13.022  27.672  1.00 53.64  ? 44   SER A N   1 
ATOM   307  C CA  . SER A 1 44  ? 54.580  11.834  26.920  1.00 54.51  ? 44   SER A CA  1 
ATOM   308  C C   . SER A 1 44  ? 53.405  10.934  26.508  1.00 53.17  ? 44   SER A C   1 
ATOM   309  O O   . SER A 1 44  ? 53.570  9.885   25.892  1.00 53.24  ? 44   SER A O   1 
ATOM   310  C CB  . SER A 1 44  ? 55.596  11.030  27.728  1.00 55.98  ? 44   SER A CB  1 
ATOM   311  O OG  . SER A 1 44  ? 54.951  10.231  28.711  1.00 56.35  ? 44   SER A OG  1 
ATOM   312  N N   . ARG A 1 45  ? 52.209  11.391  26.824  1.00 52.32  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 45  ? 51.031  10.574  26.697  1.00 51.38  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 45  ? 50.075  11.028  25.578  1.00 48.98  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 45  ? 49.116  10.331  25.252  1.00 48.18  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 45  ? 50.345  10.559  28.048  1.00 51.89  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 45  ? 50.002  9.184   28.504  1.00 55.95  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 45  ? 49.685  9.195   29.966  1.00 61.17  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 45  ? 50.776  8.558   30.664  1.00 68.30  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 45  ? 50.764  8.215   31.951  1.00 70.68  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 45  ? 51.838  7.627   32.479  1.00 71.04  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 45  ? 49.695  8.469   32.703  1.00 70.15  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 46  ? 50.353  12.184  24.982  1.00 47.63  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 46  ? 49.638  12.634  23.795  1.00 45.46  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 46  ? 49.755  11.574  22.697  1.00 45.11  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 46  ? 50.803  10.977  22.540  1.00 46.39  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 46  ? 50.201  13.983  23.343  1.00 45.45  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 46  ? 49.533  14.592  22.169  1.00 43.64  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 46  ? 50.321  15.775  21.669  1.00 43.66  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 46  ? 50.134  16.971  22.482  1.00 43.60  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 46  ? 50.826  18.098  22.319  1.00 43.95  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 46  ? 51.761  18.167  21.388  1.00 46.05  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 46  ? 50.601  19.151  23.091  1.00 42.10  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 47  ? 48.675  11.352  21.947  1.00 43.78  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 47  ? 48.585  10.296  20.927  1.00 43.31  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 47  ? 48.495  8.856   21.461  1.00 44.24  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 47  ? 48.187  7.937   20.696  1.00 44.39  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 47  ? 49.703  10.392  19.887  1.00 44.04  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 47  ? 50.006  11.795  19.441  1.00 43.64  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 47  ? 49.006  12.612  18.910  1.00 41.49  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 47  ? 51.290  12.298  19.545  1.00 42.61  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 47  ? 49.291  13.900  18.508  1.00 39.82  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 47  ? 51.574  13.582  19.148  1.00 42.20  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 47  ? 50.570  14.384  18.632  1.00 40.65  ? 47   PHE A CZ  1 
ATOM   345  N N   . MET A 1 48  ? 48.734  8.656   22.757  1.00 44.85  ? 48   MET A N   1 
ATOM   346  C CA  . MET A 1 48  ? 48.724  7.314   23.341  1.00 45.85  ? 48   MET A CA  1 
ATOM   347  C C   . MET A 1 48  ? 47.328  6.887   23.788  1.00 44.68  ? 48   MET A C   1 
ATOM   348  O O   . MET A 1 48  ? 46.512  7.731   24.177  1.00 43.29  ? 48   MET A O   1 
ATOM   349  C CB  . MET A 1 48  ? 49.695  7.231   24.526  1.00 46.97  ? 48   MET A CB  1 
ATOM   350  C CG  . MET A 1 48  ? 51.148  7.337   24.137  1.00 50.46  ? 48   MET A CG  1 
ATOM   351  S SD  . MET A 1 48  ? 51.750  5.866   23.248  1.00 57.52  ? 48   MET A SD  1 
ATOM   352  C CE  . MET A 1 48  ? 52.070  4.759   24.623  1.00 54.25  ? 48   MET A CE  1 
ATOM   353  N N   . PRO A 1 49  ? 47.056  5.570   23.748  1.00 45.27  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 49  ? 45.807  5.033   24.312  1.00 45.14  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 49  ? 45.653  5.451   25.773  1.00 45.61  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 49  ? 46.652  5.692   26.454  1.00 46.78  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 49  ? 45.985  3.507   24.233  1.00 45.78  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 49  ? 47.115  3.267   23.297  1.00 46.11  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 49  ? 47.965  4.507   23.273  1.00 46.60  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 50  ? 44.410  5.587   26.246  1.00 45.26  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 50  ? 44.240  6.046   27.614  1.00 45.39  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 50  ? 44.535  4.934   28.604  1.00 47.28  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 50  ? 44.327  3.737   28.304  1.00 47.77  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 50  ? 42.763  6.400   27.667  1.00 43.96  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 50  ? 42.144  5.515   26.654  1.00 43.18  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 50  ? 43.121  5.458   25.545  1.00 43.91  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 51  ? 45.020  5.334   29.775  1.00 48.46  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 51  ? 45.184  4.438   30.906  1.00 50.00  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 51  ? 44.098  4.773   31.914  1.00 48.73  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 51  ? 43.755  5.939   32.085  1.00 47.35  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 51  ? 46.567  4.617   31.526  1.00 51.88  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 51  ? 47.705  4.350   30.529  1.00 57.67  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 51  ? 49.068  4.162   31.203  1.00 64.83  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 51  ? 49.643  5.181   31.672  1.00 66.29  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 51  ? 49.565  3.000   31.241  1.00 67.85  ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 52  ? 43.556  3.747   32.598  1.00 49.11  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 52  ? 42.558  3.943   33.668  1.00 48.49  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 52  ? 42.968  5.018   34.692  1.00 48.28  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 52  ? 44.143  5.107   35.050  1.00 48.89  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 52  ? 42.514  2.562   34.343  1.00 49.51  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 52  ? 42.857  1.622   33.263  1.00 49.70  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 52  ? 43.890  2.322   32.417  1.00 49.48  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 53  ? 42.009  5.818   35.156  1.00 47.47  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 53  ? 42.267  6.825   36.193  1.00 47.78  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 53  ? 42.700  6.152   37.496  1.00 49.63  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 53  ? 42.061  5.199   37.936  1.00 50.57  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 53  ? 41.011  7.678   36.433  1.00 46.79  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 53  ? 41.083  8.626   37.629  1.00 46.22  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 53  ? 42.070  9.769   37.407  1.00 45.81  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 53  ? 42.192  10.658  38.641  1.00 44.75  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 53  ? 42.992  11.867  38.313  1.00 44.63  ? 53   LYS A NZ  1 
ATOM   392  N N   . ARG A 1 54  ? 43.777  6.645   38.106  1.00 50.70  ? 54   ARG A N   1 
ATOM   393  C CA  . ARG A 1 54  ? 44.307  6.087   39.343  1.00 52.13  ? 54   ARG A CA  1 
ATOM   394  C C   . ARG A 1 54  ? 43.453  6.553   40.522  1.00 52.14  ? 54   ARG A C   1 
ATOM   395  O O   . ARG A 1 54  ? 42.988  7.696   40.530  1.00 51.58  ? 54   ARG A O   1 
ATOM   396  C CB  . ARG A 1 54  ? 45.766  6.507   39.528  1.00 53.56  ? 54   ARG A CB  1 
ATOM   397  C CG  . ARG A 1 54  ? 46.751  5.734   38.652  1.00 56.35  ? 54   ARG A CG  1 
ATOM   398  C CD  . ARG A 1 54  ? 48.128  5.656   39.304  1.00 64.05  ? 54   ARG A CD  1 
ATOM   399  N NE  . ARG A 1 54  ? 49.021  6.752   38.897  1.00 69.11  ? 54   ARG A NE  1 
ATOM   400  C CZ  . ARG A 1 54  ? 49.812  6.730   37.811  1.00 71.31  ? 54   ARG A CZ  1 
ATOM   401  N NH1 . ARG A 1 54  ? 49.831  5.674   36.993  1.00 71.16  ? 54   ARG A NH1 1 
ATOM   402  N NH2 . ARG A 1 54  ? 50.591  7.775   37.529  1.00 71.94  ? 54   ARG A NH2 1 
ATOM   403  N N   . PRO A 1 55  ? 43.222  5.676   41.520  1.00 52.71  ? 55   PRO A N   1 
ATOM   404  C CA  . PRO A 1 55  ? 42.304  6.069   42.607  1.00 52.80  ? 55   PRO A CA  1 
ATOM   405  C C   . PRO A 1 55  ? 42.731  7.364   43.310  1.00 53.33  ? 55   PRO A C   1 
ATOM   406  O O   . PRO A 1 55  ? 43.928  7.640   43.419  1.00 54.10  ? 55   PRO A O   1 
ATOM   407  C CB  . PRO A 1 55  ? 42.367  4.882   43.572  1.00 53.15  ? 55   PRO A CB  1 
ATOM   408  C CG  . PRO A 1 55  ? 42.676  3.733   42.713  1.00 54.10  ? 55   PRO A CG  1 
ATOM   409  C CD  . PRO A 1 55  ? 43.591  4.253   41.605  1.00 53.58  ? 55   PRO A CD  1 
ATOM   410  N N   . TRP A 1 56  ? 41.763  8.156   43.763  1.00 52.88  ? 56   TRP A N   1 
ATOM   411  C CA  . TRP A 1 56  ? 42.075  9.384   44.497  1.00 53.44  ? 56   TRP A CA  1 
ATOM   412  C C   . TRP A 1 56  ? 41.723  9.227   45.967  1.00 54.92  ? 56   TRP A C   1 
ATOM   413  O O   . TRP A 1 56  ? 41.127  8.207   46.387  1.00 55.61  ? 56   TRP A O   1 
ATOM   414  C CB  . TRP A 1 56  ? 41.352  10.588  43.896  1.00 52.19  ? 56   TRP A CB  1 
ATOM   415  C CG  . TRP A 1 56  ? 39.868  10.405  43.810  1.00 51.94  ? 56   TRP A CG  1 
ATOM   416  C CD1 . TRP A 1 56  ? 38.942  10.763  44.749  1.00 52.66  ? 56   TRP A CD1 1 
ATOM   417  C CD2 . TRP A 1 56  ? 39.131  9.814   42.730  1.00 50.32  ? 56   TRP A CD2 1 
ATOM   418  N NE1 . TRP A 1 56  ? 37.674  10.443  44.316  1.00 51.12  ? 56   TRP A NE1 1 
ATOM   419  C CE2 . TRP A 1 56  ? 37.764  9.855   43.082  1.00 49.83  ? 56   TRP A CE2 1 
ATOM   420  C CE3 . TRP A 1 56  ? 39.492  9.260   41.496  1.00 49.14  ? 56   TRP A CE3 1 
ATOM   421  C CZ2 . TRP A 1 56  ? 36.761  9.352   42.249  1.00 48.23  ? 56   TRP A CZ2 1 
ATOM   422  C CZ3 . TRP A 1 56  ? 38.491  8.756   40.667  1.00 47.40  ? 56   TRP A CZ3 1 
ATOM   423  C CH2 . TRP A 1 56  ? 37.142  8.805   41.053  1.00 47.41  ? 56   TRP A CH2 1 
ATOM   424  N N   . SER A 1 57  ? 42.107  10.215  46.764  1.00 55.72  ? 57   SER A N   1 
ATOM   425  C CA  . SER A 1 57  ? 41.768  10.172  48.168  1.00 56.70  ? 57   SER A CA  1 
ATOM   426  C C   . SER A 1 57  ? 40.875  11.349  48.465  1.00 56.17  ? 57   SER A C   1 
ATOM   427  O O   . SER A 1 57  ? 40.920  12.355  47.758  1.00 55.48  ? 57   SER A O   1 
ATOM   428  C CB  . SER A 1 57  ? 43.028  10.210  49.029  1.00 58.67  ? 57   SER A CB  1 
ATOM   429  O OG  . SER A 1 57  ? 43.729  11.416  48.819  1.00 58.51  ? 57   SER A OG  1 
ATOM   430  N N   . GLY A 1 58  ? 40.063  11.218  49.510  1.00 56.63  ? 58   GLY A N   1 
ATOM   431  C CA  . GLY A 1 58  ? 39.104  12.245  49.868  1.00 56.15  ? 58   GLY A CA  1 
ATOM   432  C C   . GLY A 1 58  ? 37.929  12.236  48.916  1.00 54.69  ? 58   GLY A C   1 
ATOM   433  O O   . GLY A 1 58  ? 37.779  11.324  48.090  1.00 53.76  ? 58   GLY A O   1 
ATOM   434  N N   . VAL A 1 59  ? 37.093  13.260  49.026  1.00 54.34  ? 59   VAL A N   1 
ATOM   435  C CA  . VAL A 1 59  ? 35.864  13.311  48.249  1.00 53.03  ? 59   VAL A CA  1 
ATOM   436  C C   . VAL A 1 59  ? 36.093  14.222  47.060  1.00 52.38  ? 59   VAL A C   1 
ATOM   437  O O   . VAL A 1 59  ? 36.348  15.423  47.225  1.00 52.64  ? 59   VAL A O   1 
ATOM   438  C CB  . VAL A 1 59  ? 34.666  13.811  49.094  1.00 53.21  ? 59   VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 59  ? 33.380  13.791  48.270  1.00 51.74  ? 59   VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 59  ? 34.503  12.961  50.341  1.00 53.73  ? 59   VAL A CG2 1 
ATOM   441  N N   . LEU A 1 60  ? 36.019  13.636  45.867  1.00 51.52  ? 60   LEU A N   1 
ATOM   442  C CA  . LEU A 1 60  ? 36.153  14.375  44.631  1.00 50.92  ? 60   LEU A CA  1 
ATOM   443  C C   . LEU A 1 60  ? 34.883  15.198  44.413  1.00 51.16  ? 60   LEU A C   1 
ATOM   444  O O   . LEU A 1 60  ? 33.765  14.675  44.503  1.00 51.41  ? 60   LEU A O   1 
ATOM   445  C CB  . LEU A 1 60  ? 36.395  13.420  43.461  1.00 49.79  ? 60   LEU A CB  1 
ATOM   446  C CG  . LEU A 1 60  ? 36.745  14.061  42.104  1.00 48.35  ? 60   LEU A CG  1 
ATOM   447  C CD1 . LEU A 1 60  ? 37.919  13.379  41.419  1.00 47.43  ? 60   LEU A CD1 1 
ATOM   448  C CD2 . LEU A 1 60  ? 35.560  14.047  41.209  1.00 47.26  ? 60   LEU A CD2 1 
ATOM   449  N N   . ASP A 1 61  ? 35.052  16.489  44.160  1.00 51.29  ? 61   ASP A N   1 
ATOM   450  C CA  . ASP A 1 61  ? 33.920  17.307  43.798  1.00 51.26  ? 61   ASP A CA  1 
ATOM   451  C C   . ASP A 1 61  ? 33.446  17.035  42.364  1.00 49.55  ? 61   ASP A C   1 
ATOM   452  O O   . ASP A 1 61  ? 34.211  17.187  41.384  1.00 49.04  ? 61   ASP A O   1 
ATOM   453  C CB  . ASP A 1 61  ? 34.216  18.795  43.966  1.00 52.54  ? 61   ASP A CB  1 
ATOM   454  C CG  . ASP A 1 61  ? 33.002  19.654  43.603  1.00 55.33  ? 61   ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 61  ? 32.607  19.685  42.401  1.00 55.49  ? 61   ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 61  ? 32.420  20.251  44.536  1.00 58.75  ? 61   ASP A OD2 1 
ATOM   457  N N   . ALA A 1 62  ? 32.174  16.663  42.243  1.00 48.23  ? 62   ALA A N   1 
ATOM   458  C CA  . ALA A 1 62  ? 31.607  16.352  40.939  1.00 46.57  ? 62   ALA A CA  1 
ATOM   459  C C   . ALA A 1 62  ? 30.354  17.183  40.659  1.00 46.16  ? 62   ALA A C   1 
ATOM   460  O O   . ALA A 1 62  ? 29.309  16.641  40.306  1.00 45.69  ? 62   ALA A O   1 
ATOM   461  C CB  . ALA A 1 62  ? 31.329  14.867  40.821  1.00 46.01  ? 62   ALA A CB  1 
ATOM   462  N N   . THR A 1 63  ? 30.491  18.505  40.803  1.00 46.10  ? 63   THR A N   1 
ATOM   463  C CA  . THR A 1 63  ? 29.372  19.438  40.710  1.00 45.81  ? 63   THR A CA  1 
ATOM   464  C C   . THR A 1 63  ? 29.453  20.393  39.503  1.00 45.42  ? 63   THR A C   1 
ATOM   465  O O   . THR A 1 63  ? 28.525  21.178  39.268  1.00 45.99  ? 63   THR A O   1 
ATOM   466  C CB  . THR A 1 63  ? 29.219  20.285  42.015  1.00 47.36  ? 63   THR A CB  1 
ATOM   467  O OG1 . THR A 1 63  ? 30.286  21.229  42.102  1.00 47.60  ? 63   THR A OG1 1 
ATOM   468  C CG2 . THR A 1 63  ? 29.214  19.403  43.299  1.00 47.04  ? 63   THR A CG2 1 
ATOM   469  N N   . THR A 1 64  ? 30.554  20.347  38.752  1.00 44.56  ? 64   THR A N   1 
ATOM   470  C CA  . THR A 1 64  ? 30.740  21.220  37.587  1.00 44.13  ? 64   THR A CA  1 
ATOM   471  C C   . THR A 1 64  ? 31.323  20.434  36.410  1.00 43.15  ? 64   THR A C   1 
ATOM   472  O O   . THR A 1 64  ? 32.037  19.454  36.598  1.00 42.92  ? 64   THR A O   1 
ATOM   473  C CB  . THR A 1 64  ? 31.721  22.357  37.877  1.00 44.48  ? 64   THR A CB  1 
ATOM   474  O OG1 . THR A 1 64  ? 33.001  21.781  38.129  1.00 45.82  ? 64   THR A OG1 1 
ATOM   475  C CG2 . THR A 1 64  ? 31.306  23.144  39.103  1.00 46.09  ? 64   THR A CG2 1 
ATOM   476  N N   . PHE A 1 65  ? 31.027  20.873  35.192  1.00 42.48  ? 65   PHE A N   1 
ATOM   477  C CA  . PHE A 1 65  ? 31.596  20.232  34.026  1.00 40.97  ? 65   PHE A CA  1 
ATOM   478  C C   . PHE A 1 65  ? 33.082  20.465  33.991  1.00 41.38  ? 65   PHE A C   1 
ATOM   479  O O   . PHE A 1 65  ? 33.569  21.520  34.389  1.00 42.18  ? 65   PHE A O   1 
ATOM   480  C CB  . PHE A 1 65  ? 30.946  20.755  32.756  1.00 39.64  ? 65   PHE A CB  1 
ATOM   481  C CG  . PHE A 1 65  ? 29.572  20.198  32.516  1.00 39.86  ? 65   PHE A CG  1 
ATOM   482  C CD1 . PHE A 1 65  ? 29.389  18.816  32.306  1.00 37.96  ? 65   PHE A CD1 1 
ATOM   483  C CD2 . PHE A 1 65  ? 28.449  21.052  32.498  1.00 38.50  ? 65   PHE A CD2 1 
ATOM   484  C CE1 . PHE A 1 65  ? 28.112  18.285  32.072  1.00 37.55  ? 65   PHE A CE1 1 
ATOM   485  C CE2 . PHE A 1 65  ? 27.182  20.557  32.277  1.00 37.81  ? 65   PHE A CE2 1 
ATOM   486  C CZ  . PHE A 1 65  ? 26.996  19.162  32.069  1.00 39.16  ? 65   PHE A CZ  1 
ATOM   487  N N   . GLN A 1 66  ? 33.810  19.485  33.490  1.00 41.14  ? 66   GLN A N   1 
ATOM   488  C CA  . GLN A 1 66  ? 35.246  19.623  33.379  1.00 41.52  ? 66   GLN A CA  1 
ATOM   489  C C   . GLN A 1 66  ? 35.678  20.143  32.014  1.00 41.12  ? 66   GLN A C   1 
ATOM   490  O O   . GLN A 1 66  ? 34.834  20.421  31.148  1.00 39.88  ? 66   GLN A O   1 
ATOM   491  C CB  . GLN A 1 66  ? 35.915  18.308  33.731  1.00 42.09  ? 66   GLN A CB  1 
ATOM   492  C CG  . GLN A 1 66  ? 36.191  18.225  35.206  1.00 44.77  ? 66   GLN A CG  1 
ATOM   493  C CD  . GLN A 1 66  ? 37.505  18.923  35.579  1.00 48.65  ? 66   GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 66  ? 38.152  19.588  34.737  1.00 48.86  ? 66   GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 66  ? 37.915  18.757  36.829  1.00 46.71  ? 66   GLN A NE2 1 
ATOM   496  N N   . ASN A 1 67  ? 36.996  20.308  31.844  1.00 41.41  ? 67   ASN A N   1 
ATOM   497  C CA  . ASN A 1 67  ? 37.563  20.844  30.619  1.00 40.85  ? 67   ASN A CA  1 
ATOM   498  C C   . ASN A 1 67  ? 37.060  20.119  29.374  1.00 39.83  ? 67   ASN A C   1 
ATOM   499  O O   . ASN A 1 67  ? 36.778  18.920  29.397  1.00 38.82  ? 67   ASN A O   1 
ATOM   500  C CB  . ASN A 1 67  ? 39.080  20.765  30.651  1.00 41.43  ? 67   ASN A CB  1 
ATOM   501  C CG  . ASN A 1 67  ? 39.688  21.522  31.822  1.00 43.99  ? 67   ASN A CG  1 
ATOM   502  O OD1 . ASN A 1 67  ? 39.248  22.623  32.213  1.00 43.62  ? 67   ASN A OD1 1 
ATOM   503  N ND2 . ASN A 1 67  ? 40.729  20.934  32.383  1.00 45.12  ? 67   ASN A ND2 1 
ATOM   504  N N   . VAL A 1 68  ? 36.958  20.882  28.289  1.00 39.57  ? 68   VAL A N   1 
ATOM   505  C CA  . VAL A 1 68  ? 36.635  20.362  26.982  1.00 38.53  ? 68   VAL A CA  1 
ATOM   506  C C   . VAL A 1 68  ? 37.946  19.961  26.311  1.00 39.40  ? 68   VAL A C   1 
ATOM   507  O O   . VAL A 1 68  ? 39.000  20.588  26.549  1.00 40.56  ? 68   VAL A O   1 
ATOM   508  C CB  . VAL A 1 68  ? 35.907  21.413  26.185  1.00 38.49  ? 68   VAL A CB  1 
ATOM   509  C CG1 . VAL A 1 68  ? 35.687  20.963  24.750  1.00 36.88  ? 68   VAL A CG1 1 
ATOM   510  C CG2 . VAL A 1 68  ? 34.565  21.740  26.881  1.00 37.92  ? 68   VAL A CG2 1 
ATOM   511  N N   . CYS A 1 69  ? 37.902  18.895  25.513  1.00 38.70  ? 69   CYS A N   1 
ATOM   512  C CA  . CYS A 1 69  ? 39.089  18.438  24.819  1.00 39.14  ? 69   CYS A CA  1 
ATOM   513  C C   . CYS A 1 69  ? 39.551  19.482  23.815  1.00 39.83  ? 69   CYS A C   1 
ATOM   514  O O   . CYS A 1 69  ? 38.752  20.203  23.231  1.00 39.96  ? 69   CYS A O   1 
ATOM   515  C CB  . CYS A 1 69  ? 38.838  17.080  24.194  1.00 38.38  ? 69   CYS A CB  1 
ATOM   516  S SG  . CYS A 1 69  ? 38.677  15.753  25.489  1.00 40.42  ? 69   CYS A SG  1 
ATOM   517  N N   . TYR A 1 70  ? 40.849  19.598  23.640  1.00 40.95  ? 70   TYR A N   1 
ATOM   518  C CA  . TYR A 1 70  ? 41.396  20.683  22.843  1.00 41.99  ? 70   TYR A CA  1 
ATOM   519  C C   . TYR A 1 70  ? 41.226  20.535  21.334  1.00 41.90  ? 70   TYR A C   1 
ATOM   520  O O   . TYR A 1 70  ? 41.189  19.412  20.864  1.00 41.73  ? 70   TYR A O   1 
ATOM   521  C CB  . TYR A 1 70  ? 42.942  20.709  23.069  1.00 42.91  ? 70   TYR A CB  1 
ATOM   522  C CG  . TYR A 1 70  ? 43.533  22.103  23.056  1.00 43.99  ? 70   TYR A CG  1 
ATOM   523  C CD1 . TYR A 1 70  ? 43.996  22.714  24.231  1.00 45.50  ? 70   TYR A CD1 1 
ATOM   524  C CD2 . TYR A 1 70  ? 43.589  22.832  21.876  1.00 45.69  ? 70   TYR A CD2 1 
ATOM   525  C CE1 . TYR A 1 70  ? 44.498  24.025  24.221  1.00 45.79  ? 70   TYR A CE1 1 
ATOM   526  C CE2 . TYR A 1 70  ? 44.084  24.116  21.848  1.00 46.21  ? 70   TYR A CE2 1 
ATOM   527  C CZ  . TYR A 1 70  ? 44.526  24.716  23.019  1.00 48.01  ? 70   TYR A CZ  1 
ATOM   528  O OH  . TYR A 1 70  ? 45.008  26.018  22.935  1.00 51.21  ? 70   TYR A OH  1 
ATOM   529  N N   . GLN A 1 71  ? 40.973  21.597  20.552  1.00 42.17  ? 71   GLN A N   1 
ATOM   530  C CA  . GLN A 1 71  ? 39.807  21.694  19.631  1.00 41.09  ? 71   GLN A CA  1 
ATOM   531  C C   . GLN A 1 71  ? 39.688  23.023  18.912  1.00 42.32  ? 71   GLN A C   1 
ATOM   532  O O   . GLN A 1 71  ? 39.878  24.071  19.509  1.00 42.63  ? 71   GLN A O   1 
ATOM   533  C CB  . GLN A 1 71  ? 38.494  21.079  20.078  1.00 40.03  ? 71   GLN A CB  1 
ATOM   534  C CG  . GLN A 1 71  ? 37.399  21.988  20.501  1.00 37.26  ? 71   GLN A CG  1 
ATOM   535  C CD  . GLN A 1 71  ? 36.215  21.171  20.882  1.00 36.48  ? 71   GLN A CD  1 
ATOM   536  O OE1 . GLN A 1 71  ? 35.117  21.397  20.382  1.00 37.50  ? 71   GLN A OE1 1 
ATOM   537  N NE2 . GLN A 1 71  ? 36.434  20.151  21.727  1.00 33.67  ? 71   GLN A NE2 1 
ATOM   538  N N   . TYR A 1 72  ? 39.460  22.956  17.603  1.00 43.31  ? 72   TYR A N   1 
ATOM   539  C CA  . TYR A 1 72  ? 39.205  24.144  16.798  1.00 44.85  ? 72   TYR A CA  1 
ATOM   540  C C   . TYR A 1 72  ? 37.890  24.790  17.236  1.00 45.32  ? 72   TYR A C   1 
ATOM   541  O O   . TYR A 1 72  ? 36.895  24.104  17.464  1.00 44.36  ? 72   TYR A O   1 
ATOM   542  C CB  . TYR A 1 72  ? 39.182  23.774  15.311  1.00 44.87  ? 72   TYR A CB  1 
ATOM   543  C CG  . TYR A 1 72  ? 38.763  24.894  14.396  1.00 46.51  ? 72   TYR A CG  1 
ATOM   544  C CD1 . TYR A 1 72  ? 37.498  24.897  13.805  1.00 46.27  ? 72   TYR A CD1 1 
ATOM   545  C CD2 . TYR A 1 72  ? 39.631  25.968  14.120  1.00 49.37  ? 72   TYR A CD2 1 
ATOM   546  C CE1 . TYR A 1 72  ? 37.110  25.918  12.959  1.00 47.57  ? 72   TYR A CE1 1 
ATOM   547  C CE2 . TYR A 1 72  ? 39.243  27.003  13.276  1.00 49.38  ? 72   TYR A CE2 1 
ATOM   548  C CZ  . TYR A 1 72  ? 37.975  26.970  12.703  1.00 49.79  ? 72   TYR A CZ  1 
ATOM   549  O OH  . TYR A 1 72  ? 37.575  27.989  11.858  1.00 53.66  ? 72   TYR A OH  1 
ATOM   550  N N   . VAL A 1 73  ? 37.913  26.111  17.391  1.00 47.32  ? 73   VAL A N   1 
ATOM   551  C CA  . VAL A 1 73  ? 36.739  26.897  17.789  1.00 48.05  ? 73   VAL A CA  1 
ATOM   552  C C   . VAL A 1 73  ? 36.199  27.605  16.545  1.00 49.46  ? 73   VAL A C   1 
ATOM   553  O O   . VAL A 1 73  ? 36.934  28.316  15.864  1.00 50.18  ? 73   VAL A O   1 
ATOM   554  C CB  . VAL A 1 73  ? 37.125  27.945  18.864  1.00 48.72  ? 73   VAL A CB  1 
ATOM   555  C CG1 . VAL A 1 73  ? 35.946  28.821  19.254  1.00 47.27  ? 73   VAL A CG1 1 
ATOM   556  C CG2 . VAL A 1 73  ? 37.715  27.262  20.086  1.00 48.30  ? 73   VAL A CG2 1 
ATOM   557  N N   . ASP A 1 74  ? 34.917  27.413  16.251  1.00 50.45  ? 74   ASP A N   1 
ATOM   558  C CA  . ASP A 1 74  ? 34.301  28.035  15.078  1.00 51.97  ? 74   ASP A CA  1 
ATOM   559  C C   . ASP A 1 74  ? 34.245  29.549  15.178  1.00 54.01  ? 74   ASP A C   1 
ATOM   560  O O   . ASP A 1 74  ? 33.787  30.096  16.171  1.00 54.27  ? 74   ASP A O   1 
ATOM   561  C CB  . ASP A 1 74  ? 32.894  27.480  14.851  1.00 51.28  ? 74   ASP A CB  1 
ATOM   562  C CG  . ASP A 1 74  ? 32.367  27.777  13.455  1.00 52.03  ? 74   ASP A CG  1 
ATOM   563  O OD1 . ASP A 1 74  ? 31.870  28.909  13.209  1.00 51.63  ? 74   ASP A OD1 1 
ATOM   564  O OD2 . ASP A 1 74  ? 32.464  26.863  12.612  1.00 52.83  ? 74   ASP A OD2 1 
ATOM   565  N N   . THR A 1 75  ? 34.705  30.220  14.127  1.00 57.03  ? 75   THR A N   1 
ATOM   566  C CA  . THR A 1 75  ? 34.666  31.696  14.066  1.00 60.10  ? 75   THR A CA  1 
ATOM   567  C C   . THR A 1 75  ? 34.056  32.270  12.769  1.00 61.25  ? 75   THR A C   1 
ATOM   568  O O   . THR A 1 75  ? 34.042  33.495  12.584  1.00 62.53  ? 75   THR A O   1 
ATOM   569  C CB  . THR A 1 75  ? 36.063  32.352  14.355  1.00 61.57  ? 75   THR A CB  1 
ATOM   570  O OG1 . THR A 1 75  ? 37.110  31.481  13.897  1.00 61.32  ? 75   THR A OG1 1 
ATOM   571  C CG2 . THR A 1 75  ? 36.230  32.652  15.875  1.00 62.31  ? 75   THR A CG2 1 
ATOM   572  N N   . LEU A 1 76  ? 33.525  31.396  11.906  1.00 61.16  ? 76   LEU A N   1 
ATOM   573  C CA  . LEU A 1 76  ? 32.788  31.832  10.704  1.00 62.28  ? 76   LEU A CA  1 
ATOM   574  C C   . LEU A 1 76  ? 31.667  32.858  10.958  1.00 63.35  ? 76   LEU A C   1 
ATOM   575  O O   . LEU A 1 76  ? 31.528  33.813  10.194  1.00 64.06  ? 76   LEU A O   1 
ATOM   576  C CB  . LEU A 1 76  ? 32.233  30.639  9.906   1.00 61.19  ? 76   LEU A CB  1 
ATOM   577  C CG  . LEU A 1 76  ? 31.518  31.019  8.589   1.00 62.52  ? 76   LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 76  ? 32.461  31.708  7.562   1.00 61.71  ? 76   LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 76  ? 30.762  29.838  7.949   1.00 60.82  ? 76   LEU A CD2 1 
ATOM   580  N N   . TYR A 1 77  ? 30.864  32.651  12.008  1.00 63.75  ? 77   TYR A N   1 
ATOM   581  C CA  . TYR A 1 77  ? 29.750  33.571  12.326  1.00 64.69  ? 77   TYR A CA  1 
ATOM   582  C C   . TYR A 1 77  ? 29.748  33.954  13.797  1.00 65.07  ? 77   TYR A C   1 
ATOM   583  O O   . TYR A 1 77  ? 28.944  33.446  14.579  1.00 64.75  ? 77   TYR A O   1 
ATOM   584  C CB  . TYR A 1 77  ? 28.395  32.967  11.963  1.00 63.98  ? 77   TYR A CB  1 
ATOM   585  C CG  . TYR A 1 77  ? 28.162  32.730  10.493  1.00 63.82  ? 77   TYR A CG  1 
ATOM   586  C CD1 . TYR A 1 77  ? 28.127  33.787  9.598   1.00 64.64  ? 77   TYR A CD1 1 
ATOM   587  C CD2 . TYR A 1 77  ? 27.945  31.446  10.007  1.00 61.67  ? 77   TYR A CD2 1 
ATOM   588  C CE1 . TYR A 1 77  ? 27.898  33.569  8.242   1.00 65.94  ? 77   TYR A CE1 1 
ATOM   589  C CE2 . TYR A 1 77  ? 27.704  31.216  8.661   1.00 63.07  ? 77   TYR A CE2 1 
ATOM   590  C CZ  . TYR A 1 77  ? 27.686  32.277  7.773   1.00 64.71  ? 77   TYR A CZ  1 
ATOM   591  O OH  . TYR A 1 77  ? 27.447  32.062  6.420   1.00 64.45  ? 77   TYR A OH  1 
ATOM   592  N N   . PRO A 1 78  ? 30.642  34.872  14.176  1.00 66.07  ? 78   PRO A N   1 
ATOM   593  C CA  . PRO A 1 78  ? 30.885  35.192  15.600  1.00 66.09  ? 78   PRO A CA  1 
ATOM   594  C C   . PRO A 1 78  ? 29.717  35.913  16.317  1.00 65.66  ? 78   PRO A C   1 
ATOM   595  O O   . PRO A 1 78  ? 29.279  36.979  15.868  1.00 66.63  ? 78   PRO A O   1 
ATOM   596  C CB  . PRO A 1 78  ? 32.132  36.090  15.540  1.00 67.71  ? 78   PRO A CB  1 
ATOM   597  C CG  . PRO A 1 78  ? 32.043  36.755  14.163  1.00 68.72  ? 78   PRO A CG  1 
ATOM   598  C CD  . PRO A 1 78  ? 31.481  35.675  13.259  1.00 67.01  ? 78   PRO A CD  1 
ATOM   599  N N   . GLY A 1 79  ? 29.240  35.334  17.430  1.00 63.62  ? 79   GLY A N   1 
ATOM   600  C CA  . GLY A 1 79  ? 28.107  35.921  18.193  1.00 61.64  ? 79   GLY A CA  1 
ATOM   601  C C   . GLY A 1 79  ? 26.779  35.248  17.856  1.00 58.76  ? 79   GLY A C   1 
ATOM   602  O O   . GLY A 1 79  ? 25.778  35.415  18.555  1.00 58.38  ? 79   GLY A O   1 
ATOM   603  N N   . PHE A 1 80  ? 26.805  34.466  16.780  1.00 55.64  ? 80   PHE A N   1 
ATOM   604  C CA  . PHE A 1 80  ? 25.647  33.812  16.235  1.00 53.28  ? 80   PHE A CA  1 
ATOM   605  C C   . PHE A 1 80  ? 25.385  32.497  16.953  1.00 51.89  ? 80   PHE A C   1 
ATOM   606  O O   . PHE A 1 80  ? 26.246  31.622  17.031  1.00 50.55  ? 80   PHE A O   1 
ATOM   607  C CB  . PHE A 1 80  ? 25.882  33.590  14.742  1.00 52.71  ? 80   PHE A CB  1 
ATOM   608  C CG  . PHE A 1 80  ? 24.830  32.769  14.063  1.00 51.09  ? 80   PHE A CG  1 
ATOM   609  C CD1 . PHE A 1 80  ? 23.523  33.240  13.944  1.00 49.31  ? 80   PHE A CD1 1 
ATOM   610  C CD2 . PHE A 1 80  ? 25.157  31.526  13.514  1.00 49.50  ? 80   PHE A CD2 1 
ATOM   611  C CE1 . PHE A 1 80  ? 22.558  32.494  13.307  1.00 48.89  ? 80   PHE A CE1 1 
ATOM   612  C CE2 . PHE A 1 80  ? 24.194  30.766  12.866  1.00 48.94  ? 80   PHE A CE2 1 
ATOM   613  C CZ  . PHE A 1 80  ? 22.886  31.247  12.767  1.00 48.91  ? 80   PHE A CZ  1 
ATOM   614  N N   . GLU A 1 81  ? 24.171  32.357  17.458  1.00 51.59  ? 81   GLU A N   1 
ATOM   615  C CA  . GLU A 1 81  ? 23.822  31.222  18.274  1.00 51.13  ? 81   GLU A CA  1 
ATOM   616  C C   . GLU A 1 81  ? 23.883  29.877  17.530  1.00 48.85  ? 81   GLU A C   1 
ATOM   617  O O   . GLU A 1 81  ? 24.220  28.850  18.115  1.00 47.04  ? 81   GLU A O   1 
ATOM   618  C CB  . GLU A 1 81  ? 22.457  31.450  18.920  1.00 52.26  ? 81   GLU A CB  1 
ATOM   619  C CG  . GLU A 1 81  ? 21.781  30.150  19.387  1.00 57.17  ? 81   GLU A CG  1 
ATOM   620  C CD  . GLU A 1 81  ? 21.311  30.198  20.847  1.00 66.19  ? 81   GLU A CD  1 
ATOM   621  O OE1 . GLU A 1 81  ? 21.077  31.339  21.377  1.00 69.98  ? 81   GLU A OE1 1 
ATOM   622  O OE2 . GLU A 1 81  ? 21.175  29.091  21.455  1.00 66.19  ? 81   GLU A OE2 1 
ATOM   623  N N   . GLY A 1 82  ? 23.568  29.898  16.240  1.00 48.09  ? 82   GLY A N   1 
ATOM   624  C CA  . GLY A 1 82  ? 23.584  28.694  15.421  1.00 46.19  ? 82   GLY A CA  1 
ATOM   625  C C   . GLY A 1 82  ? 24.930  28.012  15.403  1.00 44.65  ? 82   GLY A C   1 
ATOM   626  O O   . GLY A 1 82  ? 24.994  26.806  15.220  1.00 43.88  ? 82   GLY A O   1 
ATOM   627  N N   . THR A 1 83  ? 26.002  28.781  15.594  1.00 44.36  ? 83   THR A N   1 
ATOM   628  C CA  . THR A 1 83  ? 27.341  28.212  15.684  1.00 43.61  ? 83   THR A CA  1 
ATOM   629  C C   . THR A 1 83  ? 27.825  28.122  17.127  1.00 43.92  ? 83   THR A C   1 
ATOM   630  O O   . THR A 1 83  ? 28.389  27.099  17.524  1.00 43.54  ? 83   THR A O   1 
ATOM   631  C CB  . THR A 1 83  ? 28.384  28.993  14.850  1.00 43.64  ? 83   THR A CB  1 
ATOM   632  O OG1 . THR A 1 83  ? 28.312  30.376  15.189  1.00 45.72  ? 83   THR A OG1 1 
ATOM   633  C CG2 . THR A 1 83  ? 28.144  28.834  13.364  1.00 41.80  ? 83   THR A CG2 1 
ATOM   634  N N   . GLU A 1 84  ? 27.604  29.175  17.913  1.00 44.97  ? 84   GLU A N   1 
ATOM   635  C CA  . GLU A 1 84  ? 28.120  29.204  19.276  1.00 45.62  ? 84   GLU A CA  1 
ATOM   636  C C   . GLU A 1 84  ? 27.546  28.081  20.125  1.00 44.43  ? 84   GLU A C   1 
ATOM   637  O O   . GLU A 1 84  ? 28.214  27.597  21.031  1.00 45.26  ? 84   GLU A O   1 
ATOM   638  C CB  . GLU A 1 84  ? 27.933  30.562  19.965  1.00 47.16  ? 84   GLU A CB  1 
ATOM   639  C CG  . GLU A 1 84  ? 28.673  31.772  19.324  1.00 51.90  ? 84   GLU A CG  1 
ATOM   640  C CD  . GLU A 1 84  ? 30.210  31.749  19.484  1.00 57.45  ? 84   GLU A CD  1 
ATOM   641  O OE1 . GLU A 1 84  ? 30.765  30.874  20.205  1.00 59.59  ? 84   GLU A OE1 1 
ATOM   642  O OE2 . GLU A 1 84  ? 30.873  32.633  18.888  1.00 59.99  ? 84   GLU A OE2 1 
ATOM   643  N N   . MET A 1 85  ? 26.346  27.608  19.823  1.00 43.18  ? 85   MET A N   1 
ATOM   644  C CA  . MET A 1 85  ? 25.807  26.487  20.597  1.00 41.65  ? 85   MET A CA  1 
ATOM   645  C C   . MET A 1 85  ? 26.662  25.208  20.519  1.00 40.83  ? 85   MET A C   1 
ATOM   646  O O   . MET A 1 85  ? 26.534  24.330  21.370  1.00 40.53  ? 85   MET A O   1 
ATOM   647  C CB  . MET A 1 85  ? 24.379  26.177  20.189  1.00 41.60  ? 85   MET A CB  1 
ATOM   648  C CG  . MET A 1 85  ? 24.259  25.538  18.816  1.00 40.88  ? 85   MET A CG  1 
ATOM   649  S SD  . MET A 1 85  ? 22.527  25.347  18.362  1.00 40.85  ? 85   MET A SD  1 
ATOM   650  C CE  . MET A 1 85  ? 22.000  24.095  19.515  1.00 38.73  ? 85   MET A CE  1 
ATOM   651  N N   . TRP A 1 86  ? 27.522  25.094  19.503  1.00 39.88  ? 86   TRP A N   1 
ATOM   652  C CA  . TRP A 1 86  ? 28.334  23.901  19.347  1.00 38.46  ? 86   TRP A CA  1 
ATOM   653  C C   . TRP A 1 86  ? 29.769  24.114  19.860  1.00 38.59  ? 86   TRP A C   1 
ATOM   654  O O   . TRP A 1 86  ? 30.529  23.162  19.991  1.00 37.43  ? 86   TRP A O   1 
ATOM   655  C CB  . TRP A 1 86  ? 28.336  23.426  17.886  1.00 37.99  ? 86   TRP A CB  1 
ATOM   656  C CG  . TRP A 1 86  ? 26.972  23.246  17.314  1.00 37.86  ? 86   TRP A CG  1 
ATOM   657  C CD1 . TRP A 1 86  ? 26.389  24.005  16.362  1.00 37.24  ? 86   TRP A CD1 1 
ATOM   658  C CD2 . TRP A 1 86  ? 26.014  22.240  17.670  1.00 37.93  ? 86   TRP A CD2 1 
ATOM   659  N NE1 . TRP A 1 86  ? 25.133  23.538  16.078  1.00 37.56  ? 86   TRP A NE1 1 
ATOM   660  C CE2 . TRP A 1 86  ? 24.869  22.463  16.877  1.00 36.93  ? 86   TRP A CE2 1 
ATOM   661  C CE3 . TRP A 1 86  ? 26.020  21.164  18.578  1.00 36.62  ? 86   TRP A CE3 1 
ATOM   662  C CZ2 . TRP A 1 86  ? 23.727  21.664  16.962  1.00 37.02  ? 86   TRP A CZ2 1 
ATOM   663  C CZ3 . TRP A 1 86  ? 24.890  20.363  18.666  1.00 37.37  ? 86   TRP A CZ3 1 
ATOM   664  C CH2 . TRP A 1 86  ? 23.753  20.619  17.858  1.00 38.44  ? 86   TRP A CH2 1 
ATOM   665  N N   . ASN A 1 87  ? 30.119  25.360  20.152  1.00 38.94  ? 87   ASN A N   1 
ATOM   666  C CA  . ASN A 1 87  ? 31.464  25.706  20.560  1.00 40.10  ? 87   ASN A CA  1 
ATOM   667  C C   . ASN A 1 87  ? 31.748  25.289  22.009  1.00 40.54  ? 87   ASN A C   1 
ATOM   668  O O   . ASN A 1 87  ? 30.817  25.068  22.773  1.00 40.75  ? 87   ASN A O   1 
ATOM   669  C CB  . ASN A 1 87  ? 31.692  27.215  20.346  1.00 41.24  ? 87   ASN A CB  1 
ATOM   670  C CG  . ASN A 1 87  ? 32.168  27.542  18.916  1.00 42.33  ? 87   ASN A CG  1 
ATOM   671  O OD1 . ASN A 1 87  ? 32.489  26.627  18.137  1.00 44.22  ? 87   ASN A OD1 1 
ATOM   672  N ND2 . ASN A 1 87  ? 32.225  28.837  18.572  1.00 39.00  ? 87   ASN A ND2 1 
ATOM   673  N N   . PRO A 1 88  ? 33.035  25.170  22.396  1.00 40.82  ? 88   PRO A N   1 
ATOM   674  C CA  . PRO A 1 88  ? 33.342  24.781  23.780  1.00 40.56  ? 88   PRO A CA  1 
ATOM   675  C C   . PRO A 1 88  ? 32.777  25.741  24.814  1.00 41.61  ? 88   PRO A C   1 
ATOM   676  O O   . PRO A 1 88  ? 32.854  26.962  24.633  1.00 42.38  ? 88   PRO A O   1 
ATOM   677  C CB  . PRO A 1 88  ? 34.872  24.818  23.827  1.00 40.07  ? 88   PRO A CB  1 
ATOM   678  C CG  . PRO A 1 88  ? 35.292  24.557  22.439  1.00 40.00  ? 88   PRO A CG  1 
ATOM   679  C CD  . PRO A 1 88  ? 34.254  25.225  21.562  1.00 40.85  ? 88   PRO A CD  1 
ATOM   680  N N   . ASN A 1 89  ? 32.230  25.182  25.894  1.00 41.70  ? 89   ASN A N   1 
ATOM   681  C CA  . ASN A 1 89  ? 31.645  25.974  26.966  1.00 42.22  ? 89   ASN A CA  1 
ATOM   682  C C   . ASN A 1 89  ? 32.409  25.833  28.287  1.00 42.80  ? 89   ASN A C   1 
ATOM   683  O O   . ASN A 1 89  ? 31.956  26.305  29.320  1.00 44.20  ? 89   ASN A O   1 
ATOM   684  C CB  . ASN A 1 89  ? 30.138  25.676  27.122  1.00 41.42  ? 89   ASN A CB  1 
ATOM   685  C CG  . ASN A 1 89  ? 29.850  24.228  27.593  1.00 42.45  ? 89   ASN A CG  1 
ATOM   686  O OD1 . ASN A 1 89  ? 30.702  23.348  27.498  1.00 41.07  ? 89   ASN A OD1 1 
ATOM   687  N ND2 . ASN A 1 89  ? 28.626  23.991  28.098  1.00 42.76  ? 89   ASN A ND2 1 
ATOM   688  N N   . ARG A 1 90  ? 33.564  25.172  28.247  1.00 42.67  ? 90   ARG A N   1 
ATOM   689  C CA  . ARG A 1 90  ? 34.532  25.173  29.367  1.00 43.07  ? 90   ARG A CA  1 
ATOM   690  C C   . ARG A 1 90  ? 35.935  25.429  28.836  1.00 42.36  ? 90   ARG A C   1 
ATOM   691  O O   . ARG A 1 90  ? 36.139  25.478  27.636  1.00 41.58  ? 90   ARG A O   1 
ATOM   692  C CB  . ARG A 1 90  ? 34.505  23.848  30.144  1.00 43.11  ? 90   ARG A CB  1 
ATOM   693  C CG  . ARG A 1 90  ? 33.135  23.432  30.670  1.00 44.70  ? 90   ARG A CG  1 
ATOM   694  C CD  . ARG A 1 90  ? 32.546  24.440  31.651  1.00 48.54  ? 90   ARG A CD  1 
ATOM   695  N NE  . ARG A 1 90  ? 32.900  24.083  33.014  1.00 54.37  ? 90   ARG A NE  1 
ATOM   696  C CZ  . ARG A 1 90  ? 32.957  24.948  34.026  1.00 60.38  ? 90   ARG A CZ  1 
ATOM   697  N NH1 . ARG A 1 90  ? 33.322  24.540  35.244  1.00 59.95  ? 90   ARG A NH1 1 
ATOM   698  N NH2 . ARG A 1 90  ? 32.654  26.234  33.821  1.00 64.07  ? 90   ARG A NH2 1 
ATOM   699  N N   . GLU A 1 91  ? 36.899  25.608  29.723  1.00 42.94  ? 91   GLU A N   1 
ATOM   700  C CA  . GLU A 1 91  ? 38.285  25.736  29.289  1.00 43.86  ? 91   GLU A CA  1 
ATOM   701  C C   . GLU A 1 91  ? 38.740  24.565  28.411  1.00 42.73  ? 91   GLU A C   1 
ATOM   702  O O   . GLU A 1 91  ? 38.396  23.391  28.653  1.00 42.60  ? 91   GLU A O   1 
ATOM   703  C CB  . GLU A 1 91  ? 39.191  25.815  30.494  1.00 45.28  ? 91   GLU A CB  1 
ATOM   704  C CG  . GLU A 1 91  ? 40.644  26.165  30.172  1.00 49.25  ? 91   GLU A CG  1 
ATOM   705  C CD  . GLU A 1 91  ? 41.577  25.977  31.379  1.00 54.16  ? 91   GLU A CD  1 
ATOM   706  O OE1 . GLU A 1 91  ? 41.079  26.051  32.537  1.00 52.90  ? 91   GLU A OE1 1 
ATOM   707  O OE2 . GLU A 1 91  ? 42.801  25.739  31.167  1.00 56.21  ? 91   GLU A OE2 1 
ATOM   708  N N   . LEU A 1 92  ? 39.495  24.894  27.378  1.00 42.26  ? 92   LEU A N   1 
ATOM   709  C CA  . LEU A 1 92  ? 40.151  23.900  26.544  1.00 41.43  ? 92   LEU A CA  1 
ATOM   710  C C   . LEU A 1 92  ? 41.417  23.399  27.217  1.00 42.22  ? 92   LEU A C   1 
ATOM   711  O O   . LEU A 1 92  ? 42.295  24.194  27.608  1.00 43.48  ? 92   LEU A O   1 
ATOM   712  C CB  . LEU A 1 92  ? 40.485  24.503  25.181  1.00 41.43  ? 92   LEU A CB  1 
ATOM   713  C CG  . LEU A 1 92  ? 39.266  24.916  24.333  1.00 41.46  ? 92   LEU A CG  1 
ATOM   714  C CD1 . LEU A 1 92  ? 39.720  25.599  23.080  1.00 41.57  ? 92   LEU A CD1 1 
ATOM   715  C CD2 . LEU A 1 92  ? 38.408  23.671  23.966  1.00 39.46  ? 92   LEU A CD2 1 
ATOM   716  N N   . SER A 1 93  ? 41.503  22.081  27.371  1.00 41.41  ? 93   SER A N   1 
ATOM   717  C CA  . SER A 1 93  ? 42.706  21.442  27.898  1.00 41.51  ? 93   SER A CA  1 
ATOM   718  C C   . SER A 1 93  ? 42.892  20.025  27.332  1.00 40.76  ? 93   SER A C   1 
ATOM   719  O O   . SER A 1 93  ? 41.935  19.367  26.942  1.00 39.54  ? 93   SER A O   1 
ATOM   720  C CB  . SER A 1 93  ? 42.635  21.419  29.430  1.00 42.13  ? 93   SER A CB  1 
ATOM   721  O OG  . SER A 1 93  ? 43.651  20.617  30.000  1.00 42.63  ? 93   SER A OG  1 
ATOM   722  N N   . GLU A 1 94  ? 44.136  19.563  27.281  1.00 41.50  ? 94   GLU A N   1 
ATOM   723  C CA  . GLU A 1 94  ? 44.426  18.193  26.879  1.00 40.89  ? 94   GLU A CA  1 
ATOM   724  C C   . GLU A 1 94  ? 44.051  17.266  28.009  1.00 41.07  ? 94   GLU A C   1 
ATOM   725  O O   . GLU A 1 94  ? 43.814  16.071  27.787  1.00 41.07  ? 94   GLU A O   1 
ATOM   726  C CB  . GLU A 1 94  ? 45.892  18.010  26.531  1.00 41.65  ? 94   GLU A CB  1 
ATOM   727  C CG  . GLU A 1 94  ? 46.212  18.228  25.095  1.00 41.94  ? 94   GLU A CG  1 
ATOM   728  C CD  . GLU A 1 94  ? 47.686  18.075  24.824  1.00 44.60  ? 94   GLU A CD  1 
ATOM   729  O OE1 . GLU A 1 94  ? 48.427  19.016  25.155  1.00 46.12  ? 94   GLU A OE1 1 
ATOM   730  O OE2 . GLU A 1 94  ? 48.105  17.020  24.281  1.00 46.10  ? 94   GLU A OE2 1 
ATOM   731  N N   . ASP A 1 95  ? 44.001  17.827  29.217  1.00 41.17  ? 95   ASP A N   1 
ATOM   732  C CA  . ASP A 1 95  ? 43.449  17.159  30.377  1.00 41.24  ? 95   ASP A CA  1 
ATOM   733  C C   . ASP A 1 95  ? 41.921  17.258  30.325  1.00 40.25  ? 95   ASP A C   1 
ATOM   734  O O   . ASP A 1 95  ? 41.332  18.168  30.915  1.00 40.62  ? 95   ASP A O   1 
ATOM   735  C CB  . ASP A 1 95  ? 43.977  17.828  31.650  1.00 42.37  ? 95   ASP A CB  1 
ATOM   736  C CG  . ASP A 1 95  ? 43.546  17.106  32.921  1.00 43.26  ? 95   ASP A CG  1 
ATOM   737  O OD1 . ASP A 1 95  ? 42.739  16.163  32.845  1.00 43.37  ? 95   ASP A OD1 1 
ATOM   738  O OD2 . ASP A 1 95  ? 44.025  17.478  34.010  1.00 46.42  ? 95   ASP A OD2 1 
ATOM   739  N N   . CYS A 1 96  ? 41.280  16.311  29.654  1.00 39.05  ? 96   CYS A N   1 
ATOM   740  C CA  . CYS A 1 96  ? 39.871  16.443  29.351  1.00 38.50  ? 96   CYS A CA  1 
ATOM   741  C C   . CYS A 1 96  ? 39.031  15.147  29.451  1.00 37.96  ? 96   CYS A C   1 
ATOM   742  O O   . CYS A 1 96  ? 37.818  15.145  29.157  1.00 37.77  ? 96   CYS A O   1 
ATOM   743  C CB  . CYS A 1 96  ? 39.740  17.056  27.959  1.00 38.34  ? 96   CYS A CB  1 
ATOM   744  S SG  . CYS A 1 96  ? 40.359  15.979  26.635  1.00 38.53  ? 96   CYS A SG  1 
ATOM   745  N N   . LEU A 1 97  ? 39.666  14.061  29.874  1.00 37.60  ? 97   LEU A N   1 
ATOM   746  C CA  . LEU A 1 97  ? 39.008  12.769  29.920  1.00 36.91  ? 97   LEU A CA  1 
ATOM   747  C C   . LEU A 1 97  ? 38.127  12.582  31.198  1.00 36.98  ? 97   LEU A C   1 
ATOM   748  O O   . LEU A 1 97  ? 38.523  12.000  32.206  1.00 37.75  ? 97   LEU A O   1 
ATOM   749  C CB  . LEU A 1 97  ? 40.059  11.663  29.701  1.00 37.59  ? 97   LEU A CB  1 
ATOM   750  C CG  . LEU A 1 97  ? 40.784  11.754  28.332  1.00 36.86  ? 97   LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 97  ? 41.708  10.580  28.063  1.00 34.79  ? 97   LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 97  ? 39.765  11.858  27.190  1.00 36.09  ? 97   LEU A CD2 1 
ATOM   753  N N   . TYR A 1 98  ? 36.928  13.130  31.138  1.00 36.26  ? 98   TYR A N   1 
ATOM   754  C CA  . TYR A 1 98  ? 36.007  13.143  32.262  1.00 36.19  ? 98   TYR A CA  1 
ATOM   755  C C   . TYR A 1 98  ? 34.666  12.727  31.740  1.00 35.10  ? 98   TYR A C   1 
ATOM   756  O O   . TYR A 1 98  ? 34.438  12.815  30.549  1.00 34.12  ? 98   TYR A O   1 
ATOM   757  C CB  . TYR A 1 98  ? 35.948  14.558  32.870  1.00 36.79  ? 98   TYR A CB  1 
ATOM   758  C CG  . TYR A 1 98  ? 37.291  15.003  33.439  1.00 38.18  ? 98   TYR A CG  1 
ATOM   759  C CD1 . TYR A 1 98  ? 37.595  14.830  34.791  1.00 39.18  ? 98   TYR A CD1 1 
ATOM   760  C CD2 . TYR A 1 98  ? 38.260  15.547  32.624  1.00 37.99  ? 98   TYR A CD2 1 
ATOM   761  C CE1 . TYR A 1 98  ? 38.819  15.215  35.309  1.00 39.10  ? 98   TYR A CE1 1 
ATOM   762  C CE2 . TYR A 1 98  ? 39.490  15.925  33.139  1.00 39.46  ? 98   TYR A CE2 1 
ATOM   763  C CZ  . TYR A 1 98  ? 39.754  15.764  34.477  1.00 38.79  ? 98   TYR A CZ  1 
ATOM   764  O OH  . TYR A 1 98  ? 40.968  16.140  34.968  1.00 39.09  ? 98   TYR A OH  1 
ATOM   765  N N   . LEU A 1 99  ? 33.789  12.240  32.615  1.00 35.95  ? 99   LEU A N   1 
ATOM   766  C CA  . LEU A 1 99  ? 32.425  11.894  32.214  1.00 35.68  ? 99   LEU A CA  1 
ATOM   767  C C   . LEU A 1 99  ? 31.380  12.456  33.188  1.00 36.80  ? 99   LEU A C   1 
ATOM   768  O O   . LEU A 1 99  ? 31.735  12.918  34.285  1.00 36.87  ? 99   LEU A O   1 
ATOM   769  C CB  . LEU A 1 99  ? 32.278  10.382  32.003  1.00 35.26  ? 99   LEU A CB  1 
ATOM   770  C CG  . LEU A 1 99  ? 32.555  9.373   33.118  1.00 36.06  ? 99   LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 99  ? 31.444  9.355   34.145  1.00 34.99  ? 99   LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 99  ? 32.738  7.981   32.554  1.00 33.93  ? 99   LEU A CD2 1 
ATOM   773  N N   . ASN A 1 100 ? 30.108  12.399  32.767  1.00 36.74  ? 100  ASN A N   1 
ATOM   774  C CA  . ASN A 1 100 ? 28.968  12.947  33.491  1.00 36.98  ? 100  ASN A CA  1 
ATOM   775  C C   . ASN A 1 100 ? 27.836  11.917  33.672  1.00 37.80  ? 100  ASN A C   1 
ATOM   776  O O   . ASN A 1 100 ? 27.566  11.092  32.779  1.00 38.16  ? 100  ASN A O   1 
ATOM   777  C CB  . ASN A 1 100 ? 28.432  14.161  32.731  1.00 36.67  ? 100  ASN A CB  1 
ATOM   778  C CG  . ASN A 1 100 ? 29.552  15.097  32.237  1.00 37.30  ? 100  ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 100 ? 30.335  15.631  33.037  1.00 37.62  ? 100  ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 100 ? 29.623  15.302  30.913  1.00 35.07  ? 100  ASN A ND2 1 
ATOM   781  N N   . VAL A 1 101 ? 27.170  11.956  34.825  1.00 38.20  ? 101  VAL A N   1 
ATOM   782  C CA  . VAL A 1 101 ? 26.087  11.047  35.108  1.00 38.09  ? 101  VAL A CA  1 
ATOM   783  C C   . VAL A 1 101 ? 24.894  11.838  35.649  1.00 39.44  ? 101  VAL A C   1 
ATOM   784  O O   . VAL A 1 101 ? 25.049  12.641  36.578  1.00 39.88  ? 101  VAL A O   1 
ATOM   785  C CB  . VAL A 1 101 ? 26.511  9.999   36.143  1.00 38.99  ? 101  VAL A CB  1 
ATOM   786  C CG1 . VAL A 1 101 ? 25.341  9.071   36.461  1.00 38.64  ? 101  VAL A CG1 1 
ATOM   787  C CG2 . VAL A 1 101 ? 27.704  9.207   35.649  1.00 36.92  ? 101  VAL A CG2 1 
ATOM   788  N N   . TRP A 1 102 ? 23.717  11.631  35.054  1.00 39.61  ? 102  TRP A N   1 
ATOM   789  C CA  . TRP A 1 102 ? 22.469  12.164  35.599  1.00 40.79  ? 102  TRP A CA  1 
ATOM   790  C C   . TRP A 1 102 ? 21.601  10.989  36.015  1.00 42.18  ? 102  TRP A C   1 
ATOM   791  O O   . TRP A 1 102 ? 21.425  10.032  35.243  1.00 41.37  ? 102  TRP A O   1 
ATOM   792  C CB  . TRP A 1 102 ? 21.690  12.954  34.552  1.00 40.44  ? 102  TRP A CB  1 
ATOM   793  C CG  . TRP A 1 102 ? 22.225  14.305  34.207  1.00 40.34  ? 102  TRP A CG  1 
ATOM   794  C CD1 . TRP A 1 102 ? 21.854  15.506  34.764  1.00 40.78  ? 102  TRP A CD1 1 
ATOM   795  C CD2 . TRP A 1 102 ? 23.191  14.611  33.196  1.00 38.88  ? 102  TRP A CD2 1 
ATOM   796  N NE1 . TRP A 1 102 ? 22.546  16.539  34.166  1.00 42.71  ? 102  TRP A NE1 1 
ATOM   797  C CE2 . TRP A 1 102 ? 23.381  16.015  33.209  1.00 40.26  ? 102  TRP A CE2 1 
ATOM   798  C CE3 . TRP A 1 102 ? 23.931  13.835  32.293  1.00 38.65  ? 102  TRP A CE3 1 
ATOM   799  C CZ2 . TRP A 1 102 ? 24.280  16.658  32.348  1.00 39.22  ? 102  TRP A CZ2 1 
ATOM   800  C CZ3 . TRP A 1 102 ? 24.816  14.476  31.422  1.00 36.84  ? 102  TRP A CZ3 1 
ATOM   801  C CH2 . TRP A 1 102 ? 24.982  15.872  31.458  1.00 37.77  ? 102  TRP A CH2 1 
ATOM   802  N N   . THR A 1 103 ? 21.052  11.060  37.223  1.00 43.33  ? 103  THR A N   1 
ATOM   803  C CA  . THR A 1 103 ? 20.129  10.045  37.679  1.00 45.23  ? 103  THR A CA  1 
ATOM   804  C C   . THR A 1 103 ? 18.927  10.724  38.334  1.00 46.28  ? 103  THR A C   1 
ATOM   805  O O   . THR A 1 103 ? 19.012  11.887  38.720  1.00 46.53  ? 103  THR A O   1 
ATOM   806  C CB  . THR A 1 103 ? 20.789  9.069   38.684  1.00 45.89  ? 103  THR A CB  1 
ATOM   807  O OG1 . THR A 1 103 ? 20.865  9.702   39.953  1.00 48.57  ? 103  THR A OG1 1 
ATOM   808  C CG2 . THR A 1 103 ? 22.186  8.711   38.285  1.00 45.44  ? 103  THR A CG2 1 
ATOM   809  N N   . PRO A 1 104 ? 17.797  10.009  38.450  1.00 47.38  ? 104  PRO A N   1 
ATOM   810  C CA  . PRO A 1 104 ? 16.662  10.527  39.199  1.00 49.09  ? 104  PRO A CA  1 
ATOM   811  C C   . PRO A 1 104 ? 17.063  10.896  40.621  1.00 50.12  ? 104  PRO A C   1 
ATOM   812  O O   . PRO A 1 104 ? 18.079  10.403  41.111  1.00 50.01  ? 104  PRO A O   1 
ATOM   813  C CB  . PRO A 1 104 ? 15.700  9.339   39.228  1.00 50.08  ? 104  PRO A CB  1 
ATOM   814  C CG  . PRO A 1 104 ? 15.940  8.671   37.939  1.00 48.89  ? 104  PRO A CG  1 
ATOM   815  C CD  . PRO A 1 104 ? 17.426  8.812   37.677  1.00 47.76  ? 104  PRO A CD  1 
ATOM   816  N N   . TYR A 1 105 ? 16.286  11.776  41.249  1.00 51.18  ? 105  TYR A N   1 
ATOM   817  C CA  . TYR A 1 105 ? 16.497  12.144  42.638  1.00 52.61  ? 105  TYR A CA  1 
ATOM   818  C C   . TYR A 1 105 ? 15.199  11.889  43.400  1.00 55.25  ? 105  TYR A C   1 
ATOM   819  O O   . TYR A 1 105 ? 14.133  12.405  43.031  1.00 56.28  ? 105  TYR A O   1 
ATOM   820  C CB  . TYR A 1 105 ? 16.933  13.603  42.758  1.00 51.77  ? 105  TYR A CB  1 
ATOM   821  C CG  . TYR A 1 105 ? 17.229  14.120  44.162  1.00 51.01  ? 105  TYR A CG  1 
ATOM   822  C CD1 . TYR A 1 105 ? 18.529  14.426  44.546  1.00 49.00  ? 105  TYR A CD1 1 
ATOM   823  C CD2 . TYR A 1 105 ? 16.210  14.361  45.083  1.00 51.20  ? 105  TYR A CD2 1 
ATOM   824  C CE1 . TYR A 1 105 ? 18.819  14.929  45.816  1.00 48.47  ? 105  TYR A CE1 1 
ATOM   825  C CE2 . TYR A 1 105 ? 16.496  14.874  46.366  1.00 51.66  ? 105  TYR A CE2 1 
ATOM   826  C CZ  . TYR A 1 105 ? 17.805  15.147  46.715  1.00 49.90  ? 105  TYR A CZ  1 
ATOM   827  O OH  . TYR A 1 105 ? 18.112  15.645  47.952  1.00 48.95  ? 105  TYR A OH  1 
ATOM   828  N N   . PRO A 1 106 ? 15.267  11.059  44.448  1.00 56.69  ? 106  PRO A N   1 
ATOM   829  C CA  . PRO A 1 106 ? 16.448  10.299  44.853  1.00 56.77  ? 106  PRO A CA  1 
ATOM   830  C C   . PRO A 1 106 ? 16.723  9.195   43.844  1.00 56.49  ? 106  PRO A C   1 
ATOM   831  O O   . PRO A 1 106 ? 15.838  8.872   43.052  1.00 56.41  ? 106  PRO A O   1 
ATOM   832  C CB  . PRO A 1 106 ? 16.032  9.707   46.208  1.00 58.10  ? 106  PRO A CB  1 
ATOM   833  C CG  . PRO A 1 106 ? 14.536  9.625   46.128  1.00 59.15  ? 106  PRO A CG  1 
ATOM   834  C CD  . PRO A 1 106 ? 14.126  10.846  45.361  1.00 58.43  ? 106  PRO A CD  1 
ATOM   835  N N   . ARG A 1 107 ? 17.939  8.644   43.872  1.00 56.86  ? 107  ARG A N   1 
ATOM   836  C CA  . ARG A 1 107 ? 18.362  7.563   42.971  1.00 57.50  ? 107  ARG A CA  1 
ATOM   837  C C   . ARG A 1 107 ? 17.381  6.404   42.985  1.00 59.41  ? 107  ARG A C   1 
ATOM   838  O O   . ARG A 1 107 ? 16.799  6.079   44.040  1.00 60.90  ? 107  ARG A O   1 
ATOM   839  C CB  . ARG A 1 107 ? 19.760  7.052   43.321  1.00 57.03  ? 107  ARG A CB  1 
ATOM   840  C CG  . ARG A 1 107 ? 20.866  8.055   43.026  1.00 58.00  ? 107  ARG A CG  1 
ATOM   841  C CD  . ARG A 1 107 ? 22.249  7.433   43.081  1.00 59.70  ? 107  ARG A CD  1 
ATOM   842  N NE  . ARG A 1 107 ? 22.599  6.837   44.372  1.00 61.55  ? 107  ARG A NE  1 
ATOM   843  C CZ  . ARG A 1 107 ? 23.073  7.520   45.408  1.00 62.16  ? 107  ARG A CZ  1 
ATOM   844  N NH1 . ARG A 1 107 ? 23.231  8.828   45.308  1.00 61.90  ? 107  ARG A NH1 1 
ATOM   845  N NH2 . ARG A 1 107 ? 23.386  6.899   46.540  1.00 63.16  ? 107  ARG A NH2 1 
ATOM   846  N N   . PRO A 1 108 ? 17.205  5.764   41.813  1.00 59.57  ? 108  PRO A N   1 
ATOM   847  C CA  . PRO A 1 108 ? 16.213  4.702   41.577  1.00 61.01  ? 108  PRO A CA  1 
ATOM   848  C C   . PRO A 1 108 ? 16.321  3.544   42.573  1.00 62.94  ? 108  PRO A C   1 
ATOM   849  O O   . PRO A 1 108 ? 17.432  3.193   43.009  1.00 62.51  ? 108  PRO A O   1 
ATOM   850  C CB  . PRO A 1 108 ? 16.566  4.194   40.168  1.00 60.01  ? 108  PRO A CB  1 
ATOM   851  C CG  . PRO A 1 108 ? 17.366  5.260   39.544  1.00 58.07  ? 108  PRO A CG  1 
ATOM   852  C CD  . PRO A 1 108 ? 18.072  5.987   40.640  1.00 57.75  ? 108  PRO A CD  1 
ATOM   853  N N   . ALA A 1 109 ? 15.169  2.960   42.900  1.00 64.93  ? 109  ALA A N   1 
ATOM   854  C CA  . ALA A 1 109 ? 15.076  1.791   43.792  1.00 67.01  ? 109  ALA A CA  1 
ATOM   855  C C   . ALA A 1 109 ? 15.629  0.506   43.139  1.00 66.95  ? 109  ALA A C   1 
ATOM   856  O O   . ALA A 1 109 ? 16.452  -0.219  43.722  1.00 66.80  ? 109  ALA A O   1 
ATOM   857  C CB  . ALA A 1 109 ? 13.597  1.579   44.215  1.00 68.66  ? 109  ALA A CB  1 
ATOM   858  N N   . SER A 1 110 ? 15.144  0.247   41.925  1.00 66.59  ? 110  SER A N   1 
ATOM   859  C CA  . SER A 1 110 ? 15.500  -0.933  41.144  1.00 66.49  ? 110  SER A CA  1 
ATOM   860  C C   . SER A 1 110 ? 16.409  -0.522  39.971  1.00 64.17  ? 110  SER A C   1 
ATOM   861  O O   . SER A 1 110 ? 16.370  0.624   39.528  1.00 62.92  ? 110  SER A O   1 
ATOM   862  C CB  . SER A 1 110 ? 14.221  -1.595  40.637  1.00 67.56  ? 110  SER A CB  1 
ATOM   863  O OG  . SER A 1 110 ? 13.471  -0.660  39.886  1.00 68.27  ? 110  SER A OG  1 
ATOM   864  N N   . PRO A 1 111 ? 17.240  -1.454  39.474  1.00 63.55  ? 111  PRO A N   1 
ATOM   865  C CA  . PRO A 1 111 ? 18.232  -1.127  38.435  1.00 61.52  ? 111  PRO A CA  1 
ATOM   866  C C   . PRO A 1 111 ? 17.625  -0.566  37.136  1.00 60.27  ? 111  PRO A C   1 
ATOM   867  O O   . PRO A 1 111 ? 16.740  -1.198  36.542  1.00 61.26  ? 111  PRO A O   1 
ATOM   868  C CB  . PRO A 1 111 ? 18.917  -2.474  38.177  1.00 62.06  ? 111  PRO A CB  1 
ATOM   869  C CG  . PRO A 1 111 ? 18.785  -3.198  39.473  1.00 63.79  ? 111  PRO A CG  1 
ATOM   870  C CD  . PRO A 1 111 ? 17.413  -2.829  39.972  1.00 64.75  ? 111  PRO A CD  1 
ATOM   871  N N   . THR A 1 112 ? 18.127  0.592   36.698  1.00 57.51  ? 112  THR A N   1 
ATOM   872  C CA  . THR A 1 112 ? 17.518  1.350   35.612  1.00 55.78  ? 112  THR A CA  1 
ATOM   873  C C   . THR A 1 112 ? 18.333  1.294   34.329  1.00 53.74  ? 112  THR A C   1 
ATOM   874  O O   . THR A 1 112 ? 19.554  1.359   34.371  1.00 53.25  ? 112  THR A O   1 
ATOM   875  C CB  . THR A 1 112 ? 17.356  2.821   36.015  1.00 55.17  ? 112  THR A CB  1 
ATOM   876  O OG1 . THR A 1 112 ? 16.745  2.875   37.304  1.00 57.46  ? 112  THR A OG1 1 
ATOM   877  C CG2 . THR A 1 112 ? 16.489  3.573   35.013  1.00 54.04  ? 112  THR A CG2 1 
ATOM   878  N N   . PRO A 1 113 ? 17.656  1.176   33.183  1.00 52.64  ? 113  PRO A N   1 
ATOM   879  C CA  . PRO A 1 113 ? 18.361  1.249   31.912  1.00 51.13  ? 113  PRO A CA  1 
ATOM   880  C C   . PRO A 1 113 ? 19.216  2.517   31.756  1.00 49.14  ? 113  PRO A C   1 
ATOM   881  O O   . PRO A 1 113 ? 18.761  3.641   32.055  1.00 48.62  ? 113  PRO A O   1 
ATOM   882  C CB  . PRO A 1 113 ? 17.225  1.217   30.892  1.00 51.54  ? 113  PRO A CB  1 
ATOM   883  C CG  . PRO A 1 113 ? 16.192  0.364   31.554  1.00 53.21  ? 113  PRO A CG  1 
ATOM   884  C CD  . PRO A 1 113 ? 16.278  0.686   33.020  1.00 53.59  ? 113  PRO A CD  1 
ATOM   885  N N   . VAL A 1 114 ? 20.442  2.298   31.278  1.00 47.14  ? 114  VAL A N   1 
ATOM   886  C CA  . VAL A 1 114 ? 21.466  3.314   31.141  1.00 44.58  ? 114  VAL A CA  1 
ATOM   887  C C   . VAL A 1 114 ? 21.536  3.784   29.687  1.00 43.80  ? 114  VAL A C   1 
ATOM   888  O O   . VAL A 1 114 ? 21.511  2.973   28.765  1.00 44.10  ? 114  VAL A O   1 
ATOM   889  C CB  . VAL A 1 114 ? 22.841  2.739   31.585  1.00 44.33  ? 114  VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 114 ? 23.962  3.761   31.435  1.00 41.92  ? 114  VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 114 ? 22.759  2.265   33.026  1.00 45.09  ? 114  VAL A CG2 1 
ATOM   892  N N   . LEU A 1 115 ? 21.611  5.095   29.485  1.00 42.55  ? 115  LEU A N   1 
ATOM   893  C CA  . LEU A 1 115 ? 21.804  5.644   28.169  1.00 41.33  ? 115  LEU A CA  1 
ATOM   894  C C   . LEU A 1 115 ? 23.126  6.373   28.163  1.00 40.37  ? 115  LEU A C   1 
ATOM   895  O O   . LEU A 1 115 ? 23.351  7.247   29.018  1.00 40.63  ? 115  LEU A O   1 
ATOM   896  C CB  . LEU A 1 115 ? 20.684  6.612   27.840  1.00 40.94  ? 115  LEU A CB  1 
ATOM   897  C CG  . LEU A 1 115 ? 19.400  6.064   27.241  1.00 43.34  ? 115  LEU A CG  1 
ATOM   898  C CD1 . LEU A 1 115 ? 18.286  7.104   27.296  1.00 44.81  ? 115  LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1 115 ? 19.667  5.703   25.798  1.00 46.06  ? 115  LEU A CD2 1 
ATOM   900  N N   . ILE A 1 116 ? 23.999  6.019   27.216  1.00 39.34  ? 116  ILE A N   1 
ATOM   901  C CA  . ILE A 1 116 ? 25.297  6.691   27.080  1.00 38.10  ? 116  ILE A CA  1 
ATOM   902  C C   . ILE A 1 116 ? 25.342  7.507   25.801  1.00 37.32  ? 116  ILE A C   1 
ATOM   903  O O   . ILE A 1 116 ? 25.224  6.950   24.696  1.00 38.06  ? 116  ILE A O   1 
ATOM   904  C CB  . ILE A 1 116 ? 26.481  5.698   27.089  1.00 38.43  ? 116  ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 116 ? 26.492  4.904   28.406  1.00 39.08  ? 116  ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 116 ? 27.822  6.431   26.845  1.00 36.44  ? 116  ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 116 ? 27.291  3.622   28.355  1.00 36.16  ? 116  ILE A CD1 1 
ATOM   908  N N   . TRP A 1 117 ? 25.512  8.817   25.953  1.00 35.84  ? 117  TRP A N   1 
ATOM   909  C CA  . TRP A 1 117 ? 25.592  9.721   24.834  1.00 35.12  ? 117  TRP A CA  1 
ATOM   910  C C   . TRP A 1 117 ? 27.022  9.896   24.360  1.00 34.47  ? 117  TRP A C   1 
ATOM   911  O O   . TRP A 1 117 ? 27.919  10.030  25.175  1.00 33.87  ? 117  TRP A O   1 
ATOM   912  C CB  . TRP A 1 117 ? 25.034  11.075  25.216  1.00 35.22  ? 117  TRP A CB  1 
ATOM   913  C CG  . TRP A 1 117 ? 25.173  12.119  24.129  1.00 35.95  ? 117  TRP A CG  1 
ATOM   914  C CD1 . TRP A 1 117 ? 25.977  13.220  24.148  1.00 36.04  ? 117  TRP A CD1 1 
ATOM   915  C CD2 . TRP A 1 117 ? 24.459  12.162  22.886  1.00 36.59  ? 117  TRP A CD2 1 
ATOM   916  N NE1 . TRP A 1 117 ? 25.818  13.948  22.989  1.00 36.56  ? 117  TRP A NE1 1 
ATOM   917  C CE2 . TRP A 1 117 ? 24.889  13.322  22.197  1.00 37.38  ? 117  TRP A CE2 1 
ATOM   918  C CE3 . TRP A 1 117 ? 23.488  11.337  22.290  1.00 36.58  ? 117  TRP A CE3 1 
ATOM   919  C CZ2 . TRP A 1 117 ? 24.375  13.685  20.935  1.00 36.61  ? 117  TRP A CZ2 1 
ATOM   920  C CZ3 . TRP A 1 117 ? 22.985  11.687  21.036  1.00 35.96  ? 117  TRP A CZ3 1 
ATOM   921  C CH2 . TRP A 1 117 ? 23.432  12.851  20.374  1.00 37.14  ? 117  TRP A CH2 1 
ATOM   922  N N   . ILE A 1 118 ? 27.214  9.887   23.036  1.00 34.36  ? 118  ILE A N   1 
ATOM   923  C CA  . ILE A 1 118 ? 28.503  10.192  22.401  1.00 33.99  ? 118  ILE A CA  1 
ATOM   924  C C   . ILE A 1 118 ? 28.341  11.337  21.389  1.00 34.36  ? 118  ILE A C   1 
ATOM   925  O O   . ILE A 1 118 ? 27.745  11.131  20.321  1.00 35.07  ? 118  ILE A O   1 
ATOM   926  C CB  . ILE A 1 118 ? 29.084  9.000   21.649  1.00 33.32  ? 118  ILE A CB  1 
ATOM   927  C CG1 . ILE A 1 118 ? 29.048  7.731   22.516  1.00 33.90  ? 118  ILE A CG1 1 
ATOM   928  C CG2 . ILE A 1 118 ? 30.501  9.325   21.200  1.00 32.69  ? 118  ILE A CG2 1 
ATOM   929  C CD1 . ILE A 1 118 ? 29.825  6.521   21.914  1.00 29.98  ? 118  ILE A CD1 1 
ATOM   930  N N   . TYR A 1 119 ? 28.879  12.515  21.703  1.00 33.51  ? 119  TYR A N   1 
ATOM   931  C CA  . TYR A 1 119 ? 28.697  13.681  20.840  1.00 34.13  ? 119  TYR A CA  1 
ATOM   932  C C   . TYR A 1 119 ? 29.353  13.600  19.461  1.00 34.53  ? 119  TYR A C   1 
ATOM   933  O O   . TYR A 1 119 ? 30.360  12.885  19.261  1.00 33.78  ? 119  TYR A O   1 
ATOM   934  C CB  . TYR A 1 119 ? 29.180  14.971  21.513  1.00 34.18  ? 119  TYR A CB  1 
ATOM   935  C CG  . TYR A 1 119 ? 30.633  14.968  21.966  1.00 34.70  ? 119  TYR A CG  1 
ATOM   936  C CD1 . TYR A 1 119 ? 31.696  15.144  21.047  1.00 35.27  ? 119  TYR A CD1 1 
ATOM   937  C CD2 . TYR A 1 119 ? 30.945  14.823  23.319  1.00 34.06  ? 119  TYR A CD2 1 
ATOM   938  C CE1 . TYR A 1 119 ? 33.055  15.173  21.477  1.00 34.22  ? 119  TYR A CE1 1 
ATOM   939  C CE2 . TYR A 1 119 ? 32.261  14.842  23.755  1.00 36.59  ? 119  TYR A CE2 1 
ATOM   940  C CZ  . TYR A 1 119 ? 33.323  15.022  22.839  1.00 35.72  ? 119  TYR A CZ  1 
ATOM   941  O OH  . TYR A 1 119 ? 34.608  15.019  23.329  1.00 34.42  ? 119  TYR A OH  1 
ATOM   942  N N   . GLY A 1 120 ? 28.775  14.384  18.536  1.00 34.40  ? 120  GLY A N   1 
ATOM   943  C CA  . GLY A 1 120 ? 29.326  14.596  17.204  1.00 34.50  ? 120  GLY A CA  1 
ATOM   944  C C   . GLY A 1 120 ? 30.186  15.847  17.150  1.00 34.65  ? 120  GLY A C   1 
ATOM   945  O O   . GLY A 1 120 ? 30.557  16.404  18.195  1.00 34.87  ? 120  GLY A O   1 
ATOM   946  N N   . GLY A 1 121 ? 30.507  16.284  15.931  1.00 34.81  ? 121  GLY A N   1 
ATOM   947  C CA  . GLY A 1 121 ? 31.519  17.330  15.710  1.00 34.54  ? 121  GLY A CA  1 
ATOM   948  C C   . GLY A 1 121 ? 32.697  16.894  14.847  1.00 34.32  ? 121  GLY A C   1 
ATOM   949  O O   . GLY A 1 121 ? 33.825  17.392  15.030  1.00 34.67  ? 121  GLY A O   1 
ATOM   950  N N   . GLY A 1 122 ? 32.427  15.976  13.916  1.00 33.57  ? 122  GLY A N   1 
ATOM   951  C CA  . GLY A 1 122 ? 33.354  15.605  12.847  1.00 33.79  ? 122  GLY A CA  1 
ATOM   952  C C   . GLY A 1 122 ? 34.662  14.975  13.309  1.00 34.65  ? 122  GLY A C   1 
ATOM   953  O O   . GLY A 1 122 ? 35.654  14.970  12.557  1.00 34.37  ? 122  GLY A O   1 
ATOM   954  N N   . PHE A 1 123 ? 34.667  14.464  14.548  1.00 34.33  ? 123  PHE A N   1 
ATOM   955  C CA  . PHE A 1 123 ? 35.893  14.003  15.197  1.00 35.18  ? 123  PHE A CA  1 
ATOM   956  C C   . PHE A 1 123 ? 36.970  15.066  15.464  1.00 35.66  ? 123  PHE A C   1 
ATOM   957  O O   . PHE A 1 123 ? 38.105  14.689  15.815  1.00 35.97  ? 123  PHE A O   1 
ATOM   958  C CB  . PHE A 1 123 ? 36.535  12.862  14.403  1.00 35.36  ? 123  PHE A CB  1 
ATOM   959  C CG  . PHE A 1 123 ? 35.714  11.628  14.379  1.00 34.52  ? 123  PHE A CG  1 
ATOM   960  C CD1 . PHE A 1 123 ? 35.615  10.830  15.512  1.00 34.33  ? 123  PHE A CD1 1 
ATOM   961  C CD2 . PHE A 1 123 ? 35.047  11.254  13.228  1.00 33.03  ? 123  PHE A CD2 1 
ATOM   962  C CE1 . PHE A 1 123 ? 34.838  9.663   15.505  1.00 33.93  ? 123  PHE A CE1 1 
ATOM   963  C CE2 . PHE A 1 123 ? 34.278  10.093  13.197  1.00 33.80  ? 123  PHE A CE2 1 
ATOM   964  C CZ  . PHE A 1 123 ? 34.162  9.303   14.333  1.00 35.02  ? 123  PHE A CZ  1 
ATOM   965  N N   . TYR A 1 124 ? 36.641  16.351  15.285  1.00 34.75  ? 124  TYR A N   1 
ATOM   966  C CA  . TYR A 1 124 ? 37.614  17.425  15.503  1.00 35.96  ? 124  TYR A CA  1 
ATOM   967  C C   . TYR A 1 124 ? 37.083  18.356  16.595  1.00 36.41  ? 124  TYR A C   1 
ATOM   968  O O   . TYR A 1 124 ? 37.778  19.277  17.054  1.00 37.01  ? 124  TYR A O   1 
ATOM   969  C CB  . TYR A 1 124 ? 37.907  18.218  14.204  1.00 35.76  ? 124  TYR A CB  1 
ATOM   970  C CG  . TYR A 1 124 ? 36.761  19.109  13.819  1.00 35.95  ? 124  TYR A CG  1 
ATOM   971  C CD1 . TYR A 1 124 ? 36.681  20.425  14.286  1.00 36.29  ? 124  TYR A CD1 1 
ATOM   972  C CD2 . TYR A 1 124 ? 35.706  18.614  13.049  1.00 36.96  ? 124  TYR A CD2 1 
ATOM   973  C CE1 . TYR A 1 124 ? 35.583  21.249  13.949  1.00 37.55  ? 124  TYR A CE1 1 
ATOM   974  C CE2 . TYR A 1 124 ? 34.614  19.408  12.721  1.00 37.61  ? 124  TYR A CE2 1 
ATOM   975  C CZ  . TYR A 1 124 ? 34.560  20.725  13.169  1.00 37.34  ? 124  TYR A CZ  1 
ATOM   976  O OH  . TYR A 1 124 ? 33.463  21.488  12.855  1.00 36.61  ? 124  TYR A OH  1 
ATOM   977  N N   . SER A 1 125 ? 35.826  18.153  16.977  1.00 35.74  ? 125  SER A N   1 
ATOM   978  C CA  . SER A 1 125 ? 35.247  19.006  17.983  1.00 35.84  ? 125  SER A CA  1 
ATOM   979  C C   . SER A 1 125 ? 34.163  18.287  18.777  1.00 35.73  ? 125  SER A C   1 
ATOM   980  O O   . SER A 1 125 ? 33.860  17.108  18.516  1.00 34.72  ? 125  SER A O   1 
ATOM   981  C CB  . SER A 1 125 ? 34.702  20.306  17.360  1.00 35.85  ? 125  SER A CB  1 
ATOM   982  O OG  . SER A 1 125 ? 33.638  20.044  16.481  1.00 35.98  ? 125  SER A OG  1 
ATOM   983  N N   . GLY A 1 126 ? 33.595  19.014  19.744  1.00 35.72  ? 126  GLY A N   1 
ATOM   984  C CA  . GLY A 1 126 ? 32.524  18.492  20.587  1.00 36.01  ? 126  GLY A CA  1 
ATOM   985  C C   . GLY A 1 126 ? 32.876  18.456  22.065  1.00 36.29  ? 126  GLY A C   1 
ATOM   986  O O   . GLY A 1 126 ? 34.047  18.552  22.449  1.00 36.11  ? 126  GLY A O   1 
ATOM   987  N N   . ALA A 1 127 ? 31.852  18.308  22.894  1.00 36.48  ? 127  ALA A N   1 
ATOM   988  C CA  . ALA A 1 127 ? 32.031  18.240  24.339  1.00 37.43  ? 127  ALA A CA  1 
ATOM   989  C C   . ALA A 1 127 ? 30.746  17.714  24.943  1.00 37.67  ? 127  ALA A C   1 
ATOM   990  O O   . ALA A 1 127 ? 29.673  17.972  24.416  1.00 38.28  ? 127  ALA A O   1 
ATOM   991  C CB  . ALA A 1 127 ? 32.337  19.612  24.892  1.00 37.83  ? 127  ALA A CB  1 
ATOM   992  N N   . ALA A 1 128 ? 30.837  16.992  26.053  1.00 38.01  ? 128  ALA A N   1 
ATOM   993  C CA  . ALA A 1 128 ? 29.643  16.430  26.679  1.00 37.55  ? 128  ALA A CA  1 
ATOM   994  C C   . ALA A 1 128 ? 28.957  17.445  27.568  1.00 37.82  ? 128  ALA A C   1 
ATOM   995  O O   . ALA A 1 128 ? 27.915  17.157  28.154  1.00 39.32  ? 128  ALA A O   1 
ATOM   996  C CB  . ALA A 1 128 ? 29.987  15.181  27.469  1.00 37.48  ? 128  ALA A CB  1 
ATOM   997  N N   . SER A 1 129 ? 29.529  18.633  27.670  1.00 37.34  ? 129  SER A N   1 
ATOM   998  C CA  . SER A 1 129 ? 29.002  19.656  28.569  1.00 36.94  ? 129  SER A CA  1 
ATOM   999  C C   . SER A 1 129 ? 28.065  20.673  27.909  1.00 37.19  ? 129  SER A C   1 
ATOM   1000 O O   . SER A 1 129 ? 27.505  21.529  28.596  1.00 37.87  ? 129  SER A O   1 
ATOM   1001 C CB  . SER A 1 129 ? 30.160  20.380  29.264  1.00 36.97  ? 129  SER A CB  1 
ATOM   1002 O OG  . SER A 1 129 ? 31.113  20.850  28.338  1.00 34.09  ? 129  SER A OG  1 
ATOM   1003 N N   . LEU A 1 130 ? 27.917  20.601  26.587  1.00 36.71  ? 130  LEU A N   1 
ATOM   1004 C CA  . LEU A 1 130 ? 27.021  21.489  25.838  1.00 37.33  ? 130  LEU A CA  1 
ATOM   1005 C C   . LEU A 1 130 ? 25.562  21.433  26.303  1.00 38.20  ? 130  LEU A C   1 
ATOM   1006 O O   . LEU A 1 130 ? 25.033  20.377  26.666  1.00 37.96  ? 130  LEU A O   1 
ATOM   1007 C CB  . LEU A 1 130 ? 27.095  21.195  24.328  1.00 36.85  ? 130  LEU A CB  1 
ATOM   1008 C CG  . LEU A 1 130 ? 28.464  21.254  23.629  1.00 37.22  ? 130  LEU A CG  1 
ATOM   1009 C CD1 . LEU A 1 130 ? 28.322  20.940  22.160  1.00 36.77  ? 130  LEU A CD1 1 
ATOM   1010 C CD2 . LEU A 1 130 ? 29.156  22.600  23.812  1.00 35.66  ? 130  LEU A CD2 1 
ATOM   1011 N N   . ASP A 1 131 ? 24.919  22.595  26.277  1.00 40.13  ? 131  ASP A N   1 
ATOM   1012 C CA  . ASP A 1 131 ? 23.508  22.754  26.669  1.00 40.95  ? 131  ASP A CA  1 
ATOM   1013 C C   . ASP A 1 131 ? 22.536  21.770  26.051  1.00 40.51  ? 131  ASP A C   1 
ATOM   1014 O O   . ASP A 1 131 ? 21.642  21.312  26.738  1.00 41.59  ? 131  ASP A O   1 
ATOM   1015 C CB  . ASP A 1 131 ? 23.037  24.165  26.374  1.00 41.35  ? 131  ASP A CB  1 
ATOM   1016 C CG  . ASP A 1 131 ? 23.451  25.130  27.430  1.00 44.13  ? 131  ASP A CG  1 
ATOM   1017 O OD1 . ASP A 1 131 ? 24.224  24.743  28.331  1.00 45.20  ? 131  ASP A OD1 1 
ATOM   1018 O OD2 . ASP A 1 131 ? 22.986  26.288  27.379  1.00 49.50  ? 131  ASP A OD2 1 
ATOM   1019 N N   . VAL A 1 132 ? 22.716  21.443  24.773  1.00 39.67  ? 132  VAL A N   1 
ATOM   1020 C CA  . VAL A 1 132 ? 21.838  20.487  24.075  1.00 39.55  ? 132  VAL A CA  1 
ATOM   1021 C C   . VAL A 1 132 ? 22.061  19.039  24.465  1.00 39.33  ? 132  VAL A C   1 
ATOM   1022 O O   . VAL A 1 132 ? 21.292  18.157  24.069  1.00 39.73  ? 132  VAL A O   1 
ATOM   1023 C CB  . VAL A 1 132 ? 21.928  20.594  22.511  1.00 39.00  ? 132  VAL A CB  1 
ATOM   1024 C CG1 . VAL A 1 132 ? 21.179  21.822  22.043  1.00 39.75  ? 132  VAL A CG1 1 
ATOM   1025 C CG2 . VAL A 1 132 ? 23.395  20.598  22.020  1.00 37.93  ? 132  VAL A CG2 1 
ATOM   1026 N N   . TYR A 1 133 ? 23.124  18.770  25.212  1.00 39.29  ? 133  TYR A N   1 
ATOM   1027 C CA  . TYR A 1 133 ? 23.328  17.398  25.703  1.00 39.06  ? 133  TYR A CA  1 
ATOM   1028 C C   . TYR A 1 133 ? 22.937  17.202  27.181  1.00 39.40  ? 133  TYR A C   1 
ATOM   1029 O O   . TYR A 1 133 ? 23.209  16.166  27.755  1.00 40.06  ? 133  TYR A O   1 
ATOM   1030 C CB  . TYR A 1 133 ? 24.752  16.912  25.424  1.00 38.21  ? 133  TYR A CB  1 
ATOM   1031 C CG  . TYR A 1 133 ? 25.259  17.114  23.997  1.00 37.53  ? 133  TYR A CG  1 
ATOM   1032 C CD1 . TYR A 1 133 ? 24.402  16.997  22.880  1.00 34.84  ? 133  TYR A CD1 1 
ATOM   1033 C CD2 . TYR A 1 133 ? 26.627  17.409  23.764  1.00 36.84  ? 133  TYR A CD2 1 
ATOM   1034 C CE1 . TYR A 1 133 ? 24.898  17.183  21.560  1.00 34.64  ? 133  TYR A CE1 1 
ATOM   1035 C CE2 . TYR A 1 133 ? 27.135  17.595  22.463  1.00 33.56  ? 133  TYR A CE2 1 
ATOM   1036 C CZ  . TYR A 1 133 ? 26.277  17.478  21.362  1.00 34.95  ? 133  TYR A CZ  1 
ATOM   1037 O OH  . TYR A 1 133 ? 26.799  17.656  20.080  1.00 31.38  ? 133  TYR A OH  1 
ATOM   1038 N N   . ASP A 1 134 ? 22.277  18.198  27.773  1.00 40.09  ? 134  ASP A N   1 
ATOM   1039 C CA  . ASP A 1 134 ? 21.849  18.172  29.178  1.00 40.56  ? 134  ASP A CA  1 
ATOM   1040 C C   . ASP A 1 134 ? 20.891  16.990  29.490  1.00 41.02  ? 134  ASP A C   1 
ATOM   1041 O O   . ASP A 1 134 ? 19.742  16.943  29.000  1.00 41.10  ? 134  ASP A O   1 
ATOM   1042 C CB  . ASP A 1 134 ? 21.184  19.512  29.520  1.00 41.13  ? 134  ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 134 ? 20.835  19.643  30.985  1.00 42.96  ? 134  ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 134 ? 20.938  18.680  31.758  1.00 47.88  ? 134  ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 134 ? 20.440  20.726  31.384  1.00 44.92  ? 134  ASP A OD2 1 
ATOM   1046 N N   . GLY A 1 135 ? 21.364  16.054  30.315  1.00 40.39  ? 135  GLY A N   1 
ATOM   1047 C CA  . GLY A 1 135 ? 20.587  14.857  30.643  1.00 39.72  ? 135  GLY A CA  1 
ATOM   1048 C C   . GLY A 1 135 ? 19.511  15.011  31.698  1.00 40.01  ? 135  GLY A C   1 
ATOM   1049 O O   . GLY A 1 135 ? 18.809  14.052  31.989  1.00 39.51  ? 135  GLY A O   1 
ATOM   1050 N N   . ARG A 1 136 ? 19.366  16.211  32.266  1.00 40.30  ? 136  ARG A N   1 
ATOM   1051 C CA  . ARG A 1 136 ? 18.408  16.413  33.362  1.00 41.71  ? 136  ARG A CA  1 
ATOM   1052 C C   . ARG A 1 136 ? 16.967  15.995  33.011  1.00 42.49  ? 136  ARG A C   1 
ATOM   1053 O O   . ARG A 1 136 ? 16.298  15.380  33.843  1.00 43.57  ? 136  ARG A O   1 
ATOM   1054 C CB  . ARG A 1 136 ? 18.475  17.833  33.979  1.00 41.87  ? 136  ARG A CB  1 
ATOM   1055 C CG  . ARG A 1 136 ? 17.832  18.971  33.189  1.00 43.96  ? 136  ARG A CG  1 
ATOM   1056 C CD  . ARG A 1 136 ? 17.996  20.336  33.886  1.00 47.11  ? 136  ARG A CD  1 
ATOM   1057 N NE  . ARG A 1 136 ? 19.394  20.776  33.946  1.00 50.53  ? 136  ARG A NE  1 
ATOM   1058 C CZ  . ARG A 1 136 ? 19.885  21.702  34.784  1.00 52.60  ? 136  ARG A CZ  1 
ATOM   1059 N NH1 . ARG A 1 136 ? 21.177  22.026  34.734  1.00 50.26  ? 136  ARG A NH1 1 
ATOM   1060 N NH2 . ARG A 1 136 ? 19.102  22.306  35.688  1.00 53.66  ? 136  ARG A NH2 1 
ATOM   1061 N N   . PHE A 1 137 ? 16.508  16.268  31.786  1.00 42.15  ? 137  PHE A N   1 
ATOM   1062 C CA  . PHE A 1 137 ? 15.106  16.001  31.413  1.00 42.80  ? 137  PHE A CA  1 
ATOM   1063 C C   . PHE A 1 137 ? 14.817  14.518  31.218  1.00 43.27  ? 137  PHE A C   1 
ATOM   1064 O O   . PHE A 1 137 ? 13.765  14.025  31.660  1.00 44.15  ? 137  PHE A O   1 
ATOM   1065 C CB  . PHE A 1 137 ? 14.695  16.788  30.173  1.00 41.97  ? 137  PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 137 ? 15.161  18.204  30.192  1.00 41.55  ? 137  PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 137 ? 14.420  19.180  30.837  1.00 39.78  ? 137  PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 137 ? 16.366  18.569  29.573  1.00 40.46  ? 137  PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 137 ? 14.853  20.505  30.867  1.00 38.83  ? 137  PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 137 ? 16.802  19.910  29.606  1.00 38.17  ? 137  PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 137 ? 16.029  20.870  30.256  1.00 38.01  ? 137  PHE A CZ  1 
ATOM   1072 N N   . LEU A 1 138 ? 15.730  13.810  30.559  1.00 42.37  ? 138  LEU A N   1 
ATOM   1073 C CA  . LEU A 1 138 ? 15.556  12.369  30.401  1.00 43.51  ? 138  LEU A CA  1 
ATOM   1074 C C   . LEU A 1 138 ? 15.603  11.652  31.754  1.00 44.45  ? 138  LEU A C   1 
ATOM   1075 O O   . LEU A 1 138 ? 14.835  10.733  32.010  1.00 45.47  ? 138  LEU A O   1 
ATOM   1076 C CB  . LEU A 1 138 ? 16.590  11.791  29.438  1.00 42.65  ? 138  LEU A CB  1 
ATOM   1077 C CG  . LEU A 1 138 ? 16.311  12.011  27.951  1.00 42.16  ? 138  LEU A CG  1 
ATOM   1078 C CD1 . LEU A 1 138 ? 17.578  11.797  27.128  1.00 38.99  ? 138  LEU A CD1 1 
ATOM   1079 C CD2 . LEU A 1 138 ? 15.173  11.096  27.484  1.00 43.12  ? 138  LEU A CD2 1 
ATOM   1080 N N   . ALA A 1 139 ? 16.493  12.108  32.621  1.00 44.75  ? 139  ALA A N   1 
ATOM   1081 C CA  . ALA A 1 139 ? 16.615  11.584  33.970  1.00 45.82  ? 139  ALA A CA  1 
ATOM   1082 C C   . ALA A 1 139 ? 15.330  11.782  34.780  1.00 47.49  ? 139  ALA A C   1 
ATOM   1083 O O   . ALA A 1 139 ? 14.818  10.838  35.377  1.00 49.02  ? 139  ALA A O   1 
ATOM   1084 C CB  . ALA A 1 139 ? 17.827  12.223  34.683  1.00 44.78  ? 139  ALA A CB  1 
ATOM   1085 N N   . GLN A 1 140 ? 14.799  12.999  34.786  1.00 48.03  ? 140  GLN A N   1 
ATOM   1086 C CA  . GLN A 1 140 ? 13.651  13.341  35.638  1.00 48.88  ? 140  GLN A CA  1 
ATOM   1087 C C   . GLN A 1 140 ? 12.351  12.819  35.064  1.00 50.09  ? 140  GLN A C   1 
ATOM   1088 O O   . GLN A 1 140 ? 11.507  12.328  35.805  1.00 51.61  ? 140  GLN A O   1 
ATOM   1089 C CB  . GLN A 1 140 ? 13.546  14.860  35.808  1.00 48.60  ? 140  GLN A CB  1 
ATOM   1090 C CG  . GLN A 1 140 ? 12.682  15.332  36.974  1.00 49.86  ? 140  GLN A CG  1 
ATOM   1091 C CD  . GLN A 1 140 ? 11.162  15.189  36.745  1.00 51.77  ? 140  GLN A CD  1 
ATOM   1092 O OE1 . GLN A 1 140 ? 10.650  15.375  35.628  1.00 51.32  ? 140  GLN A OE1 1 
ATOM   1093 N NE2 . GLN A 1 140 ? 10.439  14.873  37.822  1.00 50.71  ? 140  GLN A NE2 1 
ATOM   1094 N N   . VAL A 1 141 ? 12.164  12.955  33.755  1.00 49.66  ? 141  VAL A N   1 
ATOM   1095 C CA  . VAL A 1 141 ? 10.869  12.632  33.170  1.00 50.57  ? 141  VAL A CA  1 
ATOM   1096 C C   . VAL A 1 141 ? 10.776  11.145  32.867  1.00 51.39  ? 141  VAL A C   1 
ATOM   1097 O O   . VAL A 1 141 ? 9.735   10.526  33.106  1.00 52.69  ? 141  VAL A O   1 
ATOM   1098 C CB  . VAL A 1 141 ? 10.564  13.471  31.917  1.00 50.12  ? 141  VAL A CB  1 
ATOM   1099 C CG1 . VAL A 1 141 ? 9.273   13.005  31.261  1.00 49.74  ? 141  VAL A CG1 1 
ATOM   1100 C CG2 . VAL A 1 141 ? 10.498  14.963  32.272  1.00 48.97  ? 141  VAL A CG2 1 
ATOM   1101 N N   . GLU A 1 142 ? 11.864  10.564  32.369  1.00 50.42  ? 142  GLU A N   1 
ATOM   1102 C CA  . GLU A 1 142 ? 11.825  9.159   32.004  1.00 51.01  ? 142  GLU A CA  1 
ATOM   1103 C C   . GLU A 1 142 ? 12.405  8.210   33.057  1.00 51.19  ? 142  GLU A C   1 
ATOM   1104 O O   . GLU A 1 142 ? 12.279  6.994   32.933  1.00 51.59  ? 142  GLU A O   1 
ATOM   1105 C CB  . GLU A 1 142 ? 12.439  8.944   30.621  1.00 50.10  ? 142  GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 142 ? 11.571  9.496   29.484  1.00 51.89  ? 142  GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 142 ? 10.203  8.820   29.375  1.00 57.06  ? 142  GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 142 ? 9.987   7.740   29.979  1.00 59.82  ? 142  GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 142 ? 9.328   9.366   28.673  1.00 59.61  ? 142  GLU A OE2 1 
ATOM   1110 N N   . GLY A 1 143 ? 13.007  8.766   34.105  1.00 50.88  ? 143  GLY A N   1 
ATOM   1111 C CA  . GLY A 1 143 ? 13.653  7.958   35.133  1.00 50.80  ? 143  GLY A CA  1 
ATOM   1112 C C   . GLY A 1 143 ? 14.968  7.372   34.651  1.00 49.94  ? 143  GLY A C   1 
ATOM   1113 O O   . GLY A 1 143 ? 15.480  6.431   35.257  1.00 50.97  ? 143  GLY A O   1 
ATOM   1114 N N   . ALA A 1 144 ? 15.526  7.913   33.569  1.00 48.10  ? 144  ALA A N   1 
ATOM   1115 C CA  . ALA A 1 144 ? 16.733  7.322   32.968  1.00 46.98  ? 144  ALA A CA  1 
ATOM   1116 C C   . ALA A 1 144 ? 18.026  7.669   33.710  1.00 45.94  ? 144  ALA A C   1 
ATOM   1117 O O   . ALA A 1 144 ? 18.114  8.705   34.378  1.00 45.82  ? 144  ALA A O   1 
ATOM   1118 C CB  . ALA A 1 144 ? 16.856  7.717   31.497  1.00 45.73  ? 144  ALA A CB  1 
ATOM   1119 N N   . VAL A 1 145 ? 19.019  6.791   33.586  1.00 45.10  ? 145  VAL A N   1 
ATOM   1120 C CA  . VAL A 1 145 ? 20.387  7.093   33.989  1.00 43.76  ? 145  VAL A CA  1 
ATOM   1121 C C   . VAL A 1 145 ? 21.146  7.465   32.732  1.00 43.08  ? 145  VAL A C   1 
ATOM   1122 O O   . VAL A 1 145 ? 21.282  6.665   31.803  1.00 42.96  ? 145  VAL A O   1 
ATOM   1123 C CB  . VAL A 1 145 ? 21.052  5.917   34.714  1.00 44.48  ? 145  VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 145 ? 22.511  6.241   35.049  1.00 43.38  ? 145  VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 145 ? 20.275  5.565   35.991  1.00 44.14  ? 145  VAL A CG2 1 
ATOM   1126 N N   . LEU A 1 146 ? 21.585  8.711   32.664  1.00 42.74  ? 146  LEU A N   1 
ATOM   1127 C CA  . LEU A 1 146 ? 22.255  9.164   31.456  1.00 42.04  ? 146  LEU A CA  1 
ATOM   1128 C C   . LEU A 1 146 ? 23.723  9.438   31.716  1.00 41.13  ? 146  LEU A C   1 
ATOM   1129 O O   . LEU A 1 146 ? 24.077  10.060  32.713  1.00 41.25  ? 146  LEU A O   1 
ATOM   1130 C CB  . LEU A 1 146 ? 21.542  10.365  30.834  1.00 41.70  ? 146  LEU A CB  1 
ATOM   1131 C CG  . LEU A 1 146 ? 21.852  10.539  29.340  1.00 42.21  ? 146  LEU A CG  1 
ATOM   1132 C CD1 . LEU A 1 146 ? 20.617  10.931  28.591  1.00 43.31  ? 146  LEU A CD1 1 
ATOM   1133 C CD2 . LEU A 1 146 ? 22.961  11.574  29.106  1.00 42.10  ? 146  LEU A CD2 1 
ATOM   1134 N N   . VAL A 1 147 ? 24.560  8.960   30.807  1.00 40.43  ? 147  VAL A N   1 
ATOM   1135 C CA  . VAL A 1 147 ? 26.005  9.116   30.917  1.00 40.17  ? 147  VAL A CA  1 
ATOM   1136 C C   . VAL A 1 147 ? 26.519  9.684   29.626  1.00 39.71  ? 147  VAL A C   1 
ATOM   1137 O O   . VAL A 1 147 ? 26.141  9.228   28.548  1.00 39.95  ? 147  VAL A O   1 
ATOM   1138 C CB  . VAL A 1 147 ? 26.729  7.758   31.152  1.00 40.54  ? 147  VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 147 ? 28.255  7.931   31.135  1.00 40.48  ? 147  VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 147 ? 26.304  7.146   32.461  1.00 40.59  ? 147  VAL A CG2 1 
ATOM   1141 N N   . SER A 1 148 ? 27.392  10.676  29.735  1.00 39.20  ? 148  SER A N   1 
ATOM   1142 C CA  . SER A 1 148 ? 28.105  11.193  28.577  1.00 37.65  ? 148  SER A CA  1 
ATOM   1143 C C   . SER A 1 148 ? 29.573  11.421  28.925  1.00 37.88  ? 148  SER A C   1 
ATOM   1144 O O   . SER A 1 148 ? 29.892  11.830  30.051  1.00 38.67  ? 148  SER A O   1 
ATOM   1145 C CB  . SER A 1 148 ? 27.464  12.483  28.127  1.00 37.28  ? 148  SER A CB  1 
ATOM   1146 O OG  . SER A 1 148 ? 27.601  13.466  29.118  1.00 36.04  ? 148  SER A OG  1 
ATOM   1147 N N   . MET A 1 149 ? 30.461  11.135  27.970  1.00 37.37  ? 149  MET A N   1 
ATOM   1148 C CA  . MET A 1 149 ? 31.918  11.278  28.160  1.00 37.23  ? 149  MET A CA  1 
ATOM   1149 C C   . MET A 1 149 ? 32.556  12.252  27.158  1.00 36.88  ? 149  MET A C   1 
ATOM   1150 O O   . MET A 1 149 ? 32.046  12.444  26.045  1.00 36.62  ? 149  MET A O   1 
ATOM   1151 C CB  . MET A 1 149 ? 32.606  9.927   27.991  1.00 37.23  ? 149  MET A CB  1 
ATOM   1152 C CG  . MET A 1 149 ? 32.944  9.568   26.528  1.00 37.44  ? 149  MET A CG  1 
ATOM   1153 S SD  . MET A 1 149 ? 31.517  9.001   25.560  1.00 40.52  ? 149  MET A SD  1 
ATOM   1154 C CE  . MET A 1 149 ? 31.309  7.327   26.171  1.00 36.25  ? 149  MET A CE  1 
ATOM   1155 N N   . ASN A 1 150 ? 33.666  12.859  27.565  1.00 36.71  ? 150  ASN A N   1 
ATOM   1156 C CA  . ASN A 1 150 ? 34.535  13.568  26.650  1.00 36.43  ? 150  ASN A CA  1 
ATOM   1157 C C   . ASN A 1 150 ? 35.474  12.508  26.080  1.00 36.56  ? 150  ASN A C   1 
ATOM   1158 O O   . ASN A 1 150 ? 35.862  11.563  26.792  1.00 36.61  ? 150  ASN A O   1 
ATOM   1159 C CB  . ASN A 1 150 ? 35.351  14.663  27.366  1.00 36.71  ? 150  ASN A CB  1 
ATOM   1160 C CG  . ASN A 1 150 ? 34.527  15.916  27.727  1.00 38.09  ? 150  ASN A CG  1 
ATOM   1161 O OD1 . ASN A 1 150 ? 33.339  16.042  27.391  1.00 37.27  ? 150  ASN A OD1 1 
ATOM   1162 N ND2 . ASN A 1 150 ? 35.176  16.852  28.425  1.00 36.87  ? 150  ASN A ND2 1 
ATOM   1163 N N   . TYR A 1 151 ? 35.826  12.653  24.804  1.00 35.68  ? 151  TYR A N   1 
ATOM   1164 C CA  . TYR A 1 151 ? 36.838  11.816  24.188  1.00 35.67  ? 151  TYR A CA  1 
ATOM   1165 C C   . TYR A 1 151 ? 37.677  12.745  23.325  1.00 35.95  ? 151  TYR A C   1 
ATOM   1166 O O   . TYR A 1 151 ? 37.162  13.764  22.829  1.00 36.02  ? 151  TYR A O   1 
ATOM   1167 C CB  . TYR A 1 151 ? 36.198  10.668  23.376  1.00 35.42  ? 151  TYR A CB  1 
ATOM   1168 C CG  . TYR A 1 151 ? 35.324  11.108  22.213  1.00 34.86  ? 151  TYR A CG  1 
ATOM   1169 C CD1 . TYR A 1 151 ? 34.002  11.513  22.407  1.00 34.19  ? 151  TYR A CD1 1 
ATOM   1170 C CD2 . TYR A 1 151 ? 35.825  11.126  20.921  1.00 35.79  ? 151  TYR A CD2 1 
ATOM   1171 C CE1 . TYR A 1 151 ? 33.202  11.918  21.335  1.00 35.04  ? 151  TYR A CE1 1 
ATOM   1172 C CE2 . TYR A 1 151 ? 35.040  11.535  19.844  1.00 34.86  ? 151  TYR A CE2 1 
ATOM   1173 C CZ  . TYR A 1 151 ? 33.736  11.942  20.052  1.00 34.96  ? 151  TYR A CZ  1 
ATOM   1174 O OH  . TYR A 1 151 ? 32.974  12.353  18.971  1.00 34.90  ? 151  TYR A OH  1 
ATOM   1175 N N   . ARG A 1 152 ? 38.965  12.432  23.167  1.00 36.23  ? 152  ARG A N   1 
ATOM   1176 C CA  . ARG A 1 152 ? 39.892  13.320  22.438  1.00 36.30  ? 152  ARG A CA  1 
ATOM   1177 C C   . ARG A 1 152 ? 39.525  13.439  20.969  1.00 36.06  ? 152  ARG A C   1 
ATOM   1178 O O   . ARG A 1 152 ? 39.131  12.457  20.325  1.00 36.80  ? 152  ARG A O   1 
ATOM   1179 C CB  . ARG A 1 152 ? 41.336  12.838  22.567  1.00 37.39  ? 152  ARG A CB  1 
ATOM   1180 C CG  . ARG A 1 152 ? 41.977  13.102  23.920  1.00 37.10  ? 152  ARG A CG  1 
ATOM   1181 C CD  . ARG A 1 152 ? 43.276  12.384  24.022  1.00 35.84  ? 152  ARG A CD  1 
ATOM   1182 N NE  . ARG A 1 152 ? 43.035  10.963  24.226  1.00 36.72  ? 152  ARG A NE  1 
ATOM   1183 C CZ  . ARG A 1 152 ? 43.990  10.042  24.328  1.00 38.29  ? 152  ARG A CZ  1 
ATOM   1184 N NH1 . ARG A 1 152 ? 45.278  10.379  24.225  1.00 39.81  ? 152  ARG A NH1 1 
ATOM   1185 N NH2 . ARG A 1 152 ? 43.653  8.773   24.534  1.00 38.14  ? 152  ARG A NH2 1 
ATOM   1186 N N   . VAL A 1 153 ? 39.638  14.639  20.434  1.00 35.47  ? 153  VAL A N   1 
ATOM   1187 C CA  . VAL A 1 153 ? 39.268  14.879  19.046  1.00 35.01  ? 153  VAL A CA  1 
ATOM   1188 C C   . VAL A 1 153 ? 40.453  15.465  18.314  1.00 36.00  ? 153  VAL A C   1 
ATOM   1189 O O   . VAL A 1 153 ? 41.501  15.735  18.930  1.00 36.91  ? 153  VAL A O   1 
ATOM   1190 C CB  . VAL A 1 153 ? 38.036  15.828  18.928  1.00 34.97  ? 153  VAL A CB  1 
ATOM   1191 C CG1 . VAL A 1 153 ? 36.776  15.134  19.436  1.00 34.77  ? 153  VAL A CG1 1 
ATOM   1192 C CG2 . VAL A 1 153 ? 38.257  17.160  19.673  1.00 33.55  ? 153  VAL A CG2 1 
ATOM   1193 N N   . GLY A 1 154 ? 40.304  15.650  17.003  1.00 35.65  ? 154  GLY A N   1 
ATOM   1194 C CA  . GLY A 1 154 ? 41.362  16.213  16.191  1.00 35.94  ? 154  GLY A CA  1 
ATOM   1195 C C   . GLY A 1 154 ? 42.626  15.366  16.291  1.00 37.21  ? 154  GLY A C   1 
ATOM   1196 O O   . GLY A 1 154 ? 42.548  14.134  16.478  1.00 36.80  ? 154  GLY A O   1 
ATOM   1197 N N   . THR A 1 155 ? 43.781  16.026  16.157  1.00 37.43  ? 155  THR A N   1 
ATOM   1198 C CA  . THR A 1 155 ? 45.051  15.340  16.148  1.00 38.35  ? 155  THR A CA  1 
ATOM   1199 C C   . THR A 1 155 ? 45.175  14.503  17.420  1.00 38.99  ? 155  THR A C   1 
ATOM   1200 O O   . THR A 1 155 ? 45.574  13.328  17.371  1.00 40.29  ? 155  THR A O   1 
ATOM   1201 C CB  . THR A 1 155 ? 46.224  16.324  16.059  1.00 39.42  ? 155  THR A CB  1 
ATOM   1202 O OG1 . THR A 1 155 ? 45.997  17.414  16.959  1.00 39.11  ? 155  THR A OG1 1 
ATOM   1203 C CG2 . THR A 1 155 ? 46.380  16.867  14.647  1.00 37.82  ? 155  THR A CG2 1 
ATOM   1204 N N   . PHE A 1 156 ? 44.773  15.084  18.546  1.00 38.05  ? 156  PHE A N   1 
ATOM   1205 C CA  . PHE A 1 156 ? 44.958  14.449  19.853  1.00 38.00  ? 156  PHE A CA  1 
ATOM   1206 C C   . PHE A 1 156 ? 44.235  13.133  19.925  1.00 38.09  ? 156  PHE A C   1 
ATOM   1207 O O   . PHE A 1 156 ? 44.745  12.179  20.520  1.00 38.91  ? 156  PHE A O   1 
ATOM   1208 C CB  . PHE A 1 156 ? 44.482  15.381  20.966  1.00 37.30  ? 156  PHE A CB  1 
ATOM   1209 C CG  . PHE A 1 156 ? 45.016  16.779  20.822  1.00 36.77  ? 156  PHE A CG  1 
ATOM   1210 C CD1 . PHE A 1 156 ? 46.300  17.093  21.269  1.00 37.07  ? 156  PHE A CD1 1 
ATOM   1211 C CD2 . PHE A 1 156 ? 44.270  17.747  20.174  1.00 33.20  ? 156  PHE A CD2 1 
ATOM   1212 C CE1 . PHE A 1 156 ? 46.812  18.370  21.098  1.00 38.56  ? 156  PHE A CE1 1 
ATOM   1213 C CE2 . PHE A 1 156 ? 44.761  19.015  20.004  1.00 36.34  ? 156  PHE A CE2 1 
ATOM   1214 C CZ  . PHE A 1 156 ? 46.038  19.339  20.463  1.00 38.04  ? 156  PHE A CZ  1 
ATOM   1215 N N   . GLY A 1 157 ? 43.057  13.078  19.300  1.00 36.95  ? 157  GLY A N   1 
ATOM   1216 C CA  . GLY A 1 157 ? 42.272  11.872  19.318  1.00 36.66  ? 157  GLY A CA  1 
ATOM   1217 C C   . GLY A 1 157 ? 42.601  10.879  18.222  1.00 37.43  ? 157  GLY A C   1 
ATOM   1218 O O   . GLY A 1 157 ? 42.380  9.685   18.396  1.00 38.03  ? 157  GLY A O   1 
ATOM   1219 N N   . PHE A 1 158 ? 43.093  11.363  17.080  1.00 37.81  ? 158  PHE A N   1 
ATOM   1220 C CA  . PHE A 1 158 ? 43.064  10.554  15.855  1.00 37.94  ? 158  PHE A CA  1 
ATOM   1221 C C   . PHE A 1 158 ? 44.293  10.557  14.948  1.00 39.70  ? 158  PHE A C   1 
ATOM   1222 O O   . PHE A 1 158 ? 44.398  9.702   14.070  1.00 40.56  ? 158  PHE A O   1 
ATOM   1223 C CB  . PHE A 1 158 ? 41.785  10.806  15.075  1.00 36.61  ? 158  PHE A CB  1 
ATOM   1224 C CG  . PHE A 1 158 ? 40.561  10.472  15.857  1.00 35.11  ? 158  PHE A CG  1 
ATOM   1225 C CD1 . PHE A 1 158 ? 40.153  9.141   15.997  1.00 34.57  ? 158  PHE A CD1 1 
ATOM   1226 C CD2 . PHE A 1 158 ? 39.854  11.457  16.508  1.00 31.36  ? 158  PHE A CD2 1 
ATOM   1227 C CE1 . PHE A 1 158 ? 39.039  8.815   16.740  1.00 31.72  ? 158  PHE A CE1 1 
ATOM   1228 C CE2 . PHE A 1 158 ? 38.755  11.132  17.272  1.00 31.60  ? 158  PHE A CE2 1 
ATOM   1229 C CZ  . PHE A 1 158 ? 38.352  9.813   17.396  1.00 31.75  ? 158  PHE A CZ  1 
ATOM   1230 N N   . LEU A 1 159 ? 45.232  11.474  15.187  1.00 40.53  ? 159  LEU A N   1 
ATOM   1231 C CA  . LEU A 1 159 ? 46.503  11.457  14.471  1.00 42.08  ? 159  LEU A CA  1 
ATOM   1232 C C   . LEU A 1 159 ? 47.170  10.102  14.610  1.00 43.20  ? 159  LEU A C   1 
ATOM   1233 O O   . LEU A 1 159 ? 47.409  9.632   15.704  1.00 44.18  ? 159  LEU A O   1 
ATOM   1234 C CB  . LEU A 1 159 ? 47.450  12.568  14.962  1.00 42.57  ? 159  LEU A CB  1 
ATOM   1235 C CG  . LEU A 1 159 ? 48.774  12.726  14.187  1.00 43.57  ? 159  LEU A CG  1 
ATOM   1236 C CD1 . LEU A 1 159 ? 49.211  14.186  14.157  1.00 42.35  ? 159  LEU A CD1 1 
ATOM   1237 C CD2 . LEU A 1 159 ? 49.886  11.831  14.767  1.00 41.82  ? 159  LEU A CD2 1 
ATOM   1238 N N   . ALA A 1 160 ? 47.501  9.490   13.488  1.00 44.08  ? 160  ALA A N   1 
ATOM   1239 C CA  . ALA A 1 160 ? 47.983  8.135   13.515  1.00 45.23  ? 160  ALA A CA  1 
ATOM   1240 C C   . ALA A 1 160 ? 49.159  7.923   12.596  1.00 46.68  ? 160  ALA A C   1 
ATOM   1241 O O   . ALA A 1 160 ? 49.168  8.397   11.473  1.00 46.63  ? 160  ALA A O   1 
ATOM   1242 C CB  . ALA A 1 160 ? 46.847  7.169   13.154  1.00 44.45  ? 160  ALA A CB  1 
ATOM   1243 N N   . LEU A 1 161 ? 50.155  7.200   13.089  1.00 48.76  ? 161  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 161 ? 51.190  6.622   12.231  1.00 50.90  ? 161  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 161 ? 51.043  5.126   12.343  1.00 51.52  ? 161  LEU A C   1 
ATOM   1246 O O   . LEU A 1 161 ? 51.710  4.510   13.159  1.00 52.14  ? 161  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 161 ? 52.576  7.069   12.665  1.00 51.95  ? 161  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 161 ? 52.772  8.543   12.311  1.00 53.14  ? 161  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 161 ? 53.920  9.103   13.084  1.00 56.08  ? 161  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 161 ? 53.019  8.729   10.807  1.00 54.10  ? 161  LEU A CD2 1 
ATOM   1251 N N   . PRO A 1 162 ? 50.124  4.544   11.546  1.00 51.45  ? 162  PRO A N   1 
ATOM   1252 C CA  . PRO A 1 162 ? 49.716  3.146   11.709  1.00 52.12  ? 162  PRO A CA  1 
ATOM   1253 C C   . PRO A 1 162 ? 50.895  2.181   11.780  1.00 54.63  ? 162  PRO A C   1 
ATOM   1254 O O   . PRO A 1 162 ? 51.785  2.218   10.940  1.00 55.75  ? 162  PRO A O   1 
ATOM   1255 C CB  . PRO A 1 162 ? 48.867  2.897   10.466  1.00 51.52  ? 162  PRO A CB  1 
ATOM   1256 C CG  . PRO A 1 162 ? 48.295  4.237   10.161  1.00 50.08  ? 162  PRO A CG  1 
ATOM   1257 C CD  . PRO A 1 162 ? 49.409  5.186   10.430  1.00 50.21  ? 162  PRO A CD  1 
ATOM   1258 N N   . GLY A 1 163 ? 50.906  1.338   12.805  1.00 55.97  ? 163  GLY A N   1 
ATOM   1259 C CA  . GLY A 1 163 ? 51.963  0.357   12.975  1.00 58.23  ? 163  GLY A CA  1 
ATOM   1260 C C   . GLY A 1 163 ? 52.935  0.742   14.062  1.00 59.42  ? 163  GLY A C   1 
ATOM   1261 O O   . GLY A 1 163 ? 53.648  -0.110  14.578  1.00 61.39  ? 163  GLY A O   1 
ATOM   1262 N N   . SER A 1 164 ? 52.978  2.026   14.408  1.00 58.70  ? 164  SER A N   1 
ATOM   1263 C CA  . SER A 1 164 ? 53.827  2.507   15.506  1.00 59.46  ? 164  SER A CA  1 
ATOM   1264 C C   . SER A 1 164 ? 53.279  2.222   16.924  1.00 59.67  ? 164  SER A C   1 
ATOM   1265 O O   . SER A 1 164 ? 52.107  1.826   17.103  1.00 59.03  ? 164  SER A O   1 
ATOM   1266 C CB  . SER A 1 164 ? 54.057  4.003   15.358  1.00 58.36  ? 164  SER A CB  1 
ATOM   1267 O OG  . SER A 1 164 ? 52.897  4.729   15.724  1.00 55.54  ? 164  SER A OG  1 
ATOM   1268 N N   . ARG A 1 165 ? 54.140  2.436   17.917  1.00 60.85  ? 165  ARG A N   1 
ATOM   1269 C CA  A ARG A 1 165 ? 53.835  2.305   19.337  0.50 60.97  ? 165  ARG A CA  1 
ATOM   1270 C CA  B ARG A 1 165 ? 53.695  2.300   19.294  0.50 60.70  ? 165  ARG A CA  1 
ATOM   1271 C C   . ARG A 1 165 ? 53.301  3.659   19.840  1.00 59.43  ? 165  ARG A C   1 
ATOM   1272 O O   . ARG A 1 165 ? 52.367  3.742   20.657  1.00 58.53  ? 165  ARG A O   1 
ATOM   1273 C CB  A ARG A 1 165 ? 55.146  1.986   20.075  0.50 63.09  ? 165  ARG A CB  1 
ATOM   1274 C CB  B ARG A 1 165 ? 54.744  1.643   20.194  0.50 62.72  ? 165  ARG A CB  1 
ATOM   1275 C CG  A ARG A 1 165 ? 55.067  0.931   21.175  0.50 65.49  ? 165  ARG A CG  1 
ATOM   1276 C CG  B ARG A 1 165 ? 54.230  1.317   21.617  0.50 63.34  ? 165  ARG A CG  1 
ATOM   1277 C CD  A ARG A 1 165 ? 56.227  1.044   22.183  0.50 68.24  ? 165  ARG A CD  1 
ATOM   1278 C CD  B ARG A 1 165 ? 54.060  -0.194  21.871  0.50 66.58  ? 165  ARG A CD  1 
ATOM   1279 N NE  A ARG A 1 165 ? 55.930  2.056   23.199  0.50 68.50  ? 165  ARG A NE  1 
ATOM   1280 N NE  B ARG A 1 165 ? 52.822  -0.760  21.331  0.50 65.45  ? 165  ARG A NE  1 
ATOM   1281 C CZ  A ARG A 1 165 ? 56.600  3.193   23.353  0.50 68.54  ? 165  ARG A CZ  1 
ATOM   1282 C CZ  B ARG A 1 165 ? 52.577  -2.065  21.274  0.50 66.33  ? 165  ARG A CZ  1 
ATOM   1283 N NH1 A ARG A 1 165 ? 57.636  3.469   22.570  0.50 69.32  ? 165  ARG A NH1 1 
ATOM   1284 N NH1 B ARG A 1 165 ? 53.490  -2.924  21.713  0.50 68.25  ? 165  ARG A NH1 1 
ATOM   1285 N NH2 A ARG A 1 165 ? 56.238  4.048   24.301  0.50 67.14  ? 165  ARG A NH2 1 
ATOM   1286 N NH2 B ARG A 1 165 ? 51.435  -2.514  20.776  0.50 64.15  ? 165  ARG A NH2 1 
ATOM   1287 N N   . GLU A 1 166 ? 53.950  4.715   19.354  1.00 58.96  ? 166  GLU A N   1 
ATOM   1288 C CA  . GLU A 1 166 ? 53.772  6.065   19.862  1.00 57.78  ? 166  GLU A CA  1 
ATOM   1289 C C   . GLU A 1 166 ? 52.535  6.821   19.340  1.00 55.40  ? 166  GLU A C   1 
ATOM   1290 O O   . GLU A 1 166 ? 52.077  7.787   19.966  1.00 54.77  ? 166  GLU A O   1 
ATOM   1291 C CB  . GLU A 1 166 ? 55.041  6.873   19.600  1.00 59.55  ? 166  GLU A CB  1 
ATOM   1292 C CG  . GLU A 1 166 ? 56.341  6.261   20.165  1.00 64.32  ? 166  GLU A CG  1 
ATOM   1293 C CD  . GLU A 1 166 ? 57.090  5.303   19.193  1.00 69.48  ? 166  GLU A CD  1 
ATOM   1294 O OE1 . GLU A 1 166 ? 56.597  4.966   18.080  1.00 68.90  ? 166  GLU A OE1 1 
ATOM   1295 O OE2 . GLU A 1 166 ? 58.201  4.872   19.575  1.00 72.80  ? 166  GLU A OE2 1 
ATOM   1296 N N   . ALA A 1 167 ? 52.003  6.401   18.199  1.00 53.93  ? 167  ALA A N   1 
ATOM   1297 C CA  . ALA A 1 167 ? 50.778  6.987   17.655  1.00 51.53  ? 167  ALA A CA  1 
ATOM   1298 C C   . ALA A 1 167 ? 49.949  5.946   16.888  1.00 50.42  ? 167  ALA A C   1 
ATOM   1299 O O   . ALA A 1 167 ? 49.859  5.994   15.658  1.00 50.19  ? 167  ALA A O   1 
ATOM   1300 C CB  . ALA A 1 167 ? 51.102  8.201   16.773  1.00 51.09  ? 167  ALA A CB  1 
ATOM   1301 N N   . PRO A 1 168 ? 49.339  5.002   17.621  1.00 49.67  ? 168  PRO A N   1 
ATOM   1302 C CA  . PRO A 1 168 ? 48.654  3.888   16.959  1.00 49.48  ? 168  PRO A CA  1 
ATOM   1303 C C   . PRO A 1 168 ? 47.370  4.284   16.245  1.00 48.27  ? 168  PRO A C   1 
ATOM   1304 O O   . PRO A 1 168 ? 46.911  3.539   15.379  1.00 49.01  ? 168  PRO A O   1 
ATOM   1305 C CB  . PRO A 1 168 ? 48.334  2.925   18.111  1.00 49.52  ? 168  PRO A CB  1 
ATOM   1306 C CG  . PRO A 1 168 ? 48.349  3.793   19.368  1.00 48.90  ? 168  PRO A CG  1 
ATOM   1307 C CD  . PRO A 1 168 ? 49.364  4.860   19.094  1.00 49.50  ? 168  PRO A CD  1 
ATOM   1308 N N   . GLY A 1 169 ? 46.784  5.427   16.601  1.00 46.95  ? 169  GLY A N   1 
ATOM   1309 C CA  . GLY A 1 169 ? 45.506  5.846   16.018  1.00 45.11  ? 169  GLY A CA  1 
ATOM   1310 C C   . GLY A 1 169 ? 44.292  5.309   16.759  1.00 44.01  ? 169  GLY A C   1 
ATOM   1311 O O   . GLY A 1 169 ? 44.404  4.410   17.589  1.00 44.41  ? 169  GLY A O   1 
ATOM   1312 N N   . ASN A 1 170 ? 43.132  5.886   16.455  1.00 43.10  ? 170  ASN A N   1 
ATOM   1313 C CA  . ASN A 1 170 ? 41.839  5.546   17.083  1.00 41.94  ? 170  ASN A CA  1 
ATOM   1314 C C   . ASN A 1 170 ? 41.789  5.738   18.599  1.00 41.30  ? 170  ASN A C   1 
ATOM   1315 O O   . ASN A 1 170 ? 40.961  5.138   19.249  1.00 41.80  ? 170  ASN A O   1 
ATOM   1316 C CB  . ASN A 1 170 ? 41.406  4.107   16.746  1.00 42.11  ? 170  ASN A CB  1 
ATOM   1317 C CG  . ASN A 1 170 ? 41.205  3.868   15.249  1.00 42.66  ? 170  ASN A CG  1 
ATOM   1318 O OD1 . ASN A 1 170 ? 40.681  4.713   14.519  1.00 41.37  ? 170  ASN A OD1 1 
ATOM   1319 N ND2 . ASN A 1 170 ? 41.609  2.690   14.795  1.00 43.09  ? 170  ASN A ND2 1 
ATOM   1320 N N   . VAL A 1 171 ? 42.667  6.551   19.175  1.00 41.06  ? 171  VAL A N   1 
ATOM   1321 C CA  . VAL A 1 171 ? 42.714  6.643   20.640  1.00 39.95  ? 171  VAL A CA  1 
ATOM   1322 C C   . VAL A 1 171 ? 41.516  7.371   21.206  1.00 39.01  ? 171  VAL A C   1 
ATOM   1323 O O   . VAL A 1 171 ? 41.143  7.156   22.365  1.00 39.05  ? 171  VAL A O   1 
ATOM   1324 C CB  . VAL A 1 171 ? 44.042  7.195   21.189  1.00 40.53  ? 171  VAL A CB  1 
ATOM   1325 C CG1 . VAL A 1 171 ? 45.183  6.327   20.703  1.00 41.24  ? 171  VAL A CG1 1 
ATOM   1326 C CG2 . VAL A 1 171 ? 44.257  8.684   20.826  1.00 38.72  ? 171  VAL A CG2 1 
ATOM   1327 N N   . GLY A 1 172 ? 40.892  8.216   20.395  1.00 37.88  ? 172  GLY A N   1 
ATOM   1328 C CA  . GLY A 1 172 ? 39.636  8.846   20.825  1.00 37.05  ? 172  GLY A CA  1 
ATOM   1329 C C   . GLY A 1 172 ? 38.519  7.828   20.972  1.00 36.66  ? 172  GLY A C   1 
ATOM   1330 O O   . GLY A 1 172 ? 37.648  7.958   21.839  1.00 35.77  ? 172  GLY A O   1 
ATOM   1331 N N   . LEU A 1 173 ? 38.554  6.810   20.114  1.00 37.37  ? 173  LEU A N   1 
ATOM   1332 C CA  . LEU A 1 173 ? 37.602  5.712   20.181  1.00 38.04  ? 173  LEU A CA  1 
ATOM   1333 C C   . LEU A 1 173 ? 37.858  4.878   21.423  1.00 38.89  ? 173  LEU A C   1 
ATOM   1334 O O   . LEU A 1 173 ? 36.913  4.419   22.070  1.00 38.94  ? 173  LEU A O   1 
ATOM   1335 C CB  . LEU A 1 173 ? 37.673  4.843   18.931  1.00 38.38  ? 173  LEU A CB  1 
ATOM   1336 C CG  . LEU A 1 173 ? 36.993  5.464   17.705  1.00 38.75  ? 173  LEU A CG  1 
ATOM   1337 C CD1 . LEU A 1 173 ? 37.259  4.563   16.524  1.00 37.97  ? 173  LEU A CD1 1 
ATOM   1338 C CD2 . LEU A 1 173 ? 35.457  5.691   17.906  1.00 34.45  ? 173  LEU A CD2 1 
ATOM   1339 N N   . LEU A 1 174 ? 39.142  4.714   21.745  1.00 39.04  ? 174  LEU A N   1 
ATOM   1340 C CA  . LEU A 1 174 ? 39.584  4.022   22.924  1.00 39.44  ? 174  LEU A CA  1 
ATOM   1341 C C   . LEU A 1 174 ? 39.193  4.780   24.208  1.00 39.47  ? 174  LEU A C   1 
ATOM   1342 O O   . LEU A 1 174 ? 38.790  4.147   25.196  1.00 39.64  ? 174  LEU A O   1 
ATOM   1343 C CB  . LEU A 1 174 ? 41.094  3.764   22.855  1.00 39.79  ? 174  LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 174 ? 41.634  2.694   21.872  1.00 40.38  ? 174  LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 174 ? 43.139  2.518   22.020  1.00 36.54  ? 174  LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 174 ? 40.973  1.335   22.050  1.00 38.33  ? 174  LEU A CD2 1 
ATOM   1347 N N   . ASP A 1 175 ? 39.301  6.116   24.201  1.00 38.91  ? 175  ASP A N   1 
ATOM   1348 C CA  . ASP A 1 175 ? 38.723  6.942   25.289  1.00 38.92  ? 175  ASP A CA  1 
ATOM   1349 C C   . ASP A 1 175 ? 37.251  6.558   25.508  1.00 38.22  ? 175  ASP A C   1 
ATOM   1350 O O   . ASP A 1 175 ? 36.825  6.358   26.641  1.00 38.66  ? 175  ASP A O   1 
ATOM   1351 C CB  . ASP A 1 175 ? 38.832  8.462   25.023  1.00 38.05  ? 175  ASP A CB  1 
ATOM   1352 C CG  . ASP A 1 175 ? 40.281  8.932   24.795  1.00 41.37  ? 175  ASP A CG  1 
ATOM   1353 O OD1 . ASP A 1 175 ? 41.240  8.190   25.151  1.00 42.25  ? 175  ASP A OD1 1 
ATOM   1354 O OD2 . ASP A 1 175 ? 40.468  10.056  24.259  1.00 41.11  ? 175  ASP A OD2 1 
ATOM   1355 N N   . GLN A 1 176 ? 36.484  6.424   24.431  1.00 37.71  ? 176  GLN A N   1 
ATOM   1356 C CA  . GLN A 1 176 ? 35.064  6.109   24.561  1.00 37.85  ? 176  GLN A CA  1 
ATOM   1357 C C   . GLN A 1 176 ? 34.865  4.725   25.155  1.00 38.87  ? 176  GLN A C   1 
ATOM   1358 O O   . GLN A 1 176 ? 33.977  4.516   25.996  1.00 39.01  ? 176  GLN A O   1 
ATOM   1359 C CB  . GLN A 1 176 ? 34.343  6.188   23.217  1.00 37.68  ? 176  GLN A CB  1 
ATOM   1360 C CG  . GLN A 1 176 ? 34.327  7.567   22.546  1.00 36.92  ? 176  GLN A CG  1 
ATOM   1361 C CD  . GLN A 1 176 ? 33.786  7.485   21.124  1.00 38.54  ? 176  GLN A CD  1 
ATOM   1362 O OE1 . GLN A 1 176 ? 33.240  6.445   20.713  1.00 39.28  ? 176  GLN A OE1 1 
ATOM   1363 N NE2 . GLN A 1 176 ? 33.949  8.568   20.351  1.00 37.29  ? 176  GLN A NE2 1 
ATOM   1364 N N   . ARG A 1 177 ? 35.693  3.779   24.714  1.00 39.79  ? 177  ARG A N   1 
ATOM   1365 C CA  . ARG A 1 177 ? 35.626  2.410   25.225  1.00 40.57  ? 177  ARG A CA  1 
ATOM   1366 C C   . ARG A 1 177 ? 35.916  2.372   26.716  1.00 40.66  ? 177  ARG A C   1 
ATOM   1367 O O   . ARG A 1 177 ? 35.220  1.679   27.453  1.00 41.43  ? 177  ARG A O   1 
ATOM   1368 C CB  . ARG A 1 177 ? 36.592  1.489   24.493  1.00 41.83  ? 177  ARG A CB  1 
ATOM   1369 C CG  . ARG A 1 177 ? 36.481  0.032   24.913  1.00 42.50  ? 177  ARG A CG  1 
ATOM   1370 C CD  . ARG A 1 177 ? 37.410  -0.797  24.097  1.00 45.33  ? 177  ARG A CD  1 
ATOM   1371 N NE  . ARG A 1 177 ? 36.829  -1.162  22.800  1.00 47.35  ? 177  ARG A NE  1 
ATOM   1372 C CZ  . ARG A 1 177 ? 37.535  -1.634  21.771  1.00 48.01  ? 177  ARG A CZ  1 
ATOM   1373 N NH1 . ARG A 1 177 ? 38.861  -1.773  21.874  1.00 47.43  ? 177  ARG A NH1 1 
ATOM   1374 N NH2 . ARG A 1 177 ? 36.917  -1.954  20.634  1.00 46.34  ? 177  ARG A NH2 1 
ATOM   1375 N N   . LEU A 1 178 ? 36.923  3.128   27.150  1.00 39.98  ? 178  LEU A N   1 
ATOM   1376 C CA  . LEU A 1 178 ? 37.291  3.186   28.551  1.00 40.46  ? 178  LEU A CA  1 
ATOM   1377 C C   . LEU A 1 178 ? 36.122  3.697   29.382  1.00 40.62  ? 178  LEU A C   1 
ATOM   1378 O O   . LEU A 1 178 ? 35.828  3.145   30.438  1.00 41.11  ? 178  LEU A O   1 
ATOM   1379 C CB  . LEU A 1 178 ? 38.530  4.055   28.754  1.00 40.09  ? 178  LEU A CB  1 
ATOM   1380 C CG  . LEU A 1 178 ? 39.103  4.135   30.168  1.00 41.21  ? 178  LEU A CG  1 
ATOM   1381 C CD1 . LEU A 1 178 ? 39.406  2.755   30.736  1.00 43.03  ? 178  LEU A CD1 1 
ATOM   1382 C CD2 . LEU A 1 178 ? 40.359  4.995   30.208  1.00 41.00  ? 178  LEU A CD2 1 
ATOM   1383 N N   . ALA A 1 179 ? 35.427  4.723   28.875  1.00 40.46  ? 179  ALA A N   1 
ATOM   1384 C CA  . ALA A 1 179 ? 34.242  5.256   29.542  1.00 40.26  ? 179  ALA A CA  1 
ATOM   1385 C C   . ALA A 1 179 ? 33.129  4.224   29.559  1.00 40.86  ? 179  ALA A C   1 
ATOM   1386 O O   . ALA A 1 179 ? 32.334  4.195   30.496  1.00 42.19  ? 179  ALA A O   1 
ATOM   1387 C CB  . ALA A 1 179 ? 33.772  6.542   28.887  1.00 39.11  ? 179  ALA A CB  1 
ATOM   1388 N N   . LEU A 1 180 ? 33.062  3.372   28.542  1.00 40.86  ? 180  LEU A N   1 
ATOM   1389 C CA  . LEU A 1 180 ? 32.090  2.299   28.571  1.00 41.46  ? 180  LEU A CA  1 
ATOM   1390 C C   . LEU A 1 180 ? 32.467  1.254   29.636  1.00 42.88  ? 180  LEU A C   1 
ATOM   1391 O O   . LEU A 1 180 ? 31.597  0.801   30.398  1.00 43.11  ? 180  LEU A O   1 
ATOM   1392 C CB  . LEU A 1 180 ? 31.897  1.671   27.191  1.00 41.56  ? 180  LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 180 ? 31.449  2.526   25.999  1.00 40.77  ? 180  LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 180 ? 30.782  1.643   24.981  1.00 39.84  ? 180  LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 180 ? 30.501  3.667   26.383  1.00 39.81  ? 180  LEU A CD2 1 
ATOM   1396 N N   . GLN A 1 181 ? 33.748  0.894   29.708  1.00 43.11  ? 181  GLN A N   1 
ATOM   1397 C CA  . GLN A 1 181 ? 34.209  -0.015  30.749  1.00 45.13  ? 181  GLN A CA  1 
ATOM   1398 C C   . GLN A 1 181 ? 33.882  0.511   32.163  1.00 45.08  ? 181  GLN A C   1 
ATOM   1399 O O   . GLN A 1 181 ? 33.393  -0.238  33.026  1.00 45.46  ? 181  GLN A O   1 
ATOM   1400 C CB  . GLN A 1 181 ? 35.697  -0.330  30.582  1.00 46.06  ? 181  GLN A CB  1 
ATOM   1401 C CG  . GLN A 1 181 ? 35.956  -1.178  29.328  1.00 50.00  ? 181  GLN A CG  1 
ATOM   1402 C CD  . GLN A 1 181 ? 37.421  -1.352  28.954  1.00 52.28  ? 181  GLN A CD  1 
ATOM   1403 O OE1 . GLN A 1 181 ? 38.260  -0.512  29.250  1.00 54.03  ? 181  GLN A OE1 1 
ATOM   1404 N NE2 . GLN A 1 181 ? 37.724  -2.450  28.277  1.00 54.11  ? 181  GLN A NE2 1 
ATOM   1405 N N   . TRP A 1 182 ? 34.129  1.809   32.364  1.00 44.08  ? 182  TRP A N   1 
ATOM   1406 C CA  . TRP A 1 182 ? 33.761  2.526   33.579  1.00 43.29  ? 182  TRP A CA  1 
ATOM   1407 C C   . TRP A 1 182 ? 32.283  2.411   33.934  1.00 43.09  ? 182  TRP A C   1 
ATOM   1408 O O   . TRP A 1 182 ? 31.946  2.271   35.106  1.00 43.65  ? 182  TRP A O   1 
ATOM   1409 C CB  . TRP A 1 182 ? 34.134  4.005   33.466  1.00 42.28  ? 182  TRP A CB  1 
ATOM   1410 C CG  . TRP A 1 182 ? 33.963  4.769   34.753  1.00 41.66  ? 182  TRP A CG  1 
ATOM   1411 C CD1 . TRP A 1 182 ? 34.934  5.062   35.661  1.00 41.24  ? 182  TRP A CD1 1 
ATOM   1412 C CD2 . TRP A 1 182 ? 32.750  5.323   35.271  1.00 40.04  ? 182  TRP A CD2 1 
ATOM   1413 N NE1 . TRP A 1 182 ? 34.410  5.776   36.701  1.00 40.94  ? 182  TRP A NE1 1 
ATOM   1414 C CE2 . TRP A 1 182 ? 33.069  5.953   36.488  1.00 40.87  ? 182  TRP A CE2 1 
ATOM   1415 C CE3 . TRP A 1 182 ? 31.426  5.359   34.819  1.00 39.49  ? 182  TRP A CE3 1 
ATOM   1416 C CZ2 . TRP A 1 182 ? 32.106  6.609   37.274  1.00 41.94  ? 182  TRP A CZ2 1 
ATOM   1417 C CZ3 . TRP A 1 182 ? 30.470  6.025   35.588  1.00 40.40  ? 182  TRP A CZ3 1 
ATOM   1418 C CH2 . TRP A 1 182 ? 30.816  6.627   36.811  1.00 41.45  ? 182  TRP A CH2 1 
ATOM   1419 N N   . VAL A 1 183 ? 31.398  2.494   32.946  1.00 42.10  ? 183  VAL A N   1 
ATOM   1420 C CA  . VAL A 1 183 ? 29.975  2.322   33.238  1.00 41.97  ? 183  VAL A CA  1 
ATOM   1421 C C   . VAL A 1 183 ? 29.711  0.867   33.713  1.00 43.36  ? 183  VAL A C   1 
ATOM   1422 O O   . VAL A 1 183 ? 28.952  0.648   34.655  1.00 44.33  ? 183  VAL A O   1 
ATOM   1423 C CB  . VAL A 1 183 ? 29.080  2.724   32.035  1.00 41.37  ? 183  VAL A CB  1 
ATOM   1424 C CG1 . VAL A 1 183 ? 27.655  2.154   32.160  1.00 40.74  ? 183  VAL A CG1 1 
ATOM   1425 C CG2 . VAL A 1 183 ? 29.056  4.239   31.842  1.00 39.79  ? 183  VAL A CG2 1 
ATOM   1426 N N   . GLN A 1 184 ? 30.363  -0.115  33.106  1.00 43.44  ? 184  GLN A N   1 
ATOM   1427 C CA  . GLN A 1 184 ? 30.192  -1.505  33.552  1.00 45.22  ? 184  GLN A CA  1 
ATOM   1428 C C   . GLN A 1 184 ? 30.579  -1.696  35.017  1.00 45.85  ? 184  GLN A C   1 
ATOM   1429 O O   . GLN A 1 184 ? 29.888  -2.391  35.767  1.00 46.18  ? 184  GLN A O   1 
ATOM   1430 C CB  . GLN A 1 184 ? 30.981  -2.499  32.678  1.00 45.48  ? 184  GLN A CB  1 
ATOM   1431 C CG  . GLN A 1 184 ? 30.412  -2.694  31.295  1.00 45.59  ? 184  GLN A CG  1 
ATOM   1432 C CD  . GLN A 1 184 ? 28.981  -3.230  31.287  1.00 46.31  ? 184  GLN A CD  1 
ATOM   1433 O OE1 . GLN A 1 184 ? 28.043  -2.499  30.936  1.00 42.76  ? 184  GLN A OE1 1 
ATOM   1434 N NE2 . GLN A 1 184 ? 28.807  -4.511  31.658  1.00 46.68  ? 184  GLN A NE2 1 
ATOM   1435 N N   . GLU A 1 185 ? 31.681  -1.083  35.429  1.00 45.61  ? 185  GLU A N   1 
ATOM   1436 C CA  . GLU A 1 185 ? 32.144  -1.338  36.775  1.00 46.86  ? 185  GLU A CA  1 
ATOM   1437 C C   . GLU A 1 185 ? 31.352  -0.537  37.779  1.00 45.91  ? 185  GLU A C   1 
ATOM   1438 O O   . GLU A 1 185 ? 31.060  -1.030  38.858  1.00 46.87  ? 185  GLU A O   1 
ATOM   1439 C CB  . GLU A 1 185 ? 33.638  -1.086  36.957  1.00 47.19  ? 185  GLU A CB  1 
ATOM   1440 C CG  . GLU A 1 185 ? 34.128  -1.647  38.282  1.00 51.86  ? 185  GLU A CG  1 
ATOM   1441 C CD  . GLU A 1 185 ? 35.634  -1.624  38.473  1.00 56.36  ? 185  GLU A CD  1 
ATOM   1442 O OE1 . GLU A 1 185 ? 36.372  -1.132  37.581  1.00 57.90  ? 185  GLU A OE1 1 
ATOM   1443 O OE2 . GLU A 1 185 ? 36.076  -2.110  39.536  1.00 58.12  ? 185  GLU A OE2 1 
ATOM   1444 N N   . ASN A 1 186 ? 30.986  0.684   37.414  1.00 44.00  ? 186  ASN A N   1 
ATOM   1445 C CA  . ASN A 1 186 ? 30.541  1.648   38.412  1.00 43.06  ? 186  ASN A CA  1 
ATOM   1446 C C   . ASN A 1 186 ? 29.083  2.068   38.412  1.00 42.65  ? 186  ASN A C   1 
ATOM   1447 O O   . ASN A 1 186 ? 28.610  2.504   39.446  1.00 43.09  ? 186  ASN A O   1 
ATOM   1448 C CB  . ASN A 1 186 ? 31.436  2.880   38.382  1.00 41.91  ? 186  ASN A CB  1 
ATOM   1449 C CG  . ASN A 1 186 ? 32.896  2.534   38.593  1.00 42.72  ? 186  ASN A CG  1 
ATOM   1450 O OD1 . ASN A 1 186 ? 33.330  2.230   39.726  1.00 43.91  ? 186  ASN A OD1 1 
ATOM   1451 N ND2 . ASN A 1 186 ? 33.674  2.587   37.508  1.00 40.81  ? 186  ASN A ND2 1 
ATOM   1452 N N   . ILE A 1 187 ? 28.373  1.941   37.283  1.00 42.05  ? 187  ILE A N   1 
ATOM   1453 C CA  . ILE A 1 187 ? 27.033  2.528   37.161  1.00 41.54  ? 187  ILE A CA  1 
ATOM   1454 C C   . ILE A 1 187 ? 26.009  1.989   38.178  1.00 43.09  ? 187  ILE A C   1 
ATOM   1455 O O   . ILE A 1 187 ? 25.052  2.685   38.524  1.00 43.35  ? 187  ILE A O   1 
ATOM   1456 C CB  . ILE A 1 187 ? 26.473  2.506   35.699  1.00 40.54  ? 187  ILE A CB  1 
ATOM   1457 C CG1 . ILE A 1 187 ? 25.512  3.671   35.485  1.00 39.59  ? 187  ILE A CG1 1 
ATOM   1458 C CG2 . ILE A 1 187 ? 25.793  1.182   35.340  1.00 41.20  ? 187  ILE A CG2 1 
ATOM   1459 C CD1 . ILE A 1 187 ? 26.198  5.065   35.509  1.00 38.71  ? 187  ILE A CD1 1 
ATOM   1460 N N   . ALA A 1 188 ? 26.221  0.770   38.671  1.00 44.02  ? 188  ALA A N   1 
ATOM   1461 C CA  . ALA A 1 188 ? 25.344  0.218   39.693  1.00 45.15  ? 188  ALA A CA  1 
ATOM   1462 C C   . ALA A 1 188 ? 25.368  1.046   40.982  1.00 45.62  ? 188  ALA A C   1 
ATOM   1463 O O   . ALA A 1 188 ? 24.363  1.083   41.698  1.00 47.02  ? 188  ALA A O   1 
ATOM   1464 C CB  . ALA A 1 188 ? 25.666  -1.242  39.969  1.00 46.22  ? 188  ALA A CB  1 
ATOM   1465 N N   . ALA A 1 189 ? 26.484  1.722   41.266  1.00 44.76  ? 189  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 189 ? 26.567  2.659   42.391  1.00 44.85  ? 189  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 189 ? 25.541  3.791   42.294  1.00 44.94  ? 189  ALA A C   1 
ATOM   1468 O O   . ALA A 1 189 ? 25.198  4.398   43.306  1.00 46.11  ? 189  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 189 ? 27.982  3.239   42.525  1.00 43.48  ? 189  ALA A CB  1 
ATOM   1470 N N   . PHE A 1 190 ? 25.071  4.086   41.087  1.00 44.18  ? 190  PHE A N   1 
ATOM   1471 C CA  . PHE A 1 190 ? 24.179  5.221   40.863  1.00 44.30  ? 190  PHE A CA  1 
ATOM   1472 C C   . PHE A 1 190 ? 22.770  4.704   40.627  1.00 45.36  ? 190  PHE A C   1 
ATOM   1473 O O   . PHE A 1 190 ? 21.832  5.487   40.450  1.00 45.49  ? 190  PHE A O   1 
ATOM   1474 C CB  . PHE A 1 190 ? 24.622  6.078   39.660  1.00 42.73  ? 190  PHE A CB  1 
ATOM   1475 C CG  . PHE A 1 190 ? 26.009  6.669   39.792  1.00 42.26  ? 190  PHE A CG  1 
ATOM   1476 C CD1 . PHE A 1 190 ? 27.144  5.910   39.489  1.00 42.99  ? 190  PHE A CD1 1 
ATOM   1477 C CD2 . PHE A 1 190 ? 26.185  7.982   40.208  1.00 40.52  ? 190  PHE A CD2 1 
ATOM   1478 C CE1 . PHE A 1 190 ? 28.438  6.459   39.598  1.00 41.05  ? 190  PHE A CE1 1 
ATOM   1479 C CE2 . PHE A 1 190 ? 27.454  8.536   40.325  1.00 40.69  ? 190  PHE A CE2 1 
ATOM   1480 C CZ  . PHE A 1 190 ? 28.588  7.773   40.008  1.00 41.42  ? 190  PHE A CZ  1 
ATOM   1481 N N   . GLY A 1 191 ? 22.620  3.380   40.639  1.00 46.33  ? 191  GLY A N   1 
ATOM   1482 C CA  . GLY A 1 191 ? 21.329  2.747   40.373  1.00 46.60  ? 191  GLY A CA  1 
ATOM   1483 C C   . GLY A 1 191 ? 21.131  2.396   38.913  1.00 46.47  ? 191  GLY A C   1 
ATOM   1484 O O   . GLY A 1 191 ? 20.041  1.996   38.519  1.00 47.38  ? 191  GLY A O   1 
ATOM   1485 N N   . GLY A 1 192 ? 22.173  2.556   38.095  1.00 45.28  ? 192  GLY A N   1 
ATOM   1486 C CA  . GLY A 1 192 ? 22.108  2.116   36.703  1.00 45.00  ? 192  GLY A CA  1 
ATOM   1487 C C   . GLY A 1 192 ? 22.240  0.608   36.574  1.00 46.32  ? 192  GLY A C   1 
ATOM   1488 O O   . GLY A 1 192 ? 22.805  -0.046  37.456  1.00 47.28  ? 192  GLY A O   1 
ATOM   1489 N N   . ASP A 1 193 ? 21.708  0.060   35.482  1.00 46.56  ? 193  ASP A N   1 
ATOM   1490 C CA  . ASP A 1 193 ? 21.747  -1.373  35.205  1.00 47.58  ? 193  ASP A CA  1 
ATOM   1491 C C   . ASP A 1 193 ? 22.812  -1.645  34.167  1.00 47.37  ? 193  ASP A C   1 
ATOM   1492 O O   . ASP A 1 193 ? 22.635  -1.343  32.978  1.00 46.22  ? 193  ASP A O   1 
ATOM   1493 C CB  . ASP A 1 193 ? 20.390  -1.856  34.681  1.00 48.60  ? 193  ASP A CB  1 
ATOM   1494 C CG  . ASP A 1 193 ? 20.305  -3.389  34.515  1.00 49.88  ? 193  ASP A CG  1 
ATOM   1495 O OD1 . ASP A 1 193 ? 21.328  -4.108  34.650  1.00 49.32  ? 193  ASP A OD1 1 
ATOM   1496 O OD2 . ASP A 1 193 ? 19.181  -3.869  34.242  1.00 50.82  ? 193  ASP A OD2 1 
ATOM   1497 N N   . PRO A 1 194 ? 23.924  -2.247  34.599  1.00 48.16  ? 194  PRO A N   1 
ATOM   1498 C CA  . PRO A 1 194 ? 25.019  -2.454  33.654  1.00 48.05  ? 194  PRO A CA  1 
ATOM   1499 C C   . PRO A 1 194 ? 24.662  -3.495  32.594  1.00 49.04  ? 194  PRO A C   1 
ATOM   1500 O O   . PRO A 1 194 ? 25.365  -3.615  31.600  1.00 48.45  ? 194  PRO A O   1 
ATOM   1501 C CB  . PRO A 1 194 ? 26.159  -2.942  34.549  1.00 48.69  ? 194  PRO A CB  1 
ATOM   1502 C CG  . PRO A 1 194 ? 25.474  -3.558  35.704  1.00 49.15  ? 194  PRO A CG  1 
ATOM   1503 C CD  . PRO A 1 194 ? 24.231  -2.777  35.935  1.00 48.54  ? 194  PRO A CD  1 
ATOM   1504 N N   . MET A 1 195 ? 23.569  -4.220  32.801  1.00 50.64  ? 195  MET A N   1 
ATOM   1505 C CA  . MET A 1 195 ? 23.148  -5.257  31.861  1.00 52.48  ? 195  MET A CA  1 
ATOM   1506 C C   . MET A 1 195 ? 22.129  -4.737  30.842  1.00 51.42  ? 195  MET A C   1 
ATOM   1507 O O   . MET A 1 195 ? 21.589  -5.498  30.035  1.00 52.53  ? 195  MET A O   1 
ATOM   1508 C CB  . MET A 1 195 ? 22.600  -6.480  32.602  1.00 54.60  ? 195  MET A CB  1 
ATOM   1509 C CG  . MET A 1 195 ? 23.559  -7.049  33.631  1.00 59.18  ? 195  MET A CG  1 
ATOM   1510 S SD  . MET A 1 195 ? 23.327  -8.821  33.930  1.00 69.96  ? 195  MET A SD  1 
ATOM   1511 C CE  . MET A 1 195 ? 24.055  -9.424  32.380  1.00 69.11  ? 195  MET A CE  1 
ATOM   1512 N N   . SER A 1 196 ? 21.872  -3.437  30.882  1.00 49.43  ? 196  SER A N   1 
ATOM   1513 C CA  . SER A 1 196 ? 21.000  -2.799  29.910  1.00 48.00  ? 196  SER A CA  1 
ATOM   1514 C C   . SER A 1 196 ? 21.526  -1.378  29.629  1.00 46.11  ? 196  SER A C   1 
ATOM   1515 O O   . SER A 1 196 ? 21.045  -0.379  30.190  1.00 45.50  ? 196  SER A O   1 
ATOM   1516 C CB  . SER A 1 196 ? 19.543  -2.823  30.386  1.00 48.70  ? 196  SER A CB  1 
ATOM   1517 O OG  . SER A 1 196 ? 18.700  -2.077  29.527  1.00 47.88  ? 196  SER A OG  1 
ATOM   1518 N N   . VAL A 1 197 ? 22.530  -1.335  28.752  1.00 44.80  ? 197  VAL A N   1 
ATOM   1519 C CA  . VAL A 1 197 ? 23.224  -0.121  28.343  1.00 42.83  ? 197  VAL A CA  1 
ATOM   1520 C C   . VAL A 1 197 ? 22.982  0.088   26.857  1.00 42.24  ? 197  VAL A C   1 
ATOM   1521 O O   . VAL A 1 197 ? 23.272  -0.812  26.042  1.00 43.16  ? 197  VAL A O   1 
ATOM   1522 C CB  . VAL A 1 197 ? 24.784  -0.246  28.566  1.00 42.82  ? 197  VAL A CB  1 
ATOM   1523 C CG1 . VAL A 1 197 ? 25.526  0.856   27.824  1.00 40.33  ? 197  VAL A CG1 1 
ATOM   1524 C CG2 . VAL A 1 197 ? 25.159  -0.267  30.052  1.00 40.98  ? 197  VAL A CG2 1 
ATOM   1525 N N   . THR A 1 198 ? 22.459  1.269   26.519  1.00 40.82  ? 198  THR A N   1 
ATOM   1526 C CA  . THR A 1 198 ? 22.166  1.694   25.149  1.00 39.77  ? 198  THR A CA  1 
ATOM   1527 C C   . THR A 1 198 ? 23.064  2.893   24.771  1.00 38.81  ? 198  THR A C   1 
ATOM   1528 O O   . THR A 1 198 ? 23.052  3.938   25.449  1.00 37.74  ? 198  THR A O   1 
ATOM   1529 C CB  . THR A 1 198 ? 20.654  2.085   25.007  1.00 40.05  ? 198  THR A CB  1 
ATOM   1530 O OG1 . THR A 1 198 ? 19.850  0.947   25.287  1.00 40.76  ? 198  THR A OG1 1 
ATOM   1531 C CG2 . THR A 1 198 ? 20.294  2.580   23.608  1.00 38.25  ? 198  THR A CG2 1 
ATOM   1532 N N   . LEU A 1 199 ? 23.855  2.721   23.712  1.00 38.79  ? 199  LEU A N   1 
ATOM   1533 C CA  . LEU A 1 199 ? 24.699  3.792   23.193  1.00 38.88  ? 199  LEU A CA  1 
ATOM   1534 C C   . LEU A 1 199 ? 23.854  4.601   22.237  1.00 38.92  ? 199  LEU A C   1 
ATOM   1535 O O   . LEU A 1 199 ? 23.107  4.023   21.448  1.00 40.15  ? 199  LEU A O   1 
ATOM   1536 C CB  . LEU A 1 199 ? 25.889  3.240   22.419  1.00 38.50  ? 199  LEU A CB  1 
ATOM   1537 C CG  . LEU A 1 199 ? 26.823  2.211   23.050  1.00 40.61  ? 199  LEU A CG  1 
ATOM   1538 C CD1 . LEU A 1 199 ? 27.967  1.885   22.103  1.00 37.43  ? 199  LEU A CD1 1 
ATOM   1539 C CD2 . LEU A 1 199 ? 27.390  2.679   24.401  1.00 41.31  ? 199  LEU A CD2 1 
ATOM   1540 N N   . PHE A 1 200 ? 23.943  5.927   22.315  1.00 37.92  ? 200  PHE A N   1 
ATOM   1541 C CA  . PHE A 1 200 ? 23.369  6.765   21.267  1.00 37.54  ? 200  PHE A CA  1 
ATOM   1542 C C   . PHE A 1 200 ? 24.265  7.955   20.989  1.00 37.21  ? 200  PHE A C   1 
ATOM   1543 O O   . PHE A 1 200 ? 25.050  8.358   21.853  1.00 37.02  ? 200  PHE A O   1 
ATOM   1544 C CB  . PHE A 1 200 ? 21.870  7.109   21.496  1.00 37.64  ? 200  PHE A CB  1 
ATOM   1545 C CG  . PHE A 1 200 ? 21.578  8.163   22.563  1.00 35.88  ? 200  PHE A CG  1 
ATOM   1546 C CD1 . PHE A 1 200 ? 22.072  8.066   23.850  1.00 34.76  ? 200  PHE A CD1 1 
ATOM   1547 C CD2 . PHE A 1 200 ? 20.708  9.208   22.284  1.00 34.03  ? 200  PHE A CD2 1 
ATOM   1548 C CE1 . PHE A 1 200 ? 21.755  9.037   24.831  1.00 34.82  ? 200  PHE A CE1 1 
ATOM   1549 C CE2 . PHE A 1 200 ? 20.378  10.174  23.275  1.00 33.14  ? 200  PHE A CE2 1 
ATOM   1550 C CZ  . PHE A 1 200 ? 20.902  10.084  24.544  1.00 31.96  ? 200  PHE A CZ  1 
ATOM   1551 N N   . GLY A 1 201 ? 24.202  8.469   19.766  1.00 36.94  ? 201  GLY A N   1 
ATOM   1552 C CA  . GLY A 1 201 ? 25.038  9.587   19.379  1.00 36.64  ? 201  GLY A CA  1 
ATOM   1553 C C   . GLY A 1 201 ? 24.638  10.093  18.017  1.00 36.85  ? 201  GLY A C   1 
ATOM   1554 O O   . GLY A 1 201 ? 23.915  9.416   17.290  1.00 37.50  ? 201  GLY A O   1 
ATOM   1555 N N   . GLU A 1 202 ? 25.124  11.274  17.660  1.00 36.30  ? 202  GLU A N   1 
ATOM   1556 C CA  . GLU A 1 202 ? 24.720  11.888  16.429  1.00 36.48  ? 202  GLU A CA  1 
ATOM   1557 C C   . GLU A 1 202 ? 25.960  12.320  15.672  1.00 36.86  ? 202  GLU A C   1 
ATOM   1558 O O   . GLU A 1 202 ? 26.980  12.657  16.291  1.00 36.93  ? 202  GLU A O   1 
ATOM   1559 C CB  . GLU A 1 202 ? 23.782  13.050  16.732  1.00 36.30  ? 202  GLU A CB  1 
ATOM   1560 C CG  . GLU A 1 202 ? 23.232  13.801  15.515  1.00 36.83  ? 202  GLU A CG  1 
ATOM   1561 C CD  . GLU A 1 202 ? 24.142  14.928  15.066  1.00 37.08  ? 202  GLU A CD  1 
ATOM   1562 O OE1 . GLU A 1 202 ? 25.162  15.190  15.761  1.00 36.83  ? 202  GLU A OE1 1 
ATOM   1563 O OE2 . GLU A 1 202 ? 23.840  15.546  14.018  1.00 36.11  ? 202  GLU A OE2 1 
ATOM   1564 N N   . SER A 1 203 ? 25.876  12.298  14.334  1.00 37.16  ? 203  SER A N   1 
ATOM   1565 C CA  . SER A 1 203 ? 27.006  12.649  13.461  1.00 36.95  ? 203  SER A CA  1 
ATOM   1566 C C   . SER A 1 203 ? 28.217  11.720  13.745  1.00 36.62  ? 203  SER A C   1 
ATOM   1567 O O   . SER A 1 203 ? 28.079  10.504  13.671  1.00 37.23  ? 203  SER A O   1 
ATOM   1568 C CB  . SER A 1 203 ? 27.346  14.138  13.623  1.00 36.77  ? 203  SER A CB  1 
ATOM   1569 O OG  . SER A 1 203 ? 27.939  14.685  12.445  1.00 38.68  ? 203  SER A OG  1 
ATOM   1570 N N   . ALA A 1 204 ? 29.373  12.277  14.104  1.00 36.32  ? 204  ALA A N   1 
ATOM   1571 C CA  . ALA A 1 204 ? 30.553  11.477  14.485  1.00 36.36  ? 204  ALA A CA  1 
ATOM   1572 C C   . ALA A 1 204 ? 30.297  10.617  15.720  1.00 36.74  ? 204  ALA A C   1 
ATOM   1573 O O   . ALA A 1 204 ? 30.985  9.604   15.929  1.00 37.18  ? 204  ALA A O   1 
ATOM   1574 C CB  . ALA A 1 204 ? 31.752  12.368  14.727  1.00 35.82  ? 204  ALA A CB  1 
ATOM   1575 N N   . GLY A 1 205 ? 29.327  11.040  16.542  1.00 36.30  ? 205  GLY A N   1 
ATOM   1576 C CA  . GLY A 1 205 ? 28.893  10.272  17.692  1.00 36.14  ? 205  GLY A CA  1 
ATOM   1577 C C   . GLY A 1 205 ? 28.206  9.026   17.169  1.00 37.13  ? 205  GLY A C   1 
ATOM   1578 O O   . GLY A 1 205 ? 28.469  7.922   17.627  1.00 38.03  ? 205  GLY A O   1 
ATOM   1579 N N   . ALA A 1 206 ? 27.344  9.197   16.177  1.00 37.01  ? 206  ALA A N   1 
ATOM   1580 C CA  . ALA A 1 206 ? 26.669  8.065   15.580  1.00 37.78  ? 206  ALA A CA  1 
ATOM   1581 C C   . ALA A 1 206 ? 27.673  7.159   14.896  1.00 38.32  ? 206  ALA A C   1 
ATOM   1582 O O   . ALA A 1 206 ? 27.580  5.910   15.016  1.00 39.04  ? 206  ALA A O   1 
ATOM   1583 C CB  . ALA A 1 206 ? 25.558  8.509   14.609  1.00 37.84  ? 206  ALA A CB  1 
ATOM   1584 N N   . ALA A 1 207 ? 28.656  7.752   14.212  1.00 37.50  ? 207  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 207 ? 29.632  6.894   13.535  1.00 38.14  ? 207  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 207 ? 30.416  6.098   14.575  1.00 38.71  ? 207  ALA A C   1 
ATOM   1587 O O   . ALA A 1 207 ? 30.727  4.907   14.390  1.00 39.26  ? 207  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 207 ? 30.540  7.686   12.653  1.00 37.58  ? 207  ALA A CB  1 
ATOM   1589 N N   . SER A 1 208 ? 30.710  6.766   15.690  1.00 38.45  ? 208  SER A N   1 
ATOM   1590 C CA  . SER A 1 208 ? 31.415  6.131   16.793  1.00 38.64  ? 208  SER A CA  1 
ATOM   1591 C C   . SER A 1 208 ? 30.619  4.937   17.283  1.00 38.73  ? 208  SER A C   1 
ATOM   1592 O O   . SER A 1 208 ? 31.177  3.860   17.486  1.00 39.78  ? 208  SER A O   1 
ATOM   1593 C CB  . SER A 1 208 ? 31.645  7.135   17.932  1.00 38.57  ? 208  SER A CB  1 
ATOM   1594 O OG  . SER A 1 208 ? 32.627  8.108   17.577  1.00 38.46  ? 208  SER A OG  1 
ATOM   1595 N N   . VAL A 1 209 ? 29.313  5.126   17.454  1.00 38.03  ? 209  VAL A N   1 
ATOM   1596 C CA  . VAL A 1 209 ? 28.458  4.083   17.990  1.00 38.29  ? 209  VAL A CA  1 
ATOM   1597 C C   . VAL A 1 209 ? 28.600  2.880   17.063  1.00 39.74  ? 209  VAL A C   1 
ATOM   1598 O O   . VAL A 1 209 ? 28.830  1.750   17.530  1.00 40.69  ? 209  VAL A O   1 
ATOM   1599 C CB  . VAL A 1 209 ? 26.995  4.556   18.088  1.00 37.80  ? 209  VAL A CB  1 
ATOM   1600 C CG1 . VAL A 1 209 ? 26.045  3.377   18.246  1.00 37.95  ? 209  VAL A CG1 1 
ATOM   1601 C CG2 . VAL A 1 209 ? 26.836  5.519   19.236  1.00 37.29  ? 209  VAL A CG2 1 
ATOM   1602 N N   . GLY A 1 210 ? 28.513  3.145   15.750  1.00 39.29  ? 210  GLY A N   1 
ATOM   1603 C CA  . GLY A 1 210 ? 28.665  2.125   14.720  1.00 40.00  ? 210  GLY A CA  1 
ATOM   1604 C C   . GLY A 1 210 ? 29.998  1.409   14.797  1.00 40.86  ? 210  GLY A C   1 
ATOM   1605 O O   . GLY A 1 210 ? 30.071  0.201   14.568  1.00 43.03  ? 210  GLY A O   1 
ATOM   1606 N N   . MET A 1 211 ? 31.056  2.128   15.131  1.00 40.04  ? 211  MET A N   1 
ATOM   1607 C CA  . MET A 1 211 ? 32.365  1.497   15.277  1.00 40.84  ? 211  MET A CA  1 
ATOM   1608 C C   . MET A 1 211 ? 32.466  0.609   16.491  1.00 40.84  ? 211  MET A C   1 
ATOM   1609 O O   . MET A 1 211 ? 33.153  -0.417  16.458  1.00 41.62  ? 211  MET A O   1 
ATOM   1610 C CB  . MET A 1 211 ? 33.491  2.524   15.245  1.00 40.53  ? 211  MET A CB  1 
ATOM   1611 C CG  . MET A 1 211 ? 33.722  2.967   13.837  1.00 42.69  ? 211  MET A CG  1 
ATOM   1612 S SD  . MET A 1 211 ? 34.617  4.486   13.695  1.00 47.70  ? 211  MET A SD  1 
ATOM   1613 C CE  . MET A 1 211 ? 34.147  4.996   12.056  1.00 46.19  ? 211  MET A CE  1 
ATOM   1614 N N   . HIS A 1 212 ? 31.758  0.966   17.555  1.00 40.04  ? 212  HIS A N   1 
ATOM   1615 C CA  . HIS A 1 212 ? 31.691  0.049   18.686  1.00 40.60  ? 212  HIS A CA  1 
ATOM   1616 C C   . HIS A 1 212 ? 30.916  -1.190  18.315  1.00 42.13  ? 212  HIS A C   1 
ATOM   1617 O O   . HIS A 1 212 ? 31.241  -2.274  18.778  1.00 43.84  ? 212  HIS A O   1 
ATOM   1618 C CB  . HIS A 1 212 ? 31.139  0.708   19.946  1.00 39.32  ? 212  HIS A CB  1 
ATOM   1619 C CG  . HIS A 1 212 ? 32.016  1.794   20.472  1.00 37.65  ? 212  HIS A CG  1 
ATOM   1620 N ND1 . HIS A 1 212 ? 33.292  1.557   20.933  1.00 37.02  ? 212  HIS A ND1 1 
ATOM   1621 C CD2 . HIS A 1 212 ? 31.828  3.131   20.549  1.00 35.17  ? 212  HIS A CD2 1 
ATOM   1622 C CE1 . HIS A 1 212 ? 33.841  2.701   21.299  1.00 36.22  ? 212  HIS A CE1 1 
ATOM   1623 N NE2 . HIS A 1 212 ? 32.972  3.673   21.078  1.00 34.24  ? 212  HIS A NE2 1 
ATOM   1624 N N   . ILE A 1 213 ? 29.908  -1.050  17.458  1.00 42.76  ? 213  ILE A N   1 
ATOM   1625 C CA  . ILE A 1 213 ? 29.170  -2.232  17.007  1.00 44.15  ? 213  ILE A CA  1 
ATOM   1626 C C   . ILE A 1 213 ? 30.109  -3.151  16.218  1.00 45.40  ? 213  ILE A C   1 
ATOM   1627 O O   . ILE A 1 213 ? 29.947  -4.356  16.247  1.00 47.01  ? 213  ILE A O   1 
ATOM   1628 C CB  . ILE A 1 213 ? 27.925  -1.855  16.156  1.00 44.19  ? 213  ILE A CB  1 
ATOM   1629 C CG1 . ILE A 1 213 ? 26.850  -1.197  17.021  1.00 43.34  ? 213  ILE A CG1 1 
ATOM   1630 C CG2 . ILE A 1 213 ? 27.339  -3.079  15.438  1.00 43.68  ? 213  ILE A CG2 1 
ATOM   1631 C CD1 . ILE A 1 213 ? 25.650  -0.695  16.212  1.00 42.06  ? 213  ILE A CD1 1 
ATOM   1632 N N   . LEU A 1 214 ? 31.093  -2.577  15.528  1.00 45.14  ? 214  LEU A N   1 
ATOM   1633 C CA  . LEU A 1 214 ? 31.924  -3.333  14.588  1.00 46.16  ? 214  LEU A CA  1 
ATOM   1634 C C   . LEU A 1 214 ? 33.245  -3.789  15.188  1.00 47.03  ? 214  LEU A C   1 
ATOM   1635 O O   . LEU A 1 214 ? 34.024  -4.484  14.527  1.00 47.88  ? 214  LEU A O   1 
ATOM   1636 C CB  . LEU A 1 214 ? 32.186  -2.500  13.328  1.00 45.67  ? 214  LEU A CB  1 
ATOM   1637 C CG  . LEU A 1 214 ? 30.970  -2.124  12.462  1.00 45.30  ? 214  LEU A CG  1 
ATOM   1638 C CD1 . LEU A 1 214 ? 31.360  -1.156  11.372  1.00 41.99  ? 214  LEU A CD1 1 
ATOM   1639 C CD2 . LEU A 1 214 ? 30.317  -3.369  11.872  1.00 44.18  ? 214  LEU A CD2 1 
ATOM   1640 N N   . SER A 1 215 ? 33.500  -3.392  16.433  1.00 46.76  ? 215  SER A N   1 
ATOM   1641 C CA  . SER A 1 215 ? 34.759  -3.694  17.094  1.00 47.59  ? 215  SER A CA  1 
ATOM   1642 C C   . SER A 1 215 ? 34.498  -4.631  18.255  1.00 49.40  ? 215  SER A C   1 
ATOM   1643 O O   . SER A 1 215 ? 33.797  -4.271  19.197  1.00 48.54  ? 215  SER A O   1 
ATOM   1644 C CB  . SER A 1 215 ? 35.399  -2.400  17.579  1.00 46.27  ? 215  SER A CB  1 
ATOM   1645 O OG  . SER A 1 215 ? 36.768  -2.562  17.867  1.00 44.39  ? 215  SER A OG  1 
ATOM   1646 N N   . LEU A 1 216 ? 35.067  -5.834  18.185  1.00 52.32  ? 216  LEU A N   1 
ATOM   1647 C CA  . LEU A 1 216 ? 34.695  -6.929  19.094  1.00 54.41  ? 216  LEU A CA  1 
ATOM   1648 C C   . LEU A 1 216 ? 34.852  -6.598  20.575  1.00 54.10  ? 216  LEU A C   1 
ATOM   1649 O O   . LEU A 1 216 ? 33.907  -6.786  21.343  1.00 54.60  ? 216  LEU A O   1 
ATOM   1650 C CB  . LEU A 1 216 ? 35.416  -8.245  18.746  1.00 56.61  ? 216  LEU A CB  1 
ATOM   1651 C CG  . LEU A 1 216 ? 34.972  -9.465  19.591  1.00 60.57  ? 216  LEU A CG  1 
ATOM   1652 C CD1 . LEU A 1 216 ? 33.470  -9.849  19.416  1.00 61.33  ? 216  LEU A CD1 1 
ATOM   1653 C CD2 . LEU A 1 216 ? 35.878  -10.701 19.360  1.00 64.83  ? 216  LEU A CD2 1 
ATOM   1654 N N   . PRO A 1 217 ? 36.029  -6.084  20.987  1.00 53.76  ? 217  PRO A N   1 
ATOM   1655 C CA  . PRO A 1 217 ? 36.140  -5.740  22.405  1.00 53.22  ? 217  PRO A CA  1 
ATOM   1656 C C   . PRO A 1 217 ? 35.042  -4.795  22.950  1.00 51.66  ? 217  PRO A C   1 
ATOM   1657 O O   . PRO A 1 217 ? 34.834  -4.758  24.154  1.00 52.19  ? 217  PRO A O   1 
ATOM   1658 C CB  . PRO A 1 217 ? 37.529  -5.087  22.498  1.00 52.97  ? 217  PRO A CB  1 
ATOM   1659 C CG  . PRO A 1 217 ? 38.297  -5.699  21.388  1.00 53.63  ? 217  PRO A CG  1 
ATOM   1660 C CD  . PRO A 1 217 ? 37.302  -5.859  20.273  1.00 53.68  ? 217  PRO A CD  1 
ATOM   1661 N N   . SER A 1 218 ? 34.340  -4.054  22.099  1.00 50.14  ? 218  SER A N   1 
ATOM   1662 C CA  . SER A 1 218 ? 33.313  -3.118  22.601  1.00 48.89  ? 218  SER A CA  1 
ATOM   1663 C C   . SER A 1 218 ? 31.955  -3.774  22.769  1.00 49.64  ? 218  SER A C   1 
ATOM   1664 O O   . SER A 1 218 ? 31.106  -3.275  23.502  1.00 48.66  ? 218  SER A O   1 
ATOM   1665 C CB  . SER A 1 218 ? 33.166  -1.881  21.709  1.00 47.26  ? 218  SER A CB  1 
ATOM   1666 O OG  . SER A 1 218 ? 34.335  -1.083  21.747  1.00 46.00  ? 218  SER A OG  1 
ATOM   1667 N N   . ARG A 1 219 ? 31.767  -4.909  22.107  1.00 51.11  ? 219  ARG A N   1 
ATOM   1668 C CA  . ARG A 1 219 ? 30.448  -5.517  22.022  1.00 52.39  ? 219  ARG A CA  1 
ATOM   1669 C C   . ARG A 1 219 ? 29.852  -5.982  23.354  1.00 52.87  ? 219  ARG A C   1 
ATOM   1670 O O   . ARG A 1 219 ? 28.637  -5.921  23.539  1.00 53.43  ? 219  ARG A O   1 
ATOM   1671 C CB  . ARG A 1 219 ? 30.438  -6.628  20.975  1.00 53.89  ? 219  ARG A CB  1 
ATOM   1672 C CG  . ARG A 1 219 ? 30.323  -6.078  19.553  1.00 55.23  ? 219  ARG A CG  1 
ATOM   1673 C CD  . ARG A 1 219 ? 28.967  -5.348  19.329  1.00 57.42  ? 219  ARG A CD  1 
ATOM   1674 N NE  . ARG A 1 219 ? 27.827  -6.270  19.237  1.00 60.40  ? 219  ARG A NE  1 
ATOM   1675 C CZ  . ARG A 1 219 ? 27.529  -6.998  18.155  1.00 64.41  ? 219  ARG A CZ  1 
ATOM   1676 N NH1 . ARG A 1 219 ? 28.280  -6.909  17.052  1.00 63.04  ? 219  ARG A NH1 1 
ATOM   1677 N NH2 . ARG A 1 219 ? 26.477  -7.831  18.174  1.00 67.01  ? 219  ARG A NH2 1 
ATOM   1678 N N   . SER A 1 220 ? 30.712  -6.418  24.271  1.00 52.82  ? 220  SER A N   1 
ATOM   1679 C CA  . SER A 1 220 ? 30.313  -6.868  25.596  1.00 52.96  ? 220  SER A CA  1 
ATOM   1680 C C   . SER A 1 220 ? 29.981  -5.719  26.546  1.00 51.16  ? 220  SER A C   1 
ATOM   1681 O O   . SER A 1 220 ? 29.621  -5.960  27.698  1.00 51.34  ? 220  SER A O   1 
ATOM   1682 C CB  . SER A 1 220 ? 31.443  -7.709  26.209  1.00 54.36  ? 220  SER A CB  1 
ATOM   1683 O OG  . SER A 1 220 ? 32.701  -7.065  26.031  1.00 54.51  ? 220  SER A OG  1 
ATOM   1684 N N   . LEU A 1 221 ? 30.119  -4.477  26.069  1.00 49.20  ? 221  LEU A N   1 
ATOM   1685 C CA  . LEU A 1 221 ? 29.960  -3.296  26.919  1.00 47.00  ? 221  LEU A CA  1 
ATOM   1686 C C   . LEU A 1 221 ? 28.651  -2.581  26.724  1.00 45.78  ? 221  LEU A C   1 
ATOM   1687 O O   . LEU A 1 221 ? 28.327  -1.693  27.506  1.00 45.25  ? 221  LEU A O   1 
ATOM   1688 C CB  . LEU A 1 221 ? 31.118  -2.309  26.754  1.00 46.29  ? 221  LEU A CB  1 
ATOM   1689 C CG  . LEU A 1 221 ? 32.551  -2.878  26.882  1.00 47.58  ? 221  LEU A CG  1 
ATOM   1690 C CD1 . LEU A 1 221 ? 33.584  -1.803  26.505  1.00 45.28  ? 221  LEU A CD1 1 
ATOM   1691 C CD2 . LEU A 1 221 ? 32.837  -3.486  28.263  1.00 44.84  ? 221  LEU A CD2 1 
ATOM   1692 N N   . PHE A 1 222 ? 27.882  -2.968  25.712  1.00 45.64  ? 222  PHE A N   1 
ATOM   1693 C CA  . PHE A 1 222 ? 26.541  -2.383  25.497  1.00 45.33  ? 222  PHE A CA  1 
ATOM   1694 C C   . PHE A 1 222 ? 25.586  -3.414  24.899  1.00 46.72  ? 222  PHE A C   1 
ATOM   1695 O O   . PHE A 1 222 ? 26.017  -4.488  24.486  1.00 47.42  ? 222  PHE A O   1 
ATOM   1696 C CB  . PHE A 1 222 ? 26.612  -1.121  24.620  1.00 43.68  ? 222  PHE A CB  1 
ATOM   1697 C CG  . PHE A 1 222 ? 27.024  -1.396  23.186  1.00 42.67  ? 222  PHE A CG  1 
ATOM   1698 C CD1 . PHE A 1 222 ? 28.375  -1.564  22.850  1.00 41.29  ? 222  PHE A CD1 1 
ATOM   1699 C CD2 . PHE A 1 222 ? 26.065  -1.467  22.175  1.00 42.14  ? 222  PHE A CD2 1 
ATOM   1700 C CE1 . PHE A 1 222 ? 28.771  -1.825  21.538  1.00 41.21  ? 222  PHE A CE1 1 
ATOM   1701 C CE2 . PHE A 1 222 ? 26.440  -1.724  20.861  1.00 42.81  ? 222  PHE A CE2 1 
ATOM   1702 C CZ  . PHE A 1 222 ? 27.812  -1.900  20.542  1.00 43.61  ? 222  PHE A CZ  1 
ATOM   1703 N N   . HIS A 1 223 ? 24.298  -3.091  24.836  1.00 47.36  ? 223  HIS A N   1 
ATOM   1704 C CA  . HIS A 1 223 ? 23.315  -4.084  24.389  1.00 50.00  ? 223  HIS A CA  1 
ATOM   1705 C C   . HIS A 1 223 ? 22.448  -3.610  23.222  1.00 49.90  ? 223  HIS A C   1 
ATOM   1706 O O   . HIS A 1 223 ? 21.906  -4.426  22.467  1.00 51.95  ? 223  HIS A O   1 
ATOM   1707 C CB  . HIS A 1 223 ? 22.456  -4.546  25.572  1.00 51.08  ? 223  HIS A CB  1 
ATOM   1708 C CG  . HIS A 1 223 ? 23.261  -4.849  26.801  1.00 54.05  ? 223  HIS A CG  1 
ATOM   1709 N ND1 . HIS A 1 223 ? 23.736  -6.115  27.092  1.00 55.96  ? 223  HIS A ND1 1 
ATOM   1710 C CD2 . HIS A 1 223 ? 23.730  -4.035  27.783  1.00 54.78  ? 223  HIS A CD2 1 
ATOM   1711 C CE1 . HIS A 1 223 ? 24.437  -6.070  28.213  1.00 57.33  ? 223  HIS A CE1 1 
ATOM   1712 N NE2 . HIS A 1 223 ? 24.451  -4.820  28.650  1.00 56.42  ? 223  HIS A NE2 1 
ATOM   1713 N N   . ARG A 1 224 ? 22.323  -2.298  23.081  1.00 48.12  ? 224  ARG A N   1 
ATOM   1714 C CA  . ARG A 1 224 ? 21.498  -1.708  22.036  1.00 47.92  ? 224  ARG A CA  1 
ATOM   1715 C C   . ARG A 1 224 ? 22.166  -0.384  21.576  1.00 45.78  ? 224  ARG A C   1 
ATOM   1716 O O   . ARG A 1 224 ? 23.038  0.151   22.266  1.00 44.81  ? 224  ARG A O   1 
ATOM   1717 C CB  . ARG A 1 224 ? 20.078  -1.474  22.561  1.00 48.49  ? 224  ARG A CB  1 
ATOM   1718 C CG  . ARG A 1 224 ? 19.205  -2.711  22.562  1.00 53.10  ? 224  ARG A CG  1 
ATOM   1719 C CD  . ARG A 1 224 ? 17.942  -2.551  23.433  1.00 57.68  ? 224  ARG A CD  1 
ATOM   1720 N NE  . ARG A 1 224 ? 18.266  -2.522  24.864  1.00 61.22  ? 224  ARG A NE  1 
ATOM   1721 C CZ  . ARG A 1 224 ? 18.378  -3.593  25.657  1.00 62.77  ? 224  ARG A CZ  1 
ATOM   1722 N NH1 . ARG A 1 224 ? 18.178  -4.822  25.195  1.00 63.75  ? 224  ARG A NH1 1 
ATOM   1723 N NH2 . ARG A 1 224 ? 18.692  -3.429  26.934  1.00 63.18  ? 224  ARG A NH2 1 
ATOM   1724 N N   . ALA A 1 225 ? 21.768  0.128   20.417  1.00 44.43  ? 225  ALA A N   1 
ATOM   1725 C CA  . ALA A 1 225 ? 22.482  1.239   19.806  1.00 42.56  ? 225  ALA A CA  1 
ATOM   1726 C C   . ALA A 1 225 ? 21.550  2.117   18.990  1.00 41.96  ? 225  ALA A C   1 
ATOM   1727 O O   . ALA A 1 225 ? 20.627  1.615   18.315  1.00 42.24  ? 225  ALA A O   1 
ATOM   1728 C CB  . ALA A 1 225 ? 23.603  0.712   18.930  1.00 42.38  ? 225  ALA A CB  1 
ATOM   1729 N N   . VAL A 1 226 ? 21.802  3.422   19.066  1.00 40.05  ? 226  VAL A N   1 
ATOM   1730 C CA  . VAL A 1 226 ? 21.063  4.397   18.298  1.00 39.80  ? 226  VAL A CA  1 
ATOM   1731 C C   . VAL A 1 226 ? 22.042  5.257   17.519  1.00 38.95  ? 226  VAL A C   1 
ATOM   1732 O O   . VAL A 1 226 ? 22.975  5.805   18.093  1.00 39.18  ? 226  VAL A O   1 
ATOM   1733 C CB  . VAL A 1 226 ? 20.231  5.286   19.198  1.00 39.63  ? 226  VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 226 ? 19.462  6.316   18.363  1.00 39.55  ? 226  VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 226 ? 19.274  4.450   20.044  1.00 40.78  ? 226  VAL A CG2 1 
ATOM   1736 N N   . LEU A 1 227 ? 21.830  5.367   16.212  1.00 38.89  ? 227  LEU A N   1 
ATOM   1737 C CA  . LEU A 1 227 ? 22.724  6.109   15.328  1.00 37.76  ? 227  LEU A CA  1 
ATOM   1738 C C   . LEU A 1 227 ? 21.959  7.242   14.640  1.00 37.25  ? 227  LEU A C   1 
ATOM   1739 O O   . LEU A 1 227 ? 21.152  6.992   13.749  1.00 38.06  ? 227  LEU A O   1 
ATOM   1740 C CB  . LEU A 1 227 ? 23.343  5.161   14.279  1.00 38.04  ? 227  LEU A CB  1 
ATOM   1741 C CG  . LEU A 1 227 ? 24.436  4.164   14.698  1.00 37.97  ? 227  LEU A CG  1 
ATOM   1742 C CD1 . LEU A 1 227 ? 23.847  2.935   15.350  1.00 37.50  ? 227  LEU A CD1 1 
ATOM   1743 C CD2 . LEU A 1 227 ? 25.327  3.749   13.525  1.00 35.37  ? 227  LEU A CD2 1 
ATOM   1744 N N   . GLN A 1 228 ? 22.227  8.480   15.043  1.00 36.53  ? 228  GLN A N   1 
ATOM   1745 C CA  . GLN A 1 228 ? 21.503  9.652   14.536  1.00 36.72  ? 228  GLN A CA  1 
ATOM   1746 C C   . GLN A 1 228 ? 22.334  10.411  13.506  1.00 37.14  ? 228  GLN A C   1 
ATOM   1747 O O   . GLN A 1 228 ? 23.385  10.994  13.841  1.00 37.20  ? 228  GLN A O   1 
ATOM   1748 C CB  . GLN A 1 228 ? 21.133  10.577  15.696  1.00 36.20  ? 228  GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 228 ? 20.410  9.847   16.837  1.00 37.07  ? 228  GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 228 ? 20.019  10.730  18.009  1.00 37.79  ? 228  GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 228 ? 19.715  10.225  19.100  1.00 38.34  ? 228  GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 228 ? 20.012  12.049  17.798  1.00 37.03  ? 228  GLN A NE2 1 
ATOM   1753 N N   . SER A 1 229 ? 21.890  10.391  12.249  1.00 37.34  ? 229  SER A N   1 
ATOM   1754 C CA  . SER A 1 229 ? 22.537  11.174  11.205  1.00 37.24  ? 229  SER A CA  1 
ATOM   1755 C C   . SER A 1 229 ? 24.023  10.892  11.089  1.00 37.28  ? 229  SER A C   1 
ATOM   1756 O O   . SER A 1 229 ? 24.832  11.834  10.961  1.00 37.40  ? 229  SER A O   1 
ATOM   1757 C CB  . SER A 1 229 ? 22.338  12.678  11.440  1.00 37.15  ? 229  SER A CB  1 
ATOM   1758 O OG  . SER A 1 229 ? 20.969  12.999  11.604  1.00 39.21  ? 229  SER A OG  1 
ATOM   1759 N N   . GLY A 1 230 ? 24.397  9.611   11.120  1.00 37.46  ? 230  GLY A N   1 
ATOM   1760 C CA  . GLY A 1 230 ? 25.801  9.241   10.971  1.00 36.63  ? 230  GLY A CA  1 
ATOM   1761 C C   . GLY A 1 230 ? 25.999  7.735   10.957  1.00 37.45  ? 230  GLY A C   1 
ATOM   1762 O O   . GLY A 1 230 ? 25.169  6.992   11.503  1.00 37.73  ? 230  GLY A O   1 
ATOM   1763 N N   . THR A 1 231 ? 27.107  7.294   10.349  1.00 37.29  ? 231  THR A N   1 
ATOM   1764 C CA  . THR A 1 231 ? 27.419  5.875   10.198  1.00 37.96  ? 231  THR A CA  1 
ATOM   1765 C C   . THR A 1 231 ? 28.918  5.579   10.137  1.00 37.74  ? 231  THR A C   1 
ATOM   1766 O O   . THR A 1 231 ? 29.717  6.423   9.737   1.00 37.47  ? 231  THR A O   1 
ATOM   1767 C CB  . THR A 1 231 ? 26.777  5.293   8.910   1.00 39.56  ? 231  THR A CB  1 
ATOM   1768 O OG1 . THR A 1 231 ? 27.322  5.949   7.748   1.00 40.33  ? 231  THR A OG1 1 
ATOM   1769 C CG2 . THR A 1 231 ? 25.261  5.413   8.929   1.00 37.92  ? 231  THR A CG2 1 
ATOM   1770 N N   . PRO A 1 232 ? 29.324  4.362   10.524  1.00 38.61  ? 232  PRO A N   1 
ATOM   1771 C CA  . PRO A 1 232 ? 30.770  4.089   10.407  1.00 38.26  ? 232  PRO A CA  1 
ATOM   1772 C C   . PRO A 1 232 ? 31.226  3.916   8.939   1.00 38.79  ? 232  PRO A C   1 
ATOM   1773 O O   . PRO A 1 232 ? 32.349  4.239   8.621   1.00 39.32  ? 232  PRO A O   1 
ATOM   1774 C CB  . PRO A 1 232 ? 30.941  2.811   11.218  1.00 38.59  ? 232  PRO A CB  1 
ATOM   1775 C CG  . PRO A 1 232 ? 29.618  2.128   11.146  1.00 38.73  ? 232  PRO A CG  1 
ATOM   1776 C CD  . PRO A 1 232 ? 28.576  3.206   11.066  1.00 38.97  ? 232  PRO A CD  1 
ATOM   1777 N N   . ASN A 1 233 ? 30.355  3.426   8.067   1.00 39.22  ? 233  ASN A N   1 
ATOM   1778 C CA  . ASN A 1 233 ? 30.601  3.380   6.633   1.00 40.28  ? 233  ASN A CA  1 
ATOM   1779 C C   . ASN A 1 233 ? 30.330  4.770   6.047   1.00 40.48  ? 233  ASN A C   1 
ATOM   1780 O O   . ASN A 1 233 ? 29.758  5.636   6.725   1.00 39.83  ? 233  ASN A O   1 
ATOM   1781 C CB  . ASN A 1 233 ? 29.654  2.369   5.972   1.00 40.69  ? 233  ASN A CB  1 
ATOM   1782 C CG  . ASN A 1 233 ? 28.187  2.622   6.347   1.00 40.74  ? 233  ASN A CG  1 
ATOM   1783 O OD1 . ASN A 1 233 ? 27.838  2.610   7.530   1.00 37.91  ? 233  ASN A OD1 1 
ATOM   1784 N ND2 . ASN A 1 233 ? 27.333  2.877   5.346   1.00 39.48  ? 233  ASN A ND2 1 
ATOM   1785 N N   . GLY A 1 234 ? 30.702  4.971   4.784   1.00 41.10  ? 234  GLY A N   1 
ATOM   1786 C CA  . GLY A 1 234 ? 30.500  6.252   4.126   1.00 41.04  ? 234  GLY A CA  1 
ATOM   1787 C C   . GLY A 1 234 ? 31.830  6.956   3.924   1.00 41.14  ? 234  GLY A C   1 
ATOM   1788 O O   . GLY A 1 234 ? 32.860  6.458   4.386   1.00 41.77  ? 234  GLY A O   1 
ATOM   1789 N N   . PRO A 1 235 ? 31.816  8.132   3.269   1.00 40.40  ? 235  PRO A N   1 
ATOM   1790 C CA  . PRO A 1 235 ? 33.045  8.753   2.779   1.00 40.14  ? 235  PRO A CA  1 
ATOM   1791 C C   . PRO A 1 235 ? 33.889  9.552   3.779   1.00 39.43  ? 235  PRO A C   1 
ATOM   1792 O O   . PRO A 1 235 ? 35.016  9.948   3.443   1.00 39.96  ? 235  PRO A O   1 
ATOM   1793 C CB  . PRO A 1 235 ? 32.541  9.680   1.668   1.00 40.23  ? 235  PRO A CB  1 
ATOM   1794 C CG  . PRO A 1 235 ? 31.137  10.029  2.067   1.00 40.29  ? 235  PRO A CG  1 
ATOM   1795 C CD  . PRO A 1 235 ? 30.603  8.861   2.851   1.00 40.18  ? 235  PRO A CD  1 
ATOM   1796 N N   . TRP A 1 236 ? 33.386  9.800   4.981   1.00 38.31  ? 236  TRP A N   1 
ATOM   1797 C CA  . TRP A 1 236 ? 34.064  10.756  5.878   1.00 37.31  ? 236  TRP A CA  1 
ATOM   1798 C C   . TRP A 1 236 ? 34.460  10.194  7.237   1.00 37.26  ? 236  TRP A C   1 
ATOM   1799 O O   . TRP A 1 236 ? 35.284  10.784  7.931   1.00 36.91  ? 236  TRP A O   1 
ATOM   1800 C CB  . TRP A 1 236 ? 33.189  11.992  6.102   1.00 36.01  ? 236  TRP A CB  1 
ATOM   1801 C CG  . TRP A 1 236 ? 31.854  11.705  6.704   1.00 35.52  ? 236  TRP A CG  1 
ATOM   1802 C CD1 . TRP A 1 236 ? 30.682  11.549  6.034   1.00 36.51  ? 236  TRP A CD1 1 
ATOM   1803 C CD2 . TRP A 1 236 ? 31.539  11.539  8.097   1.00 36.99  ? 236  TRP A CD2 1 
ATOM   1804 N NE1 . TRP A 1 236 ? 29.653  11.305  6.907   1.00 34.77  ? 236  TRP A NE1 1 
ATOM   1805 C CE2 . TRP A 1 236 ? 30.146  11.288  8.182   1.00 35.90  ? 236  TRP A CE2 1 
ATOM   1806 C CE3 . TRP A 1 236 ? 32.293  11.593  9.284   1.00 37.38  ? 236  TRP A CE3 1 
ATOM   1807 C CZ2 . TRP A 1 236 ? 29.485  11.079  9.404   1.00 34.76  ? 236  TRP A CZ2 1 
ATOM   1808 C CZ3 . TRP A 1 236 ? 31.639  11.387  10.496  1.00 37.73  ? 236  TRP A CZ3 1 
ATOM   1809 C CH2 . TRP A 1 236 ? 30.233  11.125  10.541  1.00 35.63  ? 236  TRP A CH2 1 
ATOM   1810 N N   . ALA A 1 237 ? 33.862  9.074   7.635   1.00 37.20  ? 237  ALA A N   1 
ATOM   1811 C CA  . ALA A 1 237 ? 34.062  8.591   8.997   1.00 36.91  ? 237  ALA A CA  1 
ATOM   1812 C C   . ALA A 1 237 ? 35.381  7.852   9.202   1.00 37.23  ? 237  ALA A C   1 
ATOM   1813 O O   . ALA A 1 237 ? 35.828  7.714   10.334  1.00 37.07  ? 237  ALA A O   1 
ATOM   1814 C CB  . ALA A 1 237 ? 32.887  7.750   9.466   1.00 36.97  ? 237  ALA A CB  1 
ATOM   1815 N N   . THR A 1 238 ? 36.001  7.371   8.131   1.00 37.46  ? 238  THR A N   1 
ATOM   1816 C CA  . THR A 1 238 ? 37.260  6.657   8.288   1.00 38.62  ? 238  THR A CA  1 
ATOM   1817 C C   . THR A 1 238 ? 38.308  7.070   7.280   1.00 39.95  ? 238  THR A C   1 
ATOM   1818 O O   . THR A 1 238 ? 38.044  7.885   6.389   1.00 40.99  ? 238  THR A O   1 
ATOM   1819 C CB  . THR A 1 238 ? 37.096  5.114   8.231   1.00 39.56  ? 238  THR A CB  1 
ATOM   1820 O OG1 . THR A 1 238 ? 36.551  4.705   6.961   1.00 39.95  ? 238  THR A OG1 1 
ATOM   1821 C CG2 . THR A 1 238 ? 36.227  4.634   9.365   1.00 37.10  ? 238  THR A CG2 1 
ATOM   1822 N N   . VAL A 1 239 ? 39.510  6.531   7.433   1.00 40.33  ? 239  VAL A N   1 
ATOM   1823 C CA  . VAL A 1 239 ? 40.560  6.727   6.441   1.00 40.88  ? 239  VAL A CA  1 
ATOM   1824 C C   . VAL A 1 239 ? 41.395  5.464   6.384   1.00 42.57  ? 239  VAL A C   1 
ATOM   1825 O O   . VAL A 1 239 ? 41.432  4.703   7.346   1.00 42.45  ? 239  VAL A O   1 
ATOM   1826 C CB  . VAL A 1 239 ? 41.482  7.979   6.723   1.00 40.94  ? 239  VAL A CB  1 
ATOM   1827 C CG1 . VAL A 1 239 ? 40.789  9.309   6.276   1.00 37.98  ? 239  VAL A CG1 1 
ATOM   1828 C CG2 . VAL A 1 239 ? 42.000  8.020   8.175   1.00 37.80  ? 239  VAL A CG2 1 
ATOM   1829 N N   . SER A 1 240 ? 42.045  5.227   5.252   1.00 43.86  ? 240  SER A N   1 
ATOM   1830 C CA  . SER A 1 240 ? 42.990  4.116   5.160   1.00 45.47  ? 240  SER A CA  1 
ATOM   1831 C C   . SER A 1 240 ? 44.219  4.357   6.047   1.00 45.65  ? 240  SER A C   1 
ATOM   1832 O O   . SER A 1 240 ? 44.512  5.481   6.447   1.00 44.89  ? 240  SER A O   1 
ATOM   1833 C CB  . SER A 1 240 ? 43.420  3.899   3.711   1.00 46.11  ? 240  SER A CB  1 
ATOM   1834 O OG  . SER A 1 240 ? 44.076  5.048   3.217   1.00 46.18  ? 240  SER A OG  1 
ATOM   1835 N N   . ALA A 1 241 ? 44.923  3.283   6.362   1.00 47.41  ? 241  ALA A N   1 
ATOM   1836 C CA  . ALA A 1 241 ? 46.226  3.391   7.011   1.00 48.44  ? 241  ALA A CA  1 
ATOM   1837 C C   . ALA A 1 241 ? 47.130  4.355   6.228   1.00 48.88  ? 241  ALA A C   1 
ATOM   1838 O O   . ALA A 1 241 ? 47.666  5.298   6.797   1.00 48.82  ? 241  ALA A O   1 
ATOM   1839 C CB  . ALA A 1 241 ? 46.862  2.019   7.152   1.00 49.44  ? 241  ALA A CB  1 
ATOM   1840 N N   . GLY A 1 242 ? 47.235  4.154   4.918   1.00 49.58  ? 242  GLY A N   1 
ATOM   1841 C CA  . GLY A 1 242 ? 48.100  4.977   4.074   1.00 50.22  ? 242  GLY A CA  1 
ATOM   1842 C C   . GLY A 1 242 ? 47.767  6.454   4.157   1.00 49.01  ? 242  GLY A C   1 
ATOM   1843 O O   . GLY A 1 242 ? 48.670  7.304   4.203   1.00 49.37  ? 242  GLY A O   1 
ATOM   1844 N N   . GLU A 1 243 ? 46.473  6.766   4.178   1.00 47.18  ? 243  GLU A N   1 
ATOM   1845 C CA  . GLU A 1 243 ? 46.062  8.154   4.110   1.00 46.19  ? 243  GLU A CA  1 
ATOM   1846 C C   . GLU A 1 243 ? 46.292  8.849   5.448   1.00 45.57  ? 243  GLU A C   1 
ATOM   1847 O O   . GLU A 1 243 ? 46.779  9.989   5.481   1.00 45.39  ? 243  GLU A O   1 
ATOM   1848 C CB  . GLU A 1 243 ? 44.624  8.285   3.598   1.00 45.56  ? 243  GLU A CB  1 
ATOM   1849 C CG  . GLU A 1 243 ? 43.992  9.708   3.633   1.00 44.66  ? 243  GLU A CG  1 
ATOM   1850 C CD  . GLU A 1 243 ? 44.638  10.741  2.688   1.00 46.03  ? 243  GLU A CD  1 
ATOM   1851 O OE1 . GLU A 1 243 ? 45.546  10.418  1.886   1.00 46.28  ? 243  GLU A OE1 1 
ATOM   1852 O OE2 . GLU A 1 243 ? 44.231  11.916  2.763   1.00 46.06  ? 243  GLU A OE2 1 
ATOM   1853 N N   . ALA A 1 244 ? 45.988  8.154   6.547   1.00 45.02  ? 244  ALA A N   1 
ATOM   1854 C CA  . ALA A 1 244 ? 46.320  8.668   7.878   1.00 44.63  ? 244  ALA A CA  1 
ATOM   1855 C C   . ALA A 1 244 ? 47.847  8.897   8.075   1.00 46.28  ? 244  ALA A C   1 
ATOM   1856 O O   . ALA A 1 244 ? 48.254  9.909   8.662   1.00 46.32  ? 244  ALA A O   1 
ATOM   1857 C CB  . ALA A 1 244 ? 45.756  7.776   8.947   1.00 43.85  ? 244  ALA A CB  1 
ATOM   1858 N N   . ARG A 1 245 ? 48.681  7.982   7.566   1.00 47.27  ? 245  ARG A N   1 
ATOM   1859 C CA  . ARG A 1 245 ? 50.132  8.179   7.599   1.00 48.54  ? 245  ARG A CA  1 
ATOM   1860 C C   . ARG A 1 245 ? 50.520  9.457   6.858   1.00 48.61  ? 245  ARG A C   1 
ATOM   1861 O O   . ARG A 1 245 ? 51.320  10.246  7.347   1.00 48.98  ? 245  ARG A O   1 
ATOM   1862 C CB  . ARG A 1 245 ? 50.898  6.969   7.030   1.00 49.81  ? 245  ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 245 ? 52.406  7.186   6.910   1.00 49.98  ? 245  ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 245 ? 53.194  5.874   6.761   1.00 52.21  ? 245  ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 245 ? 53.013  5.011   7.932   1.00 51.18  ? 245  ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 245 ? 53.731  5.088   9.051   1.00 51.51  ? 245  ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 245 ? 54.715  5.972   9.189   1.00 51.45  ? 245  ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 245 ? 53.455  4.277   10.053  1.00 52.18  ? 245  ARG A NH2 1 
ATOM   1869 N N   . ARG A 1 246 ? 49.936  9.650   5.683   1.00 48.29  ? 246  ARG A N   1 
ATOM   1870 C CA  . ARG A 1 246 ? 50.227  10.814  4.859   1.00 48.38  ? 246  ARG A CA  1 
ATOM   1871 C C   . ARG A 1 246 ? 49.891  12.119  5.579   1.00 47.27  ? 246  ARG A C   1 
ATOM   1872 O O   . ARG A 1 246 ? 50.726  13.040  5.611   1.00 47.71  ? 246  ARG A O   1 
ATOM   1873 C CB  . ARG A 1 246 ? 49.484  10.716  3.530   1.00 48.19  ? 246  ARG A CB  1 
ATOM   1874 C CG  . ARG A 1 246 ? 49.948  11.714  2.482   1.00 50.19  ? 246  ARG A CG  1 
ATOM   1875 C CD  . ARG A 1 246 ? 48.957  11.821  1.306   1.00 50.28  ? 246  ARG A CD  1 
ATOM   1876 N NE  . ARG A 1 246 ? 47.645  12.333  1.710   1.00 48.98  ? 246  ARG A NE  1 
ATOM   1877 C CZ  . ARG A 1 246 ? 47.348  13.622  1.933   1.00 47.83  ? 246  ARG A CZ  1 
ATOM   1878 N NH1 . ARG A 1 246 ? 48.264  14.580  1.803   1.00 45.32  ? 246  ARG A NH1 1 
ATOM   1879 N NH2 . ARG A 1 246 ? 46.109  13.952  2.284   1.00 45.54  ? 246  ARG A NH2 1 
ATOM   1880 N N   . ARG A 1 247 ? 48.693  12.183  6.174   1.00 45.47  ? 247  ARG A N   1 
ATOM   1881 C CA  . ARG A 1 247 ? 48.246  13.384  6.889   1.00 44.36  ? 247  ARG A CA  1 
ATOM   1882 C C   . ARG A 1 247 ? 49.065  13.686  8.137   1.00 44.75  ? 247  ARG A C   1 
ATOM   1883 O O   . ARG A 1 247 ? 49.415  14.843  8.383   1.00 44.55  ? 247  ARG A O   1 
ATOM   1884 C CB  . ARG A 1 247 ? 46.782  13.287  7.268   1.00 42.63  ? 247  ARG A CB  1 
ATOM   1885 C CG  . ARG A 1 247 ? 45.901  13.090  6.080   1.00 42.33  ? 247  ARG A CG  1 
ATOM   1886 C CD  . ARG A 1 247 ? 44.468  13.146  6.481   1.00 39.16  ? 247  ARG A CD  1 
ATOM   1887 N NE  . ARG A 1 247 ? 43.622  12.882  5.339   1.00 37.90  ? 247  ARG A NE  1 
ATOM   1888 C CZ  . ARG A 1 247 ? 42.292  12.836  5.384   1.00 36.60  ? 247  ARG A CZ  1 
ATOM   1889 N NH1 . ARG A 1 247 ? 41.632  13.048  6.520   1.00 33.74  ? 247  ARG A NH1 1 
ATOM   1890 N NH2 . ARG A 1 247 ? 41.622  12.598  4.276   1.00 34.96  ? 247  ARG A NH2 1 
ATOM   1891 N N   . ALA A 1 248 ? 49.356  12.649  8.920   1.00 45.17  ? 248  ALA A N   1 
ATOM   1892 C CA  . ALA A 1 248 ? 50.169  12.794  10.123  1.00 45.99  ? 248  ALA A CA  1 
ATOM   1893 C C   . ALA A 1 248 ? 51.528  13.336  9.753   1.00 47.65  ? 248  ALA A C   1 
ATOM   1894 O O   . ALA A 1 248 ? 52.038  14.229  10.415  1.00 48.63  ? 248  ALA A O   1 
ATOM   1895 C CB  . ALA A 1 248 ? 50.327  11.471  10.826  1.00 46.36  ? 248  ALA A CB  1 
ATOM   1896 N N   . THR A 1 249 ? 52.102  12.802  8.685   1.00 48.35  ? 249  THR A N   1 
ATOM   1897 C CA  . THR A 1 249 ? 53.422  13.194  8.259   1.00 50.39  ? 249  THR A CA  1 
ATOM   1898 C C   . THR A 1 249 ? 53.426  14.642  7.785   1.00 50.47  ? 249  THR A C   1 
ATOM   1899 O O   . THR A 1 249 ? 54.371  15.390  8.064   1.00 51.13  ? 249  THR A O   1 
ATOM   1900 C CB  . THR A 1 249 ? 53.944  12.260  7.132   1.00 51.95  ? 249  THR A CB  1 
ATOM   1901 O OG1 . THR A 1 249 ? 54.070  10.918  7.631   1.00 52.59  ? 249  THR A OG1 1 
ATOM   1902 C CG2 . THR A 1 249 ? 55.283  12.720  6.626   1.00 52.83  ? 249  THR A CG2 1 
ATOM   1903 N N   . LEU A 1 250 ? 52.368  15.021  7.060   1.00 49.59  ? 250  LEU A N   1 
ATOM   1904 C CA  . LEU A 1 250 ? 52.241  16.368  6.517   1.00 49.41  ? 250  LEU A CA  1 
ATOM   1905 C C   . LEU A 1 250 ? 52.068  17.381  7.648   1.00 49.31  ? 250  LEU A C   1 
ATOM   1906 O O   . LEU A 1 250 ? 52.760  18.412  7.691   1.00 50.40  ? 250  LEU A O   1 
ATOM   1907 C CB  . LEU A 1 250 ? 51.093  16.456  5.507   1.00 48.05  ? 250  LEU A CB  1 
ATOM   1908 C CG  . LEU A 1 250 ? 50.842  17.816  4.806   1.00 47.97  ? 250  LEU A CG  1 
ATOM   1909 C CD1 . LEU A 1 250 ? 52.139  18.566  4.381   1.00 46.47  ? 250  LEU A CD1 1 
ATOM   1910 C CD2 . LEU A 1 250 ? 49.886  17.687  3.627   1.00 44.54  ? 250  LEU A CD2 1 
ATOM   1911 N N   . LEU A 1 251 ? 51.166  17.072  8.577   1.00 48.38  ? 251  LEU A N   1 
ATOM   1912 C CA  . LEU A 1 251 ? 50.984  17.904  9.749   1.00 47.93  ? 251  LEU A CA  1 
ATOM   1913 C C   . LEU A 1 251 ? 52.316  18.099  10.442  1.00 49.43  ? 251  LEU A C   1 
ATOM   1914 O O   . LEU A 1 251 ? 52.670  19.217  10.803  1.00 49.57  ? 251  LEU A O   1 
ATOM   1915 C CB  . LEU A 1 251 ? 49.988  17.295  10.722  1.00 46.47  ? 251  LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 251 ? 49.925  18.228  11.934  1.00 46.55  ? 251  LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 251 ? 48.903  19.341  11.767  1.00 43.52  ? 251  LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 251 ? 49.711  17.503  13.218  1.00 46.66  ? 251  LEU A CD2 1 
ATOM   1919 N N   . ALA A 1 252 ? 53.055  17.005  10.602  1.00 50.61  ? 252  ALA A N   1 
ATOM   1920 C CA  . ALA A 1 252 ? 54.374  17.050  11.220  1.00 52.65  ? 252  ALA A CA  1 
ATOM   1921 C C   . ALA A 1 252 ? 55.246  18.091  10.539  1.00 54.35  ? 252  ALA A C   1 
ATOM   1922 O O   . ALA A 1 252 ? 55.692  19.019  11.187  1.00 54.51  ? 252  ALA A O   1 
ATOM   1923 C CB  . ALA A 1 252 ? 55.021  15.685  11.206  1.00 53.31  ? 252  ALA A CB  1 
ATOM   1924 N N   . ARG A 1 253 ? 55.437  17.954  9.227   1.00 55.87  ? 253  ARG A N   1 
ATOM   1925 C CA  . ARG A 1 253 ? 56.122  18.958  8.397   1.00 58.10  ? 253  ARG A CA  1 
ATOM   1926 C C   . ARG A 1 253 ? 55.682  20.408  8.635   1.00 57.83  ? 253  ARG A C   1 
ATOM   1927 O O   . ARG A 1 253 ? 56.518  21.289  8.818   1.00 58.88  ? 253  ARG A O   1 
ATOM   1928 C CB  . ARG A 1 253 ? 55.900  18.648  6.928   1.00 58.34  ? 253  ARG A CB  1 
ATOM   1929 C CG  . ARG A 1 253 ? 56.883  17.735  6.340   1.00 62.06  ? 253  ARG A CG  1 
ATOM   1930 C CD  . ARG A 1 253 ? 56.783  17.723  4.816   1.00 69.37  ? 253  ARG A CD  1 
ATOM   1931 N NE  . ARG A 1 253 ? 58.101  17.423  4.251   1.00 76.47  ? 253  ARG A NE  1 
ATOM   1932 C CZ  . ARG A 1 253 ? 58.612  16.193  4.116   1.00 78.67  ? 253  ARG A CZ  1 
ATOM   1933 N NH1 . ARG A 1 253 ? 57.893  15.119  4.480   1.00 76.88  ? 253  ARG A NH1 1 
ATOM   1934 N NH2 . ARG A 1 253 ? 59.839  16.039  3.603   1.00 79.78  ? 253  ARG A NH2 1 
ATOM   1935 N N   . LEU A 1 254 ? 54.371  20.650  8.615   1.00 56.74  ? 254  LEU A N   1 
ATOM   1936 C CA  . LEU A 1 254 ? 53.829  22.012  8.748   1.00 56.90  ? 254  LEU A CA  1 
ATOM   1937 C C   . LEU A 1 254 ? 54.201  22.683  10.066  1.00 57.88  ? 254  LEU A C   1 
ATOM   1938 O O   . LEU A 1 254 ? 54.365  23.891  10.123  1.00 58.25  ? 254  LEU A O   1 
ATOM   1939 C CB  . LEU A 1 254 ? 52.313  22.032  8.540   1.00 54.49  ? 254  LEU A CB  1 
ATOM   1940 C CG  . LEU A 1 254 ? 51.776  21.505  7.202   1.00 53.83  ? 254  LEU A CG  1 
ATOM   1941 C CD1 . LEU A 1 254 ? 50.265  21.413  7.213   1.00 51.22  ? 254  LEU A CD1 1 
ATOM   1942 C CD2 . LEU A 1 254 ? 52.231  22.310  6.004   1.00 54.19  ? 254  LEU A CD2 1 
ATOM   1943 N N   . VAL A 1 255 ? 54.327  21.886  11.118  1.00 58.82  ? 255  VAL A N   1 
ATOM   1944 C CA  . VAL A 1 255 ? 54.794  22.368  12.414  1.00 60.65  ? 255  VAL A CA  1 
ATOM   1945 C C   . VAL A 1 255 ? 56.277  22.014  12.585  1.00 64.07  ? 255  VAL A C   1 
ATOM   1946 O O   . VAL A 1 255 ? 56.848  22.200  13.661  1.00 65.11  ? 255  VAL A O   1 
ATOM   1947 C CB  . VAL A 1 255 ? 53.965  21.765  13.574  1.00 58.81  ? 255  VAL A CB  1 
ATOM   1948 C CG1 . VAL A 1 255 ? 52.513  22.123  13.427  1.00 55.86  ? 255  VAL A CG1 1 
ATOM   1949 C CG2 . VAL A 1 255 ? 54.125  20.257  13.638  1.00 58.01  ? 255  VAL A CG2 1 
ATOM   1950 N N   . GLY A 1 256 ? 56.882  21.577  11.474  1.00 66.58  ? 256  GLY A N   1 
ATOM   1951 C CA  . GLY A 1 256 ? 58.073  20.707  11.413  1.00 69.75  ? 256  GLY A CA  1 
ATOM   1952 C C   . GLY A 1 256 ? 59.123  20.833  12.482  1.00 72.17  ? 256  GLY A C   1 
ATOM   1953 O O   . GLY A 1 256 ? 59.506  21.943  12.804  1.00 73.53  ? 256  GLY A O   1 
ATOM   1954 N N   . CYS A 1 257 ? 59.614  19.734  13.055  1.00 73.70  ? 257  CYS A N   1 
ATOM   1955 C CA  . CYS A 1 257 ? 59.213  18.322  12.839  1.00 73.59  ? 257  CYS A CA  1 
ATOM   1956 C C   . CYS A 1 257 ? 59.391  17.701  11.456  1.00 76.47  ? 257  CYS A C   1 
ATOM   1957 O O   . CYS A 1 257 ? 58.455  17.103  10.942  1.00 74.99  ? 257  CYS A O   1 
ATOM   1958 C CB  . CYS A 1 257 ? 57.834  18.006  13.431  1.00 70.41  ? 257  CYS A CB  1 
ATOM   1959 S SG  . CYS A 1 257 ? 57.700  18.234  15.219  1.00 64.19  ? 257  CYS A SG  1 
ATOM   1960 N N   . PRO A 1 258 ? 60.612  17.809  10.882  1.00 81.21  ? 258  PRO A N   1 
ATOM   1961 C CA  . PRO A 1 258 ? 60.961  17.145  9.619   1.00 83.84  ? 258  PRO A CA  1 
ATOM   1962 C C   . PRO A 1 258 ? 60.882  15.605  9.764   1.00 85.59  ? 258  PRO A C   1 
ATOM   1963 O O   . PRO A 1 258 ? 61.738  14.998  10.425  1.00 87.08  ? 258  PRO A O   1 
ATOM   1964 C CB  . PRO A 1 258 ? 62.405  17.603  9.371   1.00 86.45  ? 258  PRO A CB  1 
ATOM   1965 C CG  . PRO A 1 258 ? 62.940  17.900  10.776  1.00 86.47  ? 258  PRO A CG  1 
ATOM   1966 C CD  . PRO A 1 258 ? 61.769  18.550  11.443  1.00 83.29  ? 258  PRO A CD  1 
ATOM   1967 N N   . PRO A 1 259 ? 59.844  14.988  9.151   1.00 85.73  ? 259  PRO A N   1 
ATOM   1968 C CA  . PRO A 1 259 ? 59.493  13.556  9.134   1.00 86.20  ? 259  PRO A CA  1 
ATOM   1969 C C   . PRO A 1 259 ? 60.644  12.534  9.128   1.00 88.79  ? 259  PRO A C   1 
ATOM   1970 O O   . PRO A 1 259 ? 60.500  11.455  9.737   1.00 89.20  ? 259  PRO A O   1 
ATOM   1971 C CB  . PRO A 1 259 ? 58.661  13.440  7.851   1.00 85.46  ? 259  PRO A CB  1 
ATOM   1972 C CG  . PRO A 1 259 ? 57.883  14.716  7.867   1.00 83.71  ? 259  PRO A CG  1 
ATOM   1973 C CD  . PRO A 1 259 ? 58.855  15.767  8.372   1.00 84.63  ? 259  PRO A CD  1 
ATOM   1974 N N   . GLY A 1 264 ? 64.647  8.172   8.961   1.00 86.57  ? 264  GLY A N   1 
ATOM   1975 C CA  . GLY A 1 264 ? 63.655  9.069   9.573   1.00 84.27  ? 264  GLY A CA  1 
ATOM   1976 C C   . GLY A 1 264 ? 62.401  8.331   10.119  1.00 81.79  ? 264  GLY A C   1 
ATOM   1977 O O   . GLY A 1 264 ? 61.295  8.527   9.620   1.00 80.24  ? 264  GLY A O   1 
ATOM   1978 N N   . ASN A 1 265 ? 62.592  7.494   11.149  1.00 81.54  ? 265  ASN A N   1 
ATOM   1979 C CA  . ASN A 1 265 ? 61.505  6.668   11.736  1.00 78.78  ? 265  ASN A CA  1 
ATOM   1980 C C   . ASN A 1 265 ? 60.443  7.418   12.562  1.00 75.32  ? 265  ASN A C   1 
ATOM   1981 O O   . ASN A 1 265 ? 60.556  8.625   12.805  1.00 74.83  ? 265  ASN A O   1 
ATOM   1982 C CB  . ASN A 1 265 ? 62.065  5.443   12.519  1.00 80.52  ? 265  ASN A CB  1 
ATOM   1983 C CG  . ASN A 1 265 ? 62.950  5.829   13.733  1.00 82.04  ? 265  ASN A CG  1 
ATOM   1984 O OD1 . ASN A 1 265 ? 62.673  6.788   14.465  1.00 81.12  ? 265  ASN A OD1 1 
ATOM   1985 N ND2 . ASN A 1 265 ? 64.011  5.047   13.954  1.00 84.45  ? 265  ASN A ND2 1 
ATOM   1986 N N   . ASP A 1 266 ? 59.435  6.670   13.010  1.00 72.49  ? 266  ASP A N   1 
ATOM   1987 C CA  . ASP A 1 266 ? 58.222  7.219   13.624  1.00 68.91  ? 266  ASP A CA  1 
ATOM   1988 C C   . ASP A 1 266 ? 58.366  7.749   15.045  1.00 67.87  ? 266  ASP A C   1 
ATOM   1989 O O   . ASP A 1 266 ? 57.624  8.640   15.456  1.00 66.33  ? 266  ASP A O   1 
ATOM   1990 C CB  . ASP A 1 266 ? 57.118  6.167   13.595  1.00 67.68  ? 266  ASP A CB  1 
ATOM   1991 C CG  . ASP A 1 266 ? 56.590  5.912   12.192  1.00 67.94  ? 266  ASP A CG  1 
ATOM   1992 O OD1 . ASP A 1 266 ? 56.917  6.699   11.270  1.00 67.78  ? 266  ASP A OD1 1 
ATOM   1993 O OD2 . ASP A 1 266 ? 55.841  4.921   12.009  1.00 67.83  ? 266  ASP A OD2 1 
ATOM   1994 N N   . THR A 1 267 ? 59.308  7.194   15.796  1.00 68.58  ? 267  THR A N   1 
ATOM   1995 C CA  . THR A 1 267 ? 59.548  7.617   17.174  1.00 67.52  ? 267  THR A CA  1 
ATOM   1996 C C   . THR A 1 267 ? 60.043  9.050   17.200  1.00 67.16  ? 267  THR A C   1 
ATOM   1997 O O   . THR A 1 267 ? 59.538  9.860   17.963  1.00 66.29  ? 267  THR A O   1 
ATOM   1998 C CB  . THR A 1 267 ? 60.579  6.709   17.885  1.00 69.34  ? 267  THR A CB  1 
ATOM   1999 O OG1 . THR A 1 267 ? 60.199  5.340   17.716  1.00 68.58  ? 267  THR A OG1 1 
ATOM   2000 C CG2 . THR A 1 267 ? 60.663  7.039   19.384  1.00 68.31  ? 267  THR A CG2 1 
ATOM   2001 N N   . GLU A 1 268 ? 61.020  9.346   16.349  1.00 67.91  ? 268  GLU A N   1 
ATOM   2002 C CA  . GLU A 1 268 ? 61.619  10.677  16.255  1.00 67.99  ? 268  GLU A CA  1 
ATOM   2003 C C   . GLU A 1 268 ? 60.554  11.753  15.938  1.00 64.94  ? 268  GLU A C   1 
ATOM   2004 O O   . GLU A 1 268 ? 60.606  12.875  16.452  1.00 64.48  ? 268  GLU A O   1 
ATOM   2005 C CB  . GLU A 1 268 ? 62.738  10.670  15.196  1.00 69.92  ? 268  GLU A CB  1 
ATOM   2006 C CG  . GLU A 1 268 ? 64.006  11.396  15.617  1.00 73.62  ? 268  GLU A CG  1 
ATOM   2007 C CD  . GLU A 1 268 ? 65.105  11.389  14.536  1.00 78.84  ? 268  GLU A CD  1 
ATOM   2008 O OE1 . GLU A 1 268 ? 66.262  11.021  14.868  1.00 81.80  ? 268  GLU A OE1 1 
ATOM   2009 O OE2 . GLU A 1 268 ? 64.831  11.756  13.361  1.00 77.96  ? 268  GLU A OE2 1 
ATOM   2010 N N   . LEU A 1 269 ? 59.585  11.382  15.108  1.00 62.22  ? 269  LEU A N   1 
ATOM   2011 C CA  . LEU A 1 269 ? 58.621  12.313  14.583  1.00 59.57  ? 269  LEU A CA  1 
ATOM   2012 C C   . LEU A 1 269 ? 57.516  12.581  15.610  1.00 57.64  ? 269  LEU A C   1 
ATOM   2013 O O   . LEU A 1 269 ? 57.106  13.733  15.812  1.00 56.88  ? 269  LEU A O   1 
ATOM   2014 C CB  . LEU A 1 269 ? 58.052  11.770  13.267  1.00 58.93  ? 269  LEU A CB  1 
ATOM   2015 C CG  . LEU A 1 269 ? 56.996  12.569  12.491  1.00 56.91  ? 269  LEU A CG  1 
ATOM   2016 C CD1 . LEU A 1 269 ? 56.910  12.066  11.096  1.00 57.81  ? 269  LEU A CD1 1 
ATOM   2017 C CD2 . LEU A 1 269 ? 55.620  12.463  13.113  1.00 55.65  ? 269  LEU A CD2 1 
ATOM   2018 N N   . ILE A 1 270 ? 57.023  11.519  16.246  1.00 56.17  ? 270  ILE A N   1 
ATOM   2019 C CA  . ILE A 1 270 ? 56.016  11.674  17.273  1.00 53.79  ? 270  ILE A CA  1 
ATOM   2020 C C   . ILE A 1 270 ? 56.616  12.408  18.459  1.00 54.12  ? 270  ILE A C   1 
ATOM   2021 O O   . ILE A 1 270 ? 55.989  13.314  19.007  1.00 52.99  ? 270  ILE A O   1 
ATOM   2022 C CB  . ILE A 1 270 ? 55.412  10.335  17.669  1.00 53.29  ? 270  ILE A CB  1 
ATOM   2023 C CG1 . ILE A 1 270 ? 54.569  9.818   16.520  1.00 52.79  ? 270  ILE A CG1 1 
ATOM   2024 C CG2 . ILE A 1 270 ? 54.549  10.458  18.909  1.00 50.75  ? 270  ILE A CG2 1 
ATOM   2025 C CD1 . ILE A 1 270 ? 54.625  8.326   16.388  1.00 54.85  ? 270  ILE A CD1 1 
ATOM   2026 N N   . ALA A 1 271 ? 57.841  12.053  18.827  1.00 55.31  ? 271  ALA A N   1 
ATOM   2027 C CA  . ALA A 1 271 ? 58.540  12.771  19.887  1.00 56.42  ? 271  ALA A CA  1 
ATOM   2028 C C   . ALA A 1 271 ? 58.537  14.282  19.620  1.00 56.19  ? 271  ALA A C   1 
ATOM   2029 O O   . ALA A 1 271 ? 58.280  15.087  20.525  1.00 55.64  ? 271  ALA A O   1 
ATOM   2030 C CB  . ALA A 1 271 ? 59.989  12.240  20.073  1.00 57.81  ? 271  ALA A CB  1 
ATOM   2031 N N   . CYS A 1 272 ? 58.807  14.658  18.372  1.00 56.70  ? 272  CYS A N   1 
ATOM   2032 C CA  . CYS A 1 272 ? 58.873  16.066  18.010  1.00 57.08  ? 272  CYS A CA  1 
ATOM   2033 C C   . CYS A 1 272 ? 57.473  16.692  18.054  1.00 54.20  ? 272  CYS A C   1 
ATOM   2034 O O   . CYS A 1 272 ? 57.276  17.728  18.694  1.00 53.78  ? 272  CYS A O   1 
ATOM   2035 C CB  . CYS A 1 272 ? 59.583  16.246  16.663  1.00 58.77  ? 272  CYS A CB  1 
ATOM   2036 S SG  . CYS A 1 272 ? 59.634  17.939  16.022  1.00 62.69  ? 272  CYS A SG  1 
ATOM   2037 N N   . LEU A 1 273 ? 56.495  16.044  17.423  1.00 52.03  ? 273  LEU A N   1 
ATOM   2038 C CA  . LEU A 1 273 ? 55.100  16.473  17.549  1.00 49.83  ? 273  LEU A CA  1 
ATOM   2039 C C   . LEU A 1 273 ? 54.669  16.664  19.004  1.00 49.32  ? 273  LEU A C   1 
ATOM   2040 O O   . LEU A 1 273 ? 53.846  17.535  19.310  1.00 48.07  ? 273  LEU A O   1 
ATOM   2041 C CB  . LEU A 1 273 ? 54.156  15.487  16.869  1.00 48.31  ? 273  LEU A CB  1 
ATOM   2042 C CG  . LEU A 1 273 ? 53.846  15.726  15.398  1.00 47.43  ? 273  LEU A CG  1 
ATOM   2043 C CD1 . LEU A 1 273 ? 53.056  14.565  14.833  1.00 46.43  ? 273  LEU A CD1 1 
ATOM   2044 C CD2 . LEU A 1 273 ? 53.065  17.010  15.249  1.00 46.16  ? 273  LEU A CD2 1 
ATOM   2045 N N   A ARG A 1 274 ? 55.243  15.854  19.891  0.50 49.71  ? 274  ARG A N   1 
ATOM   2046 N N   B ARG A 1 274 ? 55.256  15.868  19.895  0.50 49.95  ? 274  ARG A N   1 
ATOM   2047 C CA  A ARG A 1 274 ? 54.868  15.846  21.297  0.50 49.10  ? 274  ARG A CA  1 
ATOM   2048 C CA  B ARG A 1 274 ? 54.854  15.855  21.295  0.50 49.52  ? 274  ARG A CA  1 
ATOM   2049 C C   A ARG A 1 274 ? 55.343  17.106  22.026  0.50 50.24  ? 274  ARG A C   1 
ATOM   2050 C C   B ARG A 1 274 ? 55.442  17.019  22.101  0.50 50.60  ? 274  ARG A C   1 
ATOM   2051 O O   A ARG A 1 274 ? 54.749  17.514  23.029  0.50 49.91  ? 274  ARG A O   1 
ATOM   2052 O O   B ARG A 1 274 ? 55.019  17.280  23.230  0.50 50.48  ? 274  ARG A O   1 
ATOM   2053 C CB  A ARG A 1 274 ? 55.421  14.596  21.966  0.50 49.30  ? 274  ARG A CB  1 
ATOM   2054 C CB  B ARG A 1 274 ? 55.187  14.503  21.919  0.50 49.63  ? 274  ARG A CB  1 
ATOM   2055 C CG  A ARG A 1 274 ? 54.395  13.815  22.720  0.50 46.93  ? 274  ARG A CG  1 
ATOM   2056 C CG  B ARG A 1 274 ? 53.989  13.859  22.549  0.50 48.35  ? 274  ARG A CG  1 
ATOM   2057 C CD  A ARG A 1 274 ? 54.789  12.354  22.817  0.50 45.07  ? 274  ARG A CD  1 
ATOM   2058 C CD  B ARG A 1 274 ? 53.718  12.466  22.002  0.50 48.19  ? 274  ARG A CD  1 
ATOM   2059 N NE  A ARG A 1 274 ? 56.170  12.188  23.255  0.50 44.64  ? 274  ARG A NE  1 
ATOM   2060 N NE  B ARG A 1 274 ? 54.555  11.426  22.599  0.50 48.75  ? 274  ARG A NE  1 
ATOM   2061 C CZ  A ARG A 1 274 ? 56.933  11.156  22.915  0.50 42.79  ? 274  ARG A CZ  1 
ATOM   2062 C CZ  B ARG A 1 274 ? 54.226  10.138  22.644  0.50 48.49  ? 274  ARG A CZ  1 
ATOM   2063 N NH1 A ARG A 1 274 ? 56.440  10.213  22.128  0.50 40.35  ? 274  ARG A NH1 1 
ATOM   2064 N NH1 B ARG A 1 274 ? 53.064  9.721   22.142  0.50 44.57  ? 274  ARG A NH1 1 
ATOM   2065 N NH2 A ARG A 1 274 ? 58.178  11.079  23.353  0.50 41.87  ? 274  ARG A NH2 1 
ATOM   2066 N NH2 B ARG A 1 274 ? 55.056  9.265   23.206  0.50 50.11  ? 274  ARG A NH2 1 
ATOM   2067 N N   . THR A 1 275 ? 56.398  17.728  21.510  1.00 51.74  ? 275  THR A N   1 
ATOM   2068 C CA  . THR A 1 275 ? 56.926  18.947  22.107  1.00 53.00  ? 275  THR A CA  1 
ATOM   2069 C C   . THR A 1 275 ? 56.136  20.163  21.628  1.00 52.44  ? 275  THR A C   1 
ATOM   2070 O O   . THR A 1 275 ? 56.311  21.240  22.145  1.00 53.24  ? 275  THR A O   1 
ATOM   2071 C CB  . THR A 1 275 ? 58.437  19.183  21.781  1.00 54.93  ? 275  THR A CB  1 
ATOM   2072 O OG1 . THR A 1 275 ? 58.597  19.322  20.373  1.00 54.31  ? 275  THR A OG1 1 
ATOM   2073 C CG2 . THR A 1 275 ? 59.295  18.053  22.254  1.00 54.90  ? 275  THR A CG2 1 
ATOM   2074 N N   . ARG A 1 276 ? 55.277  20.004  20.633  1.00 51.72  ? 276  ARG A N   1 
ATOM   2075 C CA  . ARG A 1 276 ? 54.524  21.158  20.127  1.00 51.60  ? 276  ARG A CA  1 
ATOM   2076 C C   . ARG A 1 276 ? 53.347  21.534  21.032  1.00 50.56  ? 276  ARG A C   1 
ATOM   2077 O O   . ARG A 1 276 ? 52.697  20.664  21.620  1.00 49.31  ? 276  ARG A O   1 
ATOM   2078 C CB  . ARG A 1 276 ? 54.045  20.931  18.691  1.00 50.79  ? 276  ARG A CB  1 
ATOM   2079 C CG  . ARG A 1 276 ? 55.168  20.857  17.685  1.00 53.42  ? 276  ARG A CG  1 
ATOM   2080 C CD  . ARG A 1 276 ? 55.828  22.194  17.534  1.00 58.07  ? 276  ARG A CD  1 
ATOM   2081 N NE  . ARG A 1 276 ? 57.120  22.086  16.872  1.00 65.03  ? 276  ARG A NE  1 
ATOM   2082 C CZ  . ARG A 1 276 ? 58.296  21.903  17.486  1.00 68.26  ? 276  ARG A CZ  1 
ATOM   2083 N NH1 . ARG A 1 276 ? 58.370  21.790  18.812  1.00 67.48  ? 276  ARG A NH1 1 
ATOM   2084 N NH2 . ARG A 1 276 ? 59.415  21.840  16.756  1.00 70.59  ? 276  ARG A NH2 1 
ATOM   2085 N N   . PRO A 1 277 ? 53.067  22.841  21.146  1.00 50.97  ? 277  PRO A N   1 
ATOM   2086 C CA  . PRO A 1 277 ? 51.938  23.277  21.960  1.00 49.83  ? 277  PRO A CA  1 
ATOM   2087 C C   . PRO A 1 277 ? 50.621  22.838  21.324  1.00 47.79  ? 277  PRO A C   1 
ATOM   2088 O O   . PRO A 1 277 ? 50.519  22.789  20.110  1.00 47.61  ? 277  PRO A O   1 
ATOM   2089 C CB  . PRO A 1 277 ? 52.054  24.807  21.921  1.00 50.82  ? 277  PRO A CB  1 
ATOM   2090 C CG  . PRO A 1 277 ? 53.444  25.092  21.439  1.00 52.67  ? 277  PRO A CG  1 
ATOM   2091 C CD  . PRO A 1 277 ? 53.748  23.979  20.506  1.00 52.06  ? 277  PRO A CD  1 
ATOM   2092 N N   . ALA A 1 278 ? 49.620  22.526  22.131  1.00 46.60  ? 278  ALA A N   1 
ATOM   2093 C CA  . ALA A 1 278 ? 48.308  22.135  21.598  1.00 45.25  ? 278  ALA A CA  1 
ATOM   2094 C C   . ALA A 1 278 ? 47.752  23.065  20.514  1.00 44.96  ? 278  ALA A C   1 
ATOM   2095 O O   . ALA A 1 278 ? 47.324  22.583  19.475  1.00 43.74  ? 278  ALA A O   1 
ATOM   2096 C CB  . ALA A 1 278 ? 47.281  21.934  22.729  1.00 43.98  ? 278  ALA A CB  1 
ATOM   2097 N N   . GLN A 1 279 ? 47.772  24.381  20.742  1.00 46.35  ? 279  GLN A N   1 
ATOM   2098 C CA  . GLN A 1 279 ? 47.092  25.313  19.822  1.00 46.94  ? 279  GLN A CA  1 
ATOM   2099 C C   . GLN A 1 279 ? 47.744  25.258  18.466  1.00 48.03  ? 279  GLN A C   1 
ATOM   2100 O O   . GLN A 1 279 ? 47.108  25.462  17.422  1.00 48.11  ? 279  GLN A O   1 
ATOM   2101 C CB  . GLN A 1 279 ? 47.073  26.753  20.349  1.00 47.79  ? 279  GLN A CB  1 
ATOM   2102 C CG  . GLN A 1 279 ? 46.172  27.691  19.553  1.00 46.55  ? 279  GLN A CG  1 
ATOM   2103 C CD  . GLN A 1 279 ? 44.708  27.265  19.563  1.00 46.38  ? 279  GLN A CD  1 
ATOM   2104 O OE1 . GLN A 1 279 ? 44.108  27.041  20.626  1.00 46.12  ? 279  GLN A OE1 1 
ATOM   2105 N NE2 . GLN A 1 279 ? 44.117  27.181  18.376  1.00 44.86  ? 279  GLN A NE2 1 
ATOM   2106 N N   . ASP A 1 280 ? 49.021  24.933  18.495  1.00 49.60  ? 280  ASP A N   1 
ATOM   2107 C CA  . ASP A 1 280 ? 49.812  24.852  17.297  1.00 51.01  ? 280  ASP A CA  1 
ATOM   2108 C C   . ASP A 1 280 ? 49.400  23.695  16.380  1.00 49.61  ? 280  ASP A C   1 
ATOM   2109 O O   . ASP A 1 280 ? 49.415  23.832  15.167  1.00 49.75  ? 280  ASP A O   1 
ATOM   2110 C CB  . ASP A 1 280 ? 51.271  24.737  17.676  1.00 53.19  ? 280  ASP A CB  1 
ATOM   2111 C CG  . ASP A 1 280 ? 52.118  25.675  16.915  1.00 57.16  ? 280  ASP A CG  1 
ATOM   2112 O OD1 . ASP A 1 280 ? 51.845  25.829  15.703  1.00 61.16  ? 280  ASP A OD1 1 
ATOM   2113 O OD2 . ASP A 1 280 ? 53.033  26.275  17.526  1.00 61.23  ? 280  ASP A OD2 1 
ATOM   2114 N N   . LEU A 1 281 ? 49.029  22.563  16.961  1.00 48.46  ? 281  LEU A N   1 
ATOM   2115 C CA  . LEU A 1 281 ? 48.528  21.441  16.174  1.00 47.17  ? 281  LEU A CA  1 
ATOM   2116 C C   . LEU A 1 281 ? 47.196  21.811  15.565  1.00 45.84  ? 281  LEU A C   1 
ATOM   2117 O O   . LEU A 1 281 ? 46.959  21.529  14.394  1.00 45.63  ? 281  LEU A O   1 
ATOM   2118 C CB  . LEU A 1 281 ? 48.448  20.148  17.005  1.00 46.71  ? 281  LEU A CB  1 
ATOM   2119 C CG  . LEU A 1 281 ? 49.776  19.693  17.643  1.00 47.83  ? 281  LEU A CG  1 
ATOM   2120 C CD1 . LEU A 1 281 ? 49.656  18.366  18.307  1.00 47.78  ? 281  LEU A CD1 1 
ATOM   2121 C CD2 . LEU A 1 281 ? 50.940  19.651  16.647  1.00 48.82  ? 281  LEU A CD2 1 
ATOM   2122 N N   . VAL A 1 282 ? 46.354  22.496  16.341  1.00 45.40  ? 282  VAL A N   1 
ATOM   2123 C CA  . VAL A 1 282 ? 45.037  22.931  15.865  1.00 44.18  ? 282  VAL A CA  1 
ATOM   2124 C C   . VAL A 1 282 ? 45.163  23.930  14.707  1.00 45.09  ? 282  VAL A C   1 
ATOM   2125 O O   . VAL A 1 282 ? 44.456  23.798  13.703  1.00 44.34  ? 282  VAL A O   1 
ATOM   2126 C CB  . VAL A 1 282 ? 44.149  23.489  17.017  1.00 43.73  ? 282  VAL A CB  1 
ATOM   2127 C CG1 . VAL A 1 282 ? 42.921  24.184  16.477  1.00 41.85  ? 282  VAL A CG1 1 
ATOM   2128 C CG2 . VAL A 1 282 ? 43.728  22.363  17.980  1.00 42.09  ? 282  VAL A CG2 1 
ATOM   2129 N N   . ASP A 1 283 ? 46.074  24.899  14.834  1.00 46.39  ? 283  ASP A N   1 
ATOM   2130 C CA  . ASP A 1 283 ? 46.296  25.892  13.769  1.00 47.87  ? 283  ASP A CA  1 
ATOM   2131 C C   . ASP A 1 283 ? 46.637  25.304  12.386  1.00 48.27  ? 283  ASP A C   1 
ATOM   2132 O O   . ASP A 1 283 ? 46.477  25.995  11.383  1.00 48.64  ? 283  ASP A O   1 
ATOM   2133 C CB  . ASP A 1 283 ? 47.395  26.905  14.134  1.00 49.62  ? 283  ASP A CB  1 
ATOM   2134 C CG  . ASP A 1 283 ? 47.030  27.820  15.322  1.00 51.01  ? 283  ASP A CG  1 
ATOM   2135 O OD1 . ASP A 1 283 ? 45.834  27.929  15.704  1.00 47.39  ? 283  ASP A OD1 1 
ATOM   2136 O OD2 . ASP A 1 283 ? 47.986  28.448  15.864  1.00 54.49  ? 283  ASP A OD2 1 
ATOM   2137 N N   . HIS A 1 284 ? 47.100  24.050  12.326  1.00 48.43  ? 284  HIS A N   1 
ATOM   2138 C CA  . HIS A 1 284 ? 47.480  23.434  11.044  1.00 49.07  ? 284  HIS A CA  1 
ATOM   2139 C C   . HIS A 1 284 ? 46.648  22.218  10.646  1.00 47.97  ? 284  HIS A C   1 
ATOM   2140 O O   . HIS A 1 284 ? 46.748  21.737  9.533   1.00 47.81  ? 284  HIS A O   1 
ATOM   2141 C CB  . HIS A 1 284 ? 48.963  23.082  11.019  1.00 50.25  ? 284  HIS A CB  1 
ATOM   2142 C CG  . HIS A 1 284 ? 49.862  24.267  11.100  1.00 52.40  ? 284  HIS A CG  1 
ATOM   2143 N ND1 . HIS A 1 284 ? 50.420  24.696  12.286  1.00 53.25  ? 284  HIS A ND1 1 
ATOM   2144 C CD2 . HIS A 1 284 ? 50.300  25.120  10.142  1.00 53.90  ? 284  HIS A CD2 1 
ATOM   2145 C CE1 . HIS A 1 284 ? 51.165  25.763  12.054  1.00 54.72  ? 284  HIS A CE1 1 
ATOM   2146 N NE2 . HIS A 1 284 ? 51.103  26.043  10.762  1.00 54.98  ? 284  HIS A NE2 1 
ATOM   2147 N N   . GLU A 1 285 ? 45.837  21.727  11.562  1.00 47.67  ? 285  GLU A N   1 
ATOM   2148 C CA  . GLU A 1 285 ? 44.938  20.587  11.323  1.00 47.78  ? 285  GLU A CA  1 
ATOM   2149 C C   . GLU A 1 285 ? 44.250  20.588  9.933   1.00 47.62  ? 285  GLU A C   1 
ATOM   2150 O O   . GLU A 1 285 ? 44.225  19.575  9.224   1.00 46.82  ? 285  GLU A O   1 
ATOM   2151 C CB  . GLU A 1 285 ? 43.877  20.639  12.402  1.00 46.61  ? 285  GLU A CB  1 
ATOM   2152 C CG  . GLU A 1 285 ? 43.263  19.360  12.756  1.00 48.30  ? 285  GLU A CG  1 
ATOM   2153 C CD  . GLU A 1 285 ? 42.138  19.575  13.738  1.00 49.48  ? 285  GLU A CD  1 
ATOM   2154 O OE1 . GLU A 1 285 ? 42.202  20.535  14.524  1.00 51.55  ? 285  GLU A OE1 1 
ATOM   2155 O OE2 . GLU A 1 285 ? 41.173  18.808  13.719  1.00 50.60  ? 285  GLU A OE2 1 
ATOM   2156 N N   . TRP A 1 286 ? 43.727  21.746  9.548   1.00 48.25  ? 286  TRP A N   1 
ATOM   2157 C CA  . TRP A 1 286 ? 42.876  21.871  8.369   1.00 49.41  ? 286  TRP A CA  1 
ATOM   2158 C C   . TRP A 1 286 ? 43.654  21.764  7.071   1.00 49.50  ? 286  TRP A C   1 
ATOM   2159 O O   . TRP A 1 286 ? 43.107  21.373  6.040   1.00 48.99  ? 286  TRP A O   1 
ATOM   2160 C CB  . TRP A 1 286 ? 42.115  23.195  8.446   1.00 50.33  ? 286  TRP A CB  1 
ATOM   2161 C CG  . TRP A 1 286 ? 41.150  23.502  7.327   1.00 56.67  ? 286  TRP A CG  1 
ATOM   2162 C CD1 . TRP A 1 286 ? 41.262  24.526  6.393   1.00 62.04  ? 286  TRP A CD1 1 
ATOM   2163 C CD2 . TRP A 1 286 ? 39.921  22.818  7.025   1.00 61.75  ? 286  TRP A CD2 1 
ATOM   2164 N NE1 . TRP A 1 286 ? 40.180  24.504  5.533   1.00 64.36  ? 286  TRP A NE1 1 
ATOM   2165 C CE2 . TRP A 1 286 ? 39.340  23.476  5.889   1.00 63.85  ? 286  TRP A CE2 1 
ATOM   2166 C CE3 . TRP A 1 286 ? 39.255  21.705  7.588   1.00 64.24  ? 286  TRP A CE3 1 
ATOM   2167 C CZ2 . TRP A 1 286 ? 38.111  23.061  5.305   1.00 64.70  ? 286  TRP A CZ2 1 
ATOM   2168 C CZ3 . TRP A 1 286 ? 38.005  21.288  7.011   1.00 66.52  ? 286  TRP A CZ3 1 
ATOM   2169 C CH2 . TRP A 1 286 ? 37.459  21.977  5.868   1.00 65.78  ? 286  TRP A CH2 1 
ATOM   2170 N N   . HIS A 1 287 ? 44.939  22.090  7.143   1.00 50.58  ? 287  HIS A N   1 
ATOM   2171 C CA  . HIS A 1 287 ? 45.813  22.146  5.974   1.00 51.79  ? 287  HIS A CA  1 
ATOM   2172 C C   . HIS A 1 287 ? 46.278  20.799  5.384   1.00 51.01  ? 287  HIS A C   1 
ATOM   2173 O O   . HIS A 1 287 ? 47.018  20.778  4.385   1.00 52.18  ? 287  HIS A O   1 
ATOM   2174 C CB  . HIS A 1 287 ? 47.012  23.047  6.279   1.00 53.65  ? 287  HIS A CB  1 
ATOM   2175 C CG  . HIS A 1 287 ? 46.630  24.462  6.578   1.00 57.52  ? 287  HIS A CG  1 
ATOM   2176 N ND1 . HIS A 1 287 ? 47.019  25.111  7.730   1.00 61.40  ? 287  HIS A ND1 1 
ATOM   2177 C CD2 . HIS A 1 287 ? 45.877  25.349  5.881   1.00 60.42  ? 287  HIS A CD2 1 
ATOM   2178 C CE1 . HIS A 1 287 ? 46.532  26.339  7.727   1.00 62.73  ? 287  HIS A CE1 1 
ATOM   2179 N NE2 . HIS A 1 287 ? 45.829  26.506  6.620   1.00 62.84  ? 287  HIS A NE2 1 
ATOM   2180 N N   . VAL A 1 288 ? 45.846  19.685  5.969   1.00 48.80  ? 288  VAL A N   1 
ATOM   2181 C CA  . VAL A 1 288 ? 46.269  18.369  5.475   1.00 48.29  ? 288  VAL A CA  1 
ATOM   2182 C C   . VAL A 1 288 ? 45.226  17.683  4.583   1.00 47.33  ? 288  VAL A C   1 
ATOM   2183 O O   . VAL A 1 288 ? 45.449  16.582  4.101   1.00 46.58  ? 288  VAL A O   1 
ATOM   2184 C CB  . VAL A 1 288 ? 46.801  17.412  6.627   1.00 48.21  ? 288  VAL A CB  1 
ATOM   2185 C CG1 . VAL A 1 288 ? 47.922  18.086  7.443   1.00 47.47  ? 288  VAL A CG1 1 
ATOM   2186 C CG2 . VAL A 1 288 ? 45.649  16.909  7.533   1.00 46.32  ? 288  VAL A CG2 1 
ATOM   2187 N N   . LEU A 1 289 ? 44.092  18.336  4.355   1.00 47.19  ? 289  LEU A N   1 
ATOM   2188 C CA  . LEU A 1 289 ? 43.036  17.725  3.533   1.00 47.64  ? 289  LEU A CA  1 
ATOM   2189 C C   . LEU A 1 289 ? 43.456  17.639  2.062   1.00 48.99  ? 289  LEU A C   1 
ATOM   2190 O O   . LEU A 1 289 ? 43.929  18.616  1.493   1.00 49.48  ? 289  LEU A O   1 
ATOM   2191 C CB  . LEU A 1 289 ? 41.712  18.465  3.669   1.00 46.17  ? 289  LEU A CB  1 
ATOM   2192 C CG  . LEU A 1 289 ? 40.924  18.246  4.963   1.00 46.34  ? 289  LEU A CG  1 
ATOM   2193 C CD1 . LEU A 1 289 ? 39.799  19.264  5.035   1.00 43.81  ? 289  LEU A CD1 1 
ATOM   2194 C CD2 . LEU A 1 289 ? 40.364  16.816  5.111   1.00 45.41  ? 289  LEU A CD2 1 
ATOM   2195 N N   . PRO A 1 290 ? 43.285  16.460  1.445   1.00 49.94  ? 290  PRO A N   1 
ATOM   2196 C CA  . PRO A 1 290 ? 43.822  16.280  0.089   1.00 51.54  ? 290  PRO A CA  1 
ATOM   2197 C C   . PRO A 1 290 ? 43.165  17.154  -1.007  1.00 52.24  ? 290  PRO A C   1 
ATOM   2198 O O   . PRO A 1 290 ? 43.810  17.452  -2.001  1.00 53.23  ? 290  PRO A O   1 
ATOM   2199 C CB  . PRO A 1 290 ? 43.629  14.783  -0.183  1.00 51.56  ? 290  PRO A CB  1 
ATOM   2200 C CG  . PRO A 1 290 ? 42.737  14.249  0.912   1.00 49.76  ? 290  PRO A CG  1 
ATOM   2201 C CD  . PRO A 1 290 ? 42.453  15.326  1.895   1.00 48.92  ? 290  PRO A CD  1 
ATOM   2202 N N   . GLN A 1 291 ? 41.907  17.556  -0.829  1.00 52.36  ? 291  GLN A N   1 
ATOM   2203 C CA  . GLN A 1 291 ? 41.241  18.462  -1.780  1.00 53.56  ? 291  GLN A CA  1 
ATOM   2204 C C   . GLN A 1 291 ? 40.459  19.555  -1.066  1.00 52.81  ? 291  GLN A C   1 
ATOM   2205 O O   . GLN A 1 291 ? 40.179  19.445  0.123   1.00 52.83  ? 291  GLN A O   1 
ATOM   2206 C CB  . GLN A 1 291 ? 40.275  17.702  -2.704  1.00 53.94  ? 291  GLN A CB  1 
ATOM   2207 C CG  . GLN A 1 291 ? 40.853  16.492  -3.430  1.00 56.57  ? 291  GLN A CG  1 
ATOM   2208 C CD  . GLN A 1 291 ? 40.700  15.234  -2.606  1.00 59.29  ? 291  GLN A CD  1 
ATOM   2209 O OE1 . GLN A 1 291 ? 39.952  15.217  -1.603  1.00 60.76  ? 291  GLN A OE1 1 
ATOM   2210 N NE2 . GLN A 1 291 ? 41.404  14.168  -3.005  1.00 58.61  ? 291  GLN A NE2 1 
ATOM   2211 N N   . GLU A 1 292 ? 40.096  20.603  -1.801  1.00 53.02  ? 292  GLU A N   1 
ATOM   2212 C CA  . GLU A 1 292 ? 39.069  21.538  -1.366  1.00 52.37  ? 292  GLU A CA  1 
ATOM   2213 C C   . GLU A 1 292 ? 37.769  20.724  -1.150  1.00 50.50  ? 292  GLU A C   1 
ATOM   2214 O O   . GLU A 1 292 ? 37.316  20.018  -2.053  1.00 50.51  ? 292  GLU A O   1 
ATOM   2215 C CB  . GLU A 1 292 ? 38.899  22.627  -2.438  1.00 53.67  ? 292  GLU A CB  1 
ATOM   2216 C CG  . GLU A 1 292 ? 37.852  23.694  -2.127  1.00 57.29  ? 292  GLU A CG  1 
ATOM   2217 C CD  . GLU A 1 292 ? 37.800  24.841  -3.161  1.00 64.01  ? 292  GLU A CD  1 
ATOM   2218 O OE1 . GLU A 1 292 ? 38.321  24.696  -4.297  1.00 66.24  ? 292  GLU A OE1 1 
ATOM   2219 O OE2 . GLU A 1 292 ? 37.215  25.904  -2.834  1.00 66.07  ? 292  GLU A OE2 1 
ATOM   2220 N N   . SER A 1 293 ? 37.185  20.787  0.044   1.00 48.39  ? 293  SER A N   1 
ATOM   2221 C CA  . SER A 1 293 ? 36.022  19.937  0.337   1.00 46.75  ? 293  SER A CA  1 
ATOM   2222 C C   . SER A 1 293 ? 35.158  20.434  1.472   1.00 44.93  ? 293  SER A C   1 
ATOM   2223 O O   . SER A 1 293 ? 35.568  21.280  2.235   1.00 44.94  ? 293  SER A O   1 
ATOM   2224 C CB  . SER A 1 293 ? 36.455  18.501  0.640   1.00 46.64  ? 293  SER A CB  1 
ATOM   2225 O OG  . SER A 1 293 ? 37.341  18.446  1.741   1.00 48.32  ? 293  SER A OG  1 
ATOM   2226 N N   . ILE A 1 294 ? 33.938  19.926  1.535   1.00 43.64  ? 294  ILE A N   1 
ATOM   2227 C CA  . ILE A 1 294 ? 33.100  20.044  2.718   1.00 41.95  ? 294  ILE A CA  1 
ATOM   2228 C C   . ILE A 1 294 ? 32.720  18.633  3.144   1.00 41.02  ? 294  ILE A C   1 
ATOM   2229 O O   . ILE A 1 294 ? 32.834  17.691  2.359   1.00 41.01  ? 294  ILE A O   1 
ATOM   2230 C CB  . ILE A 1 294 ? 31.835  20.898  2.483   1.00 42.19  ? 294  ILE A CB  1 
ATOM   2231 C CG1 . ILE A 1 294 ? 30.998  20.336  1.328   1.00 41.86  ? 294  ILE A CG1 1 
ATOM   2232 C CG2 . ILE A 1 294 ? 32.211  22.371  2.265   1.00 42.86  ? 294  ILE A CG2 1 
ATOM   2233 C CD1 . ILE A 1 294 ? 29.653  20.878  1.251   1.00 40.02  ? 294  ILE A CD1 1 
ATOM   2234 N N   . PHE A 1 295 ? 32.302  18.502  4.400   1.00 39.81  ? 295  PHE A N   1 
ATOM   2235 C CA  . PHE A 1 295 ? 32.028  17.232  5.044   1.00 38.66  ? 295  PHE A CA  1 
ATOM   2236 C C   . PHE A 1 295 ? 33.241  16.286  5.003   1.00 38.81  ? 295  PHE A C   1 
ATOM   2237 O O   . PHE A 1 295 ? 33.108  15.058  4.843   1.00 38.56  ? 295  PHE A O   1 
ATOM   2238 C CB  . PHE A 1 295 ? 30.793  16.560  4.448   1.00 38.46  ? 295  PHE A CB  1 
ATOM   2239 C CG  . PHE A 1 295 ? 29.890  15.987  5.479   1.00 38.84  ? 295  PHE A CG  1 
ATOM   2240 C CD1 . PHE A 1 295 ? 30.398  15.146  6.477   1.00 37.94  ? 295  PHE A CD1 1 
ATOM   2241 C CD2 . PHE A 1 295 ? 28.517  16.312  5.491   1.00 38.05  ? 295  PHE A CD2 1 
ATOM   2242 C CE1 . PHE A 1 295 ? 29.557  14.630  7.458   1.00 36.50  ? 295  PHE A CE1 1 
ATOM   2243 C CE2 . PHE A 1 295 ? 27.675  15.797  6.462   1.00 37.08  ? 295  PHE A CE2 1 
ATOM   2244 C CZ  . PHE A 1 295 ? 28.196  14.955  7.451   1.00 36.66  ? 295  PHE A CZ  1 
ATOM   2245 N N   . ARG A 1 296 ? 34.420  16.866  5.149   1.00 38.34  ? 296  ARG A N   1 
ATOM   2246 C CA  . ARG A 1 296 ? 35.630  16.067  5.332   1.00 38.77  ? 296  ARG A CA  1 
ATOM   2247 C C   . ARG A 1 296 ? 36.440  16.645  6.473   1.00 38.53  ? 296  ARG A C   1 
ATOM   2248 O O   . ARG A 1 296 ? 36.571  17.888  6.610   1.00 39.52  ? 296  ARG A O   1 
ATOM   2249 C CB  . ARG A 1 296 ? 36.483  15.980  4.059   1.00 38.70  ? 296  ARG A CB  1 
ATOM   2250 C CG  . ARG A 1 296 ? 35.812  15.346  2.881   1.00 38.25  ? 296  ARG A CG  1 
ATOM   2251 C CD  . ARG A 1 296 ? 35.548  13.859  3.068   1.00 37.92  ? 296  ARG A CD  1 
ATOM   2252 N NE  . ARG A 1 296 ? 35.011  13.258  1.842   1.00 40.95  ? 296  ARG A NE  1 
ATOM   2253 C CZ  . ARG A 1 296 ? 33.712  13.167  1.538   1.00 41.03  ? 296  ARG A CZ  1 
ATOM   2254 N NH1 . ARG A 1 296 ? 32.783  13.646  2.357   1.00 41.96  ? 296  ARG A NH1 1 
ATOM   2255 N NH2 . ARG A 1 296 ? 33.339  12.624  0.392   1.00 40.07  ? 296  ARG A NH2 1 
ATOM   2256 N N   . PHE A 1 297 ? 36.982  15.739  7.280   1.00 37.62  ? 297  PHE A N   1 
ATOM   2257 C CA  . PHE A 1 297 ? 37.680  16.105  8.485   1.00 37.01  ? 297  PHE A CA  1 
ATOM   2258 C C   . PHE A 1 297 ? 39.055  15.456  8.503   1.00 37.95  ? 297  PHE A C   1 
ATOM   2259 O O   . PHE A 1 297 ? 39.228  14.337  8.005   1.00 38.37  ? 297  PHE A O   1 
ATOM   2260 C CB  . PHE A 1 297 ? 36.832  15.706  9.675   1.00 36.23  ? 297  PHE A CB  1 
ATOM   2261 C CG  . PHE A 1 297 ? 35.358  16.000  9.483   1.00 35.80  ? 297  PHE A CG  1 
ATOM   2262 C CD1 . PHE A 1 297 ? 34.876  17.315  9.578   1.00 31.93  ? 297  PHE A CD1 1 
ATOM   2263 C CD2 . PHE A 1 297 ? 34.453  14.970  9.176   1.00 32.43  ? 297  PHE A CD2 1 
ATOM   2264 C CE1 . PHE A 1 297 ? 33.508  17.596  9.401   1.00 32.68  ? 297  PHE A CE1 1 
ATOM   2265 C CE2 . PHE A 1 297 ? 33.082  15.257  8.984   1.00 31.69  ? 297  PHE A CE2 1 
ATOM   2266 C CZ  . PHE A 1 297 ? 32.603  16.570  9.113   1.00 29.53  ? 297  PHE A CZ  1 
ATOM   2267 N N   . SER A 1 298 ? 40.033  16.167  9.058   1.00 38.09  ? 298  SER A N   1 
ATOM   2268 C CA  . SER A 1 298 ? 41.436  15.810  8.894   1.00 38.73  ? 298  SER A CA  1 
ATOM   2269 C C   . SER A 1 298 ? 41.855  14.558  9.646   1.00 39.20  ? 298  SER A C   1 
ATOM   2270 O O   . SER A 1 298 ? 42.598  13.719  9.114   1.00 40.57  ? 298  SER A O   1 
ATOM   2271 C CB  . SER A 1 298 ? 42.310  16.962  9.328   1.00 38.94  ? 298  SER A CB  1 
ATOM   2272 O OG  . SER A 1 298 ? 42.238  18.003  8.383   1.00 40.20  ? 298  SER A OG  1 
ATOM   2273 N N   . PHE A 1 299 ? 41.394  14.423  10.886  1.00 38.15  ? 299  PHE A N   1 
ATOM   2274 C CA  . PHE A 1 299 ? 41.858  13.345  11.741  1.00 37.05  ? 299  PHE A CA  1 
ATOM   2275 C C   . PHE A 1 299 ? 40.674  12.575  12.262  1.00 36.40  ? 299  PHE A C   1 
ATOM   2276 O O   . PHE A 1 299 ? 39.961  13.051  13.124  1.00 36.45  ? 299  PHE A O   1 
ATOM   2277 C CB  . PHE A 1 299 ? 42.766  13.905  12.821  1.00 36.04  ? 299  PHE A CB  1 
ATOM   2278 C CG  . PHE A 1 299 ? 44.048  14.440  12.261  1.00 36.63  ? 299  PHE A CG  1 
ATOM   2279 C CD1 . PHE A 1 299 ? 45.092  13.582  11.951  1.00 36.34  ? 299  PHE A CD1 1 
ATOM   2280 C CD2 . PHE A 1 299 ? 44.191  15.795  11.966  1.00 35.46  ? 299  PHE A CD2 1 
ATOM   2281 C CE1 . PHE A 1 299 ? 46.283  14.069  11.387  1.00 38.17  ? 299  PHE A CE1 1 
ATOM   2282 C CE2 . PHE A 1 299 ? 45.360  16.290  11.404  1.00 36.26  ? 299  PHE A CE2 1 
ATOM   2283 C CZ  . PHE A 1 299 ? 46.428  15.427  11.121  1.00 36.72  ? 299  PHE A CZ  1 
ATOM   2284 N N   . VAL A 1 300 ? 40.452  11.401  11.682  1.00 36.37  ? 300  VAL A N   1 
ATOM   2285 C CA  . VAL A 1 300 ? 39.281  10.568  11.980  1.00 35.83  ? 300  VAL A CA  1 
ATOM   2286 C C   . VAL A 1 300 ? 39.706  9.105   12.191  1.00 36.95  ? 300  VAL A C   1 
ATOM   2287 O O   . VAL A 1 300 ? 40.886  8.771   12.061  1.00 37.43  ? 300  VAL A O   1 
ATOM   2288 C CB  . VAL A 1 300 ? 38.204  10.692  10.868  1.00 35.39  ? 300  VAL A CB  1 
ATOM   2289 C CG1 . VAL A 1 300 ? 37.836  12.167  10.639  1.00 34.19  ? 300  VAL A CG1 1 
ATOM   2290 C CG2 . VAL A 1 300 ? 38.673  10.074  9.549   1.00 36.33  ? 300  VAL A CG2 1 
ATOM   2291 N N   . PRO A 1 301 ? 38.758  8.230   12.551  1.00 36.91  ? 301  PRO A N   1 
ATOM   2292 C CA  . PRO A 1 301 ? 39.161  6.848   12.780  1.00 37.43  ? 301  PRO A CA  1 
ATOM   2293 C C   . PRO A 1 301 ? 39.849  6.247   11.565  1.00 38.88  ? 301  PRO A C   1 
ATOM   2294 O O   . PRO A 1 301 ? 39.434  6.486   10.424  1.00 39.03  ? 301  PRO A O   1 
ATOM   2295 C CB  . PRO A 1 301 ? 37.827  6.150   13.051  1.00 36.65  ? 301  PRO A CB  1 
ATOM   2296 C CG  . PRO A 1 301 ? 37.067  7.206   13.832  1.00 36.64  ? 301  PRO A CG  1 
ATOM   2297 C CD  . PRO A 1 301 ? 37.418  8.512   13.109  1.00 36.23  ? 301  PRO A CD  1 
ATOM   2298 N N   . VAL A 1 302 ? 40.889  5.467   11.813  1.00 39.72  ? 302  VAL A N   1 
ATOM   2299 C CA  . VAL A 1 302 ? 41.660  4.844   10.748  1.00 41.20  ? 302  VAL A CA  1 
ATOM   2300 C C   . VAL A 1 302 ? 41.459  3.299   10.733  1.00 42.86  ? 302  VAL A C   1 
ATOM   2301 O O   . VAL A 1 302 ? 41.341  2.650   11.800  1.00 43.24  ? 302  VAL A O   1 
ATOM   2302 C CB  . VAL A 1 302 ? 43.171  5.215   10.892  1.00 41.53  ? 302  VAL A CB  1 
ATOM   2303 C CG1 . VAL A 1 302 ? 43.698  4.803   12.253  1.00 41.08  ? 302  VAL A CG1 1 
ATOM   2304 C CG2 . VAL A 1 302 ? 44.006  4.570   9.814   1.00 42.84  ? 302  VAL A CG2 1 
ATOM   2305 N N   . VAL A 1 303 ? 41.436  2.719   9.534   1.00 43.32  ? 303  VAL A N   1 
ATOM   2306 C CA  . VAL A 1 303 ? 41.349  1.274   9.390   1.00 44.67  ? 303  VAL A CA  1 
ATOM   2307 C C   . VAL A 1 303 ? 42.739  0.694   9.687   1.00 46.76  ? 303  VAL A C   1 
ATOM   2308 O O   . VAL A 1 303 ? 43.616  0.635   8.812   1.00 47.61  ? 303  VAL A O   1 
ATOM   2309 C CB  . VAL A 1 303 ? 40.834  0.868   7.991   1.00 45.01  ? 303  VAL A CB  1 
ATOM   2310 C CG1 . VAL A 1 303 ? 40.656  -0.630  7.901   1.00 45.83  ? 303  VAL A CG1 1 
ATOM   2311 C CG2 . VAL A 1 303 ? 39.522  1.555   7.687   1.00 43.10  ? 303  VAL A CG2 1 
ATOM   2312 N N   . ASP A 1 304 ? 42.932  0.296   10.944  1.00 47.44  ? 304  ASP A N   1 
ATOM   2313 C CA  . ASP A 1 304 ? 44.240  -0.084  11.465  1.00 49.16  ? 304  ASP A CA  1 
ATOM   2314 C C   . ASP A 1 304 ? 44.475  -1.584  11.455  1.00 51.12  ? 304  ASP A C   1 
ATOM   2315 O O   . ASP A 1 304 ? 45.598  -2.029  11.679  1.00 52.31  ? 304  ASP A O   1 
ATOM   2316 C CB  . ASP A 1 304 ? 44.430  0.457   12.893  1.00 48.69  ? 304  ASP A CB  1 
ATOM   2317 C CG  . ASP A 1 304 ? 43.281  0.053   13.865  1.00 49.85  ? 304  ASP A CG  1 
ATOM   2318 O OD1 . ASP A 1 304 ? 42.195  -0.426  13.424  1.00 49.23  ? 304  ASP A OD1 1 
ATOM   2319 O OD2 . ASP A 1 304 ? 43.474  0.246   15.096  1.00 50.51  ? 304  ASP A OD2 1 
ATOM   2320 N N   . GLY A 1 305 ? 43.417  -2.351  11.198  1.00 51.59  ? 305  GLY A N   1 
ATOM   2321 C CA  . GLY A 1 305 ? 43.467  -3.804  11.309  1.00 53.89  ? 305  GLY A CA  1 
ATOM   2322 C C   . GLY A 1 305 ? 43.449  -4.289  12.757  1.00 54.79  ? 305  GLY A C   1 
ATOM   2323 O O   . GLY A 1 305 ? 43.704  -5.473  13.016  1.00 56.28  ? 305  GLY A O   1 
ATOM   2324 N N   . ASP A 1 306 ? 43.164  -3.375  13.697  1.00 53.54  ? 306  ASP A N   1 
ATOM   2325 C CA  . ASP A 1 306 ? 43.095  -3.689  15.130  1.00 53.69  ? 306  ASP A CA  1 
ATOM   2326 C C   . ASP A 1 306 ? 41.725  -3.319  15.698  1.00 52.33  ? 306  ASP A C   1 
ATOM   2327 O O   . ASP A 1 306 ? 40.855  -4.197  15.805  1.00 53.09  ? 306  ASP A O   1 
ATOM   2328 C CB  . ASP A 1 306 ? 44.227  -2.995  15.900  1.00 53.92  ? 306  ASP A CB  1 
ATOM   2329 C CG  . ASP A 1 306 ? 44.255  -3.347  17.402  1.00 55.65  ? 306  ASP A CG  1 
ATOM   2330 O OD1 . ASP A 1 306 ? 43.449  -4.180  17.896  1.00 55.82  ? 306  ASP A OD1 1 
ATOM   2331 O OD2 . ASP A 1 306 ? 45.108  -2.766  18.107  1.00 57.78  ? 306  ASP A OD2 1 
ATOM   2332 N N   . PHE A 1 307 ? 41.529  -2.048  16.073  1.00 50.18  ? 307  PHE A N   1 
ATOM   2333 C CA  . PHE A 1 307 ? 40.204  -1.579  16.478  1.00 48.54  ? 307  PHE A CA  1 
ATOM   2334 C C   . PHE A 1 307 ? 39.215  -1.889  15.359  1.00 48.90  ? 307  PHE A C   1 
ATOM   2335 O O   . PHE A 1 307 ? 38.121  -2.413  15.604  1.00 49.16  ? 307  PHE A O   1 
ATOM   2336 C CB  . PHE A 1 307 ? 40.182  -0.075  16.788  1.00 46.63  ? 307  PHE A CB  1 
ATOM   2337 C CG  . PHE A 1 307 ? 38.960  0.365   17.542  1.00 43.77  ? 307  PHE A CG  1 
ATOM   2338 C CD1 . PHE A 1 307 ? 37.723  0.487   16.897  1.00 41.31  ? 307  PHE A CD1 1 
ATOM   2339 C CD2 . PHE A 1 307 ? 39.031  0.651   18.910  1.00 43.35  ? 307  PHE A CD2 1 
ATOM   2340 C CE1 . PHE A 1 307 ? 36.558  0.882   17.599  1.00 37.55  ? 307  PHE A CE1 1 
ATOM   2341 C CE2 . PHE A 1 307 ? 37.863  1.064   19.633  1.00 41.27  ? 307  PHE A CE2 1 
ATOM   2342 C CZ  . PHE A 1 307 ? 36.626  1.162   18.966  1.00 38.21  ? 307  PHE A CZ  1 
ATOM   2343 N N   . LEU A 1 308 ? 39.612  -1.563  14.130  1.00 49.07  ? 308  LEU A N   1 
ATOM   2344 C CA  . LEU A 1 308 ? 38.794  -1.819  12.964  1.00 49.28  ? 308  LEU A CA  1 
ATOM   2345 C C   . LEU A 1 308 ? 39.516  -2.849  12.123  1.00 51.20  ? 308  LEU A C   1 
ATOM   2346 O O   . LEU A 1 308 ? 40.504  -2.524  11.472  1.00 51.81  ? 308  LEU A O   1 
ATOM   2347 C CB  . LEU A 1 308 ? 38.550  -0.520  12.186  1.00 47.65  ? 308  LEU A CB  1 
ATOM   2348 C CG  . LEU A 1 308 ? 37.430  0.398   12.680  1.00 46.28  ? 308  LEU A CG  1 
ATOM   2349 C CD1 . LEU A 1 308 ? 37.340  1.630   11.806  1.00 44.52  ? 308  LEU A CD1 1 
ATOM   2350 C CD2 . LEU A 1 308 ? 36.056  -0.324  12.715  1.00 45.89  ? 308  LEU A CD2 1 
ATOM   2351 N N   . SER A 1 309 ? 39.047  -4.098  12.150  1.00 52.85  ? 309  SER A N   1 
ATOM   2352 C CA  . SER A 1 309 ? 39.805  -5.195  11.531  1.00 55.05  ? 309  SER A CA  1 
ATOM   2353 C C   . SER A 1 309 ? 39.817  -5.120  9.993   1.00 55.62  ? 309  SER A C   1 
ATOM   2354 O O   . SER A 1 309 ? 40.702  -5.667  9.347   1.00 56.86  ? 309  SER A O   1 
ATOM   2355 C CB  . SER A 1 309 ? 39.358  -6.573  12.059  1.00 56.54  ? 309  SER A CB  1 
ATOM   2356 O OG  . SER A 1 309 ? 38.033  -6.900  11.661  1.00 57.46  ? 309  SER A OG  1 
ATOM   2357 N N   . ASP A 1 310 ? 38.848  -4.401  9.435   1.00 54.84  ? 310  ASP A N   1 
ATOM   2358 C CA  . ASP A 1 310 ? 38.721  -4.161  8.001   1.00 54.96  ? 310  ASP A CA  1 
ATOM   2359 C C   . ASP A 1 310 ? 37.825  -2.919  7.820   1.00 53.40  ? 310  ASP A C   1 
ATOM   2360 O O   . ASP A 1 310 ? 37.322  -2.371  8.802   1.00 51.95  ? 310  ASP A O   1 
ATOM   2361 C CB  . ASP A 1 310 ? 38.093  -5.389  7.342   1.00 56.44  ? 310  ASP A CB  1 
ATOM   2362 C CG  . ASP A 1 310 ? 38.436  -5.519  5.871   1.00 58.30  ? 310  ASP A CG  1 
ATOM   2363 O OD1 . ASP A 1 310 ? 38.976  -4.567  5.253   1.00 59.53  ? 310  ASP A OD1 1 
ATOM   2364 O OD2 . ASP A 1 310 ? 38.146  -6.595  5.326   1.00 59.88  ? 310  ASP A OD2 1 
ATOM   2365 N N   . THR A 1 311 ? 37.621  -2.469  6.586   1.00 53.47  ? 311  THR A N   1 
ATOM   2366 C CA  . THR A 1 311 ? 36.815  -1.275  6.340   1.00 52.73  ? 311  THR A CA  1 
ATOM   2367 C C   . THR A 1 311 ? 35.416  -1.480  6.883   1.00 52.63  ? 311  THR A C   1 
ATOM   2368 O O   . THR A 1 311 ? 34.899  -2.603  6.808   1.00 54.34  ? 311  THR A O   1 
ATOM   2369 C CB  . THR A 1 311 ? 36.642  -0.989  4.833   1.00 53.60  ? 311  THR A CB  1 
ATOM   2370 O OG1 . THR A 1 311 ? 35.874  -2.053  4.234   1.00 55.01  ? 311  THR A OG1 1 
ATOM   2371 C CG2 . THR A 1 311 ? 38.006  -0.807  4.126   1.00 52.86  ? 311  THR A CG2 1 
ATOM   2372 N N   . PRO A 1 312 ? 34.783  -0.409  7.412   1.00 51.27  ? 312  PRO A N   1 
ATOM   2373 C CA  . PRO A 1 312 ? 33.398  -0.533  7.866   1.00 51.32  ? 312  PRO A CA  1 
ATOM   2374 C C   . PRO A 1 312 ? 32.468  -1.204  6.850   1.00 52.99  ? 312  PRO A C   1 
ATOM   2375 O O   . PRO A 1 312 ? 31.667  -2.045  7.237   1.00 53.89  ? 312  PRO A O   1 
ATOM   2376 C CB  . PRO A 1 312 ? 32.998  0.922   8.139   1.00 49.56  ? 312  PRO A CB  1 
ATOM   2377 C CG  . PRO A 1 312 ? 34.237  1.507   8.636   1.00 48.35  ? 312  PRO A CG  1 
ATOM   2378 C CD  . PRO A 1 312 ? 35.319  0.924   7.740   1.00 49.74  ? 312  PRO A CD  1 
ATOM   2379 N N   . GLU A 1 313 ? 32.608  -0.866  5.569   1.00 54.45  ? 313  GLU A N   1 
ATOM   2380 C CA  . GLU A 1 313 ? 31.872  -1.519  4.482   1.00 56.63  ? 313  GLU A CA  1 
ATOM   2381 C C   . GLU A 1 313 ? 32.075  -3.056  4.477   1.00 57.96  ? 313  GLU A C   1 
ATOM   2382 O O   . GLU A 1 313 ? 31.114  -3.823  4.369   1.00 58.95  ? 313  GLU A O   1 
ATOM   2383 C CB  . GLU A 1 313 ? 32.246  -0.892  3.116   1.00 57.38  ? 313  GLU A CB  1 
ATOM   2384 C CG  . GLU A 1 313 ? 31.452  -1.483  1.919   1.00 64.15  ? 313  GLU A CG  1 
ATOM   2385 C CD  . GLU A 1 313 ? 32.044  -1.173  0.519   1.00 70.78  ? 313  GLU A CD  1 
ATOM   2386 O OE1 . GLU A 1 313 ? 32.277  -2.130  -0.264  1.00 73.77  ? 313  GLU A OE1 1 
ATOM   2387 O OE2 . GLU A 1 313 ? 32.256  0.020   0.187   1.00 72.61  ? 313  GLU A OE2 1 
ATOM   2388 N N   . ALA A 1 314 ? 33.312  -3.519  4.607   1.00 58.05  ? 314  ALA A N   1 
ATOM   2389 C CA  . ALA A 1 314 ? 33.524  -4.949  4.608   1.00 59.55  ? 314  ALA A CA  1 
ATOM   2390 C C   . ALA A 1 314 ? 32.870  -5.570  5.832   1.00 59.67  ? 314  ALA A C   1 
ATOM   2391 O O   . ALA A 1 314 ? 32.267  -6.638  5.734   1.00 61.18  ? 314  ALA A O   1 
ATOM   2392 C CB  . ALA A 1 314 ? 35.015  -5.299  4.530   1.00 60.24  ? 314  ALA A CB  1 
ATOM   2393 N N   . LEU A 1 315 ? 32.978  -4.903  6.981   1.00 58.36  ? 315  LEU A N   1 
ATOM   2394 C CA  . LEU A 1 315 ? 32.429  -5.457  8.227   1.00 58.43  ? 315  LEU A CA  1 
ATOM   2395 C C   . LEU A 1 315 ? 30.892  -5.484  8.271   1.00 58.97  ? 315  LEU A C   1 
ATOM   2396 O O   . LEU A 1 315 ? 30.320  -6.445  8.769   1.00 60.06  ? 315  LEU A O   1 
ATOM   2397 C CB  . LEU A 1 315 ? 33.012  -4.769  9.463   1.00 56.56  ? 315  LEU A CB  1 
ATOM   2398 C CG  . LEU A 1 315 ? 34.531  -4.864  9.645   1.00 56.41  ? 315  LEU A CG  1 
ATOM   2399 C CD1 . LEU A 1 315 ? 34.965  -4.040  10.827  1.00 52.77  ? 315  LEU A CD1 1 
ATOM   2400 C CD2 . LEU A 1 315 ? 35.028  -6.297  9.774   1.00 54.47  ? 315  LEU A CD2 1 
ATOM   2401 N N   . ILE A 1 316 ? 30.220  -4.465  7.739   1.00 58.72  ? 316  ILE A N   1 
ATOM   2402 C CA  . ILE A 1 316 ? 28.754  -4.538  7.647   1.00 60.02  ? 316  ILE A CA  1 
ATOM   2403 C C   . ILE A 1 316 ? 28.259  -5.562  6.602   1.00 62.63  ? 316  ILE A C   1 
ATOM   2404 O O   . ILE A 1 316 ? 27.238  -6.210  6.819   1.00 63.43  ? 316  ILE A O   1 
ATOM   2405 C CB  . ILE A 1 316 ? 28.053  -3.153  7.461   1.00 58.34  ? 316  ILE A CB  1 
ATOM   2406 C CG1 . ILE A 1 316 ? 28.273  -2.598  6.052   1.00 58.59  ? 316  ILE A CG1 1 
ATOM   2407 C CG2 . ILE A 1 316 ? 28.497  -2.171  8.547   1.00 56.73  ? 316  ILE A CG2 1 
ATOM   2408 C CD1 . ILE A 1 316 ? 27.576  -1.260  5.755   1.00 58.45  ? 316  ILE A CD1 1 
ATOM   2409 N N   . ASN A 1 317 ? 28.978  -5.710  5.484   1.00 64.44  ? 317  ASN A N   1 
ATOM   2410 C CA  . ASN A 1 317 ? 28.584  -6.673  4.445   1.00 67.34  ? 317  ASN A CA  1 
ATOM   2411 C C   . ASN A 1 317 ? 28.671  -8.130  4.912   1.00 69.26  ? 317  ASN A C   1 
ATOM   2412 O O   . ASN A 1 317 ? 27.931  -8.966  4.422   1.00 70.95  ? 317  ASN A O   1 
ATOM   2413 C CB  . ASN A 1 317 ? 29.385  -6.483  3.141   1.00 67.99  ? 317  ASN A CB  1 
ATOM   2414 C CG  . ASN A 1 317 ? 28.977  -5.217  2.352   1.00 68.71  ? 317  ASN A CG  1 
ATOM   2415 O OD1 . ASN A 1 317 ? 28.010  -4.517  2.709   1.00 69.65  ? 317  ASN A OD1 1 
ATOM   2416 N ND2 . ASN A 1 317 ? 29.724  -4.921  1.269   1.00 67.84  ? 317  ASN A ND2 1 
ATOM   2417 N N   . THR A 1 318 ? 29.553  -8.424  5.867   1.00 69.58  ? 318  THR A N   1 
ATOM   2418 C CA  . THR A 1 318 ? 29.803  -9.813  6.290   1.00 71.88  ? 318  THR A CA  1 
ATOM   2419 C C   . THR A 1 318 ? 29.520  -10.109 7.771   1.00 71.96  ? 318  THR A C   1 
ATOM   2420 O O   . THR A 1 318 ? 29.506  -11.269 8.182   1.00 73.49  ? 318  THR A O   1 
ATOM   2421 C CB  . THR A 1 318 ? 31.261  -10.235 6.010   1.00 72.70  ? 318  THR A CB  1 
ATOM   2422 O OG1 . THR A 1 318 ? 32.146  -9.476  6.853   1.00 71.05  ? 318  THR A OG1 1 
ATOM   2423 C CG2 . THR A 1 318 ? 31.618  -10.021 4.533   1.00 73.32  ? 318  THR A CG2 1 
ATOM   2424 N N   . GLY A 1 319 ? 29.329  -9.067  8.572   1.00 70.48  ? 319  GLY A N   1 
ATOM   2425 C CA  . GLY A 1 319 ? 28.983  -9.236  9.978   1.00 70.72  ? 319  GLY A CA  1 
ATOM   2426 C C   . GLY A 1 319 ? 27.717  -10.051 10.214  1.00 72.20  ? 319  GLY A C   1 
ATOM   2427 O O   . GLY A 1 319 ? 26.848  -10.173 9.335   1.00 72.65  ? 319  GLY A O   1 
ATOM   2428 N N   . ASP A 1 320 ? 27.635  -10.625 11.409  1.00 72.83  ? 320  ASP A N   1 
ATOM   2429 C CA  . ASP A 1 320 ? 26.465  -11.355 11.853  1.00 74.39  ? 320  ASP A CA  1 
ATOM   2430 C C   . ASP A 1 320 ? 25.882  -10.585 13.037  1.00 72.90  ? 320  ASP A C   1 
ATOM   2431 O O   . ASP A 1 320 ? 26.523  -10.457 14.088  1.00 72.46  ? 320  ASP A O   1 
ATOM   2432 C CB  . ASP A 1 320 ? 26.865  -12.787 12.232  1.00 76.79  ? 320  ASP A CB  1 
ATOM   2433 C CG  . ASP A 1 320 ? 25.875  -13.448 13.174  1.00 78.91  ? 320  ASP A CG  1 
ATOM   2434 O OD1 . ASP A 1 320 ? 24.691  -13.598 12.796  1.00 80.79  ? 320  ASP A OD1 1 
ATOM   2435 O OD2 . ASP A 1 320 ? 26.292  -13.818 14.294  1.00 80.32  ? 320  ASP A OD2 1 
ATOM   2436 N N   . PHE A 1 321 ? 24.678  -10.053 12.862  1.00 72.15  ? 321  PHE A N   1 
ATOM   2437 C CA  . PHE A 1 321 ? 24.146  -9.095  13.830  1.00 70.46  ? 321  PHE A CA  1 
ATOM   2438 C C   . PHE A 1 321 ? 22.857  -9.581  14.478  1.00 71.64  ? 321  PHE A C   1 
ATOM   2439 O O   . PHE A 1 321 ? 21.944  -8.782  14.730  1.00 70.82  ? 321  PHE A O   1 
ATOM   2440 C CB  . PHE A 1 321 ? 23.924  -7.740  13.150  1.00 68.87  ? 321  PHE A CB  1 
ATOM   2441 C CG  . PHE A 1 321 ? 25.160  -7.168  12.507  1.00 67.05  ? 321  PHE A CG  1 
ATOM   2442 C CD1 . PHE A 1 321 ? 26.165  -6.591  13.284  1.00 65.61  ? 321  PHE A CD1 1 
ATOM   2443 C CD2 . PHE A 1 321 ? 25.316  -7.198  11.123  1.00 67.34  ? 321  PHE A CD2 1 
ATOM   2444 C CE1 . PHE A 1 321 ? 27.312  -6.055  12.700  1.00 64.55  ? 321  PHE A CE1 1 
ATOM   2445 C CE2 . PHE A 1 321 ? 26.457  -6.668  10.522  1.00 66.48  ? 321  PHE A CE2 1 
ATOM   2446 C CZ  . PHE A 1 321 ? 27.458  -6.089  11.317  1.00 65.57  ? 321  PHE A CZ  1 
ATOM   2447 N N   . GLN A 1 322 ? 22.810  -10.884 14.775  1.00 73.22  ? 322  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 322 ? 21.576  -11.565 15.166  1.00 74.39  ? 322  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 322 ? 20.824  -10.969 16.349  1.00 72.85  ? 322  GLN A C   1 
ATOM   2450 O O   . GLN A 1 322 ? 19.600  -10.826 16.303  1.00 73.43  ? 322  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 322 ? 21.828  -13.047 15.415  1.00 77.10  ? 322  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 322 ? 21.432  -13.932 14.250  1.00 81.10  ? 322  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 322 ? 21.784  -15.391 14.487  1.00 85.95  ? 322  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 322 ? 21.707  -16.209 13.574  1.00 88.92  ? 322  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 322 ? 22.173  -15.725 15.718  1.00 86.50  ? 322  GLN A NE2 1 
ATOM   2456 N N   A ASP A 1 323 ? 21.587  -10.555 17.359  0.50 71.02  ? 323  ASP A N   1 
ATOM   2457 N N   B ASP A 1 323 ? 21.497  -10.686 17.449  0.50 71.34  ? 323  ASP A N   1 
ATOM   2458 C CA  A ASP A 1 323 ? 21.036  -10.068 18.620  0.50 69.96  ? 323  ASP A CA  1 
ATOM   2459 C CA  B ASP A 1 323 ? 20.764  -9.975  18.482  0.50 70.12  ? 323  ASP A CA  1 
ATOM   2460 C C   A ASP A 1 323 ? 20.815  -8.552  18.694  0.50 67.26  ? 323  ASP A C   1 
ATOM   2461 C C   B ASP A 1 323 ? 21.339  -8.616  18.768  0.50 67.19  ? 323  ASP A C   1 
ATOM   2462 O O   A ASP A 1 323 ? 20.166  -8.068  19.625  0.50 66.99  ? 323  ASP A O   1 
ATOM   2463 O O   B ASP A 1 323 ? 21.798  -8.314  19.871  0.50 66.47  ? 323  ASP A O   1 
ATOM   2464 C CB  A ASP A 1 323 ? 21.930  -10.525 19.789  0.50 70.39  ? 323  ASP A CB  1 
ATOM   2465 C CB  B ASP A 1 323 ? 20.444  -10.816 19.734  0.50 71.78  ? 323  ASP A CB  1 
ATOM   2466 C CG  A ASP A 1 323 ? 23.402  -10.188 19.574  0.50 69.62  ? 323  ASP A CG  1 
ATOM   2467 C CG  B ASP A 1 323 ? 18.937  -11.038 19.902  0.50 73.56  ? 323  ASP A CG  1 
ATOM   2468 O OD1 A ASP A 1 323 ? 23.719  -9.012  19.314  0.50 68.15  ? 323  ASP A OD1 1 
ATOM   2469 O OD1 B ASP A 1 323 ? 18.158  -10.071 19.637  0.50 74.56  ? 323  ASP A OD1 1 
ATOM   2470 O OD2 A ASP A 1 323 ? 24.248  -11.100 19.679  0.50 71.12  ? 323  ASP A OD2 1 
ATOM   2471 O OD2 B ASP A 1 323 ? 18.526  -12.162 20.284  0.50 75.35  ? 323  ASP A OD2 1 
ATOM   2472 N N   . LEU A 1 324 ? 21.327  -7.822  17.705  1.00 65.50  ? 324  LEU A N   1 
ATOM   2473 C CA  . LEU A 1 324 ? 21.499  -6.389  17.790  1.00 61.96  ? 324  LEU A CA  1 
ATOM   2474 C C   . LEU A 1 324 ? 20.212  -5.661  17.485  1.00 60.50  ? 324  LEU A C   1 
ATOM   2475 O O   . LEU A 1 324 ? 19.495  -5.972  16.528  1.00 60.91  ? 324  LEU A O   1 
ATOM   2476 C CB  . LEU A 1 324 ? 22.555  -5.933  16.804  1.00 60.98  ? 324  LEU A CB  1 
ATOM   2477 C CG  . LEU A 1 324 ? 23.012  -4.494  16.973  1.00 58.60  ? 324  LEU A CG  1 
ATOM   2478 C CD1 . LEU A 1 324 ? 23.800  -4.346  18.270  1.00 57.60  ? 324  LEU A CD1 1 
ATOM   2479 C CD2 . LEU A 1 324 ? 23.847  -4.142  15.786  1.00 57.43  ? 324  LEU A CD2 1 
ATOM   2480 N N   . GLN A 1 325 ? 19.934  -4.668  18.306  1.00 58.28  ? 325  GLN A N   1 
ATOM   2481 C CA  . GLN A 1 325 ? 18.804  -3.800  18.059  1.00 56.97  ? 325  GLN A CA  1 
ATOM   2482 C C   . GLN A 1 325 ? 19.268  -2.369  17.899  1.00 54.23  ? 325  GLN A C   1 
ATOM   2483 O O   . GLN A 1 325 ? 19.926  -1.808  18.785  1.00 53.30  ? 325  GLN A O   1 
ATOM   2484 C CB  . GLN A 1 325 ? 17.796  -3.970  19.173  1.00 57.73  ? 325  GLN A CB  1 
ATOM   2485 C CG  . GLN A 1 325 ? 17.476  -5.441  19.330  1.00 59.80  ? 325  GLN A CG  1 
ATOM   2486 C CD  . GLN A 1 325 ? 17.057  -5.809  20.719  1.00 61.84  ? 325  GLN A CD  1 
ATOM   2487 O OE1 . GLN A 1 325 ? 17.691  -5.423  21.715  1.00 60.42  ? 325  GLN A OE1 1 
ATOM   2488 N NE2 . GLN A 1 325 ? 15.973  -6.573  20.804  1.00 64.69  ? 325  GLN A NE2 1 
ATOM   2489 N N   . VAL A 1 326 ? 18.946  -1.806  16.741  1.00 52.66  ? 326  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 326 ? 19.392  -0.480  16.363  1.00 50.52  ? 326  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 326 ? 18.238  0.388   15.911  1.00 49.57  ? 326  VAL A C   1 
ATOM   2492 O O   . VAL A 1 326 ? 17.375  -0.041  15.136  1.00 50.57  ? 326  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 326 ? 20.404  -0.541  15.203  1.00 50.65  ? 326  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 326 ? 21.723  -1.090  15.674  1.00 50.54  ? 326  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 326 ? 19.858  -1.423  14.064  1.00 52.91  ? 326  VAL A CG2 1 
ATOM   2496 N N   . LEU A 1 327 ? 18.237  1.617   16.397  1.00 47.54  ? 327  LEU A N   1 
ATOM   2497 C CA  . LEU A 1 327 ? 17.384  2.657   15.879  1.00 46.48  ? 327  LEU A CA  1 
ATOM   2498 C C   . LEU A 1 327 ? 18.283  3.597   15.060  1.00 44.78  ? 327  LEU A C   1 
ATOM   2499 O O   . LEU A 1 327 ? 19.316  4.055   15.554  1.00 43.50  ? 327  LEU A O   1 
ATOM   2500 C CB  . LEU A 1 327 ? 16.679  3.378   17.037  1.00 46.58  ? 327  LEU A CB  1 
ATOM   2501 C CG  . LEU A 1 327 ? 15.832  4.650   16.800  1.00 47.44  ? 327  LEU A CG  1 
ATOM   2502 C CD1 . LEU A 1 327 ? 14.970  4.542   15.563  1.00 48.61  ? 327  LEU A CD1 1 
ATOM   2503 C CD2 . LEU A 1 327 ? 14.928  4.904   17.981  1.00 48.94  ? 327  LEU A CD2 1 
ATOM   2504 N N   . VAL A 1 328 ? 17.914  3.846   13.804  1.00 44.18  ? 328  VAL A N   1 
ATOM   2505 C CA  . VAL A 1 328 ? 18.739  4.668   12.897  1.00 43.21  ? 328  VAL A CA  1 
ATOM   2506 C C   . VAL A 1 328 ? 17.878  5.720   12.244  1.00 42.68  ? 328  VAL A C   1 
ATOM   2507 O O   . VAL A 1 328 ? 16.685  5.499   12.056  1.00 43.91  ? 328  VAL A O   1 
ATOM   2508 C CB  . VAL A 1 328 ? 19.466  3.822   11.773  1.00 43.35  ? 328  VAL A CB  1 
ATOM   2509 C CG1 . VAL A 1 328 ? 20.338  2.773   12.380  1.00 43.74  ? 328  VAL A CG1 1 
ATOM   2510 C CG2 . VAL A 1 328 ? 18.466  3.150   10.831  1.00 44.48  ? 328  VAL A CG2 1 
ATOM   2511 N N   . GLY A 1 329 ? 18.461  6.852   11.873  1.00 40.91  ? 329  GLY A N   1 
ATOM   2512 C CA  . GLY A 1 329 ? 17.640  7.856   11.220  1.00 40.78  ? 329  GLY A CA  1 
ATOM   2513 C C   . GLY A 1 329 ? 18.363  9.078   10.754  1.00 39.83  ? 329  GLY A C   1 
ATOM   2514 O O   . GLY A 1 329 ? 19.555  9.219   11.009  1.00 39.75  ? 329  GLY A O   1 
ATOM   2515 N N   . VAL A 1 330 ? 17.638  9.969   10.076  1.00 39.83  ? 330  VAL A N   1 
ATOM   2516 C CA  . VAL A 1 330 ? 18.222  11.186  9.508   1.00 38.93  ? 330  VAL A CA  1 
ATOM   2517 C C   . VAL A 1 330 ? 17.289  12.379  9.684   1.00 39.70  ? 330  VAL A C   1 
ATOM   2518 O O   . VAL A 1 330 ? 16.093  12.200  9.984   1.00 40.02  ? 330  VAL A O   1 
ATOM   2519 C CB  . VAL A 1 330 ? 18.547  11.012  7.988   1.00 39.43  ? 330  VAL A CB  1 
ATOM   2520 C CG1 . VAL A 1 330 ? 19.351  9.730   7.724   1.00 39.34  ? 330  VAL A CG1 1 
ATOM   2521 C CG2 . VAL A 1 330 ? 17.287  11.031  7.136   1.00 39.49  ? 330  VAL A CG2 1 
ATOM   2522 N N   . VAL A 1 331 ? 17.821  13.596  9.498   1.00 39.59  ? 331  VAL A N   1 
ATOM   2523 C CA  . VAL A 1 331 ? 16.973  14.811  9.469   1.00 40.14  ? 331  VAL A CA  1 
ATOM   2524 C C   . VAL A 1 331 ? 16.641  15.176  8.023   1.00 41.34  ? 331  VAL A C   1 
ATOM   2525 O O   . VAL A 1 331 ? 17.312  14.714  7.104   1.00 41.60  ? 331  VAL A O   1 
ATOM   2526 C CB  . VAL A 1 331 ? 17.610  16.029  10.203  1.00 39.15  ? 331  VAL A CB  1 
ATOM   2527 C CG1 . VAL A 1 331 ? 17.731  15.743  11.666  1.00 38.76  ? 331  VAL A CG1 1 
ATOM   2528 C CG2 . VAL A 1 331 ? 18.972  16.400  9.604   1.00 37.93  ? 331  VAL A CG2 1 
ATOM   2529 N N   . LYS A 1 332 ? 15.621  16.007  7.821   1.00 42.32  ? 332  LYS A N   1 
ATOM   2530 C CA  . LYS A 1 332 ? 15.145  16.327  6.474   1.00 43.35  ? 332  LYS A CA  1 
ATOM   2531 C C   . LYS A 1 332 ? 16.220  16.994  5.609   1.00 42.93  ? 332  LYS A C   1 
ATOM   2532 O O   . LYS A 1 332 ? 16.214  16.818  4.398   1.00 43.27  ? 332  LYS A O   1 
ATOM   2533 C CB  . LYS A 1 332 ? 13.894  17.212  6.558   1.00 45.07  ? 332  LYS A CB  1 
ATOM   2534 C CG  . LYS A 1 332 ? 13.127  17.501  5.252   1.00 46.57  ? 332  LYS A CG  1 
ATOM   2535 C CD  . LYS A 1 332 ? 11.893  18.357  5.593   1.00 49.92  ? 332  LYS A CD  1 
ATOM   2536 C CE  . LYS A 1 332 ? 11.720  19.593  4.660   1.00 54.34  ? 332  LYS A CE  1 
ATOM   2537 N NZ  . LYS A 1 332 ? 12.506  20.859  5.089   1.00 51.78  ? 332  LYS A NZ  1 
ATOM   2538 N N   . ASP A 1 333 ? 17.148  17.739  6.220   1.00 41.61  ? 333  ASP A N   1 
ATOM   2539 C CA  . ASP A 1 333 ? 18.089  18.564  5.436   1.00 40.86  ? 333  ASP A CA  1 
ATOM   2540 C C   . ASP A 1 333 ? 19.529  18.391  5.890   1.00 39.93  ? 333  ASP A C   1 
ATOM   2541 O O   . ASP A 1 333 ? 20.171  19.315  6.398   1.00 38.93  ? 333  ASP A O   1 
ATOM   2542 C CB  . ASP A 1 333 ? 17.655  20.032  5.465   1.00 41.17  ? 333  ASP A CB  1 
ATOM   2543 C CG  . ASP A 1 333 ? 16.310  20.247  4.784   1.00 42.41  ? 333  ASP A CG  1 
ATOM   2544 O OD1 . ASP A 1 333 ? 15.266  20.221  5.458   1.00 43.39  ? 333  ASP A OD1 1 
ATOM   2545 O OD2 . ASP A 1 333 ? 16.292  20.400  3.563   1.00 42.35  ? 333  ASP A OD2 1 
ATOM   2546 N N   . GLU A 1 334 ? 20.030  17.177  5.704   1.00 39.81  ? 334  GLU A N   1 
ATOM   2547 C CA  . GLU A 1 334 ? 21.312  16.800  6.248   1.00 39.10  ? 334  GLU A CA  1 
ATOM   2548 C C   . GLU A 1 334 ? 22.445  17.690  5.759   1.00 38.73  ? 334  GLU A C   1 
ATOM   2549 O O   . GLU A 1 334 ? 23.330  18.025  6.528   1.00 38.23  ? 334  GLU A O   1 
ATOM   2550 C CB  . GLU A 1 334 ? 21.607  15.334  5.932   1.00 39.42  ? 334  GLU A CB  1 
ATOM   2551 C CG  . GLU A 1 334 ? 20.814  14.330  6.748   1.00 40.44  ? 334  GLU A CG  1 
ATOM   2552 C CD  . GLU A 1 334 ? 21.243  14.286  8.201   1.00 41.27  ? 334  GLU A CD  1 
ATOM   2553 O OE1 . GLU A 1 334 ? 22.233  14.972  8.548   1.00 38.40  ? 334  GLU A OE1 1 
ATOM   2554 O OE2 . GLU A 1 334 ? 20.574  13.580  8.993   1.00 41.57  ? 334  GLU A OE2 1 
ATOM   2555 N N   . GLY A 1 335 ? 22.398  18.102  4.496   1.00 39.14  ? 335  GLY A N   1 
ATOM   2556 C CA  . GLY A 1 335 ? 23.507  18.833  3.888   1.00 39.47  ? 335  GLY A CA  1 
ATOM   2557 C C   . GLY A 1 335 ? 23.518  20.341  3.977   1.00 39.94  ? 335  GLY A C   1 
ATOM   2558 O O   . GLY A 1 335 ? 24.588  20.960  3.894   1.00 40.35  ? 335  GLY A O   1 
ATOM   2559 N N   . SER A 1 336 ? 22.346  20.939  4.172   1.00 40.21  ? 336  SER A N   1 
ATOM   2560 C CA  . SER A 1 336 ? 22.189  22.379  3.992   1.00 40.84  ? 336  SER A CA  1 
ATOM   2561 C C   . SER A 1 336 ? 23.216  23.219  4.738   1.00 40.31  ? 336  SER A C   1 
ATOM   2562 O O   . SER A 1 336 ? 23.854  24.056  4.143   1.00 40.92  ? 336  SER A O   1 
ATOM   2563 C CB  . SER A 1 336 ? 20.759  22.826  4.329   1.00 41.54  ? 336  SER A CB  1 
ATOM   2564 O OG  . SER A 1 336 ? 20.471  22.651  5.704   1.00 42.23  ? 336  SER A OG  1 
ATOM   2565 N N   . ALA A 1 337 ? 23.398  22.984  6.030   1.00 39.92  ? 337  ALA A N   1 
ATOM   2566 C CA  . ALA A 1 337 ? 24.323  23.815  6.819   1.00 39.87  ? 337  ALA A CA  1 
ATOM   2567 C C   . ALA A 1 337 ? 25.804  23.592  6.493   1.00 39.66  ? 337  ALA A C   1 
ATOM   2568 O O   . ALA A 1 337 ? 26.653  24.414  6.845   1.00 39.40  ? 337  ALA A O   1 
ATOM   2569 C CB  . ALA A 1 337 ? 24.081  23.648  8.307   1.00 39.13  ? 337  ALA A CB  1 
ATOM   2570 N N   . PHE A 1 338 ? 26.124  22.495  5.815   1.00 39.23  ? 338  PHE A N   1 
ATOM   2571 C CA  . PHE A 1 338 ? 27.512  22.265  5.469   1.00 38.77  ? 338  PHE A CA  1 
ATOM   2572 C C   . PHE A 1 338 ? 27.972  23.183  4.335   1.00 39.27  ? 338  PHE A C   1 
ATOM   2573 O O   . PHE A 1 338 ? 29.171  23.395  4.145   1.00 39.28  ? 338  PHE A O   1 
ATOM   2574 C CB  . PHE A 1 338 ? 27.731  20.798  5.127   1.00 38.88  ? 338  PHE A CB  1 
ATOM   2575 C CG  . PHE A 1 338 ? 27.746  19.906  6.336   1.00 38.07  ? 338  PHE A CG  1 
ATOM   2576 C CD1 . PHE A 1 338 ? 26.561  19.321  6.803   1.00 37.83  ? 338  PHE A CD1 1 
ATOM   2577 C CD2 . PHE A 1 338 ? 28.939  19.681  7.031   1.00 36.24  ? 338  PHE A CD2 1 
ATOM   2578 C CE1 . PHE A 1 338 ? 26.568  18.505  7.935   1.00 36.57  ? 338  PHE A CE1 1 
ATOM   2579 C CE2 . PHE A 1 338 ? 28.964  18.895  8.155   1.00 34.94  ? 338  PHE A CE2 1 
ATOM   2580 C CZ  . PHE A 1 338 ? 27.785  18.293  8.616   1.00 36.53  ? 338  PHE A CZ  1 
ATOM   2581 N N   . LEU A 1 339 ? 27.011  23.765  3.621   1.00 39.13  ? 339  LEU A N   1 
ATOM   2582 C CA  . LEU A 1 339 ? 27.305  24.448  2.380   1.00 39.20  ? 339  LEU A CA  1 
ATOM   2583 C C   . LEU A 1 339 ? 28.001  25.799  2.584   1.00 39.81  ? 339  LEU A C   1 
ATOM   2584 O O   . LEU A 1 339 ? 28.736  26.264  1.711   1.00 41.04  ? 339  LEU A O   1 
ATOM   2585 C CB  . LEU A 1 339 ? 26.022  24.595  1.566   1.00 39.31  ? 339  LEU A CB  1 
ATOM   2586 C CG  . LEU A 1 339 ? 25.258  23.317  1.181   1.00 38.94  ? 339  LEU A CG  1 
ATOM   2587 C CD1 . LEU A 1 339 ? 24.048  23.687  0.343   1.00 39.24  ? 339  LEU A CD1 1 
ATOM   2588 C CD2 . LEU A 1 339 ? 26.133  22.302  0.419   1.00 38.40  ? 339  LEU A CD2 1 
ATOM   2589 N N   . VAL A 1 340 ? 27.762  26.427  3.727   1.00 39.42  ? 340  VAL A N   1 
ATOM   2590 C CA  . VAL A 1 340 ? 28.308  27.742  4.028   1.00 39.71  ? 340  VAL A CA  1 
ATOM   2591 C C   . VAL A 1 340 ? 29.754  27.632  4.497   1.00 40.05  ? 340  VAL A C   1 
ATOM   2592 O O   . VAL A 1 340 ? 30.435  28.639  4.660   1.00 40.60  ? 340  VAL A O   1 
ATOM   2593 C CB  . VAL A 1 340 ? 27.458  28.498  5.079   1.00 39.89  ? 340  VAL A CB  1 
ATOM   2594 C CG1 . VAL A 1 340 ? 26.109  28.834  4.513   1.00 38.77  ? 340  VAL A CG1 1 
ATOM   2595 C CG2 . VAL A 1 340 ? 27.301  27.677  6.373   1.00 38.40  ? 340  VAL A CG2 1 
ATOM   2596 N N   . TYR A 1 341 ? 30.217  26.403  4.694   1.00 39.83  ? 341  TYR A N   1 
ATOM   2597 C CA  . TYR A 1 341 ? 31.603  26.153  5.080   1.00 40.75  ? 341  TYR A CA  1 
ATOM   2598 C C   . TYR A 1 341 ? 32.544  25.780  3.911   1.00 41.52  ? 341  TYR A C   1 
ATOM   2599 O O   . TYR A 1 341 ? 33.503  25.023  4.110   1.00 42.58  ? 341  TYR A O   1 
ATOM   2600 C CB  . TYR A 1 341 ? 31.662  25.096  6.206   1.00 39.75  ? 341  TYR A CB  1 
ATOM   2601 C CG  . TYR A 1 341 ? 31.148  25.641  7.513   1.00 40.30  ? 341  TYR A CG  1 
ATOM   2602 C CD1 . TYR A 1 341 ? 29.788  25.573  7.847   1.00 38.15  ? 341  TYR A CD1 1 
ATOM   2603 C CD2 . TYR A 1 341 ? 32.013  26.279  8.392   1.00 41.14  ? 341  TYR A CD2 1 
ATOM   2604 C CE1 . TYR A 1 341 ? 29.321  26.105  9.024   1.00 38.27  ? 341  TYR A CE1 1 
ATOM   2605 C CE2 . TYR A 1 341 ? 31.564  26.805  9.572   1.00 41.22  ? 341  TYR A CE2 1 
ATOM   2606 C CZ  . TYR A 1 341 ? 30.216  26.726  9.884   1.00 41.53  ? 341  TYR A CZ  1 
ATOM   2607 O OH  . TYR A 1 341 ? 29.796  27.276  11.079  1.00 43.70  ? 341  TYR A OH  1 
ATOM   2608 N N   . GLY A 1 342 ? 32.288  26.300  2.707   1.00 42.24  ? 342  GLY A N   1 
ATOM   2609 C CA  . GLY A 1 342 ? 33.208  26.089  1.576   1.00 42.35  ? 342  GLY A CA  1 
ATOM   2610 C C   . GLY A 1 342 ? 32.667  26.106  0.147   1.00 42.91  ? 342  GLY A C   1 
ATOM   2611 O O   . GLY A 1 342 ? 33.444  26.241  -0.802  1.00 43.96  ? 342  GLY A O   1 
ATOM   2612 N N   . VAL A 1 343 ? 31.361  25.956  -0.043  1.00 41.97  ? 343  VAL A N   1 
ATOM   2613 C CA  . VAL A 1 343 ? 30.827  26.085  -1.399  1.00 42.25  ? 343  VAL A CA  1 
ATOM   2614 C C   . VAL A 1 343 ? 30.632  27.572  -1.803  1.00 42.90  ? 343  VAL A C   1 
ATOM   2615 O O   . VAL A 1 343 ? 29.832  28.284  -1.205  1.00 42.66  ? 343  VAL A O   1 
ATOM   2616 C CB  . VAL A 1 343 ? 29.519  25.263  -1.605  1.00 42.03  ? 343  VAL A CB  1 
ATOM   2617 C CG1 . VAL A 1 343 ? 29.110  25.249  -3.080  1.00 39.90  ? 343  VAL A CG1 1 
ATOM   2618 C CG2 . VAL A 1 343 ? 29.696  23.852  -1.094  1.00 40.40  ? 343  VAL A CG2 1 
ATOM   2619 N N   . PRO A 1 344 ? 31.375  28.049  -2.813  1.00 43.75  ? 344  PRO A N   1 
ATOM   2620 C CA  . PRO A 1 344 ? 31.101  29.452  -3.217  1.00 44.85  ? 344  PRO A CA  1 
ATOM   2621 C C   . PRO A 1 344 ? 29.637  29.619  -3.639  1.00 45.42  ? 344  PRO A C   1 
ATOM   2622 O O   . PRO A 1 344 ? 29.080  28.742  -4.335  1.00 44.93  ? 344  PRO A O   1 
ATOM   2623 C CB  . PRO A 1 344 ? 32.043  29.696  -4.416  1.00 44.93  ? 344  PRO A CB  1 
ATOM   2624 C CG  . PRO A 1 344 ? 33.045  28.598  -4.370  1.00 44.81  ? 344  PRO A CG  1 
ATOM   2625 C CD  . PRO A 1 344 ? 32.395  27.410  -3.664  1.00 43.92  ? 344  PRO A CD  1 
ATOM   2626 N N   . GLY A 1 345 ? 29.029  30.721  -3.194  1.00 45.99  ? 345  GLY A N   1 
ATOM   2627 C CA  . GLY A 1 345 ? 27.641  31.031  -3.495  1.00 46.30  ? 345  GLY A CA  1 
ATOM   2628 C C   . GLY A 1 345 ? 26.696  30.898  -2.312  1.00 46.10  ? 345  GLY A C   1 
ATOM   2629 O O   . GLY A 1 345 ? 25.568  31.389  -2.369  1.00 46.76  ? 345  GLY A O   1 
ATOM   2630 N N   . PHE A 1 346 ? 27.146  30.249  -1.234  1.00 45.25  ? 346  PHE A N   1 
ATOM   2631 C CA  . PHE A 1 346 ? 26.273  29.995  -0.083  1.00 44.49  ? 346  PHE A CA  1 
ATOM   2632 C C   . PHE A 1 346 ? 26.580  30.829  1.145   1.00 45.02  ? 346  PHE A C   1 
ATOM   2633 O O   . PHE A 1 346 ? 27.739  30.977  1.531   1.00 45.10  ? 346  PHE A O   1 
ATOM   2634 C CB  . PHE A 1 346 ? 26.268  28.520  0.264   1.00 42.86  ? 346  PHE A CB  1 
ATOM   2635 C CG  . PHE A 1 346 ? 25.633  27.673  -0.786  1.00 42.58  ? 346  PHE A CG  1 
ATOM   2636 C CD1 . PHE A 1 346 ? 26.380  27.198  -1.866  1.00 40.69  ? 346  PHE A CD1 1 
ATOM   2637 C CD2 . PHE A 1 346 ? 24.279  27.356  -0.709  1.00 41.07  ? 346  PHE A CD2 1 
ATOM   2638 C CE1 . PHE A 1 346 ? 25.793  26.408  -2.842  1.00 40.67  ? 346  PHE A CE1 1 
ATOM   2639 C CE2 . PHE A 1 346 ? 23.682  26.570  -1.678  1.00 40.77  ? 346  PHE A CE2 1 
ATOM   2640 C CZ  . PHE A 1 346 ? 24.434  26.100  -2.754  1.00 41.43  ? 346  PHE A CZ  1 
ATOM   2641 N N   . SER A 1 347 ? 25.533  31.399  1.736   1.00 45.60  ? 347  SER A N   1 
ATOM   2642 C CA  . SER A 1 347 ? 25.662  32.155  2.990   1.00 46.64  ? 347  SER A CA  1 
ATOM   2643 C C   . SER A 1 347 ? 24.412  31.973  3.875   1.00 46.73  ? 347  SER A C   1 
ATOM   2644 O O   . SER A 1 347 ? 23.344  31.658  3.355   1.00 47.75  ? 347  SER A O   1 
ATOM   2645 C CB  . SER A 1 347 ? 25.951  33.645  2.718   1.00 47.45  ? 347  SER A CB  1 
ATOM   2646 O OG  . SER A 1 347 ? 25.863  34.397  3.913   1.00 47.70  ? 347  SER A OG  1 
ATOM   2647 N N   . LYS A 1 348 ? 24.549  32.143  5.190   1.00 46.25  ? 348  LYS A N   1 
ATOM   2648 C CA  . LYS A 1 348 ? 23.409  32.064  6.091   1.00 46.61  ? 348  LYS A CA  1 
ATOM   2649 C C   . LYS A 1 348 ? 22.603  33.369  6.051   1.00 48.84  ? 348  LYS A C   1 
ATOM   2650 O O   . LYS A 1 348 ? 21.435  33.389  6.456   1.00 48.70  ? 348  LYS A O   1 
ATOM   2651 C CB  . LYS A 1 348 ? 23.859  31.770  7.529   1.00 45.69  ? 348  LYS A CB  1 
ATOM   2652 C CG  . LYS A 1 348 ? 24.214  33.000  8.357   1.00 45.91  ? 348  LYS A CG  1 
ATOM   2653 C CD  . LYS A 1 348 ? 24.459  32.687  9.827   1.00 45.45  ? 348  LYS A CD  1 
ATOM   2654 C CE  . LYS A 1 348 ? 24.764  33.975  10.631  1.00 45.55  ? 348  LYS A CE  1 
ATOM   2655 N NZ  . LYS A 1 348 ? 23.611  34.952  10.757  1.00 45.93  ? 348  LYS A NZ  1 
ATOM   2656 N N   . ASP A 1 349 ? 23.237  34.443  5.565   1.00 50.29  ? 349  ASP A N   1 
ATOM   2657 C CA  . ASP A 1 349 ? 22.652  35.792  5.588   1.00 53.02  ? 349  ASP A CA  1 
ATOM   2658 C C   . ASP A 1 349 ? 21.894  36.195  4.309   1.00 54.53  ? 349  ASP A C   1 
ATOM   2659 O O   . ASP A 1 349 ? 21.276  37.262  4.280   1.00 55.56  ? 349  ASP A O   1 
ATOM   2660 C CB  . ASP A 1 349 ? 23.726  36.842  5.912   1.00 53.63  ? 349  ASP A CB  1 
ATOM   2661 C CG  . ASP A 1 349 ? 24.375  36.615  7.266   1.00 54.56  ? 349  ASP A CG  1 
ATOM   2662 O OD1 . ASP A 1 349 ? 23.619  36.383  8.254   1.00 52.75  ? 349  ASP A OD1 1 
ATOM   2663 O OD2 . ASP A 1 349 ? 25.645  36.657  7.329   1.00 55.62  ? 349  ASP A OD2 1 
ATOM   2664 N N   . ASN A 1 350 ? 21.964  35.360  3.263   1.00 54.56  ? 350  ASN A N   1 
ATOM   2665 C CA  . ASN A 1 350 ? 21.108  35.515  2.076   1.00 56.14  ? 350  ASN A CA  1 
ATOM   2666 C C   . ASN A 1 350 ? 20.409  34.204  1.665   1.00 54.41  ? 350  ASN A C   1 
ATOM   2667 O O   . ASN A 1 350 ? 20.536  33.190  2.350   1.00 52.80  ? 350  ASN A O   1 
ATOM   2668 C CB  . ASN A 1 350 ? 21.824  36.265  0.908   1.00 58.05  ? 350  ASN A CB  1 
ATOM   2669 C CG  . ASN A 1 350 ? 22.966  35.454  0.239   1.00 62.11  ? 350  ASN A CG  1 
ATOM   2670 O OD1 . ASN A 1 350 ? 22.819  34.258  -0.031  1.00 63.36  ? 350  ASN A OD1 1 
ATOM   2671 N ND2 . ASN A 1 350 ? 24.099  36.128  -0.055  1.00 70.68  ? 350  ASN A ND2 1 
ATOM   2672 N N   . GLU A 1 351 ? 19.652  34.247  0.569   1.00 54.66  ? 351  GLU A N   1 
ATOM   2673 C CA  . GLU A 1 351 ? 18.830  33.114  0.109   1.00 53.59  ? 351  GLU A CA  1 
ATOM   2674 C C   . GLU A 1 351 ? 19.647  32.027  -0.586  1.00 51.38  ? 351  GLU A C   1 
ATOM   2675 O O   . GLU A 1 351 ? 19.145  30.920  -0.810  1.00 50.24  ? 351  GLU A O   1 
ATOM   2676 C CB  . GLU A 1 351 ? 17.706  33.598  -0.826  1.00 55.63  ? 351  GLU A CB  1 
ATOM   2677 C CG  . GLU A 1 351 ? 16.500  34.231  -0.130  1.00 60.05  ? 351  GLU A CG  1 
ATOM   2678 C CD  . GLU A 1 351 ? 16.065  33.444  1.107   1.00 64.67  ? 351  GLU A CD  1 
ATOM   2679 O OE1 . GLU A 1 351 ? 15.361  32.402  0.968   1.00 66.34  ? 351  GLU A OE1 1 
ATOM   2680 O OE2 . GLU A 1 351 ? 16.447  33.873  2.223   1.00 65.78  ? 351  GLU A OE2 1 
ATOM   2681 N N   . SER A 1 352 ? 20.891  32.364  -0.934  1.00 49.88  ? 352  SER A N   1 
ATOM   2682 C CA  . SER A 1 352 ? 21.845  31.431  -1.548  1.00 48.71  ? 352  SER A CA  1 
ATOM   2683 C C   . SER A 1 352 ? 21.359  30.819  -2.867  1.00 48.92  ? 352  SER A C   1 
ATOM   2684 O O   . SER A 1 352 ? 21.678  29.655  -3.172  1.00 47.68  ? 352  SER A O   1 
ATOM   2685 C CB  . SER A 1 352 ? 22.258  30.308  -0.579  1.00 47.06  ? 352  SER A CB  1 
ATOM   2686 O OG  . SER A 1 352 ? 22.917  30.828  0.547   1.00 46.79  ? 352  SER A OG  1 
ATOM   2687 N N   . LEU A 1 353 ? 20.599  31.595  -3.640  1.00 49.29  ? 353  LEU A N   1 
ATOM   2688 C CA  . LEU A 1 353 ? 20.206  31.173  -4.975  1.00 49.67  ? 353  LEU A CA  1 
ATOM   2689 C C   . LEU A 1 353 ? 21.449  31.117  -5.871  1.00 49.79  ? 353  LEU A C   1 
ATOM   2690 O O   . LEU A 1 353 ? 22.208  32.093  -5.968  1.00 50.50  ? 353  LEU A O   1 
ATOM   2691 C CB  . LEU A 1 353 ? 19.153  32.118  -5.541  1.00 51.03  ? 353  LEU A CB  1 
ATOM   2692 C CG  . LEU A 1 353 ? 17.848  32.254  -4.736  1.00 51.42  ? 353  LEU A CG  1 
ATOM   2693 C CD1 . LEU A 1 353 ? 16.838  32.936  -5.607  1.00 53.94  ? 353  LEU A CD1 1 
ATOM   2694 C CD2 . LEU A 1 353 ? 17.281  30.933  -4.256  1.00 49.80  ? 353  LEU A CD2 1 
ATOM   2695 N N   . ILE A 1 354 ? 21.683  29.965  -6.491  1.00 48.93  ? 354  ILE A N   1 
ATOM   2696 C CA  . ILE A 1 354 ? 22.918  29.757  -7.246  1.00 48.40  ? 354  ILE A CA  1 
ATOM   2697 C C   . ILE A 1 354 ? 22.718  29.454  -8.724  1.00 49.53  ? 354  ILE A C   1 
ATOM   2698 O O   . ILE A 1 354 ? 21.633  29.045  -9.155  1.00 50.08  ? 354  ILE A O   1 
ATOM   2699 C CB  . ILE A 1 354 ? 23.806  28.661  -6.621  1.00 47.19  ? 354  ILE A CB  1 
ATOM   2700 C CG1 . ILE A 1 354 ? 23.021  27.355  -6.428  1.00 45.20  ? 354  ILE A CG1 1 
ATOM   2701 C CG2 . ILE A 1 354 ? 24.449  29.180  -5.332  1.00 46.02  ? 354  ILE A CG2 1 
ATOM   2702 C CD1 . ILE A 1 354 ? 23.885  26.102  -6.419  1.00 44.75  ? 354  ILE A CD1 1 
ATOM   2703 N N   . SER A 1 355 ? 23.787  29.653  -9.487  1.00 50.14  ? 355  SER A N   1 
ATOM   2704 C CA  . SER A 1 355 ? 23.800  29.381  -10.922 1.00 51.69  ? 355  SER A CA  1 
ATOM   2705 C C   . SER A 1 355 ? 24.178  27.920  -11.177 1.00 51.20  ? 355  SER A C   1 
ATOM   2706 O O   . SER A 1 355 ? 24.688  27.213  -10.293 1.00 50.04  ? 355  SER A O   1 
ATOM   2707 C CB  . SER A 1 355 ? 24.808  30.307  -11.629 1.00 52.85  ? 355  SER A CB  1 
ATOM   2708 O OG  . SER A 1 355 ? 26.148  29.804  -11.511 1.00 52.70  ? 355  SER A OG  1 
ATOM   2709 N N   . ARG A 1 356 ? 23.948  27.484  -12.402 1.00 52.15  ? 356  ARG A N   1 
ATOM   2710 C CA  . ARG A 1 356 ? 24.328  26.154  -12.820 1.00 52.54  ? 356  ARG A CA  1 
ATOM   2711 C C   . ARG A 1 356 ? 25.858  25.919  -12.730 1.00 51.74  ? 356  ARG A C   1 
ATOM   2712 O O   . ARG A 1 356 ? 26.314  24.829  -12.332 1.00 50.37  ? 356  ARG A O   1 
ATOM   2713 C CB  . ARG A 1 356 ? 23.777  25.896  -14.225 1.00 54.70  ? 356  ARG A CB  1 
ATOM   2714 C CG  . ARG A 1 356 ? 23.996  24.497  -14.698 1.00 57.35  ? 356  ARG A CG  1 
ATOM   2715 C CD  . ARG A 1 356 ? 22.897  23.964  -15.587 1.00 60.90  ? 356  ARG A CD  1 
ATOM   2716 N NE  . ARG A 1 356 ? 23.176  22.538  -15.756 1.00 63.60  ? 356  ARG A NE  1 
ATOM   2717 C CZ  . ARG A 1 356 ? 22.595  21.554  -15.071 1.00 62.94  ? 356  ARG A CZ  1 
ATOM   2718 N NH1 . ARG A 1 356 ? 21.631  21.815  -14.181 1.00 61.99  ? 356  ARG A NH1 1 
ATOM   2719 N NH2 . ARG A 1 356 ? 22.962  20.299  -15.312 1.00 62.33  ? 356  ARG A NH2 1 
ATOM   2720 N N   . ALA A 1 357 ? 26.640  26.947  -13.071 1.00 51.90  ? 357  ALA A N   1 
ATOM   2721 C CA  . ALA A 1 357 ? 28.102  26.883  -12.933 1.00 50.86  ? 357  ALA A CA  1 
ATOM   2722 C C   . ALA A 1 357 ? 28.470  26.696  -11.467 1.00 49.22  ? 357  ALA A C   1 
ATOM   2723 O O   . ALA A 1 357 ? 29.346  25.895  -11.133 1.00 48.93  ? 357  ALA A O   1 
ATOM   2724 C CB  . ALA A 1 357 ? 28.777  28.135  -13.508 1.00 51.03  ? 357  ALA A CB  1 
ATOM   2725 N N   . GLN A 1 358 ? 27.792  27.420  -10.589 1.00 48.45  ? 358  GLN A N   1 
ATOM   2726 C CA  . GLN A 1 358 ? 28.094  27.314  -9.181  1.00 47.31  ? 358  GLN A CA  1 
ATOM   2727 C C   . GLN A 1 358 ? 27.678  25.950  -8.651  1.00 46.21  ? 358  GLN A C   1 
ATOM   2728 O O   . GLN A 1 358 ? 28.305  25.440  -7.724  1.00 45.55  ? 358  GLN A O   1 
ATOM   2729 C CB  . GLN A 1 358 ? 27.425  28.437  -8.383  1.00 47.43  ? 358  GLN A CB  1 
ATOM   2730 C CG  . GLN A 1 358 ? 27.846  29.822  -8.800  1.00 49.08  ? 358  GLN A CG  1 
ATOM   2731 C CD  . GLN A 1 358 ? 27.237  30.918  -7.936  1.00 51.06  ? 358  GLN A CD  1 
ATOM   2732 O OE1 . GLN A 1 358 ? 26.010  31.015  -7.787  1.00 52.04  ? 358  GLN A OE1 1 
ATOM   2733 N NE2 . GLN A 1 358 ? 28.096  31.758  -7.369  1.00 48.94  ? 358  GLN A NE2 1 
ATOM   2734 N N   . PHE A 1 359 ? 26.625  25.366  -9.228  1.00 46.10  ? 359  PHE A N   1 
ATOM   2735 C CA  . PHE A 1 359 ? 26.212  23.998  -8.877  1.00 44.90  ? 359  PHE A CA  1 
ATOM   2736 C C   . PHE A 1 359 ? 27.238  22.935  -9.280  1.00 44.58  ? 359  PHE A C   1 
ATOM   2737 O O   . PHE A 1 359 ? 27.581  22.087  -8.472  1.00 43.55  ? 359  PHE A O   1 
ATOM   2738 C CB  . PHE A 1 359 ? 24.804  23.673  -9.408  1.00 45.25  ? 359  PHE A CB  1 
ATOM   2739 C CG  . PHE A 1 359 ? 24.350  22.258  -9.131  1.00 43.83  ? 359  PHE A CG  1 
ATOM   2740 C CD1 . PHE A 1 359 ? 24.033  21.400  -10.178 1.00 43.80  ? 359  PHE A CD1 1 
ATOM   2741 C CD2 . PHE A 1 359 ? 24.251  21.781  -7.834  1.00 43.07  ? 359  PHE A CD2 1 
ATOM   2742 C CE1 . PHE A 1 359 ? 23.604  20.104  -9.940  1.00 43.13  ? 359  PHE A CE1 1 
ATOM   2743 C CE2 . PHE A 1 359 ? 23.837  20.478  -7.583  1.00 41.86  ? 359  PHE A CE2 1 
ATOM   2744 C CZ  . PHE A 1 359 ? 23.504  19.642  -8.642  1.00 42.69  ? 359  PHE A CZ  1 
ATOM   2745 N N   . LEU A 1 360 ? 27.735  22.983  -10.511 1.00 45.79  ? 360  LEU A N   1 
ATOM   2746 C CA  . LEU A 1 360 ? 28.814  22.079  -10.925 1.00 46.49  ? 360  LEU A CA  1 
ATOM   2747 C C   . LEU A 1 360 ? 30.070  22.240  -10.063 1.00 45.93  ? 360  LEU A C   1 
ATOM   2748 O O   . LEU A 1 360 ? 30.705  21.250  -9.704  1.00 45.63  ? 360  LEU A O   1 
ATOM   2749 C CB  . LEU A 1 360 ? 29.151  22.238  -12.411 1.00 48.00  ? 360  LEU A CB  1 
ATOM   2750 C CG  . LEU A 1 360 ? 30.420  21.541  -12.989 1.00 51.57  ? 360  LEU A CG  1 
ATOM   2751 C CD1 . LEU A 1 360 ? 30.757  20.083  -12.428 1.00 51.99  ? 360  LEU A CD1 1 
ATOM   2752 C CD2 . LEU A 1 360 ? 30.442  21.554  -14.547 1.00 53.43  ? 360  LEU A CD2 1 
ATOM   2753 N N   . ALA A 1 361 ? 30.416  23.484  -9.730  1.00 46.08  ? 361  ALA A N   1 
ATOM   2754 C CA  . ALA A 1 361 ? 31.586  23.776  -8.910  1.00 45.53  ? 361  ALA A CA  1 
ATOM   2755 C C   . ALA A 1 361 ? 31.375  23.265  -7.492  1.00 44.99  ? 361  ALA A C   1 
ATOM   2756 O O   . ALA A 1 361 ? 32.317  22.745  -6.866  1.00 45.41  ? 361  ALA A O   1 
ATOM   2757 C CB  . ALA A 1 361 ? 31.894  25.261  -8.908  1.00 45.32  ? 361  ALA A CB  1 
ATOM   2758 N N   . GLY A 1 362 ? 30.148  23.391  -6.988  1.00 44.19  ? 362  GLY A N   1 
ATOM   2759 C CA  . GLY A 1 362 ? 29.813  22.869  -5.681  1.00 43.03  ? 362  GLY A CA  1 
ATOM   2760 C C   . GLY A 1 362 ? 29.888  21.345  -5.597  1.00 43.37  ? 362  GLY A C   1 
ATOM   2761 O O   . GLY A 1 362 ? 30.260  20.795  -4.564  1.00 42.54  ? 362  GLY A O   1 
ATOM   2762 N N   . VAL A 1 363 ? 29.534  20.666  -6.683  1.00 44.01  ? 363  VAL A N   1 
ATOM   2763 C CA  . VAL A 1 363 ? 29.475  19.218  -6.696  1.00 44.17  ? 363  VAL A CA  1 
ATOM   2764 C C   . VAL A 1 363 ? 30.877  18.637  -6.569  1.00 45.06  ? 363  VAL A C   1 
ATOM   2765 O O   . VAL A 1 363 ? 31.066  17.628  -5.889  1.00 45.24  ? 363  VAL A O   1 
ATOM   2766 C CB  . VAL A 1 363 ? 28.746  18.697  -7.966  1.00 45.06  ? 363  VAL A CB  1 
ATOM   2767 C CG1 . VAL A 1 363 ? 29.017  17.221  -8.222  1.00 43.40  ? 363  VAL A CG1 1 
ATOM   2768 C CG2 . VAL A 1 363 ? 27.249  18.962  -7.851  1.00 44.60  ? 363  VAL A CG2 1 
ATOM   2769 N N   . ARG A 1 364 ? 31.854  19.283  -7.198  1.00 45.78  ? 364  ARG A N   1 
ATOM   2770 C CA  . ARG A 1 364 ? 33.261  18.899  -7.054  1.00 46.69  ? 364  ARG A CA  1 
ATOM   2771 C C   . ARG A 1 364 ? 33.801  19.047  -5.639  1.00 46.00  ? 364  ARG A C   1 
ATOM   2772 O O   . ARG A 1 364 ? 34.736  18.341  -5.246  1.00 45.51  ? 364  ARG A O   1 
ATOM   2773 C CB  . ARG A 1 364 ? 34.139  19.752  -7.959  1.00 48.15  ? 364  ARG A CB  1 
ATOM   2774 C CG  . ARG A 1 364 ? 33.867  19.602  -9.431  1.00 50.54  ? 364  ARG A CG  1 
ATOM   2775 C CD  . ARG A 1 364 ? 33.840  18.140  -9.845  1.00 54.29  ? 364  ARG A CD  1 
ATOM   2776 N NE  . ARG A 1 364 ? 34.595  17.987  -11.091 1.00 59.94  ? 364  ARG A NE  1 
ATOM   2777 C CZ  . ARG A 1 364 ? 35.581  17.106  -11.290 1.00 61.70  ? 364  ARG A CZ  1 
ATOM   2778 N NH1 . ARG A 1 364 ? 35.929  16.230  -10.343 1.00 59.56  ? 364  ARG A NH1 1 
ATOM   2779 N NH2 . ARG A 1 364 ? 36.212  17.097  -12.462 1.00 63.81  ? 364  ARG A NH2 1 
ATOM   2780 N N   . ILE A 1 365 ? 33.234  19.998  -4.894  1.00 45.45  ? 365  ILE A N   1 
ATOM   2781 C CA  . ILE A 1 365 ? 33.652  20.247  -3.524  1.00 44.53  ? 365  ILE A CA  1 
ATOM   2782 C C   . ILE A 1 365 ? 32.906  19.321  -2.566  1.00 43.95  ? 365  ILE A C   1 
ATOM   2783 O O   . ILE A 1 365 ? 33.473  18.831  -1.592  1.00 42.99  ? 365  ILE A O   1 
ATOM   2784 C CB  . ILE A 1 365 ? 33.461  21.724  -3.155  1.00 44.14  ? 365  ILE A CB  1 
ATOM   2785 C CG1 . ILE A 1 365 ? 34.413  22.565  -4.004  1.00 45.07  ? 365  ILE A CG1 1 
ATOM   2786 C CG2 . ILE A 1 365 ? 33.685  21.955  -1.654  1.00 42.44  ? 365  ILE A CG2 1 
ATOM   2787 C CD1 . ILE A 1 365 ? 34.123  24.028  -3.984  1.00 45.17  ? 365  ILE A CD1 1 
ATOM   2788 N N   . GLY A 1 366 ? 31.630  19.096  -2.859  1.00 44.29  ? 366  GLY A N   1 
ATOM   2789 C CA  . GLY A 1 366 ? 30.779  18.245  -2.052  1.00 44.37  ? 366  GLY A CA  1 
ATOM   2790 C C   . GLY A 1 366 ? 31.090  16.769  -2.264  1.00 45.19  ? 366  GLY A C   1 
ATOM   2791 O O   . GLY A 1 366 ? 30.814  15.943  -1.390  1.00 44.87  ? 366  GLY A O   1 
ATOM   2792 N N   . VAL A 1 367 ? 31.656  16.429  -3.419  1.00 45.75  ? 367  VAL A N   1 
ATOM   2793 C CA  . VAL A 1 367 ? 32.012  15.046  -3.706  1.00 46.42  ? 367  VAL A CA  1 
ATOM   2794 C C   . VAL A 1 367 ? 33.441  15.075  -4.157  1.00 47.49  ? 367  VAL A C   1 
ATOM   2795 O O   . VAL A 1 367 ? 33.714  14.821  -5.316  1.00 49.01  ? 367  VAL A O   1 
ATOM   2796 C CB  . VAL A 1 367 ? 31.152  14.418  -4.861  1.00 47.04  ? 367  VAL A CB  1 
ATOM   2797 C CG1 . VAL A 1 367 ? 31.251  12.922  -4.823  1.00 46.46  ? 367  VAL A CG1 1 
ATOM   2798 C CG2 . VAL A 1 367 ? 29.709  14.847  -4.787  1.00 45.73  ? 367  VAL A CG2 1 
ATOM   2799 N N   . PRO A 1 368 ? 34.370  15.412  -3.253  1.00 47.75  ? 368  PRO A N   1 
ATOM   2800 C CA  . PRO A 1 368 ? 35.761  15.686  -3.645  1.00 48.46  ? 368  PRO A CA  1 
ATOM   2801 C C   . PRO A 1 368 ? 36.530  14.512  -4.224  1.00 50.35  ? 368  PRO A C   1 
ATOM   2802 O O   . PRO A 1 368 ? 37.489  14.728  -4.966  1.00 51.68  ? 368  PRO A O   1 
ATOM   2803 C CB  . PRO A 1 368 ? 36.408  16.116  -2.339  1.00 47.69  ? 368  PRO A CB  1 
ATOM   2804 C CG  . PRO A 1 368 ? 35.524  15.569  -1.277  1.00 46.45  ? 368  PRO A CG  1 
ATOM   2805 C CD  . PRO A 1 368 ? 34.157  15.609  -1.809  1.00 46.30  ? 368  PRO A CD  1 
ATOM   2806 N N   . GLN A 1 369 ? 36.121  13.287  -3.891  1.00 51.12  ? 369  GLN A N   1 
ATOM   2807 C CA  A GLN A 1 369 ? 36.841  12.105  -4.368  0.50 52.47  ? 369  GLN A CA  1 
ATOM   2808 C CA  B GLN A 1 369 ? 36.775  12.053  -4.358  0.50 52.45  ? 369  GLN A CA  1 
ATOM   2809 C C   . GLN A 1 369 ? 36.437  11.729  -5.805  1.00 54.04  ? 369  GLN A C   1 
ATOM   2810 O O   . GLN A 1 369 ? 36.979  10.786  -6.378  1.00 55.52  ? 369  GLN A O   1 
ATOM   2811 C CB  A GLN A 1 369 ? 36.682  10.921  -3.388  0.50 51.99  ? 369  GLN A CB  1 
ATOM   2812 C CB  B GLN A 1 369 ? 36.352  10.840  -3.511  0.50 51.84  ? 369  GLN A CB  1 
ATOM   2813 C CG  A GLN A 1 369 ? 37.753  10.855  -2.251  0.50 50.43  ? 369  GLN A CG  1 
ATOM   2814 C CG  B GLN A 1 369 ? 35.541  11.162  -2.275  0.50 49.78  ? 369  GLN A CG  1 
ATOM   2815 C CD  A GLN A 1 369 ? 37.576  11.925  -1.159  0.50 47.64  ? 369  GLN A CD  1 
ATOM   2816 C CD  B GLN A 1 369 ? 34.063  11.217  -2.555  0.50 47.04  ? 369  GLN A CD  1 
ATOM   2817 O OE1 A GLN A 1 369 ? 36.690  11.834  -0.298  0.50 43.92  ? 369  GLN A OE1 1 
ATOM   2818 O OE1 B GLN A 1 369 ? 33.448  12.262  -2.416  0.50 45.51  ? 369  GLN A OE1 1 
ATOM   2819 N NE2 A GLN A 1 369 ? 38.435  12.938  -1.194  0.50 46.89  ? 369  GLN A NE2 1 
ATOM   2820 N NE2 B GLN A 1 369 ? 33.484  10.087  -2.953  0.50 46.18  ? 369  GLN A NE2 1 
ATOM   2821 N N   . ALA A 1 370 ? 35.519  12.494  -6.390  1.00 54.56  ? 370  ALA A N   1 
ATOM   2822 C CA  . ALA A 1 370 ? 34.919  12.129  -7.670  1.00 56.06  ? 370  ALA A CA  1 
ATOM   2823 C C   . ALA A 1 370 ? 35.706  12.536  -8.907  1.00 57.45  ? 370  ALA A C   1 
ATOM   2824 O O   . ALA A 1 370 ? 36.175  13.658  -9.005  1.00 57.53  ? 370  ALA A O   1 
ATOM   2825 C CB  . ALA A 1 370 ? 33.492  12.657  -7.752  1.00 55.30  ? 370  ALA A CB  1 
ATOM   2826 N N   . SER A 1 371 ? 35.817  11.616  -9.860  1.00 59.01  ? 371  SER A N   1 
ATOM   2827 C CA  . SER A 1 371 ? 36.358  11.935  -11.169 1.00 60.62  ? 371  SER A CA  1 
ATOM   2828 C C   . SER A 1 371 ? 35.399  12.864  -11.920 1.00 60.77  ? 371  SER A C   1 
ATOM   2829 O O   . SER A 1 371 ? 34.295  13.130  -11.453 1.00 60.24  ? 371  SER A O   1 
ATOM   2830 C CB  . SER A 1 371 ? 36.582  10.652  -11.959 1.00 61.98  ? 371  SER A CB  1 
ATOM   2831 O OG  . SER A 1 371 ? 35.353  10.076  -12.374 1.00 62.94  ? 371  SER A OG  1 
ATOM   2832 N N   . ASP A 1 372 ? 35.822  13.356  -13.080 1.00 61.82  ? 372  ASP A N   1 
ATOM   2833 C CA  . ASP A 1 372 ? 34.964  14.198  -13.918 1.00 62.25  ? 372  ASP A CA  1 
ATOM   2834 C C   . ASP A 1 372 ? 33.716  13.440  -14.378 1.00 61.93  ? 372  ASP A C   1 
ATOM   2835 O O   . ASP A 1 372 ? 32.614  14.002  -14.441 1.00 61.37  ? 372  ASP A O   1 
ATOM   2836 C CB  . ASP A 1 372 ? 35.732  14.710  -15.137 1.00 63.91  ? 372  ASP A CB  1 
ATOM   2837 C CG  . ASP A 1 372 ? 36.977  15.480  -14.758 1.00 65.60  ? 372  ASP A CG  1 
ATOM   2838 O OD1 . ASP A 1 372 ? 37.840  14.916  -14.037 1.00 67.56  ? 372  ASP A OD1 1 
ATOM   2839 O OD2 . ASP A 1 372 ? 37.091  16.649  -15.187 1.00 67.40  ? 372  ASP A OD2 1 
ATOM   2840 N N   . LEU A 1 373 ? 33.914  12.166  -14.707 1.00 61.69  ? 373  LEU A N   1 
ATOM   2841 C CA  . LEU A 1 373 ? 32.819  11.299  -15.092 1.00 61.24  ? 373  LEU A CA  1 
ATOM   2842 C C   . LEU A 1 373 ? 31.771  11.169  -13.968 1.00 59.50  ? 373  LEU A C   1 
ATOM   2843 O O   . LEU A 1 373 ? 30.566  11.290  -14.218 1.00 59.60  ? 373  LEU A O   1 
ATOM   2844 C CB  . LEU A 1 373 ? 33.347  9.930   -15.532 1.00 61.90  ? 373  LEU A CB  1 
ATOM   2845 C CG  . LEU A 1 373 ? 32.312  9.055   -16.249 1.00 62.37  ? 373  LEU A CG  1 
ATOM   2846 C CD1 . LEU A 1 373 ? 31.577  9.809   -17.373 1.00 61.58  ? 373  LEU A CD1 1 
ATOM   2847 C CD2 . LEU A 1 373 ? 32.923  7.751   -16.753 1.00 62.77  ? 373  LEU A CD2 1 
ATOM   2848 N N   . ALA A 1 374 ? 32.234  10.951  -12.741 1.00 57.62  ? 374  ALA A N   1 
ATOM   2849 C CA  . ALA A 1 374 ? 31.340  10.770  -11.598 1.00 55.80  ? 374  ALA A CA  1 
ATOM   2850 C C   . ALA A 1 374 ? 30.582  12.051  -11.240 1.00 54.42  ? 374  ALA A C   1 
ATOM   2851 O O   . ALA A 1 374 ? 29.398  12.013  -10.936 1.00 53.78  ? 374  ALA A O   1 
ATOM   2852 C CB  . ALA A 1 374 ? 32.114  10.252  -10.406 1.00 54.96  ? 374  ALA A CB  1 
ATOM   2853 N N   . ALA A 1 375 ? 31.275  13.178  -11.295 1.00 54.04  ? 375  ALA A N   1 
ATOM   2854 C CA  . ALA A 1 375 ? 30.690  14.471  -10.984 1.00 53.44  ? 375  ALA A CA  1 
ATOM   2855 C C   . ALA A 1 375 ? 29.589  14.806  -11.979 1.00 54.33  ? 375  ALA A C   1 
ATOM   2856 O O   . ALA A 1 375 ? 28.551  15.368  -11.606 1.00 54.40  ? 375  ALA A O   1 
ATOM   2857 C CB  . ALA A 1 375 ? 31.764  15.561  -10.995 1.00 53.19  ? 375  ALA A CB  1 
ATOM   2858 N N   . GLU A 1 376 ? 29.809  14.446  -13.241 1.00 55.24  ? 376  GLU A N   1 
ATOM   2859 C CA  . GLU A 1 376 ? 28.839  14.733  -14.275 1.00 55.89  ? 376  GLU A CA  1 
ATOM   2860 C C   . GLU A 1 376 ? 27.635  13.815  -14.038 1.00 54.86  ? 376  GLU A C   1 
ATOM   2861 O O   . GLU A 1 376 ? 26.493  14.250  -14.170 1.00 54.99  ? 376  GLU A O   1 
ATOM   2862 C CB  . GLU A 1 376 ? 29.468  14.593  -15.670 1.00 57.86  ? 376  GLU A CB  1 
ATOM   2863 C CG  . GLU A 1 376 ? 28.721  15.271  -16.856 1.00 62.87  ? 376  GLU A CG  1 
ATOM   2864 C CD  . GLU A 1 376 ? 28.234  16.702  -16.573 1.00 68.70  ? 376  GLU A CD  1 
ATOM   2865 O OE1 . GLU A 1 376 ? 29.029  17.541  -16.058 1.00 70.58  ? 376  GLU A OE1 1 
ATOM   2866 O OE2 . GLU A 1 376 ? 27.043  16.990  -16.879 1.00 70.90  ? 376  GLU A OE2 1 
ATOM   2867 N N   . ALA A 1 377 ? 27.885  12.575  -13.630 1.00 53.17  ? 377  ALA A N   1 
ATOM   2868 C CA  . ALA A 1 377 ? 26.791  11.696  -13.244 1.00 52.37  ? 377  ALA A CA  1 
ATOM   2869 C C   . ALA A 1 377 ? 25.938  12.312  -12.116 1.00 51.17  ? 377  ALA A C   1 
ATOM   2870 O O   . ALA A 1 377 ? 24.698  12.328  -12.215 1.00 51.15  ? 377  ALA A O   1 
ATOM   2871 C CB  . ALA A 1 377 ? 27.296  10.321  -12.861 1.00 51.97  ? 377  ALA A CB  1 
ATOM   2872 N N   . VAL A 1 378 ? 26.602  12.848  -11.081 1.00 49.42  ? 378  VAL A N   1 
ATOM   2873 C CA  . VAL A 1 378 ? 25.922  13.458  -9.936  1.00 47.85  ? 378  VAL A CA  1 
ATOM   2874 C C   . VAL A 1 378 ? 25.023  14.597  -10.425 1.00 48.53  ? 378  VAL A C   1 
ATOM   2875 O O   . VAL A 1 378 ? 23.833  14.677  -10.088 1.00 48.64  ? 378  VAL A O   1 
ATOM   2876 C CB  . VAL A 1 378 ? 26.931  13.998  -8.879  1.00 46.73  ? 378  VAL A CB  1 
ATOM   2877 C CG1 . VAL A 1 378 ? 26.228  14.846  -7.835  1.00 44.57  ? 378  VAL A CG1 1 
ATOM   2878 C CG2 . VAL A 1 378 ? 27.666  12.852  -8.184  1.00 45.70  ? 378  VAL A CG2 1 
ATOM   2879 N N   . VAL A 1 379 ? 25.605  15.455  -11.252 1.00 48.57  ? 379  VAL A N   1 
ATOM   2880 C CA  . VAL A 1 379 ? 24.944  16.639  -11.745 1.00 48.47  ? 379  VAL A CA  1 
ATOM   2881 C C   . VAL A 1 379 ? 23.736  16.292  -12.610 1.00 49.67  ? 379  VAL A C   1 
ATOM   2882 O O   . VAL A 1 379 ? 22.682  16.929  -12.518 1.00 49.39  ? 379  VAL A O   1 
ATOM   2883 C CB  . VAL A 1 379 ? 25.938  17.496  -12.538 1.00 48.50  ? 379  VAL A CB  1 
ATOM   2884 C CG1 . VAL A 1 379 ? 25.215  18.465  -13.455 1.00 48.03  ? 379  VAL A CG1 1 
ATOM   2885 C CG2 . VAL A 1 379 ? 26.828  18.241  -11.573 1.00 47.70  ? 379  VAL A CG2 1 
ATOM   2886 N N   . LEU A 1 380 ? 23.897  15.286  -13.455 1.00 50.57  ? 380  LEU A N   1 
ATOM   2887 C CA  . LEU A 1 380 ? 22.811  14.892  -14.320 1.00 52.10  ? 380  LEU A CA  1 
ATOM   2888 C C   . LEU A 1 380 ? 21.682  14.244  -13.512 1.00 51.94  ? 380  LEU A C   1 
ATOM   2889 O O   . LEU A 1 380 ? 20.511  14.464  -13.791 1.00 52.61  ? 380  LEU A O   1 
ATOM   2890 C CB  . LEU A 1 380 ? 23.315  13.993  -15.444 1.00 53.55  ? 380  LEU A CB  1 
ATOM   2891 C CG  . LEU A 1 380 ? 24.402  14.586  -16.357 1.00 54.79  ? 380  LEU A CG  1 
ATOM   2892 C CD1 . LEU A 1 380 ? 24.833  13.566  -17.381 1.00 56.69  ? 380  LEU A CD1 1 
ATOM   2893 C CD2 . LEU A 1 380 ? 23.981  15.884  -17.061 1.00 56.15  ? 380  LEU A CD2 1 
ATOM   2894 N N   . HIS A 1 381 ? 22.038  13.480  -12.487 1.00 50.97  ? 381  HIS A N   1 
ATOM   2895 C CA  . HIS A 1 381 ? 21.042  12.876  -11.624 1.00 50.50  ? 381  HIS A CA  1 
ATOM   2896 C C   . HIS A 1 381 ? 20.244  13.913  -10.849 1.00 49.79  ? 381  HIS A C   1 
ATOM   2897 O O   . HIS A 1 381 ? 19.045  13.755  -10.628 1.00 50.05  ? 381  HIS A O   1 
ATOM   2898 C CB  . HIS A 1 381 ? 21.704  11.920  -10.640 1.00 49.68  ? 381  HIS A CB  1 
ATOM   2899 C CG  . HIS A 1 381 ? 20.731  11.131  -9.826  1.00 50.53  ? 381  HIS A CG  1 
ATOM   2900 N ND1 . HIS A 1 381 ? 20.112  9.994   -10.301 1.00 53.46  ? 381  HIS A ND1 1 
ATOM   2901 C CD2 . HIS A 1 381 ? 20.261  11.316  -8.573  1.00 51.23  ? 381  HIS A CD2 1 
ATOM   2902 C CE1 . HIS A 1 381 ? 19.314  9.505   -9.370  1.00 53.04  ? 381  HIS A CE1 1 
ATOM   2903 N NE2 . HIS A 1 381 ? 19.388  10.287  -8.309  1.00 52.11  ? 381  HIS A NE2 1 
ATOM   2904 N N   . TYR A 1 382 ? 20.915  14.967  -10.408 1.00 48.98  ? 382  TYR A N   1 
ATOM   2905 C CA  . TYR A 1 382 ? 20.259  15.921  -9.526  1.00 47.94  ? 382  TYR A CA  1 
ATOM   2906 C C   . TYR A 1 382 ? 19.586  17.054  -10.256 1.00 49.09  ? 382  TYR A C   1 
ATOM   2907 O O   . TYR A 1 382 ? 18.764  17.738  -9.665  1.00 49.89  ? 382  TYR A O   1 
ATOM   2908 C CB  . TYR A 1 382 ? 21.207  16.416  -8.443  1.00 46.08  ? 382  TYR A CB  1 
ATOM   2909 C CG  . TYR A 1 382 ? 21.316  15.444  -7.279  1.00 44.19  ? 382  TYR A CG  1 
ATOM   2910 C CD1 . TYR A 1 382 ? 22.262  14.428  -7.287  1.00 43.21  ? 382  TYR A CD1 1 
ATOM   2911 C CD2 . TYR A 1 382 ? 20.451  15.533  -6.178  1.00 43.06  ? 382  TYR A CD2 1 
ATOM   2912 C CE1 . TYR A 1 382 ? 22.362  13.528  -6.236  1.00 42.64  ? 382  TYR A CE1 1 
ATOM   2913 C CE2 . TYR A 1 382 ? 20.542  14.643  -5.118  1.00 42.70  ? 382  TYR A CE2 1 
ATOM   2914 C CZ  . TYR A 1 382 ? 21.507  13.640  -5.155  1.00 43.46  ? 382  TYR A CZ  1 
ATOM   2915 O OH  . TYR A 1 382 ? 21.632  12.751  -4.115  1.00 42.42  ? 382  TYR A OH  1 
ATOM   2916 N N   . THR A 1 383 ? 19.892  17.229  -11.541 1.00 50.26  ? 383  THR A N   1 
ATOM   2917 C CA  . THR A 1 383 ? 19.276  18.287  -12.340 1.00 51.57  ? 383  THR A CA  1 
ATOM   2918 C C   . THR A 1 383 ? 17.772  18.051  -12.460 1.00 53.60  ? 383  THR A C   1 
ATOM   2919 O O   . THR A 1 383 ? 17.331  16.922  -12.624 1.00 55.06  ? 383  THR A O   1 
ATOM   2920 C CB  . THR A 1 383 ? 19.951  18.409  -13.727 1.00 52.01  ? 383  THR A CB  1 
ATOM   2921 O OG1 . THR A 1 383 ? 21.321  18.749  -13.544 1.00 51.39  ? 383  THR A OG1 1 
ATOM   2922 C CG2 . THR A 1 383 ? 19.313  19.480  -14.609 1.00 51.57  ? 383  THR A CG2 1 
ATOM   2923 N N   . ASP A 1 384 ? 16.987  19.110  -12.321 1.00 54.79  ? 384  ASP A N   1 
ATOM   2924 C CA  . ASP A 1 384 ? 15.597  19.067  -12.717 1.00 57.02  ? 384  ASP A CA  1 
ATOM   2925 C C   . ASP A 1 384 ? 15.554  19.440  -14.194 1.00 58.52  ? 384  ASP A C   1 
ATOM   2926 O O   . ASP A 1 384 ? 15.603  20.622  -14.527 1.00 59.01  ? 384  ASP A O   1 
ATOM   2927 C CB  . ASP A 1 384 ? 14.780  20.073  -11.911 1.00 57.24  ? 384  ASP A CB  1 
ATOM   2928 C CG  . ASP A 1 384 ? 13.332  20.173  -12.390 1.00 61.32  ? 384  ASP A CG  1 
ATOM   2929 O OD1 . ASP A 1 384 ? 12.926  19.407  -13.298 1.00 63.11  ? 384  ASP A OD1 1 
ATOM   2930 O OD2 . ASP A 1 384 ? 12.594  21.030  -11.855 1.00 64.33  ? 384  ASP A OD2 1 
ATOM   2931 N N   . TRP A 1 385 ? 15.462  18.443  -15.077 1.00 59.27  ? 385  TRP A N   1 
ATOM   2932 C CA  . TRP A 1 385 ? 15.526  18.700  -16.522 1.00 60.23  ? 385  TRP A CA  1 
ATOM   2933 C C   . TRP A 1 385 ? 14.379  19.548  -17.099 1.00 61.98  ? 385  TRP A C   1 
ATOM   2934 O O   . TRP A 1 385 ? 14.473  20.027  -18.230 1.00 63.28  ? 385  TRP A O   1 
ATOM   2935 C CB  . TRP A 1 385 ? 15.798  17.409  -17.307 1.00 60.50  ? 385  TRP A CB  1 
ATOM   2936 C CG  . TRP A 1 385 ? 17.129  16.882  -16.924 1.00 57.60  ? 385  TRP A CG  1 
ATOM   2937 C CD1 . TRP A 1 385 ? 17.401  15.903  -16.006 1.00 54.13  ? 385  TRP A CD1 1 
ATOM   2938 C CD2 . TRP A 1 385 ? 18.392  17.364  -17.382 1.00 54.79  ? 385  TRP A CD2 1 
ATOM   2939 N NE1 . TRP A 1 385 ? 18.757  15.731  -15.887 1.00 51.52  ? 385  TRP A NE1 1 
ATOM   2940 C CE2 . TRP A 1 385 ? 19.392  16.615  -16.712 1.00 51.40  ? 385  TRP A CE2 1 
ATOM   2941 C CE3 . TRP A 1 385 ? 18.775  18.364  -18.281 1.00 55.46  ? 385  TRP A CE3 1 
ATOM   2942 C CZ2 . TRP A 1 385 ? 20.746  16.826  -16.913 1.00 51.93  ? 385  TRP A CZ2 1 
ATOM   2943 C CZ3 . TRP A 1 385 ? 20.142  18.586  -18.489 1.00 56.47  ? 385  TRP A CZ3 1 
ATOM   2944 C CH2 . TRP A 1 385 ? 21.113  17.808  -17.810 1.00 55.42  ? 385  TRP A CH2 1 
ATOM   2945 N N   . LEU A 1 386 ? 13.320  19.740  -16.318 1.00 62.21  ? 386  LEU A N   1 
ATOM   2946 C CA  . LEU A 1 386 ? 12.244  20.656  -16.697 1.00 64.04  ? 386  LEU A CA  1 
ATOM   2947 C C   . LEU A 1 386 ? 12.585  22.134  -16.457 1.00 63.79  ? 386  LEU A C   1 
ATOM   2948 O O   . LEU A 1 386 ? 12.146  23.006  -17.207 1.00 65.22  ? 386  LEU A O   1 
ATOM   2949 C CB  . LEU A 1 386 ? 10.941  20.303  -15.973 1.00 64.44  ? 386  LEU A CB  1 
ATOM   2950 C CG  . LEU A 1 386 ? 9.871   19.572  -16.782 1.00 67.33  ? 386  LEU A CG  1 
ATOM   2951 C CD1 . LEU A 1 386 ? 8.615   19.412  -15.949 1.00 68.84  ? 386  LEU A CD1 1 
ATOM   2952 C CD2 . LEU A 1 386 ? 9.557   20.329  -18.089 1.00 70.02  ? 386  LEU A CD2 1 
ATOM   2953 N N   . HIS A 1 387 ? 13.339  22.403  -15.394 1.00 62.27  ? 387  HIS A N   1 
ATOM   2954 C CA  . HIS A 1 387 ? 13.719  23.756  -15.001 1.00 62.01  ? 387  HIS A CA  1 
ATOM   2955 C C   . HIS A 1 387 ? 15.215  23.715  -14.632 1.00 60.22  ? 387  HIS A C   1 
ATOM   2956 O O   . HIS A 1 387 ? 15.582  23.990  -13.488 1.00 58.71  ? 387  HIS A O   1 
ATOM   2957 C CB  . HIS A 1 387 ? 12.899  24.253  -13.777 1.00 62.06  ? 387  HIS A CB  1 
ATOM   2958 C CG  . HIS A 1 387 ? 11.402  24.195  -13.934 1.00 64.95  ? 387  HIS A CG  1 
ATOM   2959 N ND1 . HIS A 1 387 ? 10.628  23.220  -13.337 1.00 66.14  ? 387  HIS A ND1 1 
ATOM   2960 C CD2 . HIS A 1 387 ? 10.532  25.018  -14.573 1.00 68.50  ? 387  HIS A CD2 1 
ATOM   2961 C CE1 . HIS A 1 387 ? 9.351   23.429  -13.620 1.00 67.72  ? 387  HIS A CE1 1 
ATOM   2962 N NE2 . HIS A 1 387 ? 9.264   24.516  -14.365 1.00 68.73  ? 387  HIS A NE2 1 
ATOM   2963 N N   . PRO A 1 388 ? 16.091  23.368  -15.599 1.00 60.43  ? 388  PRO A N   1 
ATOM   2964 C CA  . PRO A 1 388 ? 17.510  23.126  -15.271 1.00 58.92  ? 388  PRO A CA  1 
ATOM   2965 C C   . PRO A 1 388 ? 18.325  24.351  -14.820 1.00 58.15  ? 388  PRO A C   1 
ATOM   2966 O O   . PRO A 1 388 ? 19.468  24.201  -14.425 1.00 57.15  ? 388  PRO A O   1 
ATOM   2967 C CB  . PRO A 1 388 ? 18.080  22.549  -16.577 1.00 59.76  ? 388  PRO A CB  1 
ATOM   2968 C CG  . PRO A 1 388 ? 17.188  23.061  -17.653 1.00 61.46  ? 388  PRO A CG  1 
ATOM   2969 C CD  . PRO A 1 388 ? 15.823  23.233  -17.047 1.00 61.89  ? 388  PRO A CD  1 
ATOM   2970 N N   . GLU A 1 389 ? 17.735  25.540  -14.867 1.00 59.30  ? 389  GLU A N   1 
ATOM   2971 C CA  . GLU A 1 389 ? 18.455  26.790  -14.567 1.00 59.43  ? 389  GLU A CA  1 
ATOM   2972 C C   . GLU A 1 389 ? 17.890  27.474  -13.336 1.00 57.88  ? 389  GLU A C   1 
ATOM   2973 O O   . GLU A 1 389 ? 18.377  28.524  -12.940 1.00 57.77  ? 389  GLU A O   1 
ATOM   2974 C CB  . GLU A 1 389 ? 18.372  27.788  -15.746 1.00 61.36  ? 389  GLU A CB  1 
ATOM   2975 C CG  . GLU A 1 389 ? 18.824  27.246  -17.126 1.00 65.66  ? 389  GLU A CG  1 
ATOM   2976 C CD  . GLU A 1 389 ? 20.280  27.546  -17.467 1.00 68.78  ? 389  GLU A CD  1 
ATOM   2977 O OE1 . GLU A 1 389 ? 21.194  27.121  -16.723 1.00 69.99  ? 389  GLU A OE1 1 
ATOM   2978 O OE2 . GLU A 1 389 ? 20.507  28.215  -18.494 1.00 71.42  ? 389  GLU A OE2 1 
ATOM   2979 N N   . ASP A 1 390 ? 16.842  26.892  -12.764 1.00 56.81  ? 390  ASP A N   1 
ATOM   2980 C CA  . ASP A 1 390 ? 16.164  27.465  -11.620 1.00 55.79  ? 390  ASP A CA  1 
ATOM   2981 C C   . ASP A 1 390 ? 17.117  27.532  -10.415 1.00 53.56  ? 390  ASP A C   1 
ATOM   2982 O O   . ASP A 1 390 ? 17.566  26.515  -9.909  1.00 51.60  ? 390  ASP A O   1 
ATOM   2983 C CB  . ASP A 1 390 ? 14.909  26.654  -11.305 1.00 56.38  ? 390  ASP A CB  1 
ATOM   2984 C CG  . ASP A 1 390 ? 14.098  27.255  -10.195 1.00 56.51  ? 390  ASP A CG  1 
ATOM   2985 O OD1 . ASP A 1 390 ? 13.248  28.096  -10.476 1.00 57.96  ? 390  ASP A OD1 1 
ATOM   2986 O OD2 . ASP A 1 390 ? 14.311  26.893  -9.029  1.00 58.42  ? 390  ASP A OD2 1 
ATOM   2987 N N   . PRO A 1 391 ? 17.457  28.749  -9.980  1.00 53.58  ? 391  PRO A N   1 
ATOM   2988 C CA  . PRO A 1 391 ? 18.455  28.885  -8.916  1.00 52.16  ? 391  PRO A CA  1 
ATOM   2989 C C   . PRO A 1 391 ? 18.000  28.360  -7.559  1.00 50.87  ? 391  PRO A C   1 
ATOM   2990 O O   . PRO A 1 391 ? 18.842  27.988  -6.755  1.00 49.45  ? 391  PRO A O   1 
ATOM   2991 C CB  . PRO A 1 391 ? 18.712  30.396  -8.865  1.00 52.82  ? 391  PRO A CB  1 
ATOM   2992 C CG  . PRO A 1 391 ? 17.573  31.007  -9.546  1.00 54.09  ? 391  PRO A CG  1 
ATOM   2993 C CD  . PRO A 1 391 ? 17.101  30.052  -10.567 1.00 54.45  ? 391  PRO A CD  1 
ATOM   2994 N N   . THR A 1 392 ? 16.688  28.327  -7.312  1.00 51.18  ? 392  THR A N   1 
ATOM   2995 C CA  . THR A 1 392 ? 16.155  27.723  -6.087  1.00 49.77  ? 392  THR A CA  1 
ATOM   2996 C C   . THR A 1 392 ? 16.324  26.210  -6.118  1.00 49.01  ? 392  THR A C   1 
ATOM   2997 O O   . THR A 1 392 ? 16.697  25.595  -5.112  1.00 47.65  ? 392  THR A O   1 
ATOM   2998 C CB  . THR A 1 392 ? 14.671  28.054  -5.849  1.00 50.69  ? 392  THR A CB  1 
ATOM   2999 O OG1 . THR A 1 392 ? 14.494  29.470  -5.821  1.00 51.77  ? 392  THR A OG1 1 
ATOM   3000 C CG2 . THR A 1 392 ? 14.203  27.484  -4.514  1.00 48.93  ? 392  THR A CG2 1 
ATOM   3001 N N   . HIS A 1 393 ? 16.029  25.599  -7.259  1.00 49.46  ? 393  HIS A N   1 
ATOM   3002 C CA  . HIS A 1 393 ? 16.217  24.181  -7.346  1.00 49.19  ? 393  HIS A CA  1 
ATOM   3003 C C   . HIS A 1 393 ? 17.705  23.808  -7.229  1.00 47.32  ? 393  HIS A C   1 
ATOM   3004 O O   . HIS A 1 393 ? 18.043  22.820  -6.591  1.00 46.19  ? 393  HIS A O   1 
ATOM   3005 C CB  . HIS A 1 393 ? 15.598  23.557  -8.591  1.00 50.84  ? 393  HIS A CB  1 
ATOM   3006 C CG  . HIS A 1 393 ? 15.857  22.086  -8.663  1.00 54.97  ? 393  HIS A CG  1 
ATOM   3007 N ND1 . HIS A 1 393 ? 15.143  21.170  -7.909  1.00 58.85  ? 393  HIS A ND1 1 
ATOM   3008 C CD2 . HIS A 1 393 ? 16.836  21.382  -9.288  1.00 57.21  ? 393  HIS A CD2 1 
ATOM   3009 C CE1 . HIS A 1 393 ? 15.633  19.958  -8.120  1.00 60.20  ? 393  HIS A CE1 1 
ATOM   3010 N NE2 . HIS A 1 393 ? 16.667  20.061  -8.945  1.00 59.16  ? 393  HIS A NE2 1 
ATOM   3011 N N   . LEU A 1 394 ? 18.582  24.612  -7.822  1.00 46.80  ? 394  LEU A N   1 
ATOM   3012 C CA  . LEU A 1 394 ? 20.019  24.349  -7.779  1.00 45.74  ? 394  LEU A CA  1 
ATOM   3013 C C   . LEU A 1 394 ? 20.573  24.411  -6.349  1.00 44.11  ? 394  LEU A C   1 
ATOM   3014 O O   . LEU A 1 394 ? 21.307  23.532  -5.920  1.00 42.49  ? 394  LEU A O   1 
ATOM   3015 C CB  . LEU A 1 394 ? 20.782  25.255  -8.763  1.00 46.19  ? 394  LEU A CB  1 
ATOM   3016 C CG  . LEU A 1 394 ? 20.462  24.867  -10.236 1.00 47.98  ? 394  LEU A CG  1 
ATOM   3017 C CD1 . LEU A 1 394 ? 20.752  25.960  -11.283 1.00 47.80  ? 394  LEU A CD1 1 
ATOM   3018 C CD2 . LEU A 1 394 ? 21.102  23.530  -10.671 1.00 45.92  ? 394  LEU A CD2 1 
ATOM   3019 N N   . ARG A 1 395 ? 20.159  25.425  -5.608  1.00 44.10  ? 395  ARG A N   1 
ATOM   3020 C CA  . ARG A 1 395 ? 20.489  25.526  -4.214  1.00 43.57  ? 395  ARG A CA  1 
ATOM   3021 C C   . ARG A 1 395 ? 20.079  24.257  -3.451  1.00 43.28  ? 395  ARG A C   1 
ATOM   3022 O O   . ARG A 1 395 ? 20.881  23.692  -2.702  1.00 42.43  ? 395  ARG A O   1 
ATOM   3023 C CB  . ARG A 1 395 ? 19.840  26.781  -3.618  1.00 44.04  ? 395  ARG A CB  1 
ATOM   3024 C CG  . ARG A 1 395 ? 19.987  26.945  -2.095  1.00 42.59  ? 395  ARG A CG  1 
ATOM   3025 C CD  . ARG A 1 395 ? 18.612  26.788  -1.426  1.00 43.73  ? 395  ARG A CD  1 
ATOM   3026 N NE  . ARG A 1 395 ? 17.958  28.077  -1.326  1.00 45.02  ? 395  ARG A NE  1 
ATOM   3027 C CZ  . ARG A 1 395 ? 16.653  28.292  -1.208  1.00 46.48  ? 395  ARG A CZ  1 
ATOM   3028 N NH1 . ARG A 1 395 ? 15.772  27.295  -1.188  1.00 44.20  ? 395  ARG A NH1 1 
ATOM   3029 N NH2 . ARG A 1 395 ? 16.228  29.551  -1.124  1.00 49.24  ? 395  ARG A NH2 1 
ATOM   3030 N N   . ASP A 1 396 ? 18.847  23.805  -3.665  1.00 43.95  ? 396  ASP A N   1 
ATOM   3031 C CA  . ASP A 1 396 ? 18.314  22.650  -2.967  1.00 43.43  ? 396  ASP A CA  1 
ATOM   3032 C C   . ASP A 1 396 ? 18.962  21.369  -3.439  1.00 43.26  ? 396  ASP A C   1 
ATOM   3033 O O   . ASP A 1 396 ? 19.160  20.442  -2.643  1.00 43.31  ? 396  ASP A O   1 
ATOM   3034 C CB  . ASP A 1 396 ? 16.788  22.595  -3.098  1.00 44.48  ? 396  ASP A CB  1 
ATOM   3035 C CG  . ASP A 1 396 ? 16.085  23.770  -2.356  1.00 45.88  ? 396  ASP A CG  1 
ATOM   3036 O OD1 . ASP A 1 396 ? 16.745  24.426  -1.492  1.00 44.79  ? 396  ASP A OD1 1 
ATOM   3037 O OD2 . ASP A 1 396 ? 14.886  24.035  -2.634  1.00 45.54  ? 396  ASP A OD2 1 
ATOM   3038 N N   . ALA A 1 397 ? 19.329  21.306  -4.712  1.00 43.40  ? 397  ALA A N   1 
ATOM   3039 C CA  . ALA A 1 397 ? 20.000  20.108  -5.210  1.00 43.53  ? 397  ALA A CA  1 
ATOM   3040 C C   . ALA A 1 397 ? 21.391  19.969  -4.585  1.00 42.89  ? 397  ALA A C   1 
ATOM   3041 O O   . ALA A 1 397 ? 21.821  18.854  -4.244  1.00 42.44  ? 397  ALA A O   1 
ATOM   3042 C CB  . ALA A 1 397 ? 20.091  20.113  -6.717  1.00 44.21  ? 397  ALA A CB  1 
ATOM   3043 N N   . MET A 1 398 ? 22.074  21.106  -4.428  1.00 42.26  ? 398  MET A N   1 
ATOM   3044 C CA  . MET A 1 398 ? 23.403  21.134  -3.860  1.00 41.38  ? 398  MET A CA  1 
ATOM   3045 C C   . MET A 1 398 ? 23.347  20.625  -2.426  1.00 40.32  ? 398  MET A C   1 
ATOM   3046 O O   . MET A 1 398 ? 24.226  19.863  -2.002  1.00 39.80  ? 398  MET A O   1 
ATOM   3047 C CB  . MET A 1 398 ? 23.974  22.550  -3.900  1.00 41.86  ? 398  MET A CB  1 
ATOM   3048 C CG  . MET A 1 398 ? 25.435  22.661  -3.499  1.00 41.33  ? 398  MET A CG  1 
ATOM   3049 S SD  . MET A 1 398 ? 26.508  21.813  -4.672  1.00 43.34  ? 398  MET A SD  1 
ATOM   3050 C CE  . MET A 1 398 ? 27.013  20.405  -3.698  1.00 39.86  ? 398  MET A CE  1 
ATOM   3051 N N   . SER A 1 399 ? 22.304  21.023  -1.698  1.00 39.54  ? 399  SER A N   1 
ATOM   3052 C CA  . SER A 1 399 ? 22.110  20.573  -0.318  1.00 38.49  ? 399  SER A CA  1 
ATOM   3053 C C   . SER A 1 399 ? 21.838  19.064  -0.234  1.00 38.24  ? 399  SER A C   1 
ATOM   3054 O O   . SER A 1 399 ? 22.420  18.370  0.593   1.00 37.17  ? 399  SER A O   1 
ATOM   3055 C CB  . SER A 1 399 ? 20.994  21.364  0.363   1.00 38.52  ? 399  SER A CB  1 
ATOM   3056 O OG  . SER A 1 399 ? 20.548  20.739  1.564   1.00 37.20  ? 399  SER A OG  1 
ATOM   3057 N N   . ALA A 1 400 ? 20.957  18.572  -1.091  1.00 38.91  ? 400  ALA A N   1 
ATOM   3058 C CA  . ALA A 1 400 ? 20.634  17.147  -1.131  1.00 39.19  ? 400  ALA A CA  1 
ATOM   3059 C C   . ALA A 1 400 ? 21.851  16.320  -1.563  1.00 38.98  ? 400  ALA A C   1 
ATOM   3060 O O   . ALA A 1 400 ? 22.093  15.252  -1.030  1.00 38.19  ? 400  ALA A O   1 
ATOM   3061 C CB  . ALA A 1 400 ? 19.443  16.890  -2.057  1.00 39.77  ? 400  ALA A CB  1 
ATOM   3062 N N   . VAL A 1 401 ? 22.632  16.836  -2.512  1.00 39.82  ? 401  VAL A N   1 
ATOM   3063 C CA  . VAL A 1 401 ? 23.852  16.140  -2.945  1.00 39.94  ? 401  VAL A CA  1 
ATOM   3064 C C   . VAL A 1 401 ? 24.752  15.878  -1.751  1.00 39.47  ? 401  VAL A C   1 
ATOM   3065 O O   . VAL A 1 401 ? 25.224  14.773  -1.558  1.00 40.26  ? 401  VAL A O   1 
ATOM   3066 C CB  . VAL A 1 401 ? 24.634  16.918  -4.025  1.00 40.46  ? 401  VAL A CB  1 
ATOM   3067 C CG1 . VAL A 1 401 ? 26.086  16.396  -4.111  1.00 38.60  ? 401  VAL A CG1 1 
ATOM   3068 C CG2 . VAL A 1 401 ? 23.916  16.821  -5.372  1.00 39.26  ? 401  VAL A CG2 1 
ATOM   3069 N N   . VAL A 1 402 ? 24.949  16.892  -0.930  1.00 39.26  ? 402  VAL A N   1 
ATOM   3070 C CA  . VAL A 1 402 ? 25.766  16.748  0.259   1.00 39.12  ? 402  VAL A CA  1 
ATOM   3071 C C   . VAL A 1 402 ? 25.131  15.853  1.337   1.00 39.29  ? 402  VAL A C   1 
ATOM   3072 O O   . VAL A 1 402 ? 25.811  15.000  1.927   1.00 39.36  ? 402  VAL A O   1 
ATOM   3073 C CB  . VAL A 1 402 ? 26.128  18.129  0.823   1.00 38.53  ? 402  VAL A CB  1 
ATOM   3074 C CG1 . VAL A 1 402 ? 26.709  17.992  2.174   1.00 37.06  ? 402  VAL A CG1 1 
ATOM   3075 C CG2 . VAL A 1 402 ? 27.106  18.805  -0.110  1.00 38.17  ? 402  VAL A CG2 1 
ATOM   3076 N N   . GLY A 1 403 ? 23.834  16.030  1.572   1.00 39.77  ? 403  GLY A N   1 
ATOM   3077 C CA  . GLY A 1 403 ? 23.100  15.232  2.557   1.00 39.72  ? 403  GLY A CA  1 
ATOM   3078 C C   . GLY A 1 403 ? 23.026  13.767  2.174   1.00 40.83  ? 403  GLY A C   1 
ATOM   3079 O O   . GLY A 1 403 ? 23.302  12.877  2.996   1.00 41.30  ? 403  GLY A O   1 
ATOM   3080 N N   . ASP A 1 404 ? 22.671  13.507  0.920   1.00 41.09  ? 404  ASP A N   1 
ATOM   3081 C CA  . ASP A 1 404 ? 22.534  12.150  0.440   1.00 41.40  ? 404  ASP A CA  1 
ATOM   3082 C C   . ASP A 1 404 ? 23.868  11.388  0.507   1.00 41.62  ? 404  ASP A C   1 
ATOM   3083 O O   . ASP A 1 404 ? 23.920  10.254  0.988   1.00 41.71  ? 404  ASP A O   1 
ATOM   3084 C CB  . ASP A 1 404 ? 21.979  12.145  -0.982  1.00 42.04  ? 404  ASP A CB  1 
ATOM   3085 C CG  . ASP A 1 404 ? 20.538  12.659  -1.068  1.00 43.59  ? 404  ASP A CG  1 
ATOM   3086 O OD1 . ASP A 1 404 ? 19.927  12.948  -0.013  1.00 42.64  ? 404  ASP A OD1 1 
ATOM   3087 O OD2 . ASP A 1 404 ? 19.997  12.768  -2.203  1.00 46.24  ? 404  ASP A OD2 1 
ATOM   3088 N N   . HIS A 1 405 ? 24.946  12.024  0.049   1.00 41.33  ? 405  HIS A N   1 
ATOM   3089 C CA  . HIS A 1 405 ? 26.248  11.352  -0.104  1.00 41.09  ? 405  HIS A CA  1 
ATOM   3090 C C   . HIS A 1 405 ? 26.904  11.043  1.240   1.00 40.50  ? 405  HIS A C   1 
ATOM   3091 O O   . HIS A 1 405 ? 27.529  9.990   1.428   1.00 41.19  ? 405  HIS A O   1 
ATOM   3092 C CB  . HIS A 1 405 ? 27.136  12.240  -0.974  1.00 41.01  ? 405  HIS A CB  1 
ATOM   3093 C CG  . HIS A 1 405 ? 28.568  11.822  -1.054  1.00 39.87  ? 405  HIS A CG  1 
ATOM   3094 N ND1 . HIS A 1 405 ? 28.958  10.565  -1.455  1.00 40.71  ? 405  HIS A ND1 1 
ATOM   3095 C CD2 . HIS A 1 405 ? 29.709  12.522  -0.845  1.00 38.63  ? 405  HIS A CD2 1 
ATOM   3096 C CE1 . HIS A 1 405 ? 30.278  10.502  -1.471  1.00 40.78  ? 405  HIS A CE1 1 
ATOM   3097 N NE2 . HIS A 1 405 ? 30.756  11.679  -1.111  1.00 39.75  ? 405  HIS A NE2 1 
ATOM   3098 N N   . ASN A 1 406 ? 26.719  11.949  2.185   1.00 39.54  ? 406  ASN A N   1 
ATOM   3099 C CA  . ASN A 1 406 ? 27.387  11.847  3.451   1.00 38.99  ? 406  ASN A CA  1 
ATOM   3100 C C   . ASN A 1 406 ? 26.614  11.193  4.581   1.00 38.76  ? 406  ASN A C   1 
ATOM   3101 O O   . ASN A 1 406 ? 27.235  10.644  5.493   1.00 38.54  ? 406  ASN A O   1 
ATOM   3102 C CB  . ASN A 1 406 ? 27.868  13.221  3.870   1.00 38.48  ? 406  ASN A CB  1 
ATOM   3103 C CG  . ASN A 1 406 ? 29.015  13.682  3.036   1.00 39.59  ? 406  ASN A CG  1 
ATOM   3104 O OD1 . ASN A 1 406 ? 30.050  13.017  2.985   1.00 41.04  ? 406  ASN A OD1 1 
ATOM   3105 N ND2 . ASN A 1 406 ? 28.842  14.803  2.347   1.00 39.23  ? 406  ASN A ND2 1 
ATOM   3106 N N   . VAL A 1 407 ? 25.281  11.252  4.534   1.00 38.84  ? 407  VAL A N   1 
ATOM   3107 C CA  . VAL A 1 407 ? 24.463  10.738  5.624   1.00 38.29  ? 407  VAL A CA  1 
ATOM   3108 C C   . VAL A 1 407 ? 23.305  9.821   5.181   1.00 39.75  ? 407  VAL A C   1 
ATOM   3109 O O   . VAL A 1 407 ? 23.261  8.655   5.590   1.00 40.55  ? 407  VAL A O   1 
ATOM   3110 C CB  . VAL A 1 407 ? 23.902  11.864  6.510   1.00 37.86  ? 407  VAL A CB  1 
ATOM   3111 C CG1 . VAL A 1 407 ? 23.130  11.270  7.690   1.00 37.44  ? 407  VAL A CG1 1 
ATOM   3112 C CG2 . VAL A 1 407 ? 25.004  12.800  7.020   1.00 36.36  ? 407  VAL A CG2 1 
ATOM   3113 N N   . VAL A 1 408 ? 22.371  10.323  4.368   1.00 39.83  ? 408  VAL A N   1 
ATOM   3114 C CA  . VAL A 1 408 ? 21.145  9.565   4.098   1.00 40.00  ? 408  VAL A CA  1 
ATOM   3115 C C   . VAL A 1 408 ? 21.452  8.194   3.493   1.00 41.60  ? 408  VAL A C   1 
ATOM   3116 O O   . VAL A 1 408 ? 20.934  7.158   3.979   1.00 41.87  ? 408  VAL A O   1 
ATOM   3117 C CB  . VAL A 1 408 ? 20.123  10.345  3.233   1.00 40.42  ? 408  VAL A CB  1 
ATOM   3118 C CG1 . VAL A 1 408 ? 18.829  9.596   3.163   1.00 39.84  ? 408  VAL A CG1 1 
ATOM   3119 C CG2 . VAL A 1 408 ? 19.857  11.707  3.814   1.00 38.54  ? 408  VAL A CG2 1 
ATOM   3120 N N   . CYS A 1 409 ? 22.333  8.170   2.488   1.00 41.68  ? 409  CYS A N   1 
ATOM   3121 C CA  . CYS A 1 409 ? 22.589  6.922   1.755   1.00 43.11  ? 409  CYS A CA  1 
ATOM   3122 C C   . CYS A 1 409 ? 23.514  5.964   2.500   1.00 43.15  ? 409  CYS A C   1 
ATOM   3123 O O   . CYS A 1 409 ? 23.351  4.748   2.403   1.00 44.48  ? 409  CYS A O   1 
ATOM   3124 C CB  . CYS A 1 409 ? 23.028  7.176   0.298   1.00 43.26  ? 409  CYS A CB  1 
ATOM   3125 S SG  . CYS A 1 409 ? 21.710  8.020   -0.676  1.00 44.77  ? 409  CYS A SG  1 
ATOM   3126 N N   . PRO A 1 410 ? 24.488  6.501   3.247   1.00 42.13  ? 410  PRO A N   1 
ATOM   3127 C CA  . PRO A 1 410 ? 25.232  5.601   4.105   1.00 41.79  ? 410  PRO A CA  1 
ATOM   3128 C C   . PRO A 1 410 ? 24.349  4.990   5.200   1.00 42.15  ? 410  PRO A C   1 
ATOM   3129 O O   . PRO A 1 410 ? 24.511  3.805   5.538   1.00 43.69  ? 410  PRO A O   1 
ATOM   3130 C CB  . PRO A 1 410 ? 26.301  6.518   4.696   1.00 40.46  ? 410  PRO A CB  1 
ATOM   3131 C CG  . PRO A 1 410 ? 26.555  7.491   3.617   1.00 40.31  ? 410  PRO A CG  1 
ATOM   3132 C CD  . PRO A 1 410 ? 25.179  7.796   3.100   1.00 41.29  ? 410  PRO A CD  1 
ATOM   3133 N N   . VAL A 1 411 ? 23.427  5.775   5.747   1.00 41.35  ? 411  VAL A N   1 
ATOM   3134 C CA  . VAL A 1 411 ? 22.439  5.246   6.671   1.00 41.42  ? 411  VAL A CA  1 
ATOM   3135 C C   . VAL A 1 411 ? 21.567  4.165   6.017   1.00 43.14  ? 411  VAL A C   1 
ATOM   3136 O O   . VAL A 1 411 ? 21.333  3.117   6.613   1.00 44.08  ? 411  VAL A O   1 
ATOM   3137 C CB  . VAL A 1 411 ? 21.576  6.373   7.284   1.00 41.10  ? 411  VAL A CB  1 
ATOM   3138 C CG1 . VAL A 1 411 ? 20.326  5.823   7.991   1.00 40.07  ? 411  VAL A CG1 1 
ATOM   3139 C CG2 . VAL A 1 411 ? 22.406  7.205   8.240   1.00 39.38  ? 411  VAL A CG2 1 
ATOM   3140 N N   . ALA A 1 412 ? 21.095  4.409   4.798   1.00 44.02  ? 412  ALA A N   1 
ATOM   3141 C CA  . ALA A 1 412 ? 20.197  3.460   4.115   1.00 45.47  ? 412  ALA A CA  1 
ATOM   3142 C C   . ALA A 1 412 ? 20.928  2.156   3.846   1.00 46.77  ? 412  ALA A C   1 
ATOM   3143 O O   . ALA A 1 412 ? 20.400  1.062   4.096   1.00 47.87  ? 412  ALA A O   1 
ATOM   3144 C CB  . ALA A 1 412 ? 19.670  4.050   2.831   1.00 45.24  ? 412  ALA A CB  1 
ATOM   3145 N N   . GLN A 1 413 ? 22.160  2.280   3.371   1.00 46.57  ? 413  GLN A N   1 
ATOM   3146 C CA  . GLN A 1 413 ? 23.027  1.138   3.207   1.00 48.48  ? 413  GLN A CA  1 
ATOM   3147 C C   . GLN A 1 413 ? 23.171  0.353   4.519   1.00 48.63  ? 413  GLN A C   1 
ATOM   3148 O O   . GLN A 1 413 ? 23.034  -0.877  4.551   1.00 49.77  ? 413  GLN A O   1 
ATOM   3149 C CB  . GLN A 1 413 ? 24.390  1.615   2.764   1.00 48.15  ? 413  GLN A CB  1 
ATOM   3150 C CG  . GLN A 1 413 ? 25.399  0.519   2.717   1.00 52.58  ? 413  GLN A CG  1 
ATOM   3151 C CD  . GLN A 1 413 ? 25.743  0.149   1.317   1.00 58.96  ? 413  GLN A CD  1 
ATOM   3152 O OE1 . GLN A 1 413 ? 25.082  -0.697  0.683   1.00 61.44  ? 413  GLN A OE1 1 
ATOM   3153 N NE2 . GLN A 1 413 ? 26.794  0.791   0.798   1.00 60.58  ? 413  GLN A NE2 1 
ATOM   3154 N N   . LEU A 1 414 ? 23.460  1.082   5.596   1.00 47.64  ? 414  LEU A N   1 
ATOM   3155 C CA  . LEU A 1 414 ? 23.607  0.489   6.920   1.00 47.05  ? 414  LEU A CA  1 
ATOM   3156 C C   . LEU A 1 414 ? 22.340  -0.262  7.322   1.00 47.80  ? 414  LEU A C   1 
ATOM   3157 O O   . LEU A 1 414 ? 22.417  -1.461  7.642   1.00 48.69  ? 414  LEU A O   1 
ATOM   3158 C CB  . LEU A 1 414 ? 23.980  1.548   7.965   1.00 45.21  ? 414  LEU A CB  1 
ATOM   3159 C CG  . LEU A 1 414 ? 24.311  1.038   9.380   1.00 45.86  ? 414  LEU A CG  1 
ATOM   3160 C CD1 . LEU A 1 414 ? 25.614  0.207   9.451   1.00 45.69  ? 414  LEU A CD1 1 
ATOM   3161 C CD2 . LEU A 1 414 ? 24.376  2.201   10.348  1.00 42.73  ? 414  LEU A CD2 1 
ATOM   3162 N N   . ALA A 1 415 ? 21.187  0.416   7.287   1.00 47.06  ? 415  ALA A N   1 
ATOM   3163 C CA  . ALA A 1 415 ? 19.940  -0.218  7.713   1.00 48.24  ? 415  ALA A CA  1 
ATOM   3164 C C   . ALA A 1 415 ? 19.699  -1.507  6.898   1.00 50.63  ? 415  ALA A C   1 
ATOM   3165 O O   . ALA A 1 415 ? 19.461  -2.577  7.454   1.00 51.56  ? 415  ALA A O   1 
ATOM   3166 C CB  . ALA A 1 415 ? 18.774  0.744   7.605   1.00 47.27  ? 415  ALA A CB  1 
ATOM   3167 N N   . GLY A 1 416 ? 19.817  -1.397  5.579   1.00 51.57  ? 416  GLY A N   1 
ATOM   3168 C CA  . GLY A 1 416 ? 19.730  -2.539  4.686   1.00 54.08  ? 416  GLY A CA  1 
ATOM   3169 C C   . GLY A 1 416 ? 20.616  -3.721  5.040   1.00 55.11  ? 416  GLY A C   1 
ATOM   3170 O O   . GLY A 1 416 ? 20.136  -4.857  5.097   1.00 56.87  ? 416  GLY A O   1 
ATOM   3171 N N   . ARG A 1 417 ? 21.901  -3.472  5.271   1.00 54.37  ? 417  ARG A N   1 
ATOM   3172 C CA  . ARG A 1 417 ? 22.817  -4.563  5.571   1.00 55.54  ? 417  ARG A CA  1 
ATOM   3173 C C   . ARG A 1 417 ? 22.542  -5.216  6.929   1.00 55.75  ? 417  ARG A C   1 
ATOM   3174 O O   . ARG A 1 417 ? 22.434  -6.447  7.027   1.00 57.08  ? 417  ARG A O   1 
ATOM   3175 C CB  . ARG A 1 417 ? 24.278  -4.134  5.398   1.00 55.10  ? 417  ARG A CB  1 
ATOM   3176 C CG  . ARG A 1 417 ? 24.744  -4.113  3.924   1.00 57.86  ? 417  ARG A CG  1 
ATOM   3177 C CD  . ARG A 1 417 ? 24.188  -5.306  3.161   1.00 65.23  ? 417  ARG A CD  1 
ATOM   3178 N NE  . ARG A 1 417 ? 24.901  -5.629  1.926   1.00 71.61  ? 417  ARG A NE  1 
ATOM   3179 C CZ  . ARG A 1 417 ? 25.594  -6.757  1.721   1.00 76.05  ? 417  ARG A CZ  1 
ATOM   3180 N NH1 . ARG A 1 417 ? 25.681  -7.685  2.685   1.00 76.97  ? 417  ARG A NH1 1 
ATOM   3181 N NH2 . ARG A 1 417 ? 26.207  -6.963  0.550   1.00 76.37  ? 417  ARG A NH2 1 
ATOM   3182 N N   . LEU A 1 418 ? 22.391  -4.390  7.964   1.00 54.46  ? 418  LEU A N   1 
ATOM   3183 C CA  . LEU A 1 418 ? 22.005  -4.883  9.289   1.00 54.17  ? 418  LEU A CA  1 
ATOM   3184 C C   . LEU A 1 418 ? 20.717  -5.703  9.244   1.00 55.45  ? 418  LEU A C   1 
ATOM   3185 O O   . LEU A 1 418 ? 20.665  -6.805  9.785   1.00 56.76  ? 418  LEU A O   1 
ATOM   3186 C CB  . LEU A 1 418 ? 21.883  -3.738  10.305  1.00 52.09  ? 418  LEU A CB  1 
ATOM   3187 C CG  . LEU A 1 418 ? 23.105  -2.858  10.582  1.00 51.40  ? 418  LEU A CG  1 
ATOM   3188 C CD1 . LEU A 1 418 ? 22.813  -1.929  11.743  1.00 50.46  ? 418  LEU A CD1 1 
ATOM   3189 C CD2 . LEU A 1 418 ? 24.373  -3.660  10.856  1.00 51.09  ? 418  LEU A CD2 1 
ATOM   3190 N N   . ALA A 1 419 ? 19.683  -5.179  8.597   1.00 55.57  ? 419  ALA A N   1 
ATOM   3191 C CA  . ALA A 1 419 ? 18.403  -5.888  8.540   1.00 57.42  ? 419  ALA A CA  1 
ATOM   3192 C C   . ALA A 1 419 ? 18.495  -7.230  7.784   1.00 59.68  ? 419  ALA A C   1 
ATOM   3193 O O   . ALA A 1 419 ? 17.801  -8.192  8.128   1.00 61.29  ? 419  ALA A O   1 
ATOM   3194 C CB  . ALA A 1 419 ? 17.318  -5.008  7.961   1.00 56.63  ? 419  ALA A CB  1 
ATOM   3195 N N   . ALA A 1 420 ? 19.363  -7.289  6.774   1.00 59.98  ? 420  ALA A N   1 
ATOM   3196 C CA  . ALA A 1 420 ? 19.543  -8.504  5.974   1.00 62.17  ? 420  ALA A CA  1 
ATOM   3197 C C   . ALA A 1 420 ? 20.279  -9.578  6.749   1.00 63.25  ? 420  ALA A C   1 
ATOM   3198 O O   . ALA A 1 420 ? 20.162  -10.766 6.433   1.00 65.41  ? 420  ALA A O   1 
ATOM   3199 C CB  . ALA A 1 420 ? 20.280  -8.196  4.673   1.00 61.70  ? 420  ALA A CB  1 
ATOM   3200 N N   . GLN A 1 421 ? 21.019  -9.158  7.776   1.00 62.30  ? 421  GLN A N   1 
ATOM   3201 C CA  . GLN A 1 421 ? 21.910  -10.057 8.514   1.00 63.08  ? 421  GLN A CA  1 
ATOM   3202 C C   . GLN A 1 421 ? 21.603  -10.145 10.014  1.00 62.24  ? 421  GLN A C   1 
ATOM   3203 O O   . GLN A 1 421 ? 22.526  -10.193 10.852  1.00 61.68  ? 421  GLN A O   1 
ATOM   3204 C CB  . GLN A 1 421 ? 23.375  -9.679  8.260   1.00 62.58  ? 421  GLN A CB  1 
ATOM   3205 C CG  . GLN A 1 421 ? 23.843  -9.930  6.820   1.00 65.24  ? 421  GLN A CG  1 
ATOM   3206 C CD  . GLN A 1 421 ? 24.759  -8.828  6.331   1.00 66.92  ? 421  GLN A CD  1 
ATOM   3207 O OE1 . GLN A 1 421 ? 24.809  -8.519  5.130   1.00 68.63  ? 421  GLN A OE1 1 
ATOM   3208 N NE2 . GLN A 1 421 ? 25.479  -8.207  7.265   1.00 65.24  ? 421  GLN A NE2 1 
ATOM   3209 N N   . GLY A 1 422 ? 20.302  -10.150 10.333  1.00 62.22  ? 422  GLY A N   1 
ATOM   3210 C CA  . GLY A 1 422 ? 19.793  -10.515 11.660  1.00 61.58  ? 422  GLY A CA  1 
ATOM   3211 C C   . GLY A 1 422 ? 19.329  -9.418  12.604  1.00 59.59  ? 422  GLY A C   1 
ATOM   3212 O O   . GLY A 1 422 ? 18.597  -9.688  13.563  1.00 60.44  ? 422  GLY A O   1 
ATOM   3213 N N   . ALA A 1 423 ? 19.747  -8.182  12.359  1.00 57.02  ? 423  ALA A N   1 
ATOM   3214 C CA  . ALA A 1 423 ? 19.417  -7.094  13.272  1.00 54.53  ? 423  ALA A CA  1 
ATOM   3215 C C   . ALA A 1 423 ? 17.955  -6.715  13.221  1.00 53.99  ? 423  ALA A C   1 
ATOM   3216 O O   . ALA A 1 423 ? 17.312  -6.787  12.179  1.00 54.30  ? 423  ALA A O   1 
ATOM   3217 C CB  . ALA A 1 423 ? 20.282  -5.871  12.987  1.00 53.16  ? 423  ALA A CB  1 
ATOM   3218 N N   . ARG A 1 424 ? 17.432  -6.330  14.370  1.00 52.94  ? 424  ARG A N   1 
ATOM   3219 C CA  . ARG A 1 424 ? 16.197  -5.603  14.386  1.00 52.88  ? 424  ARG A CA  1 
ATOM   3220 C C   . ARG A 1 424 ? 16.542  -4.116  14.262  1.00 50.05  ? 424  ARG A C   1 
ATOM   3221 O O   . ARG A 1 424 ? 17.240  -3.561  15.096  1.00 48.36  ? 424  ARG A O   1 
ATOM   3222 C CB  . ARG A 1 424 ? 15.420  -5.874  15.659  1.00 53.91  ? 424  ARG A CB  1 
ATOM   3223 C CG  . ARG A 1 424 ? 13.937  -5.581  15.510  1.00 58.07  ? 424  ARG A CG  1 
ATOM   3224 C CD  . ARG A 1 424 ? 13.261  -5.524  16.877  1.00 64.18  ? 424  ARG A CD  1 
ATOM   3225 N NE  . ARG A 1 424 ? 12.960  -6.859  17.416  1.00 70.36  ? 424  ARG A NE  1 
ATOM   3226 C CZ  . ARG A 1 424 ? 12.760  -7.118  18.713  1.00 72.40  ? 424  ARG A CZ  1 
ATOM   3227 N NH1 . ARG A 1 424 ? 12.841  -6.136  19.620  1.00 69.89  ? 424  ARG A NH1 1 
ATOM   3228 N NH2 . ARG A 1 424 ? 12.480  -8.362  19.108  1.00 74.30  ? 424  ARG A NH2 1 
ATOM   3229 N N   . VAL A 1 425 ? 16.033  -3.495  13.207  1.00 49.41  ? 425  VAL A N   1 
ATOM   3230 C CA  . VAL A 1 425 ? 16.349  -2.135  12.848  1.00 47.13  ? 425  VAL A CA  1 
ATOM   3231 C C   . VAL A 1 425 ? 15.077  -1.316  12.810  1.00 47.02  ? 425  VAL A C   1 
ATOM   3232 O O   . VAL A 1 425 ? 14.109  -1.717  12.173  1.00 48.29  ? 425  VAL A O   1 
ATOM   3233 C CB  . VAL A 1 425 ? 16.958  -2.078  11.436  1.00 47.14  ? 425  VAL A CB  1 
ATOM   3234 C CG1 . VAL A 1 425 ? 17.398  -0.650  11.108  1.00 45.44  ? 425  VAL A CG1 1 
ATOM   3235 C CG2 . VAL A 1 425 ? 18.106  -3.082  11.288  1.00 46.31  ? 425  VAL A CG2 1 
ATOM   3236 N N   . TYR A 1 426 ? 15.083  -0.169  13.483  1.00 45.75  ? 426  TYR A N   1 
ATOM   3237 C CA  . TYR A 1 426 ? 13.995  0.804   13.370  1.00 45.50  ? 426  TYR A CA  1 
ATOM   3238 C C   . TYR A 1 426 ? 14.546  2.054   12.725  1.00 44.60  ? 426  TYR A C   1 
ATOM   3239 O O   . TYR A 1 426 ? 15.678  2.448   13.019  1.00 43.64  ? 426  TYR A O   1 
ATOM   3240 C CB  . TYR A 1 426 ? 13.421  1.134   14.738  1.00 45.06  ? 426  TYR A CB  1 
ATOM   3241 C CG  . TYR A 1 426 ? 12.623  0.004   15.360  1.00 45.99  ? 426  TYR A CG  1 
ATOM   3242 C CD1 . TYR A 1 426 ? 13.229  -0.913  16.234  1.00 44.86  ? 426  TYR A CD1 1 
ATOM   3243 C CD2 . TYR A 1 426 ? 11.251  -0.140  15.093  1.00 46.08  ? 426  TYR A CD2 1 
ATOM   3244 C CE1 . TYR A 1 426 ? 12.490  -1.959  16.821  1.00 46.22  ? 426  TYR A CE1 1 
ATOM   3245 C CE2 . TYR A 1 426 ? 10.506  -1.178  15.661  1.00 47.84  ? 426  TYR A CE2 1 
ATOM   3246 C CZ  . TYR A 1 426 ? 11.127  -2.087  16.525  1.00 48.86  ? 426  TYR A CZ  1 
ATOM   3247 O OH  . TYR A 1 426 ? 10.379  -3.105  17.089  1.00 50.06  ? 426  TYR A OH  1 
ATOM   3248 N N   . ALA A 1 427 ? 13.770  2.678   11.841  1.00 45.22  ? 427  ALA A N   1 
ATOM   3249 C CA  . ALA A 1 427 ? 14.299  3.792   11.035  1.00 44.53  ? 427  ALA A CA  1 
ATOM   3250 C C   . ALA A 1 427 ? 13.359  4.979   11.000  1.00 44.96  ? 427  ALA A C   1 
ATOM   3251 O O   . ALA A 1 427 ? 12.144  4.789   10.914  1.00 46.24  ? 427  ALA A O   1 
ATOM   3252 C CB  . ALA A 1 427 ? 14.617  3.325   9.614   1.00 44.40  ? 427  ALA A CB  1 
ATOM   3253 N N   . TYR A 1 428 ? 13.920  6.193   11.052  1.00 44.24  ? 428  TYR A N   1 
ATOM   3254 C CA  . TYR A 1 428 ? 13.121  7.426   11.055  1.00 44.85  ? 428  TYR A CA  1 
ATOM   3255 C C   . TYR A 1 428 ? 13.698  8.513   10.141  1.00 44.78  ? 428  TYR A C   1 
ATOM   3256 O O   . TYR A 1 428 ? 14.892  8.504   9.809   1.00 44.27  ? 428  TYR A O   1 
ATOM   3257 C CB  . TYR A 1 428 ? 13.000  7.991   12.486  1.00 44.28  ? 428  TYR A CB  1 
ATOM   3258 C CG  . TYR A 1 428 ? 14.308  8.528   13.020  1.00 42.41  ? 428  TYR A CG  1 
ATOM   3259 C CD1 . TYR A 1 428 ? 14.730  9.830   12.734  1.00 40.75  ? 428  TYR A CD1 1 
ATOM   3260 C CD2 . TYR A 1 428 ? 15.140  7.725   13.794  1.00 41.57  ? 428  TYR A CD2 1 
ATOM   3261 C CE1 . TYR A 1 428 ? 15.973  10.310  13.205  1.00 40.04  ? 428  TYR A CE1 1 
ATOM   3262 C CE2 . TYR A 1 428 ? 16.366  8.192   14.274  1.00 39.67  ? 428  TYR A CE2 1 
ATOM   3263 C CZ  . TYR A 1 428 ? 16.782  9.474   13.977  1.00 40.09  ? 428  TYR A CZ  1 
ATOM   3264 O OH  . TYR A 1 428 ? 18.001  9.908   14.466  1.00 39.34  ? 428  TYR A OH  1 
ATOM   3265 N N   . ILE A 1 429 ? 12.839  9.447   9.734   1.00 45.25  ? 429  ILE A N   1 
ATOM   3266 C CA  . ILE A 1 429 ? 13.280  10.727  9.191   1.00 44.40  ? 429  ILE A CA  1 
ATOM   3267 C C   . ILE A 1 429 ? 12.658  11.810  10.078  1.00 44.56  ? 429  ILE A C   1 
ATOM   3268 O O   . ILE A 1 429 ? 11.465  11.802  10.352  1.00 46.02  ? 429  ILE A O   1 
ATOM   3269 C CB  . ILE A 1 429 ? 12.926  10.894  7.696   1.00 44.78  ? 429  ILE A CB  1 
ATOM   3270 C CG1 . ILE A 1 429 ? 13.397  12.240  7.167   1.00 44.08  ? 429  ILE A CG1 1 
ATOM   3271 C CG2 . ILE A 1 429 ? 11.428  10.757  7.457   1.00 47.00  ? 429  ILE A CG2 1 
ATOM   3272 C CD1 . ILE A 1 429 ? 13.294  12.352  5.651   1.00 45.38  ? 429  ILE A CD1 1 
ATOM   3273 N N   . PHE A 1 430 ? 13.482  12.722  10.552  1.00 43.71  ? 430  PHE A N   1 
ATOM   3274 C CA  . PHE A 1 430 ? 13.045  13.752  11.472  1.00 43.82  ? 430  PHE A CA  1 
ATOM   3275 C C   . PHE A 1 430 ? 12.784  15.022  10.649  1.00 44.02  ? 430  PHE A C   1 
ATOM   3276 O O   . PHE A 1 430 ? 13.682  15.534  9.965   1.00 43.17  ? 430  PHE A O   1 
ATOM   3277 C CB  . PHE A 1 430 ? 14.144  13.975  12.533  1.00 42.95  ? 430  PHE A CB  1 
ATOM   3278 C CG  . PHE A 1 430 ? 13.754  14.922  13.627  1.00 43.15  ? 430  PHE A CG  1 
ATOM   3279 C CD1 . PHE A 1 430 ? 13.938  16.295  13.478  1.00 41.60  ? 430  PHE A CD1 1 
ATOM   3280 C CD2 . PHE A 1 430 ? 13.208  14.444  14.818  1.00 43.20  ? 430  PHE A CD2 1 
ATOM   3281 C CE1 . PHE A 1 430 ? 13.567  17.167  14.486  1.00 40.56  ? 430  PHE A CE1 1 
ATOM   3282 C CE2 . PHE A 1 430 ? 12.859  15.319  15.834  1.00 42.43  ? 430  PHE A CE2 1 
ATOM   3283 C CZ  . PHE A 1 430 ? 13.033  16.675  15.663  1.00 41.18  ? 430  PHE A CZ  1 
ATOM   3284 N N   . GLU A 1 431 ? 11.553  15.520  10.710  1.00 44.91  ? 431  GLU A N   1 
ATOM   3285 C CA  . GLU A 1 431 ? 11.112  16.548  9.768   1.00 45.58  ? 431  GLU A CA  1 
ATOM   3286 C C   . GLU A 1 431 ? 10.611  17.848  10.399  1.00 45.60  ? 431  GLU A C   1 
ATOM   3287 O O   . GLU A 1 431 ? 10.026  18.668  9.705   1.00 46.00  ? 431  GLU A O   1 
ATOM   3288 C CB  . GLU A 1 431 ? 10.000  15.996  8.885   1.00 46.95  ? 431  GLU A CB  1 
ATOM   3289 C CG  . GLU A 1 431 ? 10.358  14.814  8.020   1.00 48.85  ? 431  GLU A CG  1 
ATOM   3290 C CD  . GLU A 1 431 ? 9.280   14.513  6.972   1.00 53.21  ? 431  GLU A CD  1 
ATOM   3291 O OE1 . GLU A 1 431 ? 8.054   14.591  7.294   1.00 56.13  ? 431  GLU A OE1 1 
ATOM   3292 O OE2 . GLU A 1 431 ? 9.660   14.197  5.823   1.00 53.07  ? 431  GLU A OE2 1 
ATOM   3293 N N   . HIS A 1 432 ? 10.818  18.038  11.698  1.00 45.24  ? 432  HIS A N   1 
ATOM   3294 C CA  . HIS A 1 432 ? 10.371  19.262  12.347  1.00 46.19  ? 432  HIS A CA  1 
ATOM   3295 C C   . HIS A 1 432 ? 11.486  20.310  12.573  1.00 45.45  ? 432  HIS A C   1 
ATOM   3296 O O   . HIS A 1 432 ? 12.526  20.017  13.160  1.00 44.34  ? 432  HIS A O   1 
ATOM   3297 C CB  . HIS A 1 432 ? 9.643   18.958  13.650  1.00 46.88  ? 432  HIS A CB  1 
ATOM   3298 C CG  . HIS A 1 432 ? 9.325   20.185  14.445  1.00 48.85  ? 432  HIS A CG  1 
ATOM   3299 N ND1 . HIS A 1 432 ? 8.370   21.098  14.053  1.00 51.58  ? 432  HIS A ND1 1 
ATOM   3300 C CD2 . HIS A 1 432 ? 9.861   20.671  15.586  1.00 48.85  ? 432  HIS A CD2 1 
ATOM   3301 C CE1 . HIS A 1 432 ? 8.321   22.087  14.924  1.00 51.18  ? 432  HIS A CE1 1 
ATOM   3302 N NE2 . HIS A 1 432 ? 9.212   21.848  15.868  1.00 50.71  ? 432  HIS A NE2 1 
ATOM   3303 N N   . ARG A 1 433 ? 11.241  21.522  12.087  1.00 45.98  ? 433  ARG A N   1 
ATOM   3304 C CA  . ARG A 1 433 ? 12.115  22.668  12.293  1.00 46.31  ? 433  ARG A CA  1 
ATOM   3305 C C   . ARG A 1 433 ? 11.797  23.352  13.630  1.00 47.00  ? 433  ARG A C   1 
ATOM   3306 O O   . ARG A 1 433 ? 10.668  23.827  13.845  1.00 48.83  ? 433  ARG A O   1 
ATOM   3307 C CB  . ARG A 1 433 ? 11.915  23.683  11.160  1.00 46.68  ? 433  ARG A CB  1 
ATOM   3308 C CG  . ARG A 1 433 ? 13.058  24.656  10.991  1.00 47.56  ? 433  ARG A CG  1 
ATOM   3309 C CD  . ARG A 1 433 ? 12.716  25.707  9.949   1.00 49.00  ? 433  ARG A CD  1 
ATOM   3310 N NE  . ARG A 1 433 ? 13.321  26.999  10.267  1.00 48.82  ? 433  ARG A NE  1 
ATOM   3311 C CZ  . ARG A 1 433 ? 14.549  27.364  9.904   1.00 50.38  ? 433  ARG A CZ  1 
ATOM   3312 N NH1 . ARG A 1 433 ? 15.336  26.543  9.196   1.00 50.25  ? 433  ARG A NH1 1 
ATOM   3313 N NH2 . ARG A 1 433 ? 14.993  28.567  10.231  1.00 49.61  ? 433  ARG A NH2 1 
ATOM   3314 N N   . ALA A 1 434 ? 12.789  23.426  14.512  1.00 45.74  ? 434  ALA A N   1 
ATOM   3315 C CA  . ALA A 1 434 ? 12.621  24.103  15.783  1.00 46.25  ? 434  ALA A CA  1 
ATOM   3316 C C   . ALA A 1 434 ? 12.130  25.506  15.501  1.00 47.28  ? 434  ALA A C   1 
ATOM   3317 O O   . ALA A 1 434 ? 12.693  26.193  14.658  1.00 47.73  ? 434  ALA A O   1 
ATOM   3318 C CB  . ALA A 1 434 ? 13.949  24.148  16.536  1.00 45.08  ? 434  ALA A CB  1 
ATOM   3319 N N   . SER A 1 435 ? 11.072  25.930  16.179  1.00 48.38  ? 435  SER A N   1 
ATOM   3320 C CA  . SER A 1 435 ? 10.621  27.325  16.073  1.00 49.62  ? 435  SER A CA  1 
ATOM   3321 C C   . SER A 1 435 ? 11.709  28.342  16.544  1.00 49.19  ? 435  SER A C   1 
ATOM   3322 O O   . SER A 1 435 ? 11.651  29.517  16.226  1.00 49.82  ? 435  SER A O   1 
ATOM   3323 C CB  . SER A 1 435 ? 9.294   27.526  16.826  1.00 50.42  ? 435  SER A CB  1 
ATOM   3324 O OG  . SER A 1 435 ? 9.482   27.527  18.228  1.00 50.14  ? 435  SER A OG  1 
ATOM   3325 N N   . THR A 1 436 ? 12.699  27.857  17.279  1.00 47.97  ? 436  THR A N   1 
ATOM   3326 C CA  . THR A 1 436 ? 13.701  28.702  17.889  1.00 48.20  ? 436  THR A CA  1 
ATOM   3327 C C   . THR A 1 436 ? 14.988  28.753  17.067  1.00 47.50  ? 436  THR A C   1 
ATOM   3328 O O   . THR A 1 436 ? 15.975  29.352  17.515  1.00 47.63  ? 436  THR A O   1 
ATOM   3329 C CB  . THR A 1 436 ? 14.073  28.196  19.304  1.00 47.79  ? 436  THR A CB  1 
ATOM   3330 O OG1 . THR A 1 436 ? 14.732  26.913  19.218  1.00 47.47  ? 436  THR A OG1 1 
ATOM   3331 C CG2 . THR A 1 436 ? 12.845  28.076  20.164  1.00 48.60  ? 436  THR A CG2 1 
ATOM   3332 N N   . LEU A 1 437 ? 14.983  28.124  15.887  1.00 46.80  ? 437  LEU A N   1 
ATOM   3333 C CA  . LEU A 1 437 ? 16.186  27.998  15.054  1.00 45.77  ? 437  LEU A CA  1 
ATOM   3334 C C   . LEU A 1 437 ? 16.668  29.340  14.514  1.00 46.39  ? 437  LEU A C   1 
ATOM   3335 O O   . LEU A 1 437 ? 15.879  30.218  14.204  1.00 47.38  ? 437  LEU A O   1 
ATOM   3336 C CB  . LEU A 1 437 ? 15.917  27.045  13.894  1.00 45.70  ? 437  LEU A CB  1 
ATOM   3337 C CG  . LEU A 1 437 ? 17.064  26.218  13.316  1.00 44.74  ? 437  LEU A CG  1 
ATOM   3338 C CD1 . LEU A 1 437 ? 17.940  25.785  14.400  1.00 45.69  ? 437  LEU A CD1 1 
ATOM   3339 C CD2 . LEU A 1 437 ? 16.520  24.994  12.632  1.00 45.11  ? 437  LEU A CD2 1 
ATOM   3340 N N   . THR A 1 438 ? 17.973  29.509  14.396  1.00 45.98  ? 438  THR A N   1 
ATOM   3341 C CA  . THR A 1 438 ? 18.483  30.809  14.008  1.00 46.54  ? 438  THR A CA  1 
ATOM   3342 C C   . THR A 1 438 ? 19.197  30.736  12.679  1.00 45.85  ? 438  THR A C   1 
ATOM   3343 O O   . THR A 1 438 ? 19.547  31.781  12.116  1.00 46.77  ? 438  THR A O   1 
ATOM   3344 C CB  . THR A 1 438 ? 19.433  31.384  15.068  1.00 47.17  ? 438  THR A CB  1 
ATOM   3345 O OG1 . THR A 1 438 ? 20.504  30.452  15.283  1.00 46.53  ? 438  THR A OG1 1 
ATOM   3346 C CG2 . THR A 1 438 ? 18.688  31.612  16.392  1.00 47.05  ? 438  THR A CG2 1 
ATOM   3347 N N   . TRP A 1 439 ? 19.433  29.515  12.185  1.00 43.93  ? 439  TRP A N   1 
ATOM   3348 C CA  . TRP A 1 439 ? 19.849  29.324  10.802  1.00 42.74  ? 439  TRP A CA  1 
ATOM   3349 C C   . TRP A 1 439 ? 18.684  29.772  9.910   1.00 43.78  ? 439  TRP A C   1 
ATOM   3350 O O   . TRP A 1 439 ? 17.533  29.743  10.352  1.00 44.10  ? 439  TRP A O   1 
ATOM   3351 C CB  . TRP A 1 439 ? 20.213  27.865  10.533  1.00 41.34  ? 439  TRP A CB  1 
ATOM   3352 C CG  . TRP A 1 439 ? 21.448  27.439  11.238  1.00 39.85  ? 439  TRP A CG  1 
ATOM   3353 C CD1 . TRP A 1 439 ? 21.517  26.723  12.393  1.00 39.36  ? 439  TRP A CD1 1 
ATOM   3354 C CD2 . TRP A 1 439 ? 22.801  27.730  10.867  1.00 37.88  ? 439  TRP A CD2 1 
ATOM   3355 N NE1 . TRP A 1 439 ? 22.814  26.557  12.773  1.00 37.06  ? 439  TRP A NE1 1 
ATOM   3356 C CE2 . TRP A 1 439 ? 23.632  27.146  11.848  1.00 37.20  ? 439  TRP A CE2 1 
ATOM   3357 C CE3 . TRP A 1 439 ? 23.390  28.424  9.805   1.00 37.61  ? 439  TRP A CE3 1 
ATOM   3358 C CZ2 . TRP A 1 439 ? 25.040  27.224  11.803  1.00 37.37  ? 439  TRP A CZ2 1 
ATOM   3359 C CZ3 . TRP A 1 439 ? 24.794  28.503  9.753   1.00 40.04  ? 439  TRP A CZ3 1 
ATOM   3360 C CH2 . TRP A 1 439 ? 25.603  27.898  10.755  1.00 38.90  ? 439  TRP A CH2 1 
ATOM   3361 N N   . PRO A 1 440 ? 18.975  30.208  8.662   1.00 44.07  ? 440  PRO A N   1 
ATOM   3362 C CA  . PRO A 1 440 ? 17.901  30.710  7.822   1.00 44.84  ? 440  PRO A CA  1 
ATOM   3363 C C   . PRO A 1 440 ? 16.934  29.605  7.446   1.00 45.36  ? 440  PRO A C   1 
ATOM   3364 O O   . PRO A 1 440 ? 17.252  28.400  7.544   1.00 44.93  ? 440  PRO A O   1 
ATOM   3365 C CB  . PRO A 1 440 ? 18.633  31.210  6.577   1.00 44.67  ? 440  PRO A CB  1 
ATOM   3366 C CG  . PRO A 1 440 ? 19.837  30.344  6.483   1.00 43.78  ? 440  PRO A CG  1 
ATOM   3367 C CD  . PRO A 1 440 ? 20.252  30.119  7.915   1.00 43.74  ? 440  PRO A CD  1 
ATOM   3368 N N   . LEU A 1 441 ? 15.766  30.040  7.006   1.00 46.61  ? 441  LEU A N   1 
ATOM   3369 C CA  . LEU A 1 441 ? 14.670  29.187  6.661   1.00 47.07  ? 441  LEU A CA  1 
ATOM   3370 C C   . LEU A 1 441 ? 15.011  28.243  5.519   1.00 46.68  ? 441  LEU A C   1 
ATOM   3371 O O   . LEU A 1 441 ? 14.462  27.134  5.460   1.00 47.05  ? 441  LEU A O   1 
ATOM   3372 C CB  . LEU A 1 441 ? 13.504  30.070  6.264   1.00 49.04  ? 441  LEU A CB  1 
ATOM   3373 C CG  . LEU A 1 441 ? 12.097  29.570  6.557   1.00 52.13  ? 441  LEU A CG  1 
ATOM   3374 C CD1 . LEU A 1 441 ? 11.876  29.299  8.047   1.00 52.50  ? 441  LEU A CD1 1 
ATOM   3375 C CD2 . LEU A 1 441 ? 11.098  30.620  6.041   1.00 55.77  ? 441  LEU A CD2 1 
ATOM   3376 N N   . TRP A 1 442 ? 15.915  28.654  4.617   1.00 45.84  ? 442  TRP A N   1 
ATOM   3377 C CA  . TRP A 1 442 ? 16.215  27.825  3.443   1.00 44.68  ? 442  TRP A CA  1 
ATOM   3378 C C   . TRP A 1 442 ? 16.915  26.509  3.834   1.00 43.69  ? 442  TRP A C   1 
ATOM   3379 O O   . TRP A 1 442 ? 16.807  25.512  3.120   1.00 43.76  ? 442  TRP A O   1 
ATOM   3380 C CB  . TRP A 1 442 ? 16.954  28.598  2.328   1.00 44.20  ? 442  TRP A CB  1 
ATOM   3381 C CG  . TRP A 1 442 ? 18.416  29.012  2.608   1.00 43.34  ? 442  TRP A CG  1 
ATOM   3382 C CD1 . TRP A 1 442 ? 18.866  30.274  2.955   1.00 43.33  ? 442  TRP A CD1 1 
ATOM   3383 C CD2 . TRP A 1 442 ? 19.596  28.190  2.515   1.00 39.68  ? 442  TRP A CD2 1 
ATOM   3384 N NE1 . TRP A 1 442 ? 20.231  30.272  3.097   1.00 41.22  ? 442  TRP A NE1 1 
ATOM   3385 C CE2 . TRP A 1 442 ? 20.709  29.012  2.839   1.00 40.30  ? 442  TRP A CE2 1 
ATOM   3386 C CE3 . TRP A 1 442 ? 19.824  26.849  2.186   1.00 38.11  ? 442  TRP A CE3 1 
ATOM   3387 C CZ2 . TRP A 1 442 ? 22.033  28.523  2.869   1.00 39.09  ? 442  TRP A CZ2 1 
ATOM   3388 C CZ3 . TRP A 1 442 ? 21.157  26.361  2.206   1.00 37.68  ? 442  TRP A CZ3 1 
ATOM   3389 C CH2 . TRP A 1 442 ? 22.234  27.197  2.561   1.00 37.40  ? 442  TRP A CH2 1 
ATOM   3390 N N   . MET A 1 443 ? 17.598  26.498  4.978   1.00 42.42  ? 443  MET A N   1 
ATOM   3391 C CA  . MET A 1 443 ? 18.353  25.314  5.403   1.00 40.99  ? 443  MET A CA  1 
ATOM   3392 C C   . MET A 1 443 ? 17.463  24.197  5.963   1.00 40.80  ? 443  MET A C   1 
ATOM   3393 O O   . MET A 1 443 ? 17.951  23.115  6.300   1.00 40.20  ? 443  MET A O   1 
ATOM   3394 C CB  . MET A 1 443 ? 19.454  25.681  6.410   1.00 39.92  ? 443  MET A CB  1 
ATOM   3395 C CG  . MET A 1 443 ? 20.637  26.404  5.823   1.00 38.99  ? 443  MET A CG  1 
ATOM   3396 S SD  . MET A 1 443 ? 21.834  26.777  7.121   1.00 41.65  ? 443  MET A SD  1 
ATOM   3397 C CE  . MET A 1 443 ? 23.104  27.670  6.234   1.00 41.04  ? 443  MET A CE  1 
ATOM   3398 N N   . GLY A 1 444 ? 16.166  24.450  6.064   1.00 41.35  ? 444  GLY A N   1 
ATOM   3399 C CA  . GLY A 1 444 ? 15.235  23.414  6.497   1.00 41.55  ? 444  GLY A CA  1 
ATOM   3400 C C   . GLY A 1 444 ? 15.468  22.905  7.903   1.00 41.11  ? 444  GLY A C   1 
ATOM   3401 O O   . GLY A 1 444 ? 15.498  23.685  8.856   1.00 41.60  ? 444  GLY A O   1 
ATOM   3402 N N   . VAL A 1 445 ? 15.602  21.590  8.042   1.00 40.77  ? 445  VAL A N   1 
ATOM   3403 C CA  . VAL A 1 445 ? 15.911  20.983  9.333   1.00 39.69  ? 445  VAL A CA  1 
ATOM   3404 C C   . VAL A 1 445 ? 17.356  20.511  9.221   1.00 39.49  ? 445  VAL A C   1 
ATOM   3405 O O   . VAL A 1 445 ? 17.611  19.412  8.729   1.00 40.31  ? 445  VAL A O   1 
ATOM   3406 C CB  . VAL A 1 445 ? 15.006  19.768  9.638   1.00 39.85  ? 445  VAL A CB  1 
ATOM   3407 C CG1 . VAL A 1 445 ? 15.353  19.191  11.000  1.00 37.25  ? 445  VAL A CG1 1 
ATOM   3408 C CG2 . VAL A 1 445 ? 13.484  20.127  9.533   1.00 40.30  ? 445  VAL A CG2 1 
ATOM   3409 N N   . PRO A 1 446 ? 18.316  21.344  9.628   1.00 38.90  ? 446  PRO A N   1 
ATOM   3410 C CA  . PRO A 1 446 ? 19.713  20.980  9.418   1.00 38.49  ? 446  PRO A CA  1 
ATOM   3411 C C   . PRO A 1 446 ? 20.261  19.863  10.331  1.00 38.15  ? 446  PRO A C   1 
ATOM   3412 O O   . PRO A 1 446 ? 19.614  19.445  11.290  1.00 38.24  ? 446  PRO A O   1 
ATOM   3413 C CB  . PRO A 1 446 ? 20.459  22.285  9.696   1.00 38.29  ? 446  PRO A CB  1 
ATOM   3414 C CG  . PRO A 1 446 ? 19.387  23.342  9.767   1.00 38.93  ? 446  PRO A CG  1 
ATOM   3415 C CD  . PRO A 1 446 ? 18.183  22.669  10.237  1.00 38.94  ? 446  PRO A CD  1 
ATOM   3416 N N   . HIS A 1 447 ? 21.466  19.418  9.996   1.00 37.70  ? 447  HIS A N   1 
ATOM   3417 C CA  . HIS A 1 447 ? 22.221  18.397  10.693  1.00 37.24  ? 447  HIS A CA  1 
ATOM   3418 C C   . HIS A 1 447 ? 22.415  18.888  12.136  1.00 37.01  ? 447  HIS A C   1 
ATOM   3419 O O   . HIS A 1 447 ? 22.898  19.998  12.365  1.00 37.04  ? 447  HIS A O   1 
ATOM   3420 C CB  . HIS A 1 447 ? 23.546  18.259  9.917   1.00 37.02  ? 447  HIS A CB  1 
ATOM   3421 C CG  . HIS A 1 447 ? 24.428  17.124  10.341  1.00 37.99  ? 447  HIS A CG  1 
ATOM   3422 N ND1 . HIS A 1 447 ? 24.098  15.800  10.137  1.00 38.23  ? 447  HIS A ND1 1 
ATOM   3423 C CD2 . HIS A 1 447 ? 25.666  17.121  10.899  1.00 38.48  ? 447  HIS A CD2 1 
ATOM   3424 C CE1 . HIS A 1 447 ? 25.075  15.030  10.581  1.00 37.95  ? 447  HIS A CE1 1 
ATOM   3425 N NE2 . HIS A 1 447 ? 26.040  15.806  11.048  1.00 38.50  ? 447  HIS A NE2 1 
ATOM   3426 N N   . GLY A 1 448 ? 22.001  18.074  13.103  1.00 37.06  ? 448  GLY A N   1 
ATOM   3427 C CA  . GLY A 1 448 ? 22.119  18.421  14.520  1.00 36.73  ? 448  GLY A CA  1 
ATOM   3428 C C   . GLY A 1 448 ? 20.850  18.884  15.230  1.00 37.34  ? 448  GLY A C   1 
ATOM   3429 O O   . GLY A 1 448 ? 20.796  18.912  16.463  1.00 37.18  ? 448  GLY A O   1 
ATOM   3430 N N   . TYR A 1 449 ? 19.815  19.231  14.476  1.00 37.58  ? 449  TYR A N   1 
ATOM   3431 C CA  . TYR A 1 449 ? 18.694  19.922  15.089  1.00 38.09  ? 449  TYR A CA  1 
ATOM   3432 C C   . TYR A 1 449 ? 17.492  19.047  15.512  1.00 38.92  ? 449  TYR A C   1 
ATOM   3433 O O   . TYR A 1 449 ? 16.387  19.548  15.758  1.00 39.75  ? 449  TYR A O   1 
ATOM   3434 C CB  . TYR A 1 449 ? 18.347  21.174  14.274  1.00 38.61  ? 449  TYR A CB  1 
ATOM   3435 C CG  . TYR A 1 449 ? 19.473  22.196  14.438  1.00 38.49  ? 449  TYR A CG  1 
ATOM   3436 C CD1 . TYR A 1 449 ? 20.561  22.244  13.548  1.00 35.92  ? 449  TYR A CD1 1 
ATOM   3437 C CD2 . TYR A 1 449 ? 19.481  23.062  15.530  1.00 37.57  ? 449  TYR A CD2 1 
ATOM   3438 C CE1 . TYR A 1 449 ? 21.607  23.146  13.745  1.00 35.52  ? 449  TYR A CE1 1 
ATOM   3439 C CE2 . TYR A 1 449 ? 20.507  23.957  15.720  1.00 37.08  ? 449  TYR A CE2 1 
ATOM   3440 C CZ  . TYR A 1 449 ? 21.555  24.002  14.837  1.00 37.39  ? 449  TYR A CZ  1 
ATOM   3441 O OH  . TYR A 1 449 ? 22.554  24.905  15.097  1.00 38.83  ? 449  TYR A OH  1 
ATOM   3442 N N   . GLU A 1 450 ? 17.728  17.743  15.639  1.00 38.22  ? 450  GLU A N   1 
ATOM   3443 C CA  . GLU A 1 450 ? 16.787  16.875  16.354  1.00 38.88  ? 450  GLU A CA  1 
ATOM   3444 C C   . GLU A 1 450 ? 17.226  16.670  17.808  1.00 38.76  ? 450  GLU A C   1 
ATOM   3445 O O   . GLU A 1 450 ? 16.417  16.309  18.650  1.00 39.07  ? 450  GLU A O   1 
ATOM   3446 C CB  . GLU A 1 450 ? 16.636  15.524  15.665  1.00 38.28  ? 450  GLU A CB  1 
ATOM   3447 C CG  . GLU A 1 450 ? 17.697  14.533  16.028  1.00 37.78  ? 450  GLU A CG  1 
ATOM   3448 C CD  . GLU A 1 450 ? 19.052  14.766  15.373  1.00 40.04  ? 450  GLU A CD  1 
ATOM   3449 O OE1 . GLU A 1 450 ? 19.400  15.911  14.954  1.00 40.15  ? 450  GLU A OE1 1 
ATOM   3450 O OE2 . GLU A 1 450 ? 19.801  13.764  15.300  1.00 41.45  ? 450  GLU A OE2 1 
ATOM   3451 N N   . ILE A 1 451 ? 18.499  16.928  18.102  1.00 38.34  ? 451  ILE A N   1 
ATOM   3452 C CA  . ILE A 1 451 ? 19.083  16.539  19.392  1.00 38.08  ? 451  ILE A CA  1 
ATOM   3453 C C   . ILE A 1 451 ? 18.344  17.168  20.589  1.00 38.93  ? 451  ILE A C   1 
ATOM   3454 O O   . ILE A 1 451 ? 17.836  16.478  21.482  1.00 39.90  ? 451  ILE A O   1 
ATOM   3455 C CB  . ILE A 1 451 ? 20.599  16.828  19.437  1.00 36.84  ? 451  ILE A CB  1 
ATOM   3456 C CG1 . ILE A 1 451 ? 21.317  16.091  18.295  1.00 36.28  ? 451  ILE A CG1 1 
ATOM   3457 C CG2 . ILE A 1 451 ? 21.159  16.425  20.771  1.00 35.55  ? 451  ILE A CG2 1 
ATOM   3458 C CD1 . ILE A 1 451 ? 22.812  16.467  18.101  1.00 34.23  ? 451  ILE A CD1 1 
ATOM   3459 N N   . GLU A 1 452 ? 18.378  18.483  20.608  1.00 38.95  ? 452  GLU A N   1 
ATOM   3460 C CA  . GLU A 1 452 ? 17.478  19.368  21.296  1.00 40.17  ? 452  GLU A CA  1 
ATOM   3461 C C   . GLU A 1 452 ? 16.105  18.752  21.661  1.00 40.78  ? 452  GLU A C   1 
ATOM   3462 O O   . GLU A 1 452 ? 15.628  18.927  22.778  1.00 41.95  ? 452  GLU A O   1 
ATOM   3463 C CB  . GLU A 1 452 ? 17.357  20.452  20.261  1.00 41.48  ? 452  GLU A CB  1 
ATOM   3464 C CG  . GLU A 1 452 ? 16.402  21.530  20.339  1.00 43.89  ? 452  GLU A CG  1 
ATOM   3465 C CD  . GLU A 1 452 ? 16.783  22.553  19.287  1.00 45.25  ? 452  GLU A CD  1 
ATOM   3466 O OE1 . GLU A 1 452 ? 17.923  22.509  18.773  1.00 44.69  ? 452  GLU A OE1 1 
ATOM   3467 O OE2 . GLU A 1 452 ? 15.966  23.423  18.985  1.00 49.04  ? 452  GLU A OE2 1 
ATOM   3468 N N   . PHE A 1 453 ? 15.479  18.023  20.743  1.00 40.03  ? 453  PHE A N   1 
ATOM   3469 C CA  . PHE A 1 453 ? 14.196  17.385  21.019  1.00 40.46  ? 453  PHE A CA  1 
ATOM   3470 C C   . PHE A 1 453 ? 14.279  16.030  21.731  1.00 40.32  ? 453  PHE A C   1 
ATOM   3471 O O   . PHE A 1 453 ? 13.459  15.766  22.615  1.00 41.21  ? 453  PHE A O   1 
ATOM   3472 C CB  . PHE A 1 453 ? 13.390  17.247  19.739  1.00 41.02  ? 453  PHE A CB  1 
ATOM   3473 C CG  . PHE A 1 453 ? 12.916  18.555  19.203  1.00 41.89  ? 453  PHE A CG  1 
ATOM   3474 C CD1 . PHE A 1 453 ? 11.660  19.058  19.570  1.00 41.32  ? 453  PHE A CD1 1 
ATOM   3475 C CD2 . PHE A 1 453 ? 13.722  19.298  18.357  1.00 39.15  ? 453  PHE A CD2 1 
ATOM   3476 C CE1 . PHE A 1 453 ? 11.234  20.268  19.097  1.00 41.64  ? 453  PHE A CE1 1 
ATOM   3477 C CE2 . PHE A 1 453 ? 13.291  20.511  17.870  1.00 41.17  ? 453  PHE A CE2 1 
ATOM   3478 C CZ  . PHE A 1 453 ? 12.054  21.003  18.235  1.00 42.32  ? 453  PHE A CZ  1 
ATOM   3479 N N   . ILE A 1 454 ? 15.234  15.185  21.329  1.00 38.76  ? 454  ILE A N   1 
ATOM   3480 C CA  . ILE A 1 454 ? 15.518  13.903  21.978  1.00 38.70  ? 454  ILE A CA  1 
ATOM   3481 C C   . ILE A 1 454 ? 15.883  14.122  23.444  1.00 38.85  ? 454  ILE A C   1 
ATOM   3482 O O   . ILE A 1 454 ? 15.507  13.335  24.304  1.00 38.79  ? 454  ILE A O   1 
ATOM   3483 C CB  . ILE A 1 454 ? 16.727  13.181  21.290  1.00 38.32  ? 454  ILE A CB  1 
ATOM   3484 C CG1 . ILE A 1 454 ? 16.523  13.042  19.773  1.00 38.61  ? 454  ILE A CG1 1 
ATOM   3485 C CG2 . ILE A 1 454 ? 17.036  11.834  21.926  1.00 37.38  ? 454  ILE A CG2 1 
ATOM   3486 C CD1 . ILE A 1 454 ? 15.243  12.434  19.399  1.00 41.05  ? 454  ILE A CD1 1 
ATOM   3487 N N   . PHE A 1 455 ? 16.638  15.190  23.720  1.00 38.97  ? 455  PHE A N   1 
ATOM   3488 C CA  . PHE A 1 455 ? 17.079  15.496  25.087  1.00 39.03  ? 455  PHE A CA  1 
ATOM   3489 C C   . PHE A 1 455 ? 16.019  16.213  25.938  1.00 40.27  ? 455  PHE A C   1 
ATOM   3490 O O   . PHE A 1 455 ? 16.234  16.455  27.126  1.00 40.86  ? 455  PHE A O   1 
ATOM   3491 C CB  . PHE A 1 455 ? 18.401  16.260  25.075  1.00 37.78  ? 455  PHE A CB  1 
ATOM   3492 C CG  . PHE A 1 455 ? 19.609  15.373  25.045  1.00 37.32  ? 455  PHE A CG  1 
ATOM   3493 C CD1 . PHE A 1 455 ? 20.100  14.877  23.842  1.00 37.43  ? 455  PHE A CD1 1 
ATOM   3494 C CD2 . PHE A 1 455 ? 20.257  15.022  26.223  1.00 37.50  ? 455  PHE A CD2 1 
ATOM   3495 C CE1 . PHE A 1 455 ? 21.244  14.039  23.813  1.00 36.37  ? 455  PHE A CE1 1 
ATOM   3496 C CE2 . PHE A 1 455 ? 21.382  14.187  26.216  1.00 35.30  ? 455  PHE A CE2 1 
ATOM   3497 C CZ  . PHE A 1 455 ? 21.877  13.700  25.005  1.00 36.13  ? 455  PHE A CZ  1 
ATOM   3498 N N   . GLY A 1 456 ? 14.875  16.540  25.332  1.00 41.17  ? 456  GLY A N   1 
ATOM   3499 C CA  . GLY A 1 456 ? 13.772  17.196  26.036  1.00 41.78  ? 456  GLY A CA  1 
ATOM   3500 C C   . GLY A 1 456 ? 13.955  18.665  26.394  1.00 42.52  ? 456  GLY A C   1 
ATOM   3501 O O   . GLY A 1 456 ? 13.261  19.180  27.278  1.00 43.47  ? 456  GLY A O   1 
ATOM   3502 N N   . LEU A 1 457 ? 14.854  19.372  25.712  1.00 42.30  ? 457  LEU A N   1 
ATOM   3503 C CA  . LEU A 1 457 ? 15.005  20.810  26.000  1.00 43.19  ? 457  LEU A CA  1 
ATOM   3504 C C   . LEU A 1 457 ? 13.696  21.628  25.965  1.00 45.05  ? 457  LEU A C   1 
ATOM   3505 O O   . LEU A 1 457 ? 13.513  22.509  26.798  1.00 45.49  ? 457  LEU A O   1 
ATOM   3506 C CB  . LEU A 1 457 ? 16.083  21.462  25.142  1.00 41.72  ? 457  LEU A CB  1 
ATOM   3507 C CG  . LEU A 1 457 ? 17.474  21.500  25.761  1.00 41.17  ? 457  LEU A CG  1 
ATOM   3508 C CD1 . LEU A 1 457 ? 18.079  20.082  25.860  1.00 39.09  ? 457  LEU A CD1 1 
ATOM   3509 C CD2 . LEU A 1 457 ? 18.394  22.441  24.976  1.00 39.55  ? 457  LEU A CD2 1 
ATOM   3510 N N   . PRO A 1 458 ? 12.774  21.324  25.028  1.00 46.32  ? 458  PRO A N   1 
ATOM   3511 C CA  . PRO A 1 458 ? 11.557  22.128  24.979  1.00 48.53  ? 458  PRO A CA  1 
ATOM   3512 C C   . PRO A 1 458 ? 10.741  22.141  26.266  1.00 50.76  ? 458  PRO A C   1 
ATOM   3513 O O   . PRO A 1 458 ? 9.883   23.006  26.419  1.00 52.13  ? 458  PRO A O   1 
ATOM   3514 C CB  . PRO A 1 458 ? 10.768  21.491  23.837  1.00 48.61  ? 458  PRO A CB  1 
ATOM   3515 C CG  . PRO A 1 458 ? 11.812  20.996  22.936  1.00 47.37  ? 458  PRO A CG  1 
ATOM   3516 C CD  . PRO A 1 458 ? 12.879  20.456  23.845  1.00 45.65  ? 458  PRO A CD  1 
ATOM   3517 N N   . LEU A 1 459 ? 11.016  21.211  27.179  1.00 51.67  ? 459  LEU A N   1 
ATOM   3518 C CA  . LEU A 1 459 ? 10.317  21.161  28.469  1.00 54.09  ? 459  LEU A CA  1 
ATOM   3519 C C   . LEU A 1 459 ? 10.696  22.294  29.425  1.00 55.38  ? 459  LEU A C   1 
ATOM   3520 O O   . LEU A 1 459 ? 9.961   22.575  30.376  1.00 56.96  ? 459  LEU A O   1 
ATOM   3521 C CB  . LEU A 1 459 ? 10.561  19.819  29.163  1.00 54.06  ? 459  LEU A CB  1 
ATOM   3522 C CG  . LEU A 1 459 ? 9.669   18.598  28.918  1.00 54.51  ? 459  LEU A CG  1 
ATOM   3523 C CD1 . LEU A 1 459 ? 9.331   18.416  27.469  1.00 55.79  ? 459  LEU A CD1 1 
ATOM   3524 C CD2 . LEU A 1 459 ? 10.409  17.377  29.393  1.00 54.11  ? 459  LEU A CD2 1 
ATOM   3525 N N   . ASP A 1 460 ? 11.847  22.920  29.193  1.00 55.31  ? 460  ASP A N   1 
ATOM   3526 C CA  . ASP A 1 460 ? 12.268  24.078  29.972  1.00 56.89  ? 460  ASP A CA  1 
ATOM   3527 C C   . ASP A 1 460 ? 11.487  25.322  29.509  1.00 58.66  ? 460  ASP A C   1 
ATOM   3528 O O   . ASP A 1 460 ? 11.764  25.862  28.426  1.00 58.03  ? 460  ASP A O   1 
ATOM   3529 C CB  . ASP A 1 460 ? 13.768  24.300  29.772  1.00 55.86  ? 460  ASP A CB  1 
ATOM   3530 C CG  . ASP A 1 460 ? 14.358  25.318  30.740  1.00 56.93  ? 460  ASP A CG  1 
ATOM   3531 O OD1 . ASP A 1 460 ? 13.610  26.150  31.297  1.00 59.05  ? 460  ASP A OD1 1 
ATOM   3532 O OD2 . ASP A 1 460 ? 15.593  25.274  30.946  1.00 57.13  ? 460  ASP A OD2 1 
ATOM   3533 N N   . PRO A 1 461 ? 10.522  25.801  30.327  1.00 60.70  ? 461  PRO A N   1 
ATOM   3534 C CA  . PRO A 1 461 ? 9.655   26.885  29.799  1.00 62.18  ? 461  PRO A CA  1 
ATOM   3535 C C   . PRO A 1 461 ? 10.440  28.164  29.469  1.00 62.21  ? 461  PRO A C   1 
ATOM   3536 O O   . PRO A 1 461 ? 10.052  28.908  28.574  1.00 63.02  ? 461  PRO A O   1 
ATOM   3537 C CB  . PRO A 1 461 ? 8.632   27.128  30.918  1.00 63.49  ? 461  PRO A CB  1 
ATOM   3538 C CG  . PRO A 1 461 ? 8.912   26.103  31.991  1.00 62.95  ? 461  PRO A CG  1 
ATOM   3539 C CD  . PRO A 1 461 ? 10.322  25.593  31.771  1.00 61.50  ? 461  PRO A CD  1 
ATOM   3540 N N   . SER A 1 462 ? 11.557  28.383  30.158  1.00 61.61  ? 462  SER A N   1 
ATOM   3541 C CA  . SER A 1 462 ? 12.441  29.509  29.867  1.00 61.76  ? 462  SER A CA  1 
ATOM   3542 C C   . SER A 1 462 ? 13.072  29.513  28.442  1.00 60.96  ? 462  SER A C   1 
ATOM   3543 O O   . SER A 1 462 ? 13.665  30.526  28.040  1.00 61.38  ? 462  SER A O   1 
ATOM   3544 C CB  . SER A 1 462 ? 13.549  29.575  30.920  1.00 61.37  ? 462  SER A CB  1 
ATOM   3545 O OG  . SER A 1 462 ? 14.559  28.614  30.635  1.00 59.66  ? 462  SER A OG  1 
ATOM   3546 N N   . LEU A 1 463 ? 12.952  28.405  27.693  1.00 59.75  ? 463  LEU A N   1 
ATOM   3547 C CA  . LEU A 1 463 ? 13.503  28.319  26.327  1.00 58.30  ? 463  LEU A CA  1 
ATOM   3548 C C   . LEU A 1 463 ? 12.565  28.686  25.151  1.00 59.20  ? 463  LEU A C   1 
ATOM   3549 O O   . LEU A 1 463 ? 13.007  28.691  23.990  1.00 58.47  ? 463  LEU A O   1 
ATOM   3550 C CB  . LEU A 1 463 ? 14.192  26.969  26.061  1.00 56.67  ? 463  LEU A CB  1 
ATOM   3551 C CG  . LEU A 1 463 ? 15.457  26.589  26.843  1.00 55.29  ? 463  LEU A CG  1 
ATOM   3552 C CD1 . LEU A 1 463 ? 15.878  25.163  26.474  1.00 53.28  ? 463  LEU A CD1 1 
ATOM   3553 C CD2 . LEU A 1 463 ? 16.622  27.584  26.693  1.00 52.16  ? 463  LEU A CD2 1 
ATOM   3554 N N   . ASN A 1 464 ? 11.296  28.987  25.422  1.00 60.75  ? 464  ASN A N   1 
ATOM   3555 C CA  . ASN A 1 464 ? 10.432  29.615  24.386  1.00 62.38  ? 464  ASN A CA  1 
ATOM   3556 C C   . ASN A 1 464 ? 9.952   28.721  23.219  1.00 60.25  ? 464  ASN A C   1 
ATOM   3557 O O   . ASN A 1 464 ? 9.488   29.229  22.195  1.00 60.60  ? 464  ASN A O   1 
ATOM   3558 C CB  . ASN A 1 464 ? 11.072  30.925  23.842  1.00 63.54  ? 464  ASN A CB  1 
ATOM   3559 C CG  . ASN A 1 464 ? 11.129  32.036  24.898  1.00 70.49  ? 464  ASN A CG  1 
ATOM   3560 O OD1 . ASN A 1 464 ? 10.466  31.954  25.949  1.00 71.78  ? 464  ASN A OD1 1 
ATOM   3561 N ND2 . ASN A 1 464 ? 11.923  33.082  24.625  1.00 79.94  ? 464  ASN A ND2 1 
ATOM   3562 N N   . TYR A 1 465 ? 10.061  27.403  23.380  1.00 57.71  ? 465  TYR A N   1 
ATOM   3563 C CA  . TYR A 1 465 ? 9.434   26.462  22.460  1.00 55.79  ? 465  TYR A CA  1 
ATOM   3564 C C   . TYR A 1 465 ? 7.917   26.506  22.622  1.00 57.09  ? 465  TYR A C   1 
ATOM   3565 O O   . TYR A 1 465 ? 7.415   26.913  23.662  1.00 57.92  ? 465  TYR A O   1 
ATOM   3566 C CB  . TYR A 1 465 ? 9.918   25.053  22.746  1.00 54.30  ? 465  TYR A CB  1 
ATOM   3567 C CG  . TYR A 1 465 ? 11.372  24.781  22.444  1.00 50.04  ? 465  TYR A CG  1 
ATOM   3568 C CD1 . TYR A 1 465 ? 11.756  24.222  21.230  1.00 48.44  ? 465  TYR A CD1 1 
ATOM   3569 C CD2 . TYR A 1 465 ? 12.357  25.051  23.382  1.00 48.57  ? 465  TYR A CD2 1 
ATOM   3570 C CE1 . TYR A 1 465 ? 13.093  23.963  20.949  1.00 47.41  ? 465  TYR A CE1 1 
ATOM   3571 C CE2 . TYR A 1 465 ? 13.694  24.788  23.125  1.00 46.29  ? 465  TYR A CE2 1 
ATOM   3572 C CZ  . TYR A 1 465 ? 14.053  24.241  21.910  1.00 46.82  ? 465  TYR A CZ  1 
ATOM   3573 O OH  . TYR A 1 465 ? 15.372  23.973  21.661  1.00 44.63  ? 465  TYR A OH  1 
ATOM   3574 N N   . THR A 1 466 ? 7.190   26.074  21.601  1.00 57.10  ? 466  THR A N   1 
ATOM   3575 C CA  . THR A 1 466 ? 5.713   26.041  21.629  1.00 58.26  ? 466  THR A CA  1 
ATOM   3576 C C   . THR A 1 466 ? 5.159   24.875  22.447  1.00 58.34  ? 466  THR A C   1 
ATOM   3577 O O   . THR A 1 466 ? 5.863   23.919  22.724  1.00 57.21  ? 466  THR A O   1 
ATOM   3578 C CB  . THR A 1 466 ? 5.165   25.878  20.212  1.00 58.73  ? 466  THR A CB  1 
ATOM   3579 O OG1 . THR A 1 466 ? 5.418   24.533  19.771  1.00 57.99  ? 466  THR A OG1 1 
ATOM   3580 C CG2 . THR A 1 466 ? 5.825   26.892  19.241  1.00 57.38  ? 466  THR A CG2 1 
ATOM   3581 N N   . THR A 1 467 ? 3.881   24.929  22.807  1.00 60.41  ? 467  THR A N   1 
ATOM   3582 C CA  . THR A 1 467 ? 3.239   23.808  23.526  1.00 60.75  ? 467  THR A CA  1 
ATOM   3583 C C   . THR A 1 467 ? 3.333   22.477  22.757  1.00 59.92  ? 467  THR A C   1 
ATOM   3584 O O   . THR A 1 467 ? 3.642   21.428  23.332  1.00 59.16  ? 467  THR A O   1 
ATOM   3585 C CB  . THR A 1 467 ? 1.761   24.134  23.898  1.00 63.21  ? 467  THR A CB  1 
ATOM   3586 O OG1 . THR A 1 467 ? 1.741   25.125  24.933  1.00 63.68  ? 467  THR A OG1 1 
ATOM   3587 C CG2 . THR A 1 467 ? 1.017   22.893  24.406  1.00 63.33  ? 467  THR A CG2 1 
ATOM   3588 N N   . GLU A 1 468 ? 3.079   22.535  21.453  1.00 59.86  ? 468  GLU A N   1 
ATOM   3589 C CA  . GLU A 1 468 ? 3.129   21.356  20.601  1.00 59.46  ? 468  GLU A CA  1 
ATOM   3590 C C   . GLU A 1 468 ? 4.542   20.763  20.549  1.00 56.88  ? 468  GLU A C   1 
ATOM   3591 O O   . GLU A 1 468 ? 4.695   19.535  20.545  1.00 56.10  ? 468  GLU A O   1 
ATOM   3592 C CB  . GLU A 1 468 ? 2.569   21.662  19.207  1.00 60.54  ? 468  GLU A CB  1 
ATOM   3593 C CG  . GLU A 1 468 ? 2.700   23.143  18.778  1.00 64.65  ? 468  GLU A CG  1 
ATOM   3594 C CD  . GLU A 1 468 ? 1.548   24.043  19.288  1.00 70.53  ? 468  GLU A CD  1 
ATOM   3595 O OE1 . GLU A 1 468 ? 1.710   24.762  20.321  1.00 71.40  ? 468  GLU A OE1 1 
ATOM   3596 O OE2 . GLU A 1 468 ? 0.480   24.020  18.644  1.00 72.21  ? 468  GLU A OE2 1 
ATOM   3597 N N   . GLU A 1 469 ? 5.556   21.638  20.546  1.00 55.12  ? 469  GLU A N   1 
ATOM   3598 C CA  . GLU A 1 469 ? 6.968   21.230  20.631  1.00 53.08  ? 469  GLU A CA  1 
ATOM   3599 C C   . GLU A 1 469 ? 7.305   20.527  21.942  1.00 52.58  ? 469  GLU A C   1 
ATOM   3600 O O   . GLU A 1 469 ? 8.170   19.663  21.988  1.00 50.84  ? 469  GLU A O   1 
ATOM   3601 C CB  . GLU A 1 469 ? 7.890   22.434  20.437  1.00 52.09  ? 469  GLU A CB  1 
ATOM   3602 C CG  . GLU A 1 469 ? 8.167   22.727  18.974  1.00 52.14  ? 469  GLU A CG  1 
ATOM   3603 C CD  . GLU A 1 469 ? 8.888   24.040  18.729  1.00 51.29  ? 469  GLU A CD  1 
ATOM   3604 O OE1 . GLU A 1 469 ? 8.722   25.003  19.522  1.00 51.57  ? 469  GLU A OE1 1 
ATOM   3605 O OE2 . GLU A 1 469 ? 9.603   24.109  17.714  1.00 48.85  ? 469  GLU A OE2 1 
ATOM   3606 N N   . ARG A 1 470 ? 6.606   20.924  23.004  1.00 53.81  ? 470  ARG A N   1 
ATOM   3607 C CA  . ARG A 1 470 ? 6.768   20.341  24.320  1.00 53.85  ? 470  ARG A CA  1 
ATOM   3608 C C   . ARG A 1 470 ? 6.236   18.912  24.284  1.00 53.26  ? 470  ARG A C   1 
ATOM   3609 O O   . ARG A 1 470 ? 6.934   18.005  24.686  1.00 52.37  ? 470  ARG A O   1 
ATOM   3610 C CB  . ARG A 1 470 ? 6.019   21.183  25.355  1.00 55.99  ? 470  ARG A CB  1 
ATOM   3611 C CG  . ARG A 1 470 ? 6.584   21.158  26.767  1.00 59.11  ? 470  ARG A CG  1 
ATOM   3612 C CD  . ARG A 1 470 ? 5.489   21.522  27.831  1.00 66.37  ? 470  ARG A CD  1 
ATOM   3613 N NE  . ARG A 1 470 ? 4.681   20.352  28.211  1.00 70.61  ? 470  ARG A NE  1 
ATOM   3614 C CZ  . ARG A 1 470 ? 3.358   20.237  28.052  1.00 75.21  ? 470  ARG A CZ  1 
ATOM   3615 N NH1 . ARG A 1 470 ? 2.624   21.236  27.548  1.00 76.91  ? 470  ARG A NH1 1 
ATOM   3616 N NH2 . ARG A 1 470 ? 2.754   19.110  28.423  1.00 76.51  ? 470  ARG A NH2 1 
ATOM   3617 N N   . ILE A 1 471 ? 5.019   18.718  23.765  1.00 53.63  ? 471  ILE A N   1 
ATOM   3618 C CA  . ILE A 1 471 ? 4.400   17.387  23.635  1.00 53.32  ? 471  ILE A CA  1 
ATOM   3619 C C   . ILE A 1 471 ? 5.199   16.484  22.687  1.00 51.86  ? 471  ILE A C   1 
ATOM   3620 O O   . ILE A 1 471 ? 5.307   15.264  22.889  1.00 51.91  ? 471  ILE A O   1 
ATOM   3621 C CB  . ILE A 1 471 ? 2.936   17.513  23.145  1.00 55.28  ? 471  ILE A CB  1 
ATOM   3622 C CG1 . ILE A 1 471 ? 2.075   18.180  24.223  1.00 56.83  ? 471  ILE A CG1 1 
ATOM   3623 C CG2 . ILE A 1 471 ? 2.332   16.153  22.750  1.00 55.44  ? 471  ILE A CG2 1 
ATOM   3624 C CD1 . ILE A 1 471 ? 1.052   19.127  23.656  1.00 59.10  ? 471  ILE A CD1 1 
ATOM   3625 N N   . PHE A 1 472 ? 5.754   17.100  21.655  1.00 50.25  ? 472  PHE A N   1 
ATOM   3626 C CA  . PHE A 1 472 ? 6.514   16.396  20.647  1.00 48.72  ? 472  PHE A CA  1 
ATOM   3627 C C   . PHE A 1 472 ? 7.817   15.877  21.250  1.00 47.41  ? 472  PHE A C   1 
ATOM   3628 O O   . PHE A 1 472 ? 8.176   14.718  21.025  1.00 46.97  ? 472  PHE A O   1 
ATOM   3629 C CB  . PHE A 1 472 ? 6.764   17.319  19.455  1.00 48.09  ? 472  PHE A CB  1 
ATOM   3630 C CG  . PHE A 1 472 ? 7.670   16.748  18.414  1.00 46.32  ? 472  PHE A CG  1 
ATOM   3631 C CD1 . PHE A 1 472 ? 7.371   15.537  17.797  1.00 45.97  ? 472  PHE A CD1 1 
ATOM   3632 C CD2 . PHE A 1 472 ? 8.812   17.445  18.023  1.00 43.90  ? 472  PHE A CD2 1 
ATOM   3633 C CE1 . PHE A 1 472 ? 8.210   15.011  16.819  1.00 45.50  ? 472  PHE A CE1 1 
ATOM   3634 C CE2 . PHE A 1 472 ? 9.658   16.937  17.048  1.00 43.55  ? 472  PHE A CE2 1 
ATOM   3635 C CZ  . PHE A 1 472 ? 9.361   15.711  16.443  1.00 44.24  ? 472  PHE A CZ  1 
ATOM   3636 N N   . ALA A 1 473 ? 8.500   16.721  22.028  1.00 46.48  ? 473  ALA A N   1 
ATOM   3637 C CA  . ALA A 1 473 ? 9.706   16.307  22.732  1.00 45.65  ? 473  ALA A CA  1 
ATOM   3638 C C   . ALA A 1 473 ? 9.409   15.182  23.719  1.00 46.81  ? 473  ALA A C   1 
ATOM   3639 O O   . ALA A 1 473 ? 10.165  14.213  23.816  1.00 46.39  ? 473  ALA A O   1 
ATOM   3640 C CB  . ALA A 1 473 ? 10.355  17.477  23.423  1.00 45.04  ? 473  ALA A CB  1 
ATOM   3641 N N   . GLN A 1 474 ? 8.289   15.300  24.429  1.00 48.71  ? 474  GLN A N   1 
ATOM   3642 C CA  . GLN A 1 474 ? 7.821   14.242  25.319  1.00 50.12  ? 474  GLN A CA  1 
ATOM   3643 C C   . GLN A 1 474 ? 7.644   12.921  24.560  1.00 50.48  ? 474  GLN A C   1 
ATOM   3644 O O   . GLN A 1 474 ? 8.097   11.864  25.024  1.00 50.13  ? 474  GLN A O   1 
ATOM   3645 C CB  . GLN A 1 474 ? 6.512   14.643  25.994  1.00 51.70  ? 474  GLN A CB  1 
ATOM   3646 C CG  . GLN A 1 474 ? 6.675   15.673  27.100  1.00 54.02  ? 474  GLN A CG  1 
ATOM   3647 C CD  . GLN A 1 474 ? 5.390   15.863  27.898  1.00 59.93  ? 474  GLN A CD  1 
ATOM   3648 O OE1 . GLN A 1 474 ? 4.404   16.442  27.408  1.00 62.38  ? 474  GLN A OE1 1 
ATOM   3649 N NE2 . GLN A 1 474 ? 5.391   15.364  29.137  1.00 61.26  ? 474  GLN A NE2 1 
ATOM   3650 N N   . ARG A 1 475 ? 7.010   12.992  23.383  1.00 50.76  ? 475  ARG A N   1 
ATOM   3651 C CA  . ARG A 1 475 ? 6.793   11.809  22.560  1.00 50.96  ? 475  ARG A CA  1 
ATOM   3652 C C   . ARG A 1 475 ? 8.132   11.127  22.184  1.00 49.40  ? 475  ARG A C   1 
ATOM   3653 O O   . ARG A 1 475 ? 8.275   9.889   22.296  1.00 49.04  ? 475  ARG A O   1 
ATOM   3654 C CB  . ARG A 1 475 ? 5.984   12.170  21.314  1.00 51.41  ? 475  ARG A CB  1 
ATOM   3655 C CG  . ARG A 1 475 ? 4.943   11.123  20.975  1.00 53.93  ? 475  ARG A CG  1 
ATOM   3656 C CD  . ARG A 1 475 ? 4.036   11.571  19.820  1.00 55.78  ? 475  ARG A CD  1 
ATOM   3657 N NE  . ARG A 1 475 ? 4.539   11.108  18.529  1.00 54.59  ? 475  ARG A NE  1 
ATOM   3658 C CZ  . ARG A 1 475 ? 4.759   11.876  17.467  1.00 52.37  ? 475  ARG A CZ  1 
ATOM   3659 N NH1 . ARG A 1 475 ? 4.511   13.182  17.508  1.00 50.66  ? 475  ARG A NH1 1 
ATOM   3660 N NH2 . ARG A 1 475 ? 5.223   11.318  16.354  1.00 52.49  ? 475  ARG A NH2 1 
ATOM   3661 N N   . LEU A 1 476 ? 9.104   11.946  21.767  1.00 47.32  ? 476  LEU A N   1 
ATOM   3662 C CA  . LEU A 1 476 ? 10.403  11.447  21.329  1.00 46.02  ? 476  LEU A CA  1 
ATOM   3663 C C   . LEU A 1 476 ? 11.248  10.832  22.440  1.00 45.21  ? 476  LEU A C   1 
ATOM   3664 O O   . LEU A 1 476 ? 11.841  9.775   22.240  1.00 44.87  ? 476  LEU A O   1 
ATOM   3665 C CB  . LEU A 1 476 ? 11.199  12.539  20.611  1.00 45.14  ? 476  LEU A CB  1 
ATOM   3666 C CG  . LEU A 1 476 ? 10.645  12.959  19.250  1.00 45.99  ? 476  LEU A CG  1 
ATOM   3667 C CD1 . LEU A 1 476 ? 11.333  14.208  18.821  1.00 46.04  ? 476  LEU A CD1 1 
ATOM   3668 C CD2 . LEU A 1 476 ? 10.812  11.869  18.199  1.00 46.25  ? 476  LEU A CD2 1 
ATOM   3669 N N   . MET A 1 477 ? 11.315  11.502  23.591  1.00 44.85  ? 477  MET A N   1 
ATOM   3670 C CA  . MET A 1 477 ? 12.053  10.996  24.733  1.00 44.42  ? 477  MET A CA  1 
ATOM   3671 C C   . MET A 1 477 ? 11.504  9.625   25.084  1.00 45.25  ? 477  MET A C   1 
ATOM   3672 O O   . MET A 1 477 ? 12.222  8.731   25.538  1.00 44.87  ? 477  MET A O   1 
ATOM   3673 C CB  . MET A 1 477 ? 11.864  11.912  25.925  1.00 45.03  ? 477  MET A CB  1 
ATOM   3674 C CG  . MET A 1 477 ? 12.519  13.262  25.804  1.00 44.70  ? 477  MET A CG  1 
ATOM   3675 S SD  . MET A 1 477 ? 11.875  14.333  27.103  1.00 47.35  ? 477  MET A SD  1 
ATOM   3676 C CE  . MET A 1 477 ? 12.710  13.755  28.558  1.00 46.85  ? 477  MET A CE  1 
ATOM   3677 N N   . LYS A 1 478 ? 10.209  9.476   24.853  1.00 46.30  ? 478  LYS A N   1 
ATOM   3678 C CA  . LYS A 1 478 ? 9.511   8.261   25.138  1.00 47.31  ? 478  LYS A CA  1 
ATOM   3679 C C   . LYS A 1 478 ? 9.858   7.142   24.142  1.00 46.56  ? 478  LYS A C   1 
ATOM   3680 O O   . LYS A 1 478 ? 10.045  6.002   24.561  1.00 46.62  ? 478  LYS A O   1 
ATOM   3681 C CB  . LYS A 1 478 ? 8.024   8.545   25.167  1.00 49.48  ? 478  LYS A CB  1 
ATOM   3682 C CG  . LYS A 1 478 ? 7.225   7.606   26.017  1.00 53.35  ? 478  LYS A CG  1 
ATOM   3683 C CD  . LYS A 1 478 ? 5.958   8.312   26.477  1.00 60.16  ? 478  LYS A CD  1 
ATOM   3684 C CE  . LYS A 1 478 ? 5.502   7.778   27.842  1.00 64.77  ? 478  LYS A CE  1 
ATOM   3685 N NZ  . LYS A 1 478 ? 6.557   7.948   28.907  1.00 64.47  ? 478  LYS A NZ  1 
ATOM   3686 N N   . TYR A 1 479 ? 9.957   7.449   22.845  1.00 45.34  ? 479  TYR A N   1 
ATOM   3687 C CA  . TYR A 1 479 ? 10.421  6.445   21.885  1.00 44.79  ? 479  TYR A CA  1 
ATOM   3688 C C   . TYR A 1 479 ? 11.841  5.962   22.240  1.00 43.85  ? 479  TYR A C   1 
ATOM   3689 O O   . TYR A 1 479 ? 12.083  4.749   22.346  1.00 43.87  ? 479  TYR A O   1 
ATOM   3690 C CB  . TYR A 1 479 ? 10.430  6.992   20.465  1.00 44.40  ? 479  TYR A CB  1 
ATOM   3691 C CG  . TYR A 1 479 ? 9.090   7.297   19.853  1.00 45.54  ? 479  TYR A CG  1 
ATOM   3692 C CD1 . TYR A 1 479 ? 8.018   6.396   19.959  1.00 46.68  ? 479  TYR A CD1 1 
ATOM   3693 C CD2 . TYR A 1 479 ? 8.905   8.468   19.113  1.00 44.36  ? 479  TYR A CD2 1 
ATOM   3694 C CE1 . TYR A 1 479 ? 6.797   6.672   19.378  1.00 47.13  ? 479  TYR A CE1 1 
ATOM   3695 C CE2 . TYR A 1 479 ? 7.691   8.751   18.522  1.00 46.08  ? 479  TYR A CE2 1 
ATOM   3696 C CZ  . TYR A 1 479 ? 6.636   7.847   18.652  1.00 47.93  ? 479  TYR A CZ  1 
ATOM   3697 O OH  . TYR A 1 479 ? 5.419   8.137   18.073  1.00 48.83  ? 479  TYR A OH  1 
ATOM   3698 N N   . TRP A 1 480 ? 12.756  6.918   22.439  1.00 42.36  ? 480  TRP A N   1 
ATOM   3699 C CA  . TRP A 1 480 ? 14.165  6.624   22.701  1.00 42.01  ? 480  TRP A CA  1 
ATOM   3700 C C   . TRP A 1 480 ? 14.357  5.770   23.948  1.00 42.82  ? 480  TRP A C   1 
ATOM   3701 O O   . TRP A 1 480 ? 15.119  4.791   23.920  1.00 42.96  ? 480  TRP A O   1 
ATOM   3702 C CB  . TRP A 1 480 ? 14.992  7.898   22.812  1.00 40.14  ? 480  TRP A CB  1 
ATOM   3703 C CG  . TRP A 1 480 ? 15.779  8.286   21.561  1.00 39.81  ? 480  TRP A CG  1 
ATOM   3704 C CD1 . TRP A 1 480 ? 17.136  8.463   21.475  1.00 38.45  ? 480  TRP A CD1 1 
ATOM   3705 C CD2 . TRP A 1 480 ? 15.259  8.589   20.248  1.00 39.40  ? 480  TRP A CD2 1 
ATOM   3706 N NE1 . TRP A 1 480 ? 17.484  8.845   20.197  1.00 37.76  ? 480  TRP A NE1 1 
ATOM   3707 C CE2 . TRP A 1 480 ? 16.357  8.927   19.429  1.00 37.80  ? 480  TRP A CE2 1 
ATOM   3708 C CE3 . TRP A 1 480 ? 13.973  8.588   19.684  1.00 40.72  ? 480  TRP A CE3 1 
ATOM   3709 C CZ2 . TRP A 1 480 ? 16.215  9.252   18.083  1.00 38.54  ? 480  TRP A CZ2 1 
ATOM   3710 C CZ3 . TRP A 1 480 ? 13.830  8.933   18.350  1.00 38.86  ? 480  TRP A CZ3 1 
ATOM   3711 C CH2 . TRP A 1 480 ? 14.940  9.267   17.566  1.00 38.88  ? 480  TRP A CH2 1 
ATOM   3712 N N   . THR A 1 481 ? 13.665  6.127   25.033  1.00 43.44  ? 481  THR A N   1 
ATOM   3713 C CA  . THR A 1 481 ? 13.795  5.373   26.281  1.00 43.69  ? 481  THR A CA  1 
ATOM   3714 C C   . THR A 1 481 ? 12.999  4.078   26.273  1.00 45.29  ? 481  THR A C   1 
ATOM   3715 O O   . THR A 1 481 ? 13.365  3.173   27.001  1.00 45.97  ? 481  THR A O   1 
ATOM   3716 C CB  . THR A 1 481 ? 13.440  6.177   27.542  1.00 43.68  ? 481  THR A CB  1 
ATOM   3717 O OG1 . THR A 1 481 ? 12.154  6.777   27.379  1.00 45.58  ? 481  THR A OG1 1 
ATOM   3718 C CG2 . THR A 1 481 ? 14.447  7.244   27.797  1.00 41.96  ? 481  THR A CG2 1 
ATOM   3719 N N   . ASN A 1 482 ? 11.929  3.970   25.476  1.00 46.07  ? 482  ASN A N   1 
ATOM   3720 C CA  . ASN A 1 482 ? 11.305  2.653   25.264  1.00 47.80  ? 482  ASN A CA  1 
ATOM   3721 C C   . ASN A 1 482 ? 12.291  1.725   24.571  1.00 47.71  ? 482  ASN A C   1 
ATOM   3722 O O   . ASN A 1 482 ? 12.404  0.551   24.939  1.00 48.91  ? 482  ASN A O   1 
ATOM   3723 C CB  . ASN A 1 482 ? 10.031  2.709   24.415  1.00 48.78  ? 482  ASN A CB  1 
ATOM   3724 C CG  . ASN A 1 482 ? 8.819   3.179   25.180  1.00 49.87  ? 482  ASN A CG  1 
ATOM   3725 O OD1 . ASN A 1 482 ? 8.795   3.204   26.401  1.00 50.57  ? 482  ASN A OD1 1 
ATOM   3726 N ND2 . ASN A 1 482 ? 7.786   3.540   24.447  1.00 52.86  ? 482  ASN A ND2 1 
ATOM   3727 N N   . PHE A 1 483 ? 12.982  2.257   23.560  1.00 46.40  ? 483  PHE A N   1 
ATOM   3728 C CA  . PHE A 1 483 ? 13.970  1.504   22.812  1.00 46.15  ? 483  PHE A CA  1 
ATOM   3729 C C   . PHE A 1 483 ? 15.120  1.032   23.707  1.00 46.88  ? 483  PHE A C   1 
ATOM   3730 O O   . PHE A 1 483 ? 15.528  -0.146  23.634  1.00 47.73  ? 483  PHE A O   1 
ATOM   3731 C CB  . PHE A 1 483 ? 14.546  2.306   21.625  1.00 44.55  ? 483  PHE A CB  1 
ATOM   3732 C CG  . PHE A 1 483 ? 15.586  1.547   20.871  1.00 42.57  ? 483  PHE A CG  1 
ATOM   3733 C CD1 . PHE A 1 483 ? 15.217  0.507   20.014  1.00 41.33  ? 483  PHE A CD1 1 
ATOM   3734 C CD2 . PHE A 1 483 ? 16.941  1.788   21.088  1.00 40.43  ? 483  PHE A CD2 1 
ATOM   3735 C CE1 . PHE A 1 483 ? 16.179  -0.254  19.350  1.00 40.56  ? 483  PHE A CE1 1 
ATOM   3736 C CE2 . PHE A 1 483 ? 17.921  1.022   20.425  1.00 39.59  ? 483  PHE A CE2 1 
ATOM   3737 C CZ  . PHE A 1 483 ? 17.532  0.009   19.547  1.00 39.83  ? 483  PHE A CZ  1 
ATOM   3738 N N   . ALA A 1 484 ? 15.662  1.948   24.520  1.00 46.58  ? 484  ALA A N   1 
ATOM   3739 C CA  . ALA A 1 484 ? 16.701  1.595   25.488  1.00 47.04  ? 484  ALA A CA  1 
ATOM   3740 C C   . ALA A 1 484 ? 16.195  0.477   26.395  1.00 49.13  ? 484  ALA A C   1 
ATOM   3741 O O   . ALA A 1 484 ? 16.905  -0.488  26.663  1.00 49.69  ? 484  ALA A O   1 
ATOM   3742 C CB  . ALA A 1 484 ? 17.099  2.809   26.317  1.00 46.09  ? 484  ALA A CB  1 
ATOM   3743 N N   . ARG A 1 485 ? 14.941  0.601   26.814  1.00 50.51  ? 485  ARG A N   1 
ATOM   3744 C CA  . ARG A 1 485 ? 14.362  -0.260  27.823  1.00 53.09  ? 485  ARG A CA  1 
ATOM   3745 C C   . ARG A 1 485 ? 14.080  -1.672  27.291  1.00 54.03  ? 485  ARG A C   1 
ATOM   3746 O O   . ARG A 1 485 ? 14.312  -2.645  27.999  1.00 54.45  ? 485  ARG A O   1 
ATOM   3747 C CB  . ARG A 1 485 ? 13.080  0.393   28.370  1.00 54.24  ? 485  ARG A CB  1 
ATOM   3748 C CG  . ARG A 1 485 ? 12.494  -0.171  29.675  1.00 59.64  ? 485  ARG A CG  1 
ATOM   3749 C CD  . ARG A 1 485 ? 11.099  0.474   30.039  1.00 66.99  ? 485  ARG A CD  1 
ATOM   3750 N NE  . ARG A 1 485 ? 10.813  1.816   29.458  1.00 68.85  ? 485  ARG A NE  1 
ATOM   3751 C CZ  . ARG A 1 485 ? 11.372  2.980   29.839  1.00 68.74  ? 485  ARG A CZ  1 
ATOM   3752 N NH1 . ARG A 1 485 ? 12.295  3.018   30.803  1.00 67.18  ? 485  ARG A NH1 1 
ATOM   3753 N NH2 . ARG A 1 485 ? 11.013  4.120   29.240  1.00 67.50  ? 485  ARG A NH2 1 
ATOM   3754 N N   . THR A 1 486 ? 13.592  -1.776  26.053  1.00 54.15  ? 486  THR A N   1 
ATOM   3755 C CA  . THR A 1 486 ? 12.968  -3.020  25.582  1.00 55.62  ? 486  THR A CA  1 
ATOM   3756 C C   . THR A 1 486 ? 13.459  -3.470  24.218  1.00 55.82  ? 486  THR A C   1 
ATOM   3757 O O   . THR A 1 486 ? 13.160  -4.588  23.787  1.00 57.16  ? 486  THR A O   1 
ATOM   3758 C CB  . THR A 1 486 ? 11.419  -2.904  25.453  1.00 56.69  ? 486  THR A CB  1 
ATOM   3759 O OG1 . THR A 1 486 ? 11.097  -2.148  24.281  1.00 55.84  ? 486  THR A OG1 1 
ATOM   3760 C CG2 . THR A 1 486 ? 10.768  -2.271  26.676  1.00 55.53  ? 486  THR A CG2 1 
ATOM   3761 N N   . GLY A 1 487 ? 14.182  -2.592  23.528  1.00 54.67  ? 487  GLY A N   1 
ATOM   3762 C CA  . GLY A 1 487 ? 14.585  -2.834  22.143  1.00 54.65  ? 487  GLY A CA  1 
ATOM   3763 C C   . GLY A 1 487 ? 13.479  -2.546  21.142  1.00 55.61  ? 487  GLY A C   1 
ATOM   3764 O O   . GLY A 1 487 ? 13.544  -2.999  20.014  1.00 56.31  ? 487  GLY A O   1 
ATOM   3765 N N   . ASP A 1 488 ? 12.469  -1.782  21.554  1.00 56.19  ? 488  ASP A N   1 
ATOM   3766 C CA  . ASP A 1 488 ? 11.276  -1.537  20.752  1.00 57.39  ? 488  ASP A CA  1 
ATOM   3767 C C   . ASP A 1 488 ? 10.756  -0.149  21.118  1.00 57.21  ? 488  ASP A C   1 
ATOM   3768 O O   . ASP A 1 488 ? 10.389  0.082   22.260  1.00 57.51  ? 488  ASP A O   1 
ATOM   3769 C CB  . ASP A 1 488 ? 10.229  -2.615  21.066  1.00 59.22  ? 488  ASP A CB  1 
ATOM   3770 C CG  . ASP A 1 488 ? 9.005   -2.549  20.165  1.00 60.64  ? 488  ASP A CG  1 
ATOM   3771 O OD1 . ASP A 1 488 ? 8.746   -1.506  19.539  1.00 60.05  ? 488  ASP A OD1 1 
ATOM   3772 O OD2 . ASP A 1 488 ? 8.262   -3.554  20.101  1.00 63.41  ? 488  ASP A OD2 1 
ATOM   3773 N N   . PRO A 1 489 ? 10.717  0.787   20.152  1.00 57.45  ? 489  PRO A N   1 
ATOM   3774 C CA  . PRO A 1 489 ? 10.349  2.144   20.543  1.00 57.67  ? 489  PRO A CA  1 
ATOM   3775 C C   . PRO A 1 489 ? 8.851   2.295   20.803  1.00 60.25  ? 489  PRO A C   1 
ATOM   3776 O O   . PRO A 1 489 ? 8.418   3.282   21.394  1.00 60.26  ? 489  PRO A O   1 
ATOM   3777 C CB  . PRO A 1 489 ? 10.806  2.984   19.349  1.00 56.13  ? 489  PRO A CB  1 
ATOM   3778 C CG  . PRO A 1 489 ? 10.717  2.065   18.196  1.00 56.48  ? 489  PRO A CG  1 
ATOM   3779 C CD  . PRO A 1 489 ? 10.929  0.672   18.697  1.00 57.07  ? 489  PRO A CD  1 
ATOM   3780 N N   . ASN A 1 490 ? 8.071   1.305   20.390  1.00 63.89  ? 490  ASN A N   1 
ATOM   3781 C CA  . ASN A 1 490 ? 6.628   1.328   20.588  1.00 67.28  ? 490  ASN A CA  1 
ATOM   3782 C C   . ASN A 1 490 ? 6.229   1.194   22.044  1.00 70.04  ? 490  ASN A C   1 
ATOM   3783 O O   . ASN A 1 490 ? 6.912   0.539   22.838  1.00 69.71  ? 490  ASN A O   1 
ATOM   3784 C CB  . ASN A 1 490 ? 5.964   0.229   19.764  1.00 68.33  ? 490  ASN A CB  1 
ATOM   3785 C CG  . ASN A 1 490 ? 6.020   0.504   18.281  1.00 67.12  ? 490  ASN A CG  1 
ATOM   3786 O OD1 . ASN A 1 490 ? 5.231   1.293   17.751  1.00 65.70  ? 490  ASN A OD1 1 
ATOM   3787 N ND2 . ASN A 1 490 ? 6.952   -0.146  17.597  1.00 64.40  ? 490  ASN A ND2 1 
ATOM   3788 N N   . ASP A 1 491 ? 5.112   1.825   22.390  1.00 74.14  ? 491  ASP A N   1 
ATOM   3789 C CA  . ASP A 1 491 ? 4.514   1.632   23.710  1.00 78.06  ? 491  ASP A CA  1 
ATOM   3790 C C   . ASP A 1 491 ? 3.635   0.381   23.714  1.00 81.25  ? 491  ASP A C   1 
ATOM   3791 O O   . ASP A 1 491 ? 2.713   0.274   22.898  1.00 82.43  ? 491  ASP A O   1 
ATOM   3792 C CB  . ASP A 1 491 ? 3.699   2.858   24.133  1.00 79.02  ? 491  ASP A CB  1 
ATOM   3793 C CG  . ASP A 1 491 ? 3.494   2.926   25.645  1.00 81.98  ? 491  ASP A CG  1 
ATOM   3794 O OD1 . ASP A 1 491 ? 2.562   2.252   26.169  1.00 84.84  ? 491  ASP A OD1 1 
ATOM   3795 O OD2 . ASP A 1 491 ? 4.285   3.653   26.302  1.00 82.98  ? 491  ASP A OD2 1 
ATOM   3796 N N   . PRO A 1 492 ? 3.922   -0.572  24.629  1.00 83.35  ? 492  PRO A N   1 
ATOM   3797 C CA  . PRO A 1 492 ? 3.154   -1.843  24.704  1.00 86.60  ? 492  PRO A CA  1 
ATOM   3798 C C   . PRO A 1 492 ? 1.671   -1.639  25.072  1.00 89.49  ? 492  PRO A C   1 
ATOM   3799 O O   . PRO A 1 492 ? 0.793   -2.221  24.433  1.00 91.41  ? 492  PRO A O   1 
ATOM   3800 C CB  . PRO A 1 492 ? 3.882   -2.646  25.799  1.00 86.47  ? 492  PRO A CB  1 
ATOM   3801 C CG  . PRO A 1 492 ? 5.200   -1.899  26.049  1.00 84.10  ? 492  PRO A CG  1 
ATOM   3802 C CD  . PRO A 1 492 ? 4.938   -0.468  25.696  1.00 82.07  ? 492  PRO A CD  1 
ATOM   3803 N N   . ARG A 1 493 ? 1.408   -0.799  26.075  1.00 90.46  ? 493  ARG A N   1 
ATOM   3804 C CA  . ARG A 1 493 ? 0.046   -0.485  26.538  1.00 93.29  ? 493  ARG A CA  1 
ATOM   3805 C C   . ARG A 1 493 ? -0.814  0.248   25.495  1.00 94.45  ? 493  ARG A C   1 
ATOM   3806 O O   . ARG A 1 493 ? -2.019  -0.014  25.364  1.00 96.66  ? 493  ARG A O   1 
ATOM   3807 C CB  . ARG A 1 493 ? 0.110   0.334   27.841  1.00 92.82  ? 493  ARG A CB  1 
ATOM   3808 N N   . ASP A 1 494 ? -0.169  1.151   24.757  1.00 93.46  ? 494  ASP A N   1 
ATOM   3809 C CA  . ASP A 1 494 ? -0.824  2.125   23.871  1.00 94.13  ? 494  ASP A CA  1 
ATOM   3810 C C   . ASP A 1 494 ? -1.256  1.553   22.499  1.00 95.13  ? 494  ASP A C   1 
ATOM   3811 O O   . ASP A 1 494 ? -0.546  1.684   21.492  1.00 93.92  ? 494  ASP A O   1 
ATOM   3812 C CB  . ASP A 1 494 ? 0.108   3.338   23.704  1.00 92.21  ? 494  ASP A CB  1 
ATOM   3813 C CG  . ASP A 1 494 ? -0.619  4.593   23.245  1.00 93.32  ? 494  ASP A CG  1 
ATOM   3814 O OD1 . ASP A 1 494 ? -1.870  4.629   23.280  1.00 96.40  ? 494  ASP A OD1 1 
ATOM   3815 O OD2 . ASP A 1 494 ? 0.078   5.556   22.857  1.00 92.02  ? 494  ASP A OD2 1 
ATOM   3816 N N   . SER A 1 495 ? -2.437  0.936   22.475  1.00 97.51  ? 495  SER A N   1 
ATOM   3817 C CA  . SER A 1 495 ? -2.986  0.317   21.260  1.00 98.71  ? 495  SER A CA  1 
ATOM   3818 C C   . SER A 1 495 ? -3.264  1.311   20.111  1.00 98.07  ? 495  SER A C   1 
ATOM   3819 O O   . SER A 1 495 ? -2.870  1.060   18.961  1.00 97.71  ? 495  SER A O   1 
ATOM   3820 C CB  . SER A 1 495 ? -4.256  -0.498  21.598  1.00 101.42 ? 495  SER A CB  1 
ATOM   3821 N N   . LYS A 1 496 ? -3.926  2.431   20.439  1.00 97.72  ? 496  LYS A N   1 
ATOM   3822 C CA  . LYS A 1 496 ? -4.441  3.413   19.453  1.00 96.83  ? 496  LYS A CA  1 
ATOM   3823 C C   . LYS A 1 496 ? -3.364  4.163   18.640  1.00 93.52  ? 496  LYS A C   1 
ATOM   3824 O O   . LYS A 1 496 ? -3.445  4.229   17.401  1.00 93.46  ? 496  LYS A O   1 
ATOM   3825 C CB  . LYS A 1 496 ? -5.405  4.409   20.138  1.00 97.96  ? 496  LYS A CB  1 
ATOM   3826 N N   . SER A 1 497 ? -2.376  4.732   19.343  1.00 90.14  ? 497  SER A N   1 
ATOM   3827 C CA  . SER A 1 497 ? -1.206  5.354   18.711  1.00 86.28  ? 497  SER A CA  1 
ATOM   3828 C C   . SER A 1 497 ? -0.736  4.502   17.552  1.00 84.79  ? 497  SER A C   1 
ATOM   3829 O O   . SER A 1 497 ? -0.710  3.259   17.661  1.00 85.63  ? 497  SER A O   1 
ATOM   3830 C CB  . SER A 1 497 ? -0.044  5.494   19.698  1.00 84.58  ? 497  SER A CB  1 
ATOM   3831 O OG  . SER A 1 497 ? -0.105  6.714   20.410  1.00 84.23  ? 497  SER A OG  1 
ATOM   3832 N N   . PRO A 1 498 ? -0.358  5.157   16.436  1.00 82.34  ? 498  PRO A N   1 
ATOM   3833 C CA  . PRO A 1 498 ? 0.127   4.388   15.289  1.00 80.40  ? 498  PRO A CA  1 
ATOM   3834 C C   . PRO A 1 498 ? 1.425   3.674   15.668  1.00 76.80  ? 498  PRO A C   1 
ATOM   3835 O O   . PRO A 1 498 ? 2.177   4.167   16.508  1.00 74.63  ? 498  PRO A O   1 
ATOM   3836 C CB  . PRO A 1 498 ? 0.362   5.461   14.213  1.00 79.81  ? 498  PRO A CB  1 
ATOM   3837 C CG  . PRO A 1 498 ? -0.379  6.679   14.695  1.00 80.89  ? 498  PRO A CG  1 
ATOM   3838 C CD  . PRO A 1 498 ? -0.323  6.610   16.182  1.00 81.31  ? 498  PRO A CD  1 
ATOM   3839 N N   . GLN A 1 499 ? 1.645   2.509   15.065  1.00 75.27  ? 499  GLN A N   1 
ATOM   3840 C CA  . GLN A 1 499 ? 2.813   1.673   15.336  1.00 71.93  ? 499  GLN A CA  1 
ATOM   3841 C C   . GLN A 1 499 ? 4.017   2.034   14.460  1.00 68.34  ? 499  GLN A C   1 
ATOM   3842 O O   . GLN A 1 499 ? 3.863   2.535   13.345  1.00 67.60  ? 499  GLN A O   1 
ATOM   3843 C CB  . GLN A 1 499 ? 2.450   0.193   15.152  1.00 73.88  ? 499  GLN A CB  1 
ATOM   3844 C CG  . GLN A 1 499 ? 1.521   -0.361  16.241  1.00 76.52  ? 499  GLN A CG  1 
ATOM   3845 C CD  . GLN A 1 499 ? 2.228   -0.532  17.579  1.00 75.96  ? 499  GLN A CD  1 
ATOM   3846 O OE1 . GLN A 1 499 ? 3.270   -1.204  17.670  1.00 75.61  ? 499  GLN A OE1 1 
ATOM   3847 N NE2 . GLN A 1 499 ? 1.673   0.080   18.622  1.00 74.92  ? 499  GLN A NE2 1 
ATOM   3848 N N   . TRP A 1 500 ? 5.210   1.770   14.992  1.00 64.90  ? 500  TRP A N   1 
ATOM   3849 C CA  . TRP A 1 500 ? 6.473   1.962   14.291  1.00 61.25  ? 500  TRP A CA  1 
ATOM   3850 C C   . TRP A 1 500 ? 6.980   0.569   13.917  1.00 61.06  ? 500  TRP A C   1 
ATOM   3851 O O   . TRP A 1 500 ? 7.485   -0.157  14.777  1.00 60.67  ? 500  TRP A O   1 
ATOM   3852 C CB  . TRP A 1 500 ? 7.459   2.674   15.218  1.00 58.72  ? 500  TRP A CB  1 
ATOM   3853 C CG  . TRP A 1 500 ? 8.777   3.102   14.628  1.00 55.85  ? 500  TRP A CG  1 
ATOM   3854 C CD1 . TRP A 1 500 ? 9.401   2.603   13.506  1.00 55.56  ? 500  TRP A CD1 1 
ATOM   3855 C CD2 . TRP A 1 500 ? 9.668   4.088   15.171  1.00 51.68  ? 500  TRP A CD2 1 
ATOM   3856 N NE1 . TRP A 1 500 ? 10.603  3.249   13.308  1.00 52.83  ? 500  TRP A NE1 1 
ATOM   3857 C CE2 . TRP A 1 500 ? 10.793  4.155   14.319  1.00 49.77  ? 500  TRP A CE2 1 
ATOM   3858 C CE3 . TRP A 1 500 ? 9.615   4.930   16.286  1.00 49.30  ? 500  TRP A CE3 1 
ATOM   3859 C CZ2 . TRP A 1 500 ? 11.845  5.029   14.544  1.00 47.41  ? 500  TRP A CZ2 1 
ATOM   3860 C CZ3 . TRP A 1 500 ? 10.667  5.802   16.509  1.00 47.08  ? 500  TRP A CZ3 1 
ATOM   3861 C CH2 . TRP A 1 500 ? 11.769  5.843   15.646  1.00 46.32  ? 500  TRP A CH2 1 
ATOM   3862 N N   . PRO A 1 501 ? 6.836   0.181   12.634  1.00 61.00  ? 501  PRO A N   1 
ATOM   3863 C CA  . PRO A 1 501 ? 7.248   -1.159  12.236  1.00 61.12  ? 501  PRO A CA  1 
ATOM   3864 C C   . PRO A 1 501 ? 8.757   -1.229  12.022  1.00 59.11  ? 501  PRO A C   1 
ATOM   3865 O O   . PRO A 1 501 ? 9.374   -0.218  11.667  1.00 57.56  ? 501  PRO A O   1 
ATOM   3866 C CB  . PRO A 1 501 ? 6.520   -1.360  10.906  1.00 62.31  ? 501  PRO A CB  1 
ATOM   3867 C CG  . PRO A 1 501 ? 6.402   0.010   10.318  1.00 61.43  ? 501  PRO A CG  1 
ATOM   3868 C CD  . PRO A 1 501 ? 6.468   1.009   11.467  1.00 60.85  ? 501  PRO A CD  1 
ATOM   3869 N N   . PRO A 1 502 ? 9.359   -2.407  12.237  1.00 59.35  ? 502  PRO A N   1 
ATOM   3870 C CA  . PRO A 1 502 ? 10.792  -2.549  11.941  1.00 58.10  ? 502  PRO A CA  1 
ATOM   3871 C C   . PRO A 1 502 ? 11.131  -2.252  10.472  1.00 58.19  ? 502  PRO A C   1 
ATOM   3872 O O   . PRO A 1 502 ? 10.281  -2.424  9.597   1.00 59.10  ? 502  PRO A O   1 
ATOM   3873 C CB  . PRO A 1 502 ? 11.072  -4.023  12.249  1.00 59.28  ? 502  PRO A CB  1 
ATOM   3874 C CG  . PRO A 1 502 ? 10.005  -4.416  13.235  1.00 60.50  ? 502  PRO A CG  1 
ATOM   3875 C CD  . PRO A 1 502 ? 8.794   -3.608  12.882  1.00 60.63  ? 502  PRO A CD  1 
ATOM   3876 N N   . TYR A 1 503 ? 12.361  -1.803  10.211  1.00 56.79  ? 503  TYR A N   1 
ATOM   3877 C CA  . TYR A 1 503 ? 12.858  -1.703  8.850   1.00 56.88  ? 503  TYR A CA  1 
ATOM   3878 C C   . TYR A 1 503 ? 13.320  -3.072  8.318   1.00 58.07  ? 503  TYR A C   1 
ATOM   3879 O O   . TYR A 1 503 ? 14.225  -3.678  8.880   1.00 58.05  ? 503  TYR A O   1 
ATOM   3880 C CB  . TYR A 1 503 ? 13.997  -0.698  8.796   1.00 55.21  ? 503  TYR A CB  1 
ATOM   3881 C CG  . TYR A 1 503 ? 14.594  -0.528  7.422   1.00 56.52  ? 503  TYR A CG  1 
ATOM   3882 C CD1 . TYR A 1 503 ? 15.612  -1.379  6.972   1.00 57.16  ? 503  TYR A CD1 1 
ATOM   3883 C CD2 . TYR A 1 503 ? 14.154  0.484   6.569   1.00 57.23  ? 503  TYR A CD2 1 
ATOM   3884 C CE1 . TYR A 1 503 ? 16.168  -1.235  5.723   1.00 57.62  ? 503  TYR A CE1 1 
ATOM   3885 C CE2 . TYR A 1 503 ? 14.712  0.635   5.310   1.00 58.82  ? 503  TYR A CE2 1 
ATOM   3886 C CZ  . TYR A 1 503 ? 15.717  -0.233  4.896   1.00 58.97  ? 503  TYR A CZ  1 
ATOM   3887 O OH  . TYR A 1 503 ? 16.269  -0.100  3.649   1.00 61.19  ? 503  TYR A OH  1 
ATOM   3888 N N   . THR A 1 504 ? 12.695  -3.553  7.243   1.00 59.43  ? 504  THR A N   1 
ATOM   3889 C CA  . THR A 1 504 ? 13.116  -4.800  6.578   1.00 60.70  ? 504  THR A CA  1 
ATOM   3890 C C   . THR A 1 504 ? 13.621  -4.520  5.153   1.00 60.97  ? 504  THR A C   1 
ATOM   3891 O O   . THR A 1 504 ? 13.335  -3.461  4.592   1.00 60.11  ? 504  THR A O   1 
ATOM   3892 C CB  . THR A 1 504 ? 11.961  -5.849  6.475   1.00 62.80  ? 504  THR A CB  1 
ATOM   3893 O OG1 . THR A 1 504 ? 10.899  -5.320  5.673   1.00 62.99  ? 504  THR A OG1 1 
ATOM   3894 C CG2 . THR A 1 504 ? 11.423  -6.237  7.846   1.00 62.49  ? 504  THR A CG2 1 
ATOM   3895 N N   . THR A 1 505 ? 14.358  -5.468  4.567   1.00 61.98  ? 505  THR A N   1 
ATOM   3896 C CA  . THR A 1 505 ? 14.725  -5.354  3.156   1.00 62.58  ? 505  THR A CA  1 
ATOM   3897 C C   . THR A 1 505 ? 13.508  -5.489  2.246   1.00 64.18  ? 505  THR A C   1 
ATOM   3898 O O   . THR A 1 505 ? 13.425  -4.807  1.226   1.00 64.05  ? 505  THR A O   1 
ATOM   3899 C CB  . THR A 1 505 ? 15.863  -6.327  2.711   1.00 63.47  ? 505  THR A CB  1 
ATOM   3900 O OG1 . THR A 1 505 ? 15.547  -7.675  3.071   1.00 64.73  ? 505  THR A OG1 1 
ATOM   3901 C CG2 . THR A 1 505 ? 17.204  -5.917  3.344   1.00 62.35  ? 505  THR A CG2 1 
ATOM   3902 N N   . ALA A 1 506 ? 12.564  -6.348  2.627   1.00 65.67  ? 506  ALA A N   1 
ATOM   3903 C CA  . ALA A 1 506 ? 11.378  -6.594  1.806   1.00 67.71  ? 506  ALA A CA  1 
ATOM   3904 C C   . ALA A 1 506 ? 10.478  -5.376  1.728   1.00 67.09  ? 506  ALA A C   1 
ATOM   3905 O O   . ALA A 1 506 ? 9.916   -5.092  0.668   1.00 68.76  ? 506  ALA A O   1 
ATOM   3906 C CB  . ALA A 1 506 ? 10.576  -7.803  2.320   1.00 69.94  ? 506  ALA A CB  1 
ATOM   3907 N N   . ALA A 1 507 ? 10.335  -4.656  2.840   1.00 64.97  ? 507  ALA A N   1 
ATOM   3908 C CA  . ALA A 1 507 ? 9.334   -3.599  2.909   1.00 63.81  ? 507  ALA A CA  1 
ATOM   3909 C C   . ALA A 1 507 ? 9.925   -2.207  3.135   1.00 60.93  ? 507  ALA A C   1 
ATOM   3910 O O   . ALA A 1 507 ? 9.274   -1.208  2.864   1.00 60.67  ? 507  ALA A O   1 
ATOM   3911 C CB  . ALA A 1 507 ? 8.259   -3.938  3.948   1.00 64.39  ? 507  ALA A CB  1 
ATOM   3912 N N   . GLN A 1 508 ? 11.154  -2.140  3.619   1.00 58.86  ? 508  GLN A N   1 
ATOM   3913 C CA  . GLN A 1 508 ? 11.868  -0.857  3.732   1.00 56.66  ? 508  GLN A CA  1 
ATOM   3914 C C   . GLN A 1 508 ? 11.036  0.252   4.417   1.00 55.97  ? 508  GLN A C   1 
ATOM   3915 O O   . GLN A 1 508 ? 11.017  1.401   3.948   1.00 55.75  ? 508  GLN A O   1 
ATOM   3916 C CB  . GLN A 1 508 ? 12.361  -0.376  2.352   1.00 56.14  ? 508  GLN A CB  1 
ATOM   3917 C CG  . GLN A 1 508 ? 13.037  -1.435  1.483   1.00 56.83  ? 508  GLN A CG  1 
ATOM   3918 C CD  . GLN A 1 508 ? 13.620  -0.879  0.184   1.00 56.78  ? 508  GLN A CD  1 
ATOM   3919 O OE1 . GLN A 1 508 ? 14.317  0.142   0.183   1.00 56.13  ? 508  GLN A OE1 1 
ATOM   3920 N NE2 . GLN A 1 508 ? 13.356  -1.563  -0.923  1.00 57.17  ? 508  GLN A NE2 1 
ATOM   3921 N N   . GLN A 1 509 ? 10.367  -0.091  5.520   1.00 55.56  ? 509  GLN A N   1 
ATOM   3922 C CA  . GLN A 1 509 ? 9.559   0.863   6.274   1.00 54.60  ? 509  GLN A CA  1 
ATOM   3923 C C   . GLN A 1 509 ? 10.365  1.734   7.248   1.00 52.79  ? 509  GLN A C   1 
ATOM   3924 O O   . GLN A 1 509 ? 11.308  1.261   7.896   1.00 52.27  ? 509  GLN A O   1 
ATOM   3925 C CB  . GLN A 1 509 ? 8.460   0.140   7.043   1.00 55.76  ? 509  GLN A CB  1 
ATOM   3926 C CG  . GLN A 1 509 ? 7.379   -0.430  6.158   1.00 58.03  ? 509  GLN A CG  1 
ATOM   3927 C CD  . GLN A 1 509 ? 6.503   -1.435  6.869   1.00 58.43  ? 509  GLN A CD  1 
ATOM   3928 O OE1 . GLN A 1 509 ? 5.310   -1.213  7.038   1.00 59.57  ? 509  GLN A OE1 1 
ATOM   3929 N NE2 . GLN A 1 509 ? 7.090   -2.543  7.292   1.00 58.41  ? 509  GLN A NE2 1 
ATOM   3930 N N   . TYR A 1 510 ? 9.971   3.001   7.350   1.00 51.37  ? 510  TYR A N   1 
ATOM   3931 C CA  . TYR A 1 510 ? 10.525  3.925   8.324   1.00 49.92  ? 510  TYR A CA  1 
ATOM   3932 C C   . TYR A 1 510 ? 9.437   4.948   8.668   1.00 50.45  ? 510  TYR A C   1 
ATOM   3933 O O   . TYR A 1 510 ? 8.389   4.965   8.024   1.00 52.57  ? 510  TYR A O   1 
ATOM   3934 C CB  . TYR A 1 510 ? 11.772  4.606   7.766   1.00 47.95  ? 510  TYR A CB  1 
ATOM   3935 C CG  . TYR A 1 510 ? 11.494  5.501   6.586   1.00 48.54  ? 510  TYR A CG  1 
ATOM   3936 C CD1 . TYR A 1 510 ? 11.254  4.966   5.309   1.00 49.72  ? 510  TYR A CD1 1 
ATOM   3937 C CD2 . TYR A 1 510 ? 11.457  6.888   6.745   1.00 48.86  ? 510  TYR A CD2 1 
ATOM   3938 C CE1 . TYR A 1 510 ? 10.973  5.786   4.230   1.00 50.91  ? 510  TYR A CE1 1 
ATOM   3939 C CE2 . TYR A 1 510 ? 11.193  7.726   5.672   1.00 50.41  ? 510  TYR A CE2 1 
ATOM   3940 C CZ  . TYR A 1 510 ? 10.952  7.171   4.415   1.00 52.25  ? 510  TYR A CZ  1 
ATOM   3941 O OH  . TYR A 1 510 ? 10.698  8.017   3.358   1.00 53.18  ? 510  TYR A OH  1 
ATOM   3942 N N   . VAL A 1 511 ? 9.663   5.799   9.666   1.00 49.15  ? 511  VAL A N   1 
ATOM   3943 C CA  . VAL A 1 511 ? 8.607   6.693   10.121  1.00 49.17  ? 511  VAL A CA  1 
ATOM   3944 C C   . VAL A 1 511 ? 8.954   8.165   10.011  1.00 48.24  ? 511  VAL A C   1 
ATOM   3945 O O   . VAL A 1 511 ? 10.122  8.546   10.086  1.00 47.38  ? 511  VAL A O   1 
ATOM   3946 C CB  . VAL A 1 511 ? 8.181   6.399   11.581  1.00 49.67  ? 511  VAL A CB  1 
ATOM   3947 C CG1 . VAL A 1 511 ? 7.471   5.062   11.692  1.00 50.37  ? 511  VAL A CG1 1 
ATOM   3948 C CG2 . VAL A 1 511 ? 9.364   6.498   12.549  1.00 47.66  ? 511  VAL A CG2 1 
ATOM   3949 N N   . SER A 1 512 ? 7.936   8.996   9.835   1.00 48.94  ? 512  SER A N   1 
ATOM   3950 C CA  . SER A 1 512 ? 8.128   10.438  9.918   1.00 48.66  ? 512  SER A CA  1 
ATOM   3951 C C   . SER A 1 512 ? 8.039   10.870  11.382  1.00 48.23  ? 512  SER A C   1 
ATOM   3952 O O   . SER A 1 512 ? 7.049   10.579  12.054  1.00 49.12  ? 512  SER A O   1 
ATOM   3953 C CB  . SER A 1 512 ? 7.074   11.187  9.075   1.00 49.71  ? 512  SER A CB  1 
ATOM   3954 O OG  . SER A 1 512 ? 5.731   10.863  9.475   1.00 52.76  ? 512  SER A OG  1 
ATOM   3955 N N   . LEU A 1 513 ? 9.080   11.533  11.881  1.00 46.92  ? 513  LEU A N   1 
ATOM   3956 C CA  . LEU A 1 513 ? 9.002   12.210  13.177  1.00 46.70  ? 513  LEU A CA  1 
ATOM   3957 C C   . LEU A 1 513 ? 8.740   13.710  12.960  1.00 47.55  ? 513  LEU A C   1 
ATOM   3958 O O   . LEU A 1 513 ? 9.616   14.451  12.496  1.00 47.00  ? 513  LEU A O   1 
ATOM   3959 C CB  . LEU A 1 513 ? 10.257  11.950  14.025  1.00 44.71  ? 513  LEU A CB  1 
ATOM   3960 C CG  . LEU A 1 513 ? 10.607  10.483  14.334  1.00 44.09  ? 513  LEU A CG  1 
ATOM   3961 C CD1 . LEU A 1 513 ? 11.900  10.363  15.120  1.00 38.70  ? 513  LEU A CD1 1 
ATOM   3962 C CD2 . LEU A 1 513 ? 9.479   9.812   15.123  1.00 44.90  ? 513  LEU A CD2 1 
ATOM   3963 N N   . ASN A 1 514 ? 7.505   14.133  13.237  1.00 49.62  ? 514  ASN A N   1 
ATOM   3964 C CA  . ASN A 1 514 ? 7.090   15.558  13.188  1.00 50.94  ? 514  ASN A CA  1 
ATOM   3965 C C   . ASN A 1 514 ? 5.935   15.777  14.154  1.00 52.14  ? 514  ASN A C   1 
ATOM   3966 O O   . ASN A 1 514 ? 5.616   14.875  14.927  1.00 52.76  ? 514  ASN A O   1 
ATOM   3967 C CB  . ASN A 1 514 ? 6.714   16.030  11.761  1.00 51.59  ? 514  ASN A CB  1 
ATOM   3968 C CG  . ASN A 1 514 ? 5.769   15.058  11.035  1.00 53.63  ? 514  ASN A CG  1 
ATOM   3969 O OD1 . ASN A 1 514 ? 4.704   14.707  11.541  1.00 55.40  ? 514  ASN A OD1 1 
ATOM   3970 N ND2 . ASN A 1 514 ? 6.175   14.616  9.840   1.00 55.09  ? 514  ASN A ND2 1 
ATOM   3971 N N   . LEU A 1 515 ? 5.305   16.950  14.107  1.00 53.38  ? 515  LEU A N   1 
ATOM   3972 C CA  . LEU A 1 515 ? 4.177   17.267  15.018  1.00 55.57  ? 515  LEU A CA  1 
ATOM   3973 C C   . LEU A 1 515 ? 2.963   16.348  14.857  1.00 57.29  ? 515  LEU A C   1 
ATOM   3974 O O   . LEU A 1 515 ? 2.166   16.203  15.772  1.00 58.44  ? 515  LEU A O   1 
ATOM   3975 C CB  . LEU A 1 515 ? 3.746   18.730  14.880  1.00 55.96  ? 515  LEU A CB  1 
ATOM   3976 C CG  . LEU A 1 515 ? 4.826   19.811  15.073  1.00 55.30  ? 515  LEU A CG  1 
ATOM   3977 C CD1 . LEU A 1 515 ? 4.183   21.204  15.101  1.00 55.33  ? 515  LEU A CD1 1 
ATOM   3978 C CD2 . LEU A 1 515 ? 5.661   19.575  16.333  1.00 53.08  ? 515  LEU A CD2 1 
ATOM   3979 N N   . LYS A 1 516 ? 2.838   15.725  13.688  1.00 58.06  ? 516  LYS A N   1 
ATOM   3980 C CA  . LYS A 1 516 ? 1.714   14.837  13.386  1.00 60.23  ? 516  LYS A CA  1 
ATOM   3981 C C   . LYS A 1 516 ? 1.957   13.425  13.930  1.00 59.25  ? 516  LYS A C   1 
ATOM   3982 O O   . LYS A 1 516 ? 3.099   13.038  14.149  1.00 57.87  ? 516  LYS A O   1 
ATOM   3983 C CB  . LYS A 1 516 ? 1.463   14.796  11.875  1.00 61.08  ? 516  LYS A CB  1 
ATOM   3984 C CG  . LYS A 1 516 ? 0.838   16.072  11.310  1.00 65.18  ? 516  LYS A CG  1 
ATOM   3985 C CD  . LYS A 1 516 ? 0.381   15.880  9.843   1.00 72.49  ? 516  LYS A CD  1 
ATOM   3986 C CE  . LYS A 1 516 ? 1.564   15.889  8.844   1.00 73.66  ? 516  LYS A CE  1 
ATOM   3987 N NZ  . LYS A 1 516 ? 1.082   15.760  7.428   1.00 76.38  ? 516  LYS A NZ  1 
ATOM   3988 N N   . PRO A 1 517 ? 0.881   12.657  14.168  1.00 60.35  ? 517  PRO A N   1 
ATOM   3989 C CA  . PRO A 1 517 ? 1.098   11.267  14.585  1.00 59.95  ? 517  PRO A CA  1 
ATOM   3990 C C   . PRO A 1 517 ? 1.916   10.506  13.543  1.00 58.81  ? 517  PRO A C   1 
ATOM   3991 O O   . PRO A 1 517 ? 1.839   10.824  12.351  1.00 59.08  ? 517  PRO A O   1 
ATOM   3992 C CB  . PRO A 1 517 ? -0.328  10.694  14.673  1.00 61.92  ? 517  PRO A CB  1 
ATOM   3993 C CG  . PRO A 1 517 ? -1.206  11.888  14.888  1.00 62.82  ? 517  PRO A CG  1 
ATOM   3994 C CD  . PRO A 1 517 ? -0.552  13.029  14.166  1.00 61.92  ? 517  PRO A CD  1 
ATOM   3995 N N   . LEU A 1 518 ? 2.693   9.521   14.001  1.00 57.71  ? 518  LEU A N   1 
ATOM   3996 C CA  . LEU A 1 518 ? 3.584   8.727   13.142  1.00 56.57  ? 518  LEU A CA  1 
ATOM   3997 C C   . LEU A 1 518 ? 2.981   8.311   11.803  1.00 58.05  ? 518  LEU A C   1 
ATOM   3998 O O   . LEU A 1 518 ? 1.902   7.708   11.741  1.00 60.02  ? 518  LEU A O   1 
ATOM   3999 C CB  . LEU A 1 518 ? 4.009   7.453   13.867  1.00 56.06  ? 518  LEU A CB  1 
ATOM   4000 C CG  . LEU A 1 518 ? 5.086   7.433   14.935  1.00 53.96  ? 518  LEU A CG  1 
ATOM   4001 C CD1 . LEU A 1 518 ? 5.363   5.974   15.223  1.00 55.06  ? 518  LEU A CD1 1 
ATOM   4002 C CD2 . LEU A 1 518 ? 6.358   8.115   14.510  1.00 50.52  ? 518  LEU A CD2 1 
ATOM   4003 N N   . GLU A 1 519 ? 3.686   8.611   10.729  1.00 57.39  ? 519  GLU A N   1 
ATOM   4004 C CA  . GLU A 1 519 ? 3.279   8.115   9.425   1.00 58.85  ? 519  GLU A CA  1 
ATOM   4005 C C   . GLU A 1 519 ? 4.357   7.155   8.892   1.00 57.82  ? 519  GLU A C   1 
ATOM   4006 O O   . GLU A 1 519 ? 5.576   7.444   8.960   1.00 56.01  ? 519  GLU A O   1 
ATOM   4007 C CB  . GLU A 1 519 ? 2.959   9.288   8.487   1.00 59.20  ? 519  GLU A CB  1 
ATOM   4008 C CG  . GLU A 1 519 ? 3.167   9.020   7.010   1.00 62.65  ? 519  GLU A CG  1 
ATOM   4009 C CD  . GLU A 1 519 ? 2.762   10.201  6.133   1.00 66.57  ? 519  GLU A CD  1 
ATOM   4010 O OE1 . GLU A 1 519 ? 1.541   10.489  6.104   1.00 70.40  ? 519  GLU A OE1 1 
ATOM   4011 O OE2 . GLU A 1 519 ? 3.646   10.818  5.467   1.00 64.14  ? 519  GLU A OE2 1 
ATOM   4012 N N   . VAL A 1 520 ? 3.906   5.996   8.417   1.00 58.53  ? 520  VAL A N   1 
ATOM   4013 C CA  . VAL A 1 520 ? 4.803   4.965   7.907   1.00 57.74  ? 520  VAL A CA  1 
ATOM   4014 C C   . VAL A 1 520 ? 5.067   5.208   6.426   1.00 58.02  ? 520  VAL A C   1 
ATOM   4015 O O   . VAL A 1 520 ? 4.126   5.318   5.622   1.00 59.53  ? 520  VAL A O   1 
ATOM   4016 C CB  . VAL A 1 520 ? 4.206   3.553   8.101   1.00 59.51  ? 520  VAL A CB  1 
ATOM   4017 C CG1 . VAL A 1 520 ? 5.125   2.481   7.519   1.00 59.00  ? 520  VAL A CG1 1 
ATOM   4018 C CG2 . VAL A 1 520 ? 3.925   3.285   9.585   1.00 58.88  ? 520  VAL A CG2 1 
ATOM   4019 N N   . ARG A 1 521 ? 6.346   5.300   6.072   1.00 56.43  ? 521  ARG A N   1 
ATOM   4020 C CA  . ARG A 1 521 ? 6.757   5.480   4.682   1.00 56.71  ? 521  ARG A CA  1 
ATOM   4021 C C   . ARG A 1 521 ? 7.604   4.301   4.231   1.00 57.23  ? 521  ARG A C   1 
ATOM   4022 O O   . ARG A 1 521 ? 8.063   3.521   5.072   1.00 56.92  ? 521  ARG A O   1 
ATOM   4023 C CB  . ARG A 1 521 ? 7.497   6.806   4.503   1.00 55.12  ? 521  ARG A CB  1 
ATOM   4024 C CG  . ARG A 1 521 ? 6.605   8.011   4.772   1.00 54.75  ? 521  ARG A CG  1 
ATOM   4025 C CD  . ARG A 1 521 ? 7.305   9.294   4.496   1.00 52.71  ? 521  ARG A CD  1 
ATOM   4026 N NE  . ARG A 1 521 ? 6.603   10.422  5.103   1.00 52.85  ? 521  ARG A NE  1 
ATOM   4027 C CZ  . ARG A 1 521 ? 7.190   11.575  5.428   1.00 50.46  ? 521  ARG A CZ  1 
ATOM   4028 N NH1 . ARG A 1 521 ? 8.486   11.751  5.226   1.00 48.21  ? 521  ARG A NH1 1 
ATOM   4029 N NH2 . ARG A 1 521 ? 6.490   12.551  5.974   1.00 50.19  ? 521  ARG A NH2 1 
ATOM   4030 N N   . ARG A 1 522 ? 7.787   4.170   2.915   1.00 58.10  ? 522  ARG A N   1 
ATOM   4031 C CA  . ARG A 1 522 ? 8.507   3.040   2.317   1.00 59.24  ? 522  ARG A CA  1 
ATOM   4032 C C   . ARG A 1 522 ? 9.681   3.504   1.439   1.00 58.63  ? 522  ARG A C   1 
ATOM   4033 O O   . ARG A 1 522 ? 9.525   4.375   0.564   1.00 58.39  ? 522  ARG A O   1 
ATOM   4034 C CB  . ARG A 1 522 ? 7.538   2.155   1.514   1.00 61.55  ? 522  ARG A CB  1 
ATOM   4035 C CG  . ARG A 1 522 ? 6.929   0.986   2.310   1.00 64.61  ? 522  ARG A CG  1 
ATOM   4036 C CD  . ARG A 1 522 ? 5.514   0.543   1.845   1.00 70.99  ? 522  ARG A CD  1 
ATOM   4037 N NE  . ARG A 1 522 ? 4.464   1.199   2.647   1.00 75.26  ? 522  ARG A NE  1 
ATOM   4038 C CZ  . ARG A 1 522 ? 4.004   0.778   3.843   1.00 77.00  ? 522  ARG A CZ  1 
ATOM   4039 N NH1 . ARG A 1 522 ? 4.462   -0.332  4.418   1.00 77.00  ? 522  ARG A NH1 1 
ATOM   4040 N NH2 . ARG A 1 522 ? 3.064   1.474   4.481   1.00 77.11  ? 522  ARG A NH2 1 
ATOM   4041 N N   . GLY A 1 523 ? 10.856  2.924   1.680   1.00 58.26  ? 523  GLY A N   1 
ATOM   4042 C CA  . GLY A 1 523 ? 12.063  3.257   0.915   1.00 58.10  ? 523  GLY A CA  1 
ATOM   4043 C C   . GLY A 1 523 ? 12.657  4.611   1.246   1.00 57.31  ? 523  GLY A C   1 
ATOM   4044 O O   . GLY A 1 523 ? 12.065  5.650   0.958   1.00 57.85  ? 523  GLY A O   1 
ATOM   4045 N N   . LEU A 1 524 ? 13.841  4.572   1.853   1.00 57.00  ? 524  LEU A N   1 
ATOM   4046 C CA  . LEU A 1 524 ? 14.613  5.727   2.305   1.00 56.52  ? 524  LEU A CA  1 
ATOM   4047 C C   . LEU A 1 524 ? 15.828  5.611   1.382   1.00 56.65  ? 524  LEU A C   1 
ATOM   4048 O O   . LEU A 1 524 ? 17.046  5.887   1.822   1.00 57.16  ? 524  LEU A O   1 
ATOM   4049 C CB  . LEU A 1 524 ? 14.956  5.434   3.758   1.00 56.16  ? 524  LEU A CB  1 
ATOM   4050 C CG  . LEU A 1 524 ? 15.425  6.515   4.719   1.00 57.09  ? 524  LEU A CG  1 
ATOM   4051 C CD1 . LEU A 1 524 ? 16.914  6.222   4.978   1.00 58.78  ? 524  LEU A CD1 1 
ATOM   4052 C CD2 . LEU A 1 524 ? 15.169  7.987   4.238   1.00 56.21  ? 524  LEU A CD2 1 
ATOM   4053 N N   . ARG A 1 525 ? 15.596  5.737   0.103   1.00 57.82  ? 525  ARG A N   1 
ATOM   4054 C CA  . ARG A 1 525 ? 14.923  6.897   -0.426  1.00 57.51  ? 525  ARG A CA  1 
ATOM   4055 C C   . ARG A 1 525 ? 15.553  6.356   -1.686  1.00 57.42  ? 525  ARG A C   1 
ATOM   4056 O O   . ARG A 1 525 ? 16.625  6.776   -2.117  1.00 56.16  ? 525  ARG A O   1 
ATOM   4057 C CB  . ARG A 1 525 ? 15.606  8.176   0.041   1.00 56.21  ? 525  ARG A CB  1 
ATOM   4058 C CG  . ARG A 1 525 ? 15.677  9.272   -1.041  1.00 59.15  ? 525  ARG A CG  1 
ATOM   4059 C CD  . ARG A 1 525 ? 16.507  10.522  -0.650  1.00 58.83  ? 525  ARG A CD  1 
ATOM   4060 N NE  . ARG A 1 525 ? 15.769  11.400  0.266   1.00 62.31  ? 525  ARG A NE  1 
ATOM   4061 C CZ  . ARG A 1 525 ? 16.170  12.609  0.688   1.00 63.44  ? 525  ARG A CZ  1 
ATOM   4062 N NH1 . ARG A 1 525 ? 17.309  13.139  0.269   1.00 62.58  ? 525  ARG A NH1 1 
ATOM   4063 N NH2 . ARG A 1 525 ? 15.426  13.305  1.548   1.00 64.26  ? 525  ARG A NH2 1 
ATOM   4064 N N   . ALA A 1 526 ? 14.894  5.308   -2.177  1.00 58.14  ? 526  ALA A N   1 
ATOM   4065 C CA  . ALA A 1 526 ? 15.568  4.170   -2.762  1.00 58.38  ? 526  ALA A CA  1 
ATOM   4066 C C   . ALA A 1 526 ? 16.235  4.491   -4.073  1.00 58.36  ? 526  ALA A C   1 
ATOM   4067 O O   . ALA A 1 526 ? 17.382  4.085   -4.288  1.00 57.99  ? 526  ALA A O   1 
ATOM   4068 C CB  . ALA A 1 526 ? 14.598  3.005   -2.917  1.00 60.09  ? 526  ALA A CB  1 
ATOM   4069 N N   . GLN A 1 527 ? 15.534  5.234   -4.931  1.00 58.20  ? 527  GLN A N   1 
ATOM   4070 C CA  . GLN A 1 527 ? 16.041  5.477   -6.270  1.00 58.61  ? 527  GLN A CA  1 
ATOM   4071 C C   . GLN A 1 527 ? 17.409  6.140   -6.213  1.00 56.48  ? 527  GLN A C   1 
ATOM   4072 O O   . GLN A 1 527 ? 18.373  5.616   -6.754  1.00 57.07  ? 527  GLN A O   1 
ATOM   4073 C CB  . GLN A 1 527 ? 15.034  6.256   -7.121  1.00 59.49  ? 527  GLN A CB  1 
ATOM   4074 C CG  . GLN A 1 527 ? 14.937  5.770   -8.566  1.00 63.05  ? 527  GLN A CG  1 
ATOM   4075 C CD  . GLN A 1 527 ? 14.625  4.254   -8.734  1.00 67.31  ? 527  GLN A CD  1 
ATOM   4076 O OE1 . GLN A 1 527 ? 13.924  3.638   -7.923  1.00 68.29  ? 527  GLN A OE1 1 
ATOM   4077 N NE2 . GLN A 1 527 ? 15.137  3.668   -9.819  1.00 68.76  ? 527  GLN A NE2 1 
ATOM   4078 N N   . THR A 1 528 ? 17.492  7.263   -5.512  1.00 54.64  ? 528  THR A N   1 
ATOM   4079 C CA  . THR A 1 528 ? 18.735  8.007   -5.345  1.00 52.70  ? 528  THR A CA  1 
ATOM   4080 C C   . THR A 1 528 ? 19.850  7.240   -4.625  1.00 51.76  ? 528  THR A C   1 
ATOM   4081 O O   . THR A 1 528 ? 21.013  7.350   -5.001  1.00 51.53  ? 528  THR A O   1 
ATOM   4082 C CB  . THR A 1 528 ? 18.463  9.355   -4.644  1.00 51.66  ? 528  THR A CB  1 
ATOM   4083 O OG1 . THR A 1 528 ? 17.738  10.200  -5.537  1.00 52.17  ? 528  THR A OG1 1 
ATOM   4084 C CG2 . THR A 1 528 ? 19.753  10.069  -4.276  1.00 50.48  ? 528  THR A CG2 1 
ATOM   4085 N N   . CYS A 1 529 ? 19.524  6.468   -3.592  1.00 51.28  ? 529  CYS A N   1 
ATOM   4086 C CA  . CYS A 1 529 ? 20.599  5.775   -2.874  1.00 50.09  ? 529  CYS A CA  1 
ATOM   4087 C C   . CYS A 1 529 ? 21.168  4.613   -3.682  1.00 50.82  ? 529  CYS A C   1 
ATOM   4088 O O   . CYS A 1 529 ? 22.360  4.290   -3.558  1.00 50.70  ? 529  CYS A O   1 
ATOM   4089 C CB  . CYS A 1 529 ? 20.210  5.398   -1.450  1.00 49.22  ? 529  CYS A CB  1 
ATOM   4090 S SG  . CYS A 1 529 ? 20.014  6.899   -0.379  1.00 48.74  ? 529  CYS A SG  1 
ATOM   4091 N N   . ALA A 1 530 ? 20.350  4.037   -4.557  1.00 51.18  ? 530  ALA A N   1 
ATOM   4092 C CA  . ALA A 1 530 ? 20.867  3.078   -5.521  1.00 52.16  ? 530  ALA A CA  1 
ATOM   4093 C C   . ALA A 1 530 ? 21.930  3.739   -6.397  1.00 52.03  ? 530  ALA A C   1 
ATOM   4094 O O   . ALA A 1 530 ? 22.913  3.101   -6.747  1.00 52.72  ? 530  ALA A O   1 
ATOM   4095 C CB  . ALA A 1 530 ? 19.763  2.503   -6.367  1.00 53.22  ? 530  ALA A CB  1 
ATOM   4096 N N   . PHE A 1 531 ? 21.744  5.014   -6.743  1.00 51.13  ? 531  PHE A N   1 
ATOM   4097 C CA  . PHE A 1 531 ? 22.772  5.736   -7.473  1.00 50.59  ? 531  PHE A CA  1 
ATOM   4098 C C   . PHE A 1 531 ? 24.078  5.801   -6.680  1.00 49.99  ? 531  PHE A C   1 
ATOM   4099 O O   . PHE A 1 531 ? 25.144  5.522   -7.234  1.00 50.31  ? 531  PHE A O   1 
ATOM   4100 C CB  . PHE A 1 531 ? 22.302  7.141   -7.869  1.00 50.22  ? 531  PHE A CB  1 
ATOM   4101 C CG  . PHE A 1 531 ? 23.387  8.001   -8.456  1.00 49.42  ? 531  PHE A CG  1 
ATOM   4102 C CD1 . PHE A 1 531 ? 23.760  7.861   -9.793  1.00 50.64  ? 531  PHE A CD1 1 
ATOM   4103 C CD2 . PHE A 1 531 ? 24.043  8.941   -7.673  1.00 47.43  ? 531  PHE A CD2 1 
ATOM   4104 C CE1 . PHE A 1 531 ? 24.769  8.630   -10.339 1.00 49.24  ? 531  PHE A CE1 1 
ATOM   4105 C CE2 . PHE A 1 531 ? 25.058  9.726   -8.213  1.00 47.69  ? 531  PHE A CE2 1 
ATOM   4106 C CZ  . PHE A 1 531 ? 25.419  9.566   -9.544  1.00 49.31  ? 531  PHE A CZ  1 
ATOM   4107 N N   . TRP A 1 532 ? 24.004  6.159   -5.396  1.00 49.16  ? 532  TRP A N   1 
ATOM   4108 C CA  . TRP A 1 532 ? 25.232  6.368   -4.586  1.00 48.66  ? 532  TRP A CA  1 
ATOM   4109 C C   . TRP A 1 532 ? 25.874  5.075   -4.098  1.00 49.97  ? 532  TRP A C   1 
ATOM   4110 O O   . TRP A 1 532 ? 27.094  4.951   -4.096  1.00 50.09  ? 532  TRP A O   1 
ATOM   4111 C CB  . TRP A 1 532 ? 24.979  7.259   -3.375  1.00 46.19  ? 532  TRP A CB  1 
ATOM   4112 C CG  . TRP A 1 532 ? 24.646  8.665   -3.696  1.00 44.77  ? 532  TRP A CG  1 
ATOM   4113 C CD1 . TRP A 1 532 ? 23.393  9.243   -3.714  1.00 43.51  ? 532  TRP A CD1 1 
ATOM   4114 C CD2 . TRP A 1 532 ? 25.568  9.707   -4.007  1.00 43.00  ? 532  TRP A CD2 1 
ATOM   4115 N NE1 . TRP A 1 532 ? 23.485  10.573  -4.031  1.00 40.83  ? 532  TRP A NE1 1 
ATOM   4116 C CE2 . TRP A 1 532 ? 24.808  10.888  -4.221  1.00 42.42  ? 532  TRP A CE2 1 
ATOM   4117 C CE3 . TRP A 1 532 ? 26.966  9.765   -4.128  1.00 42.47  ? 532  TRP A CE3 1 
ATOM   4118 C CZ2 . TRP A 1 532 ? 25.404  12.110  -4.564  1.00 42.04  ? 532  TRP A CZ2 1 
ATOM   4119 C CZ3 . TRP A 1 532 ? 27.564  10.991  -4.469  1.00 42.04  ? 532  TRP A CZ3 1 
ATOM   4120 C CH2 . TRP A 1 532 ? 26.779  12.142  -4.677  1.00 43.22  ? 532  TRP A CH2 1 
ATOM   4121 N N   . ASN A 1 533 ? 25.049  4.114   -3.686  1.00 51.69  ? 533  ASN A N   1 
ATOM   4122 C CA  . ASN A 1 533 ? 25.556  2.881   -3.078  1.00 52.88  ? 533  ASN A CA  1 
ATOM   4123 C C   . ASN A 1 533 ? 25.815  1.755   -4.064  1.00 55.03  ? 533  ASN A C   1 
ATOM   4124 O O   . ASN A 1 533 ? 26.605  0.866   -3.778  1.00 55.71  ? 533  ASN A O   1 
ATOM   4125 C CB  . ASN A 1 533 ? 24.626  2.401   -1.964  1.00 52.40  ? 533  ASN A CB  1 
ATOM   4126 C CG  . ASN A 1 533 ? 24.393  3.460   -0.906  1.00 51.53  ? 533  ASN A CG  1 
ATOM   4127 O OD1 . ASN A 1 533 ? 25.251  4.310   -0.664  1.00 50.72  ? 533  ASN A OD1 1 
ATOM   4128 N ND2 . ASN A 1 533 ? 23.229  3.409   -0.256  1.00 52.31  ? 533  ASN A ND2 1 
ATOM   4129 N N   . ARG A 1 534 ? 25.163  1.799   -5.222  1.00 56.86  ? 534  ARG A N   1 
ATOM   4130 C CA  . ARG A 1 534 ? 25.257  0.705   -6.186  1.00 59.48  ? 534  ARG A CA  1 
ATOM   4131 C C   . ARG A 1 534 ? 25.974  1.126   -7.440  1.00 60.78  ? 534  ARG A C   1 
ATOM   4132 O O   . ARG A 1 534 ? 26.878  0.423   -7.894  1.00 62.21  ? 534  ARG A O   1 
ATOM   4133 C CB  . ARG A 1 534 ? 23.882  0.155   -6.545  1.00 60.20  ? 534  ARG A CB  1 
ATOM   4134 C CG  . ARG A 1 534 ? 23.305  -0.781  -5.522  1.00 61.46  ? 534  ARG A CG  1 
ATOM   4135 C CD  . ARG A 1 534 ? 21.800  -0.941  -5.714  1.00 63.18  ? 534  ARG A CD  1 
ATOM   4136 N NE  . ARG A 1 534 ? 21.134  -1.502  -4.528  1.00 66.05  ? 534  ARG A NE  1 
ATOM   4137 C CZ  . ARG A 1 534 ? 21.106  -2.803  -4.201  1.00 67.28  ? 534  ARG A CZ  1 
ATOM   4138 N NH1 . ARG A 1 534 ? 21.725  -3.704  -4.960  1.00 66.26  ? 534  ARG A NH1 1 
ATOM   4139 N NH2 . ARG A 1 534 ? 20.459  -3.204  -3.105  1.00 66.19  ? 534  ARG A NH2 1 
ATOM   4140 N N   . PHE A 1 535 ? 25.578  2.265   -8.012  1.00 60.94  ? 535  PHE A N   1 
ATOM   4141 C CA  . PHE A 1 535 ? 26.186  2.689   -9.265  1.00 61.82  ? 535  PHE A CA  1 
ATOM   4142 C C   . PHE A 1 535 ? 27.508  3.396   -9.056  1.00 61.96  ? 535  PHE A C   1 
ATOM   4143 O O   . PHE A 1 535 ? 28.515  2.977   -9.599  1.00 62.79  ? 535  PHE A O   1 
ATOM   4144 C CB  . PHE A 1 535 ? 25.254  3.526   -10.147 1.00 61.36  ? 535  PHE A CB  1 
ATOM   4145 C CG  . PHE A 1 535 ? 25.905  3.982   -11.412 1.00 59.87  ? 535  PHE A CG  1 
ATOM   4146 C CD1 . PHE A 1 535 ? 26.207  3.068   -12.419 1.00 59.70  ? 535  PHE A CD1 1 
ATOM   4147 C CD2 . PHE A 1 535 ? 26.271  5.312   -11.580 1.00 58.07  ? 535  PHE A CD2 1 
ATOM   4148 C CE1 . PHE A 1 535 ? 26.841  3.469   -13.579 1.00 58.78  ? 535  PHE A CE1 1 
ATOM   4149 C CE2 . PHE A 1 535 ? 26.913  5.732   -12.743 1.00 57.67  ? 535  PHE A CE2 1 
ATOM   4150 C CZ  . PHE A 1 535 ? 27.191  4.805   -13.746 1.00 58.94  ? 535  PHE A CZ  1 
ATOM   4151 N N   . LEU A 1 536 ? 27.508  4.462   -8.271  1.00 62.10  ? 536  LEU A N   1 
ATOM   4152 C CA  . LEU A 1 536 ? 28.696  5.296   -8.156  1.00 63.28  ? 536  LEU A CA  1 
ATOM   4153 C C   . LEU A 1 536 ? 30.006  4.579   -7.802  1.00 65.41  ? 536  LEU A C   1 
ATOM   4154 O O   . LEU A 1 536 ? 31.031  4.873   -8.424  1.00 65.32  ? 536  LEU A O   1 
ATOM   4155 C CB  . LEU A 1 536 ? 28.471  6.450   -7.202  1.00 61.65  ? 536  LEU A CB  1 
ATOM   4156 C CG  . LEU A 1 536 ? 29.310  7.618   -7.685  1.00 62.03  ? 536  LEU A CG  1 
ATOM   4157 C CD1 . LEU A 1 536 ? 28.748  8.108   -9.031  1.00 62.42  ? 536  LEU A CD1 1 
ATOM   4158 C CD2 . LEU A 1 536 ? 29.368  8.724   -6.644  1.00 60.48  ? 536  LEU A CD2 1 
ATOM   4159 N N   . PRO A 1 537 ? 29.987  3.643   -6.813  1.00 67.42  ? 537  PRO A N   1 
ATOM   4160 C CA  . PRO A 1 537 ? 31.234  2.933   -6.528  1.00 69.39  ? 537  PRO A CA  1 
ATOM   4161 C C   . PRO A 1 537 ? 31.739  2.290   -7.797  1.00 72.75  ? 537  PRO A C   1 
ATOM   4162 O O   . PRO A 1 537 ? 32.878  2.556   -8.215  1.00 73.46  ? 537  PRO A O   1 
ATOM   4163 C CB  . PRO A 1 537 ? 30.809  1.853   -5.526  1.00 69.30  ? 537  PRO A CB  1 
ATOM   4164 C CG  . PRO A 1 537 ? 29.619  2.404   -4.873  1.00 67.79  ? 537  PRO A CG  1 
ATOM   4165 C CD  . PRO A 1 537 ? 28.891  3.158   -5.952  1.00 67.20  ? 537  PRO A CD  1 
ATOM   4166 N N   . LYS A 1 538 ? 30.867  1.488   -8.415  1.00 75.98  ? 538  LYS A N   1 
ATOM   4167 C CA  . LYS A 1 538 ? 31.152  0.784   -9.669  1.00 79.76  ? 538  LYS A CA  1 
ATOM   4168 C C   . LYS A 1 538 ? 31.638  1.701   -10.773 1.00 81.27  ? 538  LYS A C   1 
ATOM   4169 O O   . LYS A 1 538 ? 32.191  1.206   -11.741 1.00 82.76  ? 538  LYS A O   1 
ATOM   4170 C CB  . LYS A 1 538 ? 29.930  0.004   -10.175 1.00 80.84  ? 538  LYS A CB  1 
ATOM   4171 C CG  . LYS A 1 538 ? 29.856  -1.462  -9.739  1.00 83.07  ? 538  LYS A CG  1 
ATOM   4172 C CD  . LYS A 1 538 ? 28.673  -2.171  -10.418 1.00 85.93  ? 538  LYS A CD  1 
ATOM   4173 C CE  . LYS A 1 538 ? 28.883  -3.684  -10.540 1.00 89.57  ? 538  LYS A CE  1 
ATOM   4174 N NZ  . LYS A 1 538 ? 28.869  -4.389  -9.220  1.00 89.10  ? 538  LYS A NZ  1 
ATOM   4175 N N   . LEU A 1 539 ? 31.436  3.017   -10.644 1.00 82.04  ? 539  LEU A N   1 
ATOM   4176 C CA  . LEU A 1 539 ? 31.923  3.948   -11.674 1.00 84.27  ? 539  LEU A CA  1 
ATOM   4177 C C   . LEU A 1 539 ? 33.427  3.720   -11.878 1.00 86.58  ? 539  LEU A C   1 
ATOM   4178 O O   . LEU A 1 539 ? 33.743  2.751   -12.551 1.00 88.79  ? 539  LEU A O   1 
ATOM   4179 C CB  . LEU A 1 539 ? 31.471  5.406   -11.491 1.00 82.60  ? 539  LEU A CB  1 
ATOM   4180 C CG  . LEU A 1 539 ? 31.466  6.324   -12.723 1.00 81.97  ? 539  LEU A CG  1 
ATOM   4181 C CD1 . LEU A 1 539 ? 31.448  5.560   -14.036 1.00 82.18  ? 539  LEU A CD1 1 
ATOM   4182 C CD2 . LEU A 1 539 ? 30.310  7.320   -12.664 1.00 79.49  ? 539  LEU A CD2 1 
ATOM   4183 N N   . LEU A 1 540 ? 34.401  4.487   -11.372 1.00 87.65  ? 540  LEU A N   1 
ATOM   4184 C CA  . LEU A 1 540 ? 34.445  5.709   -10.553 1.00 87.56  ? 540  LEU A CA  1 
ATOM   4185 C C   . LEU A 1 540 ? 35.945  6.130   -10.582 1.00 88.72  ? 540  LEU A C   1 
ATOM   4186 O O   . LEU A 1 540 ? 36.202  7.324   -10.784 1.00 88.62  ? 540  LEU A O   1 
ATOM   4187 C CB  . LEU A 1 540 ? 33.933  5.567   -9.095  1.00 86.29  ? 540  LEU A CB  1 
ATOM   4188 C CG  . LEU A 1 540 ? 34.293  6.600   -7.969  1.00 85.76  ? 540  LEU A CG  1 
ATOM   4189 C CD1 . LEU A 1 540 ? 34.436  8.070   -8.417  1.00 85.40  ? 540  LEU A CD1 1 
ATOM   4190 C CD2 . LEU A 1 540 ? 33.358  6.568   -6.725  1.00 84.78  ? 540  LEU A CD2 1 
ATOM   4191 N N   . SER A 1 541 ? 36.955  5.229   -10.441 1.00 90.44  ? 541  SER A N   1 
ATOM   4192 C CA  . SER A 1 541 ? 36.972  3.704   -10.436 1.00 91.85  ? 541  SER A CA  1 
ATOM   4193 C C   . SER A 1 541 ? 36.752  2.999   -11.801 1.00 93.70  ? 541  SER A C   1 
ATOM   4194 O O   . SER A 1 541 ? 37.209  1.873   -12.032 1.00 94.95  ? 541  SER A O   1 
ATOM   4195 C CB  . SER A 1 541 ? 36.129  3.053   -9.311  1.00 91.15  ? 541  SER A CB  1 
ATOM   4196 O OG  . SER A 1 541 ? 36.121  1.633   -9.443  1.00 91.99  ? 541  SER A OG  1 
ATOM   4197 N N   . GLU B 1 4   ? -17.071 5.140   -69.787 1.00 91.55  ? 4    GLU B N   1 
ATOM   4198 C CA  . GLU B 1 4   ? -15.861 5.763   -69.171 1.00 89.42  ? 4    GLU B CA  1 
ATOM   4199 C C   . GLU B 1 4   ? -16.222 6.998   -68.303 1.00 89.04  ? 4    GLU B C   1 
ATOM   4200 O O   . GLU B 1 4   ? -16.902 7.918   -68.773 1.00 90.83  ? 4    GLU B O   1 
ATOM   4201 C CB  . GLU B 1 4   ? -14.852 6.130   -70.272 1.00 89.12  ? 4    GLU B CB  1 
ATOM   4202 C CG  . GLU B 1 4   ? -13.508 6.681   -69.762 1.00 87.59  ? 4    GLU B CG  1 
ATOM   4203 C CD  . GLU B 1 4   ? -12.335 5.701   -69.899 1.00 86.37  ? 4    GLU B CD  1 
ATOM   4204 O OE1 . GLU B 1 4   ? -12.152 5.134   -70.999 1.00 86.54  ? 4    GLU B OE1 1 
ATOM   4205 O OE2 . GLU B 1 4   ? -11.579 5.524   -68.911 1.00 84.11  ? 4    GLU B OE2 1 
ATOM   4206 N N   . ASP B 1 5   ? -15.761 7.008   -67.048 1.00 86.65  ? 5    ASP B N   1 
ATOM   4207 C CA  . ASP B 1 5   ? -16.025 8.107   -66.094 1.00 85.84  ? 5    ASP B CA  1 
ATOM   4208 C C   . ASP B 1 5   ? -14.934 9.194   -66.191 1.00 84.21  ? 5    ASP B C   1 
ATOM   4209 O O   . ASP B 1 5   ? -13.792 8.940   -65.809 1.00 82.35  ? 5    ASP B O   1 
ATOM   4210 C CB  . ASP B 1 5   ? -16.112 7.541   -64.657 1.00 84.50  ? 5    ASP B CB  1 
ATOM   4211 C CG  . ASP B 1 5   ? -16.582 8.567   -63.610 1.00 83.94  ? 5    ASP B CG  1 
ATOM   4212 O OD1 . ASP B 1 5   ? -16.513 9.795   -63.848 1.00 84.41  ? 5    ASP B OD1 1 
ATOM   4213 O OD2 . ASP B 1 5   ? -17.024 8.128   -62.522 1.00 81.88  ? 5    ASP B OD2 1 
ATOM   4214 N N   . PRO B 1 6   ? -15.282 10.402  -66.705 1.00 85.20  ? 6    PRO B N   1 
ATOM   4215 C CA  . PRO B 1 6   ? -14.306 11.488  -66.930 1.00 83.92  ? 6    PRO B CA  1 
ATOM   4216 C C   . PRO B 1 6   ? -13.525 11.884  -65.691 1.00 81.51  ? 6    PRO B C   1 
ATOM   4217 O O   . PRO B 1 6   ? -12.383 12.320  -65.813 1.00 80.56  ? 6    PRO B O   1 
ATOM   4218 C CB  . PRO B 1 6   ? -15.165 12.672  -67.402 1.00 86.31  ? 6    PRO B CB  1 
ATOM   4219 C CG  . PRO B 1 6   ? -16.601 12.276  -67.134 1.00 88.50  ? 6    PRO B CG  1 
ATOM   4220 C CD  . PRO B 1 6   ? -16.626 10.775  -67.187 1.00 87.96  ? 6    PRO B CD  1 
ATOM   4221 N N   . GLN B 1 7   ? -14.129 11.725  -64.514 1.00 80.44  ? 7    GLN B N   1 
ATOM   4222 C CA  . GLN B 1 7   ? -13.441 11.984  -63.249 1.00 77.75  ? 7    GLN B CA  1 
ATOM   4223 C C   . GLN B 1 7   ? -12.290 11.017  -62.989 1.00 74.89  ? 7    GLN B C   1 
ATOM   4224 O O   . GLN B 1 7   ? -11.384 11.323  -62.203 1.00 73.29  ? 7    GLN B O   1 
ATOM   4225 C CB  . GLN B 1 7   ? -14.423 11.918  -62.076 1.00 78.56  ? 7    GLN B CB  1 
ATOM   4226 C CG  . GLN B 1 7   ? -15.384 13.109  -61.967 1.00 81.15  ? 7    GLN B CG  1 
ATOM   4227 C CD  . GLN B 1 7   ? -14.681 14.439  -61.727 1.00 82.08  ? 7    GLN B CD  1 
ATOM   4228 O OE1 . GLN B 1 7   ? -13.550 14.493  -61.224 1.00 81.28  ? 7    GLN B OE1 1 
ATOM   4229 N NE2 . GLN B 1 7   ? -15.355 15.525  -62.085 1.00 83.78  ? 7    GLN B NE2 1 
ATOM   4230 N N   . LEU B 1 8   ? -12.334 9.860   -63.651 1.00 73.78  ? 8    LEU B N   1 
ATOM   4231 C CA  . LEU B 1 8   ? -11.371 8.791   -63.426 1.00 71.12  ? 8    LEU B CA  1 
ATOM   4232 C C   . LEU B 1 8   ? -10.300 8.713   -64.510 1.00 70.30  ? 8    LEU B C   1 
ATOM   4233 O O   . LEU B 1 8   ? -9.482  7.794   -64.524 1.00 69.30  ? 8    LEU B O   1 
ATOM   4234 C CB  . LEU B 1 8   ? -12.085 7.445   -63.303 1.00 71.45  ? 8    LEU B CB  1 
ATOM   4235 C CG  . LEU B 1 8   ? -13.054 7.231   -62.136 1.00 71.19  ? 8    LEU B CG  1 
ATOM   4236 C CD1 . LEU B 1 8   ? -13.800 5.889   -62.281 1.00 70.52  ? 8    LEU B CD1 1 
ATOM   4237 C CD2 . LEU B 1 8   ? -12.327 7.322   -60.795 1.00 66.79  ? 8    LEU B CD2 1 
ATOM   4238 N N   . LEU B 1 9   ? -10.311 9.677   -65.419 1.00 70.55  ? 9    LEU B N   1 
ATOM   4239 C CA  . LEU B 1 9   ? -9.281  9.772   -66.442 1.00 69.53  ? 9    LEU B CA  1 
ATOM   4240 C C   . LEU B 1 9   ? -8.353  10.937  -66.141 1.00 67.90  ? 9    LEU B C   1 
ATOM   4241 O O   . LEU B 1 9   ? -8.814  12.068  -66.026 1.00 68.91  ? 9    LEU B O   1 
ATOM   4242 C CB  . LEU B 1 9   ? -9.922  9.977   -67.816 1.00 71.54  ? 9    LEU B CB  1 
ATOM   4243 C CG  . LEU B 1 9   ? -10.113 8.742   -68.690 1.00 72.47  ? 9    LEU B CG  1 
ATOM   4244 C CD1 . LEU B 1 9   ? -10.912 9.140   -69.922 1.00 74.68  ? 9    LEU B CD1 1 
ATOM   4245 C CD2 . LEU B 1 9   ? -8.748  8.143   -69.072 1.00 70.59  ? 9    LEU B CD2 1 
ATOM   4246 N N   . VAL B 1 10  ? -7.057  10.666  -66.021 1.00 65.18  ? 10   VAL B N   1 
ATOM   4247 C CA  . VAL B 1 10  ? -6.087  11.718  -65.758 1.00 63.84  ? 10   VAL B CA  1 
ATOM   4248 C C   . VAL B 1 10  ? -4.926  11.641  -66.735 1.00 63.73  ? 10   VAL B C   1 
ATOM   4249 O O   . VAL B 1 10  ? -4.466  10.553  -67.076 1.00 63.28  ? 10   VAL B O   1 
ATOM   4250 C CB  . VAL B 1 10  ? -5.535  11.636  -64.312 1.00 62.14  ? 10   VAL B CB  1 
ATOM   4251 C CG1 . VAL B 1 10  ? -4.590  12.779  -64.017 1.00 60.68  ? 10   VAL B CG1 1 
ATOM   4252 C CG2 . VAL B 1 10  ? -6.665  11.668  -63.312 1.00 62.88  ? 10   VAL B CG2 1 
ATOM   4253 N N   . ARG B 1 11  ? -4.452  12.801  -67.180 1.00 64.14  ? 11   ARG B N   1 
ATOM   4254 C CA  . ARG B 1 11  ? -3.222  12.870  -67.953 1.00 64.11  ? 11   ARG B CA  1 
ATOM   4255 C C   . ARG B 1 11  ? -2.060  13.399  -67.103 1.00 62.15  ? 11   ARG B C   1 
ATOM   4256 O O   . ARG B 1 11  ? -2.075  14.520  -66.612 1.00 62.21  ? 11   ARG B O   1 
ATOM   4257 C CB  . ARG B 1 11  ? -3.423  13.680  -69.247 1.00 66.62  ? 11   ARG B CB  1 
ATOM   4258 C CG  . ARG B 1 11  ? -2.131  14.139  -69.935 1.00 69.08  ? 11   ARG B CG  1 
ATOM   4259 C CD  . ARG B 1 11  ? -2.318  14.389  -71.436 1.00 75.86  ? 11   ARG B CD  1 
ATOM   4260 N NE  . ARG B 1 11  ? -1.966  13.189  -72.207 1.00 80.30  ? 11   ARG B NE  1 
ATOM   4261 C CZ  . ARG B 1 11  ? -2.698  12.656  -73.187 1.00 83.03  ? 11   ARG B CZ  1 
ATOM   4262 N NH1 . ARG B 1 11  ? -3.848  13.218  -73.569 1.00 85.44  ? 11   ARG B NH1 1 
ATOM   4263 N NH2 . ARG B 1 11  ? -2.265  11.558  -73.800 1.00 82.61  ? 11   ARG B NH2 1 
ATOM   4264 N N   . VAL B 1 12  ? -1.057  12.554  -66.940 1.00 60.67  ? 12   VAL B N   1 
ATOM   4265 C CA  . VAL B 1 12  ? 0.170   12.892  -66.250 1.00 58.92  ? 12   VAL B CA  1 
ATOM   4266 C C   . VAL B 1 12  ? 1.280   13.003  -67.311 1.00 59.59  ? 12   VAL B C   1 
ATOM   4267 O O   . VAL B 1 12  ? 1.055   12.626  -68.460 1.00 60.19  ? 12   VAL B O   1 
ATOM   4268 C CB  . VAL B 1 12  ? 0.498   11.817  -65.183 1.00 57.26  ? 12   VAL B CB  1 
ATOM   4269 C CG1 . VAL B 1 12  ? -0.601  11.758  -64.116 1.00 56.57  ? 12   VAL B CG1 1 
ATOM   4270 C CG2 . VAL B 1 12  ? 0.684   10.438  -65.819 1.00 56.74  ? 12   VAL B CG2 1 
ATOM   4271 N N   . ARG B 1 13  ? 2.460   13.502  -66.933 1.00 59.10  ? 13   ARG B N   1 
ATOM   4272 C CA  . ARG B 1 13  ? 3.581   13.682  -67.871 1.00 60.28  ? 13   ARG B CA  1 
ATOM   4273 C C   . ARG B 1 13  ? 3.848   12.460  -68.742 1.00 59.52  ? 13   ARG B C   1 
ATOM   4274 O O   . ARG B 1 13  ? 4.164   12.603  -69.921 1.00 60.73  ? 13   ARG B O   1 
ATOM   4275 C CB  . ARG B 1 13  ? 4.888   14.038  -67.139 1.00 60.27  ? 13   ARG B CB  1 
ATOM   4276 C CG  . ARG B 1 13  ? 4.913   15.410  -66.488 1.00 64.37  ? 13   ARG B CG  1 
ATOM   4277 C CD  . ARG B 1 13  ? 5.477   16.501  -67.399 1.00 73.76  ? 13   ARG B CD  1 
ATOM   4278 N NE  . ARG B 1 13  ? 5.612   17.766  -66.665 1.00 79.83  ? 13   ARG B NE  1 
ATOM   4279 C CZ  . ARG B 1 13  ? 6.618   18.062  -65.830 1.00 81.70  ? 13   ARG B CZ  1 
ATOM   4280 N NH1 . ARG B 1 13  ? 7.609   17.190  -65.612 1.00 81.17  ? 13   ARG B NH1 1 
ATOM   4281 N NH2 . ARG B 1 13  ? 6.632   19.239  -65.204 1.00 82.17  ? 13   ARG B NH2 1 
ATOM   4282 N N   . GLY B 1 14  ? 3.729   11.272  -68.156 1.00 57.25  ? 14   GLY B N   1 
ATOM   4283 C CA  . GLY B 1 14  ? 4.100   10.055  -68.836 1.00 56.16  ? 14   GLY B CA  1 
ATOM   4284 C C   . GLY B 1 14  ? 3.018   9.423   -69.682 1.00 56.44  ? 14   GLY B C   1 
ATOM   4285 O O   . GLY B 1 14  ? 3.282   8.418   -70.337 1.00 56.87  ? 14   GLY B O   1 
ATOM   4286 N N   . GLY B 1 15  ? 1.807   9.988   -69.658 1.00 56.21  ? 15   GLY B N   1 
ATOM   4287 C CA  . GLY B 1 15  ? 0.653   9.443   -70.385 1.00 56.36  ? 15   GLY B CA  1 
ATOM   4288 C C   . GLY B 1 15  ? -0.659  9.439   -69.600 1.00 56.18  ? 15   GLY B C   1 
ATOM   4289 O O   . GLY B 1 15  ? -0.768  10.073  -68.540 1.00 54.98  ? 15   GLY B O   1 
ATOM   4290 N N   . GLN B 1 16  ? -1.663  8.720   -70.112 1.00 56.66  ? 16   GLN B N   1 
ATOM   4291 C CA  . GLN B 1 16  ? -2.986  8.681   -69.466 1.00 56.87  ? 16   GLN B CA  1 
ATOM   4292 C C   . GLN B 1 16  ? -3.182  7.527   -68.491 1.00 55.41  ? 16   GLN B C   1 
ATOM   4293 O O   . GLN B 1 16  ? -2.557  6.474   -68.634 1.00 55.07  ? 16   GLN B O   1 
ATOM   4294 C CB  . GLN B 1 16  ? -4.095  8.673   -70.516 1.00 59.03  ? 16   GLN B CB  1 
ATOM   4295 C CG  . GLN B 1 16  ? -4.156  9.951   -71.322 1.00 61.53  ? 16   GLN B CG  1 
ATOM   4296 C CD  . GLN B 1 16  ? -5.475  10.096  -72.047 1.00 67.08  ? 16   GLN B CD  1 
ATOM   4297 O OE1 . GLN B 1 16  ? -5.673  9.527   -73.135 1.00 68.38  ? 16   GLN B OE1 1 
ATOM   4298 N NE2 . GLN B 1 16  ? -6.400  10.865  -71.448 1.00 67.91  ? 16   GLN B NE2 1 
ATOM   4299 N N   . LEU B 1 17  ? -4.065  7.735   -67.515 1.00 54.60  ? 17   LEU B N   1 
ATOM   4300 C CA  . LEU B 1 17  ? -4.306  6.784   -66.434 1.00 53.80  ? 17   LEU B CA  1 
ATOM   4301 C C   . LEU B 1 17  ? -5.783  6.674   -66.148 1.00 55.14  ? 17   LEU B C   1 
ATOM   4302 O O   . LEU B 1 17  ? -6.498  7.681   -66.187 1.00 56.25  ? 17   LEU B O   1 
ATOM   4303 C CB  . LEU B 1 17  ? -3.653  7.261   -65.123 1.00 52.27  ? 17   LEU B CB  1 
ATOM   4304 C CG  . LEU B 1 17  ? -2.161  7.554   -65.042 1.00 50.70  ? 17   LEU B CG  1 
ATOM   4305 C CD1 . LEU B 1 17  ? -1.832  8.370   -63.827 1.00 47.89  ? 17   LEU B CD1 1 
ATOM   4306 C CD2 . LEU B 1 17  ? -1.375  6.238   -65.064 1.00 51.12  ? 17   LEU B CD2 1 
ATOM   4307 N N   . ARG B 1 18  ? -6.226  5.468   -65.797 1.00 55.45  ? 18   ARG B N   1 
ATOM   4308 C CA  . ARG B 1 18  ? -7.600  5.248   -65.365 1.00 56.68  ? 18   ARG B CA  1 
ATOM   4309 C C   . ARG B 1 18  ? -7.626  4.770   -63.938 1.00 55.47  ? 18   ARG B C   1 
ATOM   4310 O O   . ARG B 1 18  ? -7.093  3.713   -63.619 1.00 54.91  ? 18   ARG B O   1 
ATOM   4311 C CB  . ARG B 1 18  ? -8.326  4.231   -66.249 1.00 58.19  ? 18   ARG B CB  1 
ATOM   4312 C CG  . ARG B 1 18  ? -9.855  4.355   -66.198 1.00 62.19  ? 18   ARG B CG  1 
ATOM   4313 C CD  . ARG B 1 18  ? -10.584 3.118   -66.730 1.00 67.72  ? 18   ARG B CD  1 
ATOM   4314 N NE  . ARG B 1 18  ? -9.721  2.308   -67.597 1.00 71.91  ? 18   ARG B NE  1 
ATOM   4315 C CZ  . ARG B 1 18  ? -9.730  2.307   -68.933 1.00 73.98  ? 18   ARG B CZ  1 
ATOM   4316 N NH1 . ARG B 1 18  ? -10.574 3.068   -69.628 1.00 74.44  ? 18   ARG B NH1 1 
ATOM   4317 N NH2 . ARG B 1 18  ? -8.871  1.526   -69.578 1.00 75.04  ? 18   ARG B NH2 1 
ATOM   4318 N N   . GLY B 1 19  ? -8.268  5.556   -63.086 1.00 55.61  ? 19   GLY B N   1 
ATOM   4319 C CA  . GLY B 1 19  ? -8.523  5.152   -61.723 1.00 54.91  ? 19   GLY B CA  1 
ATOM   4320 C C   . GLY B 1 19  ? -9.849  4.458   -61.548 1.00 56.27  ? 19   GLY B C   1 
ATOM   4321 O O   . GLY B 1 19  ? -10.548 4.141   -62.512 1.00 57.86  ? 19   GLY B O   1 
ATOM   4322 N N   . ILE B 1 20  ? -10.196 4.240   -60.294 1.00 56.19  ? 20   ILE B N   1 
ATOM   4323 C CA  . ILE B 1 20  ? -11.392 3.510   -59.932 1.00 57.93  ? 20   ILE B CA  1 
ATOM   4324 C C   . ILE B 1 20  ? -12.094 4.258   -58.802 1.00 58.91  ? 20   ILE B C   1 
ATOM   4325 O O   . ILE B 1 20  ? -11.434 4.755   -57.872 1.00 57.17  ? 20   ILE B O   1 
ATOM   4326 C CB  . ILE B 1 20  ? -11.027 2.069   -59.518 1.00 57.40  ? 20   ILE B CB  1 
ATOM   4327 C CG1 . ILE B 1 20  ? -12.221 1.337   -58.910 1.00 58.08  ? 20   ILE B CG1 1 
ATOM   4328 C CG2 . ILE B 1 20  ? -9.809  2.065   -58.565 1.00 55.57  ? 20   ILE B CG2 1 
ATOM   4329 C CD1 . ILE B 1 20  ? -12.087 -0.181  -58.935 1.00 57.05  ? 20   ILE B CD1 1 
ATOM   4330 N N   . ARG B 1 21  ? -13.422 4.376   -58.917 1.00 61.60  ? 21   ARG B N   1 
ATOM   4331 C CA  . ARG B 1 21  ? -14.263 4.934   -57.859 1.00 63.02  ? 21   ARG B CA  1 
ATOM   4332 C C   . ARG B 1 21  ? -14.473 3.864   -56.796 1.00 63.18  ? 21   ARG B C   1 
ATOM   4333 O O   . ARG B 1 21  ? -14.991 2.775   -57.076 1.00 64.18  ? 21   ARG B O   1 
ATOM   4334 C CB  . ARG B 1 21  ? -15.594 5.447   -58.429 1.00 65.60  ? 21   ARG B CB  1 
ATOM   4335 C CG  . ARG B 1 21  ? -16.777 5.560   -57.458 1.00 68.87  ? 21   ARG B CG  1 
ATOM   4336 C CD  . ARG B 1 21  ? -17.981 6.155   -58.195 1.00 77.03  ? 21   ARG B CD  1 
ATOM   4337 N NE  . ARG B 1 21  ? -19.292 5.629   -57.785 1.00 82.55  ? 21   ARG B NE  1 
ATOM   4338 C CZ  . ARG B 1 21  ? -20.072 4.849   -58.546 1.00 88.31  ? 21   ARG B CZ  1 
ATOM   4339 N NH1 . ARG B 1 21  ? -19.692 4.475   -59.770 1.00 88.55  ? 21   ARG B NH1 1 
ATOM   4340 N NH2 . ARG B 1 21  ? -21.256 4.435   -58.091 1.00 91.96  ? 21   ARG B NH2 1 
ATOM   4341 N N   . LEU B 1 22  ? -14.025 4.184   -55.588 1.00 62.34  ? 22   LEU B N   1 
ATOM   4342 C CA  . LEU B 1 22  ? -14.138 3.304   -54.439 1.00 62.93  ? 22   LEU B CA  1 
ATOM   4343 C C   . LEU B 1 22  ? -15.176 3.879   -53.489 1.00 64.83  ? 22   LEU B C   1 
ATOM   4344 O O   . LEU B 1 22  ? -15.483 5.085   -53.542 1.00 65.24  ? 22   LEU B O   1 
ATOM   4345 C CB  . LEU B 1 22  ? -12.785 3.186   -53.733 1.00 60.70  ? 22   LEU B CB  1 
ATOM   4346 C CG  . LEU B 1 22  ? -11.605 2.597   -54.531 1.00 59.93  ? 22   LEU B CG  1 
ATOM   4347 C CD1 . LEU B 1 22  ? -10.397 2.412   -53.657 1.00 58.50  ? 22   LEU B CD1 1 
ATOM   4348 C CD2 . LEU B 1 22  ? -11.955 1.264   -55.176 1.00 61.46  ? 22   LEU B CD2 1 
ATOM   4349 N N   . LYS B 1 23  ? -15.722 3.029   -52.619 1.00 66.38  ? 23   LYS B N   1 
ATOM   4350 C CA  . LYS B 1 23  ? -16.699 3.501   -51.634 1.00 68.13  ? 23   LYS B CA  1 
ATOM   4351 C C   . LYS B 1 23  ? -16.043 3.758   -50.280 1.00 66.43  ? 23   LYS B C   1 
ATOM   4352 O O   . LYS B 1 23  ? -15.353 2.898   -49.740 1.00 65.86  ? 23   LYS B O   1 
ATOM   4353 C CB  . LYS B 1 23  ? -17.892 2.544   -51.510 1.00 70.66  ? 23   LYS B CB  1 
ATOM   4354 C CG  . LYS B 1 23  ? -18.986 3.066   -50.559 1.00 75.57  ? 23   LYS B CG  1 
ATOM   4355 C CD  . LYS B 1 23  ? -20.165 2.094   -50.364 1.00 80.69  ? 23   LYS B CD  1 
ATOM   4356 C CE  . LYS B 1 23  ? -20.965 2.476   -49.115 1.00 82.75  ? 23   LYS B CE  1 
ATOM   4357 N NZ  . LYS B 1 23  ? -22.155 1.591   -48.900 1.00 87.20  ? 23   LYS B NZ  1 
ATOM   4358 N N   . ALA B 1 24  ? -16.211 4.979   -49.777 1.00 66.13  ? 24   ALA B N   1 
ATOM   4359 C CA  . ALA B 1 24  ? -15.971 5.312   -48.371 1.00 64.80  ? 24   ALA B CA  1 
ATOM   4360 C C   . ALA B 1 24  ? -17.358 5.461   -47.721 1.00 66.93  ? 24   ALA B C   1 
ATOM   4361 O O   . ALA B 1 24  ? -18.350 5.689   -48.430 1.00 68.24  ? 24   ALA B O   1 
ATOM   4362 C CB  . ALA B 1 24  ? -15.181 6.589   -48.260 1.00 62.87  ? 24   ALA B CB  1 
ATOM   4363 N N   . PRO B 1 25  ? -17.446 5.320   -46.382 1.00 66.89  ? 25   PRO B N   1 
ATOM   4364 C CA  . PRO B 1 25  ? -18.778 5.325   -45.753 1.00 68.81  ? 25   PRO B CA  1 
ATOM   4365 C C   . PRO B 1 25  ? -19.560 6.633   -45.980 1.00 70.01  ? 25   PRO B C   1 
ATOM   4366 O O   . PRO B 1 25  ? -20.799 6.609   -46.065 1.00 72.06  ? 25   PRO B O   1 
ATOM   4367 C CB  . PRO B 1 25  ? -18.461 5.120   -44.268 1.00 68.35  ? 25   PRO B CB  1 
ATOM   4368 C CG  . PRO B 1 25  ? -17.015 5.595   -44.111 1.00 65.93  ? 25   PRO B CG  1 
ATOM   4369 C CD  . PRO B 1 25  ? -16.364 5.163   -45.389 1.00 65.01  ? 25   PRO B CD  1 
ATOM   4370 N N   . GLY B 1 26  ? -18.839 7.751   -46.109 1.00 68.59  ? 26   GLY B N   1 
ATOM   4371 C CA  . GLY B 1 26  ? -19.463 9.068   -46.328 1.00 69.45  ? 26   GLY B CA  1 
ATOM   4372 C C   . GLY B 1 26  ? -19.788 9.409   -47.783 1.00 70.19  ? 26   GLY B C   1 
ATOM   4373 O O   . GLY B 1 26  ? -20.485 10.394  -48.054 1.00 71.55  ? 26   GLY B O   1 
ATOM   4374 N N   . GLY B 1 27  ? -19.281 8.598   -48.715 1.00 68.96  ? 27   GLY B N   1 
ATOM   4375 C CA  . GLY B 1 27  ? -19.452 8.836   -50.152 1.00 69.16  ? 27   GLY B CA  1 
ATOM   4376 C C   . GLY B 1 27  ? -18.248 8.368   -50.960 1.00 66.81  ? 27   GLY B C   1 
ATOM   4377 O O   . GLY B 1 27  ? -17.285 7.874   -50.379 1.00 65.49  ? 27   GLY B O   1 
ATOM   4378 N N   . PRO B 1 28  ? -18.293 8.522   -52.301 1.00 66.70  ? 28   PRO B N   1 
ATOM   4379 C CA  . PRO B 1 28  ? -17.240 8.077   -53.224 1.00 64.72  ? 28   PRO B CA  1 
ATOM   4380 C C   . PRO B 1 28  ? -15.910 8.842   -53.125 1.00 62.39  ? 28   PRO B C   1 
ATOM   4381 O O   . PRO B 1 28  ? -15.884 9.984   -52.672 1.00 62.24  ? 28   PRO B O   1 
ATOM   4382 C CB  . PRO B 1 28  ? -17.875 8.313   -54.600 1.00 66.45  ? 28   PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 28  ? -18.873 9.396   -54.371 1.00 67.76  ? 28   PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 28  ? -19.450 9.071   -53.036 1.00 68.80  ? 28   PRO B CD  1 
ATOM   4385 N N   . VAL B 1 29  ? -14.822 8.179   -53.533 1.00 60.56  ? 29   VAL B N   1 
ATOM   4386 C CA  . VAL B 1 29  ? -13.472 8.768   -53.677 1.00 57.96  ? 29   VAL B CA  1 
ATOM   4387 C C   . VAL B 1 29  ? -12.861 8.214   -54.970 1.00 57.46  ? 29   VAL B C   1 
ATOM   4388 O O   . VAL B 1 29  ? -13.233 7.112   -55.417 1.00 58.06  ? 29   VAL B O   1 
ATOM   4389 C CB  . VAL B 1 29  ? -12.511 8.427   -52.495 1.00 56.12  ? 29   VAL B CB  1 
ATOM   4390 C CG1 . VAL B 1 29  ? -13.127 8.770   -51.155 1.00 56.49  ? 29   VAL B CG1 1 
ATOM   4391 C CG2 . VAL B 1 29  ? -12.103 6.954   -52.506 1.00 55.45  ? 29   VAL B CG2 1 
ATOM   4392 N N   . SER B 1 30  ? -11.948 8.966   -55.579 1.00 55.82  ? 30   SER B N   1 
ATOM   4393 C CA  . SER B 1 30  ? -11.254 8.477   -56.762 1.00 55.07  ? 30   SER B CA  1 
ATOM   4394 C C   . SER B 1 30  ? -9.888  7.958   -56.340 1.00 52.70  ? 30   SER B C   1 
ATOM   4395 O O   . SER B 1 30  ? -9.146  8.652   -55.653 1.00 51.96  ? 30   SER B O   1 
ATOM   4396 C CB  . SER B 1 30  ? -11.111 9.578   -57.827 1.00 55.85  ? 30   SER B CB  1 
ATOM   4397 O OG  . SER B 1 30  ? -12.258 10.427  -57.930 1.00 58.13  ? 30   SER B OG  1 
ATOM   4398 N N   . ALA B 1 31  ? -9.556  6.733   -56.731 1.00 52.10  ? 31   ALA B N   1 
ATOM   4399 C CA  . ALA B 1 31  ? -8.247  6.160   -56.415 1.00 49.74  ? 31   ALA B CA  1 
ATOM   4400 C C   . ALA B 1 31  ? -7.473  5.773   -57.657 1.00 49.49  ? 31   ALA B C   1 
ATOM   4401 O O   . ALA B 1 31  ? -8.006  5.165   -58.561 1.00 50.73  ? 31   ALA B O   1 
ATOM   4402 C CB  . ALA B 1 31  ? -8.402  4.960   -55.517 1.00 49.42  ? 31   ALA B CB  1 
ATOM   4403 N N   . PHE B 1 32  ? -6.195  6.118   -57.687 1.00 48.58  ? 32   PHE B N   1 
ATOM   4404 C CA  . PHE B 1 32  ? -5.311  5.733   -58.782 1.00 47.66  ? 32   PHE B CA  1 
ATOM   4405 C C   . PHE B 1 32  ? -4.188  4.932   -58.173 1.00 46.65  ? 32   PHE B C   1 
ATOM   4406 O O   . PHE B 1 32  ? -3.297  5.501   -57.563 1.00 46.28  ? 32   PHE B O   1 
ATOM   4407 C CB  . PHE B 1 32  ? -4.787  6.986   -59.479 1.00 47.17  ? 32   PHE B CB  1 
ATOM   4408 C CG  . PHE B 1 32  ? -5.881  7.908   -59.924 1.00 47.17  ? 32   PHE B CG  1 
ATOM   4409 C CD1 . PHE B 1 32  ? -6.422  8.848   -59.044 1.00 46.73  ? 32   PHE B CD1 1 
ATOM   4410 C CD2 . PHE B 1 32  ? -6.405  7.809   -61.198 1.00 47.07  ? 32   PHE B CD2 1 
ATOM   4411 C CE1 . PHE B 1 32  ? -7.457  9.688   -59.442 1.00 48.08  ? 32   PHE B CE1 1 
ATOM   4412 C CE2 . PHE B 1 32  ? -7.436  8.640   -61.615 1.00 48.92  ? 32   PHE B CE2 1 
ATOM   4413 C CZ  . PHE B 1 32  ? -7.966  9.589   -60.728 1.00 48.93  ? 32   PHE B CZ  1 
ATOM   4414 N N   . LEU B 1 33  ? -4.249  3.609   -58.316 1.00 46.53  ? 33   LEU B N   1 
ATOM   4415 C CA  . LEU B 1 33  ? -3.329  2.708   -57.635 1.00 45.26  ? 33   LEU B CA  1 
ATOM   4416 C C   . LEU B 1 33  ? -2.371  2.023   -58.611 1.00 45.92  ? 33   LEU B C   1 
ATOM   4417 O O   . LEU B 1 33  ? -2.752  1.678   -59.728 1.00 47.17  ? 33   LEU B O   1 
ATOM   4418 C CB  . LEU B 1 33  ? -4.116  1.649   -56.855 1.00 44.96  ? 33   LEU B CB  1 
ATOM   4419 C CG  . LEU B 1 33  ? -5.369  2.130   -56.111 1.00 45.05  ? 33   LEU B CG  1 
ATOM   4420 C CD1 . LEU B 1 33  ? -6.288  0.961   -55.721 1.00 44.11  ? 33   LEU B CD1 1 
ATOM   4421 C CD2 . LEU B 1 33  ? -4.973  2.918   -54.894 1.00 42.58  ? 33   LEU B CD2 1 
ATOM   4422 N N   . GLY B 1 34  ? -1.134  1.792   -58.181 1.00 45.05  ? 34   GLY B N   1 
ATOM   4423 C CA  . GLY B 1 34  ? -0.161  1.151   -59.041 1.00 45.43  ? 34   GLY B CA  1 
ATOM   4424 C C   . GLY B 1 34  ? 0.366   2.039   -60.158 1.00 46.00  ? 34   GLY B C   1 
ATOM   4425 O O   . GLY B 1 34  ? 0.548   1.566   -61.265 1.00 47.57  ? 34   GLY B O   1 
ATOM   4426 N N   . ILE B 1 35  ? 0.620   3.318   -59.886 1.00 45.13  ? 35   ILE B N   1 
ATOM   4427 C CA  . ILE B 1 35  ? 1.163   4.214   -60.903 1.00 45.00  ? 35   ILE B CA  1 
ATOM   4428 C C   . ILE B 1 35  ? 2.694   4.150   -60.939 1.00 44.70  ? 35   ILE B C   1 
ATOM   4429 O O   . ILE B 1 35  ? 3.347   4.531   -59.970 1.00 44.18  ? 35   ILE B O   1 
ATOM   4430 C CB  . ILE B 1 35  ? 0.763   5.695   -60.652 1.00 44.77  ? 35   ILE B CB  1 
ATOM   4431 C CG1 . ILE B 1 35  ? -0.759  5.869   -60.551 1.00 43.95  ? 35   ILE B CG1 1 
ATOM   4432 C CG2 . ILE B 1 35  ? 1.364   6.584   -61.745 1.00 45.30  ? 35   ILE B CG2 1 
ATOM   4433 C CD1 . ILE B 1 35  ? -1.192  7.241   -60.023 1.00 41.56  ? 35   ILE B CD1 1 
ATOM   4434 N N   . PRO B 1 36  ? 3.281   3.696   -62.063 1.00 45.49  ? 36   PRO B N   1 
ATOM   4435 C CA  . PRO B 1 36  ? 4.749   3.544   -62.106 1.00 44.59  ? 36   PRO B CA  1 
ATOM   4436 C C   . PRO B 1 36  ? 5.431   4.893   -62.024 1.00 44.45  ? 36   PRO B C   1 
ATOM   4437 O O   . PRO B 1 36  ? 5.051   5.805   -62.759 1.00 45.42  ? 36   PRO B O   1 
ATOM   4438 C CB  . PRO B 1 36  ? 4.997   2.941   -63.482 1.00 45.19  ? 36   PRO B CB  1 
ATOM   4439 C CG  . PRO B 1 36  ? 3.803   3.363   -64.311 1.00 46.39  ? 36   PRO B CG  1 
ATOM   4440 C CD  . PRO B 1 36  ? 2.645   3.417   -63.371 1.00 46.52  ? 36   PRO B CD  1 
ATOM   4441 N N   . PHE B 1 37  ? 6.404   5.040   -61.133 1.00 43.36  ? 37   PHE B N   1 
ATOM   4442 C CA  . PHE B 1 37  ? 7.155   6.296   -61.066 1.00 43.25  ? 37   PHE B CA  1 
ATOM   4443 C C   . PHE B 1 37  ? 8.630   6.127   -61.434 1.00 44.04  ? 37   PHE B C   1 
ATOM   4444 O O   . PHE B 1 37  ? 9.375   7.109   -61.493 1.00 44.29  ? 37   PHE B O   1 
ATOM   4445 C CB  . PHE B 1 37  ? 6.997   7.001   -59.700 1.00 42.41  ? 37   PHE B CB  1 
ATOM   4446 C CG  . PHE B 1 37  ? 7.614   6.266   -58.528 1.00 40.08  ? 37   PHE B CG  1 
ATOM   4447 C CD1 . PHE B 1 37  ? 8.954   6.436   -58.203 1.00 40.94  ? 37   PHE B CD1 1 
ATOM   4448 C CD2 . PHE B 1 37  ? 6.836   5.445   -57.724 1.00 39.78  ? 37   PHE B CD2 1 
ATOM   4449 C CE1 . PHE B 1 37  ? 9.521   5.768   -57.102 1.00 41.02  ? 37   PHE B CE1 1 
ATOM   4450 C CE2 . PHE B 1 37  ? 7.375   4.768   -56.616 1.00 39.08  ? 37   PHE B CE2 1 
ATOM   4451 C CZ  . PHE B 1 37  ? 8.724   4.931   -56.299 1.00 39.86  ? 37   PHE B CZ  1 
ATOM   4452 N N   . ALA B 1 38  ? 9.046   4.883   -61.662 1.00 44.17  ? 38   ALA B N   1 
ATOM   4453 C CA  . ALA B 1 38  ? 10.421  4.597   -62.038 1.00 45.05  ? 38   ALA B CA  1 
ATOM   4454 C C   . ALA B 1 38  ? 10.496  3.390   -62.969 1.00 46.02  ? 38   ALA B C   1 
ATOM   4455 O O   . ALA B 1 38  ? 9.569   2.560   -63.012 1.00 46.39  ? 38   ALA B O   1 
ATOM   4456 C CB  . ALA B 1 38  ? 11.260  4.367   -60.812 1.00 44.08  ? 38   ALA B CB  1 
ATOM   4457 N N   . GLU B 1 39  ? 11.580  3.312   -63.731 1.00 46.38  ? 39   GLU B N   1 
ATOM   4458 C CA  . GLU B 1 39  ? 11.896  2.092   -64.460 1.00 47.50  ? 39   GLU B CA  1 
ATOM   4459 C C   . GLU B 1 39  ? 12.097  0.975   -63.442 1.00 47.03  ? 39   GLU B C   1 
ATOM   4460 O O   . GLU B 1 39  ? 12.800  1.167   -62.459 1.00 46.43  ? 39   GLU B O   1 
ATOM   4461 C CB  . GLU B 1 39  ? 13.164  2.268   -65.300 1.00 48.18  ? 39   GLU B CB  1 
ATOM   4462 C CG  . GLU B 1 39  ? 12.993  3.228   -66.445 1.00 49.82  ? 39   GLU B CG  1 
ATOM   4463 C CD  . GLU B 1 39  ? 12.012  2.710   -67.477 1.00 52.04  ? 39   GLU B CD  1 
ATOM   4464 O OE1 . GLU B 1 39  ? 12.422  1.841   -68.276 1.00 53.72  ? 39   GLU B OE1 1 
ATOM   4465 O OE2 . GLU B 1 39  ? 10.835  3.163   -67.478 1.00 50.66  ? 39   GLU B OE2 1 
ATOM   4466 N N   . PRO B 1 40  ? 11.469  -0.193  -63.663 1.00 47.49  ? 40   PRO B N   1 
ATOM   4467 C CA  . PRO B 1 40  ? 11.666  -1.336  -62.769 1.00 47.25  ? 40   PRO B CA  1 
ATOM   4468 C C   . PRO B 1 40  ? 13.155  -1.557  -62.397 1.00 47.74  ? 40   PRO B C   1 
ATOM   4469 O O   . PRO B 1 40  ? 13.977  -1.800  -63.279 1.00 48.81  ? 40   PRO B O   1 
ATOM   4470 C CB  . PRO B 1 40  ? 11.166  -2.494  -63.616 1.00 48.07  ? 40   PRO B CB  1 
ATOM   4471 C CG  . PRO B 1 40  ? 10.112  -1.869  -64.459 1.00 47.93  ? 40   PRO B CG  1 
ATOM   4472 C CD  . PRO B 1 40  ? 10.642  -0.545  -64.828 1.00 47.54  ? 40   PRO B CD  1 
ATOM   4473 N N   . PRO B 1 41  ? 13.505  -1.482  -61.098 1.00 47.04  ? 41   PRO B N   1 
ATOM   4474 C CA  . PRO B 1 41  ? 14.924  -1.575  -60.767 1.00 47.62  ? 41   PRO B CA  1 
ATOM   4475 C C   . PRO B 1 41  ? 15.419  -3.025  -60.786 1.00 48.38  ? 41   PRO B C   1 
ATOM   4476 O O   . PRO B 1 41  ? 15.920  -3.520  -59.781 1.00 48.31  ? 41   PRO B O   1 
ATOM   4477 C CB  . PRO B 1 41  ? 14.978  -0.997  -59.354 1.00 46.90  ? 41   PRO B CB  1 
ATOM   4478 C CG  . PRO B 1 41  ? 13.619  -1.303  -58.779 1.00 46.33  ? 41   PRO B CG  1 
ATOM   4479 C CD  . PRO B 1 41  ? 12.657  -1.513  -59.896 1.00 45.52  ? 41   PRO B CD  1 
ATOM   4480 N N   . VAL B 1 42  ? 15.282  -3.684  -61.935 1.00 49.18  ? 42   VAL B N   1 
ATOM   4481 C CA  . VAL B 1 42  ? 15.591  -5.101  -62.068 1.00 49.83  ? 42   VAL B CA  1 
ATOM   4482 C C   . VAL B 1 42  ? 16.850  -5.392  -62.884 1.00 51.22  ? 42   VAL B C   1 
ATOM   4483 O O   . VAL B 1 42  ? 17.341  -4.537  -63.627 1.00 51.28  ? 42   VAL B O   1 
ATOM   4484 C CB  . VAL B 1 42  ? 14.388  -5.880  -62.653 1.00 50.12  ? 42   VAL B CB  1 
ATOM   4485 C CG1 . VAL B 1 42  ? 13.170  -5.730  -61.725 1.00 49.35  ? 42   VAL B CG1 1 
ATOM   4486 C CG2 . VAL B 1 42  ? 14.070  -5.419  -64.065 1.00 50.04  ? 42   VAL B CG2 1 
ATOM   4487 N N   . GLY B 1 43  ? 17.362  -6.608  -62.741 1.00 52.22  ? 43   GLY B N   1 
ATOM   4488 C CA  . GLY B 1 43  ? 18.542  -7.034  -63.481 1.00 54.29  ? 43   GLY B CA  1 
ATOM   4489 C C   . GLY B 1 43  ? 19.771  -6.241  -63.083 1.00 54.69  ? 43   GLY B C   1 
ATOM   4490 O O   . GLY B 1 43  ? 20.214  -6.306  -61.932 1.00 54.39  ? 43   GLY B O   1 
ATOM   4491 N N   . SER B 1 44  ? 20.320  -5.487  -64.033 1.00 55.60  ? 44   SER B N   1 
ATOM   4492 C CA  . SER B 1 44  ? 21.504  -4.679  -63.773 1.00 56.37  ? 44   SER B CA  1 
ATOM   4493 C C   . SER B 1 44  ? 21.164  -3.422  -62.960 1.00 55.13  ? 44   SER B C   1 
ATOM   4494 O O   . SER B 1 44  ? 22.059  -2.712  -62.502 1.00 55.31  ? 44   SER B O   1 
ATOM   4495 C CB  . SER B 1 44  ? 22.192  -4.297  -65.079 1.00 57.98  ? 44   SER B CB  1 
ATOM   4496 O OG  . SER B 1 44  ? 21.744  -3.020  -65.515 1.00 58.18  ? 44   SER B OG  1 
ATOM   4497 N N   . ARG B 1 45  ? 19.873  -3.150  -62.780 1.00 53.97  ? 45   ARG B N   1 
ATOM   4498 C CA  . ARG B 1 45  ? 19.457  -2.008  -61.989 1.00 52.65  ? 45   ARG B CA  1 
ATOM   4499 C C   . ARG B 1 45  ? 19.306  -2.356  -60.504 1.00 51.21  ? 45   ARG B C   1 
ATOM   4500 O O   . ARG B 1 45  ? 18.950  -1.496  -59.701 1.00 50.50  ? 45   ARG B O   1 
ATOM   4501 C CB  . ARG B 1 45  ? 18.159  -1.395  -62.520 1.00 52.41  ? 45   ARG B CB  1 
ATOM   4502 C CG  . ARG B 1 45  ? 18.137  -0.931  -63.978 1.00 56.14  ? 45   ARG B CG  1 
ATOM   4503 C CD  . ARG B 1 45  ? 19.282  0.005   -64.341 1.00 63.17  ? 45   ARG B CD  1 
ATOM   4504 N NE  . ARG B 1 45  ? 19.319  1.222   -63.528 1.00 67.85  ? 45   ARG B NE  1 
ATOM   4505 C CZ  . ARG B 1 45  ? 20.350  2.080   -63.465 1.00 70.63  ? 45   ARG B CZ  1 
ATOM   4506 N NH1 . ARG B 1 45  ? 20.270  3.160   -62.672 1.00 68.21  ? 45   ARG B NH1 1 
ATOM   4507 N NH2 . ARG B 1 45  ? 21.464  1.861   -64.180 1.00 72.03  ? 45   ARG B NH2 1 
ATOM   4508 N N   . ARG B 1 46  ? 19.560  -3.605  -60.125 1.00 50.89  ? 46   ARG B N   1 
ATOM   4509 C CA  . ARG B 1 46  ? 19.549  -3.973  -58.707 1.00 49.26  ? 46   ARG B CA  1 
ATOM   4510 C C   . ARG B 1 46  ? 20.634  -3.176  -57.994 1.00 49.01  ? 46   ARG B C   1 
ATOM   4511 O O   . ARG B 1 46  ? 21.771  -3.094  -58.499 1.00 50.60  ? 46   ARG B O   1 
ATOM   4512 C CB  . ARG B 1 46  ? 19.822  -5.463  -58.530 1.00 50.03  ? 46   ARG B CB  1 
ATOM   4513 C CG  . ARG B 1 46  ? 19.551  -5.957  -57.134 1.00 49.16  ? 46   ARG B CG  1 
ATOM   4514 C CD  . ARG B 1 46  ? 19.897  -7.401  -57.026 1.00 49.15  ? 46   ARG B CD  1 
ATOM   4515 N NE  . ARG B 1 46  ? 18.745  -8.285  -57.128 1.00 47.79  ? 46   ARG B NE  1 
ATOM   4516 C CZ  . ARG B 1 46  ? 18.845  -9.613  -57.140 1.00 48.78  ? 46   ARG B CZ  1 
ATOM   4517 N NH1 . ARG B 1 46  ? 20.037  -10.193 -57.080 1.00 49.37  ? 46   ARG B NH1 1 
ATOM   4518 N NH2 . ARG B 1 46  ? 17.758  -10.362 -57.221 1.00 47.92  ? 46   ARG B NH2 1 
ATOM   4519 N N   . PHE B 1 47  ? 20.281  -2.600  -56.837 1.00 47.08  ? 47   PHE B N   1 
ATOM   4520 C CA  . PHE B 1 47  ? 21.180  -1.773  -56.008 1.00 46.31  ? 47   PHE B CA  1 
ATOM   4521 C C   . PHE B 1 47  ? 21.443  -0.385  -56.590 1.00 46.83  ? 47   PHE B C   1 
ATOM   4522 O O   . PHE B 1 47  ? 22.123  0.436   -55.972 1.00 47.55  ? 47   PHE B O   1 
ATOM   4523 C CB  . PHE B 1 47  ? 22.535  -2.456  -55.705 1.00 46.94  ? 47   PHE B CB  1 
ATOM   4524 C CG  . PHE B 1 47  ? 22.425  -3.891  -55.266 1.00 46.00  ? 47   PHE B CG  1 
ATOM   4525 C CD1 . PHE B 1 47  ? 21.655  -4.246  -54.139 1.00 44.21  ? 47   PHE B CD1 1 
ATOM   4526 C CD2 . PHE B 1 47  ? 23.121  -4.891  -55.956 1.00 45.43  ? 47   PHE B CD2 1 
ATOM   4527 C CE1 . PHE B 1 47  ? 21.555  -5.583  -53.715 1.00 44.00  ? 47   PHE B CE1 1 
ATOM   4528 C CE2 . PHE B 1 47  ? 23.056  -6.242  -55.542 1.00 46.40  ? 47   PHE B CE2 1 
ATOM   4529 C CZ  . PHE B 1 47  ? 22.257  -6.592  -54.423 1.00 47.22  ? 47   PHE B CZ  1 
ATOM   4530 N N   . MET B 1 48  ? 20.917  -0.115  -57.778 1.00 47.46  ? 48   MET B N   1 
ATOM   4531 C CA  . MET B 1 48  ? 21.178  1.155   -58.466 1.00 48.01  ? 48   MET B CA  1 
ATOM   4532 C C   . MET B 1 48  ? 20.140  2.238   -58.118 1.00 46.52  ? 48   MET B C   1 
ATOM   4533 O O   . MET B 1 48  ? 18.995  1.916   -57.782 1.00 45.46  ? 48   MET B O   1 
ATOM   4534 C CB  . MET B 1 48  ? 21.249  0.900   -59.979 1.00 49.40  ? 48   MET B CB  1 
ATOM   4535 C CG  . MET B 1 48  ? 22.463  0.091   -60.423 1.00 52.78  ? 48   MET B CG  1 
ATOM   4536 S SD  . MET B 1 48  ? 24.028  1.009   -60.235 1.00 57.83  ? 48   MET B SD  1 
ATOM   4537 C CE  . MET B 1 48  ? 24.058  1.793   -61.844 1.00 57.15  ? 48   MET B CE  1 
ATOM   4538 N N   . PRO B 1 49  ? 20.538  3.523   -58.175 1.00 46.81  ? 49   PRO B N   1 
ATOM   4539 C CA  . PRO B 1 49  ? 19.566  4.623   -58.065 1.00 46.19  ? 49   PRO B CA  1 
ATOM   4540 C C   . PRO B 1 49  ? 18.479  4.452   -59.108 1.00 46.60  ? 49   PRO B C   1 
ATOM   4541 O O   . PRO B 1 49  ? 18.781  4.043   -60.235 1.00 47.99  ? 49   PRO B O   1 
ATOM   4542 C CB  . PRO B 1 49  ? 20.388  5.870   -58.424 1.00 47.11  ? 49   PRO B CB  1 
ATOM   4543 C CG  . PRO B 1 49  ? 21.794  5.506   -58.180 1.00 47.18  ? 49   PRO B CG  1 
ATOM   4544 C CD  . PRO B 1 49  ? 21.920  4.013   -58.307 1.00 48.00  ? 49   PRO B CD  1 
ATOM   4545 N N   . PRO B 1 50  ? 17.218  4.770   -58.755 1.00 45.87  ? 50   PRO B N   1 
ATOM   4546 C CA  . PRO B 1 50  ? 16.108  4.568   -59.678 1.00 45.71  ? 50   PRO B CA  1 
ATOM   4547 C C   . PRO B 1 50  ? 16.174  5.565   -60.821 1.00 47.05  ? 50   PRO B C   1 
ATOM   4548 O O   . PRO B 1 50  ? 16.715  6.649   -60.631 1.00 47.67  ? 50   PRO B O   1 
ATOM   4549 C CB  . PRO B 1 50  ? 14.893  4.881   -58.807 1.00 44.54  ? 50   PRO B CB  1 
ATOM   4550 C CG  . PRO B 1 50  ? 15.365  5.867   -57.842 1.00 43.80  ? 50   PRO B CG  1 
ATOM   4551 C CD  . PRO B 1 50  ? 16.796  5.508   -57.548 1.00 44.87  ? 50   PRO B CD  1 
ATOM   4552 N N   . GLU B 1 51  ? 15.643  5.207   -61.989 1.00 48.01  ? 51   GLU B N   1 
ATOM   4553 C CA  A GLU B 1 51  ? 15.555  6.114   -63.138 0.70 49.40  ? 51   GLU B CA  1 
ATOM   4554 C CA  B GLU B 1 51  ? 15.550  6.154   -63.097 0.30 48.98  ? 51   GLU B CA  1 
ATOM   4555 C C   . GLU B 1 51  ? 14.084  6.459   -63.386 1.00 48.89  ? 51   GLU B C   1 
ATOM   4556 O O   . GLU B 1 51  ? 13.207  5.614   -63.159 1.00 48.24  ? 51   GLU B O   1 
ATOM   4557 C CB  A GLU B 1 51  ? 16.158  5.453   -64.379 0.70 51.02  ? 51   GLU B CB  1 
ATOM   4558 C CB  B GLU B 1 51  ? 16.276  5.642   -64.346 0.30 50.33  ? 51   GLU B CB  1 
ATOM   4559 C CG  A GLU B 1 51  ? 17.516  4.768   -64.129 0.70 54.27  ? 51   GLU B CG  1 
ATOM   4560 C CG  B GLU B 1 51  ? 17.802  5.825   -64.313 0.30 51.35  ? 51   GLU B CG  1 
ATOM   4561 C CD  A GLU B 1 51  ? 17.972  3.854   -65.276 0.70 59.25  ? 51   GLU B CD  1 
ATOM   4562 C CD  B GLU B 1 51  ? 18.260  7.220   -64.736 0.30 52.19  ? 51   GLU B CD  1 
ATOM   4563 O OE1 A GLU B 1 51  ? 17.176  2.995   -65.745 0.70 60.17  ? 51   GLU B OE1 1 
ATOM   4564 O OE1 B GLU B 1 51  ? 17.794  7.724   -65.786 0.30 51.99  ? 51   GLU B OE1 1 
ATOM   4565 O OE2 A GLU B 1 51  ? 19.149  3.987   -65.691 0.70 61.52  ? 51   GLU B OE2 1 
ATOM   4566 O OE2 B GLU B 1 51  ? 19.103  7.803   -64.022 0.30 51.87  ? 51   GLU B OE2 1 
ATOM   4567 N N   . PRO B 1 52  ? 13.793  7.695   -63.852 1.00 49.49  ? 52   PRO B N   1 
ATOM   4568 C CA  . PRO B 1 52  ? 12.371  8.025   -64.113 1.00 49.55  ? 52   PRO B CA  1 
ATOM   4569 C C   . PRO B 1 52  ? 11.683  7.071   -65.103 1.00 49.95  ? 52   PRO B C   1 
ATOM   4570 O O   . PRO B 1 52  ? 12.319  6.573   -66.034 1.00 50.69  ? 52   PRO B O   1 
ATOM   4571 C CB  . PRO B 1 52  ? 12.422  9.456   -64.690 1.00 50.57  ? 52   PRO B CB  1 
ATOM   4572 C CG  . PRO B 1 52  ? 13.900  9.791   -64.902 1.00 51.25  ? 52   PRO B CG  1 
ATOM   4573 C CD  . PRO B 1 52  ? 14.671  8.880   -63.978 1.00 50.48  ? 52   PRO B CD  1 
ATOM   4574 N N   . LYS B 1 53  ? 10.399  6.812   -64.881 1.00 49.30  ? 53   LYS B N   1 
ATOM   4575 C CA  . LYS B 1 53  ? 9.635   5.908   -65.735 1.00 49.68  ? 53   LYS B CA  1 
ATOM   4576 C C   . LYS B 1 53  ? 9.462   6.512   -67.123 1.00 51.42  ? 53   LYS B C   1 
ATOM   4577 O O   . LYS B 1 53  ? 9.114   7.703   -67.253 1.00 51.65  ? 53   LYS B O   1 
ATOM   4578 C CB  . LYS B 1 53  ? 8.275   5.589   -65.103 1.00 48.87  ? 53   LYS B CB  1 
ATOM   4579 C CG  . LYS B 1 53  ? 7.281   4.823   -65.997 1.00 49.49  ? 53   LYS B CG  1 
ATOM   4580 C CD  . LYS B 1 53  ? 7.570   3.305   -66.026 1.00 48.21  ? 53   LYS B CD  1 
ATOM   4581 C CE  . LYS B 1 53  ? 6.558   2.546   -66.889 1.00 46.85  ? 53   LYS B CE  1 
ATOM   4582 N NZ  . LYS B 1 53  ? 6.713   2.883   -68.312 1.00 44.77  ? 53   LYS B NZ  1 
ATOM   4583 N N   . ARG B 1 54  ? 9.717   5.695   -68.154 1.00 52.43  ? 54   ARG B N   1 
ATOM   4584 C CA  . ARG B 1 54  ? 9.515   6.113   -69.536 1.00 53.92  ? 54   ARG B CA  1 
ATOM   4585 C C   . ARG B 1 54  ? 8.016   6.306   -69.826 1.00 53.99  ? 54   ARG B C   1 
ATOM   4586 O O   . ARG B 1 54  ? 7.174   5.660   -69.213 1.00 52.68  ? 54   ARG B O   1 
ATOM   4587 C CB  . ARG B 1 54  ? 10.139  5.110   -70.506 1.00 54.95  ? 54   ARG B CB  1 
ATOM   4588 C CG  . ARG B 1 54  ? 11.668  5.039   -70.443 1.00 57.33  ? 54   ARG B CG  1 
ATOM   4589 C CD  . ARG B 1 54  ? 12.230  3.850   -71.234 1.00 61.28  ? 54   ARG B CD  1 
ATOM   4590 N NE  . ARG B 1 54  ? 11.580  2.605   -70.831 1.00 63.26  ? 54   ARG B NE  1 
ATOM   4591 C CZ  . ARG B 1 54  ? 10.821  1.853   -71.622 1.00 65.67  ? 54   ARG B CZ  1 
ATOM   4592 N NH1 . ARG B 1 54  ? 10.254  0.768   -71.136 1.00 65.65  ? 54   ARG B NH1 1 
ATOM   4593 N NH2 . ARG B 1 54  ? 10.640  2.169   -72.894 1.00 67.23  ? 54   ARG B NH2 1 
ATOM   4594 N N   . PRO B 1 55  ? 7.688   7.224   -70.742 1.00 55.20  ? 55   PRO B N   1 
ATOM   4595 C CA  . PRO B 1 55  ? 6.306   7.424   -71.192 1.00 55.82  ? 55   PRO B CA  1 
ATOM   4596 C C   . PRO B 1 55  ? 5.678   6.159   -71.779 1.00 55.85  ? 55   PRO B C   1 
ATOM   4597 O O   . PRO B 1 55  ? 6.373   5.356   -72.387 1.00 56.93  ? 55   PRO B O   1 
ATOM   4598 C CB  . PRO B 1 55  ? 6.447   8.492   -72.288 1.00 57.51  ? 55   PRO B CB  1 
ATOM   4599 C CG  . PRO B 1 55  ? 7.680   9.261   -71.906 1.00 57.66  ? 55   PRO B CG  1 
ATOM   4600 C CD  . PRO B 1 55  ? 8.610   8.216   -71.332 1.00 56.26  ? 55   PRO B CD  1 
ATOM   4601 N N   . TRP B 1 56  ? 4.372   6.000   -71.589 1.00 55.14  ? 56   TRP B N   1 
ATOM   4602 C CA  . TRP B 1 56  ? 3.615   4.867   -72.111 1.00 54.84  ? 56   TRP B CA  1 
ATOM   4603 C C   . TRP B 1 56  ? 2.523   5.317   -73.088 1.00 56.00  ? 56   TRP B C   1 
ATOM   4604 O O   . TRP B 1 56  ? 2.057   6.472   -73.052 1.00 55.76  ? 56   TRP B O   1 
ATOM   4605 C CB  . TRP B 1 56  ? 2.991   4.093   -70.956 1.00 53.61  ? 56   TRP B CB  1 
ATOM   4606 C CG  . TRP B 1 56  ? 2.072   4.922   -70.119 1.00 54.48  ? 56   TRP B CG  1 
ATOM   4607 C CD1 . TRP B 1 56  ? 0.756   5.166   -70.358 1.00 55.24  ? 56   TRP B CD1 1 
ATOM   4608 C CD2 . TRP B 1 56  ? 2.397   5.637   -68.911 1.00 53.68  ? 56   TRP B CD2 1 
ATOM   4609 N NE1 . TRP B 1 56  ? 0.239   5.976   -69.384 1.00 55.10  ? 56   TRP B NE1 1 
ATOM   4610 C CE2 . TRP B 1 56  ? 1.222   6.283   -68.484 1.00 53.43  ? 56   TRP B CE2 1 
ATOM   4611 C CE3 . TRP B 1 56  ? 3.562   5.788   -68.153 1.00 52.01  ? 56   TRP B CE3 1 
ATOM   4612 C CZ2 . TRP B 1 56  ? 1.172   7.066   -67.328 1.00 52.59  ? 56   TRP B CZ2 1 
ATOM   4613 C CZ3 . TRP B 1 56  ? 3.516   6.566   -67.009 1.00 50.92  ? 56   TRP B CZ3 1 
ATOM   4614 C CH2 . TRP B 1 56  ? 2.326   7.195   -66.605 1.00 51.63  ? 56   TRP B CH2 1 
ATOM   4615 N N   . SER B 1 57  ? 2.116   4.390   -73.950 1.00 56.31  ? 57   SER B N   1 
ATOM   4616 C CA  . SER B 1 57  ? 1.032   4.612   -74.894 1.00 57.24  ? 57   SER B CA  1 
ATOM   4617 C C   . SER B 1 57  ? -0.316  4.262   -74.264 1.00 57.09  ? 57   SER B C   1 
ATOM   4618 O O   . SER B 1 57  ? -0.362  3.545   -73.255 1.00 55.48  ? 57   SER B O   1 
ATOM   4619 C CB  . SER B 1 57  ? 1.239   3.745   -76.134 1.00 58.64  ? 57   SER B CB  1 
ATOM   4620 O OG  . SER B 1 57  ? 0.919   2.388   -75.850 1.00 57.72  ? 57   SER B OG  1 
ATOM   4621 N N   . GLY B 1 58  ? -1.400  4.753   -74.873 1.00 58.03  ? 58   GLY B N   1 
ATOM   4622 C CA  . GLY B 1 58  ? -2.756  4.380   -74.488 1.00 58.68  ? 58   GLY B CA  1 
ATOM   4623 C C   . GLY B 1 58  ? -3.143  4.814   -73.084 1.00 58.19  ? 58   GLY B C   1 
ATOM   4624 O O   . GLY B 1 58  ? -2.655  5.830   -72.565 1.00 57.55  ? 58   GLY B O   1 
ATOM   4625 N N   . VAL B 1 59  ? -4.030  4.047   -72.459 1.00 58.50  ? 59   VAL B N   1 
ATOM   4626 C CA  . VAL B 1 59  ? -4.476  4.363   -71.103 1.00 58.04  ? 59   VAL B CA  1 
ATOM   4627 C C   . VAL B 1 59  ? -4.004  3.279   -70.149 1.00 57.43  ? 59   VAL B C   1 
ATOM   4628 O O   . VAL B 1 59  ? -4.374  2.108   -70.309 1.00 58.26  ? 59   VAL B O   1 
ATOM   4629 C CB  . VAL B 1 59  ? -6.018  4.492   -71.009 1.00 59.05  ? 59   VAL B CB  1 
ATOM   4630 C CG1 . VAL B 1 59  ? -6.418  4.954   -69.622 1.00 57.63  ? 59   VAL B CG1 1 
ATOM   4631 C CG2 . VAL B 1 59  ? -6.550  5.438   -72.072 1.00 59.79  ? 59   VAL B CG2 1 
ATOM   4632 N N   . LEU B 1 60  ? -3.188  3.670   -69.167 1.00 56.44  ? 60   LEU B N   1 
ATOM   4633 C CA  . LEU B 1 60  ? -2.653  2.726   -68.189 1.00 55.73  ? 60   LEU B CA  1 
ATOM   4634 C C   . LEU B 1 60  ? -3.672  2.425   -67.100 1.00 55.88  ? 60   LEU B C   1 
ATOM   4635 O O   . LEU B 1 60  ? -4.224  3.333   -66.490 1.00 55.60  ? 60   LEU B O   1 
ATOM   4636 C CB  . LEU B 1 60  ? -1.372  3.259   -67.557 1.00 54.28  ? 60   LEU B CB  1 
ATOM   4637 C CG  . LEU B 1 60  ? -0.641  2.196   -66.745 1.00 53.29  ? 60   LEU B CG  1 
ATOM   4638 C CD1 . LEU B 1 60  ? 0.696   1.843   -67.373 1.00 54.08  ? 60   LEU B CD1 1 
ATOM   4639 C CD2 . LEU B 1 60  ? -0.440  2.662   -65.351 1.00 51.79  ? 60   LEU B CD2 1 
ATOM   4640 N N   . ASP B 1 61  ? -3.909  1.140   -66.864 1.00 56.86  ? 61   ASP B N   1 
ATOM   4641 C CA  . ASP B 1 61  ? -4.848  0.690   -65.844 1.00 57.83  ? 61   ASP B CA  1 
ATOM   4642 C C   . ASP B 1 61  ? -4.312  0.940   -64.414 1.00 56.26  ? 61   ASP B C   1 
ATOM   4643 O O   . ASP B 1 61  ? -3.302  0.334   -63.988 1.00 55.23  ? 61   ASP B O   1 
ATOM   4644 C CB  . ASP B 1 61  ? -5.163  -0.789  -66.066 1.00 59.29  ? 61   ASP B CB  1 
ATOM   4645 C CG  . ASP B 1 61  ? -5.979  -1.388  -64.934 1.00 62.73  ? 61   ASP B CG  1 
ATOM   4646 O OD1 . ASP B 1 61  ? -7.177  -1.040  -64.809 1.00 67.00  ? 61   ASP B OD1 1 
ATOM   4647 O OD2 . ASP B 1 61  ? -5.420  -2.207  -64.169 1.00 65.36  ? 61   ASP B OD2 1 
ATOM   4648 N N   . ALA B 1 62  ? -4.979  1.838   -63.683 1.00 55.52  ? 62   ALA B N   1 
ATOM   4649 C CA  . ALA B 1 62  ? -4.524  2.220   -62.334 1.00 53.52  ? 62   ALA B CA  1 
ATOM   4650 C C   . ALA B 1 62  ? -5.640  2.004   -61.321 1.00 53.57  ? 62   ALA B C   1 
ATOM   4651 O O   . ALA B 1 62  ? -6.069  2.928   -60.638 1.00 53.80  ? 62   ALA B O   1 
ATOM   4652 C CB  . ALA B 1 62  ? -4.032  3.663   -62.313 1.00 52.45  ? 62   ALA B CB  1 
ATOM   4653 N N   . THR B 1 63  ? -6.098  0.765   -61.237 1.00 54.06  ? 63   THR B N   1 
ATOM   4654 C CA  . THR B 1 63  ? -7.285  0.419   -60.481 1.00 54.71  ? 63   THR B CA  1 
ATOM   4655 C C   . THR B 1 63  ? -6.989  -0.627  -59.421 1.00 54.06  ? 63   THR B C   1 
ATOM   4656 O O   . THR B 1 63  ? -7.872  -0.970  -58.633 1.00 54.70  ? 63   THR B O   1 
ATOM   4657 C CB  . THR B 1 63  ? -8.423  -0.121  -61.411 1.00 57.10  ? 63   THR B CB  1 
ATOM   4658 O OG1 . THR B 1 63  ? -7.955  -1.261  -62.157 1.00 57.21  ? 63   THR B OG1 1 
ATOM   4659 C CG2 . THR B 1 63  ? -8.928  0.964   -62.375 1.00 57.25  ? 63   THR B CG2 1 
ATOM   4660 N N   . THR B 1 64  ? -5.756  -1.138  -59.407 1.00 53.13  ? 64   THR B N   1 
ATOM   4661 C CA  . THR B 1 64  ? -5.337  -2.166  -58.440 1.00 52.69  ? 64   THR B CA  1 
ATOM   4662 C C   . THR B 1 64  ? -3.958  -1.857  -57.892 1.00 51.14  ? 64   THR B C   1 
ATOM   4663 O O   . THR B 1 64  ? -3.118  -1.240  -58.563 1.00 50.23  ? 64   THR B O   1 
ATOM   4664 C CB  . THR B 1 64  ? -5.254  -3.575  -59.065 1.00 54.09  ? 64   THR B CB  1 
ATOM   4665 O OG1 . THR B 1 64  ? -4.230  -3.582  -60.080 1.00 55.17  ? 64   THR B OG1 1 
ATOM   4666 C CG2 . THR B 1 64  ? -6.618  -4.041  -59.660 1.00 54.67  ? 64   THR B CG2 1 
ATOM   4667 N N   . PHE B 1 65  ? -3.715  -2.297  -56.664 1.00 50.51  ? 65   PHE B N   1 
ATOM   4668 C CA  . PHE B 1 65  ? -2.386  -2.190  -56.106 1.00 48.91  ? 65   PHE B CA  1 
ATOM   4669 C C   . PHE B 1 65  ? -1.427  -3.035  -56.885 1.00 48.96  ? 65   PHE B C   1 
ATOM   4670 O O   . PHE B 1 65  ? -1.753  -4.104  -57.390 1.00 50.35  ? 65   PHE B O   1 
ATOM   4671 C CB  . PHE B 1 65  ? -2.355  -2.624  -54.658 1.00 48.29  ? 65   PHE B CB  1 
ATOM   4672 C CG  . PHE B 1 65  ? -2.995  -1.656  -53.731 1.00 48.14  ? 65   PHE B CG  1 
ATOM   4673 C CD1 . PHE B 1 65  ? -2.453  -0.383  -53.550 1.00 44.55  ? 65   PHE B CD1 1 
ATOM   4674 C CD2 . PHE B 1 65  ? -4.143  -2.023  -53.016 1.00 48.22  ? 65   PHE B CD2 1 
ATOM   4675 C CE1 . PHE B 1 65  ? -3.030  0.511   -52.683 1.00 44.27  ? 65   PHE B CE1 1 
ATOM   4676 C CE2 . PHE B 1 65  ? -4.743  -1.134  -52.142 1.00 47.50  ? 65   PHE B CE2 1 
ATOM   4677 C CZ  . PHE B 1 65  ? -4.178  0.145   -51.969 1.00 47.35  ? 65   PHE B CZ  1 
ATOM   4678 N N   . GLN B 1 66  ? -0.215  -2.545  -56.946 1.00 48.31  ? 66   GLN B N   1 
ATOM   4679 C CA  . GLN B 1 66  ? 0.820   -3.139  -57.751 1.00 48.64  ? 66   GLN B CA  1 
ATOM   4680 C C   . GLN B 1 66  ? 1.678   -4.023  -56.785 1.00 47.82  ? 66   GLN B C   1 
ATOM   4681 O O   . GLN B 1 66  ? 1.367   -4.115  -55.583 1.00 46.30  ? 66   GLN B O   1 
ATOM   4682 C CB  . GLN B 1 66  ? 1.544   -1.952  -58.406 1.00 48.06  ? 66   GLN B CB  1 
ATOM   4683 C CG  . GLN B 1 66  ? 2.407   -2.177  -59.595 1.00 51.03  ? 66   GLN B CG  1 
ATOM   4684 C CD  . GLN B 1 66  ? 1.955   -3.224  -60.563 1.00 54.48  ? 66   GLN B CD  1 
ATOM   4685 O OE1 . GLN B 1 66  ? 1.136   -2.960  -61.432 1.00 55.40  ? 66   GLN B OE1 1 
ATOM   4686 N NE2 . GLN B 1 66  ? 2.537   -4.424  -60.450 1.00 55.25  ? 66   GLN B NE2 1 
ATOM   4687 N N   . ASN B 1 67  ? 2.694   -4.724  -57.299 1.00 47.95  ? 67   ASN B N   1 
ATOM   4688 C CA  . ASN B 1 67  ? 3.502   -5.636  -56.456 1.00 47.43  ? 67   ASN B CA  1 
ATOM   4689 C C   . ASN B 1 67  ? 4.187   -4.987  -55.255 1.00 45.86  ? 67   ASN B C   1 
ATOM   4690 O O   . ASN B 1 67  ? 4.598   -3.834  -55.306 1.00 45.07  ? 67   ASN B O   1 
ATOM   4691 C CB  . ASN B 1 67  ? 4.545   -6.396  -57.296 1.00 48.12  ? 67   ASN B CB  1 
ATOM   4692 C CG  . ASN B 1 67  ? 3.903   -7.378  -58.285 1.00 50.19  ? 67   ASN B CG  1 
ATOM   4693 O OD1 . ASN B 1 67  ? 2.819   -7.886  -58.031 1.00 50.44  ? 67   ASN B OD1 1 
ATOM   4694 N ND2 . ASN B 1 67  ? 4.574   -7.639  -59.415 1.00 50.49  ? 67   ASN B ND2 1 
ATOM   4695 N N   . VAL B 1 68  ? 4.304   -5.753  -54.177 1.00 45.65  ? 68   VAL B N   1 
ATOM   4696 C CA  . VAL B 1 68  ? 5.066   -5.376  -52.992 1.00 44.66  ? 68   VAL B CA  1 
ATOM   4697 C C   . VAL B 1 68  ? 6.569   -5.594  -53.211 1.00 44.63  ? 68   VAL B C   1 
ATOM   4698 O O   . VAL B 1 68  ? 6.971   -6.627  -53.762 1.00 45.97  ? 68   VAL B O   1 
ATOM   4699 C CB  . VAL B 1 68  ? 4.559   -6.213  -51.784 1.00 45.43  ? 68   VAL B CB  1 
ATOM   4700 C CG1 . VAL B 1 68  ? 5.487   -6.111  -50.573 1.00 43.26  ? 68   VAL B CG1 1 
ATOM   4701 C CG2 . VAL B 1 68  ? 3.139   -5.783  -51.416 1.00 45.31  ? 68   VAL B CG2 1 
ATOM   4702 N N   . CYS B 1 69  ? 7.401   -4.643  -52.792 1.00 43.62  ? 69   CYS B N   1 
ATOM   4703 C CA  . CYS B 1 69  ? 8.858   -4.812  -52.910 1.00 43.95  ? 69   CYS B CA  1 
ATOM   4704 C C   . CYS B 1 69  ? 9.360   -6.063  -52.202 1.00 44.83  ? 69   CYS B C   1 
ATOM   4705 O O   . CYS B 1 69  ? 8.874   -6.414  -51.123 1.00 44.64  ? 69   CYS B O   1 
ATOM   4706 C CB  . CYS B 1 69  ? 9.604   -3.606  -52.383 1.00 42.53  ? 69   CYS B CB  1 
ATOM   4707 S SG  . CYS B 1 69  ? 9.595   -2.162  -53.472 1.00 46.02  ? 69   CYS B SG  1 
ATOM   4708 N N   . TYR B 1 70  ? 10.331  -6.739  -52.817 1.00 46.12  ? 70   TYR B N   1 
ATOM   4709 C CA  . TYR B 1 70  ? 10.841  -7.977  -52.259 1.00 47.30  ? 70   TYR B CA  1 
ATOM   4710 C C   . TYR B 1 70  ? 11.398  -7.761  -50.861 1.00 47.19  ? 70   TYR B C   1 
ATOM   4711 O O   . TYR B 1 70  ? 12.210  -6.853  -50.635 1.00 46.81  ? 70   TYR B O   1 
ATOM   4712 C CB  . TYR B 1 70  ? 11.866  -8.654  -53.180 1.00 48.49  ? 70   TYR B CB  1 
ATOM   4713 C CG  . TYR B 1 70  ? 11.734  -10.162 -53.110 1.00 50.56  ? 70   TYR B CG  1 
ATOM   4714 C CD1 . TYR B 1 70  ? 10.855  -10.843 -53.945 1.00 51.02  ? 70   TYR B CD1 1 
ATOM   4715 C CD2 . TYR B 1 70  ? 12.440  -10.899 -52.160 1.00 51.87  ? 70   TYR B CD2 1 
ATOM   4716 C CE1 . TYR B 1 70  ? 10.702  -12.226 -53.848 1.00 53.98  ? 70   TYR B CE1 1 
ATOM   4717 C CE2 . TYR B 1 70  ? 12.294  -12.286 -52.062 1.00 53.39  ? 70   TYR B CE2 1 
ATOM   4718 C CZ  . TYR B 1 70  ? 11.424  -12.940 -52.898 1.00 53.83  ? 70   TYR B CZ  1 
ATOM   4719 O OH  . TYR B 1 70  ? 11.281  -14.298 -52.791 1.00 53.83  ? 70   TYR B OH  1 
ATOM   4720 N N   . GLN B 1 71  ? 10.921  -8.598  -49.936 1.00 48.32  ? 71   GLN B N   1 
ATOM   4721 C CA  . GLN B 1 71  ? 11.204  -8.492  -48.499 1.00 48.26  ? 71   GLN B CA  1 
ATOM   4722 C C   . GLN B 1 71  ? 10.925  -9.808  -47.785 1.00 50.01  ? 71   GLN B C   1 
ATOM   4723 O O   . GLN B 1 71  ? 10.134  -10.627 -48.256 1.00 50.48  ? 71   GLN B O   1 
ATOM   4724 C CB  . GLN B 1 71  ? 10.345  -7.400  -47.851 1.00 46.73  ? 71   GLN B CB  1 
ATOM   4725 C CG  . GLN B 1 71  ? 8.847   -7.725  -47.752 1.00 46.68  ? 71   GLN B CG  1 
ATOM   4726 C CD  . GLN B 1 71  ? 7.994   -6.481  -47.528 1.00 46.07  ? 71   GLN B CD  1 
ATOM   4727 O OE1 . GLN B 1 71  ? 7.258   -6.378  -46.541 1.00 46.41  ? 71   GLN B OE1 1 
ATOM   4728 N NE2 . GLN B 1 71  ? 8.096   -5.527  -48.446 1.00 43.26  ? 71   GLN B NE2 1 
ATOM   4729 N N   . TYR B 1 72  ? 11.573  -9.976  -46.634 1.00 51.08  ? 72   TYR B N   1 
ATOM   4730 C CA  . TYR B 1 72  ? 11.265  -11.027 -45.672 1.00 52.88  ? 72   TYR B CA  1 
ATOM   4731 C C   . TYR B 1 72  ? 9.801   -10.974 -45.233 1.00 53.18  ? 72   TYR B C   1 
ATOM   4732 O O   . TYR B 1 72  ? 9.253   -9.905  -44.989 1.00 51.97  ? 72   TYR B O   1 
ATOM   4733 C CB  . TYR B 1 72  ? 12.195  -10.858 -44.468 1.00 53.04  ? 72   TYR B CB  1 
ATOM   4734 C CG  . TYR B 1 72  ? 11.886  -11.737 -43.267 1.00 55.57  ? 72   TYR B CG  1 
ATOM   4735 C CD1 . TYR B 1 72  ? 11.292  -11.194 -42.117 1.00 55.90  ? 72   TYR B CD1 1 
ATOM   4736 C CD2 . TYR B 1 72  ? 12.198  -13.099 -43.269 1.00 58.42  ? 72   TYR B CD2 1 
ATOM   4737 C CE1 . TYR B 1 72  ? 11.009  -11.976 -41.010 1.00 57.99  ? 72   TYR B CE1 1 
ATOM   4738 C CE2 . TYR B 1 72  ? 11.908  -13.903 -42.160 1.00 61.45  ? 72   TYR B CE2 1 
ATOM   4739 C CZ  . TYR B 1 72  ? 11.317  -13.324 -41.029 1.00 61.34  ? 72   TYR B CZ  1 
ATOM   4740 O OH  . TYR B 1 72  ? 11.030  -14.095 -39.917 1.00 65.37  ? 72   TYR B OH  1 
ATOM   4741 N N   . VAL B 1 73  ? 9.175   -12.140 -45.139 1.00 55.37  ? 73   VAL B N   1 
ATOM   4742 C CA  . VAL B 1 73  ? 7.797   -12.259 -44.654 1.00 55.89  ? 73   VAL B CA  1 
ATOM   4743 C C   . VAL B 1 73  ? 7.805   -12.892 -43.254 1.00 57.49  ? 73   VAL B C   1 
ATOM   4744 O O   . VAL B 1 73  ? 8.452   -13.930 -43.043 1.00 58.14  ? 73   VAL B O   1 
ATOM   4745 C CB  . VAL B 1 73  ? 6.947   -13.116 -45.641 1.00 56.91  ? 73   VAL B CB  1 
ATOM   4746 C CG1 . VAL B 1 73  ? 5.543   -13.412 -45.078 1.00 56.38  ? 73   VAL B CG1 1 
ATOM   4747 C CG2 . VAL B 1 73  ? 6.866   -12.435 -46.990 1.00 55.35  ? 73   VAL B CG2 1 
ATOM   4748 N N   . ASP B 1 74  ? 7.084   -12.274 -42.313 1.00 57.93  ? 74   ASP B N   1 
ATOM   4749 C CA  . ASP B 1 74  ? 7.090   -12.715 -40.908 1.00 59.77  ? 74   ASP B CA  1 
ATOM   4750 C C   . ASP B 1 74  ? 6.427   -14.079 -40.694 1.00 61.95  ? 74   ASP B C   1 
ATOM   4751 O O   . ASP B 1 74  ? 5.343   -14.347 -41.206 1.00 62.44  ? 74   ASP B O   1 
ATOM   4752 C CB  . ASP B 1 74  ? 6.456   -11.656 -40.001 1.00 59.14  ? 74   ASP B CB  1 
ATOM   4753 C CG  . ASP B 1 74  ? 6.998   -11.696 -38.577 1.00 60.35  ? 74   ASP B CG  1 
ATOM   4754 O OD1 . ASP B 1 74  ? 6.558   -12.566 -37.788 1.00 61.67  ? 74   ASP B OD1 1 
ATOM   4755 O OD2 . ASP B 1 74  ? 7.863   -10.839 -38.252 1.00 60.64  ? 74   ASP B OD2 1 
ATOM   4756 N N   . THR B 1 75  ? 7.097   -14.934 -39.927 1.00 63.62  ? 75   THR B N   1 
ATOM   4757 C CA  . THR B 1 75  ? 6.664   -16.321 -39.747 1.00 66.17  ? 75   THR B CA  1 
ATOM   4758 C C   . THR B 1 75  ? 6.605   -16.745 -38.279 1.00 67.40  ? 75   THR B C   1 
ATOM   4759 O O   . THR B 1 75  ? 6.254   -17.886 -37.980 1.00 69.60  ? 75   THR B O   1 
ATOM   4760 C CB  . THR B 1 75  ? 7.566   -17.324 -40.541 1.00 67.56  ? 75   THR B CB  1 
ATOM   4761 O OG1 . THR B 1 75  ? 8.951   -17.025 -40.311 1.00 67.34  ? 75   THR B OG1 1 
ATOM   4762 C CG2 . THR B 1 75  ? 7.264   -17.281 -42.043 1.00 66.42  ? 75   THR B CG2 1 
ATOM   4763 N N   . LEU B 1 76  ? 6.928   -15.826 -37.371 1.00 66.46  ? 76   LEU B N   1 
ATOM   4764 C CA  . LEU B 1 76  ? 6.861   -16.093 -35.936 1.00 67.53  ? 76   LEU B CA  1 
ATOM   4765 C C   . LEU B 1 76  ? 5.488   -16.588 -35.441 1.00 69.10  ? 76   LEU B C   1 
ATOM   4766 O O   . LEU B 1 76  ? 5.415   -17.513 -34.614 1.00 70.74  ? 76   LEU B O   1 
ATOM   4767 C CB  . LEU B 1 76  ? 7.269   -14.854 -35.151 1.00 65.94  ? 76   LEU B CB  1 
ATOM   4768 C CG  . LEU B 1 76  ? 7.375   -15.017 -33.630 1.00 66.77  ? 76   LEU B CG  1 
ATOM   4769 C CD1 . LEU B 1 76  ? 8.486   -16.000 -33.261 1.00 68.16  ? 76   LEU B CD1 1 
ATOM   4770 C CD2 . LEU B 1 76  ? 7.583   -13.666 -32.955 1.00 63.79  ? 76   LEU B CD2 1 
ATOM   4771 N N   . TYR B 1 77  ? 4.417   -15.973 -35.945 1.00 68.42  ? 77   TYR B N   1 
ATOM   4772 C CA  . TYR B 1 77  ? 3.051   -16.318 -35.539 1.00 69.72  ? 77   TYR B CA  1 
ATOM   4773 C C   . TYR B 1 77  ? 2.124   -16.473 -36.748 1.00 69.88  ? 77   TYR B C   1 
ATOM   4774 O O   . TYR B 1 77  ? 1.288   -15.604 -37.002 1.00 68.97  ? 77   TYR B O   1 
ATOM   4775 C CB  . TYR B 1 77  ? 2.484   -15.255 -34.593 1.00 68.79  ? 77   TYR B CB  1 
ATOM   4776 C CG  . TYR B 1 77  ? 3.178   -15.151 -33.251 1.00 69.77  ? 77   TYR B CG  1 
ATOM   4777 C CD1 . TYR B 1 77  ? 3.274   -16.256 -32.407 1.00 72.15  ? 77   TYR B CD1 1 
ATOM   4778 C CD2 . TYR B 1 77  ? 3.713   -13.935 -32.809 1.00 68.50  ? 77   TYR B CD2 1 
ATOM   4779 C CE1 . TYR B 1 77  ? 3.899   -16.167 -31.164 1.00 72.73  ? 77   TYR B CE1 1 
ATOM   4780 C CE2 . TYR B 1 77  ? 4.341   -13.833 -31.562 1.00 69.04  ? 77   TYR B CE2 1 
ATOM   4781 C CZ  . TYR B 1 77  ? 4.429   -14.958 -30.742 1.00 71.60  ? 77   TYR B CZ  1 
ATOM   4782 O OH  . TYR B 1 77  ? 5.046   -14.889 -29.502 1.00 71.92  ? 77   TYR B OH  1 
ATOM   4783 N N   . PRO B 1 78  ? 2.244   -17.595 -37.482 1.00 71.28  ? 78   PRO B N   1 
ATOM   4784 C CA  . PRO B 1 78  ? 1.506   -17.706 -38.758 1.00 71.21  ? 78   PRO B CA  1 
ATOM   4785 C C   . PRO B 1 78  ? -0.022  -17.580 -38.616 1.00 71.56  ? 78   PRO B C   1 
ATOM   4786 O O   . PRO B 1 78  ? -0.627  -18.252 -37.775 1.00 73.11  ? 78   PRO B O   1 
ATOM   4787 C CB  . PRO B 1 78  ? 1.920   -19.089 -39.300 1.00 73.03  ? 78   PRO B CB  1 
ATOM   4788 C CG  . PRO B 1 78  ? 3.185   -19.466 -38.515 1.00 73.58  ? 78   PRO B CG  1 
ATOM   4789 C CD  . PRO B 1 78  ? 3.000   -18.826 -37.165 1.00 72.99  ? 78   PRO B CD  1 
ATOM   4790 N N   . GLY B 1 79  ? -0.619  -16.699 -39.422 1.00 69.94  ? 79   GLY B N   1 
ATOM   4791 C CA  . GLY B 1 79  ? -2.068  -16.486 -39.424 1.00 70.32  ? 79   GLY B CA  1 
ATOM   4792 C C   . GLY B 1 79  ? -2.638  -15.715 -38.234 1.00 69.93  ? 79   GLY B C   1 
ATOM   4793 O O   . GLY B 1 79  ? -3.855  -15.723 -38.007 1.00 71.02  ? 79   GLY B O   1 
ATOM   4794 N N   . PHE B 1 80  ? -1.766  -15.067 -37.462 1.00 67.87  ? 80   PHE B N   1 
ATOM   4795 C CA  . PHE B 1 80  ? -2.190  -14.227 -36.359 1.00 66.77  ? 80   PHE B CA  1 
ATOM   4796 C C   . PHE B 1 80  ? -2.309  -12.817 -36.921 1.00 64.73  ? 80   PHE B C   1 
ATOM   4797 O O   . PHE B 1 80  ? -1.392  -12.330 -37.577 1.00 63.24  ? 80   PHE B O   1 
ATOM   4798 C CB  . PHE B 1 80  ? -1.189  -14.347 -35.198 1.00 66.42  ? 80   PHE B CB  1 
ATOM   4799 C CG  . PHE B 1 80  ? -1.296  -13.259 -34.163 1.00 65.47  ? 80   PHE B CG  1 
ATOM   4800 C CD1 . PHE B 1 80  ? -2.436  -13.122 -33.375 1.00 65.88  ? 80   PHE B CD1 1 
ATOM   4801 C CD2 . PHE B 1 80  ? -0.240  -12.371 -33.959 1.00 63.54  ? 80   PHE B CD2 1 
ATOM   4802 C CE1 . PHE B 1 80  ? -2.529  -12.099 -32.417 1.00 63.93  ? 80   PHE B CE1 1 
ATOM   4803 C CE2 . PHE B 1 80  ? -0.324  -11.359 -32.991 1.00 61.82  ? 80   PHE B CE2 1 
ATOM   4804 C CZ  . PHE B 1 80  ? -1.473  -11.226 -32.228 1.00 61.90  ? 80   PHE B CZ  1 
ATOM   4805 N N   . GLU B 1 81  ? -3.453  -12.180 -36.696 1.00 64.99  ? 81   GLU B N   1 
ATOM   4806 C CA  . GLU B 1 81  ? -3.759  -10.869 -37.272 1.00 64.02  ? 81   GLU B CA  1 
ATOM   4807 C C   . GLU B 1 81  ? -2.686  -9.834  -36.951 1.00 61.24  ? 81   GLU B C   1 
ATOM   4808 O O   . GLU B 1 81  ? -2.290  -9.047  -37.817 1.00 59.55  ? 81   GLU B O   1 
ATOM   4809 C CB  . GLU B 1 81  ? -5.094  -10.375 -36.731 1.00 65.89  ? 81   GLU B CB  1 
ATOM   4810 C CG  . GLU B 1 81  ? -6.066  -9.767  -37.759 1.00 71.08  ? 81   GLU B CG  1 
ATOM   4811 C CD  . GLU B 1 81  ? -7.559  -9.873  -37.304 1.00 79.41  ? 81   GLU B CD  1 
ATOM   4812 O OE1 . GLU B 1 81  ? -8.027  -10.991 -36.951 1.00 81.55  ? 81   GLU B OE1 1 
ATOM   4813 O OE2 . GLU B 1 81  ? -8.262  -8.826  -37.295 1.00 81.51  ? 81   GLU B OE2 1 
ATOM   4814 N N   . GLY B 1 82  ? -2.216  -9.852  -35.705 1.00 60.36  ? 82   GLY B N   1 
ATOM   4815 C CA  . GLY B 1 82  ? -1.290  -8.855  -35.202 1.00 57.42  ? 82   GLY B CA  1 
ATOM   4816 C C   . GLY B 1 82  ? 0.029   -8.816  -35.933 1.00 55.66  ? 82   GLY B C   1 
ATOM   4817 O O   . GLY B 1 82  ? 0.719   -7.785  -35.922 1.00 53.82  ? 82   GLY B O   1 
ATOM   4818 N N   . THR B 1 83  ? 0.394   -9.935  -36.558 1.00 55.70  ? 83   THR B N   1 
ATOM   4819 C CA  . THR B 1 83  ? 1.572   -9.956  -37.419 1.00 54.28  ? 83   THR B CA  1 
ATOM   4820 C C   . THR B 1 83  ? 1.206   -9.881  -38.898 1.00 54.23  ? 83   THR B C   1 
ATOM   4821 O O   . THR B 1 83  ? 1.847   -9.164  -39.664 1.00 52.82  ? 83   THR B O   1 
ATOM   4822 C CB  . THR B 1 83  ? 2.505   -11.172 -37.160 1.00 55.23  ? 83   THR B CB  1 
ATOM   4823 O OG1 . THR B 1 83  ? 1.789   -12.407 -37.335 1.00 56.49  ? 83   THR B OG1 1 
ATOM   4824 C CG2 . THR B 1 83  ? 3.112   -11.110 -35.772 1.00 54.15  ? 83   THR B CG2 1 
ATOM   4825 N N   . GLU B 1 84  ? 0.174   -10.622 -39.296 1.00 56.13  ? 84   GLU B N   1 
ATOM   4826 C CA  . GLU B 1 84  ? -0.179  -10.734 -40.709 1.00 56.96  ? 84   GLU B CA  1 
ATOM   4827 C C   . GLU B 1 84  ? -0.608  -9.403  -41.294 1.00 55.39  ? 84   GLU B C   1 
ATOM   4828 O O   . GLU B 1 84  ? -0.569  -9.230  -42.507 1.00 55.77  ? 84   GLU B O   1 
ATOM   4829 C CB  . GLU B 1 84  ? -1.304  -11.748 -40.933 1.00 59.31  ? 84   GLU B CB  1 
ATOM   4830 C CG  . GLU B 1 84  ? -0.968  -13.187 -40.585 1.00 63.82  ? 84   GLU B CG  1 
ATOM   4831 C CD  . GLU B 1 84  ? 0.041   -13.839 -41.514 1.00 67.09  ? 84   GLU B CD  1 
ATOM   4832 O OE1 . GLU B 1 84  ? 0.354   -13.247 -42.580 1.00 68.25  ? 84   GLU B OE1 1 
ATOM   4833 O OE2 . GLU B 1 84  ? 0.513   -14.954 -41.168 1.00 68.40  ? 84   GLU B OE2 1 
ATOM   4834 N N   . MET B 1 85  ? -1.021  -8.467  -40.439 1.00 54.24  ? 85   MET B N   1 
ATOM   4835 C CA  . MET B 1 85  ? -1.510  -7.166  -40.897 1.00 52.37  ? 85   MET B CA  1 
ATOM   4836 C C   . MET B 1 85  ? -0.382  -6.297  -41.438 1.00 50.43  ? 85   MET B C   1 
ATOM   4837 O O   . MET B 1 85  ? -0.636  -5.274  -42.083 1.00 49.73  ? 85   MET B O   1 
ATOM   4838 C CB  . MET B 1 85  ? -2.242  -6.437  -39.775 1.00 52.43  ? 85   MET B CB  1 
ATOM   4839 C CG  . MET B 1 85  ? -1.356  -6.040  -38.607 1.00 51.55  ? 85   MET B CG  1 
ATOM   4840 S SD  . MET B 1 85  ? -2.245  -5.018  -37.432 1.00 52.29  ? 85   MET B SD  1 
ATOM   4841 C CE  . MET B 1 85  ? -2.364  -3.472  -38.338 1.00 48.68  ? 85   MET B CE  1 
ATOM   4842 N N   . TRP B 1 86  ? 0.854   -6.698  -41.153 1.00 49.35  ? 86   TRP B N   1 
ATOM   4843 C CA  . TRP B 1 86  ? 2.027   -5.971  -41.629 1.00 47.86  ? 86   TRP B CA  1 
ATOM   4844 C C   . TRP B 1 86  ? 2.725   -6.742  -42.762 1.00 48.13  ? 86   TRP B C   1 
ATOM   4845 O O   . TRP B 1 86  ? 3.720   -6.250  -43.323 1.00 46.75  ? 86   TRP B O   1 
ATOM   4846 C CB  . TRP B 1 86  ? 3.028   -5.706  -40.492 1.00 47.01  ? 86   TRP B CB  1 
ATOM   4847 C CG  . TRP B 1 86  ? 2.433   -5.087  -39.257 1.00 46.81  ? 86   TRP B CG  1 
ATOM   4848 C CD1 . TRP B 1 86  ? 2.238   -5.693  -38.062 1.00 46.32  ? 86   TRP B CD1 1 
ATOM   4849 C CD2 . TRP B 1 86  ? 1.956   -3.741  -39.108 1.00 45.33  ? 86   TRP B CD2 1 
ATOM   4850 N NE1 . TRP B 1 86  ? 1.672   -4.819  -37.175 1.00 46.17  ? 86   TRP B NE1 1 
ATOM   4851 C CE2 . TRP B 1 86  ? 1.479   -3.615  -37.791 1.00 44.85  ? 86   TRP B CE2 1 
ATOM   4852 C CE3 . TRP B 1 86  ? 1.879   -2.635  -39.963 1.00 43.82  ? 86   TRP B CE3 1 
ATOM   4853 C CZ2 . TRP B 1 86  ? 0.942   -2.422  -37.294 1.00 44.10  ? 86   TRP B CZ2 1 
ATOM   4854 C CZ3 . TRP B 1 86  ? 1.336   -1.446  -39.473 1.00 42.96  ? 86   TRP B CZ3 1 
ATOM   4855 C CH2 . TRP B 1 86  ? 0.876   -1.353  -38.151 1.00 43.20  ? 86   TRP B CH2 1 
ATOM   4856 N N   . ASN B 1 87  ? 2.217   -7.945  -43.066 1.00 48.54  ? 87   ASN B N   1 
ATOM   4857 C CA  . ASN B 1 87  ? 2.813   -8.810  -44.084 1.00 49.14  ? 87   ASN B CA  1 
ATOM   4858 C C   . ASN B 1 87  ? 2.392   -8.387  -45.499 1.00 48.95  ? 87   ASN B C   1 
ATOM   4859 O O   . ASN B 1 87  ? 1.360   -7.729  -45.666 1.00 48.93  ? 87   ASN B O   1 
ATOM   4860 C CB  . ASN B 1 87  ? 2.444   -10.289 -43.833 1.00 50.52  ? 87   ASN B CB  1 
ATOM   4861 C CG  . ASN B 1 87  ? 3.482   -11.045 -42.981 1.00 50.99  ? 87   ASN B CG  1 
ATOM   4862 O OD1 . ASN B 1 87  ? 4.621   -10.599 -42.789 1.00 51.00  ? 87   ASN B OD1 1 
ATOM   4863 N ND2 . ASN B 1 87  ? 3.083   -12.208 -42.476 1.00 51.25  ? 87   ASN B ND2 1 
ATOM   4864 N N   . PRO B 1 88  ? 3.178   -8.761  -46.531 1.00 49.14  ? 88   PRO B N   1 
ATOM   4865 C CA  . PRO B 1 88  ? 2.785   -8.340  -47.877 1.00 48.67  ? 88   PRO B CA  1 
ATOM   4866 C C   . PRO B 1 88  ? 1.380   -8.801  -48.213 1.00 50.34  ? 88   PRO B C   1 
ATOM   4867 O O   . PRO B 1 88  ? 1.038   -9.969  -47.979 1.00 52.00  ? 88   PRO B O   1 
ATOM   4868 C CB  . PRO B 1 88  ? 3.800   -9.038  -48.767 1.00 48.80  ? 88   PRO B CB  1 
ATOM   4869 C CG  . PRO B 1 88  ? 5.013   -9.173  -47.904 1.00 48.58  ? 88   PRO B CG  1 
ATOM   4870 C CD  . PRO B 1 88  ? 4.478   -9.468  -46.537 1.00 49.44  ? 88   PRO B CD  1 
ATOM   4871 N N   . ASN B 1 89  ? 0.554   -7.889  -48.732 1.00 50.10  ? 89   ASN B N   1 
ATOM   4872 C CA  . ASN B 1 89  ? -0.785  -8.270  -49.170 1.00 50.71  ? 89   ASN B CA  1 
ATOM   4873 C C   . ASN B 1 89  ? -0.941  -8.366  -50.698 1.00 50.90  ? 89   ASN B C   1 
ATOM   4874 O O   . ASN B 1 89  ? -2.039  -8.617  -51.208 1.00 52.26  ? 89   ASN B O   1 
ATOM   4875 C CB  . ASN B 1 89  ? -1.870  -7.431  -48.484 1.00 50.49  ? 89   ASN B CB  1 
ATOM   4876 C CG  . ASN B 1 89  ? -1.854  -5.974  -48.903 1.00 50.55  ? 89   ASN B CG  1 
ATOM   4877 O OD1 . ASN B 1 89  ? -0.879  -5.469  -49.472 1.00 49.23  ? 89   ASN B OD1 1 
ATOM   4878 N ND2 . ASN B 1 89  ? -2.949  -5.284  -48.614 1.00 51.64  ? 89   ASN B ND2 1 
ATOM   4879 N N   . ARG B 1 90  ? 0.160   -8.167  -51.416 1.00 49.75  ? 90   ARG B N   1 
ATOM   4880 C CA  A ARG B 1 90  ? 0.209   -8.447  -52.851 0.50 49.98  ? 90   ARG B CA  1 
ATOM   4881 C CA  B ARG B 1 90  ? 0.208   -8.451  -52.852 0.50 50.41  ? 90   ARG B CA  1 
ATOM   4882 C C   . ARG B 1 90  ? 1.418   -9.345  -53.160 1.00 50.75  ? 90   ARG B C   1 
ATOM   4883 O O   . ARG B 1 90  ? 2.140   -9.769  -52.258 1.00 50.81  ? 90   ARG B O   1 
ATOM   4884 C CB  A ARG B 1 90  ? 0.258   -7.150  -53.672 0.50 48.55  ? 90   ARG B CB  1 
ATOM   4885 C CB  B ARG B 1 90  ? 0.253   -7.159  -53.681 0.50 49.29  ? 90   ARG B CB  1 
ATOM   4886 C CG  A ARG B 1 90  ? -0.978  -6.265  -53.564 0.50 46.55  ? 90   ARG B CG  1 
ATOM   4887 C CG  B ARG B 1 90  ? -1.062  -6.390  -53.762 0.50 49.41  ? 90   ARG B CG  1 
ATOM   4888 C CD  A ARG B 1 90  ? -2.260  -7.005  -53.932 0.50 45.55  ? 90   ARG B CD  1 
ATOM   4889 C CD  B ARG B 1 90  ? -2.177  -7.181  -54.452 0.50 52.23  ? 90   ARG B CD  1 
ATOM   4890 N NE  A ARG B 1 90  ? -3.441  -6.147  -53.798 0.50 44.25  ? 90   ARG B NE  1 
ATOM   4891 N NE  B ARG B 1 90  ? -3.463  -6.500  -54.308 0.50 54.29  ? 90   ARG B NE  1 
ATOM   4892 C CZ  A ARG B 1 90  ? -4.387  -6.289  -52.875 0.50 40.81  ? 90   ARG B CZ  1 
ATOM   4893 C CZ  B ARG B 1 90  ? -4.158  -5.945  -55.303 0.50 55.18  ? 90   ARG B CZ  1 
ATOM   4894 N NH1 A ARG B 1 90  ? -4.313  -7.263  -51.991 0.50 40.71  ? 90   ARG B NH1 1 
ATOM   4895 N NH1 B ARG B 1 90  ? -3.726  -6.002  -56.563 0.50 53.21  ? 90   ARG B NH1 1 
ATOM   4896 N NH2 A ARG B 1 90  ? -5.406  -5.451  -52.844 0.50 37.85  ? 90   ARG B NH2 1 
ATOM   4897 N NH2 B ARG B 1 90  ? -5.306  -5.329  -55.029 0.50 56.14  ? 90   ARG B NH2 1 
ATOM   4898 N N   . GLU B 1 91  ? 1.634   -9.639  -54.433 1.00 51.59  ? 91   GLU B N   1 
ATOM   4899 C CA  . GLU B 1 91  ? 2.739   -10.482 -54.861 1.00 52.35  ? 91   GLU B CA  1 
ATOM   4900 C C   . GLU B 1 91  ? 4.071   -9.789  -54.619 1.00 50.59  ? 91   GLU B C   1 
ATOM   4901 O O   . GLU B 1 91  ? 4.202   -8.580  -54.821 1.00 49.75  ? 91   GLU B O   1 
ATOM   4902 C CB  . GLU B 1 91  ? 2.583   -10.799 -56.352 1.00 53.56  ? 91   GLU B CB  1 
ATOM   4903 C CG  . GLU B 1 91  ? 3.062   -12.184 -56.752 1.00 59.08  ? 91   GLU B CG  1 
ATOM   4904 C CD  . GLU B 1 91  ? 2.211   -13.302 -56.148 1.00 63.18  ? 91   GLU B CD  1 
ATOM   4905 O OE1 . GLU B 1 91  ? 0.983   -13.346 -56.418 1.00 63.07  ? 91   GLU B OE1 1 
ATOM   4906 O OE2 . GLU B 1 91  ? 2.793   -14.134 -55.410 1.00 64.91  ? 91   GLU B OE2 1 
ATOM   4907 N N   . LEU B 1 92  ? 5.060   -10.550 -54.171 1.00 50.35  ? 92   LEU B N   1 
ATOM   4908 C CA  . LEU B 1 92  ? 6.398   -10.025 -54.036 1.00 48.99  ? 92   LEU B CA  1 
ATOM   4909 C C   . LEU B 1 92  ? 7.038   -9.887  -55.411 1.00 49.32  ? 92   LEU B C   1 
ATOM   4910 O O   . LEU B 1 92  ? 6.852   -10.741 -56.263 1.00 50.44  ? 92   LEU B O   1 
ATOM   4911 C CB  . LEU B 1 92  ? 7.238   -10.951 -53.164 1.00 49.34  ? 92   LEU B CB  1 
ATOM   4912 C CG  . LEU B 1 92  ? 6.977   -10.991 -51.655 1.00 49.43  ? 92   LEU B CG  1 
ATOM   4913 C CD1 . LEU B 1 92  ? 8.003   -11.889 -50.962 1.00 47.40  ? 92   LEU B CD1 1 
ATOM   4914 C CD2 . LEU B 1 92  ? 6.989   -9.602  -51.040 1.00 46.79  ? 92   LEU B CD2 1 
ATOM   4915 N N   . SER B 1 93  ? 7.804   -8.817  -55.623 1.00 48.39  ? 93   SER B N   1 
ATOM   4916 C CA  . SER B 1 93  ? 8.567   -8.650  -56.866 1.00 48.13  ? 93   SER B CA  1 
ATOM   4917 C C   . SER B 1 93  ? 9.592   -7.544  -56.710 1.00 46.96  ? 93   SER B C   1 
ATOM   4918 O O   . SER B 1 93  ? 9.336   -6.550  -56.022 1.00 46.30  ? 93   SER B O   1 
ATOM   4919 C CB  . SER B 1 93  ? 7.628   -8.281  -58.006 1.00 48.23  ? 93   SER B CB  1 
ATOM   4920 O OG  . SER B 1 93  ? 8.349   -8.137  -59.209 1.00 49.86  ? 93   SER B OG  1 
ATOM   4921 N N   . GLU B 1 94  ? 10.746  -7.695  -57.353 1.00 47.18  ? 94   GLU B N   1 
ATOM   4922 C CA  . GLU B 1 94  ? 11.727  -6.605  -57.401 1.00 45.97  ? 94   GLU B CA  1 
ATOM   4923 C C   . GLU B 1 94  ? 11.208  -5.433  -58.229 1.00 45.45  ? 94   GLU B C   1 
ATOM   4924 O O   . GLU B 1 94  ? 11.734  -4.318  -58.143 1.00 44.72  ? 94   GLU B O   1 
ATOM   4925 C CB  . GLU B 1 94  ? 13.080  -7.081  -57.928 1.00 47.02  ? 94   GLU B CB  1 
ATOM   4926 C CG  . GLU B 1 94  ? 13.943  -7.749  -56.876 1.00 47.08  ? 94   GLU B CG  1 
ATOM   4927 C CD  . GLU B 1 94  ? 15.319  -8.133  -57.402 1.00 50.19  ? 94   GLU B CD  1 
ATOM   4928 O OE1 . GLU B 1 94  ? 16.274  -7.345  -57.201 1.00 51.62  ? 94   GLU B OE1 1 
ATOM   4929 O OE2 . GLU B 1 94  ? 15.449  -9.208  -58.031 1.00 51.39  ? 94   GLU B OE2 1 
ATOM   4930 N N   . ASP B 1 95  ? 10.174  -5.699  -59.028 1.00 45.75  ? 95   ASP B N   1 
ATOM   4931 C CA  . ASP B 1 95  ? 9.532   -4.689  -59.846 1.00 45.31  ? 95   ASP B CA  1 
ATOM   4932 C C   . ASP B 1 95  ? 8.390   -4.086  -59.025 1.00 44.71  ? 95   ASP B C   1 
ATOM   4933 O O   . ASP B 1 95  ? 7.263   -4.557  -59.098 1.00 45.51  ? 95   ASP B O   1 
ATOM   4934 C CB  . ASP B 1 95  ? 9.062   -5.350  -61.146 1.00 45.89  ? 95   ASP B CB  1 
ATOM   4935 C CG  . ASP B 1 95  ? 8.201   -4.445  -62.044 1.00 46.58  ? 95   ASP B CG  1 
ATOM   4936 O OD1 . ASP B 1 95  ? 7.885   -3.270  -61.707 1.00 45.69  ? 95   ASP B OD1 1 
ATOM   4937 O OD2 . ASP B 1 95  ? 7.817   -4.960  -63.126 1.00 48.13  ? 95   ASP B OD2 1 
ATOM   4938 N N   . CYS B 1 96  ? 8.683   -3.041  -58.247 1.00 43.63  ? 96   CYS B N   1 
ATOM   4939 C CA  . CYS B 1 96  ? 7.713   -2.518  -57.264 1.00 42.90  ? 96   CYS B CA  1 
ATOM   4940 C C   . CYS B 1 96  ? 7.596   -0.985  -57.133 1.00 41.47  ? 96   CYS B C   1 
ATOM   4941 O O   . CYS B 1 96  ? 6.889   -0.493  -56.259 1.00 41.13  ? 96   CYS B O   1 
ATOM   4942 C CB  . CYS B 1 96  ? 8.030   -3.105  -55.890 1.00 42.91  ? 96   CYS B CB  1 
ATOM   4943 S SG  . CYS B 1 96  ? 9.770   -2.885  -55.387 1.00 45.04  ? 96   CYS B SG  1 
ATOM   4944 N N   . LEU B 1 97  ? 8.256   -0.238  -58.007 1.00 40.60  ? 97   LEU B N   1 
ATOM   4945 C CA  . LEU B 1 97  ? 8.283   1.204   -57.891 1.00 39.22  ? 97   LEU B CA  1 
ATOM   4946 C C   . LEU B 1 97  ? 6.997   1.872   -58.434 1.00 39.99  ? 97   LEU B C   1 
ATOM   4947 O O   . LEU B 1 97  ? 6.925   2.395   -59.560 1.00 40.19  ? 97   LEU B O   1 
ATOM   4948 C CB  . LEU B 1 97  ? 9.593   1.758   -58.470 1.00 38.84  ? 97   LEU B CB  1 
ATOM   4949 C CG  . LEU B 1 97  ? 10.847  1.185   -57.781 1.00 38.90  ? 97   LEU B CG  1 
ATOM   4950 C CD1 . LEU B 1 97  ? 12.112  1.941   -58.133 1.00 38.11  ? 97   LEU B CD1 1 
ATOM   4951 C CD2 . LEU B 1 97  ? 10.711  1.121   -56.238 1.00 37.51  ? 97   LEU B CD2 1 
ATOM   4952 N N   . TYR B 1 98  ? 5.971   1.845   -57.589 1.00 40.14  ? 98   TYR B N   1 
ATOM   4953 C CA  . TYR B 1 98  ? 4.668   2.376   -57.936 1.00 40.90  ? 98   TYR B CA  1 
ATOM   4954 C C   . TYR B 1 98  ? 4.133   3.159   -56.760 1.00 41.06  ? 98   TYR B C   1 
ATOM   4955 O O   . TYR B 1 98  ? 4.506   2.896   -55.605 1.00 41.16  ? 98   TYR B O   1 
ATOM   4956 C CB  . TYR B 1 98  ? 3.697   1.249   -58.287 1.00 41.13  ? 98   TYR B CB  1 
ATOM   4957 C CG  . TYR B 1 98  ? 4.190   0.399   -59.434 1.00 43.01  ? 98   TYR B CG  1 
ATOM   4958 C CD1 . TYR B 1 98  ? 3.809   0.679   -60.766 1.00 43.24  ? 98   TYR B CD1 1 
ATOM   4959 C CD2 . TYR B 1 98  ? 5.049   -0.688  -59.208 1.00 41.18  ? 98   TYR B CD2 1 
ATOM   4960 C CE1 . TYR B 1 98  ? 4.275   -0.109  -61.811 1.00 42.47  ? 98   TYR B CE1 1 
ATOM   4961 C CE2 . TYR B 1 98  ? 5.514   -1.471  -60.262 1.00 41.42  ? 98   TYR B CE2 1 
ATOM   4962 C CZ  . TYR B 1 98  ? 5.130   -1.173  -61.545 1.00 41.92  ? 98   TYR B CZ  1 
ATOM   4963 O OH  . TYR B 1 98  ? 5.594   -1.958  -62.571 1.00 44.77  ? 98   TYR B OH  1 
ATOM   4964 N N   . LEU B 1 99  ? 3.252   4.114   -57.047 1.00 41.15  ? 99   LEU B N   1 
ATOM   4965 C CA  . LEU B 1 99  ? 2.611   4.856   -56.001 1.00 40.62  ? 99   LEU B CA  1 
ATOM   4966 C C   . LEU B 1 99  ? 1.097   4.870   -56.201 1.00 41.87  ? 99   LEU B C   1 
ATOM   4967 O O   . LEU B 1 99  ? 0.602   4.501   -57.263 1.00 43.11  ? 99   LEU B O   1 
ATOM   4968 C CB  . LEU B 1 99  ? 3.187   6.272   -55.939 1.00 40.21  ? 99   LEU B CB  1 
ATOM   4969 C CG  . LEU B 1 99  ? 3.296   7.081   -57.235 1.00 40.60  ? 99   LEU B CG  1 
ATOM   4970 C CD1 . LEU B 1 99  ? 1.971   7.759   -57.591 1.00 37.64  ? 99   LEU B CD1 1 
ATOM   4971 C CD2 . LEU B 1 99  ? 4.441   8.102   -57.135 1.00 37.89  ? 99   LEU B CD2 1 
ATOM   4972 N N   . ASN B 1 100 ? 0.376   5.326   -55.180 1.00 41.64  ? 100  ASN B N   1 
ATOM   4973 C CA  . ASN B 1 100 ? -1.062  5.371   -55.193 1.00 42.29  ? 100  ASN B CA  1 
ATOM   4974 C C   . ASN B 1 100 ? -1.514  6.778   -54.820 1.00 42.51  ? 100  ASN B C   1 
ATOM   4975 O O   . ASN B 1 100 ? -0.868  7.437   -54.021 1.00 42.54  ? 100  ASN B O   1 
ATOM   4976 C CB  . ASN B 1 100 ? -1.578  4.349   -54.186 1.00 42.10  ? 100  ASN B CB  1 
ATOM   4977 C CG  . ASN B 1 100 ? -0.792  3.047   -54.238 1.00 42.18  ? 100  ASN B CG  1 
ATOM   4978 O OD1 . ASN B 1 100 ? -0.836  2.337   -55.234 1.00 44.80  ? 100  ASN B OD1 1 
ATOM   4979 N ND2 . ASN B 1 100 ? -0.052  2.739   -53.177 1.00 40.65  ? 100  ASN B ND2 1 
ATOM   4980 N N   . VAL B 1 101 ? -2.620  7.233   -55.396 1.00 43.38  ? 101  VAL B N   1 
ATOM   4981 C CA  . VAL B 1 101 ? -3.197  8.544   -55.116 1.00 43.68  ? 101  VAL B CA  1 
ATOM   4982 C C   . VAL B 1 101 ? -4.680  8.355   -54.822 1.00 45.61  ? 101  VAL B C   1 
ATOM   4983 O O   . VAL B 1 101 ? -5.408  7.741   -55.617 1.00 47.02  ? 101  VAL B O   1 
ATOM   4984 C CB  . VAL B 1 101 ? -3.049  9.518   -56.345 1.00 44.05  ? 101  VAL B CB  1 
ATOM   4985 C CG1 . VAL B 1 101 ? -3.765  10.818  -56.109 1.00 43.20  ? 101  VAL B CG1 1 
ATOM   4986 C CG2 . VAL B 1 101 ? -1.580  9.806   -56.657 1.00 42.89  ? 101  VAL B CG2 1 
ATOM   4987 N N   . TRP B 1 102 ? -5.129  8.862   -53.676 1.00 46.17  ? 102  TRP B N   1 
ATOM   4988 C CA  . TRP B 1 102 ? -6.559  9.005   -53.404 1.00 47.57  ? 102  TRP B CA  1 
ATOM   4989 C C   . TRP B 1 102 ? -6.913  10.482  -53.456 1.00 49.07  ? 102  TRP B C   1 
ATOM   4990 O O   . TRP B 1 102 ? -6.208  11.322  -52.881 1.00 48.00  ? 102  TRP B O   1 
ATOM   4991 C CB  . TRP B 1 102 ? -6.917  8.468   -52.025 1.00 46.89  ? 102  TRP B CB  1 
ATOM   4992 C CG  . TRP B 1 102 ? -6.836  6.991   -51.871 1.00 46.55  ? 102  TRP B CG  1 
ATOM   4993 C CD1 . TRP B 1 102 ? -7.855  6.097   -52.030 1.00 48.18  ? 102  TRP B CD1 1 
ATOM   4994 C CD2 . TRP B 1 102 ? -5.680  6.224   -51.506 1.00 44.09  ? 102  TRP B CD2 1 
ATOM   4995 N NE1 . TRP B 1 102 ? -7.408  4.820   -51.785 1.00 48.71  ? 102  TRP B NE1 1 
ATOM   4996 C CE2 . TRP B 1 102 ? -6.076  4.870   -51.464 1.00 44.95  ? 102  TRP B CE2 1 
ATOM   4997 C CE3 . TRP B 1 102 ? -4.345  6.553   -51.215 1.00 42.72  ? 102  TRP B CE3 1 
ATOM   4998 C CZ2 . TRP B 1 102 ? -5.188  3.835   -51.140 1.00 43.60  ? 102  TRP B CZ2 1 
ATOM   4999 C CZ3 . TRP B 1 102 ? -3.462  5.533   -50.879 1.00 40.87  ? 102  TRP B CZ3 1 
ATOM   5000 C CH2 . TRP B 1 102 ? -3.891  4.183   -50.845 1.00 42.73  ? 102  TRP B CH2 1 
ATOM   5001 N N   . THR B 1 103 ? -8.019  10.784  -54.127 1.00 51.34  ? 103  THR B N   1 
ATOM   5002 C CA  . THR B 1 103 ? -8.523  12.142  -54.248 1.00 53.64  ? 103  THR B CA  1 
ATOM   5003 C C   . THR B 1 103 ? -10.021 12.125  -53.875 1.00 55.40  ? 103  THR B C   1 
ATOM   5004 O O   . THR B 1 103 ? -10.614 11.054  -53.836 1.00 56.18  ? 103  THR B O   1 
ATOM   5005 C CB  . THR B 1 103 ? -8.343  12.659  -55.698 1.00 54.70  ? 103  THR B CB  1 
ATOM   5006 O OG1 . THR B 1 103 ? -8.649  14.054  -55.748 1.00 58.63  ? 103  THR B OG1 1 
ATOM   5007 C CG2 . THR B 1 103 ? -9.305  11.960  -56.650 1.00 54.65  ? 103  THR B CG2 1 
ATOM   5008 N N   . PRO B 1 104 ? -10.626 13.291  -53.547 1.00 56.63  ? 104  PRO B N   1 
ATOM   5009 C CA  . PRO B 1 104 ? -12.093 13.359  -53.465 1.00 58.51  ? 104  PRO B CA  1 
ATOM   5010 C C   . PRO B 1 104 ? -12.751 13.149  -54.821 1.00 60.61  ? 104  PRO B C   1 
ATOM   5011 O O   . PRO B 1 104 ? -12.142 13.425  -55.862 1.00 60.96  ? 104  PRO B O   1 
ATOM   5012 C CB  . PRO B 1 104 ? -12.357 14.788  -53.012 1.00 58.80  ? 104  PRO B CB  1 
ATOM   5013 C CG  . PRO B 1 104 ? -11.168 15.158  -52.250 1.00 57.64  ? 104  PRO B CG  1 
ATOM   5014 C CD  . PRO B 1 104 ? -9.997  14.438  -52.866 1.00 56.05  ? 104  PRO B CD  1 
ATOM   5015 N N   . TYR B 1 105 ? -13.985 12.651  -54.791 1.00 62.46  ? 105  TYR B N   1 
ATOM   5016 C CA  . TYR B 1 105 ? -14.798 12.452  -55.975 1.00 64.19  ? 105  TYR B CA  1 
ATOM   5017 C C   . TYR B 1 105 ? -16.036 13.275  -55.748 1.00 66.94  ? 105  TYR B C   1 
ATOM   5018 O O   . TYR B 1 105 ? -16.763 13.015  -54.793 1.00 67.78  ? 105  TYR B O   1 
ATOM   5019 C CB  . TYR B 1 105 ? -15.190 10.985  -56.109 1.00 64.01  ? 105  TYR B CB  1 
ATOM   5020 C CG  . TYR B 1 105 ? -16.003 10.659  -57.337 1.00 64.75  ? 105  TYR B CG  1 
ATOM   5021 C CD1 . TYR B 1 105 ? -15.432 9.987   -58.408 1.00 63.46  ? 105  TYR B CD1 1 
ATOM   5022 C CD2 . TYR B 1 105 ? -17.353 11.012  -57.425 1.00 66.68  ? 105  TYR B CD2 1 
ATOM   5023 C CE1 . TYR B 1 105 ? -16.176 9.674   -59.538 1.00 64.92  ? 105  TYR B CE1 1 
ATOM   5024 C CE2 . TYR B 1 105 ? -18.113 10.710  -58.556 1.00 67.51  ? 105  TYR B CE2 1 
ATOM   5025 C CZ  . TYR B 1 105 ? -17.519 10.038  -59.610 1.00 67.24  ? 105  TYR B CZ  1 
ATOM   5026 O OH  . TYR B 1 105 ? -18.258 9.731   -60.743 1.00 68.15  ? 105  TYR B OH  1 
ATOM   5027 N N   . PRO B 1 106 ? -16.297 14.273  -56.618 1.00 69.15  ? 106  PRO B N   1 
ATOM   5028 C CA  . PRO B 1 106 ? -15.503 14.642  -57.797 1.00 69.37  ? 106  PRO B CA  1 
ATOM   5029 C C   . PRO B 1 106 ? -14.162 15.244  -57.388 1.00 68.21  ? 106  PRO B C   1 
ATOM   5030 O O   . PRO B 1 106 ? -14.019 15.678  -56.245 1.00 67.50  ? 106  PRO B O   1 
ATOM   5031 C CB  . PRO B 1 106 ? -16.379 15.701  -58.486 1.00 71.76  ? 106  PRO B CB  1 
ATOM   5032 C CG  . PRO B 1 106 ? -17.186 16.308  -57.370 1.00 72.00  ? 106  PRO B CG  1 
ATOM   5033 C CD  . PRO B 1 106 ? -17.470 15.162  -56.442 1.00 71.21  ? 106  PRO B CD  1 
ATOM   5034 N N   . ARG B 1 107 ? -13.189 15.255  -58.302 1.00 68.40  ? 107  ARG B N   1 
ATOM   5035 C CA  . ARG B 1 107 ? -11.869 15.829  -58.010 1.00 67.85  ? 107  ARG B CA  1 
ATOM   5036 C C   . ARG B 1 107 ? -11.976 17.273  -57.515 1.00 68.78  ? 107  ARG B C   1 
ATOM   5037 O O   . ARG B 1 107 ? -12.845 18.011  -57.972 1.00 70.86  ? 107  ARG B O   1 
ATOM   5038 C CB  . ARG B 1 107 ? -10.944 15.722  -59.219 1.00 67.56  ? 107  ARG B CB  1 
ATOM   5039 C CG  . ARG B 1 107 ? -10.408 14.289  -59.426 1.00 68.75  ? 107  ARG B CG  1 
ATOM   5040 C CD  . ARG B 1 107 ? -9.117  14.299  -60.210 1.00 69.74  ? 107  ARG B CD  1 
ATOM   5041 N NE  . ARG B 1 107 ? -9.208  15.263  -61.308 1.00 73.05  ? 107  ARG B NE  1 
ATOM   5042 C CZ  . ARG B 1 107 ? -9.389  14.938  -62.587 1.00 74.56  ? 107  ARG B CZ  1 
ATOM   5043 N NH1 . ARG B 1 107 ? -9.486  13.662  -62.966 1.00 74.05  ? 107  ARG B NH1 1 
ATOM   5044 N NH2 . ARG B 1 107 ? -9.463  15.900  -63.495 1.00 76.61  ? 107  ARG B NH2 1 
ATOM   5045 N N   . PRO B 1 108 ? -11.108 17.672  -56.570 1.00 67.56  ? 108  PRO B N   1 
ATOM   5046 C CA  . PRO B 1 108 ? -11.204 18.972  -55.919 1.00 68.72  ? 108  PRO B CA  1 
ATOM   5047 C C   . PRO B 1 108 ? -11.241 20.144  -56.896 1.00 70.65  ? 108  PRO B C   1 
ATOM   5048 O O   . PRO B 1 108 ? -10.491 20.163  -57.882 1.00 70.41  ? 108  PRO B O   1 
ATOM   5049 C CB  . PRO B 1 108 ? -9.925  19.029  -55.084 1.00 66.79  ? 108  PRO B CB  1 
ATOM   5050 C CG  . PRO B 1 108 ? -9.635  17.613  -54.787 1.00 65.41  ? 108  PRO B CG  1 
ATOM   5051 C CD  . PRO B 1 108 ? -9.968  16.899  -56.051 1.00 65.54  ? 108  PRO B CD  1 
ATOM   5052 N N   . ALA B 1 109 ? -12.108 21.109  -56.599 1.00 72.71  ? 109  ALA B N   1 
ATOM   5053 C CA  . ALA B 1 109 ? -12.304 22.301  -57.432 1.00 74.99  ? 109  ALA B CA  1 
ATOM   5054 C C   . ALA B 1 109 ? -11.089 23.237  -57.404 1.00 74.44  ? 109  ALA B C   1 
ATOM   5055 O O   . ALA B 1 109 ? -10.711 23.808  -58.425 1.00 75.37  ? 109  ALA B O   1 
ATOM   5056 C CB  . ALA B 1 109 ? -13.583 23.056  -57.002 1.00 77.09  ? 109  ALA B CB  1 
ATOM   5057 N N   . SER B 1 110 ? -10.487 23.396  -56.229 1.00 73.01  ? 110  SER B N   1 
ATOM   5058 C CA  . SER B 1 110 ? -9.302  24.235  -56.080 1.00 72.25  ? 110  SER B CA  1 
ATOM   5059 C C   . SER B 1 110 ? -8.194  23.393  -55.467 1.00 69.64  ? 110  SER B C   1 
ATOM   5060 O O   . SER B 1 110 ? -8.492  22.445  -54.736 1.00 69.01  ? 110  SER B O   1 
ATOM   5061 C CB  . SER B 1 110 ? -9.618  25.417  -55.178 1.00 73.39  ? 110  SER B CB  1 
ATOM   5062 O OG  . SER B 1 110 ? -10.096 24.953  -53.934 1.00 72.96  ? 110  SER B OG  1 
ATOM   5063 N N   . PRO B 1 111 ? -6.913  23.738  -55.742 1.00 68.33  ? 111  PRO B N   1 
ATOM   5064 C CA  . PRO B 1 111 ? -5.774  22.931  -55.265 1.00 65.38  ? 111  PRO B CA  1 
ATOM   5065 C C   . PRO B 1 111 ? -5.817  22.604  -53.753 1.00 63.33  ? 111  PRO B C   1 
ATOM   5066 O O   . PRO B 1 111 ? -6.006  23.490  -52.925 1.00 64.01  ? 111  PRO B O   1 
ATOM   5067 C CB  . PRO B 1 111 ? -4.562  23.811  -55.601 1.00 65.71  ? 111  PRO B CB  1 
ATOM   5068 C CG  . PRO B 1 111 ? -5.034  24.718  -56.693 1.00 67.92  ? 111  PRO B CG  1 
ATOM   5069 C CD  . PRO B 1 111 ? -6.464  24.987  -56.389 1.00 69.52  ? 111  PRO B CD  1 
ATOM   5070 N N   . THR B 1 112 ? -5.629  21.332  -53.419 1.00 60.84  ? 112  THR B N   1 
ATOM   5071 C CA  . THR B 1 112 ? -5.774  20.820  -52.058 1.00 58.90  ? 112  THR B CA  1 
ATOM   5072 C C   . THR B 1 112 ? -4.422  20.418  -51.473 1.00 56.22  ? 112  THR B C   1 
ATOM   5073 O O   . THR B 1 112 ? -3.580  19.896  -52.188 1.00 55.58  ? 112  THR B O   1 
ATOM   5074 C CB  . THR B 1 112 ? -6.681  19.581  -52.059 1.00 58.85  ? 112  THR B CB  1 
ATOM   5075 O OG1 . THR B 1 112 ? -7.933  19.920  -52.668 1.00 61.74  ? 112  THR B OG1 1 
ATOM   5076 C CG2 . THR B 1 112 ? -6.929  19.065  -50.647 1.00 58.20  ? 112  THR B CG2 1 
ATOM   5077 N N   . PRO B 1 113 ? -4.206  20.659  -50.164 1.00 54.71  ? 113  PRO B N   1 
ATOM   5078 C CA  . PRO B 1 113 ? -2.969  20.165  -49.567 1.00 51.89  ? 113  PRO B CA  1 
ATOM   5079 C C   . PRO B 1 113 ? -2.792  18.680  -49.797 1.00 49.80  ? 113  PRO B C   1 
ATOM   5080 O O   . PRO B 1 113 ? -3.771  17.936  -49.840 1.00 49.72  ? 113  PRO B O   1 
ATOM   5081 C CB  . PRO B 1 113 ? -3.163  20.458  -48.085 1.00 51.79  ? 113  PRO B CB  1 
ATOM   5082 C CG  . PRO B 1 113 ? -4.006  21.676  -48.083 1.00 54.28  ? 113  PRO B CG  1 
ATOM   5083 C CD  . PRO B 1 113 ? -4.958  21.523  -49.234 1.00 55.14  ? 113  PRO B CD  1 
ATOM   5084 N N   . VAL B 1 114 ? -1.538  18.268  -49.956 1.00 47.90  ? 114  VAL B N   1 
ATOM   5085 C CA  . VAL B 1 114 ? -1.195  16.899  -50.272 1.00 45.77  ? 114  VAL B CA  1 
ATOM   5086 C C   . VAL B 1 114 ? -0.483  16.263  -49.104 1.00 44.66  ? 114  VAL B C   1 
ATOM   5087 O O   . VAL B 1 114 ? 0.488   16.803  -48.594 1.00 44.15  ? 114  VAL B O   1 
ATOM   5088 C CB  . VAL B 1 114 ? -0.265  16.847  -51.491 1.00 45.73  ? 114  VAL B CB  1 
ATOM   5089 C CG1 . VAL B 1 114 ? 0.182   15.399  -51.796 1.00 44.11  ? 114  VAL B CG1 1 
ATOM   5090 C CG2 . VAL B 1 114 ? -0.944  17.473  -52.697 1.00 46.22  ? 114  VAL B CG2 1 
ATOM   5091 N N   . LEU B 1 115 ? -0.951  15.093  -48.688 1.00 44.42  ? 115  LEU B N   1 
ATOM   5092 C CA  . LEU B 1 115 ? -0.193  14.287  -47.740 1.00 42.99  ? 115  LEU B CA  1 
ATOM   5093 C C   . LEU B 1 115 ? 0.482   13.105  -48.441 1.00 42.06  ? 115  LEU B C   1 
ATOM   5094 O O   . LEU B 1 115 ? -0.129  12.410  -49.257 1.00 42.81  ? 115  LEU B O   1 
ATOM   5095 C CB  . LEU B 1 115 ? -1.090  13.797  -46.617 1.00 43.16  ? 115  LEU B CB  1 
ATOM   5096 C CG  . LEU B 1 115 ? -1.528  14.778  -45.535 1.00 44.26  ? 115  LEU B CG  1 
ATOM   5097 C CD1 . LEU B 1 115 ? -2.838  15.438  -45.902 1.00 47.33  ? 115  LEU B CD1 1 
ATOM   5098 C CD2 . LEU B 1 115 ? -1.713  14.008  -44.286 1.00 44.76  ? 115  LEU B CD2 1 
ATOM   5099 N N   . ILE B 1 116 ? 1.747   12.892  -48.124 1.00 40.16  ? 116  ILE B N   1 
ATOM   5100 C CA  . ILE B 1 116 ? 2.474   11.783  -48.675 1.00 39.01  ? 116  ILE B CA  1 
ATOM   5101 C C   . ILE B 1 116 ? 2.915   10.851  -47.549 1.00 38.36  ? 116  ILE B C   1 
ATOM   5102 O O   . ILE B 1 116 ? 3.686   11.243  -46.654 1.00 38.08  ? 116  ILE B O   1 
ATOM   5103 C CB  . ILE B 1 116 ? 3.704   12.252  -49.489 1.00 39.22  ? 116  ILE B CB  1 
ATOM   5104 C CG1 . ILE B 1 116 ? 3.290   13.250  -50.580 1.00 39.79  ? 116  ILE B CG1 1 
ATOM   5105 C CG2 . ILE B 1 116 ? 4.446   11.041  -50.116 1.00 38.14  ? 116  ILE B CG2 1 
ATOM   5106 C CD1 . ILE B 1 116 ? 4.457   13.843  -51.379 1.00 39.23  ? 116  ILE B CD1 1 
ATOM   5107 N N   . TRP B 1 117 ? 2.444   9.613   -47.610 1.00 37.58  ? 117  TRP B N   1 
ATOM   5108 C CA  . TRP B 1 117 ? 2.756   8.624   -46.607 1.00 37.31  ? 117  TRP B CA  1 
ATOM   5109 C C   . TRP B 1 117 ? 3.991   7.805   -46.975 1.00 36.96  ? 117  TRP B C   1 
ATOM   5110 O O   . TRP B 1 117 ? 4.123   7.330   -48.106 1.00 37.04  ? 117  TRP B O   1 
ATOM   5111 C CB  . TRP B 1 117 ? 1.562   7.689   -46.439 1.00 38.16  ? 117  TRP B CB  1 
ATOM   5112 C CG  . TRP B 1 117 ? 1.821   6.538   -45.505 1.00 39.71  ? 117  TRP B CG  1 
ATOM   5113 C CD1 . TRP B 1 117 ? 1.994   5.232   -45.839 1.00 39.99  ? 117  TRP B CD1 1 
ATOM   5114 C CD2 . TRP B 1 117 ? 1.948   6.611   -44.079 1.00 40.42  ? 117  TRP B CD2 1 
ATOM   5115 N NE1 . TRP B 1 117 ? 2.200   4.479   -44.708 1.00 40.19  ? 117  TRP B NE1 1 
ATOM   5116 C CE2 . TRP B 1 117 ? 2.164   5.302   -43.613 1.00 40.20  ? 117  TRP B CE2 1 
ATOM   5117 C CE3 . TRP B 1 117 ? 1.877   7.663   -43.144 1.00 40.40  ? 117  TRP B CE3 1 
ATOM   5118 C CZ2 . TRP B 1 117 ? 2.324   5.009   -42.247 1.00 41.03  ? 117  TRP B CZ2 1 
ATOM   5119 C CZ3 . TRP B 1 117 ? 2.030   7.372   -41.792 1.00 39.47  ? 117  TRP B CZ3 1 
ATOM   5120 C CH2 . TRP B 1 117 ? 2.270   6.056   -41.357 1.00 39.63  ? 117  TRP B CH2 1 
ATOM   5121 N N   . ILE B 1 118 ? 4.892   7.640   -46.016 1.00 36.79  ? 118  ILE B N   1 
ATOM   5122 C CA  . ILE B 1 118 ? 6.027   6.715   -46.171 1.00 37.09  ? 118  ILE B CA  1 
ATOM   5123 C C   . ILE B 1 118 ? 5.917   5.601   -45.101 1.00 37.95  ? 118  ILE B C   1 
ATOM   5124 O O   . ILE B 1 118 ? 6.019   5.869   -43.903 1.00 38.56  ? 118  ILE B O   1 
ATOM   5125 C CB  . ILE B 1 118 ? 7.384   7.458   -46.070 1.00 36.06  ? 118  ILE B CB  1 
ATOM   5126 C CG1 . ILE B 1 118 ? 7.392   8.670   -46.997 1.00 35.45  ? 118  ILE B CG1 1 
ATOM   5127 C CG2 . ILE B 1 118 ? 8.527   6.551   -46.424 1.00 34.92  ? 118  ILE B CG2 1 
ATOM   5128 C CD1 . ILE B 1 118 ? 8.589   9.564   -46.838 1.00 31.31  ? 118  ILE B CD1 1 
ATOM   5129 N N   . TYR B 1 119 ? 5.699   4.363   -45.514 1.00 38.42  ? 119  TYR B N   1 
ATOM   5130 C CA  . TYR B 1 119 ? 5.523   3.288   -44.530 1.00 39.19  ? 119  TYR B CA  1 
ATOM   5131 C C   . TYR B 1 119 ? 6.827   2.926   -43.814 1.00 39.41  ? 119  TYR B C   1 
ATOM   5132 O O   . TYR B 1 119 ? 7.923   3.269   -44.281 1.00 38.90  ? 119  TYR B O   1 
ATOM   5133 C CB  . TYR B 1 119 ? 4.943   2.028   -45.195 1.00 39.85  ? 119  TYR B CB  1 
ATOM   5134 C CG  . TYR B 1 119 ? 5.765   1.499   -46.364 1.00 39.69  ? 119  TYR B CG  1 
ATOM   5135 C CD1 . TYR B 1 119 ? 6.990   0.855   -46.146 1.00 40.10  ? 119  TYR B CD1 1 
ATOM   5136 C CD2 . TYR B 1 119 ? 5.312   1.627   -47.682 1.00 37.56  ? 119  TYR B CD2 1 
ATOM   5137 C CE1 . TYR B 1 119 ? 7.763   0.353   -47.224 1.00 39.50  ? 119  TYR B CE1 1 
ATOM   5138 C CE2 . TYR B 1 119 ? 6.060   1.124   -48.761 1.00 39.31  ? 119  TYR B CE2 1 
ATOM   5139 C CZ  . TYR B 1 119 ? 7.292   0.491   -48.522 1.00 40.32  ? 119  TYR B CZ  1 
ATOM   5140 O OH  . TYR B 1 119 ? 8.060   0.004   -49.563 1.00 40.69  ? 119  TYR B OH  1 
ATOM   5141 N N   . GLY B 1 120 ? 6.676   2.238   -42.673 1.00 40.16  ? 120  GLY B N   1 
ATOM   5142 C CA  . GLY B 1 120 ? 7.771   1.630   -41.915 1.00 40.02  ? 120  GLY B CA  1 
ATOM   5143 C C   . GLY B 1 120 ? 7.912   0.128   -42.177 1.00 41.04  ? 120  GLY B C   1 
ATOM   5144 O O   . GLY B 1 120 ? 7.387   -0.399  -43.176 1.00 41.21  ? 120  GLY B O   1 
ATOM   5145 N N   . GLY B 1 121 ? 8.634   -0.554  -41.286 1.00 41.16  ? 121  GLY B N   1 
ATOM   5146 C CA  . GLY B 1 121 ? 9.070   -1.924  -41.516 1.00 41.75  ? 121  GLY B CA  1 
ATOM   5147 C C   . GLY B 1 121 ? 10.574  -2.121  -41.359 1.00 42.23  ? 121  GLY B C   1 
ATOM   5148 O O   . GLY B 1 121 ? 11.149  -3.071  -41.920 1.00 43.63  ? 121  GLY B O   1 
ATOM   5149 N N   . GLY B 1 122 ? 11.216  -1.224  -40.615 1.00 41.41  ? 122  GLY B N   1 
ATOM   5150 C CA  . GLY B 1 122 ? 12.637  -1.344  -40.293 1.00 41.31  ? 122  GLY B CA  1 
ATOM   5151 C C   . GLY B 1 122 ? 13.581  -1.232  -41.480 1.00 41.52  ? 122  GLY B C   1 
ATOM   5152 O O   . GLY B 1 122 ? 14.729  -1.702  -41.411 1.00 42.27  ? 122  GLY B O   1 
ATOM   5153 N N   . PHE B 1 123 ? 13.107  -0.605  -42.561 1.00 40.22  ? 123  PHE B N   1 
ATOM   5154 C CA  . PHE B 1 123 ? 13.830  -0.561  -43.834 1.00 40.11  ? 123  PHE B CA  1 
ATOM   5155 C C   . PHE B 1 123 ? 14.064  -1.951  -44.407 1.00 41.35  ? 123  PHE B C   1 
ATOM   5156 O O   . PHE B 1 123 ? 14.770  -2.076  -45.416 1.00 41.32  ? 123  PHE B O   1 
ATOM   5157 C CB  . PHE B 1 123 ? 15.176  0.177   -43.728 1.00 40.44  ? 123  PHE B CB  1 
ATOM   5158 C CG  . PHE B 1 123 ? 15.069  1.635   -43.300 1.00 38.66  ? 123  PHE B CG  1 
ATOM   5159 C CD1 . PHE B 1 123 ? 14.714  2.634   -44.226 1.00 37.94  ? 123  PHE B CD1 1 
ATOM   5160 C CD2 . PHE B 1 123 ? 15.353  2.008   -41.985 1.00 35.81  ? 123  PHE B CD2 1 
ATOM   5161 C CE1 . PHE B 1 123 ? 14.629  3.984   -43.837 1.00 36.18  ? 123  PHE B CE1 1 
ATOM   5162 C CE2 . PHE B 1 123 ? 15.272  3.343   -41.578 1.00 33.77  ? 123  PHE B CE2 1 
ATOM   5163 C CZ  . PHE B 1 123 ? 14.918  4.334   -42.504 1.00 36.12  ? 123  PHE B CZ  1 
ATOM   5164 N N   . TYR B 1 124 ? 13.475  -2.988  -43.789 1.00 41.80  ? 124  TYR B N   1 
ATOM   5165 C CA  . TYR B 1 124 ? 13.524  -4.345  -44.375 1.00 43.21  ? 124  TYR B CA  1 
ATOM   5166 C C   . TYR B 1 124 ? 12.167  -4.837  -44.907 1.00 43.56  ? 124  TYR B C   1 
ATOM   5167 O O   . TYR B 1 124 ? 12.098  -5.922  -45.528 1.00 44.50  ? 124  TYR B O   1 
ATOM   5168 C CB  . TYR B 1 124 ? 14.079  -5.389  -43.384 1.00 43.73  ? 124  TYR B CB  1 
ATOM   5169 C CG  . TYR B 1 124 ? 13.074  -5.761  -42.320 1.00 44.22  ? 124  TYR B CG  1 
ATOM   5170 C CD1 . TYR B 1 124 ? 12.099  -6.728  -42.560 1.00 44.84  ? 124  TYR B CD1 1 
ATOM   5171 C CD2 . TYR B 1 124 ? 13.069  -5.115  -41.086 1.00 44.95  ? 124  TYR B CD2 1 
ATOM   5172 C CE1 . TYR B 1 124 ? 11.147  -7.055  -41.594 1.00 45.54  ? 124  TYR B CE1 1 
ATOM   5173 C CE2 . TYR B 1 124 ? 12.120  -5.436  -40.107 1.00 45.73  ? 124  TYR B CE2 1 
ATOM   5174 C CZ  . TYR B 1 124 ? 11.159  -6.409  -40.372 1.00 45.46  ? 124  TYR B CZ  1 
ATOM   5175 O OH  . TYR B 1 124 ? 10.217  -6.723  -39.415 1.00 44.54  ? 124  TYR B OH  1 
ATOM   5176 N N   . SER B 1 125 ? 11.096  -4.087  -44.640 1.00 42.39  ? 125  SER B N   1 
ATOM   5177 C CA  . SER B 1 125 ? 9.751   -4.527  -45.034 1.00 42.40  ? 125  SER B CA  1 
ATOM   5178 C C   . SER B 1 125 ? 8.801   -3.352  -45.158 1.00 41.83  ? 125  SER B C   1 
ATOM   5179 O O   . SER B 1 125 ? 9.170   -2.198  -44.889 1.00 40.65  ? 125  SER B O   1 
ATOM   5180 C CB  . SER B 1 125 ? 9.177   -5.508  -44.016 1.00 43.07  ? 125  SER B CB  1 
ATOM   5181 O OG  . SER B 1 125 ? 9.164   -4.934  -42.710 1.00 43.47  ? 125  SER B OG  1 
ATOM   5182 N N   . GLY B 1 126 ? 7.560   -3.663  -45.536 1.00 42.15  ? 126  GLY B N   1 
ATOM   5183 C CA  . GLY B 1 126 ? 6.511   -2.666  -45.671 1.00 41.09  ? 126  GLY B CA  1 
ATOM   5184 C C   . GLY B 1 126 ? 5.956   -2.664  -47.069 1.00 41.37  ? 126  GLY B C   1 
ATOM   5185 O O   . GLY B 1 126 ? 6.513   -3.313  -47.968 1.00 41.26  ? 126  GLY B O   1 
ATOM   5186 N N   . ALA B 1 127 ? 4.845   -1.944  -47.238 1.00 41.07  ? 127  ALA B N   1 
ATOM   5187 C CA  . ALA B 1 127 ? 4.172   -1.782  -48.532 1.00 41.45  ? 127  ALA B CA  1 
ATOM   5188 C C   . ALA B 1 127 ? 3.115   -0.700  -48.411 1.00 41.06  ? 127  ALA B C   1 
ATOM   5189 O O   . ALA B 1 127 ? 2.559   -0.501  -47.336 1.00 41.24  ? 127  ALA B O   1 
ATOM   5190 C CB  . ALA B 1 127 ? 3.538   -3.092  -48.990 1.00 42.08  ? 127  ALA B CB  1 
ATOM   5191 N N   . ALA B 1 128 ? 2.822   -0.012  -49.506 1.00 40.79  ? 128  ALA B N   1 
ATOM   5192 C CA  . ALA B 1 128 ? 1.864   1.083   -49.442 1.00 41.07  ? 128  ALA B CA  1 
ATOM   5193 C C   . ALA B 1 128 ? 0.433   0.560   -49.582 1.00 42.45  ? 128  ALA B C   1 
ATOM   5194 O O   . ALA B 1 128 ? -0.518  1.342   -49.494 1.00 42.95  ? 128  ALA B O   1 
ATOM   5195 C CB  . ALA B 1 128 ? 2.171   2.160   -50.478 1.00 40.27  ? 128  ALA B CB  1 
ATOM   5196 N N   . SER B 1 129 ? 0.295   -0.767  -49.741 1.00 43.16  ? 129  SER B N   1 
ATOM   5197 C CA  . SER B 1 129 ? -1.004  -1.414  -50.019 1.00 43.88  ? 129  SER B CA  1 
ATOM   5198 C C   . SER B 1 129 ? -1.735  -2.044  -48.811 1.00 44.57  ? 129  SER B C   1 
ATOM   5199 O O   . SER B 1 129 ? -2.853  -2.550  -48.960 1.00 45.12  ? 129  SER B O   1 
ATOM   5200 C CB  . SER B 1 129 ? -0.833  -2.457  -51.130 1.00 44.57  ? 129  SER B CB  1 
ATOM   5201 O OG  . SER B 1 129 ? 0.195   -3.383  -50.821 1.00 43.02  ? 129  SER B OG  1 
ATOM   5202 N N   . LEU B 1 130 ? -1.101  -2.017  -47.637 1.00 44.03  ? 130  LEU B N   1 
ATOM   5203 C CA  . LEU B 1 130 ? -1.660  -2.600  -46.423 1.00 45.21  ? 130  LEU B CA  1 
ATOM   5204 C C   . LEU B 1 130 ? -2.941  -1.868  -46.069 1.00 46.35  ? 130  LEU B C   1 
ATOM   5205 O O   . LEU B 1 130 ? -3.033  -0.651  -46.293 1.00 46.53  ? 130  LEU B O   1 
ATOM   5206 C CB  . LEU B 1 130 ? -0.669  -2.479  -45.260 1.00 44.56  ? 130  LEU B CB  1 
ATOM   5207 C CG  . LEU B 1 130 ? 0.767   -3.010  -45.434 1.00 44.88  ? 130  LEU B CG  1 
ATOM   5208 C CD1 . LEU B 1 130 ? 1.610   -2.796  -44.181 1.00 42.35  ? 130  LEU B CD1 1 
ATOM   5209 C CD2 . LEU B 1 130 ? 0.761   -4.500  -45.828 1.00 45.96  ? 130  LEU B CD2 1 
ATOM   5210 N N   . ASP B 1 131 ? -3.915  -2.582  -45.501 1.00 47.64  ? 131  ASP B N   1 
ATOM   5211 C CA  . ASP B 1 131 ? -5.208  -1.976  -45.185 1.00 49.19  ? 131  ASP B CA  1 
ATOM   5212 C C   . ASP B 1 131 ? -5.132  -0.808  -44.213 1.00 48.79  ? 131  ASP B C   1 
ATOM   5213 O O   . ASP B 1 131 ? -5.990  0.073   -44.271 1.00 49.76  ? 131  ASP B O   1 
ATOM   5214 C CB  . ASP B 1 131 ? -6.190  -3.000  -44.624 1.00 51.20  ? 131  ASP B CB  1 
ATOM   5215 C CG  . ASP B 1 131 ? -6.436  -4.161  -45.565 1.00 54.53  ? 131  ASP B CG  1 
ATOM   5216 O OD1 . ASP B 1 131 ? -6.193  -4.040  -46.797 1.00 54.45  ? 131  ASP B OD1 1 
ATOM   5217 O OD2 . ASP B 1 131 ? -6.858  -5.215  -45.046 1.00 58.94  ? 131  ASP B OD2 1 
ATOM   5218 N N   . VAL B 1 132 ? -4.137  -0.791  -43.319 1.00 47.53  ? 132  VAL B N   1 
ATOM   5219 C CA  . VAL B 1 132 ? -4.010  0.319   -42.379 1.00 46.80  ? 132  VAL B CA  1 
ATOM   5220 C C   . VAL B 1 132 ? -3.532  1.601   -43.047 1.00 46.23  ? 132  VAL B C   1 
ATOM   5221 O O   . VAL B 1 132 ? -3.566  2.680   -42.414 1.00 46.34  ? 132  VAL B O   1 
ATOM   5222 C CB  . VAL B 1 132 ? -3.106  0.002   -41.148 1.00 46.10  ? 132  VAL B CB  1 
ATOM   5223 C CG1 . VAL B 1 132 ? -3.791  -0.971  -40.232 1.00 46.77  ? 132  VAL B CG1 1 
ATOM   5224 C CG2 . VAL B 1 132 ? -1.746  -0.531  -41.582 1.00 45.35  ? 132  VAL B CG2 1 
ATOM   5225 N N   . TYR B 1 133 ? -3.053  1.509   -44.291 1.00 45.19  ? 133  TYR B N   1 
ATOM   5226 C CA  . TYR B 1 133 ? -2.622  2.743   -44.962 1.00 44.19  ? 133  TYR B CA  1 
ATOM   5227 C C   . TYR B 1 133 ? -3.623  3.183   -46.000 1.00 44.91  ? 133  TYR B C   1 
ATOM   5228 O O   . TYR B 1 133 ? -3.293  3.945   -46.871 1.00 45.13  ? 133  TYR B O   1 
ATOM   5229 C CB  . TYR B 1 133 ? -1.210  2.664   -45.577 1.00 42.81  ? 133  TYR B CB  1 
ATOM   5230 C CG  . TYR B 1 133 ? -0.144  2.060   -44.701 1.00 40.62  ? 133  TYR B CG  1 
ATOM   5231 C CD1 . TYR B 1 133 ? -0.093  2.320   -43.336 1.00 38.70  ? 133  TYR B CD1 1 
ATOM   5232 C CD2 . TYR B 1 133 ? 0.820   1.215   -45.249 1.00 39.06  ? 133  TYR B CD2 1 
ATOM   5233 C CE1 . TYR B 1 133 ? 0.892   1.749   -42.545 1.00 39.01  ? 133  TYR B CE1 1 
ATOM   5234 C CE2 . TYR B 1 133 ? 1.808   0.638   -44.469 1.00 37.06  ? 133  TYR B CE2 1 
ATOM   5235 C CZ  . TYR B 1 133 ? 1.843   0.908   -43.119 1.00 38.47  ? 133  TYR B CZ  1 
ATOM   5236 O OH  . TYR B 1 133 ? 2.818   0.336   -42.333 1.00 37.78  ? 133  TYR B OH  1 
ATOM   5237 N N   . ASP B 1 134 ? -4.855  2.712   -45.877 1.00 46.39  ? 134  ASP B N   1 
ATOM   5238 C CA  . ASP B 1 134 ? -5.938  3.041   -46.796 1.00 47.37  ? 134  ASP B CA  1 
ATOM   5239 C C   . ASP B 1 134 ? -6.230  4.548   -46.759 1.00 47.12  ? 134  ASP B C   1 
ATOM   5240 O O   . ASP B 1 134 ? -6.693  5.058   -45.738 1.00 47.22  ? 134  ASP B O   1 
ATOM   5241 C CB  . ASP B 1 134 ? -7.166  2.232   -46.382 1.00 49.00  ? 134  ASP B CB  1 
ATOM   5242 C CG  . ASP B 1 134 ? -8.218  2.159   -47.462 1.00 52.52  ? 134  ASP B CG  1 
ATOM   5243 O OD1 . ASP B 1 134 ? -8.197  3.003   -48.377 1.00 55.78  ? 134  ASP B OD1 1 
ATOM   5244 O OD2 . ASP B 1 134 ? -9.079  1.258   -47.391 1.00 53.96  ? 134  ASP B OD2 1 
ATOM   5245 N N   . GLY B 1 135 ? -5.932  5.252   -47.863 1.00 46.78  ? 135  GLY B N   1 
ATOM   5246 C CA  . GLY B 1 135 ? -6.108  6.728   -47.990 1.00 46.33  ? 135  GLY B CA  1 
ATOM   5247 C C   . GLY B 1 135 ? -7.545  7.214   -48.218 1.00 47.44  ? 135  GLY B C   1 
ATOM   5248 O O   . GLY B 1 135 ? -7.820  8.420   -48.278 1.00 47.47  ? 135  GLY B O   1 
ATOM   5249 N N   . ARG B 1 136 ? -8.450  6.255   -48.339 1.00 48.07  ? 136  ARG B N   1 
ATOM   5250 C CA  . ARG B 1 136 ? -9.867  6.455   -48.638 1.00 50.01  ? 136  ARG B CA  1 
ATOM   5251 C C   . ARG B 1 136 ? -10.574 7.451   -47.689 1.00 50.46  ? 136  ARG B C   1 
ATOM   5252 O O   . ARG B 1 136 ? -11.176 8.444   -48.123 1.00 51.41  ? 136  ARG B O   1 
ATOM   5253 C CB  . ARG B 1 136 ? -10.501 5.064   -48.554 1.00 51.13  ? 136  ARG B CB  1 
ATOM   5254 C CG  . ARG B 1 136 ? -11.980 4.951   -48.684 1.00 54.86  ? 136  ARG B CG  1 
ATOM   5255 C CD  . ARG B 1 136 ? -12.415 3.500   -48.412 1.00 60.19  ? 136  ARG B CD  1 
ATOM   5256 N NE  . ARG B 1 136 ? -11.489 2.527   -49.002 1.00 62.64  ? 136  ARG B NE  1 
ATOM   5257 C CZ  . ARG B 1 136 ? -11.858 1.443   -49.695 1.00 65.04  ? 136  ARG B CZ  1 
ATOM   5258 N NH1 . ARG B 1 136 ? -13.141 1.168   -49.908 1.00 66.64  ? 136  ARG B NH1 1 
ATOM   5259 N NH2 . ARG B 1 136 ? -10.935 0.633   -50.195 1.00 64.59  ? 136  ARG B NH2 1 
ATOM   5260 N N   . PHE B 1 137 ? -10.484 7.180   -46.392 1.00 49.87  ? 137  PHE B N   1 
ATOM   5261 C CA  . PHE B 1 137 ? -11.121 7.996   -45.359 1.00 50.23  ? 137  PHE B CA  1 
ATOM   5262 C C   . PHE B 1 137 ? -10.662 9.455   -45.353 1.00 50.14  ? 137  PHE B C   1 
ATOM   5263 O O   . PHE B 1 137 ? -11.518 10.366  -45.355 1.00 51.49  ? 137  PHE B O   1 
ATOM   5264 C CB  . PHE B 1 137 ? -10.936 7.328   -43.993 1.00 49.33  ? 137  PHE B CB  1 
ATOM   5265 C CG  . PHE B 1 137 ? -11.278 5.878   -44.010 1.00 50.06  ? 137  PHE B CG  1 
ATOM   5266 C CD1 . PHE B 1 137 ? -12.623 5.465   -44.013 1.00 51.50  ? 137  PHE B CD1 1 
ATOM   5267 C CD2 . PHE B 1 137 ? -10.275 4.913   -44.107 1.00 48.40  ? 137  PHE B CD2 1 
ATOM   5268 C CE1 . PHE B 1 137 ? -12.955 4.105   -44.080 1.00 51.70  ? 137  PHE B CE1 1 
ATOM   5269 C CE2 . PHE B 1 137 ? -10.597 3.540   -44.166 1.00 49.13  ? 137  PHE B CE2 1 
ATOM   5270 C CZ  . PHE B 1 137 ? -11.935 3.139   -44.152 1.00 50.22  ? 137  PHE B CZ  1 
ATOM   5271 N N   . LEU B 1 138 ? -9.338  9.676   -45.341 1.00 48.42  ? 138  LEU B N   1 
ATOM   5272 C CA  . LEU B 1 138 ? -8.759  11.033  -45.343 1.00 48.29  ? 138  LEU B CA  1 
ATOM   5273 C C   . LEU B 1 138 ? -9.177  11.825  -46.576 1.00 49.79  ? 138  LEU B C   1 
ATOM   5274 O O   . LEU B 1 138 ? -9.468  13.029  -46.480 1.00 50.84  ? 138  LEU B O   1 
ATOM   5275 C CB  . LEU B 1 138 ? -7.228  11.019  -45.228 1.00 46.23  ? 138  LEU B CB  1 
ATOM   5276 C CG  . LEU B 1 138 ? -6.676  10.643  -43.856 1.00 44.97  ? 138  LEU B CG  1 
ATOM   5277 C CD1 . LEU B 1 138 ? -5.242  10.189  -43.924 1.00 42.84  ? 138  LEU B CD1 1 
ATOM   5278 C CD2 . LEU B 1 138 ? -6.798  11.800  -42.903 1.00 46.05  ? 138  LEU B CD2 1 
ATOM   5279 N N   . ALA B 1 139 ? -9.222  11.155  -47.725 1.00 50.03  ? 139  ALA B N   1 
ATOM   5280 C CA  . ALA B 1 139 ? -9.691  11.799  -48.938 1.00 51.45  ? 139  ALA B CA  1 
ATOM   5281 C C   . ALA B 1 139 ? -11.169 12.206  -48.793 1.00 54.16  ? 139  ALA B C   1 
ATOM   5282 O O   . ALA B 1 139 ? -11.550 13.339  -49.110 1.00 55.51  ? 139  ALA B O   1 
ATOM   5283 C CB  . ALA B 1 139 ? -9.497  10.875  -50.124 1.00 51.30  ? 139  ALA B CB  1 
ATOM   5284 N N   . GLN B 1 140 ? -11.994 11.300  -48.273 1.00 55.01  ? 140  GLN B N   1 
ATOM   5285 C CA  . GLN B 1 140 ? -13.413 11.529  -48.254 1.00 57.30  ? 140  GLN B CA  1 
ATOM   5286 C C   . GLN B 1 140 ? -13.893 12.542  -47.209 1.00 58.68  ? 140  GLN B C   1 
ATOM   5287 O O   . GLN B 1 140 ? -14.781 13.352  -47.495 1.00 60.11  ? 140  GLN B O   1 
ATOM   5288 C CB  . GLN B 1 140 ? -14.146 10.207  -48.084 1.00 58.20  ? 140  GLN B CB  1 
ATOM   5289 C CG  . GLN B 1 140 ? -15.583 10.254  -48.592 1.00 59.97  ? 140  GLN B CG  1 
ATOM   5290 C CD  . GLN B 1 140 ? -16.527 10.840  -47.558 1.00 62.14  ? 140  GLN B CD  1 
ATOM   5291 O OE1 . GLN B 1 140 ? -16.447 10.518  -46.364 1.00 63.21  ? 140  GLN B OE1 1 
ATOM   5292 N NE2 . GLN B 1 140 ? -17.418 11.704  -48.005 1.00 62.23  ? 140  GLN B NE2 1 
ATOM   5293 N N   . VAL B 1 141 ? -13.331 12.489  -46.006 1.00 58.11  ? 141  VAL B N   1 
ATOM   5294 C CA  . VAL B 1 141 ? -13.862 13.290  -44.899 1.00 59.09  ? 141  VAL B CA  1 
ATOM   5295 C C   . VAL B 1 141 ? -13.222 14.672  -44.859 1.00 59.16  ? 141  VAL B C   1 
ATOM   5296 O O   . VAL B 1 141 ? -13.934 15.683  -44.737 1.00 60.75  ? 141  VAL B O   1 
ATOM   5297 C CB  . VAL B 1 141 ? -13.691 12.571  -43.542 1.00 58.50  ? 141  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 1 141 ? -14.223 13.417  -42.411 1.00 58.52  ? 141  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 1 141 ? -14.406 11.225  -43.575 1.00 58.65  ? 141  VAL B CG2 1 
ATOM   5300 N N   . GLU B 1 142 ? -11.892 14.698  -44.992 1.00 57.41  ? 142  GLU B N   1 
ATOM   5301 C CA  . GLU B 1 142 ? -11.107 15.927  -44.923 1.00 57.17  ? 142  GLU B CA  1 
ATOM   5302 C C   . GLU B 1 142 ? -10.810 16.552  -46.300 1.00 57.50  ? 142  GLU B C   1 
ATOM   5303 O O   . GLU B 1 142 ? -10.258 17.668  -46.385 1.00 57.64  ? 142  GLU B O   1 
ATOM   5304 C CB  . GLU B 1 142 ? -9.801  15.678  -44.168 1.00 55.38  ? 142  GLU B CB  1 
ATOM   5305 C CG  . GLU B 1 142 ? -9.959  15.288  -42.703 1.00 56.71  ? 142  GLU B CG  1 
ATOM   5306 C CD  . GLU B 1 142 ? -10.788 16.291  -41.904 1.00 61.97  ? 142  GLU B CD  1 
ATOM   5307 O OE1 . GLU B 1 142 ? -10.656 17.524  -42.132 1.00 63.47  ? 142  GLU B OE1 1 
ATOM   5308 O OE2 . GLU B 1 142 ? -11.573 15.839  -41.036 1.00 64.31  ? 142  GLU B OE2 1 
ATOM   5309 N N   . GLY B 1 143 ? -11.173 15.844  -47.369 1.00 57.53  ? 143  GLY B N   1 
ATOM   5310 C CA  . GLY B 1 143 ? -10.938 16.331  -48.727 1.00 57.65  ? 143  GLY B CA  1 
ATOM   5311 C C   . GLY B 1 143 ? -9.468  16.366  -49.151 1.00 56.26  ? 143  GLY B C   1 
ATOM   5312 O O   . GLY B 1 143 ? -9.090  17.142  -50.033 1.00 57.22  ? 143  GLY B O   1 
ATOM   5313 N N   . ALA B 1 144 ? -8.639  15.517  -48.544 1.00 54.01  ? 144  ALA B N   1 
ATOM   5314 C CA  . ALA B 1 144 ? -7.200  15.534  -48.789 1.00 51.64  ? 144  ALA B CA  1 
ATOM   5315 C C   . ALA B 1 144 ? -6.808  14.734  -50.033 1.00 50.86  ? 144  ALA B C   1 
ATOM   5316 O O   . ALA B 1 144 ? -7.506  13.802  -50.422 1.00 51.42  ? 144  ALA B O   1 
ATOM   5317 C CB  . ALA B 1 144 ? -6.468  15.017  -47.574 1.00 50.00  ? 144  ALA B CB  1 
ATOM   5318 N N   . VAL B 1 145 ? -5.703  15.120  -50.661 1.00 49.48  ? 145  VAL B N   1 
ATOM   5319 C CA  . VAL B 1 145 ? -5.109  14.320  -51.697 1.00 48.61  ? 145  VAL B CA  1 
ATOM   5320 C C   . VAL B 1 145 ? -4.018  13.548  -50.984 1.00 47.68  ? 145  VAL B C   1 
ATOM   5321 O O   . VAL B 1 145 ? -3.048  14.113  -50.478 1.00 47.49  ? 145  VAL B O   1 
ATOM   5322 C CB  . VAL B 1 145 ? -4.551  15.175  -52.870 1.00 49.09  ? 145  VAL B CB  1 
ATOM   5323 C CG1 . VAL B 1 145 ? -3.812  14.317  -53.883 1.00 46.97  ? 145  VAL B CG1 1 
ATOM   5324 C CG2 . VAL B 1 145 ? -5.678  15.903  -53.569 1.00 50.49  ? 145  VAL B CG2 1 
ATOM   5325 N N   . LEU B 1 146 ? -4.189  12.243  -50.918 1.00 47.65  ? 146  LEU B N   1 
ATOM   5326 C CA  . LEU B 1 146 ? -3.236  11.410  -50.216 1.00 46.63  ? 146  LEU B CA  1 
ATOM   5327 C C   . LEU B 1 146 ? -2.451  10.543  -51.193 1.00 46.04  ? 146  LEU B C   1 
ATOM   5328 O O   . LEU B 1 146 ? -3.046  9.885   -52.067 1.00 46.98  ? 146  LEU B O   1 
ATOM   5329 C CB  . LEU B 1 146 ? -3.948  10.559  -49.163 1.00 46.62  ? 146  LEU B CB  1 
ATOM   5330 C CG  . LEU B 1 146 ? -2.971  9.990   -48.144 1.00 46.53  ? 146  LEU B CG  1 
ATOM   5331 C CD1 . LEU B 1 146 ? -3.507  10.185  -46.763 1.00 46.53  ? 146  LEU B CD1 1 
ATOM   5332 C CD2 . LEU B 1 146 ? -2.648  8.509   -48.424 1.00 47.49  ? 146  LEU B CD2 1 
ATOM   5333 N N   . VAL B 1 147 ? -1.119  10.549  -51.037 1.00 44.63  ? 147  VAL B N   1 
ATOM   5334 C CA  . VAL B 1 147 ? -0.210  9.821   -51.928 1.00 43.41  ? 147  VAL B CA  1 
ATOM   5335 C C   . VAL B 1 147 ? 0.623   8.851   -51.096 1.00 42.59  ? 147  VAL B C   1 
ATOM   5336 O O   . VAL B 1 147 ? 1.031   9.204   -49.994 1.00 42.59  ? 147  VAL B O   1 
ATOM   5337 C CB  . VAL B 1 147 ? 0.699   10.818  -52.689 1.00 43.25  ? 147  VAL B CB  1 
ATOM   5338 C CG1 . VAL B 1 147 ? 1.692   10.114  -53.588 1.00 42.27  ? 147  VAL B CG1 1 
ATOM   5339 C CG2 . VAL B 1 147 ? -0.142  11.776  -53.511 1.00 44.35  ? 147  VAL B CG2 1 
ATOM   5340 N N   . SER B 1 148 ? 0.861   7.634   -51.599 1.00 42.01  ? 148  SER B N   1 
ATOM   5341 C CA  . SER B 1 148 ? 1.831   6.707   -50.980 1.00 40.55  ? 148  SER B CA  1 
ATOM   5342 C C   . SER B 1 148 ? 2.653   5.918   -52.011 1.00 40.86  ? 148  SER B C   1 
ATOM   5343 O O   . SER B 1 148 ? 2.095   5.418   -52.987 1.00 41.39  ? 148  SER B O   1 
ATOM   5344 C CB  . SER B 1 148 ? 1.147   5.748   -50.005 1.00 40.02  ? 148  SER B CB  1 
ATOM   5345 O OG  . SER B 1 148 ? 0.206   4.919   -50.654 1.00 39.78  ? 148  SER B OG  1 
ATOM   5346 N N   . MET B 1 149 ? 3.967   5.797   -51.790 1.00 40.08  ? 149  MET B N   1 
ATOM   5347 C CA  . MET B 1 149 ? 4.822   5.067   -52.732 1.00 40.70  ? 149  MET B CA  1 
ATOM   5348 C C   . MET B 1 149 ? 5.357   3.798   -52.123 1.00 40.56  ? 149  MET B C   1 
ATOM   5349 O O   . MET B 1 149 ? 5.492   3.726   -50.899 1.00 41.06  ? 149  MET B O   1 
ATOM   5350 C CB  . MET B 1 149 ? 6.005   5.924   -53.153 1.00 40.47  ? 149  MET B CB  1 
ATOM   5351 C CG  . MET B 1 149 ? 7.175   5.897   -52.155 1.00 40.82  ? 149  MET B CG  1 
ATOM   5352 S SD  . MET B 1 149 ? 6.875   6.776   -50.601 1.00 41.51  ? 149  MET B SD  1 
ATOM   5353 C CE  . MET B 1 149 ? 6.831   8.471   -51.182 1.00 38.31  ? 149  MET B CE  1 
ATOM   5354 N N   . ASN B 1 150 ? 5.652   2.800   -52.956 1.00 40.52  ? 150  ASN B N   1 
ATOM   5355 C CA  . ASN B 1 150 ? 6.521   1.698   -52.541 1.00 40.30  ? 150  ASN B CA  1 
ATOM   5356 C C   . ASN B 1 150 ? 7.957   2.168   -52.687 1.00 39.92  ? 150  ASN B C   1 
ATOM   5357 O O   . ASN B 1 150 ? 8.262   2.933   -53.597 1.00 39.75  ? 150  ASN B O   1 
ATOM   5358 C CB  . ASN B 1 150 ? 6.333   0.463   -53.414 1.00 40.94  ? 150  ASN B CB  1 
ATOM   5359 C CG  . ASN B 1 150 ? 5.080   -0.298  -53.080 1.00 43.12  ? 150  ASN B CG  1 
ATOM   5360 O OD1 . ASN B 1 150 ? 4.399   0.041   -52.119 1.00 45.22  ? 150  ASN B OD1 1 
ATOM   5361 N ND2 . ASN B 1 150 ? 4.746   -1.320  -53.882 1.00 42.38  ? 150  ASN B ND2 1 
ATOM   5362 N N   . TYR B 1 151 ? 8.833   1.723   -51.791 1.00 39.43  ? 151  TYR B N   1 
ATOM   5363 C CA  . TYR B 1 151 ? 10.266  1.952   -51.955 1.00 39.51  ? 151  TYR B CA  1 
ATOM   5364 C C   . TYR B 1 151 ? 10.997  0.645   -51.646 1.00 40.17  ? 151  TYR B C   1 
ATOM   5365 O O   . TYR B 1 151 ? 10.499  -0.161  -50.857 1.00 40.45  ? 151  TYR B O   1 
ATOM   5366 C CB  . TYR B 1 151 ? 10.754  3.123   -51.090 1.00 38.49  ? 151  TYR B CB  1 
ATOM   5367 C CG  . TYR B 1 151 ? 10.587  2.927   -49.606 1.00 38.11  ? 151  TYR B CG  1 
ATOM   5368 C CD1 . TYR B 1 151 ? 9.409   3.310   -48.948 1.00 37.40  ? 151  TYR B CD1 1 
ATOM   5369 C CD2 . TYR B 1 151 ? 11.607  2.354   -48.853 1.00 38.08  ? 151  TYR B CD2 1 
ATOM   5370 C CE1 . TYR B 1 151 ? 9.270   3.131   -47.573 1.00 37.45  ? 151  TYR B CE1 1 
ATOM   5371 C CE2 . TYR B 1 151 ? 11.478  2.157   -47.497 1.00 38.09  ? 151  TYR B CE2 1 
ATOM   5372 C CZ  . TYR B 1 151 ? 10.316  2.545   -46.850 1.00 38.31  ? 151  TYR B CZ  1 
ATOM   5373 O OH  . TYR B 1 151 ? 10.221  2.324   -45.486 1.00 37.03  ? 151  TYR B OH  1 
ATOM   5374 N N   . ARG B 1 152 ? 12.142  0.420   -52.289 1.00 40.40  ? 152  ARG B N   1 
ATOM   5375 C CA  . ARG B 1 152 ? 12.882  -0.824  -52.103 1.00 41.04  ? 152  ARG B CA  1 
ATOM   5376 C C   . ARG B 1 152 ? 13.368  -0.931  -50.666 1.00 40.44  ? 152  ARG B C   1 
ATOM   5377 O O   . ARG B 1 152 ? 13.691  0.072   -50.058 1.00 40.60  ? 152  ARG B O   1 
ATOM   5378 C CB  . ARG B 1 152 ? 14.078  -0.883  -53.050 1.00 42.10  ? 152  ARG B CB  1 
ATOM   5379 C CG  . ARG B 1 152 ? 13.731  -1.188  -54.487 1.00 41.32  ? 152  ARG B CG  1 
ATOM   5380 C CD  . ARG B 1 152 ? 14.972  -1.054  -55.347 1.00 40.36  ? 152  ARG B CD  1 
ATOM   5381 N NE  . ARG B 1 152 ? 15.263  0.329   -55.700 1.00 38.47  ? 152  ARG B NE  1 
ATOM   5382 C CZ  . ARG B 1 152 ? 16.310  0.732   -56.424 1.00 41.11  ? 152  ARG B CZ  1 
ATOM   5383 N NH1 . ARG B 1 152 ? 17.238  -0.138  -56.864 1.00 41.79  ? 152  ARG B NH1 1 
ATOM   5384 N NH2 . ARG B 1 152 ? 16.448  2.029   -56.697 1.00 39.07  ? 152  ARG B NH2 1 
ATOM   5385 N N   . VAL B 1 153 ? 13.415  -2.150  -50.143 1.00 40.33  ? 153  VAL B N   1 
ATOM   5386 C CA  . VAL B 1 153 ? 13.817  -2.420  -48.764 1.00 39.52  ? 153  VAL B CA  1 
ATOM   5387 C C   . VAL B 1 153 ? 14.863  -3.541  -48.708 1.00 40.66  ? 153  VAL B C   1 
ATOM   5388 O O   . VAL B 1 153 ? 15.225  -4.120  -49.745 1.00 40.99  ? 153  VAL B O   1 
ATOM   5389 C CB  . VAL B 1 153 ? 12.608  -2.850  -47.885 1.00 39.64  ? 153  VAL B CB  1 
ATOM   5390 C CG1 . VAL B 1 153 ? 11.610  -1.711  -47.725 1.00 38.15  ? 153  VAL B CG1 1 
ATOM   5391 C CG2 . VAL B 1 153 ? 11.931  -4.133  -48.431 1.00 39.08  ? 153  VAL B CG2 1 
ATOM   5392 N N   . GLY B 1 154 ? 15.331  -3.849  -47.491 1.00 40.99  ? 154  GLY B N   1 
ATOM   5393 C CA  . GLY B 1 154 ? 16.372  -4.875  -47.267 1.00 42.08  ? 154  GLY B CA  1 
ATOM   5394 C C   . GLY B 1 154 ? 17.574  -4.647  -48.164 1.00 42.93  ? 154  GLY B C   1 
ATOM   5395 O O   . GLY B 1 154 ? 17.956  -3.493  -48.420 1.00 42.81  ? 154  GLY B O   1 
ATOM   5396 N N   . THR B 1 155 ? 18.147  -5.725  -48.689 1.00 43.86  ? 155  THR B N   1 
ATOM   5397 C CA  . THR B 1 155 ? 19.340  -5.585  -49.528 1.00 44.77  ? 155  THR B CA  1 
ATOM   5398 C C   . THR B 1 155 ? 19.043  -4.726  -50.752 1.00 44.31  ? 155  THR B C   1 
ATOM   5399 O O   . THR B 1 155 ? 19.819  -3.839  -51.105 1.00 45.43  ? 155  THR B O   1 
ATOM   5400 C CB  . THR B 1 155 ? 19.907  -6.939  -49.977 1.00 45.69  ? 155  THR B CB  1 
ATOM   5401 O OG1 . THR B 1 155 ? 18.896  -7.630  -50.686 1.00 45.69  ? 155  THR B OG1 1 
ATOM   5402 C CG2 . THR B 1 155 ? 20.314  -7.776  -48.789 1.00 45.86  ? 155  THR B CG2 1 
ATOM   5403 N N   . PHE B 1 156 ? 17.905  -4.974  -51.377 1.00 43.58  ? 156  PHE B N   1 
ATOM   5404 C CA  . PHE B 1 156 ? 17.522  -4.263  -52.597 1.00 43.16  ? 156  PHE B CA  1 
ATOM   5405 C C   . PHE B 1 156 ? 17.465  -2.754  -52.428 1.00 42.45  ? 156  PHE B C   1 
ATOM   5406 O O   . PHE B 1 156 ? 17.769  -2.025  -53.352 1.00 43.39  ? 156  PHE B O   1 
ATOM   5407 C CB  . PHE B 1 156 ? 16.174  -4.798  -53.096 1.00 42.42  ? 156  PHE B CB  1 
ATOM   5408 C CG  . PHE B 1 156 ? 16.106  -6.279  -53.069 1.00 42.04  ? 156  PHE B CG  1 
ATOM   5409 C CD1 . PHE B 1 156 ? 16.683  -7.029  -54.104 1.00 41.72  ? 156  PHE B CD1 1 
ATOM   5410 C CD2 . PHE B 1 156 ? 15.558  -6.945  -51.968 1.00 41.28  ? 156  PHE B CD2 1 
ATOM   5411 C CE1 . PHE B 1 156 ? 16.668  -8.431  -54.081 1.00 42.14  ? 156  PHE B CE1 1 
ATOM   5412 C CE2 . PHE B 1 156 ? 15.541  -8.366  -51.924 1.00 43.64  ? 156  PHE B CE2 1 
ATOM   5413 C CZ  . PHE B 1 156 ? 16.098  -9.108  -52.989 1.00 42.65  ? 156  PHE B CZ  1 
ATOM   5414 N N   . GLY B 1 157 ? 17.071  -2.288  -51.252 1.00 41.86  ? 157  GLY B N   1 
ATOM   5415 C CA  . GLY B 1 157 ? 16.960  -0.857  -50.998 1.00 41.16  ? 157  GLY B CA  1 
ATOM   5416 C C   . GLY B 1 157 ? 18.193  -0.225  -50.366 1.00 41.48  ? 157  GLY B C   1 
ATOM   5417 O O   . GLY B 1 157 ? 18.434  0.980   -50.548 1.00 41.62  ? 157  GLY B O   1 
ATOM   5418 N N   . PHE B 1 158 ? 18.983  -1.018  -49.639 1.00 41.68  ? 158  PHE B N   1 
ATOM   5419 C CA  . PHE B 1 158 ? 20.007  -0.443  -48.772 1.00 41.94  ? 158  PHE B CA  1 
ATOM   5420 C C   . PHE B 1 158 ? 21.347  -1.166  -48.693 1.00 44.12  ? 158  PHE B C   1 
ATOM   5421 O O   . PHE B 1 158 ? 22.244  -0.711  -47.992 1.00 44.45  ? 158  PHE B O   1 
ATOM   5422 C CB  . PHE B 1 158 ? 19.436  -0.177  -47.367 1.00 40.69  ? 158  PHE B CB  1 
ATOM   5423 C CG  . PHE B 1 158 ? 18.235  0.729   -47.376 1.00 37.68  ? 158  PHE B CG  1 
ATOM   5424 C CD1 . PHE B 1 158 ? 18.387  2.106   -47.465 1.00 34.44  ? 158  PHE B CD1 1 
ATOM   5425 C CD2 . PHE B 1 158 ? 16.954  0.201   -47.349 1.00 35.98  ? 158  PHE B CD2 1 
ATOM   5426 C CE1 . PHE B 1 158 ? 17.287  2.939   -47.505 1.00 33.99  ? 158  PHE B CE1 1 
ATOM   5427 C CE2 . PHE B 1 158 ? 15.838  1.039   -47.397 1.00 35.18  ? 158  PHE B CE2 1 
ATOM   5428 C CZ  . PHE B 1 158 ? 16.007  2.405   -47.480 1.00 33.85  ? 158  PHE B CZ  1 
ATOM   5429 N N   . LEU B 1 159 ? 21.516  -2.266  -49.429 1.00 45.87  ? 159  LEU B N   1 
ATOM   5430 C CA  . LEU B 1 159 ? 22.852  -2.856  -49.519 1.00 47.72  ? 159  LEU B CA  1 
ATOM   5431 C C   . LEU B 1 159 ? 23.784  -1.810  -50.125 1.00 48.75  ? 159  LEU B C   1 
ATOM   5432 O O   . LEU B 1 159 ? 23.444  -1.174  -51.123 1.00 48.55  ? 159  LEU B O   1 
ATOM   5433 C CB  . LEU B 1 159 ? 22.859  -4.133  -50.333 1.00 47.85  ? 159  LEU B CB  1 
ATOM   5434 C CG  . LEU B 1 159 ? 24.196  -4.884  -50.299 1.00 49.98  ? 159  LEU B CG  1 
ATOM   5435 C CD1 . LEU B 1 159 ? 23.977  -6.365  -49.982 1.00 48.80  ? 159  LEU B CD1 1 
ATOM   5436 C CD2 . LEU B 1 159 ? 24.992  -4.723  -51.614 1.00 50.31  ? 159  LEU B CD2 1 
ATOM   5437 N N   . ALA B 1 160 ? 24.934  -1.606  -49.486 1.00 50.18  ? 160  ALA B N   1 
ATOM   5438 C CA  . ALA B 1 160 ? 25.863  -0.565  -49.911 1.00 50.88  ? 160  ALA B CA  1 
ATOM   5439 C C   . ALA B 1 160 ? 27.315  -0.998  -49.862 1.00 52.66  ? 160  ALA B C   1 
ATOM   5440 O O   . ALA B 1 160 ? 27.786  -1.565  -48.869 1.00 52.96  ? 160  ALA B O   1 
ATOM   5441 C CB  . ALA B 1 160 ? 25.677  0.694   -49.076 1.00 50.05  ? 160  ALA B CB  1 
ATOM   5442 N N   . LEU B 1 161 ? 28.009  -0.725  -50.961 1.00 53.70  ? 161  LEU B N   1 
ATOM   5443 C CA  . LEU B 1 161 ? 29.448  -0.681  -50.967 1.00 55.63  ? 161  LEU B CA  1 
ATOM   5444 C C   . LEU B 1 161 ? 29.840  0.762   -51.217 1.00 55.91  ? 161  LEU B C   1 
ATOM   5445 O O   . LEU B 1 161 ? 29.975  1.176   -52.363 1.00 56.11  ? 161  LEU B O   1 
ATOM   5446 C CB  . LEU B 1 161 ? 30.011  -1.611  -52.028 1.00 57.17  ? 161  LEU B CB  1 
ATOM   5447 C CG  . LEU B 1 161 ? 29.867  -3.076  -51.639 1.00 58.26  ? 161  LEU B CG  1 
ATOM   5448 C CD1 . LEU B 1 161 ? 30.481  -3.918  -52.698 1.00 62.51  ? 161  LEU B CD1 1 
ATOM   5449 C CD2 . LEU B 1 161 ? 30.563  -3.352  -50.325 1.00 59.65  ? 161  LEU B CD2 1 
ATOM   5450 N N   . PRO B 1 162 ? 30.002  1.539   -50.130 1.00 55.90  ? 162  PRO B N   1 
ATOM   5451 C CA  . PRO B 1 162 ? 30.159  2.992   -50.177 1.00 56.30  ? 162  PRO B CA  1 
ATOM   5452 C C   . PRO B 1 162 ? 31.335  3.438   -51.015 1.00 58.46  ? 162  PRO B C   1 
ATOM   5453 O O   . PRO B 1 162 ? 32.440  2.947   -50.817 1.00 60.25  ? 162  PRO B O   1 
ATOM   5454 C CB  . PRO B 1 162 ? 30.373  3.362   -48.706 1.00 56.18  ? 162  PRO B CB  1 
ATOM   5455 C CG  . PRO B 1 162 ? 29.616  2.281   -47.968 1.00 55.22  ? 162  PRO B CG  1 
ATOM   5456 C CD  . PRO B 1 162 ? 29.940  1.046   -48.744 1.00 55.52  ? 162  PRO B CD  1 
ATOM   5457 N N   . GLY B 1 163 ? 31.074  4.348   -51.952 1.00 58.82  ? 163  GLY B N   1 
ATOM   5458 C CA  . GLY B 1 163 ? 32.101  4.918   -52.823 1.00 61.49  ? 163  GLY B CA  1 
ATOM   5459 C C   . GLY B 1 163 ? 32.163  4.206   -54.161 1.00 62.99  ? 163  GLY B C   1 
ATOM   5460 O O   . GLY B 1 163 ? 32.956  4.565   -55.045 1.00 64.43  ? 163  GLY B O   1 
ATOM   5461 N N   . SER B 1 164 ? 31.340  3.171   -54.293 1.00 62.49  ? 164  SER B N   1 
ATOM   5462 C CA  . SER B 1 164 ? 31.227  2.425   -55.539 1.00 63.55  ? 164  SER B CA  1 
ATOM   5463 C C   . SER B 1 164 ? 30.172  3.059   -56.437 1.00 63.24  ? 164  SER B C   1 
ATOM   5464 O O   . SER B 1 164 ? 29.262  3.760   -55.965 1.00 62.07  ? 164  SER B O   1 
ATOM   5465 C CB  . SER B 1 164 ? 30.870  0.956   -55.267 1.00 62.95  ? 164  SER B CB  1 
ATOM   5466 O OG  . SER B 1 164 ? 29.499  0.800   -54.924 1.00 59.26  ? 164  SER B OG  1 
ATOM   5467 N N   . ARG B 1 165 ? 30.297  2.783   -57.726 1.00 65.06  ? 165  ARG B N   1 
ATOM   5468 C CA  . ARG B 1 165 ? 29.394  3.281   -58.741 1.00 65.69  ? 165  ARG B CA  1 
ATOM   5469 C C   . ARG B 1 165 ? 28.127  2.427   -58.736 1.00 63.75  ? 165  ARG B C   1 
ATOM   5470 O O   . ARG B 1 165 ? 27.029  2.925   -59.011 1.00 62.70  ? 165  ARG B O   1 
ATOM   5471 C CB  . ARG B 1 165 ? 30.079  3.174   -60.105 1.00 68.25  ? 165  ARG B CB  1 
ATOM   5472 C CG  . ARG B 1 165 ? 29.853  4.339   -61.081 1.00 72.90  ? 165  ARG B CG  1 
ATOM   5473 C CD  . ARG B 1 165 ? 29.809  3.808   -62.541 1.00 79.86  ? 165  ARG B CD  1 
ATOM   5474 N NE  . ARG B 1 165 ? 28.508  3.168   -62.807 1.00 83.05  ? 165  ARG B NE  1 
ATOM   5475 C CZ  . ARG B 1 165 ? 28.302  2.113   -63.603 1.00 84.69  ? 165  ARG B CZ  1 
ATOM   5476 N NH1 . ARG B 1 165 ? 29.320  1.540   -64.245 1.00 85.99  ? 165  ARG B NH1 1 
ATOM   5477 N NH2 . ARG B 1 165 ? 27.064  1.628   -63.755 1.00 82.54  ? 165  ARG B NH2 1 
ATOM   5478 N N   . GLU B 1 166 ? 28.270  1.145   -58.402 1.00 63.38  ? 166  GLU B N   1 
ATOM   5479 C CA  . GLU B 1 166 ? 27.177  0.205   -58.636 1.00 62.03  ? 166  GLU B CA  1 
ATOM   5480 C C   . GLU B 1 166 ? 26.469  -0.363  -57.408 1.00 59.66  ? 166  GLU B C   1 
ATOM   5481 O O   . GLU B 1 166 ? 25.582  -1.212  -57.544 1.00 59.45  ? 166  GLU B O   1 
ATOM   5482 C CB  . GLU B 1 166 ? 27.555  -0.878  -59.683 1.00 64.48  ? 166  GLU B CB  1 
ATOM   5483 C CG  . GLU B 1 166 ? 28.804  -1.669  -59.406 1.00 68.19  ? 166  GLU B CG  1 
ATOM   5484 C CD  . GLU B 1 166 ? 30.079  -0.950  -59.828 1.00 74.38  ? 166  GLU B CD  1 
ATOM   5485 O OE1 . GLU B 1 166 ? 30.392  -0.948  -61.044 1.00 76.64  ? 166  GLU B OE1 1 
ATOM   5486 O OE2 . GLU B 1 166 ? 30.786  -0.417  -58.930 1.00 76.37  ? 166  GLU B OE2 1 
ATOM   5487 N N   . ALA B 1 167 ? 26.837  0.131   -56.226 1.00 57.87  ? 167  ALA B N   1 
ATOM   5488 C CA  . ALA B 1 167 ? 26.059  -0.055  -54.993 1.00 55.09  ? 167  ALA B CA  1 
ATOM   5489 C C   . ALA B 1 167 ? 26.309  1.112   -54.038 1.00 53.96  ? 167  ALA B C   1 
ATOM   5490 O O   . ALA B 1 167 ? 26.880  0.927   -52.976 1.00 54.23  ? 167  ALA B O   1 
ATOM   5491 C CB  . ALA B 1 167 ? 26.387  -1.377  -54.317 1.00 54.66  ? 167  ALA B CB  1 
ATOM   5492 N N   . PRO B 1 168 ? 25.875  2.326   -54.416 1.00 53.04  ? 168  PRO B N   1 
ATOM   5493 C CA  . PRO B 1 168 ? 26.226  3.528   -53.628 1.00 52.47  ? 168  PRO B CA  1 
ATOM   5494 C C   . PRO B 1 168 ? 25.467  3.680   -52.298 1.00 51.07  ? 168  PRO B C   1 
ATOM   5495 O O   . PRO B 1 168 ? 25.809  4.553   -51.485 1.00 50.92  ? 168  PRO B O   1 
ATOM   5496 C CB  . PRO B 1 168 ? 25.890  4.682   -54.579 1.00 52.05  ? 168  PRO B CB  1 
ATOM   5497 C CG  . PRO B 1 168 ? 24.809  4.118   -55.469 1.00 51.86  ? 168  PRO B CG  1 
ATOM   5498 C CD  . PRO B 1 168 ? 25.119  2.657   -55.641 1.00 52.45  ? 168  PRO B CD  1 
ATOM   5499 N N   . GLY B 1 169 ? 24.459  2.836   -52.075 1.00 49.80  ? 169  GLY B N   1 
ATOM   5500 C CA  . GLY B 1 169 ? 23.686  2.893   -50.841 1.00 47.91  ? 169  GLY B CA  1 
ATOM   5501 C C   . GLY B 1 169 ? 22.580  3.920   -50.920 1.00 46.52  ? 169  GLY B C   1 
ATOM   5502 O O   . GLY B 1 169 ? 22.569  4.781   -51.814 1.00 47.08  ? 169  GLY B O   1 
ATOM   5503 N N   . ASN B 1 170 ? 21.641  3.814   -49.989 1.00 45.20  ? 170  ASN B N   1 
ATOM   5504 C CA  . ASN B 1 170 ? 20.516  4.745   -49.867 1.00 44.01  ? 170  ASN B CA  1 
ATOM   5505 C C   . ASN B 1 170 ? 19.478  4.766   -51.027 1.00 43.50  ? 170  ASN B C   1 
ATOM   5506 O O   . ASN B 1 170 ? 18.622  5.654   -51.087 1.00 42.46  ? 170  ASN B O   1 
ATOM   5507 C CB  . ASN B 1 170 ? 21.037  6.159   -49.555 1.00 44.25  ? 170  ASN B CB  1 
ATOM   5508 C CG  . ASN B 1 170 ? 21.782  6.234   -48.217 1.00 45.05  ? 170  ASN B CG  1 
ATOM   5509 O OD1 . ASN B 1 170 ? 21.359  5.648   -47.214 1.00 43.29  ? 170  ASN B OD1 1 
ATOM   5510 N ND2 . ASN B 1 170 ? 22.901  6.961   -48.204 1.00 45.78  ? 170  ASN B ND2 1 
ATOM   5511 N N   . VAL B 1 171 ? 19.527  3.785   -51.929 1.00 43.89  ? 171  VAL B N   1 
ATOM   5512 C CA  . VAL B 1 171 ? 18.675  3.858   -53.122 1.00 43.30  ? 171  VAL B CA  1 
ATOM   5513 C C   . VAL B 1 171 ? 17.165  3.840   -52.805 1.00 42.43  ? 171  VAL B C   1 
ATOM   5514 O O   . VAL B 1 171 ? 16.372  4.572   -53.429 1.00 42.36  ? 171  VAL B O   1 
ATOM   5515 C CB  . VAL B 1 171 ? 19.095  2.872   -54.224 1.00 44.27  ? 171  VAL B CB  1 
ATOM   5516 C CG1 . VAL B 1 171 ? 20.582  3.019   -54.474 1.00 45.25  ? 171  VAL B CG1 1 
ATOM   5517 C CG2 . VAL B 1 171 ? 18.752  1.425   -53.860 1.00 43.76  ? 171  VAL B CG2 1 
ATOM   5518 N N   . GLY B 1 172 ? 16.767  3.055   -51.813 1.00 41.26  ? 172  GLY B N   1 
ATOM   5519 C CA  . GLY B 1 172 ? 15.389  3.154   -51.322 1.00 40.59  ? 172  GLY B CA  1 
ATOM   5520 C C   . GLY B 1 172 ? 14.970  4.555   -50.867 1.00 40.47  ? 172  GLY B C   1 
ATOM   5521 O O   . GLY B 1 172 ? 13.784  4.919   -50.953 1.00 39.97  ? 172  GLY B O   1 
ATOM   5522 N N   . LEU B 1 173 ? 15.918  5.348   -50.351 1.00 40.46  ? 173  LEU B N   1 
ATOM   5523 C CA  . LEU B 1 173 ? 15.606  6.747   -50.028 1.00 39.94  ? 173  LEU B CA  1 
ATOM   5524 C C   . LEU B 1 173 ? 15.505  7.564   -51.306 1.00 40.65  ? 173  LEU B C   1 
ATOM   5525 O O   . LEU B 1 173 ? 14.724  8.525   -51.372 1.00 41.00  ? 173  LEU B O   1 
ATOM   5526 C CB  . LEU B 1 173 ? 16.642  7.365   -49.083 1.00 40.68  ? 173  LEU B CB  1 
ATOM   5527 C CG  . LEU B 1 173 ? 16.644  6.943   -47.597 1.00 39.80  ? 173  LEU B CG  1 
ATOM   5528 C CD1 . LEU B 1 173 ? 17.866  7.478   -46.917 1.00 37.75  ? 173  LEU B CD1 1 
ATOM   5529 C CD2 . LEU B 1 173 ? 15.402  7.437   -46.900 1.00 37.75  ? 173  LEU B CD2 1 
ATOM   5530 N N   . LEU B 1 174 ? 16.274  7.180   -52.331 1.00 41.00  ? 174  LEU B N   1 
ATOM   5531 C CA  . LEU B 1 174 ? 16.145  7.824   -53.636 1.00 41.20  ? 174  LEU B CA  1 
ATOM   5532 C C   . LEU B 1 174 ? 14.813  7.447   -54.328 1.00 41.40  ? 174  LEU B C   1 
ATOM   5533 O O   . LEU B 1 174 ? 14.249  8.251   -55.066 1.00 41.44  ? 174  LEU B O   1 
ATOM   5534 C CB  . LEU B 1 174 ? 17.369  7.572   -54.516 1.00 41.51  ? 174  LEU B CB  1 
ATOM   5535 C CG  . LEU B 1 174 ? 18.720  8.200   -54.075 1.00 41.85  ? 174  LEU B CG  1 
ATOM   5536 C CD1 . LEU B 1 174 ? 19.948  7.646   -54.878 1.00 38.59  ? 174  LEU B CD1 1 
ATOM   5537 C CD2 . LEU B 1 174 ? 18.726  9.733   -54.126 1.00 40.47  ? 174  LEU B CD2 1 
ATOM   5538 N N   . ASP B 1 175 ? 14.303  6.237   -54.077 1.00 41.17  ? 175  ASP B N   1 
ATOM   5539 C CA  . ASP B 1 175 ? 12.996  5.847   -54.600 1.00 40.85  ? 175  ASP B CA  1 
ATOM   5540 C C   . ASP B 1 175 ? 11.972  6.842   -54.040 1.00 40.76  ? 175  ASP B C   1 
ATOM   5541 O O   . ASP B 1 175 ? 11.153  7.394   -54.786 1.00 40.86  ? 175  ASP B O   1 
ATOM   5542 C CB  . ASP B 1 175 ? 12.622  4.403   -54.198 1.00 40.29  ? 175  ASP B CB  1 
ATOM   5543 C CG  . ASP B 1 175 ? 13.564  3.341   -54.804 1.00 42.12  ? 175  ASP B CG  1 
ATOM   5544 O OD1 . ASP B 1 175 ? 14.320  3.664   -55.747 1.00 41.93  ? 175  ASP B OD1 1 
ATOM   5545 O OD2 . ASP B 1 175 ? 13.549  2.172   -54.334 1.00 41.56  ? 175  ASP B OD2 1 
ATOM   5546 N N   . GLN B 1 176 ? 12.039  7.090   -52.730 1.00 40.14  ? 176  GLN B N   1 
ATOM   5547 C CA  . GLN B 1 176 ? 11.100  7.991   -52.092 1.00 39.85  ? 176  GLN B CA  1 
ATOM   5548 C C   . GLN B 1 176 ? 11.256  9.383   -52.700 1.00 40.59  ? 176  GLN B C   1 
ATOM   5549 O O   . GLN B 1 176 ? 10.267  9.998   -53.117 1.00 40.79  ? 176  GLN B O   1 
ATOM   5550 C CB  . GLN B 1 176 ? 11.323  8.029   -50.584 1.00 39.88  ? 176  GLN B CB  1 
ATOM   5551 C CG  . GLN B 1 176 ? 11.094  6.680   -49.834 1.00 40.06  ? 176  GLN B CG  1 
ATOM   5552 C CD  . GLN B 1 176 ? 11.680  6.701   -48.411 1.00 39.58  ? 176  GLN B CD  1 
ATOM   5553 O OE1 . GLN B 1 176 ? 11.991  7.766   -47.882 1.00 37.62  ? 176  GLN B OE1 1 
ATOM   5554 N NE2 . GLN B 1 176 ? 11.823  5.523   -47.797 1.00 39.15  ? 176  GLN B NE2 1 
ATOM   5555 N N   . ARG B 1 177 ? 12.498  9.864   -52.795 1.00 40.80  ? 177  ARG B N   1 
ATOM   5556 C CA  . ARG B 1 177 ? 12.741  11.181  -53.383 1.00 41.17  ? 177  ARG B CA  1 
ATOM   5557 C C   . ARG B 1 177 ? 12.172  11.292  -54.785 1.00 41.79  ? 177  ARG B C   1 
ATOM   5558 O O   . ARG B 1 177 ? 11.544  12.309  -55.111 1.00 43.10  ? 177  ARG B O   1 
ATOM   5559 C CB  . ARG B 1 177 ? 14.225  11.541  -53.399 1.00 41.76  ? 177  ARG B CB  1 
ATOM   5560 C CG  . ARG B 1 177 ? 14.495  12.926  -53.975 1.00 43.02  ? 177  ARG B CG  1 
ATOM   5561 C CD  . ARG B 1 177 ? 15.964  13.266  -53.982 1.00 46.26  ? 177  ARG B CD  1 
ATOM   5562 N NE  . ARG B 1 177 ? 16.399  13.571  -52.623 1.00 49.43  ? 177  ARG B NE  1 
ATOM   5563 C CZ  . ARG B 1 177 ? 17.661  13.535  -52.217 1.00 49.30  ? 177  ARG B CZ  1 
ATOM   5564 N NH1 . ARG B 1 177 ? 18.618  13.199  -53.080 1.00 50.13  ? 177  ARG B NH1 1 
ATOM   5565 N NH2 . ARG B 1 177 ? 17.952  13.825  -50.950 1.00 47.28  ? 177  ARG B NH2 1 
ATOM   5566 N N   . LEU B 1 178 ? 12.358  10.257  -55.610 1.00 41.54  ? 178  LEU B N   1 
ATOM   5567 C CA  . LEU B 1 178 ? 11.719  10.231  -56.937 1.00 41.55  ? 178  LEU B CA  1 
ATOM   5568 C C   . LEU B 1 178 ? 10.171  10.293  -56.882 1.00 41.13  ? 178  LEU B C   1 
ATOM   5569 O O   . LEU B 1 178 ? 9.561   10.987  -57.678 1.00 41.88  ? 178  LEU B O   1 
ATOM   5570 C CB  . LEU B 1 178 ? 12.244  9.095   -57.831 1.00 41.25  ? 178  LEU B CB  1 
ATOM   5571 C CG  . LEU B 1 178 ? 11.795  9.003   -59.310 1.00 42.12  ? 178  LEU B CG  1 
ATOM   5572 C CD1 . LEU B 1 178 ? 12.106  10.232  -60.163 1.00 42.59  ? 178  LEU B CD1 1 
ATOM   5573 C CD2 . LEU B 1 178 ? 12.392  7.803   -59.974 1.00 43.30  ? 178  LEU B CD2 1 
ATOM   5574 N N   . ALA B 1 179 ? 9.539   9.598   -55.942 1.00 40.54  ? 179  ALA B N   1 
ATOM   5575 C CA  . ALA B 1 179 ? 8.077   9.685   -55.813 1.00 40.78  ? 179  ALA B CA  1 
ATOM   5576 C C   . ALA B 1 179 ? 7.663   11.123  -55.443 1.00 41.60  ? 179  ALA B C   1 
ATOM   5577 O O   . ALA B 1 179 ? 6.693   11.650  -55.969 1.00 41.89  ? 179  ALA B O   1 
ATOM   5578 C CB  . ALA B 1 179 ? 7.558   8.686   -54.811 1.00 39.36  ? 179  ALA B CB  1 
ATOM   5579 N N   . LEU B 1 180 ? 8.443   11.758  -54.569 1.00 42.03  ? 180  LEU B N   1 
ATOM   5580 C CA  . LEU B 1 180 ? 8.240   13.163  -54.215 1.00 42.80  ? 180  LEU B CA  1 
ATOM   5581 C C   . LEU B 1 180 ? 8.330   14.089  -55.420 1.00 44.40  ? 180  LEU B C   1 
ATOM   5582 O O   . LEU B 1 180 ? 7.468   14.957  -55.561 1.00 44.90  ? 180  LEU B O   1 
ATOM   5583 C CB  . LEU B 1 180 ? 9.211   13.610  -53.119 1.00 42.07  ? 180  LEU B CB  1 
ATOM   5584 C CG  . LEU B 1 180 ? 8.876   13.362  -51.638 1.00 41.31  ? 180  LEU B CG  1 
ATOM   5585 C CD1 . LEU B 1 180 ? 8.099   12.063  -51.336 1.00 39.53  ? 180  LEU B CD1 1 
ATOM   5586 C CD2 . LEU B 1 180 ? 10.144  13.423  -50.814 1.00 40.83  ? 180  LEU B CD2 1 
ATOM   5587 N N   . GLN B 1 181 ? 9.351   13.906  -56.276 1.00 45.58  ? 181  GLN B N   1 
ATOM   5588 C CA  . GLN B 1 181 ? 9.500   14.696  -57.533 1.00 47.23  ? 181  GLN B CA  1 
ATOM   5589 C C   . GLN B 1 181 ? 8.317   14.443  -58.432 1.00 46.97  ? 181  GLN B C   1 
ATOM   5590 O O   . GLN B 1 181 ? 7.819   15.374  -59.086 1.00 48.37  ? 181  GLN B O   1 
ATOM   5591 C CB  . GLN B 1 181 ? 10.766  14.334  -58.324 1.00 47.84  ? 181  GLN B CB  1 
ATOM   5592 C CG  . GLN B 1 181 ? 11.957  15.250  -58.102 1.00 53.06  ? 181  GLN B CG  1 
ATOM   5593 C CD  . GLN B 1 181 ? 13.326  14.497  -58.147 1.00 58.60  ? 181  GLN B CD  1 
ATOM   5594 O OE1 . GLN B 1 181 ? 13.411  13.335  -58.600 1.00 60.78  ? 181  GLN B OE1 1 
ATOM   5595 N NE2 . GLN B 1 181 ? 14.392  15.160  -57.668 1.00 57.74  ? 181  GLN B NE2 1 
ATOM   5596 N N   . TRP B 1 182 ? 7.870   13.186  -58.467 1.00 45.68  ? 182  TRP B N   1 
ATOM   5597 C CA  . TRP B 1 182 ? 6.748   12.798  -59.311 1.00 45.61  ? 182  TRP B CA  1 
ATOM   5598 C C   . TRP B 1 182 ? 5.519   13.581  -58.892 1.00 45.41  ? 182  TRP B C   1 
ATOM   5599 O O   . TRP B 1 182 ? 4.759   14.039  -59.733 1.00 46.08  ? 182  TRP B O   1 
ATOM   5600 C CB  . TRP B 1 182 ? 6.478   11.293  -59.235 1.00 45.12  ? 182  TRP B CB  1 
ATOM   5601 C CG  . TRP B 1 182 ? 5.371   10.841  -60.181 1.00 46.14  ? 182  TRP B CG  1 
ATOM   5602 C CD1 . TRP B 1 182 ? 5.522   10.334  -61.446 1.00 45.40  ? 182  TRP B CD1 1 
ATOM   5603 C CD2 . TRP B 1 182 ? 3.953   10.887  -59.935 1.00 44.76  ? 182  TRP B CD2 1 
ATOM   5604 N NE1 . TRP B 1 182 ? 4.291   10.061  -61.993 1.00 46.29  ? 182  TRP B NE1 1 
ATOM   5605 C CE2 . TRP B 1 182 ? 3.314   10.385  -61.090 1.00 45.39  ? 182  TRP B CE2 1 
ATOM   5606 C CE3 . TRP B 1 182 ? 3.171   11.292  -58.851 1.00 43.83  ? 182  TRP B CE3 1 
ATOM   5607 C CZ2 . TRP B 1 182 ? 1.924   10.284  -61.196 1.00 46.81  ? 182  TRP B CZ2 1 
ATOM   5608 C CZ3 . TRP B 1 182 ? 1.785   11.194  -58.952 1.00 45.23  ? 182  TRP B CZ3 1 
ATOM   5609 C CH2 . TRP B 1 182 ? 1.174   10.691  -60.118 1.00 46.16  ? 182  TRP B CH2 1 
ATOM   5610 N N   . VAL B 1 183 ? 5.349   13.730  -57.584 1.00 44.31  ? 183  VAL B N   1 
ATOM   5611 C CA  . VAL B 1 183 ? 4.270   14.524  -57.014 1.00 44.66  ? 183  VAL B CA  1 
ATOM   5612 C C   . VAL B 1 183 ? 4.328   16.005  -57.454 1.00 46.21  ? 183  VAL B C   1 
ATOM   5613 O O   . VAL B 1 183 ? 3.301   16.577  -57.836 1.00 46.56  ? 183  VAL B O   1 
ATOM   5614 C CB  . VAL B 1 183 ? 4.208   14.366  -55.465 1.00 43.67  ? 183  VAL B CB  1 
ATOM   5615 C CG1 . VAL B 1 183 ? 3.396   15.495  -54.788 1.00 43.26  ? 183  VAL B CG1 1 
ATOM   5616 C CG2 . VAL B 1 183 ? 3.657   13.000  -55.109 1.00 41.91  ? 183  VAL B CG2 1 
ATOM   5617 N N   . GLN B 1 184 ? 5.515   16.609  -57.403 1.00 46.44  ? 184  GLN B N   1 
ATOM   5618 C CA  . GLN B 1 184 ? 5.686   18.007  -57.823 1.00 48.16  ? 184  GLN B CA  1 
ATOM   5619 C C   . GLN B 1 184 ? 5.243   18.199  -59.261 1.00 49.52  ? 184  GLN B C   1 
ATOM   5620 O O   . GLN B 1 184 ? 4.520   19.137  -59.569 1.00 50.87  ? 184  GLN B O   1 
ATOM   5621 C CB  . GLN B 1 184 ? 7.145   18.471  -57.698 1.00 48.17  ? 184  GLN B CB  1 
ATOM   5622 C CG  . GLN B 1 184 ? 7.581   18.789  -56.295 1.00 48.59  ? 184  GLN B CG  1 
ATOM   5623 C CD  . GLN B 1 184 ? 6.709   19.854  -55.633 1.00 50.06  ? 184  GLN B CD  1 
ATOM   5624 O OE1 . GLN B 1 184 ? 6.047   19.593  -54.623 1.00 47.37  ? 184  GLN B OE1 1 
ATOM   5625 N NE2 . GLN B 1 184 ? 6.686   21.047  -56.214 1.00 50.71  ? 184  GLN B NE2 1 
ATOM   5626 N N   . GLU B 1 185 ? 5.672   17.292  -60.127 1.00 49.76  ? 185  GLU B N   1 
ATOM   5627 C CA  . GLU B 1 185 ? 5.431   17.414  -61.560 1.00 51.33  ? 185  GLU B CA  1 
ATOM   5628 C C   . GLU B 1 185 ? 3.997   17.096  -61.946 1.00 51.04  ? 185  GLU B C   1 
ATOM   5629 O O   . GLU B 1 185 ? 3.534   17.576  -62.982 1.00 52.92  ? 185  GLU B O   1 
ATOM   5630 C CB  . GLU B 1 185 ? 6.389   16.504  -62.352 1.00 51.47  ? 185  GLU B CB  1 
ATOM   5631 C CG  . GLU B 1 185 ? 7.869   16.900  -62.232 1.00 55.00  ? 185  GLU B CG  1 
ATOM   5632 C CD  . GLU B 1 185 ? 8.834   15.856  -62.819 1.00 60.90  ? 185  GLU B CD  1 
ATOM   5633 O OE1 . GLU B 1 185 ? 8.386   14.721  -63.128 1.00 63.81  ? 185  GLU B OE1 1 
ATOM   5634 O OE2 . GLU B 1 185 ? 10.049  16.163  -62.970 1.00 61.92  ? 185  GLU B OE2 1 
ATOM   5635 N N   . ASN B 1 186 ? 3.297   16.303  -61.123 1.00 49.24  ? 186  ASN B N   1 
ATOM   5636 C CA  . ASN B 1 186 ? 2.044   15.652  -61.552 1.00 48.71  ? 186  ASN B CA  1 
ATOM   5637 C C   . ASN B 1 186 ? 0.799   15.846  -60.701 1.00 48.75  ? 186  ASN B C   1 
ATOM   5638 O O   . ASN B 1 186 ? -0.317  15.725  -61.213 1.00 50.09  ? 186  ASN B O   1 
ATOM   5639 C CB  . ASN B 1 186 ? 2.255   14.149  -61.742 1.00 47.57  ? 186  ASN B CB  1 
ATOM   5640 C CG  . ASN B 1 186 ? 3.226   13.829  -62.859 1.00 46.95  ? 186  ASN B CG  1 
ATOM   5641 O OD1 . ASN B 1 186 ? 2.956   14.088  -64.028 1.00 47.30  ? 186  ASN B OD1 1 
ATOM   5642 N ND2 . ASN B 1 186 ? 4.346   13.237  -62.507 1.00 45.12  ? 186  ASN B ND2 1 
ATOM   5643 N N   . ILE B 1 187 ? 0.973   16.133  -59.412 1.00 47.82  ? 187  ILE B N   1 
ATOM   5644 C CA  . ILE B 1 187 ? -0.149  16.110  -58.479 1.00 46.74  ? 187  ILE B CA  1 
ATOM   5645 C C   . ILE B 1 187 ? -1.239  17.127  -58.814 1.00 48.52  ? 187  ILE B C   1 
ATOM   5646 O O   . ILE B 1 187 ? -2.422  16.857  -58.565 1.00 49.01  ? 187  ILE B O   1 
ATOM   5647 C CB  . ILE B 1 187 ? 0.310   16.158  -56.988 1.00 45.56  ? 187  ILE B CB  1 
ATOM   5648 C CG1 . ILE B 1 187 ? -0.725  15.483  -56.078 1.00 43.59  ? 187  ILE B CG1 1 
ATOM   5649 C CG2 . ILE B 1 187 ? 0.642   17.593  -56.540 1.00 45.93  ? 187  ILE B CG2 1 
ATOM   5650 C CD1 . ILE B 1 187 ? -0.903  13.999  -56.333 1.00 41.71  ? 187  ILE B CD1 1 
ATOM   5651 N N   . ALA B 1 188 ? -0.855  18.261  -59.412 1.00 49.62  ? 188  ALA B N   1 
ATOM   5652 C CA  . ALA B 1 188 ? -1.839  19.282  -59.852 1.00 51.28  ? 188  ALA B CA  1 
ATOM   5653 C C   . ALA B 1 188 ? -2.915  18.714  -60.774 1.00 52.36  ? 188  ALA B C   1 
ATOM   5654 O O   . ALA B 1 188 ? -4.083  19.108  -60.688 1.00 53.61  ? 188  ALA B O   1 
ATOM   5655 C CB  . ALA B 1 188 ? -1.155  20.493  -60.512 1.00 52.09  ? 188  ALA B CB  1 
ATOM   5656 N N   . ALA B 1 189 ? -2.531  17.776  -61.638 1.00 52.36  ? 189  ALA B N   1 
ATOM   5657 C CA  . ALA B 1 189 ? -3.497  17.121  -62.536 1.00 53.56  ? 189  ALA B CA  1 
ATOM   5658 C C   . ALA B 1 189 ? -4.596  16.381  -61.756 1.00 53.31  ? 189  ALA B C   1 
ATOM   5659 O O   . ALA B 1 189 ? -5.675  16.148  -62.288 1.00 54.78  ? 189  ALA B O   1 
ATOM   5660 C CB  . ALA B 1 189 ? -2.784  16.174  -63.523 1.00 52.79  ? 189  ALA B CB  1 
ATOM   5661 N N   . PHE B 1 190 ? -4.307  16.016  -60.505 1.00 52.16  ? 190  PHE B N   1 
ATOM   5662 C CA  . PHE B 1 190 ? -5.287  15.387  -59.601 1.00 51.93  ? 190  PHE B CA  1 
ATOM   5663 C C   . PHE B 1 190 ? -6.032  16.403  -58.702 1.00 52.87  ? 190  PHE B C   1 
ATOM   5664 O O   . PHE B 1 190 ? -6.911  16.026  -57.906 1.00 52.96  ? 190  PHE B O   1 
ATOM   5665 C CB  . PHE B 1 190 ? -4.592  14.345  -58.723 1.00 49.51  ? 190  PHE B CB  1 
ATOM   5666 C CG  . PHE B 1 190 ? -3.947  13.227  -59.493 1.00 48.91  ? 190  PHE B CG  1 
ATOM   5667 C CD1 . PHE B 1 190 ? -2.620  13.324  -59.922 1.00 48.36  ? 190  PHE B CD1 1 
ATOM   5668 C CD2 . PHE B 1 190 ? -4.642  12.061  -59.771 1.00 48.55  ? 190  PHE B CD2 1 
ATOM   5669 C CE1 . PHE B 1 190 ? -2.002  12.278  -60.623 1.00 46.77  ? 190  PHE B CE1 1 
ATOM   5670 C CE2 . PHE B 1 190 ? -4.019  11.003  -60.476 1.00 48.92  ? 190  PHE B CE2 1 
ATOM   5671 C CZ  . PHE B 1 190 ? -2.698  11.121  -60.900 1.00 47.02  ? 190  PHE B CZ  1 
ATOM   5672 N N   . GLY B 1 191 ? -5.675  17.682  -58.833 1.00 53.47  ? 191  GLY B N   1 
ATOM   5673 C CA  . GLY B 1 191 ? -6.214  18.720  -57.980 1.00 54.08  ? 191  GLY B CA  1 
ATOM   5674 C C   . GLY B 1 191 ? -5.426  18.911  -56.694 1.00 53.17  ? 191  GLY B C   1 
ATOM   5675 O O   . GLY B 1 191 ? -5.810  19.726  -55.857 1.00 53.99  ? 191  GLY B O   1 
ATOM   5676 N N   . GLY B 1 192 ? -4.329  18.175  -56.518 1.00 51.68  ? 192  GLY B N   1 
ATOM   5677 C CA  . GLY B 1 192 ? -3.404  18.452  -55.420 1.00 50.64  ? 192  GLY B CA  1 
ATOM   5678 C C   . GLY B 1 192 ? -2.658  19.776  -55.579 1.00 51.60  ? 192  GLY B C   1 
ATOM   5679 O O   . GLY B 1 192 ? -2.501  20.280  -56.693 1.00 53.19  ? 192  GLY B O   1 
ATOM   5680 N N   . ASP B 1 193 ? -2.208  20.346  -54.464 1.00 51.26  ? 193  ASP B N   1 
ATOM   5681 C CA  . ASP B 1 193 ? -1.365  21.550  -54.449 1.00 52.09  ? 193  ASP B CA  1 
ATOM   5682 C C   . ASP B 1 193 ? 0.109   21.163  -54.265 1.00 51.03  ? 193  ASP B C   1 
ATOM   5683 O O   . ASP B 1 193 ? 0.503   20.781  -53.163 1.00 49.81  ? 193  ASP B O   1 
ATOM   5684 C CB  . ASP B 1 193 ? -1.793  22.443  -53.286 1.00 52.73  ? 193  ASP B CB  1 
ATOM   5685 C CG  . ASP B 1 193 ? -1.266  23.868  -53.395 1.00 55.16  ? 193  ASP B CG  1 
ATOM   5686 O OD1 . ASP B 1 193 ? -0.363  24.117  -54.224 1.00 55.95  ? 193  ASP B OD1 1 
ATOM   5687 O OD2 . ASP B 1 193 ? -1.765  24.745  -52.640 1.00 56.55  ? 193  ASP B OD2 1 
ATOM   5688 N N   . PRO B 1 194 ? 0.934   21.256  -55.333 1.00 51.45  ? 194  PRO B N   1 
ATOM   5689 C CA  . PRO B 1 194 ? 2.336   20.845  -55.175 1.00 50.70  ? 194  PRO B CA  1 
ATOM   5690 C C   . PRO B 1 194 ? 3.077   21.819  -54.254 1.00 51.39  ? 194  PRO B C   1 
ATOM   5691 O O   . PRO B 1 194 ? 4.194   21.549  -53.802 1.00 51.09  ? 194  PRO B O   1 
ATOM   5692 C CB  . PRO B 1 194 ? 2.892   20.907  -56.601 1.00 51.03  ? 194  PRO B CB  1 
ATOM   5693 C CG  . PRO B 1 194 ? 2.036   21.932  -57.295 1.00 53.09  ? 194  PRO B CG  1 
ATOM   5694 C CD  . PRO B 1 194 ? 0.679   21.895  -56.639 1.00 52.86  ? 194  PRO B CD  1 
ATOM   5695 N N   . MET B 1 195 ? 2.421   22.930  -53.955 1.00 52.83  ? 195  MET B N   1 
ATOM   5696 C CA  . MET B 1 195 ? 2.980   23.971  -53.117 1.00 53.90  ? 195  MET B CA  1 
ATOM   5697 C C   . MET B 1 195 ? 2.652   23.811  -51.622 1.00 52.07  ? 195  MET B C   1 
ATOM   5698 O O   . MET B 1 195 ? 3.093   24.625  -50.798 1.00 52.30  ? 195  MET B O   1 
ATOM   5699 C CB  . MET B 1 195 ? 2.471   25.306  -53.616 1.00 56.49  ? 195  MET B CB  1 
ATOM   5700 C CG  . MET B 1 195 ? 3.502   26.375  -53.651 1.00 61.89  ? 195  MET B CG  1 
ATOM   5701 S SD  . MET B 1 195 ? 3.073   27.466  -55.011 1.00 72.45  ? 195  MET B SD  1 
ATOM   5702 C CE  . MET B 1 195 ? 4.146   26.783  -56.283 1.00 71.82  ? 195  MET B CE  1 
ATOM   5703 N N   . SER B 1 196 ? 1.893   22.762  -51.294 1.00 49.87  ? 196  SER B N   1 
ATOM   5704 C CA  . SER B 1 196 ? 1.591   22.374  -49.922 1.00 48.02  ? 196  SER B CA  1 
ATOM   5705 C C   . SER B 1 196 ? 1.669   20.845  -49.793 1.00 46.79  ? 196  SER B C   1 
ATOM   5706 O O   . SER B 1 196 ? 0.654   20.139  -49.827 1.00 46.37  ? 196  SER B O   1 
ATOM   5707 C CB  . SER B 1 196 ? 0.212   22.883  -49.492 1.00 48.53  ? 196  SER B CB  1 
ATOM   5708 O OG  . SER B 1 196 ? -0.118  22.452  -48.185 1.00 46.66  ? 196  SER B OG  1 
ATOM   5709 N N   . VAL B 1 197 ? 2.888   20.345  -49.632 1.00 45.52  ? 197  VAL B N   1 
ATOM   5710 C CA  . VAL B 1 197 ? 3.114   18.920  -49.490 1.00 43.95  ? 197  VAL B CA  1 
ATOM   5711 C C   . VAL B 1 197 ? 3.600   18.621  -48.085 1.00 42.81  ? 197  VAL B C   1 
ATOM   5712 O O   . VAL B 1 197 ? 4.615   19.176  -47.652 1.00 43.32  ? 197  VAL B O   1 
ATOM   5713 C CB  . VAL B 1 197 ? 4.149   18.406  -50.529 1.00 43.83  ? 197  VAL B CB  1 
ATOM   5714 C CG1 . VAL B 1 197 ? 4.706   17.051  -50.113 1.00 42.07  ? 197  VAL B CG1 1 
ATOM   5715 C CG2 . VAL B 1 197 ? 3.519   18.350  -51.917 1.00 43.53  ? 197  VAL B CG2 1 
ATOM   5716 N N   . THR B 1 198 ? 2.875   17.758  -47.383 1.00 41.39  ? 198  THR B N   1 
ATOM   5717 C CA  . THR B 1 198 ? 3.264   17.314  -46.065 1.00 40.44  ? 198  THR B CA  1 
ATOM   5718 C C   . THR B 1 198 ? 3.683   15.854  -46.118 1.00 39.86  ? 198  THR B C   1 
ATOM   5719 O O   . THR B 1 198 ? 2.889   14.985  -46.528 1.00 39.99  ? 198  THR B O   1 
ATOM   5720 C CB  . THR B 1 198 ? 2.080   17.416  -45.093 1.00 40.74  ? 198  THR B CB  1 
ATOM   5721 O OG1 . THR B 1 198 ? 1.491   18.713  -45.194 1.00 42.80  ? 198  THR B OG1 1 
ATOM   5722 C CG2 . THR B 1 198 ? 2.533   17.190  -43.664 1.00 39.51  ? 198  THR B CG2 1 
ATOM   5723 N N   . LEU B 1 199 ? 4.911   15.563  -45.704 1.00 39.31  ? 199  LEU B N   1 
ATOM   5724 C CA  . LEU B 1 199 ? 5.325   14.164  -45.573 1.00 39.07  ? 199  LEU B CA  1 
ATOM   5725 C C   . LEU B 1 199 ? 4.854   13.654  -44.239 1.00 39.11  ? 199  LEU B C   1 
ATOM   5726 O O   . LEU B 1 199 ? 4.866   14.398  -43.277 1.00 40.82  ? 199  LEU B O   1 
ATOM   5727 C CB  . LEU B 1 199 ? 6.844   14.004  -45.662 1.00 38.14  ? 199  LEU B CB  1 
ATOM   5728 C CG  . LEU B 1 199 ? 7.568   14.636  -46.860 1.00 38.89  ? 199  LEU B CG  1 
ATOM   5729 C CD1 . LEU B 1 199 ? 9.090   14.371  -46.798 1.00 35.72  ? 199  LEU B CD1 1 
ATOM   5730 C CD2 . LEU B 1 199 ? 6.964   14.227  -48.209 1.00 37.21  ? 199  LEU B CD2 1 
ATOM   5731 N N   . PHE B 1 200 ? 4.429   12.403  -44.164 1.00 38.72  ? 200  PHE B N   1 
ATOM   5732 C CA  . PHE B 1 200 ? 4.256   11.774  -42.865 1.00 38.12  ? 200  PHE B CA  1 
ATOM   5733 C C   . PHE B 1 200 ? 4.570   10.289  -42.930 1.00 38.25  ? 200  PHE B C   1 
ATOM   5734 O O   . PHE B 1 200 ? 4.437   9.659   -43.978 1.00 38.73  ? 200  PHE B O   1 
ATOM   5735 C CB  . PHE B 1 200 ? 2.880   12.074  -42.257 1.00 38.23  ? 200  PHE B CB  1 
ATOM   5736 C CG  . PHE B 1 200 ? 1.711   11.384  -42.918 1.00 37.70  ? 200  PHE B CG  1 
ATOM   5737 C CD1 . PHE B 1 200 ? 1.495   11.450  -44.301 1.00 37.37  ? 200  PHE B CD1 1 
ATOM   5738 C CD2 . PHE B 1 200 ? 0.746   10.754  -42.130 1.00 36.26  ? 200  PHE B CD2 1 
ATOM   5739 C CE1 . PHE B 1 200 ? 0.341   10.829  -44.895 1.00 37.41  ? 200  PHE B CE1 1 
ATOM   5740 C CE2 . PHE B 1 200 ? -0.394  10.151  -42.704 1.00 35.32  ? 200  PHE B CE2 1 
ATOM   5741 C CZ  . PHE B 1 200 ? -0.583  10.171  -44.088 1.00 35.35  ? 200  PHE B CZ  1 
ATOM   5742 N N   . GLY B 1 201 ? 5.026   9.732   -41.820 1.00 37.98  ? 201  GLY B N   1 
ATOM   5743 C CA  . GLY B 1 201 ? 5.464   8.343   -41.822 1.00 38.15  ? 201  GLY B CA  1 
ATOM   5744 C C   . GLY B 1 201 ? 5.645   7.835   -40.419 1.00 38.13  ? 201  GLY B C   1 
ATOM   5745 O O   . GLY B 1 201 ? 5.692   8.615   -39.460 1.00 38.28  ? 201  GLY B O   1 
ATOM   5746 N N   . GLU B 1 202 ? 5.719   6.523   -40.297 1.00 38.06  ? 202  GLU B N   1 
ATOM   5747 C CA  . GLU B 1 202 ? 5.865   5.904   -38.998 1.00 38.52  ? 202  GLU B CA  1 
ATOM   5748 C C   . GLU B 1 202 ? 7.062   4.957   -38.982 1.00 38.57  ? 202  GLU B C   1 
ATOM   5749 O O   . GLU B 1 202 ? 7.364   4.314   -39.993 1.00 38.78  ? 202  GLU B O   1 
ATOM   5750 C CB  . GLU B 1 202 ? 4.570   5.188   -38.620 1.00 38.69  ? 202  GLU B CB  1 
ATOM   5751 C CG  . GLU B 1 202 ? 4.481   4.697   -37.194 1.00 39.30  ? 202  GLU B CG  1 
ATOM   5752 C CD  . GLU B 1 202 ? 4.968   3.285   -37.064 1.00 42.00  ? 202  GLU B CD  1 
ATOM   5753 O OE1 . GLU B 1 202 ? 5.285   2.695   -38.115 1.00 42.66  ? 202  GLU B OE1 1 
ATOM   5754 O OE2 . GLU B 1 202 ? 5.054   2.761   -35.930 1.00 43.20  ? 202  GLU B OE2 1 
ATOM   5755 N N   . SER B 1 203 ? 7.724   4.877   -37.830 1.00 38.55  ? 203  SER B N   1 
ATOM   5756 C CA  . SER B 1 203 ? 8.863   3.982   -37.623 1.00 39.20  ? 203  SER B CA  1 
ATOM   5757 C C   . SER B 1 203 ? 9.975   4.299   -38.638 1.00 38.94  ? 203  SER B C   1 
ATOM   5758 O O   . SER B 1 203 ? 10.449  5.433   -38.681 1.00 39.29  ? 203  SER B O   1 
ATOM   5759 C CB  . SER B 1 203 ? 8.419   2.524   -37.693 1.00 39.18  ? 203  SER B CB  1 
ATOM   5760 O OG  . SER B 1 203 ? 9.299   1.697   -36.945 1.00 40.85  ? 203  SER B OG  1 
ATOM   5761 N N   . ALA B 1 204 ? 10.360  3.334   -39.475 1.00 39.25  ? 204  ALA B N   1 
ATOM   5762 C CA  . ALA B 1 204 ? 11.340  3.611   -40.546 1.00 39.34  ? 204  ALA B CA  1 
ATOM   5763 C C   . ALA B 1 204 ? 10.853  4.729   -41.469 1.00 38.64  ? 204  ALA B C   1 
ATOM   5764 O O   . ALA B 1 204 ? 11.658  5.557   -41.935 1.00 38.89  ? 204  ALA B O   1 
ATOM   5765 C CB  . ALA B 1 204 ? 11.689  2.344   -41.351 1.00 39.25  ? 204  ALA B CB  1 
ATOM   5766 N N   . GLY B 1 205 ? 9.544   4.765   -41.710 1.00 38.04  ? 205  GLY B N   1 
ATOM   5767 C CA  . GLY B 1 205 ? 8.944   5.842   -42.501 1.00 38.55  ? 205  GLY B CA  1 
ATOM   5768 C C   . GLY B 1 205 ? 9.184   7.211   -41.857 1.00 38.52  ? 205  GLY B C   1 
ATOM   5769 O O   . GLY B 1 205 ? 9.542   8.181   -42.538 1.00 38.66  ? 205  GLY B O   1 
ATOM   5770 N N   . ALA B 1 206 ? 9.018   7.282   -40.540 1.00 38.22  ? 206  ALA B N   1 
ATOM   5771 C CA  . ALA B 1 206 ? 9.339   8.496   -39.814 1.00 38.17  ? 206  ALA B CA  1 
ATOM   5772 C C   . ALA B 1 206 ? 10.836  8.842   -39.900 1.00 38.20  ? 206  ALA B C   1 
ATOM   5773 O O   . ALA B 1 206 ? 11.184  10.009  -40.136 1.00 38.41  ? 206  ALA B O   1 
ATOM   5774 C CB  . ALA B 1 206 ? 8.867   8.405   -38.375 1.00 38.42  ? 206  ALA B CB  1 
ATOM   5775 N N   . ALA B 1 207 ? 11.717  7.855   -39.748 1.00 37.78  ? 207  ALA B N   1 
ATOM   5776 C CA  . ALA B 1 207 ? 13.148  8.122   -39.953 1.00 38.48  ? 207  ALA B CA  1 
ATOM   5777 C C   . ALA B 1 207 ? 13.447  8.623   -41.372 1.00 38.69  ? 207  ALA B C   1 
ATOM   5778 O O   . ALA B 1 207 ? 14.286  9.501   -41.560 1.00 39.25  ? 207  ALA B O   1 
ATOM   5779 C CB  . ALA B 1 207 ? 13.974  6.901   -39.640 1.00 38.79  ? 207  ALA B CB  1 
ATOM   5780 N N   . SER B 1 208 ? 12.741  8.072   -42.363 1.00 38.82  ? 208  SER B N   1 
ATOM   5781 C CA  . SER B 1 208 ? 12.853  8.516   -43.760 1.00 38.83  ? 208  SER B CA  1 
ATOM   5782 C C   . SER B 1 208 ? 12.433  9.974   -43.907 1.00 38.83  ? 208  SER B C   1 
ATOM   5783 O O   . SER B 1 208 ? 13.203  10.786  -44.412 1.00 40.12  ? 208  SER B O   1 
ATOM   5784 C CB  . SER B 1 208 ? 12.033  7.617   -44.696 1.00 39.03  ? 208  SER B CB  1 
ATOM   5785 O OG  . SER B 1 208 ? 12.356  6.235   -44.525 1.00 38.79  ? 208  SER B OG  1 
ATOM   5786 N N   . VAL B 1 209 ? 11.238  10.328  -43.446 1.00 37.90  ? 209  VAL B N   1 
ATOM   5787 C CA  . VAL B 1 209 ? 10.846  11.728  -43.404 1.00 37.76  ? 209  VAL B CA  1 
ATOM   5788 C C   . VAL B 1 209 ? 12.008  12.571  -42.803 1.00 39.16  ? 209  VAL B C   1 
ATOM   5789 O O   . VAL B 1 209 ? 12.440  13.587  -43.394 1.00 39.81  ? 209  VAL B O   1 
ATOM   5790 C CB  . VAL B 1 209 ? 9.541   11.926  -42.600 1.00 37.50  ? 209  VAL B CB  1 
ATOM   5791 C CG1 . VAL B 1 209 ? 9.249   13.389  -42.403 1.00 36.77  ? 209  VAL B CG1 1 
ATOM   5792 C CG2 . VAL B 1 209 ? 8.354   11.232  -43.283 1.00 36.59  ? 209  VAL B CG2 1 
ATOM   5793 N N   . GLY B 1 210 ? 12.528  12.134  -41.650 1.00 39.37  ? 210  GLY B N   1 
ATOM   5794 C CA  . GLY B 1 210 ? 13.699  12.773  -41.015 1.00 40.15  ? 210  GLY B CA  1 
ATOM   5795 C C   . GLY B 1 210 ? 14.880  12.941  -41.967 1.00 40.86  ? 210  GLY B C   1 
ATOM   5796 O O   . GLY B 1 210 ? 15.539  13.996  -42.021 1.00 40.46  ? 210  GLY B O   1 
ATOM   5797 N N   . MET B 1 211 ? 15.126  11.903  -42.753 1.00 40.75  ? 211  MET B N   1 
ATOM   5798 C CA  . MET B 1 211 ? 16.232  11.974  -43.696 1.00 41.97  ? 211  MET B CA  1 
ATOM   5799 C C   . MET B 1 211 ? 15.993  12.985  -44.824 1.00 41.95  ? 211  MET B C   1 
ATOM   5800 O O   . MET B 1 211 ? 16.915  13.676  -45.257 1.00 42.86  ? 211  MET B O   1 
ATOM   5801 C CB  . MET B 1 211 ? 16.642  10.582  -44.153 1.00 41.38  ? 211  MET B CB  1 
ATOM   5802 C CG  . MET B 1 211 ? 17.470  9.980   -43.048 1.00 44.31  ? 211  MET B CG  1 
ATOM   5803 S SD  . MET B 1 211 ? 17.617  8.216   -43.086 1.00 50.78  ? 211  MET B SD  1 
ATOM   5804 C CE  . MET B 1 211 ? 17.826  7.854   -41.356 1.00 47.53  ? 211  MET B CE  1 
ATOM   5805 N N   . HIS B 1 212 ? 14.746  13.116  -45.252 1.00 41.04  ? 212  HIS B N   1 
ATOM   5806 C CA  . HIS B 1 212 ? 14.451  14.107  -46.250 1.00 41.32  ? 212  HIS B CA  1 
ATOM   5807 C C   . HIS B 1 212 ? 14.616  15.513  -45.666 1.00 42.07  ? 212  HIS B C   1 
ATOM   5808 O O   . HIS B 1 212 ? 15.013  16.430  -46.379 1.00 43.27  ? 212  HIS B O   1 
ATOM   5809 C CB  . HIS B 1 212 ? 13.078  13.846  -46.886 1.00 40.48  ? 212  HIS B CB  1 
ATOM   5810 C CG  . HIS B 1 212 ? 13.024  12.572  -47.684 1.00 39.68  ? 212  HIS B CG  1 
ATOM   5811 N ND1 . HIS B 1 212 ? 13.707  12.406  -48.872 1.00 37.94  ? 212  HIS B ND1 1 
ATOM   5812 C CD2 . HIS B 1 212 ? 12.376  11.403  -47.462 1.00 37.82  ? 212  HIS B CD2 1 
ATOM   5813 C CE1 . HIS B 1 212 ? 13.480  11.195  -49.348 1.00 36.52  ? 212  HIS B CE1 1 
ATOM   5814 N NE2 . HIS B 1 212 ? 12.668  10.568  -48.517 1.00 36.96  ? 212  HIS B NE2 1 
ATOM   5815 N N   . ILE B 1 213 ? 14.365  15.681  -44.369 1.00 41.89  ? 213  ILE B N   1 
ATOM   5816 C CA  . ILE B 1 213 ? 14.565  16.981  -43.731 1.00 42.25  ? 213  ILE B CA  1 
ATOM   5817 C C   . ILE B 1 213 ? 16.043  17.317  -43.767 1.00 43.42  ? 213  ILE B C   1 
ATOM   5818 O O   . ILE B 1 213 ? 16.436  18.466  -44.015 1.00 44.66  ? 213  ILE B O   1 
ATOM   5819 C CB  . ILE B 1 213 ? 14.061  16.991  -42.271 1.00 42.13  ? 213  ILE B CB  1 
ATOM   5820 C CG1 . ILE B 1 213 ? 12.525  16.948  -42.230 1.00 41.75  ? 213  ILE B CG1 1 
ATOM   5821 C CG2 . ILE B 1 213 ? 14.554  18.231  -41.509 1.00 41.31  ? 213  ILE B CG2 1 
ATOM   5822 C CD1 . ILE B 1 213 ? 11.949  16.605  -40.861 1.00 40.10  ? 213  ILE B CD1 1 
ATOM   5823 N N   . LEU B 1 214 ? 16.857  16.290  -43.550 1.00 43.20  ? 214  LEU B N   1 
ATOM   5824 C CA  . LEU B 1 214 ? 18.300  16.435  -43.433 1.00 43.90  ? 214  LEU B CA  1 
ATOM   5825 C C   . LEU B 1 214 ? 19.074  16.370  -44.756 1.00 45.11  ? 214  LEU B C   1 
ATOM   5826 O O   . LEU B 1 214 ? 20.312  16.449  -44.753 1.00 45.76  ? 214  LEU B O   1 
ATOM   5827 C CB  . LEU B 1 214 ? 18.840  15.400  -42.442 1.00 43.04  ? 214  LEU B CB  1 
ATOM   5828 C CG  . LEU B 1 214 ? 18.310  15.552  -41.010 1.00 42.19  ? 214  LEU B CG  1 
ATOM   5829 C CD1 . LEU B 1 214 ? 18.875  14.476  -40.135 1.00 40.51  ? 214  LEU B CD1 1 
ATOM   5830 C CD2 . LEU B 1 214 ? 18.650  16.922  -40.431 1.00 43.72  ? 214  LEU B CD2 1 
ATOM   5831 N N   . SER B 1 215 ? 18.365  16.248  -45.880 1.00 45.19  ? 215  SER B N   1 
ATOM   5832 C CA  . SER B 1 215 ? 19.035  16.117  -47.176 1.00 46.64  ? 215  SER B CA  1 
ATOM   5833 C C   . SER B 1 215 ? 18.606  17.221  -48.131 1.00 48.21  ? 215  SER B C   1 
ATOM   5834 O O   . SER B 1 215 ? 17.446  17.275  -48.532 1.00 47.67  ? 215  SER B O   1 
ATOM   5835 C CB  . SER B 1 215 ? 18.743  14.742  -47.773 1.00 45.82  ? 215  SER B CB  1 
ATOM   5836 O OG  . SER B 1 215 ? 19.628  14.407  -48.826 1.00 46.31  ? 215  SER B OG  1 
ATOM   5837 N N   . LEU B 1 216 ? 19.541  18.097  -48.504 1.00 50.71  ? 216  LEU B N   1 
ATOM   5838 C CA  . LEU B 1 216 ? 19.195  19.302  -49.272 1.00 52.70  ? 216  LEU B CA  1 
ATOM   5839 C C   . LEU B 1 216 ? 18.349  19.058  -50.528 1.00 52.64  ? 216  LEU B C   1 
ATOM   5840 O O   . LEU B 1 216 ? 17.338  19.739  -50.716 1.00 53.16  ? 216  LEU B O   1 
ATOM   5841 C CB  . LEU B 1 216 ? 20.423  20.143  -49.623 1.00 55.10  ? 216  LEU B CB  1 
ATOM   5842 C CG  . LEU B 1 216 ? 20.133  21.657  -49.549 1.00 58.69  ? 216  LEU B CG  1 
ATOM   5843 C CD1 . LEU B 1 216 ? 20.470  22.179  -48.116 1.00 60.59  ? 216  LEU B CD1 1 
ATOM   5844 C CD2 . LEU B 1 216 ? 20.867  22.480  -50.639 1.00 61.48  ? 216  LEU B CD2 1 
ATOM   5845 N N   . PRO B 1 217 ? 18.745  18.095  -51.393 1.00 52.73  ? 217  PRO B N   1 
ATOM   5846 C CA  . PRO B 1 217 ? 17.926  17.866  -52.604 1.00 52.32  ? 217  PRO B CA  1 
ATOM   5847 C C   . PRO B 1 217 ? 16.464  17.479  -52.340 1.00 50.95  ? 217  PRO B C   1 
ATOM   5848 O O   . PRO B 1 217 ? 15.620  17.677  -53.212 1.00 51.79  ? 217  PRO B O   1 
ATOM   5849 C CB  . PRO B 1 217 ? 18.669  16.730  -53.318 1.00 52.38  ? 217  PRO B CB  1 
ATOM   5850 C CG  . PRO B 1 217 ? 20.107  16.919  -52.872 1.00 53.12  ? 217  PRO B CG  1 
ATOM   5851 C CD  . PRO B 1 217 ? 19.974  17.271  -51.417 1.00 52.82  ? 217  PRO B CD  1 
ATOM   5852 N N   . SER B 1 218 ? 16.156  16.966  -51.152 1.00 49.39  ? 218  SER B N   1 
ATOM   5853 C CA  . SER B 1 218 ? 14.774  16.619  -50.814 1.00 47.69  ? 218  SER B CA  1 
ATOM   5854 C C   . SER B 1 218 ? 13.951  17.823  -50.389 1.00 48.54  ? 218  SER B C   1 
ATOM   5855 O O   . SER B 1 218 ? 12.726  17.838  -50.579 1.00 48.38  ? 218  SER B O   1 
ATOM   5856 C CB  . SER B 1 218 ? 14.730  15.547  -49.733 1.00 46.22  ? 218  SER B CB  1 
ATOM   5857 O OG  . SER B 1 218 ? 14.993  14.268  -50.288 1.00 44.57  ? 218  SER B OG  1 
ATOM   5858 N N   . ARG B 1 219 ? 14.629  18.837  -49.846 1.00 49.46  ? 219  ARG B N   1 
ATOM   5859 C CA  . ARG B 1 219 ? 13.965  19.987  -49.214 1.00 50.03  ? 219  ARG B CA  1 
ATOM   5860 C C   . ARG B 1 219 ? 13.026  20.771  -50.124 1.00 50.34  ? 219  ARG B C   1 
ATOM   5861 O O   . ARG B 1 219 ? 12.006  21.266  -49.683 1.00 51.03  ? 219  ARG B O   1 
ATOM   5862 C CB  . ARG B 1 219 ? 14.977  20.933  -48.543 1.00 50.97  ? 219  ARG B CB  1 
ATOM   5863 C CG  . ARG B 1 219 ? 15.671  20.348  -47.321 1.00 51.24  ? 219  ARG B CG  1 
ATOM   5864 C CD  . ARG B 1 219 ? 14.686  20.011  -46.203 1.00 53.54  ? 219  ARG B CD  1 
ATOM   5865 N NE  . ARG B 1 219 ? 14.080  21.218  -45.659 1.00 56.46  ? 219  ARG B NE  1 
ATOM   5866 C CZ  . ARG B 1 219 ? 14.614  21.942  -44.682 1.00 59.14  ? 219  ARG B CZ  1 
ATOM   5867 N NH1 . ARG B 1 219 ? 15.759  21.558  -44.129 1.00 59.20  ? 219  ARG B NH1 1 
ATOM   5868 N NH2 . ARG B 1 219 ? 14.007  23.049  -44.255 1.00 61.32  ? 219  ARG B NH2 1 
ATOM   5869 N N   . SER B 1 220 ? 13.345  20.873  -51.397 1.00 50.73  ? 220  SER B N   1 
ATOM   5870 C CA  . SER B 1 220 ? 12.469  21.615  -52.292 1.00 50.92  ? 220  SER B CA  1 
ATOM   5871 C C   . SER B 1 220 ? 11.206  20.806  -52.703 1.00 49.75  ? 220  SER B C   1 
ATOM   5872 O O   . SER B 1 220 ? 10.429  21.253  -53.540 1.00 50.41  ? 220  SER B O   1 
ATOM   5873 C CB  . SER B 1 220 ? 13.267  22.118  -53.509 1.00 52.18  ? 220  SER B CB  1 
ATOM   5874 O OG  . SER B 1 220 ? 13.783  21.040  -54.274 1.00 51.88  ? 220  SER B OG  1 
ATOM   5875 N N   . LEU B 1 221 ? 10.995  19.635  -52.096 1.00 47.79  ? 221  LEU B N   1 
ATOM   5876 C CA  . LEU B 1 221 ? 9.905   18.735  -52.501 1.00 46.36  ? 221  LEU B CA  1 
ATOM   5877 C C   . LEU B 1 221 ? 8.782   18.609  -51.475 1.00 45.41  ? 221  LEU B C   1 
ATOM   5878 O O   . LEU B 1 221 ? 7.792   17.925  -51.718 1.00 44.84  ? 221  LEU B O   1 
ATOM   5879 C CB  . LEU B 1 221 ? 10.457  17.349  -52.850 1.00 45.55  ? 221  LEU B CB  1 
ATOM   5880 C CG  . LEU B 1 221 ? 11.652  17.327  -53.811 1.00 45.84  ? 221  LEU B CG  1 
ATOM   5881 C CD1 . LEU B 1 221 ? 12.096  15.902  -54.038 1.00 44.05  ? 221  LEU B CD1 1 
ATOM   5882 C CD2 . LEU B 1 221 ? 11.307  18.009  -55.115 1.00 45.07  ? 221  LEU B CD2 1 
ATOM   5883 N N   . PHE B 1 222 ? 8.942   19.261  -50.326 1.00 45.27  ? 222  PHE B N   1 
ATOM   5884 C CA  . PHE B 1 222 ? 7.901   19.304  -49.306 1.00 44.74  ? 222  PHE B CA  1 
ATOM   5885 C C   . PHE B 1 222 ? 8.003   20.572  -48.459 1.00 45.86  ? 222  PHE B C   1 
ATOM   5886 O O   . PHE B 1 222 ? 9.004   21.274  -48.502 1.00 46.11  ? 222  PHE B O   1 
ATOM   5887 C CB  . PHE B 1 222 ? 7.936   18.047  -48.428 1.00 43.05  ? 222  PHE B CB  1 
ATOM   5888 C CG  . PHE B 1 222 ? 9.209   17.873  -47.631 1.00 41.89  ? 222  PHE B CG  1 
ATOM   5889 C CD1 . PHE B 1 222 ? 10.366  17.353  -48.225 1.00 40.91  ? 222  PHE B CD1 1 
ATOM   5890 C CD2 . PHE B 1 222 ? 9.236   18.190  -46.261 1.00 40.65  ? 222  PHE B CD2 1 
ATOM   5891 C CE1 . PHE B 1 222 ? 11.541  17.170  -47.479 1.00 40.21  ? 222  PHE B CE1 1 
ATOM   5892 C CE2 . PHE B 1 222 ? 10.395  18.034  -45.507 1.00 39.25  ? 222  PHE B CE2 1 
ATOM   5893 C CZ  . PHE B 1 222 ? 11.559  17.507  -46.114 1.00 40.25  ? 222  PHE B CZ  1 
ATOM   5894 N N   . HIS B 1 223 ? 6.970   20.845  -47.669 1.00 46.64  ? 223  HIS B N   1 
ATOM   5895 C CA  . HIS B 1 223 ? 6.928   22.075  -46.896 1.00 48.56  ? 223  HIS B CA  1 
ATOM   5896 C C   . HIS B 1 223 ? 6.774   21.836  -45.384 1.00 48.18  ? 223  HIS B C   1 
ATOM   5897 O O   . HIS B 1 223 ? 7.124   22.714  -44.586 1.00 49.43  ? 223  HIS B O   1 
ATOM   5898 C CB  . HIS B 1 223 ? 5.839   23.018  -47.442 1.00 49.98  ? 223  HIS B CB  1 
ATOM   5899 C CG  . HIS B 1 223 ? 5.815   23.102  -48.942 1.00 52.98  ? 223  HIS B CG  1 
ATOM   5900 N ND1 . HIS B 1 223 ? 6.434   24.119  -49.643 1.00 56.19  ? 223  HIS B ND1 1 
ATOM   5901 C CD2 . HIS B 1 223 ? 5.263   22.284  -49.876 1.00 53.31  ? 223  HIS B CD2 1 
ATOM   5902 C CE1 . HIS B 1 223 ? 6.264   23.924  -50.942 1.00 57.10  ? 223  HIS B CE1 1 
ATOM   5903 N NE2 . HIS B 1 223 ? 5.559   22.817  -51.110 1.00 55.79  ? 223  HIS B NE2 1 
ATOM   5904 N N   . ARG B 1 224 ? 6.272   20.654  -45.004 1.00 46.82  ? 224  ARG B N   1 
ATOM   5905 C CA  . ARG B 1 224 ? 6.047   20.261  -43.603 1.00 45.63  ? 224  ARG B CA  1 
ATOM   5906 C C   . ARG B 1 224 ? 6.310   18.762  -43.451 1.00 43.62  ? 224  ARG B C   1 
ATOM   5907 O O   . ARG B 1 224 ? 6.404   18.058  -44.445 1.00 43.40  ? 224  ARG B O   1 
ATOM   5908 C CB  . ARG B 1 224 ? 4.606   20.566  -43.192 1.00 46.65  ? 224  ARG B CB  1 
ATOM   5909 C CG  . ARG B 1 224 ? 4.317   22.026  -43.047 1.00 50.49  ? 224  ARG B CG  1 
ATOM   5910 C CD  . ARG B 1 224 ? 2.831   22.318  -42.810 1.00 54.10  ? 224  ARG B CD  1 
ATOM   5911 N NE  . ARG B 1 224 ? 2.102   22.513  -44.055 1.00 56.79  ? 224  ARG B NE  1 
ATOM   5912 C CZ  . ARG B 1 224 ? 2.324   23.512  -44.905 1.00 59.70  ? 224  ARG B CZ  1 
ATOM   5913 N NH1 . ARG B 1 224 ? 3.272   24.416  -44.663 1.00 59.59  ? 224  ARG B NH1 1 
ATOM   5914 N NH2 . ARG B 1 224 ? 1.614   23.588  -46.024 1.00 61.48  ? 224  ARG B NH2 1 
ATOM   5915 N N   . ALA B 1 225 ? 6.415   18.276  -42.212 1.00 42.37  ? 225  ALA B N   1 
ATOM   5916 C CA  . ALA B 1 225 ? 6.767   16.877  -41.931 1.00 40.60  ? 225  ALA B CA  1 
ATOM   5917 C C   . ALA B 1 225 ? 6.116   16.378  -40.653 1.00 40.08  ? 225  ALA B C   1 
ATOM   5918 O O   . ALA B 1 225 ? 5.914   17.151  -39.711 1.00 40.93  ? 225  ALA B O   1 
ATOM   5919 C CB  . ALA B 1 225 ? 8.273   16.741  -41.813 1.00 39.98  ? 225  ALA B CB  1 
ATOM   5920 N N   . VAL B 1 226 ? 5.835   15.083  -40.607 1.00 38.70  ? 226  VAL B N   1 
ATOM   5921 C CA  . VAL B 1 226 ? 5.278   14.425  -39.435 1.00 38.14  ? 226  VAL B CA  1 
ATOM   5922 C C   . VAL B 1 226 ? 6.078   13.156  -39.251 1.00 37.97  ? 226  VAL B C   1 
ATOM   5923 O O   . VAL B 1 226 ? 6.197   12.377  -40.179 1.00 38.36  ? 226  VAL B O   1 
ATOM   5924 C CB  . VAL B 1 226 ? 3.803   13.978  -39.648 1.00 37.97  ? 226  VAL B CB  1 
ATOM   5925 C CG1 . VAL B 1 226 ? 3.252   13.264  -38.426 1.00 37.27  ? 226  VAL B CG1 1 
ATOM   5926 C CG2 . VAL B 1 226 ? 2.911   15.148  -40.035 1.00 38.59  ? 226  VAL B CG2 1 
ATOM   5927 N N   . LEU B 1 227 ? 6.613   12.950  -38.054 1.00 38.15  ? 227  LEU B N   1 
ATOM   5928 C CA  . LEU B 1 227 ? 7.452   11.798  -37.752 1.00 37.46  ? 227  LEU B CA  1 
ATOM   5929 C C   . LEU B 1 227 ? 6.793   11.094  -36.590 1.00 37.78  ? 227  LEU B C   1 
ATOM   5930 O O   . LEU B 1 227 ? 6.766   11.628  -35.479 1.00 38.16  ? 227  LEU B O   1 
ATOM   5931 C CB  . LEU B 1 227 ? 8.866   12.232  -37.361 1.00 36.76  ? 227  LEU B CB  1 
ATOM   5932 C CG  . LEU B 1 227 ? 9.770   12.819  -38.454 1.00 37.27  ? 227  LEU B CG  1 
ATOM   5933 C CD1 . LEU B 1 227 ? 9.517   14.325  -38.670 1.00 36.58  ? 227  LEU B CD1 1 
ATOM   5934 C CD2 . LEU B 1 227 ? 11.266  12.568  -38.160 1.00 33.70  ? 227  LEU B CD2 1 
ATOM   5935 N N   . GLN B 1 228 ? 6.235   9.913   -36.851 1.00 37.54  ? 228  GLN B N   1 
ATOM   5936 C CA  . GLN B 1 228 ? 5.532   9.164   -35.839 1.00 37.63  ? 228  GLN B CA  1 
ATOM   5937 C C   . GLN B 1 228 ? 6.420   8.013   -35.409 1.00 38.08  ? 228  GLN B C   1 
ATOM   5938 O O   . GLN B 1 228 ? 6.767   7.165   -36.221 1.00 38.05  ? 228  GLN B O   1 
ATOM   5939 C CB  . GLN B 1 228 ? 4.235   8.614   -36.408 1.00 37.84  ? 228  GLN B CB  1 
ATOM   5940 C CG  . GLN B 1 228 ? 3.255   9.671   -36.903 1.00 37.93  ? 228  GLN B CG  1 
ATOM   5941 C CD  . GLN B 1 228 ? 2.078   9.069   -37.672 1.00 40.18  ? 228  GLN B CD  1 
ATOM   5942 O OE1 . GLN B 1 228 ? 1.628   9.635   -38.660 1.00 41.96  ? 228  GLN B OE1 1 
ATOM   5943 N NE2 . GLN B 1 228 ? 1.579   7.920   -37.222 1.00 40.37  ? 228  GLN B NE2 1 
ATOM   5944 N N   . SER B 1 229 ? 6.800   7.983   -34.132 1.00 38.24  ? 229  SER B N   1 
ATOM   5945 C CA  . SER B 1 229 ? 7.534   6.847   -33.582 1.00 37.95  ? 229  SER B CA  1 
ATOM   5946 C C   . SER B 1 229 ? 8.828   6.513   -34.316 1.00 37.51  ? 229  SER B C   1 
ATOM   5947 O O   . SER B 1 229 ? 9.166   5.338   -34.438 1.00 38.67  ? 229  SER B O   1 
ATOM   5948 C CB  . SER B 1 229 ? 6.639   5.595   -33.578 1.00 38.48  ? 229  SER B CB  1 
ATOM   5949 O OG  . SER B 1 229 ? 5.582   5.719   -32.655 1.00 37.66  ? 229  SER B OG  1 
ATOM   5950 N N   . GLY B 1 230 ? 9.536   7.513   -34.822 1.00 36.82  ? 230  GLY B N   1 
ATOM   5951 C CA  . GLY B 1 230 ? 10.799  7.278   -35.524 1.00 36.48  ? 230  GLY B CA  1 
ATOM   5952 C C   . GLY B 1 230 ? 11.551  8.562   -35.850 1.00 36.72  ? 230  GLY B C   1 
ATOM   5953 O O   . GLY B 1 230 ? 10.948  9.637   -36.003 1.00 36.76  ? 230  GLY B O   1 
ATOM   5954 N N   . THR B 1 231 ? 12.869  8.446   -35.975 1.00 36.74  ? 231  THR B N   1 
ATOM   5955 C CA  . THR B 1 231 ? 13.753  9.600   -36.137 1.00 36.95  ? 231  THR B CA  1 
ATOM   5956 C C   . THR B 1 231 ? 14.979  9.238   -36.951 1.00 37.24  ? 231  THR B C   1 
ATOM   5957 O O   . THR B 1 231 ? 15.392  8.092   -36.940 1.00 37.60  ? 231  THR B O   1 
ATOM   5958 C CB  . THR B 1 231 ? 14.285  10.095  -34.749 1.00 37.83  ? 231  THR B CB  1 
ATOM   5959 O OG1 . THR B 1 231 ? 15.103  9.082   -34.142 1.00 35.98  ? 231  THR B OG1 1 
ATOM   5960 C CG2 . THR B 1 231 ? 13.136  10.498  -33.811 1.00 37.05  ? 231  THR B CG2 1 
ATOM   5961 N N   . PRO B 1 232 ? 15.602  10.219  -37.622 1.00 37.70  ? 232  PRO B N   1 
ATOM   5962 C CA  . PRO B 1 232 ? 16.819  9.853   -38.381 1.00 38.22  ? 232  PRO B CA  1 
ATOM   5963 C C   . PRO B 1 232 ? 18.028  9.648   -37.470 1.00 39.63  ? 232  PRO B C   1 
ATOM   5964 O O   . PRO B 1 232 ? 18.914  8.872   -37.789 1.00 41.06  ? 232  PRO B O   1 
ATOM   5965 C CB  . PRO B 1 232 ? 17.030  11.042  -39.319 1.00 38.22  ? 232  PRO B CB  1 
ATOM   5966 C CG  . PRO B 1 232 ? 16.300  12.195  -38.658 1.00 38.17  ? 232  PRO B CG  1 
ATOM   5967 C CD  . PRO B 1 232 ? 15.174  11.613  -37.859 1.00 37.25  ? 232  PRO B CD  1 
ATOM   5968 N N   . ASN B 1 233 ? 18.063  10.350  -36.341 1.00 40.24  ? 233  ASN B N   1 
ATOM   5969 C CA  . ASN B 1 233 ? 19.048  10.105  -35.283 1.00 40.62  ? 233  ASN B CA  1 
ATOM   5970 C C   . ASN B 1 233 ? 18.671  8.851   -34.527 1.00 41.18  ? 233  ASN B C   1 
ATOM   5971 O O   . ASN B 1 233 ? 17.580  8.290   -34.742 1.00 40.66  ? 233  ASN B O   1 
ATOM   5972 C CB  . ASN B 1 233 ? 19.060  11.281  -34.301 1.00 40.74  ? 233  ASN B CB  1 
ATOM   5973 C CG  . ASN B 1 233 ? 17.667  11.641  -33.802 1.00 39.42  ? 233  ASN B CG  1 
ATOM   5974 O OD1 . ASN B 1 233 ? 16.768  11.964  -34.592 1.00 36.53  ? 233  ASN B OD1 1 
ATOM   5975 N ND2 . ASN B 1 233 ? 17.477  11.578  -32.480 1.00 38.60  ? 233  ASN B ND2 1 
ATOM   5976 N N   . GLY B 1 234 ? 19.554  8.420   -33.629 1.00 42.40  ? 234  GLY B N   1 
ATOM   5977 C CA  . GLY B 1 234 ? 19.291  7.238   -32.805 1.00 42.97  ? 234  GLY B CA  1 
ATOM   5978 C C   . GLY B 1 234 ? 20.017  5.974   -33.244 1.00 43.58  ? 234  GLY B C   1 
ATOM   5979 O O   . GLY B 1 234 ? 20.714  5.969   -34.255 1.00 43.82  ? 234  GLY B O   1 
ATOM   5980 N N   . PRO B 1 235 ? 19.834  4.872   -32.499 1.00 44.11  ? 235  PRO B N   1 
ATOM   5981 C CA  . PRO B 1 235 ? 20.744  3.737   -32.667 1.00 44.85  ? 235  PRO B CA  1 
ATOM   5982 C C   . PRO B 1 235 ? 20.462  2.745   -33.818 1.00 44.39  ? 235  PRO B C   1 
ATOM   5983 O O   . PRO B 1 235 ? 21.341  1.918   -34.108 1.00 45.09  ? 235  PRO B O   1 
ATOM   5984 C CB  . PRO B 1 235 ? 20.658  3.036   -31.318 1.00 45.77  ? 235  PRO B CB  1 
ATOM   5985 C CG  . PRO B 1 235 ? 19.266  3.366   -30.799 1.00 45.11  ? 235  PRO B CG  1 
ATOM   5986 C CD  . PRO B 1 235 ? 18.758  4.585   -31.536 1.00 43.91  ? 235  PRO B CD  1 
ATOM   5987 N N   . TRP B 1 236 ? 19.305  2.834   -34.491 1.00 42.36  ? 236  TRP B N   1 
ATOM   5988 C CA  . TRP B 1 236 ? 18.960  1.833   -35.525 1.00 41.55  ? 236  TRP B CA  1 
ATOM   5989 C C   . TRP B 1 236 ? 18.734  2.354   -36.941 1.00 41.25  ? 236  TRP B C   1 
ATOM   5990 O O   . TRP B 1 236 ? 18.670  1.571   -37.892 1.00 41.88  ? 236  TRP B O   1 
ATOM   5991 C CB  . TRP B 1 236 ? 17.716  1.076   -35.116 1.00 40.83  ? 236  TRP B CB  1 
ATOM   5992 C CG  . TRP B 1 236 ? 16.567  1.997   -34.869 1.00 40.05  ? 236  TRP B CG  1 
ATOM   5993 C CD1 . TRP B 1 236 ? 16.220  2.555   -33.678 1.00 40.04  ? 236  TRP B CD1 1 
ATOM   5994 C CD2 . TRP B 1 236 ? 15.632  2.488   -35.831 1.00 39.76  ? 236  TRP B CD2 1 
ATOM   5995 N NE1 . TRP B 1 236 ? 15.124  3.354   -33.826 1.00 39.34  ? 236  TRP B NE1 1 
ATOM   5996 C CE2 . TRP B 1 236 ? 14.729  3.333   -35.136 1.00 40.26  ? 236  TRP B CE2 1 
ATOM   5997 C CE3 . TRP B 1 236 ? 15.453  2.289   -37.210 1.00 40.49  ? 236  TRP B CE3 1 
ATOM   5998 C CZ2 . TRP B 1 236 ? 13.641  3.982   -35.772 1.00 38.77  ? 236  TRP B CZ2 1 
ATOM   5999 C CZ3 . TRP B 1 236 ? 14.381  2.953   -37.857 1.00 40.75  ? 236  TRP B CZ3 1 
ATOM   6000 C CH2 . TRP B 1 236 ? 13.488  3.786   -37.125 1.00 39.40  ? 236  TRP B CH2 1 
ATOM   6001 N N   . ALA B 1 237 ? 18.575  3.662   -37.091 1.00 40.73  ? 237  ALA B N   1 
ATOM   6002 C CA  . ALA B 1 237 ? 18.135  4.227   -38.379 1.00 39.83  ? 237  ALA B CA  1 
ATOM   6003 C C   . ALA B 1 237 ? 19.250  4.430   -39.404 1.00 40.00  ? 237  ALA B C   1 
ATOM   6004 O O   . ALA B 1 237 ? 18.970  4.486   -40.593 1.00 40.20  ? 237  ALA B O   1 
ATOM   6005 C CB  . ALA B 1 237 ? 17.309  5.525   -38.176 1.00 38.55  ? 237  ALA B CB  1 
ATOM   6006 N N   . THR B 1 238 ? 20.499  4.545   -38.956 1.00 40.19  ? 238  THR B N   1 
ATOM   6007 C CA  . THR B 1 238 ? 21.630  4.643   -39.880 1.00 41.01  ? 238  THR B CA  1 
ATOM   6008 C C   . THR B 1 238 ? 22.791  3.715   -39.520 1.00 42.98  ? 238  THR B C   1 
ATOM   6009 O O   . THR B 1 238 ? 22.853  3.175   -38.413 1.00 43.72  ? 238  THR B O   1 
ATOM   6010 C CB  . THR B 1 238 ? 22.218  6.070   -39.984 1.00 41.00  ? 238  THR B CB  1 
ATOM   6011 O OG1 . THR B 1 238 ? 22.803  6.439   -38.728 1.00 41.36  ? 238  THR B OG1 1 
ATOM   6012 C CG2 . THR B 1 238 ? 21.167  7.076   -40.412 1.00 38.72  ? 238  THR B CG2 1 
ATOM   6013 N N   . VAL B 1 239 ? 23.709  3.527   -40.465 1.00 43.88  ? 239  VAL B N   1 
ATOM   6014 C CA  . VAL B 1 239 ? 24.975  2.883   -40.160 1.00 45.35  ? 239  VAL B CA  1 
ATOM   6015 C C   . VAL B 1 239 ? 26.116  3.674   -40.764 1.00 46.87  ? 239  VAL B C   1 
ATOM   6016 O O   . VAL B 1 239 ? 25.924  4.457   -41.697 1.00 46.75  ? 239  VAL B O   1 
ATOM   6017 C CB  . VAL B 1 239 ? 25.039  1.410   -40.655 1.00 45.93  ? 239  VAL B CB  1 
ATOM   6018 C CG1 . VAL B 1 239 ? 24.189  0.511   -39.771 1.00 45.04  ? 239  VAL B CG1 1 
ATOM   6019 C CG2 . VAL B 1 239 ? 24.652  1.283   -42.126 1.00 43.56  ? 239  VAL B CG2 1 
ATOM   6020 N N   . SER B 1 240 ? 27.318  3.460   -40.247 1.00 48.86  ? 240  SER B N   1 
ATOM   6021 C CA  . SER B 1 240 ? 28.485  4.120   -40.824 1.00 50.39  ? 240  SER B CA  1 
ATOM   6022 C C   . SER B 1 240 ? 28.808  3.439   -42.155 1.00 51.34  ? 240  SER B C   1 
ATOM   6023 O O   . SER B 1 240 ? 28.396  2.288   -42.402 1.00 50.75  ? 240  SER B O   1 
ATOM   6024 C CB  . SER B 1 240 ? 29.661  4.017   -39.887 1.00 51.05  ? 240  SER B CB  1 
ATOM   6025 O OG  . SER B 1 240 ? 30.117  2.677   -39.895 1.00 53.11  ? 240  SER B OG  1 
ATOM   6026 N N   . ALA B 1 241 ? 29.533  4.164   -43.008 1.00 52.82  ? 241  ALA B N   1 
ATOM   6027 C CA  . ALA B 1 241 ? 30.030  3.618   -44.277 1.00 53.76  ? 241  ALA B CA  1 
ATOM   6028 C C   . ALA B 1 241 ? 30.846  2.355   -44.031 1.00 55.43  ? 241  ALA B C   1 
ATOM   6029 O O   . ALA B 1 241 ? 30.655  1.343   -44.725 1.00 56.24  ? 241  ALA B O   1 
ATOM   6030 C CB  . ALA B 1 241 ? 30.856  4.648   -45.016 1.00 54.33  ? 241  ALA B CB  1 
ATOM   6031 N N   . GLY B 1 242 ? 31.734  2.412   -43.034 1.00 56.21  ? 242  GLY B N   1 
ATOM   6032 C CA  . GLY B 1 242 ? 32.551  1.261   -42.645 1.00 57.39  ? 242  GLY B CA  1 
ATOM   6033 C C   . GLY B 1 242 ? 31.702  0.049   -42.296 1.00 56.50  ? 242  GLY B C   1 
ATOM   6034 O O   . GLY B 1 242 ? 32.025  -1.072  -42.698 1.00 57.42  ? 242  GLY B O   1 
ATOM   6035 N N   . GLU B 1 243 ? 30.609  0.271   -41.565 1.00 54.62  ? 243  GLU B N   1 
ATOM   6036 C CA  . GLU B 1 243 ? 29.710  -0.826  -41.190 1.00 53.98  ? 243  GLU B CA  1 
ATOM   6037 C C   . GLU B 1 243 ? 28.799  -1.384  -42.315 1.00 52.88  ? 243  GLU B C   1 
ATOM   6038 O O   . GLU B 1 243 ? 28.504  -2.582  -42.313 1.00 53.54  ? 243  GLU B O   1 
ATOM   6039 C CB  . GLU B 1 243 ? 28.902  -0.473  -39.930 1.00 53.01  ? 243  GLU B CB  1 
ATOM   6040 C CG  . GLU B 1 243 ? 27.861  -1.527  -39.488 1.00 52.31  ? 243  GLU B CG  1 
ATOM   6041 C CD  . GLU B 1 243 ? 28.463  -2.788  -38.864 1.00 53.54  ? 243  GLU B CD  1 
ATOM   6042 O OE1 . GLU B 1 243 ? 29.705  -2.928  -38.806 1.00 54.50  ? 243  GLU B OE1 1 
ATOM   6043 O OE2 . GLU B 1 243 ? 27.666  -3.657  -38.436 1.00 53.06  ? 243  GLU B OE2 1 
ATOM   6044 N N   . ALA B 1 244 ? 28.358  -0.561  -43.268 1.00 51.49  ? 244  ALA B N   1 
ATOM   6045 C CA  . ALA B 1 244 ? 27.554  -1.104  -44.402 1.00 50.73  ? 244  ALA B CA  1 
ATOM   6046 C C   . ALA B 1 244 ? 28.412  -1.973  -45.324 1.00 52.48  ? 244  ALA B C   1 
ATOM   6047 O O   . ALA B 1 244 ? 27.963  -2.996  -45.837 1.00 52.66  ? 244  ALA B O   1 
ATOM   6048 C CB  . ALA B 1 244 ? 26.882  -0.017  -45.183 1.00 49.04  ? 244  ALA B CB  1 
ATOM   6049 N N   . ARG B 1 245 ? 29.665  -1.558  -45.495 1.00 53.94  ? 245  ARG B N   1 
ATOM   6050 C CA  . ARG B 1 245 ? 30.625  -2.283  -46.292 1.00 55.52  ? 245  ARG B CA  1 
ATOM   6051 C C   . ARG B 1 245 ? 30.896  -3.656  -45.682 1.00 57.02  ? 245  ARG B C   1 
ATOM   6052 O O   . ARG B 1 245 ? 31.069  -4.645  -46.405 1.00 58.37  ? 245  ARG B O   1 
ATOM   6053 C CB  . ARG B 1 245 ? 31.914  -1.476  -46.403 1.00 56.86  ? 245  ARG B CB  1 
ATOM   6054 C CG  . ARG B 1 245 ? 33.056  -2.215  -47.088 1.00 58.31  ? 245  ARG B CG  1 
ATOM   6055 C CD  . ARG B 1 245 ? 34.197  -1.283  -47.453 1.00 59.08  ? 245  ARG B CD  1 
ATOM   6056 N NE  . ARG B 1 245 ? 33.839  -0.420  -48.579 1.00 57.89  ? 245  ARG B NE  1 
ATOM   6057 C CZ  . ARG B 1 245 ? 33.836  -0.812  -49.854 1.00 59.86  ? 245  ARG B CZ  1 
ATOM   6058 N NH1 . ARG B 1 245 ? 33.498  0.038   -50.821 1.00 59.63  ? 245  ARG B NH1 1 
ATOM   6059 N NH2 . ARG B 1 245 ? 34.163  -2.057  -50.176 1.00 59.85  ? 245  ARG B NH2 1 
ATOM   6060 N N   . ARG B 1 246 ? 30.926  -3.714  -44.353 1.00 56.70  ? 246  ARG B N   1 
ATOM   6061 C CA  . ARG B 1 246 ? 31.216  -4.954  -43.650 1.00 57.38  ? 246  ARG B CA  1 
ATOM   6062 C C   . ARG B 1 246 ? 30.053  -5.923  -43.857 1.00 56.30  ? 246  ARG B C   1 
ATOM   6063 O O   . ARG B 1 246 ? 30.265  -7.102  -44.160 1.00 57.39  ? 246  ARG B O   1 
ATOM   6064 C CB  . ARG B 1 246 ? 31.430  -4.661  -42.164 1.00 57.67  ? 246  ARG B CB  1 
ATOM   6065 C CG  . ARG B 1 246 ? 32.120  -5.739  -41.355 1.00 59.50  ? 246  ARG B CG  1 
ATOM   6066 C CD  . ARG B 1 246 ? 31.540  -5.773  -39.922 1.00 60.31  ? 246  ARG B CD  1 
ATOM   6067 N NE  . ARG B 1 246 ? 30.745  -6.983  -39.699 1.00 61.04  ? 246  ARG B NE  1 
ATOM   6068 C CZ  . ARG B 1 246 ? 29.464  -7.028  -39.333 1.00 59.20  ? 246  ARG B CZ  1 
ATOM   6069 N NH1 . ARG B 1 246 ? 28.770  -5.927  -39.102 1.00 55.26  ? 246  ARG B NH1 1 
ATOM   6070 N NH2 . ARG B 1 246 ? 28.882  -8.209  -39.173 1.00 61.37  ? 246  ARG B NH2 1 
ATOM   6071 N N   . ARG B 1 247 ? 28.828  -5.415  -43.733 1.00 54.00  ? 247  ARG B N   1 
ATOM   6072 C CA  . ARG B 1 247 ? 27.654  -6.268  -43.840 1.00 52.96  ? 247  ARG B CA  1 
ATOM   6073 C C   . ARG B 1 247 ? 27.423  -6.726  -45.276 1.00 53.43  ? 247  ARG B C   1 
ATOM   6074 O O   . ARG B 1 247 ? 27.073  -7.886  -45.506 1.00 54.25  ? 247  ARG B O   1 
ATOM   6075 C CB  . ARG B 1 247 ? 26.416  -5.564  -43.299 1.00 51.15  ? 247  ARG B CB  1 
ATOM   6076 C CG  . ARG B 1 247 ? 26.529  -5.086  -41.844 1.00 50.01  ? 247  ARG B CG  1 
ATOM   6077 C CD  . ARG B 1 247 ? 25.232  -4.399  -41.416 1.00 46.85  ? 247  ARG B CD  1 
ATOM   6078 N NE  . ARG B 1 247 ? 25.300  -3.870  -40.060 1.00 46.75  ? 247  ARG B NE  1 
ATOM   6079 C CZ  . ARG B 1 247 ? 24.259  -3.405  -39.365 1.00 45.75  ? 247  ARG B CZ  1 
ATOM   6080 N NH1 . ARG B 1 247 ? 23.018  -3.395  -39.886 1.00 43.88  ? 247  ARG B NH1 1 
ATOM   6081 N NH2 . ARG B 1 247 ? 24.463  -2.944  -38.134 1.00 42.99  ? 247  ARG B NH2 1 
ATOM   6082 N N   . ALA B 1 248 ? 27.619  -5.825  -46.241 1.00 53.29  ? 248  ALA B N   1 
ATOM   6083 C CA  . ALA B 1 248 ? 27.425  -6.163  -47.651 1.00 53.54  ? 248  ALA B CA  1 
ATOM   6084 C C   . ALA B 1 248 ? 28.439  -7.228  -48.023 1.00 56.38  ? 248  ALA B C   1 
ATOM   6085 O O   . ALA B 1 248 ? 28.070  -8.280  -48.555 1.00 57.38  ? 248  ALA B O   1 
ATOM   6086 C CB  . ALA B 1 248 ? 27.583  -4.945  -48.527 1.00 52.63  ? 248  ALA B CB  1 
ATOM   6087 N N   . THR B 1 249 ? 29.710  -6.961  -47.703 1.00 57.64  ? 249  THR B N   1 
ATOM   6088 C CA  . THR B 1 249 ? 30.791  -7.917  -47.888 1.00 59.98  ? 249  THR B CA  1 
ATOM   6089 C C   . THR B 1 249 ? 30.492  -9.267  -47.244 1.00 60.81  ? 249  THR B C   1 
ATOM   6090 O O   . THR B 1 249 ? 30.769  -10.324 -47.828 1.00 62.38  ? 249  THR B O   1 
ATOM   6091 C CB  . THR B 1 249 ? 32.117  -7.348  -47.332 1.00 61.53  ? 249  THR B CB  1 
ATOM   6092 O OG1 . THR B 1 249 ? 32.309  -6.032  -47.868 1.00 61.70  ? 249  THR B OG1 1 
ATOM   6093 C CG2 . THR B 1 249 ? 33.306  -8.219  -47.704 1.00 62.35  ? 249  THR B CG2 1 
ATOM   6094 N N   . LEU B 1 250 ? 29.928  -9.231  -46.044 1.00 59.99  ? 250  LEU B N   1 
ATOM   6095 C CA  . LEU B 1 250 ? 29.646  -10.462 -45.317 1.00 61.09  ? 250  LEU B CA  1 
ATOM   6096 C C   . LEU B 1 250 ? 28.499  -11.215 -45.979 1.00 60.74  ? 250  LEU B C   1 
ATOM   6097 O O   . LEU B 1 250 ? 28.555  -12.447 -46.110 1.00 62.20  ? 250  LEU B O   1 
ATOM   6098 C CB  . LEU B 1 250 ? 29.365  -10.191 -43.829 1.00 60.18  ? 250  LEU B CB  1 
ATOM   6099 C CG  . LEU B 1 250 ? 29.006  -11.402 -42.956 1.00 60.82  ? 250  LEU B CG  1 
ATOM   6100 C CD1 . LEU B 1 250 ? 30.025  -12.508 -43.108 1.00 61.34  ? 250  LEU B CD1 1 
ATOM   6101 C CD2 . LEU B 1 250 ? 28.829  -11.031 -41.486 1.00 58.73  ? 250  LEU B CD2 1 
ATOM   6102 N N   . LEU B 1 251 ? 27.478  -10.476 -46.412 1.00 59.05  ? 251  LEU B N   1 
ATOM   6103 C CA  . LEU B 1 251 ? 26.354  -11.085 -47.120 1.00 58.89  ? 251  LEU B CA  1 
ATOM   6104 C C   . LEU B 1 251 ? 26.832  -11.771 -48.391 1.00 60.73  ? 251  LEU B C   1 
ATOM   6105 O O   . LEU B 1 251 ? 26.427  -12.899 -48.685 1.00 61.80  ? 251  LEU B O   1 
ATOM   6106 C CB  . LEU B 1 251 ? 25.266  -10.063 -47.453 1.00 56.59  ? 251  LEU B CB  1 
ATOM   6107 C CG  . LEU B 1 251 ? 24.037  -10.704 -48.110 1.00 55.58  ? 251  LEU B CG  1 
ATOM   6108 C CD1 . LEU B 1 251 ? 23.120  -11.343 -47.077 1.00 53.06  ? 251  LEU B CD1 1 
ATOM   6109 C CD2 . LEU B 1 251 ? 23.282  -9.663  -48.903 1.00 54.99  ? 251  LEU B CD2 1 
ATOM   6110 N N   . ALA B 1 252 ? 27.705  -11.092 -49.131 1.00 61.67  ? 252  ALA B N   1 
ATOM   6111 C CA  . ALA B 1 252 ? 28.281  -11.655 -50.345 1.00 63.56  ? 252  ALA B CA  1 
ATOM   6112 C C   . ALA B 1 252 ? 28.983  -12.964 -50.013 1.00 66.26  ? 252  ALA B C   1 
ATOM   6113 O O   . ALA B 1 252 ? 28.705  -13.987 -50.633 1.00 67.18  ? 252  ALA B O   1 
ATOM   6114 C CB  . ALA B 1 252 ? 29.236  -10.677 -50.985 1.00 63.70  ? 252  ALA B CB  1 
ATOM   6115 N N   . ARG B 1 253 ? 29.862  -12.945 -49.013 1.00 68.07  ? 253  ARG B N   1 
ATOM   6116 C CA  . ARG B 1 253 ? 30.557  -14.170 -48.606 1.00 71.42  ? 253  ARG B CA  1 
ATOM   6117 C C   . ARG B 1 253 ? 29.541  -15.271 -48.344 1.00 71.47  ? 253  ARG B C   1 
ATOM   6118 O O   . ARG B 1 253 ? 29.738  -16.407 -48.756 1.00 73.05  ? 253  ARG B O   1 
ATOM   6119 C CB  . ARG B 1 253 ? 31.424  -13.956 -47.352 1.00 72.49  ? 253  ARG B CB  1 
ATOM   6120 C CG  . ARG B 1 253 ? 32.681  -14.799 -47.349 1.00 77.77  ? 253  ARG B CG  1 
ATOM   6121 C CD  . ARG B 1 253 ? 33.362  -14.906 -45.988 1.00 84.57  ? 253  ARG B CD  1 
ATOM   6122 N NE  . ARG B 1 253 ? 32.956  -16.100 -45.236 1.00 88.93  ? 253  ARG B NE  1 
ATOM   6123 C CZ  . ARG B 1 253 ? 32.376  -16.075 -44.032 1.00 89.55  ? 253  ARG B CZ  1 
ATOM   6124 N NH1 . ARG B 1 253 ? 32.143  -14.918 -43.413 1.00 87.66  ? 253  ARG B NH1 1 
ATOM   6125 N NH2 . ARG B 1 253 ? 32.041  -17.211 -43.433 1.00 90.78  ? 253  ARG B NH2 1 
ATOM   6126 N N   . LEU B 1 254 ? 28.439  -14.911 -47.683 1.00 69.95  ? 254  LEU B N   1 
ATOM   6127 C CA  . LEU B 1 254 ? 27.421  -15.880 -47.274 1.00 70.13  ? 254  LEU B CA  1 
ATOM   6128 C C   . LEU B 1 254 ? 26.684  -16.563 -48.433 1.00 70.62  ? 254  LEU B C   1 
ATOM   6129 O O   . LEU B 1 254 ? 26.231  -17.699 -48.295 1.00 71.60  ? 254  LEU B O   1 
ATOM   6130 C CB  . LEU B 1 254 ? 26.427  -15.238 -46.302 1.00 67.87  ? 254  LEU B CB  1 
ATOM   6131 C CG  . LEU B 1 254 ? 26.846  -15.045 -44.836 1.00 67.77  ? 254  LEU B CG  1 
ATOM   6132 C CD1 . LEU B 1 254 ? 25.800  -14.221 -44.107 1.00 64.30  ? 254  LEU B CD1 1 
ATOM   6133 C CD2 . LEU B 1 254 ? 27.065  -16.384 -44.115 1.00 68.27  ? 254  LEU B CD2 1 
ATOM   6134 N N   . VAL B 1 255 ? 26.581  -15.881 -49.569 1.00 70.48  ? 255  VAL B N   1 
ATOM   6135 C CA  . VAL B 1 255 ? 25.876  -16.438 -50.737 1.00 71.36  ? 255  VAL B CA  1 
ATOM   6136 C C   . VAL B 1 255 ? 26.798  -16.877 -51.880 1.00 74.02  ? 255  VAL B C   1 
ATOM   6137 O O   . VAL B 1 255 ? 26.332  -17.057 -53.004 1.00 74.66  ? 255  VAL B O   1 
ATOM   6138 C CB  . VAL B 1 255 ? 24.753  -15.487 -51.296 1.00 68.73  ? 255  VAL B CB  1 
ATOM   6139 C CG1 . VAL B 1 255 ? 23.566  -15.443 -50.359 1.00 66.91  ? 255  VAL B CG1 1 
ATOM   6140 C CG2 . VAL B 1 255 ? 25.285  -14.091 -51.567 1.00 66.71  ? 255  VAL B CG2 1 
ATOM   6141 N N   . GLY B 1 256 ? 28.090  -17.031 -51.598 1.00 76.57  ? 256  GLY B N   1 
ATOM   6142 C CA  . GLY B 1 256 ? 29.059  -17.545 -52.573 1.00 79.85  ? 256  GLY B CA  1 
ATOM   6143 C C   . GLY B 1 256 ? 29.717  -16.517 -53.482 1.00 80.74  ? 256  GLY B C   1 
ATOM   6144 O O   . GLY B 1 256 ? 30.336  -16.878 -54.474 1.00 82.38  ? 256  GLY B O   1 
ATOM   6145 N N   . CYS B 1 257 ? 29.583  -15.237 -53.152 1.00 80.37  ? 257  CYS B N   1 
ATOM   6146 C CA  . CYS B 1 257 ? 30.174  -14.158 -53.946 1.00 81.58  ? 257  CYS B CA  1 
ATOM   6147 C C   . CYS B 1 257 ? 31.323  -13.470 -53.203 1.00 83.58  ? 257  CYS B C   1 
ATOM   6148 O O   . CYS B 1 257 ? 31.167  -13.074 -52.043 1.00 83.18  ? 257  CYS B O   1 
ATOM   6149 C CB  . CYS B 1 257 ? 29.107  -13.123 -54.300 1.00 78.48  ? 257  CYS B CB  1 
ATOM   6150 S SG  . CYS B 1 257 ? 27.771  -13.745 -55.356 1.00 78.42  ? 257  CYS B SG  1 
ATOM   6151 N N   . PRO B 1 258 ? 32.475  -13.294 -53.870 1.00 86.44  ? 258  PRO B N   1 
ATOM   6152 C CA  . PRO B 1 258 ? 32.712  -13.648 -55.266 1.00 88.39  ? 258  PRO B CA  1 
ATOM   6153 C C   . PRO B 1 258 ? 33.419  -15.020 -55.362 1.00 91.65  ? 258  PRO B C   1 
ATOM   6154 O O   . PRO B 1 258 ? 33.997  -15.470 -54.366 1.00 92.75  ? 258  PRO B O   1 
ATOM   6155 C CB  . PRO B 1 258 ? 33.635  -12.515 -55.741 1.00 88.86  ? 258  PRO B CB  1 
ATOM   6156 C CG  . PRO B 1 258 ? 34.414  -12.080 -54.439 1.00 89.36  ? 258  PRO B CG  1 
ATOM   6157 C CD  . PRO B 1 258 ? 33.678  -12.695 -53.249 1.00 87.63  ? 258  PRO B CD  1 
ATOM   6158 N N   . PRO B 1 259 ? 33.353  -15.688 -56.537 1.00 93.12  ? 259  PRO B N   1 
ATOM   6159 C CA  . PRO B 1 259 ? 34.034  -16.989 -56.725 1.00 96.19  ? 259  PRO B CA  1 
ATOM   6160 C C   . PRO B 1 259 ? 35.573  -16.919 -56.680 1.00 98.57  ? 259  PRO B C   1 
ATOM   6161 O O   . PRO B 1 259 ? 36.171  -16.975 -55.599 1.00 99.06  ? 259  PRO B O   1 
ATOM   6162 C CB  . PRO B 1 259 ? 33.557  -17.447 -58.118 1.00 96.81  ? 259  PRO B CB  1 
ATOM   6163 C CG  . PRO B 1 259 ? 33.034  -16.189 -58.793 1.00 94.59  ? 259  PRO B CG  1 
ATOM   6164 C CD  . PRO B 1 259 ? 32.494  -15.339 -57.688 1.00 91.99  ? 259  PRO B CD  1 
ATOM   6165 N N   . ASN B 1 265 ? 37.616  -6.679  -55.671 1.00 82.49  ? 265  ASN B N   1 
ATOM   6166 C CA  . ASN B 1 265 ? 37.065  -5.346  -55.950 1.00 81.38  ? 265  ASN B CA  1 
ATOM   6167 C C   . ASN B 1 265 ? 35.515  -5.264  -56.024 1.00 78.44  ? 265  ASN B C   1 
ATOM   6168 O O   . ASN B 1 265 ? 34.822  -6.274  -56.222 1.00 77.82  ? 265  ASN B O   1 
ATOM   6169 C CB  . ASN B 1 265 ? 37.747  -4.690  -57.181 1.00 82.89  ? 265  ASN B CB  1 
ATOM   6170 C CG  . ASN B 1 265 ? 37.217  -5.207  -58.537 1.00 83.92  ? 265  ASN B CG  1 
ATOM   6171 O OD1 . ASN B 1 265 ? 36.020  -5.472  -58.713 1.00 82.02  ? 265  ASN B OD1 1 
ATOM   6172 N ND2 . ASN B 1 265 ? 38.124  -5.314  -59.513 1.00 87.65  ? 265  ASN B ND2 1 
ATOM   6173 N N   . ASP B 1 266 ? 34.991  -4.050  -55.874 1.00 76.65  ? 266  ASP B N   1 
ATOM   6174 C CA  . ASP B 1 266 ? 33.540  -3.828  -55.759 1.00 73.86  ? 266  ASP B CA  1 
ATOM   6175 C C   . ASP B 1 266 ? 32.689  -4.283  -56.948 1.00 72.84  ? 266  ASP B C   1 
ATOM   6176 O O   . ASP B 1 266 ? 31.608  -4.851  -56.759 1.00 71.14  ? 266  ASP B O   1 
ATOM   6177 C CB  . ASP B 1 266 ? 33.257  -2.367  -55.418 1.00 72.50  ? 266  ASP B CB  1 
ATOM   6178 C CG  . ASP B 1 266 ? 33.635  -2.030  -53.989 1.00 73.52  ? 266  ASP B CG  1 
ATOM   6179 O OD1 . ASP B 1 266 ? 33.937  -2.975  -53.219 1.00 74.00  ? 266  ASP B OD1 1 
ATOM   6180 O OD2 . ASP B 1 266 ? 33.626  -0.827  -53.631 1.00 74.38  ? 266  ASP B OD2 1 
ATOM   6181 N N   . THR B 1 267 ? 33.193  -4.041  -58.157 1.00 73.63  ? 267  THR B N   1 
ATOM   6182 C CA  . THR B 1 267 ? 32.489  -4.357  -59.402 1.00 72.73  ? 267  THR B CA  1 
ATOM   6183 C C   . THR B 1 267 ? 32.118  -5.839  -59.474 1.00 72.40  ? 267  THR B C   1 
ATOM   6184 O O   . THR B 1 267 ? 30.962  -6.190  -59.753 1.00 70.80  ? 267  THR B O   1 
ATOM   6185 C CB  . THR B 1 267 ? 33.379  -3.981  -60.600 1.00 74.99  ? 267  THR B CB  1 
ATOM   6186 O OG1 . THR B 1 267 ? 33.813  -2.629  -60.440 1.00 75.38  ? 267  THR B OG1 1 
ATOM   6187 C CG2 . THR B 1 267 ? 32.647  -4.143  -61.953 1.00 74.49  ? 267  THR B CG2 1 
ATOM   6188 N N   . GLU B 1 268 ? 33.119  -6.684  -59.212 1.00 73.72  ? 268  GLU B N   1 
ATOM   6189 C CA  . GLU B 1 268 ? 32.992  -8.139  -59.260 1.00 74.01  ? 268  GLU B CA  1 
ATOM   6190 C C   . GLU B 1 268 ? 31.992  -8.596  -58.208 1.00 71.16  ? 268  GLU B C   1 
ATOM   6191 O O   . GLU B 1 268 ? 31.058  -9.344  -58.503 1.00 70.48  ? 268  GLU B O   1 
ATOM   6192 C CB  . GLU B 1 268 ? 34.356  -8.824  -59.033 1.00 76.53  ? 268  GLU B CB  1 
ATOM   6193 C CG  . GLU B 1 268 ? 35.335  -8.777  -60.224 1.00 81.02  ? 268  GLU B CG  1 
ATOM   6194 C CD  . GLU B 1 268 ? 36.757  -9.351  -59.897 1.00 86.84  ? 268  GLU B CD  1 
ATOM   6195 O OE1 . GLU B 1 268 ? 37.235  -9.275  -58.720 1.00 86.71  ? 268  GLU B OE1 1 
ATOM   6196 O OE2 . GLU B 1 268 ? 37.408  -9.867  -60.841 1.00 88.92  ? 268  GLU B OE2 1 
ATOM   6197 N N   . LEU B 1 269 ? 32.192  -8.129  -56.982 1.00 69.35  ? 269  LEU B N   1 
ATOM   6198 C CA  . LEU B 1 269 ? 31.338  -8.500  -55.872 1.00 67.09  ? 269  LEU B CA  1 
ATOM   6199 C C   . LEU B 1 269 ? 29.866  -8.188  -56.193 1.00 64.45  ? 269  LEU B C   1 
ATOM   6200 O O   . LEU B 1 269 ? 28.996  -9.039  -56.003 1.00 63.70  ? 269  LEU B O   1 
ATOM   6201 C CB  . LEU B 1 269 ? 31.817  -7.807  -54.587 1.00 66.65  ? 269  LEU B CB  1 
ATOM   6202 C CG  . LEU B 1 269 ? 31.219  -8.174  -53.220 1.00 65.56  ? 269  LEU B CG  1 
ATOM   6203 C CD1 . LEU B 1 269 ? 32.221  -7.971  -52.087 1.00 64.28  ? 269  LEU B CD1 1 
ATOM   6204 C CD2 . LEU B 1 269 ? 29.922  -7.392  -52.949 1.00 63.07  ? 269  LEU B CD2 1 
ATOM   6205 N N   . ILE B 1 270 ? 29.602  -6.991  -56.714 1.00 62.81  ? 270  ILE B N   1 
ATOM   6206 C CA  . ILE B 1 270 ? 28.232  -6.565  -57.000 1.00 60.69  ? 270  ILE B CA  1 
ATOM   6207 C C   . ILE B 1 270 ? 27.644  -7.286  -58.234 1.00 61.15  ? 270  ILE B C   1 
ATOM   6208 O O   . ILE B 1 270 ? 26.427  -7.594  -58.270 1.00 59.85  ? 270  ILE B O   1 
ATOM   6209 C CB  . ILE B 1 270 ? 28.127  -5.013  -57.106 1.00 59.83  ? 270  ILE B CB  1 
ATOM   6210 C CG1 . ILE B 1 270 ? 28.433  -4.365  -55.756 1.00 59.39  ? 270  ILE B CG1 1 
ATOM   6211 C CG2 . ILE B 1 270 ? 26.734  -4.555  -57.529 1.00 57.53  ? 270  ILE B CG2 1 
ATOM   6212 C CD1 . ILE B 1 270 ? 29.118  -3.017  -55.883 1.00 59.82  ? 270  ILE B CD1 1 
ATOM   6213 N N   . ALA B 1 271 ? 28.493  -7.573  -59.225 1.00 62.13  ? 271  ALA B N   1 
ATOM   6214 C CA  . ALA B 1 271 ? 28.023  -8.305  -60.382 1.00 62.74  ? 271  ALA B CA  1 
ATOM   6215 C C   . ALA B 1 271 ? 27.530  -9.697  -59.982 1.00 63.16  ? 271  ALA B C   1 
ATOM   6216 O O   . ALA B 1 271 ? 26.516  -10.165 -60.502 1.00 62.98  ? 271  ALA B O   1 
ATOM   6217 C CB  . ALA B 1 271 ? 29.077  -8.378  -61.449 1.00 64.34  ? 271  ALA B CB  1 
ATOM   6218 N N   . CYS B 1 272 ? 28.224  -10.340 -59.045 1.00 64.38  ? 272  CYS B N   1 
ATOM   6219 C CA  . CYS B 1 272 ? 27.863  -11.700 -58.614 1.00 65.43  ? 272  CYS B CA  1 
ATOM   6220 C C   . CYS B 1 272 ? 26.618  -11.702 -57.741 1.00 62.86  ? 272  CYS B C   1 
ATOM   6221 O O   . CYS B 1 272 ? 25.790  -12.624 -57.823 1.00 63.00  ? 272  CYS B O   1 
ATOM   6222 C CB  . CYS B 1 272 ? 29.030  -12.424 -57.910 1.00 67.56  ? 272  CYS B CB  1 
ATOM   6223 S SG  . CYS B 1 272 ? 28.634  -14.112 -57.242 1.00 71.66  ? 272  CYS B SG  1 
ATOM   6224 N N   . LEU B 1 273 ? 26.491  -10.680 -56.898 1.00 61.03  ? 273  LEU B N   1 
ATOM   6225 C CA  . LEU B 1 273 ? 25.271  -10.498 -56.113 1.00 58.59  ? 273  LEU B CA  1 
ATOM   6226 C C   . LEU B 1 273 ? 24.085  -10.359 -57.062 1.00 57.97  ? 273  LEU B C   1 
ATOM   6227 O O   . LEU B 1 273 ? 23.006  -10.896 -56.812 1.00 57.35  ? 273  LEU B O   1 
ATOM   6228 C CB  . LEU B 1 273 ? 25.376  -9.294  -55.170 1.00 56.45  ? 273  LEU B CB  1 
ATOM   6229 C CG  . LEU B 1 273 ? 26.074  -9.500  -53.827 1.00 55.60  ? 273  LEU B CG  1 
ATOM   6230 C CD1 . LEU B 1 273 ? 26.173  -8.202  -53.065 1.00 52.40  ? 273  LEU B CD1 1 
ATOM   6231 C CD2 . LEU B 1 273 ? 25.396  -10.544 -52.965 1.00 54.27  ? 273  LEU B CD2 1 
ATOM   6232 N N   . ARG B 1 274 ? 24.319  -9.688  -58.186 1.00 58.68  ? 274  ARG B N   1 
ATOM   6233 C CA  . ARG B 1 274 ? 23.257  -9.403  -59.150 1.00 58.30  ? 274  ARG B CA  1 
ATOM   6234 C C   . ARG B 1 274 ? 22.696  -10.646 -59.829 1.00 58.63  ? 274  ARG B C   1 
ATOM   6235 O O   . ARG B 1 274 ? 21.577  -10.632 -60.329 1.00 57.98  ? 274  ARG B O   1 
ATOM   6236 C CB  . ARG B 1 274 ? 23.782  -8.458  -60.210 1.00 59.06  ? 274  ARG B CB  1 
ATOM   6237 C CG  . ARG B 1 274 ? 23.047  -7.172  -60.264 1.00 59.82  ? 274  ARG B CG  1 
ATOM   6238 C CD  . ARG B 1 274 ? 23.826  -6.246  -61.122 1.00 65.38  ? 274  ARG B CD  1 
ATOM   6239 N NE  . ARG B 1 274 ? 23.812  -4.914  -60.548 1.00 69.16  ? 274  ARG B NE  1 
ATOM   6240 C CZ  . ARG B 1 274 ? 24.770  -4.014  -60.760 1.00 73.45  ? 274  ARG B CZ  1 
ATOM   6241 N NH1 . ARG B 1 274 ? 25.815  -4.337  -61.538 1.00 74.17  ? 274  ARG B NH1 1 
ATOM   6242 N NH2 . ARG B 1 274 ? 24.684  -2.804  -60.186 1.00 71.91  ? 274  ARG B NH2 1 
ATOM   6243 N N   . THR B 1 275 ? 23.482  -11.715 -59.854 1.00 59.86  ? 275  THR B N   1 
ATOM   6244 C CA  . THR B 1 275 ? 23.064  -12.960 -60.485 1.00 60.59  ? 275  THR B CA  1 
ATOM   6245 C C   . THR B 1 275 ? 22.205  -13.792 -59.541 1.00 60.54  ? 275  THR B C   1 
ATOM   6246 O O   . THR B 1 275 ? 21.659  -14.810 -59.945 1.00 62.02  ? 275  THR B O   1 
ATOM   6247 C CB  . THR B 1 275 ? 24.280  -13.813 -60.954 1.00 62.78  ? 275  THR B CB  1 
ATOM   6248 O OG1 . THR B 1 275 ? 25.052  -14.244 -59.820 1.00 61.60  ? 275  THR B OG1 1 
ATOM   6249 C CG2 . THR B 1 275 ? 25.165  -13.014 -61.923 1.00 63.15  ? 275  THR B CG2 1 
ATOM   6250 N N   . ARG B 1 276 ? 22.088  -13.369 -58.289 1.00 59.22  ? 276  ARG B N   1 
ATOM   6251 C CA  . ARG B 1 276 ? 21.410  -14.181 -57.293 1.00 59.37  ? 276  ARG B CA  1 
ATOM   6252 C C   . ARG B 1 276 ? 19.903  -13.926 -57.235 1.00 57.68  ? 276  ARG B C   1 
ATOM   6253 O O   . ARG B 1 276 ? 19.472  -12.786 -57.141 1.00 56.25  ? 276  ARG B O   1 
ATOM   6254 C CB  . ARG B 1 276 ? 22.044  -13.974 -55.906 1.00 59.08  ? 276  ARG B CB  1 
ATOM   6255 C CG  . ARG B 1 276 ? 23.446  -14.549 -55.778 1.00 62.61  ? 276  ARG B CG  1 
ATOM   6256 C CD  . ARG B 1 276 ? 23.427  -16.071 -55.726 1.00 67.24  ? 276  ARG B CD  1 
ATOM   6257 N NE  . ARG B 1 276 ? 24.763  -16.600 -55.474 1.00 72.12  ? 276  ARG B NE  1 
ATOM   6258 C CZ  . ARG B 1 276 ? 25.631  -16.929 -56.427 1.00 75.07  ? 276  ARG B CZ  1 
ATOM   6259 N NH1 . ARG B 1 276 ? 25.300  -16.797 -57.706 1.00 75.79  ? 276  ARG B NH1 1 
ATOM   6260 N NH2 . ARG B 1 276 ? 26.829  -17.389 -56.097 1.00 77.20  ? 276  ARG B NH2 1 
ATOM   6261 N N   . PRO B 1 277 ? 19.098  -14.998 -57.285 1.00 58.23  ? 277  PRO B N   1 
ATOM   6262 C CA  . PRO B 1 277 ? 17.667  -14.898 -57.001 1.00 56.93  ? 277  PRO B CA  1 
ATOM   6263 C C   . PRO B 1 277 ? 17.390  -14.085 -55.746 1.00 55.63  ? 277  PRO B C   1 
ATOM   6264 O O   . PRO B 1 277 ? 18.142  -14.163 -54.766 1.00 55.97  ? 277  PRO B O   1 
ATOM   6265 C CB  . PRO B 1 277 ? 17.260  -16.359 -56.793 1.00 58.31  ? 277  PRO B CB  1 
ATOM   6266 C CG  . PRO B 1 277 ? 18.193  -17.122 -57.688 1.00 60.26  ? 277  PRO B CG  1 
ATOM   6267 C CD  . PRO B 1 277 ? 19.471  -16.335 -57.785 1.00 60.14  ? 277  PRO B CD  1 
ATOM   6268 N N   . ALA B 1 278 ? 16.308  -13.315 -55.772 1.00 54.66  ? 278  ALA B N   1 
ATOM   6269 C CA  . ALA B 1 278 ? 15.969  -12.398 -54.684 1.00 53.06  ? 278  ALA B CA  1 
ATOM   6270 C C   . ALA B 1 278 ? 15.896  -13.091 -53.316 1.00 53.79  ? 278  ALA B C   1 
ATOM   6271 O O   . ALA B 1 278 ? 16.421  -12.575 -52.338 1.00 52.94  ? 278  ALA B O   1 
ATOM   6272 C CB  . ALA B 1 278 ? 14.662  -11.669 -54.995 1.00 51.65  ? 278  ALA B CB  1 
ATOM   6273 N N   . GLN B 1 279 ? 15.275  -14.272 -53.262 1.00 55.71  ? 279  GLN B N   1 
ATOM   6274 C CA  . GLN B 1 279 ? 15.067  -14.997 -51.990 1.00 56.46  ? 279  GLN B CA  1 
ATOM   6275 C C   . GLN B 1 279 ? 16.372  -15.480 -51.374 1.00 57.85  ? 279  GLN B C   1 
ATOM   6276 O O   . GLN B 1 279 ? 16.449  -15.604 -50.153 1.00 57.86  ? 279  GLN B O   1 
ATOM   6277 C CB  . GLN B 1 279 ? 14.086  -16.179 -52.151 1.00 57.58  ? 279  GLN B CB  1 
ATOM   6278 C CG  . GLN B 1 279 ? 13.579  -16.794 -50.837 1.00 57.19  ? 279  GLN B CG  1 
ATOM   6279 C CD  . GLN B 1 279 ? 12.902  -15.794 -49.928 1.00 55.24  ? 279  GLN B CD  1 
ATOM   6280 O OE1 . GLN B 1 279 ? 12.139  -14.941 -50.378 1.00 55.20  ? 279  GLN B OE1 1 
ATOM   6281 N NE2 . GLN B 1 279 ? 13.177  -15.891 -48.637 1.00 54.17  ? 279  GLN B NE2 1 
ATOM   6282 N N   . ASP B 1 280 ? 17.385  -15.750 -52.206 1.00 59.19  ? 280  ASP B N   1 
ATOM   6283 C CA  . ASP B 1 280 ? 18.729  -16.062 -51.693 1.00 61.15  ? 280  ASP B CA  1 
ATOM   6284 C C   . ASP B 1 280 ? 19.278  -14.947 -50.784 1.00 60.01  ? 280  ASP B C   1 
ATOM   6285 O O   . ASP B 1 280 ? 19.870  -15.236 -49.729 1.00 61.01  ? 280  ASP B O   1 
ATOM   6286 C CB  . ASP B 1 280 ? 19.714  -16.316 -52.830 1.00 62.79  ? 280  ASP B CB  1 
ATOM   6287 C CG  . ASP B 1 280 ? 19.537  -17.680 -53.477 1.00 66.79  ? 280  ASP B CG  1 
ATOM   6288 O OD1 . ASP B 1 280 ? 18.488  -18.341 -53.253 1.00 69.71  ? 280  ASP B OD1 1 
ATOM   6289 O OD2 . ASP B 1 280 ? 20.461  -18.076 -54.223 1.00 69.09  ? 280  ASP B OD2 1 
ATOM   6290 N N   . LEU B 1 281 ? 19.068  -13.690 -51.193 1.00 57.79  ? 281  LEU B N   1 
ATOM   6291 C CA  . LEU B 1 281 ? 19.527  -12.518 -50.448 1.00 56.20  ? 281  LEU B CA  1 
ATOM   6292 C C   . LEU B 1 281 ? 18.778  -12.340 -49.138 1.00 55.23  ? 281  LEU B C   1 
ATOM   6293 O O   . LEU B 1 281 ? 19.401  -12.106 -48.108 1.00 55.30  ? 281  LEU B O   1 
ATOM   6294 C CB  . LEU B 1 281 ? 19.428  -11.250 -51.313 1.00 54.86  ? 281  LEU B CB  1 
ATOM   6295 C CG  . LEU B 1 281 ? 20.655  -10.885 -52.164 1.00 55.11  ? 281  LEU B CG  1 
ATOM   6296 C CD1 . LEU B 1 281 ? 21.537  -12.081 -52.487 1.00 56.81  ? 281  LEU B CD1 1 
ATOM   6297 C CD2 . LEU B 1 281 ? 20.278  -10.152 -53.429 1.00 54.02  ? 281  LEU B CD2 1 
ATOM   6298 N N   . VAL B 1 282 ? 17.450  -12.470 -49.187 1.00 54.10  ? 282  VAL B N   1 
ATOM   6299 C CA  . VAL B 1 282 ? 16.599  -12.466 -48.002 1.00 53.32  ? 282  VAL B CA  1 
ATOM   6300 C C   . VAL B 1 282 ? 16.918  -13.634 -47.035 1.00 55.41  ? 282  VAL B C   1 
ATOM   6301 O O   . VAL B 1 282 ? 16.868  -13.463 -45.824 1.00 55.22  ? 282  VAL B O   1 
ATOM   6302 C CB  . VAL B 1 282 ? 15.089  -12.441 -48.407 1.00 52.67  ? 282  VAL B CB  1 
ATOM   6303 C CG1 . VAL B 1 282 ? 14.178  -12.574 -47.201 1.00 51.46  ? 282  VAL B CG1 1 
ATOM   6304 C CG2 . VAL B 1 282 ? 14.762  -11.158 -49.143 1.00 50.19  ? 282  VAL B CG2 1 
ATOM   6305 N N   . ASP B 1 283 ? 17.260  -14.808 -47.574 1.00 57.82  ? 283  ASP B N   1 
ATOM   6306 C CA  . ASP B 1 283 ? 17.667  -15.975 -46.768 1.00 60.03  ? 283  ASP B CA  1 
ATOM   6307 C C   . ASP B 1 283 ? 18.795  -15.707 -45.750 1.00 60.42  ? 283  ASP B C   1 
ATOM   6308 O O   . ASP B 1 283 ? 18.796  -16.291 -44.659 1.00 60.82  ? 283  ASP B O   1 
ATOM   6309 C CB  . ASP B 1 283 ? 18.095  -17.143 -47.670 1.00 61.98  ? 283  ASP B CB  1 
ATOM   6310 C CG  . ASP B 1 283 ? 16.931  -18.032 -48.101 1.00 63.71  ? 283  ASP B CG  1 
ATOM   6311 O OD1 . ASP B 1 283 ? 15.770  -17.779 -47.679 1.00 60.95  ? 283  ASP B OD1 1 
ATOM   6312 O OD2 . ASP B 1 283 ? 17.195  -18.993 -48.883 1.00 66.90  ? 283  ASP B OD2 1 
ATOM   6313 N N   . HIS B 1 284 ? 19.737  -14.836 -46.125 1.00 60.08  ? 284  HIS B N   1 
ATOM   6314 C CA  . HIS B 1 284 ? 20.927  -14.549 -45.317 1.00 61.00  ? 284  HIS B CA  1 
ATOM   6315 C C   . HIS B 1 284 ? 20.973  -13.116 -44.739 1.00 59.62  ? 284  HIS B C   1 
ATOM   6316 O O   . HIS B 1 284 ? 21.962  -12.706 -44.130 1.00 60.22  ? 284  HIS B O   1 
ATOM   6317 C CB  . HIS B 1 284 ? 22.196  -14.858 -46.116 1.00 62.07  ? 284  HIS B CB  1 
ATOM   6318 C CG  . HIS B 1 284 ? 22.455  -16.325 -46.306 1.00 65.26  ? 284  HIS B CG  1 
ATOM   6319 N ND1 . HIS B 1 284 ? 23.046  -17.112 -45.337 1.00 67.61  ? 284  HIS B ND1 1 
ATOM   6320 C CD2 . HIS B 1 284 ? 22.227  -17.141 -47.362 1.00 65.92  ? 284  HIS B CD2 1 
ATOM   6321 C CE1 . HIS B 1 284 ? 23.157  -18.350 -45.783 1.00 68.35  ? 284  HIS B CE1 1 
ATOM   6322 N NE2 . HIS B 1 284 ? 22.670  -18.393 -47.010 1.00 68.19  ? 284  HIS B NE2 1 
ATOM   6323 N N   . GLU B 1 285 ? 19.888  -12.375 -44.903 1.00 58.56  ? 285  GLU B N   1 
ATOM   6324 C CA  . GLU B 1 285 ? 19.803  -10.980 -44.478 1.00 57.64  ? 285  GLU B CA  1 
ATOM   6325 C C   . GLU B 1 285 ? 20.033  -10.817 -42.973 1.00 58.27  ? 285  GLU B C   1 
ATOM   6326 O O   . GLU B 1 285 ? 20.739  -9.900  -42.547 1.00 57.22  ? 285  GLU B O   1 
ATOM   6327 C CB  . GLU B 1 285 ? 18.415  -10.452 -44.841 1.00 56.28  ? 285  GLU B CB  1 
ATOM   6328 C CG  . GLU B 1 285 ? 18.307  -8.975  -45.065 1.00 55.24  ? 285  GLU B CG  1 
ATOM   6329 C CD  . GLU B 1 285 ? 16.884  -8.566  -45.377 1.00 54.87  ? 285  GLU B CD  1 
ATOM   6330 O OE1 . GLU B 1 285 ? 16.280  -9.132  -46.310 1.00 56.30  ? 285  GLU B OE1 1 
ATOM   6331 O OE2 . GLU B 1 285 ? 16.364  -7.672  -44.694 1.00 54.90  ? 285  GLU B OE2 1 
ATOM   6332 N N   . TRP B 1 286 ? 19.423  -11.716 -42.191 1.00 59.64  ? 286  TRP B N   1 
ATOM   6333 C CA  A TRP B 1 286 ? 19.499  -11.594 -40.737 0.50 60.23  ? 286  TRP B CA  1 
ATOM   6334 C CA  B TRP B 1 286 ? 19.453  -11.740 -40.727 0.50 60.49  ? 286  TRP B CA  1 
ATOM   6335 C C   . TRP B 1 286 ? 20.878  -11.948 -40.216 1.00 61.76  ? 286  TRP B C   1 
ATOM   6336 O O   . TRP B 1 286 ? 21.302  -11.387 -39.202 1.00 62.14  ? 286  TRP B O   1 
ATOM   6337 C CB  A TRP B 1 286 ? 18.424  -12.407 -40.008 0.50 60.82  ? 286  TRP B CB  1 
ATOM   6338 C CB  B TRP B 1 286 ? 18.556  -12.902 -40.258 0.50 61.71  ? 286  TRP B CB  1 
ATOM   6339 C CG  A TRP B 1 286 ? 18.421  -12.219 -38.477 0.50 62.22  ? 286  TRP B CG  1 
ATOM   6340 C CG  B TRP B 1 286 ? 18.090  -12.889 -38.812 0.50 63.46  ? 286  TRP B CG  1 
ATOM   6341 C CD1 A TRP B 1 286 ? 19.015  -13.036 -37.544 0.50 64.60  ? 286  TRP B CD1 1 
ATOM   6342 C CD1 B TRP B 1 286 ? 17.454  -11.865 -38.159 0.50 63.48  ? 286  TRP B CD1 1 
ATOM   6343 C CD2 A TRP B 1 286 ? 17.795  -11.155 -37.728 0.50 61.76  ? 286  TRP B CD2 1 
ATOM   6344 C CD2 B TRP B 1 286 ? 18.169  -13.975 -37.866 0.50 66.36  ? 286  TRP B CD2 1 
ATOM   6345 N NE1 A TRP B 1 286 ? 18.800  -12.544 -36.271 0.50 64.95  ? 286  TRP B NE1 1 
ATOM   6346 N NE1 B TRP B 1 286 ? 17.164  -12.236 -36.864 0.50 65.01  ? 286  TRP B NE1 1 
ATOM   6347 C CE2 A TRP B 1 286 ? 18.053  -11.395 -36.358 0.50 63.19  ? 286  TRP B CE2 1 
ATOM   6348 C CE2 B TRP B 1 286 ? 17.592  -13.523 -36.659 0.50 66.53  ? 286  TRP B CE2 1 
ATOM   6349 C CE3 A TRP B 1 286 ? 17.052  -10.024 -38.082 0.50 59.66  ? 286  TRP B CE3 1 
ATOM   6350 C CE3 B TRP B 1 286 ? 18.692  -15.273 -37.917 0.50 69.39  ? 286  TRP B CE3 1 
ATOM   6351 C CZ2 A TRP B 1 286 ? 17.582  -10.549 -35.349 0.50 62.61  ? 286  TRP B CZ2 1 
ATOM   6352 C CZ2 B TRP B 1 286 ? 17.523  -14.325 -35.510 0.50 68.46  ? 286  TRP B CZ2 1 
ATOM   6353 C CZ3 A TRP B 1 286 ? 16.592  -9.183  -37.080 0.50 59.55  ? 286  TRP B CZ3 1 
ATOM   6354 C CZ3 B TRP B 1 286 ? 18.622  -16.070 -36.774 0.50 71.60  ? 286  TRP B CZ3 1 
ATOM   6355 C CH2 A TRP B 1 286 ? 16.855  -9.451  -35.731 0.50 60.84  ? 286  TRP B CH2 1 
ATOM   6356 C CH2 B TRP B 1 286 ? 18.040  -15.591 -35.589 0.50 70.64  ? 286  TRP B CH2 1 
ATOM   6357 N N   . HIS B 1 287 ? 21.612  -12.798 -40.918 1.00 62.87  ? 287  HIS B N   1 
ATOM   6358 C CA  . HIS B 1 287 ? 22.897  -13.244 -40.399 1.00 64.41  ? 287  HIS B CA  1 
ATOM   6359 C C   . HIS B 1 287 ? 24.047  -12.234 -40.435 1.00 63.29  ? 287  HIS B C   1 
ATOM   6360 O O   . HIS B 1 287 ? 25.154  -12.585 -40.060 1.00 65.04  ? 287  HIS B O   1 
ATOM   6361 C CB  . HIS B 1 287 ? 23.319  -14.578 -41.038 1.00 66.83  ? 287  HIS B CB  1 
ATOM   6362 C CG  . HIS B 1 287 ? 22.214  -15.587 -41.130 1.00 70.16  ? 287  HIS B CG  1 
ATOM   6363 N ND1 . HIS B 1 287 ? 22.303  -16.716 -41.917 1.00 74.90  ? 287  HIS B ND1 1 
ATOM   6364 C CD2 . HIS B 1 287 ? 20.985  -15.624 -40.559 1.00 71.96  ? 287  HIS B CD2 1 
ATOM   6365 C CE1 . HIS B 1 287 ? 21.187  -17.416 -41.810 1.00 76.35  ? 287  HIS B CE1 1 
ATOM   6366 N NE2 . HIS B 1 287 ? 20.366  -16.770 -40.999 1.00 74.85  ? 287  HIS B NE2 1 
ATOM   6367 N N   . VAL B 1 288 ? 23.815  -10.992 -40.855 1.00 60.85  ? 288  VAL B N   1 
ATOM   6368 C CA  . VAL B 1 288 ? 24.942  -10.027 -40.909 1.00 60.32  ? 288  VAL B CA  1 
ATOM   6369 C C   . VAL B 1 288 ? 25.028  -9.031  -39.731 1.00 59.40  ? 288  VAL B C   1 
ATOM   6370 O O   . VAL B 1 288 ? 25.973  -8.239  -39.652 1.00 59.09  ? 288  VAL B O   1 
ATOM   6371 C CB  . VAL B 1 288 ? 25.077  -9.273  -42.282 1.00 59.24  ? 288  VAL B CB  1 
ATOM   6372 C CG1 . VAL B 1 288 ? 25.308  -10.250 -43.423 1.00 60.22  ? 288  VAL B CG1 1 
ATOM   6373 C CG2 . VAL B 1 288 ? 23.891  -8.401  -42.544 1.00 56.32  ? 288  VAL B CG2 1 
ATOM   6374 N N   . LEU B 1 289 ? 24.040  -9.082  -38.839 1.00 58.68  ? 289  LEU B N   1 
ATOM   6375 C CA  . LEU B 1 289 ? 24.000  -8.234  -37.663 1.00 58.30  ? 289  LEU B CA  1 
ATOM   6376 C C   . LEU B 1 289 ? 25.144  -8.610  -36.701 1.00 60.67  ? 289  LEU B C   1 
ATOM   6377 O O   . LEU B 1 289 ? 25.407  -9.807  -36.486 1.00 61.91  ? 289  LEU B O   1 
ATOM   6378 C CB  . LEU B 1 289 ? 22.624  -8.328  -36.984 1.00 57.25  ? 289  LEU B CB  1 
ATOM   6379 C CG  . LEU B 1 289 ? 21.451  -7.619  -37.670 1.00 55.22  ? 289  LEU B CG  1 
ATOM   6380 C CD1 . LEU B 1 289 ? 20.136  -8.071  -37.075 1.00 53.29  ? 289  LEU B CD1 1 
ATOM   6381 C CD2 . LEU B 1 289 ? 21.599  -6.098  -37.555 1.00 53.67  ? 289  LEU B CD2 1 
ATOM   6382 N N   . PRO B 1 290 ? 25.845  -7.588  -36.146 1.00 60.95  ? 290  PRO B N   1 
ATOM   6383 C CA  . PRO B 1 290 ? 27.083  -7.816  -35.379 1.00 63.12  ? 290  PRO B CA  1 
ATOM   6384 C C   . PRO B 1 290 ? 26.874  -8.491  -34.026 1.00 64.48  ? 290  PRO B C   1 
ATOM   6385 O O   . PRO B 1 290 ? 27.768  -9.170  -33.535 1.00 66.38  ? 290  PRO B O   1 
ATOM   6386 C CB  . PRO B 1 290 ? 27.649  -6.402  -35.188 1.00 62.66  ? 290  PRO B CB  1 
ATOM   6387 C CG  . PRO B 1 290 ? 26.449  -5.486  -35.307 1.00 60.04  ? 290  PRO B CG  1 
ATOM   6388 C CD  . PRO B 1 290 ? 25.539  -6.151  -36.295 1.00 58.97  ? 290  PRO B CD  1 
ATOM   6389 N N   . GLN B 1 291 ? 25.698  -8.308  -33.442 1.00 64.22  ? 291  GLN B N   1 
ATOM   6390 C CA  . GLN B 1 291 ? 25.394  -8.794  -32.096 1.00 65.90  ? 291  GLN B CA  1 
ATOM   6391 C C   . GLN B 1 291 ? 24.016  -9.447  -32.077 1.00 65.43  ? 291  GLN B C   1 
ATOM   6392 O O   . GLN B 1 291 ? 23.183  -9.159  -32.944 1.00 64.07  ? 291  GLN B O   1 
ATOM   6393 C CB  . GLN B 1 291 ? 25.405  -7.620  -31.095 1.00 65.15  ? 291  GLN B CB  1 
ATOM   6394 C CG  . GLN B 1 291 ? 26.817  -7.140  -30.667 1.00 68.70  ? 291  GLN B CG  1 
ATOM   6395 C CD  . GLN B 1 291 ? 27.228  -5.811  -31.306 1.00 69.32  ? 291  GLN B CD  1 
ATOM   6396 O OE1 . GLN B 1 291 ? 26.391  -4.946  -31.565 1.00 70.50  ? 291  GLN B OE1 1 
ATOM   6397 N NE2 . GLN B 1 291 ? 28.518  -5.646  -31.549 1.00 69.43  ? 291  GLN B NE2 1 
ATOM   6398 N N   . GLU B 1 292 ? 23.773  -10.308 -31.087 1.00 66.77  ? 292  GLU B N   1 
ATOM   6399 C CA  . GLU B 1 292 ? 22.413  -10.753 -30.768 1.00 66.60  ? 292  GLU B CA  1 
ATOM   6400 C C   . GLU B 1 292 ? 21.593  -9.495  -30.411 1.00 64.04  ? 292  GLU B C   1 
ATOM   6401 O O   . GLU B 1 292 ? 22.029  -8.705  -29.560 1.00 64.45  ? 292  GLU B O   1 
ATOM   6402 C CB  . GLU B 1 292 ? 22.460  -11.730 -29.581 1.00 68.98  ? 292  GLU B CB  1 
ATOM   6403 C CG  . GLU B 1 292 ? 21.177  -12.569 -29.348 1.00 72.43  ? 292  GLU B CG  1 
ATOM   6404 C CD  . GLU B 1 292 ? 21.284  -13.539 -28.141 1.00 79.60  ? 292  GLU B CD  1 
ATOM   6405 O OE1 . GLU B 1 292 ? 22.408  -13.780 -27.611 1.00 81.16  ? 292  GLU B OE1 1 
ATOM   6406 O OE2 . GLU B 1 292 ? 20.224  -14.071 -27.725 1.00 82.09  ? 292  GLU B OE2 1 
ATOM   6407 N N   . SER B 1 293 ? 20.440  -9.274  -31.049 1.00 61.10  ? 293  SER B N   1 
ATOM   6408 C CA  . SER B 1 293 ? 19.688  -8.057  -30.750 1.00 58.06  ? 293  SER B CA  1 
ATOM   6409 C C   . SER B 1 293 ? 18.207  -8.052  -31.088 1.00 56.25  ? 293  SER B C   1 
ATOM   6410 O O   . SER B 1 293 ? 17.675  -8.989  -31.674 1.00 56.95  ? 293  SER B O   1 
ATOM   6411 C CB  . SER B 1 293 ? 20.371  -6.836  -31.379 1.00 56.99  ? 293  SER B CB  1 
ATOM   6412 O OG  . SER B 1 293 ? 20.561  -6.990  -32.772 1.00 57.25  ? 293  SER B OG  1 
ATOM   6413 N N   . ILE B 1 294 ? 17.546  -6.978  -30.670 1.00 54.29  ? 294  ILE B N   1 
ATOM   6414 C CA  . ILE B 1 294 ? 16.211  -6.630  -31.141 1.00 52.18  ? 294  ILE B CA  1 
ATOM   6415 C C   . ILE B 1 294 ? 16.264  -5.161  -31.495 1.00 50.42  ? 294  ILE B C   1 
ATOM   6416 O O   . ILE B 1 294 ? 17.165  -4.465  -31.055 1.00 50.28  ? 294  ILE B O   1 
ATOM   6417 C CB  . ILE B 1 294 ? 15.117  -6.856  -30.089 1.00 52.37  ? 294  ILE B CB  1 
ATOM   6418 C CG1 . ILE B 1 294 ? 15.557  -6.352  -28.720 1.00 51.46  ? 294  ILE B CG1 1 
ATOM   6419 C CG2 . ILE B 1 294 ? 14.734  -8.325  -30.012 1.00 54.16  ? 294  ILE B CG2 1 
ATOM   6420 C CD1 . ILE B 1 294 ? 14.388  -5.987  -27.854 1.00 50.96  ? 294  ILE B CD1 1 
ATOM   6421 N N   . PHE B 1 295 ? 15.303  -4.709  -32.298 1.00 49.22  ? 295  PHE B N   1 
ATOM   6422 C CA  . PHE B 1 295 ? 15.265  -3.345  -32.827 1.00 47.43  ? 295  PHE B CA  1 
ATOM   6423 C C   . PHE B 1 295 ? 16.579  -2.969  -33.518 1.00 47.52  ? 295  PHE B C   1 
ATOM   6424 O O   . PHE B 1 295 ? 17.072  -1.848  -33.367 1.00 47.81  ? 295  PHE B O   1 
ATOM   6425 C CB  . PHE B 1 295 ? 14.913  -2.334  -31.727 1.00 46.85  ? 295  PHE B CB  1 
ATOM   6426 C CG  . PHE B 1 295 ? 13.929  -1.269  -32.157 1.00 45.53  ? 295  PHE B CG  1 
ATOM   6427 C CD1 . PHE B 1 295 ? 14.190  -0.447  -33.262 1.00 43.93  ? 295  PHE B CD1 1 
ATOM   6428 C CD2 . PHE B 1 295 ? 12.739  -1.088  -31.453 1.00 44.21  ? 295  PHE B CD2 1 
ATOM   6429 C CE1 . PHE B 1 295 ? 13.289  0.524   -33.664 1.00 40.27  ? 295  PHE B CE1 1 
ATOM   6430 C CE2 . PHE B 1 295 ? 11.835  -0.107  -31.837 1.00 42.81  ? 295  PHE B CE2 1 
ATOM   6431 C CZ  . PHE B 1 295 ? 12.114  0.697   -32.948 1.00 42.30  ? 295  PHE B CZ  1 
ATOM   6432 N N   . ARG B 1 296 ? 17.164  -3.917  -34.247 1.00 47.79  ? 296  ARG B N   1 
ATOM   6433 C CA  . ARG B 1 296 ? 18.270  -3.605  -35.143 1.00 47.25  ? 296  ARG B CA  1 
ATOM   6434 C C   . ARG B 1 296 ? 18.020  -4.293  -36.461 1.00 47.16  ? 296  ARG B C   1 
ATOM   6435 O O   . ARG B 1 296 ? 17.513  -5.417  -36.509 1.00 48.71  ? 296  ARG B O   1 
ATOM   6436 C CB  . ARG B 1 296 ? 19.621  -4.035  -34.567 1.00 48.48  ? 296  ARG B CB  1 
ATOM   6437 C CG  . ARG B 1 296 ? 20.024  -3.321  -33.303 1.00 47.88  ? 296  ARG B CG  1 
ATOM   6438 C CD  . ARG B 1 296 ? 20.425  -1.898  -33.533 1.00 46.15  ? 296  ARG B CD  1 
ATOM   6439 N NE  . ARG B 1 296 ? 20.930  -1.302  -32.293 1.00 48.89  ? 296  ARG B NE  1 
ATOM   6440 C CZ  . ARG B 1 296 ? 20.162  -0.740  -31.351 1.00 48.93  ? 296  ARG B CZ  1 
ATOM   6441 N NH1 . ARG B 1 296 ? 18.831  -0.698  -31.496 1.00 47.53  ? 296  ARG B NH1 1 
ATOM   6442 N NH2 . ARG B 1 296 ? 20.722  -0.227  -30.255 1.00 46.34  ? 296  ARG B NH2 1 
ATOM   6443 N N   . PHE B 1 297 ? 18.391  -3.621  -37.537 1.00 45.82  ? 297  PHE B N   1 
ATOM   6444 C CA  . PHE B 1 297 ? 18.017  -4.061  -38.864 1.00 44.58  ? 297  PHE B CA  1 
ATOM   6445 C C   . PHE B 1 297 ? 19.235  -4.068  -39.755 1.00 45.37  ? 297  PHE B C   1 
ATOM   6446 O O   . PHE B 1 297 ? 20.077  -3.150  -39.674 1.00 44.98  ? 297  PHE B O   1 
ATOM   6447 C CB  . PHE B 1 297 ? 16.949  -3.135  -39.414 1.00 42.84  ? 297  PHE B CB  1 
ATOM   6448 C CG  . PHE B 1 297 ? 15.840  -2.860  -38.444 1.00 40.56  ? 297  PHE B CG  1 
ATOM   6449 C CD1 . PHE B 1 297 ? 14.944  -3.877  -38.074 1.00 39.24  ? 297  PHE B CD1 1 
ATOM   6450 C CD2 . PHE B 1 297 ? 15.682  -1.593  -37.898 1.00 36.90  ? 297  PHE B CD2 1 
ATOM   6451 C CE1 . PHE B 1 297 ? 13.897  -3.626  -37.176 1.00 38.40  ? 297  PHE B CE1 1 
ATOM   6452 C CE2 . PHE B 1 297 ? 14.636  -1.322  -37.002 1.00 35.65  ? 297  PHE B CE2 1 
ATOM   6453 C CZ  . PHE B 1 297 ? 13.736  -2.326  -36.646 1.00 35.47  ? 297  PHE B CZ  1 
ATOM   6454 N N   . SER B 1 298 ? 19.327  -5.104  -40.596 1.00 45.32  ? 298  SER B N   1 
ATOM   6455 C CA  . SER B 1 298 ? 20.543  -5.364  -41.344 1.00 46.30  ? 298  SER B CA  1 
ATOM   6456 C C   . SER B 1 298 ? 20.904  -4.312  -42.382 1.00 45.53  ? 298  SER B C   1 
ATOM   6457 O O   . SER B 1 298 ? 22.075  -3.992  -42.540 1.00 46.29  ? 298  SER B O   1 
ATOM   6458 C CB  . SER B 1 298 ? 20.477  -6.732  -42.007 1.00 47.29  ? 298  SER B CB  1 
ATOM   6459 O OG  . SER B 1 298 ? 20.536  -7.734  -41.021 1.00 49.51  ? 298  SER B OG  1 
ATOM   6460 N N   . PHE B 1 299 ? 19.917  -3.797  -43.112 1.00 44.20  ? 299  PHE B N   1 
ATOM   6461 C CA  . PHE B 1 299 ? 20.219  -2.915  -44.235 1.00 43.44  ? 299  PHE B CA  1 
ATOM   6462 C C   . PHE B 1 299 ? 19.384  -1.669  -44.171 1.00 42.66  ? 299  PHE B C   1 
ATOM   6463 O O   . PHE B 1 299 ? 18.176  -1.679  -44.487 1.00 42.81  ? 299  PHE B O   1 
ATOM   6464 C CB  . PHE B 1 299 ? 20.097  -3.649  -45.580 1.00 43.17  ? 299  PHE B CB  1 
ATOM   6465 C CG  . PHE B 1 299 ? 21.165  -4.705  -45.771 1.00 44.45  ? 299  PHE B CG  1 
ATOM   6466 C CD1 . PHE B 1 299 ? 22.442  -4.354  -46.203 1.00 43.50  ? 299  PHE B CD1 1 
ATOM   6467 C CD2 . PHE B 1 299 ? 20.907  -6.042  -45.455 1.00 43.63  ? 299  PHE B CD2 1 
ATOM   6468 C CE1 . PHE B 1 299 ? 23.442  -5.333  -46.344 1.00 46.36  ? 299  PHE B CE1 1 
ATOM   6469 C CE2 . PHE B 1 299 ? 21.894  -7.008  -45.576 1.00 44.29  ? 299  PHE B CE2 1 
ATOM   6470 C CZ  . PHE B 1 299 ? 23.163  -6.663  -46.023 1.00 44.91  ? 299  PHE B CZ  1 
ATOM   6471 N N   . VAL B 1 300 ? 20.040  -0.598  -43.739 1.00 41.96  ? 300  VAL B N   1 
ATOM   6472 C CA  . VAL B 1 300 ? 19.396  0.668   -43.447 1.00 40.60  ? 300  VAL B CA  1 
ATOM   6473 C C   . VAL B 1 300 ? 20.171  1.821   -44.106 1.00 40.55  ? 300  VAL B C   1 
ATOM   6474 O O   . VAL B 1 300 ? 21.279  1.624   -44.567 1.00 41.64  ? 300  VAL B O   1 
ATOM   6475 C CB  . VAL B 1 300 ? 19.317  0.882   -41.898 1.00 40.74  ? 300  VAL B CB  1 
ATOM   6476 C CG1 . VAL B 1 300 ? 18.479  -0.211  -41.227 1.00 41.12  ? 300  VAL B CG1 1 
ATOM   6477 C CG2 . VAL B 1 300 ? 20.710  0.938   -41.274 1.00 40.83  ? 300  VAL B CG2 1 
ATOM   6478 N N   . PRO B 1 301 ? 19.611  3.044   -44.124 1.00 40.28  ? 301  PRO B N   1 
ATOM   6479 C CA  . PRO B 1 301 ? 20.385  4.134   -44.718 1.00 40.60  ? 301  PRO B CA  1 
ATOM   6480 C C   . PRO B 1 301 ? 21.798  4.187   -44.154 1.00 42.08  ? 301  PRO B C   1 
ATOM   6481 O O   . PRO B 1 301 ? 21.994  3.944   -42.964 1.00 42.73  ? 301  PRO B O   1 
ATOM   6482 C CB  . PRO B 1 301 ? 19.606  5.376   -44.286 1.00 39.28  ? 301  PRO B CB  1 
ATOM   6483 C CG  . PRO B 1 301 ? 18.237  4.925   -44.217 1.00 37.98  ? 301  PRO B CG  1 
ATOM   6484 C CD  . PRO B 1 301 ? 18.291  3.520   -43.663 1.00 38.83  ? 301  PRO B CD  1 
ATOM   6485 N N   . VAL B 1 302 ? 22.768  4.480   -45.018 1.00 43.25  ? 302  VAL B N   1 
ATOM   6486 C CA  . VAL B 1 302 ? 24.189  4.552   -44.659 1.00 44.29  ? 302  VAL B CA  1 
ATOM   6487 C C   . VAL B 1 302 ? 24.632  6.027   -44.656 1.00 44.88  ? 302  VAL B C   1 
ATOM   6488 O O   . VAL B 1 302 ? 24.189  6.801   -45.506 1.00 45.52  ? 302  VAL B O   1 
ATOM   6489 C CB  . VAL B 1 302 ? 25.029  3.737   -45.675 1.00 44.96  ? 302  VAL B CB  1 
ATOM   6490 C CG1 . VAL B 1 302 ? 24.717  4.175   -47.094 1.00 44.21  ? 302  VAL B CG1 1 
ATOM   6491 C CG2 . VAL B 1 302 ? 26.528  3.872   -45.403 1.00 46.88  ? 302  VAL B CG2 1 
ATOM   6492 N N   . VAL B 1 303 ? 25.469  6.427   -43.707 1.00 45.41  ? 303  VAL B N   1 
ATOM   6493 C CA  . VAL B 1 303 ? 26.036  7.784   -43.732 1.00 46.52  ? 303  VAL B CA  1 
ATOM   6494 C C   . VAL B 1 303 ? 27.100  7.815   -44.827 1.00 48.42  ? 303  VAL B C   1 
ATOM   6495 O O   . VAL B 1 303 ? 28.247  7.435   -44.598 1.00 50.15  ? 303  VAL B O   1 
ATOM   6496 C CB  . VAL B 1 303 ? 26.609  8.240   -42.341 1.00 46.62  ? 303  VAL B CB  1 
ATOM   6497 C CG1 . VAL B 1 303 ? 27.290  9.590   -42.427 1.00 46.42  ? 303  VAL B CG1 1 
ATOM   6498 C CG2 . VAL B 1 303 ? 25.508  8.316   -41.330 1.00 44.43  ? 303  VAL B CG2 1 
ATOM   6499 N N   . ASP B 1 304 ? 26.688  8.260   -46.015 1.00 49.10  ? 304  ASP B N   1 
ATOM   6500 C CA  . ASP B 1 304 ? 27.489  8.194   -47.249 1.00 51.07  ? 304  ASP B CA  1 
ATOM   6501 C C   . ASP B 1 304 ? 28.337  9.432   -47.596 1.00 52.64  ? 304  ASP B C   1 
ATOM   6502 O O   . ASP B 1 304 ? 29.212  9.357   -48.456 1.00 54.43  ? 304  ASP B O   1 
ATOM   6503 C CB  . ASP B 1 304 ? 26.573  7.868   -48.434 1.00 50.05  ? 304  ASP B CB  1 
ATOM   6504 C CG  . ASP B 1 304 ? 25.460  8.916   -48.643 1.00 51.41  ? 304  ASP B CG  1 
ATOM   6505 O OD1 . ASP B 1 304 ? 25.224  9.783   -47.760 1.00 50.67  ? 304  ASP B OD1 1 
ATOM   6506 O OD2 . ASP B 1 304 ? 24.803  8.862   -49.715 1.00 52.64  ? 304  ASP B OD2 1 
ATOM   6507 N N   . GLY B 1 305 ? 28.077  10.564  -46.951 1.00 52.71  ? 305  GLY B N   1 
ATOM   6508 C CA  . GLY B 1 305 ? 28.730  11.815  -47.327 1.00 54.45  ? 305  GLY B CA  1 
ATOM   6509 C C   . GLY B 1 305 ? 28.037  12.438  -48.533 1.00 54.78  ? 305  GLY B C   1 
ATOM   6510 O O   . GLY B 1 305 ? 28.430  13.504  -49.006 1.00 55.50  ? 305  GLY B O   1 
ATOM   6511 N N   . ASP B 1 306 ? 26.992  11.776  -49.036 1.00 53.97  ? 306  ASP B N   1 
ATOM   6512 C CA  . ASP B 1 306 ? 26.263  12.280  -50.213 1.00 54.08  ? 306  ASP B CA  1 
ATOM   6513 C C   . ASP B 1 306 ? 24.799  12.648  -49.884 1.00 52.14  ? 306  ASP B C   1 
ATOM   6514 O O   . ASP B 1 306 ? 24.488  13.832  -49.699 1.00 51.88  ? 306  ASP B O   1 
ATOM   6515 C CB  . ASP B 1 306 ? 26.385  11.300  -51.389 1.00 54.43  ? 306  ASP B CB  1 
ATOM   6516 C CG  . ASP B 1 306 ? 25.726  11.810  -52.662 1.00 56.72  ? 306  ASP B CG  1 
ATOM   6517 O OD1 . ASP B 1 306 ? 25.461  13.032  -52.779 1.00 57.51  ? 306  ASP B OD1 1 
ATOM   6518 O OD2 . ASP B 1 306 ? 25.466  10.970  -53.559 1.00 59.50  ? 306  ASP B OD2 1 
ATOM   6519 N N   . PHE B 1 307 ? 23.920  11.641  -49.803 1.00 50.69  ? 307  PHE B N   1 
ATOM   6520 C CA  . PHE B 1 307 ? 22.527  11.860  -49.409 1.00 49.01  ? 307  PHE B CA  1 
ATOM   6521 C C   . PHE B 1 307 ? 22.528  12.428  -48.000 1.00 49.08  ? 307  PHE B C   1 
ATOM   6522 O O   . PHE B 1 307 ? 21.797  13.363  -47.708 1.00 48.85  ? 307  PHE B O   1 
ATOM   6523 C CB  . PHE B 1 307 ? 21.719  10.550  -49.451 1.00 47.58  ? 307  PHE B CB  1 
ATOM   6524 C CG  . PHE B 1 307 ? 20.226  10.742  -49.273 1.00 44.71  ? 307  PHE B CG  1 
ATOM   6525 C CD1 . PHE B 1 307 ? 19.684  11.088  -48.032 1.00 42.86  ? 307  PHE B CD1 1 
ATOM   6526 C CD2 . PHE B 1 307 ? 19.363  10.564  -50.334 1.00 43.39  ? 307  PHE B CD2 1 
ATOM   6527 C CE1 . PHE B 1 307 ? 18.298  11.259  -47.860 1.00 39.86  ? 307  PHE B CE1 1 
ATOM   6528 C CE2 . PHE B 1 307 ? 17.983  10.738  -50.171 1.00 41.90  ? 307  PHE B CE2 1 
ATOM   6529 C CZ  . PHE B 1 307 ? 17.453  11.083  -48.927 1.00 40.07  ? 307  PHE B CZ  1 
ATOM   6530 N N   . LEU B 1 308 ? 23.365  11.836  -47.145 1.00 49.63  ? 308  LEU B N   1 
ATOM   6531 C CA  . LEU B 1 308 ? 23.581  12.270  -45.779 1.00 49.51  ? 308  LEU B CA  1 
ATOM   6532 C C   . LEU B 1 308 ? 25.016  12.774  -45.657 1.00 51.83  ? 308  LEU B C   1 
ATOM   6533 O O   . LEU B 1 308 ? 25.963  11.975  -45.581 1.00 52.55  ? 308  LEU B O   1 
ATOM   6534 C CB  . LEU B 1 308 ? 23.355  11.102  -44.823 1.00 48.52  ? 308  LEU B CB  1 
ATOM   6535 C CG  . LEU B 1 308 ? 21.931  10.547  -44.668 1.00 46.79  ? 308  LEU B CG  1 
ATOM   6536 C CD1 . LEU B 1 308 ? 21.967  9.268   -43.860 1.00 45.84  ? 308  LEU B CD1 1 
ATOM   6537 C CD2 . LEU B 1 308 ? 20.972  11.547  -44.027 1.00 43.98  ? 308  LEU B CD2 1 
ATOM   6538 N N   . SER B 1 309 ? 25.180  14.096  -45.635 1.00 52.64  ? 309  SER B N   1 
ATOM   6539 C CA  . SER B 1 309 ? 26.509  14.695  -45.671 1.00 54.96  ? 309  SER B CA  1 
ATOM   6540 C C   . SER B 1 309 ? 27.347  14.450  -44.398 1.00 55.67  ? 309  SER B C   1 
ATOM   6541 O O   . SER B 1 309 ? 28.576  14.525  -44.440 1.00 57.22  ? 309  SER B O   1 
ATOM   6542 C CB  . SER B 1 309 ? 26.420  16.192  -45.997 1.00 55.67  ? 309  SER B CB  1 
ATOM   6543 O OG  . SER B 1 309 ? 25.680  16.891  -45.008 1.00 56.17  ? 309  SER B OG  1 
ATOM   6544 N N   . ASP B 1 310 ? 26.678  14.157  -43.287 1.00 54.40  ? 310  ASP B N   1 
ATOM   6545 C CA  . ASP B 1 310 ? 27.327  13.814  -42.023 1.00 55.13  ? 310  ASP B CA  1 
ATOM   6546 C C   . ASP B 1 310 ? 26.330  12.934  -41.272 1.00 53.43  ? 310  ASP B C   1 
ATOM   6547 O O   . ASP B 1 310 ? 25.272  12.645  -41.815 1.00 52.19  ? 310  ASP B O   1 
ATOM   6548 C CB  . ASP B 1 310 ? 27.667  15.087  -41.237 1.00 56.09  ? 310  ASP B CB  1 
ATOM   6549 C CG  . ASP B 1 310 ? 28.815  14.894  -40.231 1.00 58.81  ? 310  ASP B CG  1 
ATOM   6550 O OD1 . ASP B 1 310 ? 29.100  13.747  -39.818 1.00 61.07  ? 310  ASP B OD1 1 
ATOM   6551 O OD2 . ASP B 1 310 ? 29.425  15.910  -39.830 1.00 59.88  ? 310  ASP B OD2 1 
ATOM   6552 N N   . THR B 1 311 ? 26.640  12.512  -40.044 1.00 53.81  ? 311  THR B N   1 
ATOM   6553 C CA  . THR B 1 311 ? 25.675  11.739  -39.224 1.00 52.44  ? 311  THR B CA  1 
ATOM   6554 C C   . THR B 1 311 ? 24.405  12.554  -38.966 1.00 51.69  ? 311  THR B C   1 
ATOM   6555 O O   . THR B 1 311 ? 24.453  13.787  -38.916 1.00 52.23  ? 311  THR B O   1 
ATOM   6556 C CB  . THR B 1 311 ? 26.250  11.325  -37.846 1.00 52.77  ? 311  THR B CB  1 
ATOM   6557 O OG1 . THR B 1 311 ? 26.501  12.492  -37.065 1.00 52.82  ? 311  THR B OG1 1 
ATOM   6558 C CG2 . THR B 1 311 ? 27.546  10.515  -37.986 1.00 53.41  ? 311  THR B CG2 1 
ATOM   6559 N N   . PRO B 1 312 ? 23.258  11.878  -38.806 1.00 51.00  ? 312  PRO B N   1 
ATOM   6560 C CA  . PRO B 1 312 ? 22.070  12.645  -38.428 1.00 50.61  ? 312  PRO B CA  1 
ATOM   6561 C C   . PRO B 1 312 ? 22.280  13.434  -37.156 1.00 51.54  ? 312  PRO B C   1 
ATOM   6562 O O   . PRO B 1 312 ? 21.682  14.504  -37.013 1.00 52.16  ? 312  PRO B O   1 
ATOM   6563 C CB  . PRO B 1 312 ? 20.998  11.573  -38.226 1.00 49.51  ? 312  PRO B CB  1 
ATOM   6564 C CG  . PRO B 1 312 ? 21.392  10.500  -39.162 1.00 49.48  ? 312  PRO B CG  1 
ATOM   6565 C CD  . PRO B 1 312 ? 22.914  10.503  -39.210 1.00 50.25  ? 312  PRO B CD  1 
ATOM   6566 N N   . GLU B 1 313 ? 23.123  12.929  -36.250 1.00 52.53  ? 313  GLU B N   1 
ATOM   6567 C CA  A GLU B 1 313 ? 23.445  13.656  -35.012 0.50 53.21  ? 313  GLU B CA  1 
ATOM   6568 C CA  B GLU B 1 313 ? 23.414  13.652  -35.026 0.50 53.05  ? 313  GLU B CA  1 
ATOM   6569 C C   . GLU B 1 313 ? 24.133  14.973  -35.345 1.00 54.42  ? 313  GLU B C   1 
ATOM   6570 O O   . GLU B 1 313 ? 23.736  16.032  -34.855 1.00 55.07  ? 313  GLU B O   1 
ATOM   6571 C CB  A GLU B 1 313 ? 24.307  12.835  -34.031 0.50 53.78  ? 313  GLU B CB  1 
ATOM   6572 C CB  B GLU B 1 313 ? 24.189  12.763  -34.048 0.50 53.42  ? 313  GLU B CB  1 
ATOM   6573 C CG  A GLU B 1 313 ? 24.878  13.701  -32.876 0.50 55.31  ? 313  GLU B CG  1 
ATOM   6574 C CG  B GLU B 1 313 ? 23.292  11.867  -33.161 0.50 52.46  ? 313  GLU B CG  1 
ATOM   6575 C CD  A GLU B 1 313 ? 25.627  12.934  -31.783 0.50 56.11  ? 313  GLU B CD  1 
ATOM   6576 C CD  B GLU B 1 313 ? 22.784  10.593  -33.858 0.50 51.14  ? 313  GLU B CD  1 
ATOM   6577 O OE1 A GLU B 1 313 ? 24.969  12.365  -30.886 0.50 55.63  ? 313  GLU B OE1 1 
ATOM   6578 O OE1 B GLU B 1 313 ? 22.080  9.804   -33.186 0.50 48.12  ? 313  GLU B OE1 1 
ATOM   6579 O OE2 A GLU B 1 313 ? 26.876  12.949  -31.792 0.50 56.49  ? 313  GLU B OE2 1 
ATOM   6580 O OE2 B GLU B 1 313 ? 23.094  10.376  -35.061 0.50 50.76  ? 313  GLU B OE2 1 
ATOM   6581 N N   . ALA B 1 314 ? 25.165  14.924  -36.186 1.00 55.15  ? 314  ALA B N   1 
ATOM   6582 C CA  . ALA B 1 314 ? 25.873  16.155  -36.531 1.00 56.83  ? 314  ALA B CA  1 
ATOM   6583 C C   . ALA B 1 314 ? 24.963  17.121  -37.294 1.00 56.79  ? 314  ALA B C   1 
ATOM   6584 O O   . ALA B 1 314 ? 25.021  18.335  -37.072 1.00 57.63  ? 314  ALA B O   1 
ATOM   6585 C CB  . ALA B 1 314 ? 27.169  15.882  -37.302 1.00 57.58  ? 314  ALA B CB  1 
ATOM   6586 N N   . LEU B 1 315 ? 24.109  16.573  -38.163 1.00 56.12  ? 315  LEU B N   1 
ATOM   6587 C CA  . LEU B 1 315 ? 23.210  17.378  -38.987 1.00 55.64  ? 315  LEU B CA  1 
ATOM   6588 C C   . LEU B 1 315 ? 22.104  18.052  -38.183 1.00 55.73  ? 315  LEU B C   1 
ATOM   6589 O O   . LEU B 1 315 ? 21.757  19.201  -38.461 1.00 55.90  ? 315  LEU B O   1 
ATOM   6590 C CB  . LEU B 1 315 ? 22.598  16.538  -40.096 1.00 54.27  ? 315  LEU B CB  1 
ATOM   6591 C CG  . LEU B 1 315 ? 23.557  15.995  -41.145 1.00 54.24  ? 315  LEU B CG  1 
ATOM   6592 C CD1 . LEU B 1 315 ? 22.764  15.331  -42.248 1.00 49.75  ? 315  LEU B CD1 1 
ATOM   6593 C CD2 . LEU B 1 315 ? 24.470  17.099  -41.705 1.00 53.76  ? 315  LEU B CD2 1 
ATOM   6594 N N   . ILE B 1 316 ? 21.549  17.351  -37.194 1.00 55.79  ? 316  ILE B N   1 
ATOM   6595 C CA  . ILE B 1 316 ? 20.493  17.973  -36.391 1.00 56.62  ? 316  ILE B CA  1 
ATOM   6596 C C   . ILE B 1 316 ? 21.083  18.989  -35.436 1.00 58.72  ? 316  ILE B C   1 
ATOM   6597 O O   . ILE B 1 316 ? 20.462  20.020  -35.182 1.00 59.31  ? 316  ILE B O   1 
ATOM   6598 C CB  . ILE B 1 316 ? 19.536  16.984  -35.633 1.00 55.25  ? 316  ILE B CB  1 
ATOM   6599 C CG1 . ILE B 1 316 ? 20.286  16.089  -34.641 1.00 55.50  ? 316  ILE B CG1 1 
ATOM   6600 C CG2 . ILE B 1 316 ? 18.709  16.172  -36.610 1.00 53.66  ? 316  ILE B CG2 1 
ATOM   6601 C CD1 . ILE B 1 316 ? 19.362  15.405  -33.609 1.00 55.15  ? 316  ILE B CD1 1 
ATOM   6602 N N   . ASN B 1 317 ? 22.283  18.715  -34.924 1.00 60.63  ? 317  ASN B N   1 
ATOM   6603 C CA  . ASN B 1 317 ? 22.937  19.667  -34.027 1.00 62.89  ? 317  ASN B CA  1 
ATOM   6604 C C   . ASN B 1 317 ? 23.204  21.025  -34.689 1.00 63.97  ? 317  ASN B C   1 
ATOM   6605 O O   . ASN B 1 317 ? 23.118  22.045  -34.017 1.00 64.74  ? 317  ASN B O   1 
ATOM   6606 C CB  . ASN B 1 317 ? 24.213  19.082  -33.370 1.00 64.25  ? 317  ASN B CB  1 
ATOM   6607 C CG  . ASN B 1 317 ? 23.905  17.984  -32.323 1.00 64.89  ? 317  ASN B CG  1 
ATOM   6608 O OD1 . ASN B 1 317 ? 22.752  17.771  -31.933 1.00 66.06  ? 317  ASN B OD1 1 
ATOM   6609 N ND2 . ASN B 1 317 ? 24.945  17.285  -31.874 1.00 66.54  ? 317  ASN B ND2 1 
ATOM   6610 N N   . THR B 1 318 ? 23.475  21.044  -35.997 1.00 64.22  ? 318  THR B N   1 
ATOM   6611 C CA  . THR B 1 318 ? 23.935  22.277  -36.657 1.00 66.23  ? 318  THR B CA  1 
ATOM   6612 C C   . THR B 1 318 ? 23.054  22.817  -37.780 1.00 66.06  ? 318  THR B C   1 
ATOM   6613 O O   . THR B 1 318 ? 23.418  23.791  -38.434 1.00 67.03  ? 318  THR B O   1 
ATOM   6614 C CB  . THR B 1 318 ? 25.375  22.124  -37.257 1.00 67.79  ? 318  THR B CB  1 
ATOM   6615 O OG1 . THR B 1 318 ? 25.357  21.159  -38.323 1.00 66.85  ? 318  THR B OG1 1 
ATOM   6616 C CG2 . THR B 1 318 ? 26.397  21.726  -36.176 1.00 68.52  ? 318  THR B CG2 1 
ATOM   6617 N N   . GLY B 1 319 ? 21.921  22.176  -38.034 1.00 65.09  ? 319  GLY B N   1 
ATOM   6618 C CA  . GLY B 1 319 ? 21.059  22.587  -39.143 1.00 65.27  ? 319  GLY B CA  1 
ATOM   6619 C C   . GLY B 1 319 ? 20.330  23.899  -38.883 1.00 66.16  ? 319  GLY B C   1 
ATOM   6620 O O   . GLY B 1 319 ? 20.131  24.295  -37.728 1.00 65.77  ? 319  GLY B O   1 
ATOM   6621 N N   . ASP B 1 320 ? 19.955  24.581  -39.964 1.00 67.17  ? 320  ASP B N   1 
ATOM   6622 C CA  . ASP B 1 320 ? 19.029  25.699  -39.870 1.00 68.24  ? 320  ASP B CA  1 
ATOM   6623 C C   . ASP B 1 320 ? 17.623  25.244  -40.261 1.00 66.74  ? 320  ASP B C   1 
ATOM   6624 O O   . ASP B 1 320 ? 17.393  24.814  -41.396 1.00 66.52  ? 320  ASP B O   1 
ATOM   6625 C CB  . ASP B 1 320 ? 19.462  26.869  -40.752 1.00 70.39  ? 320  ASP B CB  1 
ATOM   6626 C CG  . ASP B 1 320 ? 18.614  28.115  -40.512 1.00 72.55  ? 320  ASP B CG  1 
ATOM   6627 O OD1 . ASP B 1 320 ? 17.831  28.096  -39.539 1.00 72.76  ? 320  ASP B OD1 1 
ATOM   6628 O OD2 . ASP B 1 320 ? 18.734  29.109  -41.273 1.00 75.29  ? 320  ASP B OD2 1 
ATOM   6629 N N   . PHE B 1 321 ? 16.687  25.351  -39.320 1.00 65.89  ? 321  PHE B N   1 
ATOM   6630 C CA  . PHE B 1 321 ? 15.338  24.833  -39.525 1.00 64.72  ? 321  PHE B CA  1 
ATOM   6631 C C   . PHE B 1 321 ? 14.227  25.888  -39.452 1.00 65.88  ? 321  PHE B C   1 
ATOM   6632 O O   . PHE B 1 321 ? 13.072  25.548  -39.173 1.00 65.30  ? 321  PHE B O   1 
ATOM   6633 C CB  . PHE B 1 321 ? 15.070  23.676  -38.553 1.00 63.14  ? 321  PHE B CB  1 
ATOM   6634 C CG  . PHE B 1 321 ? 16.028  22.524  -38.707 1.00 61.00  ? 321  PHE B CG  1 
ATOM   6635 C CD1 . PHE B 1 321 ? 15.985  21.706  -39.833 1.00 59.54  ? 321  PHE B CD1 1 
ATOM   6636 C CD2 . PHE B 1 321 ? 16.976  22.261  -37.736 1.00 60.61  ? 321  PHE B CD2 1 
ATOM   6637 C CE1 . PHE B 1 321 ? 16.877  20.644  -39.987 1.00 58.86  ? 321  PHE B CE1 1 
ATOM   6638 C CE2 . PHE B 1 321 ? 17.869  21.197  -37.878 1.00 60.67  ? 321  PHE B CE2 1 
ATOM   6639 C CZ  . PHE B 1 321 ? 17.815  20.385  -39.013 1.00 59.11  ? 321  PHE B CZ  1 
ATOM   6640 N N   . GLN B 1 322 ? 14.585  27.140  -39.759 1.00 67.60  ? 322  GLN B N   1 
ATOM   6641 C CA  . GLN B 1 322 ? 13.714  28.310  -39.631 1.00 69.02  ? 322  GLN B CA  1 
ATOM   6642 C C   . GLN B 1 322 ? 12.300  28.179  -40.214 1.00 68.40  ? 322  GLN B C   1 
ATOM   6643 O O   . GLN B 1 322 ? 11.323  28.313  -39.460 1.00 68.72  ? 322  GLN B O   1 
ATOM   6644 C CB  . GLN B 1 322 ? 14.392  29.574  -40.180 1.00 71.39  ? 322  GLN B CB  1 
ATOM   6645 C CG  . GLN B 1 322 ? 15.641  30.030  -39.417 1.00 74.54  ? 322  GLN B CG  1 
ATOM   6646 C CD  . GLN B 1 322 ? 15.421  31.247  -38.529 1.00 78.93  ? 322  GLN B CD  1 
ATOM   6647 O OE1 . GLN B 1 322 ? 15.934  32.338  -38.820 1.00 81.22  ? 322  GLN B OE1 1 
ATOM   6648 N NE2 . GLN B 1 322 ? 14.674  31.068  -37.434 1.00 78.01  ? 322  GLN B NE2 1 
ATOM   6649 N N   . ASP B 1 323 ? 12.155  27.938  -41.522 1.00 67.76  ? 323  ASP B N   1 
ATOM   6650 C CA  . ASP B 1 323 ? 10.783  27.855  -42.083 1.00 67.06  ? 323  ASP B CA  1 
ATOM   6651 C C   . ASP B 1 323 ? 10.315  26.402  -42.227 1.00 63.97  ? 323  ASP B C   1 
ATOM   6652 O O   . ASP B 1 323 ? 9.850   26.001  -43.300 1.00 63.77  ? 323  ASP B O   1 
ATOM   6653 C CB  . ASP B 1 323 ? 10.579  28.638  -43.433 1.00 69.30  ? 323  ASP B CB  1 
ATOM   6654 C CG  . ASP B 1 323 ? 11.191  30.083  -43.403 1.00 73.35  ? 323  ASP B CG  1 
ATOM   6655 O OD1 . ASP B 1 323 ? 12.101  30.338  -44.240 1.00 76.29  ? 323  ASP B OD1 1 
ATOM   6656 O OD2 . ASP B 1 323 ? 10.765  30.962  -42.589 1.00 75.51  ? 323  ASP B OD2 1 
ATOM   6657 N N   . LEU B 1 324 ? 10.443  25.632  -41.142 1.00 60.85  ? 324  LEU B N   1 
ATOM   6658 C CA  . LEU B 1 324 ? 9.984   24.245  -41.089 1.00 57.03  ? 324  LEU B CA  1 
ATOM   6659 C C   . LEU B 1 324 ? 8.997   24.040  -39.954 1.00 55.07  ? 324  LEU B C   1 
ATOM   6660 O O   . LEU B 1 324 ? 9.223   24.511  -38.849 1.00 55.15  ? 324  LEU B O   1 
ATOM   6661 C CB  . LEU B 1 324 ? 11.165  23.302  -40.888 1.00 56.37  ? 324  LEU B CB  1 
ATOM   6662 C CG  . LEU B 1 324 ? 10.838  21.802  -40.877 1.00 54.64  ? 324  LEU B CG  1 
ATOM   6663 C CD1 . LEU B 1 324 ? 10.418  21.353  -42.268 1.00 54.14  ? 324  LEU B CD1 1 
ATOM   6664 C CD2 . LEU B 1 324 ? 12.021  21.000  -40.386 1.00 52.98  ? 324  LEU B CD2 1 
ATOM   6665 N N   . GLN B 1 325 ? 7.908   23.337  -40.238 1.00 52.66  ? 325  GLN B N   1 
ATOM   6666 C CA  . GLN B 1 325 ? 6.967   22.907  -39.207 1.00 51.04  ? 325  GLN B CA  1 
ATOM   6667 C C   . GLN B 1 325 ? 6.981   21.389  -39.097 1.00 48.82  ? 325  GLN B C   1 
ATOM   6668 O O   . GLN B 1 325 ? 6.939   20.699  -40.119 1.00 48.40  ? 325  GLN B O   1 
ATOM   6669 C CB  . GLN B 1 325 ? 5.547   23.370  -39.512 1.00 51.40  ? 325  GLN B CB  1 
ATOM   6670 C CG  . GLN B 1 325 ? 5.377   24.863  -39.559 1.00 53.62  ? 325  GLN B CG  1 
ATOM   6671 C CD  . GLN B 1 325 ? 5.432   25.399  -40.960 1.00 54.53  ? 325  GLN B CD  1 
ATOM   6672 O OE1 . GLN B 1 325 ? 4.825   24.842  -41.872 1.00 53.15  ? 325  GLN B OE1 1 
ATOM   6673 N NE2 . GLN B 1 325 ? 6.184   26.475  -41.151 1.00 57.03  ? 325  GLN B NE2 1 
ATOM   6674 N N   . VAL B 1 326 ? 7.029   20.875  -37.867 1.00 47.09  ? 326  VAL B N   1 
ATOM   6675 C CA  . VAL B 1 326 ? 7.139   19.434  -37.634 1.00 45.53  ? 326  VAL B CA  1 
ATOM   6676 C C   . VAL B 1 326 ? 6.148   19.005  -36.581 1.00 44.60  ? 326  VAL B C   1 
ATOM   6677 O O   . VAL B 1 326 ? 6.000   19.687  -35.570 1.00 45.05  ? 326  VAL B O   1 
ATOM   6678 C CB  . VAL B 1 326 ? 8.548   19.030  -37.125 1.00 45.41  ? 326  VAL B CB  1 
ATOM   6679 C CG1 . VAL B 1 326 ? 8.799   17.573  -37.375 1.00 44.70  ? 326  VAL B CG1 1 
ATOM   6680 C CG2 . VAL B 1 326 ? 9.621   19.821  -37.820 1.00 46.03  ? 326  VAL B CG2 1 
ATOM   6681 N N   . LEU B 1 327 ? 5.464   17.890  -36.838 1.00 43.21  ? 327  LEU B N   1 
ATOM   6682 C CA  . LEU B 1 327 ? 4.665   17.184  -35.837 1.00 42.33  ? 327  LEU B CA  1 
ATOM   6683 C C   . LEU B 1 327 ? 5.368   15.873  -35.501 1.00 41.01  ? 327  LEU B C   1 
ATOM   6684 O O   . LEU B 1 327 ? 5.642   15.074  -36.396 1.00 40.55  ? 327  LEU B O   1 
ATOM   6685 C CB  . LEU B 1 327 ? 3.244   16.899  -36.347 1.00 42.43  ? 327  LEU B CB  1 
ATOM   6686 C CG  . LEU B 1 327 ? 2.351   16.024  -35.437 1.00 43.33  ? 327  LEU B CG  1 
ATOM   6687 C CD1 . LEU B 1 327 ? 2.057   16.687  -34.105 1.00 43.15  ? 327  LEU B CD1 1 
ATOM   6688 C CD2 . LEU B 1 327 ? 1.035   15.657  -36.095 1.00 45.74  ? 327  LEU B CD2 1 
ATOM   6689 N N   . VAL B 1 328 ? 5.679   15.655  -34.228 1.00 40.33  ? 328  VAL B N   1 
ATOM   6690 C CA  . VAL B 1 328 ? 6.316   14.399  -33.812 1.00 39.97  ? 328  VAL B CA  1 
ATOM   6691 C C   . VAL B 1 328 ? 5.635   13.795  -32.603 1.00 40.60  ? 328  VAL B C   1 
ATOM   6692 O O   . VAL B 1 328 ? 5.016   14.520  -31.787 1.00 42.17  ? 328  VAL B O   1 
ATOM   6693 C CB  . VAL B 1 328 ? 7.802   14.562  -33.444 1.00 39.25  ? 328  VAL B CB  1 
ATOM   6694 C CG1 . VAL B 1 328 ? 8.531   15.241  -34.526 1.00 40.13  ? 328  VAL B CG1 1 
ATOM   6695 C CG2 . VAL B 1 328 ? 7.950   15.358  -32.184 1.00 40.41  ? 328  VAL B CG2 1 
ATOM   6696 N N   . GLY B 1 329 ? 5.769   12.481  -32.461 1.00 39.63  ? 329  GLY B N   1 
ATOM   6697 C CA  . GLY B 1 329 ? 5.306   11.847  -31.264 1.00 39.95  ? 329  GLY B CA  1 
ATOM   6698 C C   . GLY B 1 329 ? 5.595   10.380  -31.145 1.00 40.11  ? 329  GLY B C   1 
ATOM   6699 O O   . GLY B 1 329 ? 6.215   9.773   -32.022 1.00 40.22  ? 329  GLY B O   1 
ATOM   6700 N N   . VAL B 1 330 ? 5.104   9.809   -30.049 1.00 40.58  ? 330  VAL B N   1 
ATOM   6701 C CA  . VAL B 1 330 ? 5.349   8.418   -29.696 1.00 40.16  ? 330  VAL B CA  1 
ATOM   6702 C C   . VAL B 1 330 ? 4.062   7.777   -29.176 1.00 40.95  ? 330  VAL B C   1 
ATOM   6703 O O   . VAL B 1 330 ? 3.121   8.472   -28.810 1.00 41.41  ? 330  VAL B O   1 
ATOM   6704 C CB  . VAL B 1 330 ? 6.453   8.320   -28.590 1.00 40.34  ? 330  VAL B CB  1 
ATOM   6705 C CG1 . VAL B 1 330 ? 7.767   8.923   -29.065 1.00 39.33  ? 330  VAL B CG1 1 
ATOM   6706 C CG2 . VAL B 1 330 ? 6.003   8.999   -27.299 1.00 40.41  ? 330  VAL B CG2 1 
ATOM   6707 N N   . VAL B 1 331 ? 4.030   6.450   -29.124 1.00 41.52  ? 331  VAL B N   1 
ATOM   6708 C CA  . VAL B 1 331 ? 2.931   5.738   -28.484 1.00 42.35  ? 331  VAL B CA  1 
ATOM   6709 C C   . VAL B 1 331 ? 3.366   5.327   -27.086 1.00 43.35  ? 331  VAL B C   1 
ATOM   6710 O O   . VAL B 1 331 ? 4.561   5.369   -26.772 1.00 42.94  ? 331  VAL B O   1 
ATOM   6711 C CB  . VAL B 1 331 ? 2.466   4.513   -29.313 1.00 42.93  ? 331  VAL B CB  1 
ATOM   6712 C CG1 . VAL B 1 331 ? 2.079   4.955   -30.725 1.00 42.40  ? 331  VAL B CG1 1 
ATOM   6713 C CG2 . VAL B 1 331 ? 3.534   3.405   -29.346 1.00 41.64  ? 331  VAL B CG2 1 
ATOM   6714 N N   . LYS B 1 332 ? 2.399   4.922   -26.264 1.00 44.77  ? 332  LYS B N   1 
ATOM   6715 C CA  . LYS B 1 332 ? 2.634   4.656   -24.853 1.00 46.37  ? 332  LYS B CA  1 
ATOM   6716 C C   . LYS B 1 332 ? 3.594   3.493   -24.594 1.00 46.72  ? 332  LYS B C   1 
ATOM   6717 O O   . LYS B 1 332 ? 4.275   3.476   -23.571 1.00 47.18  ? 332  LYS B O   1 
ATOM   6718 C CB  . LYS B 1 332 ? 1.302   4.485   -24.084 1.00 48.04  ? 332  LYS B CB  1 
ATOM   6719 C CG  . LYS B 1 332 ? 1.444   4.256   -22.540 1.00 50.81  ? 332  LYS B CG  1 
ATOM   6720 C CD  . LYS B 1 332 ? 0.071   4.253   -21.792 1.00 55.72  ? 332  LYS B CD  1 
ATOM   6721 C CE  . LYS B 1 332 ? -0.103  3.041   -20.819 1.00 59.47  ? 332  LYS B CE  1 
ATOM   6722 N NZ  . LYS B 1 332 ? -0.248  1.713   -21.562 1.00 58.97  ? 332  LYS B NZ  1 
ATOM   6723 N N   . ASP B 1 333 ? 3.672   2.529   -25.507 1.00 46.57  ? 333  ASP B N   1 
ATOM   6724 C CA  . ASP B 1 333 ? 4.509   1.350   -25.248 1.00 47.40  ? 333  ASP B CA  1 
ATOM   6725 C C   . ASP B 1 333 ? 5.363   0.993   -26.439 1.00 46.47  ? 333  ASP B C   1 
ATOM   6726 O O   . ASP B 1 333 ? 5.207   -0.055  -27.044 1.00 46.91  ? 333  ASP B O   1 
ATOM   6727 C CB  . ASP B 1 333 ? 3.639   0.171   -24.823 1.00 48.74  ? 333  ASP B CB  1 
ATOM   6728 C CG  . ASP B 1 333 ? 2.795   0.493   -23.609 1.00 51.12  ? 333  ASP B CG  1 
ATOM   6729 O OD1 . ASP B 1 333 ? 1.570   0.744   -23.760 1.00 51.78  ? 333  ASP B OD1 1 
ATOM   6730 O OD2 . ASP B 1 333 ? 3.380   0.540   -22.506 1.00 52.69  ? 333  ASP B OD2 1 
ATOM   6731 N N   . GLU B 1 334 ? 6.273   1.887   -26.781 1.00 45.88  ? 334  GLU B N   1 
ATOM   6732 C CA  . GLU B 1 334 ? 7.062   1.730   -27.989 1.00 44.96  ? 334  GLU B CA  1 
ATOM   6733 C C   . GLU B 1 334 ? 7.785   0.380   -28.071 1.00 45.37  ? 334  GLU B C   1 
ATOM   6734 O O   . GLU B 1 334 ? 7.773   -0.261  -29.111 1.00 45.96  ? 334  GLU B O   1 
ATOM   6735 C CB  . GLU B 1 334 ? 8.020   2.905   -28.143 1.00 43.66  ? 334  GLU B CB  1 
ATOM   6736 C CG  . GLU B 1 334 ? 7.307   4.203   -28.494 1.00 44.78  ? 334  GLU B CG  1 
ATOM   6737 C CD  . GLU B 1 334 ? 6.848   4.266   -29.960 1.00 45.98  ? 334  GLU B CD  1 
ATOM   6738 O OE1 . GLU B 1 334 ? 7.205   3.364   -30.736 1.00 46.42  ? 334  GLU B OE1 1 
ATOM   6739 O OE2 . GLU B 1 334 ? 6.145   5.225   -30.344 1.00 44.79  ? 334  GLU B OE2 1 
ATOM   6740 N N   . GLY B 1 335 ? 8.372   -0.086  -26.982 1.00 46.18  ? 335  GLY B N   1 
ATOM   6741 C CA  . GLY B 1 335 ? 9.170   -1.317  -27.060 1.00 47.27  ? 335  GLY B CA  1 
ATOM   6742 C C   . GLY B 1 335 ? 8.526   -2.673  -26.776 1.00 48.49  ? 335  GLY B C   1 
ATOM   6743 O O   . GLY B 1 335 ? 9.175   -3.711  -26.949 1.00 49.74  ? 335  GLY B O   1 
ATOM   6744 N N   . SER B 1 336 ? 7.273   -2.691  -26.341 1.00 48.56  ? 336  SER B N   1 
ATOM   6745 C CA  . SER B 1 336 ? 6.675   -3.937  -25.852 1.00 50.50  ? 336  SER B CA  1 
ATOM   6746 C C   . SER B 1 336 ? 6.696   -5.048  -26.897 1.00 50.51  ? 336  SER B C   1 
ATOM   6747 O O   . SER B 1 336 ? 7.154   -6.147  -26.615 1.00 51.94  ? 336  SER B O   1 
ATOM   6748 C CB  . SER B 1 336 ? 5.239   -3.708  -25.384 1.00 51.00  ? 336  SER B CB  1 
ATOM   6749 O OG  . SER B 1 336 ? 4.467   -3.185  -26.455 1.00 51.28  ? 336  SER B OG  1 
ATOM   6750 N N   . ALA B 1 337 ? 6.219   -4.751  -28.102 1.00 49.16  ? 337  ALA B N   1 
ATOM   6751 C CA  . ALA B 1 337 ? 6.054   -5.776  -29.125 1.00 49.00  ? 337  ALA B CA  1 
ATOM   6752 C C   . ALA B 1 337 ? 7.362   -6.324  -29.673 1.00 48.69  ? 337  ALA B C   1 
ATOM   6753 O O   . ALA B 1 337 ? 7.382   -7.429  -30.215 1.00 49.91  ? 337  ALA B O   1 
ATOM   6754 C CB  . ALA B 1 337 ? 5.162   -5.288  -30.249 1.00 48.15  ? 337  ALA B CB  1 
ATOM   6755 N N   . PHE B 1 338 ? 8.450   -5.585  -29.500 1.00 47.07  ? 338  PHE B N   1 
ATOM   6756 C CA  . PHE B 1 338 ? 9.758   -6.032  -29.988 1.00 46.68  ? 338  PHE B CA  1 
ATOM   6757 C C   . PHE B 1 338 ? 10.370  -7.125  -29.159 1.00 47.82  ? 338  PHE B C   1 
ATOM   6758 O O   . PHE B 1 338 ? 11.212  -7.887  -29.648 1.00 48.31  ? 338  PHE B O   1 
ATOM   6759 C CB  . PHE B 1 338 ? 10.735  -4.867  -30.051 1.00 45.59  ? 338  PHE B CB  1 
ATOM   6760 C CG  . PHE B 1 338 ? 10.455  -3.940  -31.169 1.00 44.70  ? 338  PHE B CG  1 
ATOM   6761 C CD1 . PHE B 1 338 ? 9.632   -2.829  -30.974 1.00 42.54  ? 338  PHE B CD1 1 
ATOM   6762 C CD2 . PHE B 1 338 ? 10.956  -4.207  -32.443 1.00 43.10  ? 338  PHE B CD2 1 
ATOM   6763 C CE1 . PHE B 1 338 ? 9.338   -1.988  -32.018 1.00 41.04  ? 338  PHE B CE1 1 
ATOM   6764 C CE2 . PHE B 1 338 ? 10.672  -3.358  -33.496 1.00 42.20  ? 338  PHE B CE2 1 
ATOM   6765 C CZ  . PHE B 1 338 ? 9.862   -2.244  -33.282 1.00 41.70  ? 338  PHE B CZ  1 
ATOM   6766 N N   . LEU B 1 339 ? 9.944   -7.194  -27.905 1.00 48.19  ? 339  LEU B N   1 
ATOM   6767 C CA  . LEU B 1 339 ? 10.567  -8.075  -26.930 1.00 49.79  ? 339  LEU B CA  1 
ATOM   6768 C C   . LEU B 1 339 ? 10.464  -9.553  -27.299 1.00 51.22  ? 339  LEU B C   1 
ATOM   6769 O O   . LEU B 1 339 ? 11.314  -10.343 -26.916 1.00 52.94  ? 339  LEU B O   1 
ATOM   6770 C CB  . LEU B 1 339 ? 9.999   -7.818  -25.525 1.00 50.02  ? 339  LEU B CB  1 
ATOM   6771 C CG  . LEU B 1 339 ? 10.178  -6.394  -24.984 1.00 48.70  ? 339  LEU B CG  1 
ATOM   6772 C CD1 . LEU B 1 339 ? 9.622   -6.232  -23.585 1.00 48.30  ? 339  LEU B CD1 1 
ATOM   6773 C CD2 . LEU B 1 339 ? 11.644  -6.012  -25.003 1.00 49.34  ? 339  LEU B CD2 1 
ATOM   6774 N N   . VAL B 1 340 ? 9.430   -9.916  -28.046 1.00 51.49  ? 340  VAL B N   1 
ATOM   6775 C CA  . VAL B 1 340 ? 9.140   -11.325 -28.345 1.00 53.41  ? 340  VAL B CA  1 
ATOM   6776 C C   . VAL B 1 340 ? 9.953   -11.819 -29.538 1.00 53.97  ? 340  VAL B C   1 
ATOM   6777 O O   . VAL B 1 340 ? 9.918   -13.005 -29.878 1.00 55.70  ? 340  VAL B O   1 
ATOM   6778 C CB  . VAL B 1 340 ? 7.624   -11.563 -28.609 1.00 53.46  ? 340  VAL B CB  1 
ATOM   6779 C CG1 . VAL B 1 340 ? 6.788   -11.064 -27.444 1.00 53.29  ? 340  VAL B CG1 1 
ATOM   6780 C CG2 . VAL B 1 340 ? 7.175   -10.884 -29.889 1.00 51.30  ? 340  VAL B CG2 1 
ATOM   6781 N N   . TYR B 1 341 ? 10.669  -10.885 -30.165 1.00 53.16  ? 341  TYR B N   1 
ATOM   6782 C CA  . TYR B 1 341 ? 11.519  -11.147 -31.315 1.00 53.19  ? 341  TYR B CA  1 
ATOM   6783 C C   . TYR B 1 341 ? 12.987  -11.372 -30.913 1.00 54.33  ? 341  TYR B C   1 
ATOM   6784 O O   . TYR B 1 341 ? 13.901  -11.070 -31.694 1.00 54.76  ? 341  TYR B O   1 
ATOM   6785 C CB  . TYR B 1 341 ? 11.377  -10.015 -32.353 1.00 51.29  ? 341  TYR B CB  1 
ATOM   6786 C CG  . TYR B 1 341 ? 10.085  -10.128 -33.153 1.00 51.89  ? 341  TYR B CG  1 
ATOM   6787 C CD1 . TYR B 1 341 ? 8.905   -9.511  -32.722 1.00 49.26  ? 341  TYR B CD1 1 
ATOM   6788 C CD2 . TYR B 1 341 ? 10.039  -10.894 -34.323 1.00 52.32  ? 341  TYR B CD2 1 
ATOM   6789 C CE1 . TYR B 1 341 ? 7.716   -9.651  -33.444 1.00 50.85  ? 341  TYR B CE1 1 
ATOM   6790 C CE2 . TYR B 1 341 ? 8.866   -11.037 -35.049 1.00 52.97  ? 341  TYR B CE2 1 
ATOM   6791 C CZ  . TYR B 1 341 ? 7.702   -10.418 -34.613 1.00 53.23  ? 341  TYR B CZ  1 
ATOM   6792 O OH  . TYR B 1 341 ? 6.539   -10.583 -35.358 1.00 54.16  ? 341  TYR B OH  1 
ATOM   6793 N N   . GLY B 1 342 ? 13.220  -11.903 -29.710 1.00 55.38  ? 342  GLY B N   1 
ATOM   6794 C CA  . GLY B 1 342 ? 14.584  -12.195 -29.287 1.00 56.21  ? 342  GLY B CA  1 
ATOM   6795 C C   . GLY B 1 342 ? 14.931  -12.192 -27.807 1.00 57.30  ? 342  GLY B C   1 
ATOM   6796 O O   . GLY B 1 342 ? 16.018  -12.652 -27.423 1.00 58.92  ? 342  GLY B O   1 
ATOM   6797 N N   . VAL B 1 343 ? 14.043  -11.680 -26.962 1.00 56.56  ? 343  VAL B N   1 
ATOM   6798 C CA  . VAL B 1 343 ? 14.347  -11.652 -25.534 1.00 57.19  ? 343  VAL B CA  1 
ATOM   6799 C C   . VAL B 1 343 ? 13.821  -12.891 -24.810 1.00 59.14  ? 343  VAL B C   1 
ATOM   6800 O O   . VAL B 1 343 ? 12.610  -13.070 -24.667 1.00 59.32  ? 343  VAL B O   1 
ATOM   6801 C CB  . VAL B 1 343 ? 13.865  -10.354 -24.828 1.00 56.06  ? 343  VAL B CB  1 
ATOM   6802 C CG1 . VAL B 1 343 ? 14.486  -10.265 -23.422 1.00 55.86  ? 343  VAL B CG1 1 
ATOM   6803 C CG2 . VAL B 1 343 ? 14.237  -9.114  -25.640 1.00 53.41  ? 343  VAL B CG2 1 
ATOM   6804 N N   . PRO B 1 344 ? 14.729  -13.757 -24.343 1.00 60.87  ? 344  PRO B N   1 
ATOM   6805 C CA  . PRO B 1 344 ? 14.215  -14.940 -23.652 1.00 63.05  ? 344  PRO B CA  1 
ATOM   6806 C C   . PRO B 1 344 ? 13.240  -14.526 -22.548 1.00 63.34  ? 344  PRO B C   1 
ATOM   6807 O O   . PRO B 1 344 ? 13.507  -13.554 -21.813 1.00 62.07  ? 344  PRO B O   1 
ATOM   6808 C CB  . PRO B 1 344 ? 15.476  -15.587 -23.057 1.00 64.27  ? 344  PRO B CB  1 
ATOM   6809 C CG  . PRO B 1 344 ? 16.576  -15.154 -23.953 1.00 63.45  ? 344  PRO B CG  1 
ATOM   6810 C CD  . PRO B 1 344 ? 16.203  -13.714 -24.333 1.00 61.48  ? 344  PRO B CD  1 
ATOM   6811 N N   . GLY B 1 345 ? 12.114  -15.248 -22.478 1.00 64.48  ? 345  GLY B N   1 
ATOM   6812 C CA  . GLY B 1 345 ? 11.091  -15.072 -21.447 1.00 64.84  ? 345  GLY B CA  1 
ATOM   6813 C C   . GLY B 1 345 ? 9.825   -14.370 -21.914 1.00 63.79  ? 345  GLY B C   1 
ATOM   6814 O O   . GLY B 1 345 ? 8.835   -14.306 -21.181 1.00 64.57  ? 345  GLY B O   1 
ATOM   6815 N N   . PHE B 1 346 ? 9.846   -13.823 -23.125 1.00 62.09  ? 346  PHE B N   1 
ATOM   6816 C CA  . PHE B 1 346 ? 8.713   -13.044 -23.603 1.00 60.77  ? 346  PHE B CA  1 
ATOM   6817 C C   . PHE B 1 346 ? 7.994   -13.785 -24.705 1.00 61.82  ? 346  PHE B C   1 
ATOM   6818 O O   . PHE B 1 346 ? 8.618   -14.342 -25.613 1.00 61.89  ? 346  PHE B O   1 
ATOM   6819 C CB  . PHE B 1 346 ? 9.159   -11.673 -24.110 1.00 58.19  ? 346  PHE B CB  1 
ATOM   6820 C CG  . PHE B 1 346 ? 9.660   -10.749 -23.025 1.00 56.98  ? 346  PHE B CG  1 
ATOM   6821 C CD1 . PHE B 1 346 ? 10.946  -10.875 -22.517 1.00 56.37  ? 346  PHE B CD1 1 
ATOM   6822 C CD2 . PHE B 1 346 ? 8.842   -9.748  -22.517 1.00 54.78  ? 346  PHE B CD2 1 
ATOM   6823 C CE1 . PHE B 1 346 ? 11.402  -10.021 -21.517 1.00 56.57  ? 346  PHE B CE1 1 
ATOM   6824 C CE2 . PHE B 1 346 ? 9.293   -8.900  -21.520 1.00 53.92  ? 346  PHE B CE2 1 
ATOM   6825 C CZ  . PHE B 1 346 ? 10.576  -9.028  -21.023 1.00 54.38  ? 346  PHE B CZ  1 
ATOM   6826 N N   . SER B 1 347 ? 6.670   -13.794 -24.607 1.00 62.69  ? 347  SER B N   1 
ATOM   6827 C CA  . SER B 1 347 ? 5.808   -14.394 -25.604 1.00 63.26  ? 347  SER B CA  1 
ATOM   6828 C C   . SER B 1 347 ? 4.504   -13.626 -25.577 1.00 62.77  ? 347  SER B C   1 
ATOM   6829 O O   . SER B 1 347 ? 4.158   -13.029 -24.553 1.00 63.05  ? 347  SER B O   1 
ATOM   6830 C CB  . SER B 1 347 ? 5.566   -15.867 -25.265 1.00 66.03  ? 347  SER B CB  1 
ATOM   6831 O OG  . SER B 1 347 ? 4.458   -16.387 -25.988 1.00 67.28  ? 347  SER B OG  1 
ATOM   6832 N N   . LYS B 1 348 ? 3.783   -13.633 -26.695 1.00 62.64  ? 348  LYS B N   1 
ATOM   6833 C CA  . LYS B 1 348 ? 2.468   -12.999 -26.770 1.00 62.74  ? 348  LYS B CA  1 
ATOM   6834 C C   . LYS B 1 348 ? 1.380   -13.872 -26.141 1.00 65.79  ? 348  LYS B C   1 
ATOM   6835 O O   . LYS B 1 348 ? 0.296   -13.383 -25.834 1.00 66.17  ? 348  LYS B O   1 
ATOM   6836 C CB  . LYS B 1 348 ? 2.107   -12.679 -28.221 1.00 61.13  ? 348  LYS B CB  1 
ATOM   6837 C CG  . LYS B 1 348 ? 1.511   -13.848 -28.987 1.00 62.32  ? 348  LYS B CG  1 
ATOM   6838 C CD  . LYS B 1 348 ? 0.951   -13.395 -30.318 1.00 60.71  ? 348  LYS B CD  1 
ATOM   6839 C CE  . LYS B 1 348 ? 0.293   -14.529 -31.061 1.00 60.56  ? 348  LYS B CE  1 
ATOM   6840 N NZ  . LYS B 1 348 ? -0.997  -14.873 -30.420 1.00 62.81  ? 348  LYS B NZ  1 
ATOM   6841 N N   . ASP B 1 349 ? 1.677   -15.156 -25.951 1.00 68.40  ? 349  ASP B N   1 
ATOM   6842 C CA  . ASP B 1 349 ? 0.667   -16.144 -25.550 1.00 71.99  ? 349  ASP B CA  1 
ATOM   6843 C C   . ASP B 1 349 ? 0.585   -16.392 -24.029 1.00 74.23  ? 349  ASP B C   1 
ATOM   6844 O O   . ASP B 1 349 ? -0.151  -17.275 -23.572 1.00 76.64  ? 349  ASP B O   1 
ATOM   6845 C CB  . ASP B 1 349 ? 0.872   -17.468 -26.324 1.00 73.32  ? 349  ASP B CB  1 
ATOM   6846 C CG  . ASP B 1 349 ? 0.646   -17.311 -27.834 1.00 72.83  ? 349  ASP B CG  1 
ATOM   6847 O OD1 . ASP B 1 349 ? -0.240  -16.508 -28.215 1.00 71.83  ? 349  ASP B OD1 1 
ATOM   6848 O OD2 . ASP B 1 349 ? 1.354   -17.981 -28.635 1.00 72.99  ? 349  ASP B OD2 1 
ATOM   6849 N N   . ASN B 1 350 ? 1.351   -15.619 -23.262 1.00 73.57  ? 350  ASN B N   1 
ATOM   6850 C CA  . ASN B 1 350 ? 1.297   -15.641 -21.799 1.00 75.10  ? 350  ASN B CA  1 
ATOM   6851 C C   . ASN B 1 350 ? 1.637   -14.243 -21.284 1.00 72.81  ? 350  ASN B C   1 
ATOM   6852 O O   . ASN B 1 350 ? 1.915   -13.340 -22.074 1.00 70.76  ? 350  ASN B O   1 
ATOM   6853 C CB  . ASN B 1 350 ? 2.222   -16.733 -21.204 1.00 77.08  ? 350  ASN B CB  1 
ATOM   6854 C CG  . ASN B 1 350 ? 3.725   -16.402 -21.318 1.00 77.68  ? 350  ASN B CG  1 
ATOM   6855 O OD1 . ASN B 1 350 ? 4.144   -15.232 -21.316 1.00 77.32  ? 350  ASN B OD1 1 
ATOM   6856 N ND2 . ASN B 1 350 ? 4.539   -17.444 -21.386 1.00 80.64  ? 350  ASN B ND2 1 
ATOM   6857 N N   . GLU B 1 351 ? 1.652   -14.062 -19.971 1.00 73.39  ? 351  GLU B N   1 
ATOM   6858 C CA  . GLU B 1 351 ? 1.863   -12.725 -19.413 1.00 71.38  ? 351  GLU B CA  1 
ATOM   6859 C C   . GLU B 1 351 ? 3.316   -12.207 -19.329 1.00 68.68  ? 351  GLU B C   1 
ATOM   6860 O O   . GLU B 1 351 ? 3.532   -11.047 -18.981 1.00 67.03  ? 351  GLU B O   1 
ATOM   6861 C CB  . GLU B 1 351 ? 1.134   -12.593 -18.084 1.00 73.26  ? 351  GLU B CB  1 
ATOM   6862 C CG  . GLU B 1 351 ? -0.340  -12.310 -18.261 1.00 76.37  ? 351  GLU B CG  1 
ATOM   6863 C CD  . GLU B 1 351 ? -0.823  -11.261 -17.281 1.00 81.53  ? 351  GLU B CD  1 
ATOM   6864 O OE1 . GLU B 1 351 ? -1.453  -11.657 -16.263 1.00 84.58  ? 351  GLU B OE1 1 
ATOM   6865 O OE2 . GLU B 1 351 ? -0.540  -10.050 -17.516 1.00 79.98  ? 351  GLU B OE2 1 
ATOM   6866 N N   . SER B 1 352 ? 4.282   -13.067 -19.660 1.00 68.17  ? 352  SER B N   1 
ATOM   6867 C CA  . SER B 1 352 ? 5.711   -12.719 -19.769 1.00 66.15  ? 352  SER B CA  1 
ATOM   6868 C C   . SER B 1 352 ? 6.340   -12.132 -18.519 1.00 65.80  ? 352  SER B C   1 
ATOM   6869 O O   . SER B 1 352 ? 7.078   -11.145 -18.595 1.00 64.28  ? 352  SER B O   1 
ATOM   6870 C CB  . SER B 1 352 ? 5.953   -11.767 -20.938 1.00 63.53  ? 352  SER B CB  1 
ATOM   6871 O OG  . SER B 1 352 ? 5.737   -12.414 -22.166 1.00 64.07  ? 352  SER B OG  1 
ATOM   6872 N N   . LEU B 1 353 ? 6.051   -12.735 -17.377 1.00 67.30  ? 353  LEU B N   1 
ATOM   6873 C CA  . LEU B 1 353 ? 6.574   -12.266 -16.106 1.00 67.65  ? 353  LEU B CA  1 
ATOM   6874 C C   . LEU B 1 353 ? 7.996   -12.786 -15.959 1.00 68.22  ? 353  LEU B C   1 
ATOM   6875 O O   . LEU B 1 353 ? 8.206   -13.990 -15.855 1.00 70.19  ? 353  LEU B O   1 
ATOM   6876 C CB  . LEU B 1 353 ? 5.696   -12.767 -14.951 1.00 69.93  ? 353  LEU B CB  1 
ATOM   6877 C CG  . LEU B 1 353 ? 4.188   -12.456 -14.944 1.00 70.21  ? 353  LEU B CG  1 
ATOM   6878 C CD1 . LEU B 1 353 ? 3.522   -13.032 -13.689 1.00 73.04  ? 353  LEU B CD1 1 
ATOM   6879 C CD2 . LEU B 1 353 ? 3.905   -10.952 -15.054 1.00 68.13  ? 353  LEU B CD2 1 
ATOM   6880 N N   . ILE B 1 354 ? 8.974   -11.885 -15.947 1.00 66.77  ? 354  ILE B N   1 
ATOM   6881 C CA  . ILE B 1 354 ? 10.388  -12.293 -15.959 1.00 67.00  ? 354  ILE B CA  1 
ATOM   6882 C C   . ILE B 1 354 ? 11.112  -12.182 -14.613 1.00 68.54  ? 354  ILE B C   1 
ATOM   6883 O O   . ILE B 1 354 ? 10.677  -11.460 -13.718 1.00 68.07  ? 354  ILE B O   1 
ATOM   6884 C CB  . ILE B 1 354 ? 11.192  -11.535 -17.023 1.00 64.60  ? 354  ILE B CB  1 
ATOM   6885 C CG1 . ILE B 1 354 ? 10.848  -10.039 -16.996 1.00 62.01  ? 354  ILE B CG1 1 
ATOM   6886 C CG2 . ILE B 1 354 ? 10.897  -12.113 -18.384 1.00 64.20  ? 354  ILE B CG2 1 
ATOM   6887 C CD1 . ILE B 1 354 ? 12.006  -9.119  -17.333 1.00 59.72  ? 354  ILE B CD1 1 
ATOM   6888 N N   . SER B 1 355 ? 12.212  -12.931 -14.496 1.00 70.27  ? 355  SER B N   1 
ATOM   6889 C CA  . SER B 1 355 ? 13.130  -12.863 -13.356 1.00 71.83  ? 355  SER B CA  1 
ATOM   6890 C C   . SER B 1 355 ? 14.040  -11.631 -13.497 1.00 70.17  ? 355  SER B C   1 
ATOM   6891 O O   . SER B 1 355 ? 14.125  -11.032 -14.584 1.00 68.03  ? 355  SER B O   1 
ATOM   6892 C CB  . SER B 1 355 ? 14.006  -14.123 -13.319 1.00 73.92  ? 355  SER B CB  1 
ATOM   6893 O OG  . SER B 1 355 ? 15.009  -14.041 -14.331 1.00 72.97  ? 355  SER B OG  1 
ATOM   6894 N N   . ARG B 1 356 ? 14.740  -11.274 -12.419 1.00 71.03  ? 356  ARG B N   1 
ATOM   6895 C CA  . ARG B 1 356 ? 15.788  -10.260 -12.514 1.00 70.11  ? 356  ARG B CA  1 
ATOM   6896 C C   . ARG B 1 356 ? 16.903  -10.673 -13.488 1.00 69.74  ? 356  ARG B C   1 
ATOM   6897 O O   . ARG B 1 356 ? 17.370  -9.858  -14.292 1.00 68.06  ? 356  ARG B O   1 
ATOM   6898 C CB  . ARG B 1 356 ? 16.374  -9.943  -11.144 1.00 71.92  ? 356  ARG B CB  1 
ATOM   6899 C CG  . ARG B 1 356 ? 17.382  -8.796  -11.176 1.00 72.60  ? 356  ARG B CG  1 
ATOM   6900 C CD  . ARG B 1 356 ? 17.470  -8.063  -9.838  1.00 75.45  ? 356  ARG B CD  1 
ATOM   6901 N NE  . ARG B 1 356 ? 18.468  -6.999  -9.898  1.00 76.96  ? 356  ARG B NE  1 
ATOM   6902 C CZ  . ARG B 1 356 ? 18.245  -5.765  -10.359 1.00 76.28  ? 356  ARG B CZ  1 
ATOM   6903 N NH1 . ARG B 1 356 ? 17.040  -5.403  -10.807 1.00 74.07  ? 356  ARG B NH1 1 
ATOM   6904 N NH2 . ARG B 1 356 ? 19.240  -4.883  -10.367 1.00 75.79  ? 356  ARG B NH2 1 
ATOM   6905 N N   . ALA B 1 357 ? 17.309  -11.941 -13.424 1.00 71.18  ? 357  ALA B N   1 
ATOM   6906 C CA  . ALA B 1 357 ? 18.388  -12.442 -14.261 1.00 70.85  ? 357  ALA B CA  1 
ATOM   6907 C C   . ALA B 1 357 ? 18.006  -12.292 -15.719 1.00 68.50  ? 357  ALA B C   1 
ATOM   6908 O O   . ALA B 1 357 ? 18.823  -11.886 -16.540 1.00 67.45  ? 357  ALA B O   1 
ATOM   6909 C CB  . ALA B 1 357 ? 18.709  -13.903 -13.917 1.00 73.33  ? 357  ALA B CB  1 
ATOM   6910 N N   . GLN B 1 358 ? 16.749  -12.601 -16.024 1.00 67.91  ? 358  GLN B N   1 
ATOM   6911 C CA  . GLN B 1 358 ? 16.215  -12.458 -17.376 1.00 65.88  ? 358  GLN B CA  1 
ATOM   6912 C C   . GLN B 1 358 ? 16.195  -10.997 -17.813 1.00 63.02  ? 358  GLN B C   1 
ATOM   6913 O O   . GLN B 1 358 ? 16.285  -10.691 -19.002 1.00 61.37  ? 358  GLN B O   1 
ATOM   6914 C CB  . GLN B 1 358 ? 14.811  -13.054 -17.459 1.00 66.28  ? 358  GLN B CB  1 
ATOM   6915 C CG  . GLN B 1 358 ? 14.784  -14.561 -17.667 1.00 68.97  ? 358  GLN B CG  1 
ATOM   6916 C CD  . GLN B 1 358 ? 13.395  -15.166 -17.418 1.00 71.63  ? 358  GLN B CD  1 
ATOM   6917 O OE1 . GLN B 1 358 ? 12.716  -14.808 -16.443 1.00 73.20  ? 358  GLN B OE1 1 
ATOM   6918 N NE2 . GLN B 1 358 ? 12.975  -16.089 -18.290 1.00 69.54  ? 358  GLN B NE2 1 
ATOM   6919 N N   . PHE B 1 359 ? 16.080  -10.092 -16.850 1.00 62.65  ? 359  PHE B N   1 
ATOM   6920 C CA  . PHE B 1 359 ? 16.132  -8.659  -17.160 1.00 60.39  ? 359  PHE B CA  1 
ATOM   6921 C C   . PHE B 1 359 ? 17.549  -8.209  -17.540 1.00 60.04  ? 359  PHE B C   1 
ATOM   6922 O O   . PHE B 1 359 ? 17.718  -7.614  -18.595 1.00 58.56  ? 359  PHE B O   1 
ATOM   6923 C CB  . PHE B 1 359 ? 15.508  -7.831  -16.031 1.00 60.21  ? 359  PHE B CB  1 
ATOM   6924 C CG  . PHE B 1 359 ? 15.648  -6.343  -16.194 1.00 57.82  ? 359  PHE B CG  1 
ATOM   6925 C CD1 . PHE B 1 359 ? 16.254  -5.580  -15.197 1.00 57.27  ? 359  PHE B CD1 1 
ATOM   6926 C CD2 . PHE B 1 359 ? 15.162  -5.692  -17.323 1.00 55.46  ? 359  PHE B CD2 1 
ATOM   6927 C CE1 . PHE B 1 359 ? 16.380  -4.209  -15.333 1.00 54.72  ? 359  PHE B CE1 1 
ATOM   6928 C CE2 . PHE B 1 359 ? 15.295  -4.308  -17.465 1.00 52.01  ? 359  PHE B CE2 1 
ATOM   6929 C CZ  . PHE B 1 359 ? 15.899  -3.573  -16.469 1.00 52.27  ? 359  PHE B CZ  1 
ATOM   6930 N N   . LEU B 1 360 ? 18.562  -8.528  -16.732 1.00 61.88  ? 360  LEU B N   1 
ATOM   6931 C CA  . LEU B 1 360 ? 19.940  -8.133  -17.070 1.00 62.30  ? 360  LEU B CA  1 
ATOM   6932 C C   . LEU B 1 360 ? 20.322  -8.691  -18.432 1.00 62.03  ? 360  LEU B C   1 
ATOM   6933 O O   . LEU B 1 360 ? 20.945  -7.993  -19.238 1.00 61.00  ? 360  LEU B O   1 
ATOM   6934 C CB  . LEU B 1 360 ? 20.975  -8.570  -16.021 1.00 64.55  ? 360  LEU B CB  1 
ATOM   6935 C CG  . LEU B 1 360 ? 20.704  -8.482  -14.502 1.00 67.81  ? 360  LEU B CG  1 
ATOM   6936 C CD1 . LEU B 1 360 ? 21.981  -8.700  -13.644 1.00 71.13  ? 360  LEU B CD1 1 
ATOM   6937 C CD2 . LEU B 1 360 ? 20.021  -7.191  -14.072 1.00 66.79  ? 360  LEU B CD2 1 
ATOM   6938 N N   . ALA B 1 361 ? 19.928  -9.938  -18.689 1.00 62.92  ? 361  ALA B N   1 
ATOM   6939 C CA  . ALA B 1 361 ? 20.246  -10.605 -19.953 1.00 63.11  ? 361  ALA B CA  1 
ATOM   6940 C C   . ALA B 1 361 ? 19.556  -9.942  -21.126 1.00 60.93  ? 361  ALA B C   1 
ATOM   6941 O O   . ALA B 1 361 ? 20.136  -9.826  -22.203 1.00 60.65  ? 361  ALA B O   1 
ATOM   6942 C CB  . ALA B 1 361 ? 19.891  -12.098 -19.898 1.00 64.62  ? 361  ALA B CB  1 
ATOM   6943 N N   . GLY B 1 362 ? 18.315  -9.509  -20.909 1.00 60.34  ? 362  GLY B N   1 
ATOM   6944 C CA  . GLY B 1 362 ? 17.525  -8.814  -21.934 1.00 58.13  ? 362  GLY B CA  1 
ATOM   6945 C C   . GLY B 1 362 ? 18.057  -7.436  -22.284 1.00 56.87  ? 362  GLY B C   1 
ATOM   6946 O O   . GLY B 1 362 ? 17.920  -6.983  -23.424 1.00 55.15  ? 362  GLY B O   1 
ATOM   6947 N N   . VAL B 1 363 ? 18.674  -6.771  -21.302 1.00 57.67  ? 363  VAL B N   1 
ATOM   6948 C CA  . VAL B 1 363 ? 19.294  -5.448  -21.513 1.00 56.46  ? 363  VAL B CA  1 
ATOM   6949 C C   . VAL B 1 363 ? 20.473  -5.510  -22.501 1.00 56.74  ? 363  VAL B C   1 
ATOM   6950 O O   . VAL B 1 363 ? 20.594  -4.631  -23.362 1.00 55.66  ? 363  VAL B O   1 
ATOM   6951 C CB  . VAL B 1 363 ? 19.659  -4.762  -20.164 1.00 57.04  ? 363  VAL B CB  1 
ATOM   6952 C CG1 . VAL B 1 363 ? 20.578  -3.559  -20.356 1.00 55.30  ? 363  VAL B CG1 1 
ATOM   6953 C CG2 . VAL B 1 363 ? 18.388  -4.359  -19.436 1.00 56.24  ? 363  VAL B CG2 1 
ATOM   6954 N N   . ARG B 1 364 ? 21.299  -6.556  -22.419 1.00 58.43  ? 364  ARG B N   1 
ATOM   6955 C CA  . ARG B 1 364 ? 22.417  -6.701  -23.346 1.00 59.38  ? 364  ARG B CA  1 
ATOM   6956 C C   . ARG B 1 364 ? 21.907  -6.856  -24.768 1.00 58.62  ? 364  ARG B C   1 
ATOM   6957 O O   . ARG B 1 364 ? 22.656  -6.624  -25.719 1.00 58.59  ? 364  ARG B O   1 
ATOM   6958 C CB  . ARG B 1 364 ? 23.296  -7.902  -23.009 1.00 61.84  ? 364  ARG B CB  1 
ATOM   6959 C CG  . ARG B 1 364 ? 23.807  -7.990  -21.570 1.00 65.38  ? 364  ARG B CG  1 
ATOM   6960 C CD  . ARG B 1 364 ? 24.377  -6.675  -21.029 1.00 67.99  ? 364  ARG B CD  1 
ATOM   6961 N NE  . ARG B 1 364 ? 25.603  -6.222  -21.705 1.00 70.46  ? 364  ARG B NE  1 
ATOM   6962 C CZ  . ARG B 1 364 ? 26.847  -6.514  -21.307 1.00 73.02  ? 364  ARG B CZ  1 
ATOM   6963 N NH1 . ARG B 1 364 ? 27.061  -7.284  -20.242 1.00 73.02  ? 364  ARG B NH1 1 
ATOM   6964 N NH2 . ARG B 1 364 ? 27.887  -6.034  -21.985 1.00 72.84  ? 364  ARG B NH2 1 
ATOM   6965 N N   . ILE B 1 365 ? 20.632  -7.241  -24.903 1.00 58.18  ? 365  ILE B N   1 
ATOM   6966 C CA  . ILE B 1 365 ? 19.995  -7.520  -26.203 1.00 56.90  ? 365  ILE B CA  1 
ATOM   6967 C C   . ILE B 1 365 ? 19.205  -6.299  -26.688 1.00 55.22  ? 365  ILE B C   1 
ATOM   6968 O O   . ILE B 1 365 ? 19.099  -6.040  -27.895 1.00 53.81  ? 365  ILE B O   1 
ATOM   6969 C CB  . ILE B 1 365 ? 19.101  -8.826  -26.133 1.00 57.84  ? 365  ILE B CB  1 
ATOM   6970 C CG1 . ILE B 1 365 ? 19.985  -10.068 -25.947 1.00 59.51  ? 365  ILE B CG1 1 
ATOM   6971 C CG2 . ILE B 1 365 ? 18.192  -8.995  -27.357 1.00 55.72  ? 365  ILE B CG2 1 
ATOM   6972 C CD1 . ILE B 1 365 ? 19.222  -11.383 -25.872 1.00 60.86  ? 365  ILE B CD1 1 
ATOM   6973 N N   . GLY B 1 366 ? 18.664  -5.546  -25.735 1.00 55.26  ? 366  GLY B N   1 
ATOM   6974 C CA  . GLY B 1 366 ? 17.946  -4.304  -26.037 1.00 54.25  ? 366  GLY B CA  1 
ATOM   6975 C C   . GLY B 1 366 ? 18.905  -3.160  -26.316 1.00 54.02  ? 366  GLY B C   1 
ATOM   6976 O O   . GLY B 1 366 ? 18.599  -2.258  -27.107 1.00 53.37  ? 366  GLY B O   1 
ATOM   6977 N N   . VAL B 1 367 ? 20.066  -3.207  -25.666 1.00 54.93  ? 367  VAL B N   1 
ATOM   6978 C CA  . VAL B 1 367 ? 21.111  -2.217  -25.864 1.00 54.94  ? 367  VAL B CA  1 
ATOM   6979 C C   . VAL B 1 367 ? 22.357  -2.998  -26.240 1.00 56.88  ? 367  VAL B C   1 
ATOM   6980 O O   . VAL B 1 367 ? 23.296  -3.144  -25.450 1.00 58.40  ? 367  VAL B O   1 
ATOM   6981 C CB  . VAL B 1 367 ? 21.330  -1.335  -24.611 1.00 54.98  ? 367  VAL B CB  1 
ATOM   6982 C CG1 . VAL B 1 367 ? 22.047  -0.077  -24.984 1.00 53.26  ? 367  VAL B CG1 1 
ATOM   6983 C CG2 . VAL B 1 367 ? 19.997  -0.990  -23.963 1.00 53.68  ? 367  VAL B CG2 1 
ATOM   6984 N N   . PRO B 1 368 ? 22.356  -3.530  -27.466 1.00 57.28  ? 368  PRO B N   1 
ATOM   6985 C CA  . PRO B 1 368 ? 23.392  -4.451  -27.935 1.00 58.89  ? 368  PRO B CA  1 
ATOM   6986 C C   . PRO B 1 368 ? 24.790  -3.859  -27.992 1.00 60.49  ? 368  PRO B C   1 
ATOM   6987 O O   . PRO B 1 368 ? 25.764  -4.603  -28.083 1.00 62.14  ? 368  PRO B O   1 
ATOM   6988 C CB  . PRO B 1 368 ? 22.920  -4.828  -29.342 1.00 57.87  ? 368  PRO B CB  1 
ATOM   6989 C CG  . PRO B 1 368 ? 21.880  -3.824  -29.707 1.00 56.13  ? 368  PRO B CG  1 
ATOM   6990 C CD  . PRO B 1 368 ? 21.268  -3.361  -28.447 1.00 55.30  ? 368  PRO B CD  1 
ATOM   6991 N N   . GLN B 1 369 ? 24.900  -2.541  -27.924 1.00 61.01  ? 369  GLN B N   1 
ATOM   6992 C CA  . GLN B 1 369 ? 26.200  -1.889  -28.090 1.00 63.55  ? 369  GLN B CA  1 
ATOM   6993 C C   . GLN B 1 369 ? 26.791  -1.506  -26.756 1.00 64.86  ? 369  GLN B C   1 
ATOM   6994 O O   . GLN B 1 369 ? 27.902  -0.969  -26.698 1.00 66.15  ? 369  GLN B O   1 
ATOM   6995 C CB  . GLN B 1 369 ? 26.097  -0.654  -28.989 1.00 62.57  ? 369  GLN B CB  1 
ATOM   6996 C CG  . GLN B 1 369 ? 25.405  0.551   -28.329 1.00 65.19  ? 369  GLN B CG  1 
ATOM   6997 C CD  . GLN B 1 369 ? 23.862  0.505   -28.373 1.00 67.35  ? 369  GLN B CD  1 
ATOM   6998 O OE1 . GLN B 1 369 ? 23.205  1.488   -28.030 1.00 67.09  ? 369  GLN B OE1 1 
ATOM   6999 N NE2 . GLN B 1 369 ? 23.288  -0.637  -28.783 1.00 68.14  ? 369  GLN B NE2 1 
ATOM   7000 N N   . ALA B 1 370 ? 26.050  -1.798  -25.689 1.00 65.15  ? 370  ALA B N   1 
ATOM   7001 C CA  . ALA B 1 370 ? 26.417  -1.367  -24.345 1.00 65.96  ? 370  ALA B CA  1 
ATOM   7002 C C   . ALA B 1 370 ? 27.488  -2.239  -23.735 1.00 68.15  ? 370  ALA B C   1 
ATOM   7003 O O   . ALA B 1 370 ? 27.412  -3.465  -23.811 1.00 69.30  ? 370  ALA B O   1 
ATOM   7004 C CB  . ALA B 1 370 ? 25.188  -1.344  -23.447 1.00 65.26  ? 370  ALA B CB  1 
ATOM   7005 N N   . SER B 1 371 ? 28.481  -1.597  -23.125 1.00 69.26  ? 371  SER B N   1 
ATOM   7006 C CA  . SER B 1 371 ? 29.506  -2.294  -22.360 1.00 71.70  ? 371  SER B CA  1 
ATOM   7007 C C   . SER B 1 371 ? 28.912  -2.798  -21.039 1.00 72.21  ? 371  SER B C   1 
ATOM   7008 O O   . SER B 1 371 ? 27.774  -2.467  -20.706 1.00 71.15  ? 371  SER B O   1 
ATOM   7009 C CB  . SER B 1 371 ? 30.684  -1.361  -22.099 1.00 72.89  ? 371  SER B CB  1 
ATOM   7010 O OG  . SER B 1 371 ? 30.266  -0.230  -21.360 1.00 72.89  ? 371  SER B OG  1 
ATOM   7011 N N   . ASP B 1 372 ? 29.666  -3.596  -20.289 1.00 73.95  ? 372  ASP B N   1 
ATOM   7012 C CA  . ASP B 1 372 ? 29.152  -4.132  -19.027 1.00 74.68  ? 372  ASP B CA  1 
ATOM   7013 C C   . ASP B 1 372 ? 28.716  -2.994  -18.113 1.00 73.33  ? 372  ASP B C   1 
ATOM   7014 O O   . ASP B 1 372 ? 27.624  -3.029  -17.538 1.00 72.73  ? 372  ASP B O   1 
ATOM   7015 C CB  . ASP B 1 372 ? 30.196  -5.010  -18.326 1.00 77.57  ? 372  ASP B CB  1 
ATOM   7016 C CG  . ASP B 1 372 ? 30.753  -6.100  -19.234 1.00 79.90  ? 372  ASP B CG  1 
ATOM   7017 O OD1 . ASP B 1 372 ? 30.269  -6.255  -20.381 1.00 79.67  ? 372  ASP B OD1 1 
ATOM   7018 O OD2 . ASP B 1 372 ? 31.687  -6.803  -18.798 1.00 83.36  ? 372  ASP B OD2 1 
ATOM   7019 N N   . LEU B 1 373 ? 29.571  -1.979  -18.011 1.00 72.49  ? 373  LEU B N   1 
ATOM   7020 C CA  . LEU B 1 373 ? 29.321  -0.838  -17.159 1.00 70.91  ? 373  LEU B CA  1 
ATOM   7021 C C   . LEU B 1 373 ? 28.063  -0.084  -17.576 1.00 68.11  ? 373  LEU B C   1 
ATOM   7022 O O   . LEU B 1 373 ? 27.244  0.286   -16.731 1.00 67.31  ? 373  LEU B O   1 
ATOM   7023 C CB  . LEU B 1 373 ? 30.531  0.091   -17.173 1.00 71.58  ? 373  LEU B CB  1 
ATOM   7024 C CG  . LEU B 1 373 ? 30.463  1.377   -16.341 1.00 71.08  ? 373  LEU B CG  1 
ATOM   7025 C CD1 . LEU B 1 373 ? 30.058  1.107   -14.887 1.00 70.55  ? 373  LEU B CD1 1 
ATOM   7026 C CD2 . LEU B 1 373 ? 31.802  2.090   -16.413 1.00 71.56  ? 373  LEU B CD2 1 
ATOM   7027 N N   . ALA B 1 374 ? 27.933  0.139   -18.882 1.00 66.27  ? 374  ALA B N   1 
ATOM   7028 C CA  . ALA B 1 374 ? 26.798  0.843   -19.467 1.00 63.65  ? 374  ALA B CA  1 
ATOM   7029 C C   . ALA B 1 374 ? 25.467  0.111   -19.259 1.00 62.69  ? 374  ALA B C   1 
ATOM   7030 O O   . ALA B 1 374 ? 24.447  0.736   -18.997 1.00 61.37  ? 374  ALA B O   1 
ATOM   7031 C CB  . ALA B 1 374 ? 27.050  1.086   -20.935 1.00 62.60  ? 374  ALA B CB  1 
ATOM   7032 N N   . ALA B 1 375 ? 25.493  -1.213  -19.376 1.00 63.42  ? 375  ALA B N   1 
ATOM   7033 C CA  . ALA B 1 375 ? 24.321  -2.045  -19.162 1.00 62.94  ? 375  ALA B CA  1 
ATOM   7034 C C   . ALA B 1 375 ? 23.973  -2.073  -17.683 1.00 63.97  ? 375  ALA B C   1 
ATOM   7035 O O   . ALA B 1 375 ? 22.807  -2.083  -17.305 1.00 63.96  ? 375  ALA B O   1 
ATOM   7036 C CB  . ALA B 1 375 ? 24.582  -3.429  -19.659 1.00 63.80  ? 375  ALA B CB  1 
ATOM   7037 N N   . GLU B 1 376 ? 24.990  -2.070  -16.839 1.00 65.20  ? 376  GLU B N   1 
ATOM   7038 C CA  . GLU B 1 376 ? 24.758  -1.965  -15.415 1.00 66.17  ? 376  GLU B CA  1 
ATOM   7039 C C   . GLU B 1 376 ? 24.008  -0.660  -15.129 1.00 63.84  ? 376  GLU B C   1 
ATOM   7040 O O   . GLU B 1 376 ? 23.011  -0.660  -14.407 1.00 63.75  ? 376  GLU B O   1 
ATOM   7041 C CB  . GLU B 1 376 ? 26.088  -2.030  -14.664 1.00 68.56  ? 376  GLU B CB  1 
ATOM   7042 C CG  . GLU B 1 376 ? 25.975  -2.417  -13.208 1.00 74.17  ? 376  GLU B CG  1 
ATOM   7043 C CD  . GLU B 1 376 ? 25.296  -3.761  -12.998 1.00 79.81  ? 376  GLU B CD  1 
ATOM   7044 O OE1 . GLU B 1 376 ? 25.478  -4.661  -13.852 1.00 81.81  ? 376  GLU B OE1 1 
ATOM   7045 O OE2 . GLU B 1 376 ? 24.579  -3.910  -11.977 1.00 81.73  ? 376  GLU B OE2 1 
ATOM   7046 N N   . ALA B 1 377 ? 24.474  0.436   -15.730 1.00 61.48  ? 377  ALA B N   1 
ATOM   7047 C CA  . ALA B 1 377 ? 23.839  1.733   -15.569 1.00 59.07  ? 377  ALA B CA  1 
ATOM   7048 C C   . ALA B 1 377 ? 22.390  1.714   -16.026 1.00 57.18  ? 377  ALA B C   1 
ATOM   7049 O O   . ALA B 1 377 ? 21.538  2.305   -15.374 1.00 56.80  ? 377  ALA B O   1 
ATOM   7050 C CB  . ALA B 1 377 ? 24.613  2.811   -16.301 1.00 58.25  ? 377  ALA B CB  1 
ATOM   7051 N N   . VAL B 1 378 ? 22.106  1.043   -17.143 1.00 56.07  ? 378  VAL B N   1 
ATOM   7052 C CA  . VAL B 1 378 ? 20.736  0.911   -17.615 1.00 54.11  ? 378  VAL B CA  1 
ATOM   7053 C C   . VAL B 1 378 ? 19.933  0.155   -16.572 1.00 54.82  ? 378  VAL B C   1 
ATOM   7054 O O   . VAL B 1 378 ? 18.889  0.631   -16.125 1.00 54.43  ? 378  VAL B O   1 
ATOM   7055 C CB  . VAL B 1 378 ? 20.653  0.211   -18.976 1.00 53.62  ? 378  VAL B CB  1 
ATOM   7056 C CG1 . VAL B 1 378 ? 19.206  -0.162  -19.329 1.00 52.05  ? 378  VAL B CG1 1 
ATOM   7057 C CG2 . VAL B 1 378 ? 21.216  1.118   -20.050 1.00 52.96  ? 378  VAL B CG2 1 
ATOM   7058 N N   . VAL B 1 379 ? 20.442  -0.994  -16.151 1.00 55.66  ? 379  VAL B N   1 
ATOM   7059 C CA  . VAL B 1 379 ? 19.736  -1.810  -15.186 1.00 56.55  ? 379  VAL B CA  1 
ATOM   7060 C C   . VAL B 1 379 ? 19.453  -1.049  -13.895 1.00 57.49  ? 379  VAL B C   1 
ATOM   7061 O O   . VAL B 1 379 ? 18.328  -1.076  -13.378 1.00 57.45  ? 379  VAL B O   1 
ATOM   7062 C CB  . VAL B 1 379 ? 20.497  -3.100  -14.867 1.00 58.09  ? 379  VAL B CB  1 
ATOM   7063 C CG1 . VAL B 1 379 ? 19.925  -3.739  -13.639 1.00 58.13  ? 379  VAL B CG1 1 
ATOM   7064 C CG2 . VAL B 1 379 ? 20.418  -4.057  -16.042 1.00 57.77  ? 379  VAL B CG2 1 
ATOM   7065 N N   . LEU B 1 380 ? 20.462  -0.355  -13.386 1.00 58.23  ? 380  LEU B N   1 
ATOM   7066 C CA  . LEU B 1 380 ? 20.319  0.311   -12.111 1.00 59.27  ? 380  LEU B CA  1 
ATOM   7067 C C   . LEU B 1 380 ? 19.313  1.446   -12.176 1.00 58.17  ? 380  LEU B C   1 
ATOM   7068 O O   . LEU B 1 380 ? 18.633  1.723   -11.192 1.00 59.52  ? 380  LEU B O   1 
ATOM   7069 C CB  . LEU B 1 380 ? 21.676  0.747   -11.555 1.00 60.57  ? 380  LEU B CB  1 
ATOM   7070 C CG  . LEU B 1 380 ? 22.643  -0.419  -11.239 1.00 63.15  ? 380  LEU B CG  1 
ATOM   7071 C CD1 . LEU B 1 380 ? 24.002  0.076   -10.818 1.00 64.90  ? 380  LEU B CD1 1 
ATOM   7072 C CD2 . LEU B 1 380 ? 22.119  -1.429  -10.195 1.00 64.03  ? 380  LEU B CD2 1 
ATOM   7073 N N   . HIS B 1 381 ? 19.192  2.070   -13.339 1.00 56.44  ? 381  HIS B N   1 
ATOM   7074 C CA  . HIS B 1 381 ? 18.238  3.158   -13.567 1.00 55.13  ? 381  HIS B CA  1 
ATOM   7075 C C   . HIS B 1 381 ? 16.787  2.688   -13.679 1.00 54.66  ? 381  HIS B C   1 
ATOM   7076 O O   . HIS B 1 381 ? 15.882  3.370   -13.220 1.00 54.61  ? 381  HIS B O   1 
ATOM   7077 C CB  . HIS B 1 381 ? 18.620  3.901   -14.850 1.00 54.00  ? 381  HIS B CB  1 
ATOM   7078 C CG  . HIS B 1 381 ? 17.725  5.051   -15.186 1.00 53.39  ? 381  HIS B CG  1 
ATOM   7079 N ND1 . HIS B 1 381 ? 17.929  6.321   -14.691 1.00 55.09  ? 381  HIS B ND1 1 
ATOM   7080 C CD2 . HIS B 1 381 ? 16.631  5.128   -15.982 1.00 52.87  ? 381  HIS B CD2 1 
ATOM   7081 C CE1 . HIS B 1 381 ? 16.987  7.125   -15.154 1.00 54.16  ? 381  HIS B CE1 1 
ATOM   7082 N NE2 . HIS B 1 381 ? 16.193  6.429   -15.949 1.00 51.69  ? 381  HIS B NE2 1 
ATOM   7083 N N   . TYR B 1 382 ? 16.562  1.541   -14.312 1.00 54.67  ? 382  TYR B N   1 
ATOM   7084 C CA  . TYR B 1 382 ? 15.202  1.082   -14.595 1.00 54.17  ? 382  TYR B CA  1 
ATOM   7085 C C   . TYR B 1 382 ? 14.623  0.178   -13.529 1.00 56.30  ? 382  TYR B C   1 
ATOM   7086 O O   . TYR B 1 382 ? 13.418  -0.079  -13.520 1.00 56.74  ? 382  TYR B O   1 
ATOM   7087 C CB  . TYR B 1 382 ? 15.108  0.409   -15.967 1.00 52.82  ? 382  TYR B CB  1 
ATOM   7088 C CG  . TYR B 1 382 ? 14.982  1.393   -17.107 1.00 49.76  ? 382  TYR B CG  1 
ATOM   7089 C CD1 . TYR B 1 382 ? 16.117  1.906   -17.725 1.00 48.36  ? 382  TYR B CD1 1 
ATOM   7090 C CD2 . TYR B 1 382 ? 13.730  1.815   -17.557 1.00 46.59  ? 382  TYR B CD2 1 
ATOM   7091 C CE1 . TYR B 1 382 ? 16.018  2.816   -18.770 1.00 47.16  ? 382  TYR B CE1 1 
ATOM   7092 C CE2 . TYR B 1 382 ? 13.613  2.711   -18.607 1.00 46.43  ? 382  TYR B CE2 1 
ATOM   7093 C CZ  . TYR B 1 382 ? 14.767  3.212   -19.220 1.00 47.30  ? 382  TYR B CZ  1 
ATOM   7094 O OH  . TYR B 1 382 ? 14.690  4.122   -20.272 1.00 45.96  ? 382  TYR B OH  1 
ATOM   7095 N N   . THR B 1 383 ? 15.468  -0.295  -12.625 1.00 58.32  ? 383  THR B N   1 
ATOM   7096 C CA  . THR B 1 383 ? 14.989  -1.049  -11.487 1.00 60.36  ? 383  THR B CA  1 
ATOM   7097 C C   . THR B 1 383 ? 14.157  -0.158  -10.578 1.00 61.12  ? 383  THR B C   1 
ATOM   7098 O O   . THR B 1 383 ? 14.499  1.002   -10.354 1.00 60.72  ? 383  THR B O   1 
ATOM   7099 C CB  . THR B 1 383 ? 16.152  -1.669  -10.730 1.00 61.81  ? 383  THR B CB  1 
ATOM   7100 O OG1 . THR B 1 383 ? 16.871  -2.515  -11.629 1.00 61.77  ? 383  THR B OG1 1 
ATOM   7101 C CG2 . THR B 1 383 ? 15.663  -2.502  -9.545  1.00 63.51  ? 383  THR B CG2 1 
ATOM   7102 N N   . ASP B 1 384 ? 13.031  -0.695  -10.108 1.00 62.90  ? 384  ASP B N   1 
ATOM   7103 C CA  . ASP B 1 384 ? 12.253  -0.071  -9.031  1.00 64.38  ? 384  ASP B CA  1 
ATOM   7104 C C   . ASP B 1 384 ? 12.810  -0.606  -7.703  1.00 66.18  ? 384  ASP B C   1 
ATOM   7105 O O   . ASP B 1 384 ? 12.536  -1.750  -7.312  1.00 67.02  ? 384  ASP B O   1 
ATOM   7106 C CB  . ASP B 1 384 ? 10.752  -0.381  -9.168  1.00 64.59  ? 384  ASP B CB  1 
ATOM   7107 C CG  . ASP B 1 384 ? 9.879   0.390   -8.154  1.00 68.05  ? 384  ASP B CG  1 
ATOM   7108 O OD1 . ASP B 1 384 ? 10.215  0.452   -6.943  1.00 70.05  ? 384  ASP B OD1 1 
ATOM   7109 O OD2 . ASP B 1 384 ? 8.830   0.927   -8.581  1.00 70.76  ? 384  ASP B OD2 1 
ATOM   7110 N N   . TRP B 1 385 ? 13.586  0.230   -7.014  1.00 66.11  ? 385  TRP B N   1 
ATOM   7111 C CA  . TRP B 1 385 ? 14.305  -0.227  -5.822  1.00 67.95  ? 385  TRP B CA  1 
ATOM   7112 C C   . TRP B 1 385 ? 13.406  -0.539  -4.620  1.00 70.11  ? 385  TRP B C   1 
ATOM   7113 O O   . TRP B 1 385 ? 13.854  -1.147  -3.646  1.00 72.45  ? 385  TRP B O   1 
ATOM   7114 C CB  . TRP B 1 385 ? 15.508  0.684   -5.508  1.00 67.32  ? 385  TRP B CB  1 
ATOM   7115 C CG  . TRP B 1 385 ? 16.516  0.561   -6.589  1.00 64.32  ? 385  TRP B CG  1 
ATOM   7116 C CD1 . TRP B 1 385 ? 16.725  1.424   -7.640  1.00 61.20  ? 385  TRP B CD1 1 
ATOM   7117 C CD2 . TRP B 1 385 ? 17.382  -0.544  -6.803  1.00 63.63  ? 385  TRP B CD2 1 
ATOM   7118 N NE1 . TRP B 1 385 ? 17.703  0.932   -8.475  1.00 58.15  ? 385  TRP B NE1 1 
ATOM   7119 C CE2 . TRP B 1 385 ? 18.119  -0.279  -7.986  1.00 61.57  ? 385  TRP B CE2 1 
ATOM   7120 C CE3 . TRP B 1 385 ? 17.614  -1.739  -6.113  1.00 65.66  ? 385  TRP B CE3 1 
ATOM   7121 C CZ2 . TRP B 1 385 ? 19.084  -1.161  -8.477  1.00 62.01  ? 385  TRP B CZ2 1 
ATOM   7122 C CZ3 . TRP B 1 385 ? 18.568  -2.620  -6.608  1.00 66.59  ? 385  TRP B CZ3 1 
ATOM   7123 C CH2 . TRP B 1 385 ? 19.288  -2.326  -7.784  1.00 64.89  ? 385  TRP B CH2 1 
ATOM   7124 N N   . LEU B 1 386 ? 12.129  -0.182  -4.726  1.00 70.07  ? 386  LEU B N   1 
ATOM   7125 C CA  . LEU B 1 386 ? 11.134  -0.575  -3.731  1.00 72.49  ? 386  LEU B CA  1 
ATOM   7126 C C   . LEU B 1 386 ? 10.622  -1.994  -3.977  1.00 73.34  ? 386  LEU B C   1 
ATOM   7127 O O   . LEU B 1 386 ? 10.290  -2.709  -3.046  1.00 75.51  ? 386  LEU B O   1 
ATOM   7128 C CB  . LEU B 1 386 ? 9.966   0.408   -3.729  1.00 72.03  ? 386  LEU B CB  1 
ATOM   7129 C CG  . LEU B 1 386 ? 9.463   0.919   -2.371  1.00 75.10  ? 386  LEU B CG  1 
ATOM   7130 C CD1 . LEU B 1 386 ? 8.245   1.833   -2.599  1.00 75.24  ? 386  LEU B CD1 1 
ATOM   7131 C CD2 . LEU B 1 386 ? 9.135   -0.213  -1.375  1.00 78.21  ? 386  LEU B CD2 1 
ATOM   7132 N N   . HIS B 1 387 ? 10.551  -2.385  -5.244  1.00 72.48  ? 387  HIS B N   1 
ATOM   7133 C CA  . HIS B 1 387 ? 10.133  -3.731  -5.637  1.00 73.49  ? 387  HIS B CA  1 
ATOM   7134 C C   . HIS B 1 387 ? 11.178  -4.291  -6.624  1.00 72.51  ? 387  HIS B C   1 
ATOM   7135 O O   . HIS B 1 387 ? 10.894  -4.451  -7.814  1.00 71.04  ? 387  HIS B O   1 
ATOM   7136 C CB  . HIS B 1 387 ? 8.720   -3.706  -6.264  1.00 72.95  ? 387  HIS B CB  1 
ATOM   7137 C CG  . HIS B 1 387 ? 7.699   -2.957  -5.455  1.00 74.61  ? 387  HIS B CG  1 
ATOM   7138 N ND1 . HIS B 1 387 ? 7.246   -1.698  -5.807  1.00 73.38  ? 387  HIS B ND1 1 
ATOM   7139 C CD2 . HIS B 1 387 ? 7.047   -3.286  -4.310  1.00 77.80  ? 387  HIS B CD2 1 
ATOM   7140 C CE1 . HIS B 1 387 ? 6.367   -1.281  -4.910  1.00 74.91  ? 387  HIS B CE1 1 
ATOM   7141 N NE2 . HIS B 1 387 ? 6.225   -2.228  -3.994  1.00 77.92  ? 387  HIS B NE2 1 
ATOM   7142 N N   . PRO B 1 388 ? 12.405  -4.564  -6.137  1.00 73.49  ? 388  PRO B N   1 
ATOM   7143 C CA  . PRO B 1 388 ? 13.506  -4.879  -7.052  1.00 72.79  ? 388  PRO B CA  1 
ATOM   7144 C C   . PRO B 1 388 ? 13.348  -6.159  -7.855  1.00 73.02  ? 388  PRO B C   1 
ATOM   7145 O O   . PRO B 1 388 ? 13.937  -6.271  -8.924  1.00 72.06  ? 388  PRO B O   1 
ATOM   7146 C CB  . PRO B 1 388 ? 14.730  -4.986  -6.121  1.00 74.53  ? 388  PRO B CB  1 
ATOM   7147 C CG  . PRO B 1 388 ? 14.179  -5.196  -4.756  1.00 76.41  ? 388  PRO B CG  1 
ATOM   7148 C CD  . PRO B 1 388 ? 12.879  -4.446  -4.745  1.00 75.57  ? 388  PRO B CD  1 
ATOM   7149 N N   . GLU B 1 389 ? 12.571  -7.111  -7.346  1.00 74.88  ? 389  GLU B N   1 
ATOM   7150 C CA  . GLU B 1 389 ? 12.460  -8.440  -7.969  1.00 75.79  ? 389  GLU B CA  1 
ATOM   7151 C C   . GLU B 1 389 ? 11.041  -8.802  -8.454  1.00 75.01  ? 389  GLU B C   1 
ATOM   7152 O O   . GLU B 1 389 ? 10.779  -9.955  -8.809  1.00 76.25  ? 389  GLU B O   1 
ATOM   7153 C CB  . GLU B 1 389 ? 13.042  -9.525  -7.044  1.00 78.62  ? 389  GLU B CB  1 
ATOM   7154 C CG  . GLU B 1 389 ? 14.432  -9.144  -6.478  1.00 81.99  ? 389  GLU B CG  1 
ATOM   7155 C CD  . GLU B 1 389 ? 15.361  -10.331 -6.243  1.00 87.20  ? 389  GLU B CD  1 
ATOM   7156 O OE1 . GLU B 1 389 ? 15.250  -10.972 -5.168  1.00 91.21  ? 389  GLU B OE1 1 
ATOM   7157 O OE2 . GLU B 1 389 ? 16.215  -10.606 -7.125  1.00 87.22  ? 389  GLU B OE2 1 
ATOM   7158 N N   . ASP B 1 390 ? 10.148  -7.811  -8.499  1.00 72.93  ? 390  ASP B N   1 
ATOM   7159 C CA  . ASP B 1 390 ? 8.769   -8.018  -8.942  1.00 72.04  ? 390  ASP B CA  1 
ATOM   7160 C C   . ASP B 1 390 ? 8.685   -8.203  -10.459 1.00 69.94  ? 390  ASP B C   1 
ATOM   7161 O O   . ASP B 1 390 ? 9.000   -7.281  -11.222 1.00 67.61  ? 390  ASP B O   1 
ATOM   7162 C CB  . ASP B 1 390 ? 7.878   -6.858  -8.495  1.00 71.32  ? 390  ASP B CB  1 
ATOM   7163 C CG  . ASP B 1 390 ? 6.472   -6.951  -9.058  1.00 71.46  ? 390  ASP B CG  1 
ATOM   7164 O OD1 . ASP B 1 390 ? 5.721   -7.871  -8.667  1.00 72.28  ? 390  ASP B OD1 1 
ATOM   7165 O OD2 . ASP B 1 390 ? 6.119   -6.090  -9.895  1.00 71.80  ? 390  ASP B OD2 1 
ATOM   7166 N N   . PRO B 1 391 ? 8.234   -9.390  -10.897 1.00 70.57  ? 391  PRO B N   1 
ATOM   7167 C CA  . PRO B 1 391 ? 8.261   -9.776  -12.308 1.00 69.02  ? 391  PRO B CA  1 
ATOM   7168 C C   . PRO B 1 391 ? 7.477   -8.833  -13.224 1.00 66.97  ? 391  PRO B C   1 
ATOM   7169 O O   . PRO B 1 391 ? 7.912   -8.569  -14.355 1.00 65.60  ? 391  PRO B O   1 
ATOM   7170 C CB  . PRO B 1 391 ? 7.646   -11.182 -12.300 1.00 71.21  ? 391  PRO B CB  1 
ATOM   7171 C CG  . PRO B 1 391 ? 7.794   -11.674 -10.872 1.00 73.32  ? 391  PRO B CG  1 
ATOM   7172 C CD  . PRO B 1 391 ? 7.600   -10.427 -10.059 1.00 72.99  ? 391  PRO B CD  1 
ATOM   7173 N N   . THR B 1 392 ? 6.348   -8.312  -12.745 1.00 67.06  ? 392  THR B N   1 
ATOM   7174 C CA  . THR B 1 392 ? 5.564   -7.340  -13.519 1.00 65.11  ? 392  THR B CA  1 
ATOM   7175 C C   . THR B 1 392 ? 6.391   -6.075  -13.771 1.00 63.45  ? 392  THR B C   1 
ATOM   7176 O O   . THR B 1 392 ? 6.436   -5.566  -14.893 1.00 61.79  ? 392  THR B O   1 
ATOM   7177 C CB  . THR B 1 392 ? 4.204   -6.975  -12.828 1.00 66.09  ? 392  THR B CB  1 
ATOM   7178 O OG1 . THR B 1 392 ? 3.484   -8.172  -12.485 1.00 68.10  ? 392  THR B OG1 1 
ATOM   7179 C CG2 . THR B 1 392 ? 3.335   -6.115  -13.746 1.00 63.50  ? 392  THR B CG2 1 
ATOM   7180 N N   . HIS B 1 393 ? 7.055   -5.572  -12.731 1.00 64.10  ? 393  HIS B N   1 
ATOM   7181 C CA  . HIS B 1 393 ? 7.892   -4.381  -12.892 1.00 62.72  ? 393  HIS B CA  1 
ATOM   7182 C C   . HIS B 1 393 ? 9.028   -4.629  -13.865 1.00 60.97  ? 393  HIS B C   1 
ATOM   7183 O O   . HIS B 1 393 ? 9.252   -3.824  -14.780 1.00 59.36  ? 393  HIS B O   1 
ATOM   7184 C CB  . HIS B 1 393 ? 8.457   -3.907  -11.564 1.00 64.05  ? 393  HIS B CB  1 
ATOM   7185 C CG  . HIS B 1 393 ? 7.522   -3.039  -10.785 1.00 67.58  ? 393  HIS B CG  1 
ATOM   7186 N ND1 . HIS B 1 393 ? 6.635   -3.542  -9.852  1.00 72.04  ? 393  HIS B ND1 1 
ATOM   7187 C CD2 . HIS B 1 393 ? 7.349   -1.694  -10.785 1.00 69.16  ? 393  HIS B CD2 1 
ATOM   7188 C CE1 . HIS B 1 393 ? 5.958   -2.544  -9.311  1.00 73.51  ? 393  HIS B CE1 1 
ATOM   7189 N NE2 . HIS B 1 393 ? 6.378   -1.412  -9.852  1.00 72.09  ? 393  HIS B NE2 1 
ATOM   7190 N N   . LEU B 1 394 ? 9.727   -5.746  -13.673 1.00 61.37  ? 394  LEU B N   1 
ATOM   7191 C CA  . LEU B 1 394 ? 10.853  -6.108  -14.529 1.00 60.41  ? 394  LEU B CA  1 
ATOM   7192 C C   . LEU B 1 394 ? 10.471  -6.221  -16.017 1.00 58.62  ? 394  LEU B C   1 
ATOM   7193 O O   . LEU B 1 394 ? 11.171  -5.704  -16.883 1.00 56.72  ? 394  LEU B O   1 
ATOM   7194 C CB  . LEU B 1 394 ? 11.516  -7.387  -14.012 1.00 62.58  ? 394  LEU B CB  1 
ATOM   7195 C CG  . LEU B 1 394 ? 12.230  -7.213  -12.662 1.00 63.71  ? 394  LEU B CG  1 
ATOM   7196 C CD1 . LEU B 1 394 ? 12.342  -8.534  -11.943 1.00 64.50  ? 394  LEU B CD1 1 
ATOM   7197 C CD2 . LEU B 1 394 ? 13.606  -6.565  -12.835 1.00 62.23  ? 394  LEU B CD2 1 
ATOM   7198 N N   . ARG B 1 395 ? 9.349   -6.881  -16.294 1.00 58.87  ? 395  ARG B N   1 
ATOM   7199 C CA  . ARG B 1 395 ? 8.800   -6.946  -17.637 1.00 57.57  ? 395  ARG B CA  1 
ATOM   7200 C C   . ARG B 1 395 ? 8.516   -5.538  -18.196 1.00 55.61  ? 395  ARG B C   1 
ATOM   7201 O O   . ARG B 1 395 ? 9.067   -5.159  -19.236 1.00 54.51  ? 395  ARG B O   1 
ATOM   7202 C CB  . ARG B 1 395 ? 7.547   -7.829  -17.638 1.00 58.95  ? 395  ARG B CB  1 
ATOM   7203 C CG  . ARG B 1 395 ? 6.855   -7.959  -18.985 1.00 58.31  ? 395  ARG B CG  1 
ATOM   7204 C CD  . ARG B 1 395 ? 5.527   -7.253  -18.975 1.00 58.44  ? 395  ARG B CD  1 
ATOM   7205 N NE  . ARG B 1 395 ? 4.459   -8.124  -18.502 1.00 60.43  ? 395  ARG B NE  1 
ATOM   7206 C CZ  . ARG B 1 395 ? 3.351   -7.686  -17.899 1.00 62.06  ? 395  ARG B CZ  1 
ATOM   7207 N NH1 . ARG B 1 395 ? 3.171   -6.385  -17.678 1.00 57.74  ? 395  ARG B NH1 1 
ATOM   7208 N NH2 . ARG B 1 395 ? 2.423   -8.559  -17.497 1.00 64.98  ? 395  ARG B NH2 1 
ATOM   7209 N N   . ASP B 1 396 ? 7.689   -4.753  -17.505 1.00 55.05  ? 396  ASP B N   1 
ATOM   7210 C CA  . ASP B 1 396 ? 7.387   -3.396  -17.969 1.00 53.15  ? 396  ASP B CA  1 
ATOM   7211 C C   . ASP B 1 396 ? 8.638   -2.537  -18.154 1.00 51.86  ? 396  ASP B C   1 
ATOM   7212 O O   . ASP B 1 396 ? 8.660   -1.660  -19.024 1.00 50.29  ? 396  ASP B O   1 
ATOM   7213 C CB  . ASP B 1 396 ? 6.388   -2.691  -17.050 1.00 53.34  ? 396  ASP B CB  1 
ATOM   7214 C CG  . ASP B 1 396 ? 5.007   -3.309  -17.114 1.00 55.03  ? 396  ASP B CG  1 
ATOM   7215 O OD1 . ASP B 1 396 ? 4.586   -3.717  -18.215 1.00 54.86  ? 396  ASP B OD1 1 
ATOM   7216 O OD2 . ASP B 1 396 ? 4.335   -3.401  -16.065 1.00 57.63  ? 396  ASP B OD2 1 
ATOM   7217 N N   . ALA B 1 397 ? 9.663   -2.793  -17.340 1.00 52.49  ? 397  ALA B N   1 
ATOM   7218 C CA  . ALA B 1 397 ? 10.922  -2.046  -17.418 1.00 51.72  ? 397  ALA B CA  1 
ATOM   7219 C C   . ALA B 1 397 ? 11.735  -2.433  -18.651 1.00 50.51  ? 397  ALA B C   1 
ATOM   7220 O O   . ALA B 1 397 ? 12.315  -1.578  -19.302 1.00 49.30  ? 397  ALA B O   1 
ATOM   7221 C CB  . ALA B 1 397 ? 11.748  -2.222  -16.145 1.00 52.86  ? 397  ALA B CB  1 
ATOM   7222 N N   . MET B 1 398 ? 11.774  -3.723  -18.955 1.00 51.22  ? 398  MET B N   1 
ATOM   7223 C CA  . MET B 1 398 ? 12.410  -4.223  -20.164 1.00 50.75  ? 398  MET B CA  1 
ATOM   7224 C C   . MET B 1 398 ? 11.793  -3.567  -21.409 1.00 49.14  ? 398  MET B C   1 
ATOM   7225 O O   . MET B 1 398 ? 12.494  -3.137  -22.332 1.00 47.99  ? 398  MET B O   1 
ATOM   7226 C CB  . MET B 1 398 ? 12.245  -5.736  -20.227 1.00 52.04  ? 398  MET B CB  1 
ATOM   7227 C CG  . MET B 1 398 ? 12.978  -6.394  -21.375 1.00 53.30  ? 398  MET B CG  1 
ATOM   7228 S SD  . MET B 1 398 ? 14.770  -6.303  -21.176 1.00 57.66  ? 398  MET B SD  1 
ATOM   7229 C CE  . MET B 1 398 ? 15.198  -5.069  -22.408 1.00 52.65  ? 398  MET B CE  1 
ATOM   7230 N N   . SER B 1 399 ? 10.467  -3.492  -21.425 1.00 48.89  ? 399  SER B N   1 
ATOM   7231 C CA  . SER B 1 399 ? 9.773   -2.876  -22.517 1.00 47.03  ? 399  SER B CA  1 
ATOM   7232 C C   . SER B 1 399 ? 10.119  -1.419  -22.549 1.00 45.88  ? 399  SER B C   1 
ATOM   7233 O O   . SER B 1 399 ? 10.355  -0.857  -23.621 1.00 45.35  ? 399  SER B O   1 
ATOM   7234 C CB  . SER B 1 399 ? 8.279   -3.030  -22.334 1.00 47.43  ? 399  SER B CB  1 
ATOM   7235 O OG  . SER B 1 399 ? 7.629   -1.960  -22.989 1.00 46.27  ? 399  SER B OG  1 
ATOM   7236 N N   . ALA B 1 400 ? 10.143  -0.807  -21.367 1.00 46.35  ? 400  ALA B N   1 
ATOM   7237 C CA  . ALA B 1 400 ? 10.471  0.618   -21.235 1.00 45.57  ? 400  ALA B CA  1 
ATOM   7238 C C   . ALA B 1 400 ? 11.867  0.891   -21.763 1.00 45.12  ? 400  ALA B C   1 
ATOM   7239 O O   . ALA B 1 400 ? 12.038  1.811   -22.547 1.00 45.09  ? 400  ALA B O   1 
ATOM   7240 C CB  . ALA B 1 400 ? 10.328  1.089   -19.806 1.00 46.23  ? 400  ALA B CB  1 
ATOM   7241 N N   . VAL B 1 401 ? 12.842  0.066   -21.382 1.00 45.57  ? 401  VAL B N   1 
ATOM   7242 C CA  . VAL B 1 401 ? 14.214  0.213   -21.851 1.00 45.41  ? 401  VAL B CA  1 
ATOM   7243 C C   . VAL B 1 401 ? 14.284  0.279   -23.373 1.00 45.24  ? 401  VAL B C   1 
ATOM   7244 O O   . VAL B 1 401 ? 14.977  1.142   -23.945 1.00 44.49  ? 401  VAL B O   1 
ATOM   7245 C CB  . VAL B 1 401 ? 15.122  -0.935  -21.345 1.00 47.00  ? 401  VAL B CB  1 
ATOM   7246 C CG1 . VAL B 1 401 ? 16.388  -1.092  -22.222 1.00 44.51  ? 401  VAL B CG1 1 
ATOM   7247 C CG2 . VAL B 1 401 ? 15.474  -0.728  -19.855 1.00 46.13  ? 401  VAL B CG2 1 
ATOM   7248 N N   . VAL B 1 402 ? 13.551  -0.620  -24.028 1.00 45.45  ? 402  VAL B N   1 
ATOM   7249 C CA  . VAL B 1 402 ? 13.632  -0.727  -25.476 1.00 44.58  ? 402  VAL B CA  1 
ATOM   7250 C C   . VAL B 1 402 ? 12.931  0.448   -26.158 1.00 43.61  ? 402  VAL B C   1 
ATOM   7251 O O   . VAL B 1 402 ? 13.457  1.004   -27.122 1.00 42.07  ? 402  VAL B O   1 
ATOM   7252 C CB  . VAL B 1 402 ? 13.127  -2.095  -25.996 1.00 45.08  ? 402  VAL B CB  1 
ATOM   7253 C CG1 . VAL B 1 402 ? 13.003  -2.088  -27.515 1.00 43.47  ? 402  VAL B CG1 1 
ATOM   7254 C CG2 . VAL B 1 402 ? 14.068  -3.184  -25.569 1.00 45.62  ? 402  VAL B CG2 1 
ATOM   7255 N N   . GLY B 1 403 ? 11.756  0.820   -25.648 1.00 44.13  ? 403  GLY B N   1 
ATOM   7256 C CA  . GLY B 1 403 ? 11.027  1.980   -26.179 1.00 43.76  ? 403  GLY B CA  1 
ATOM   7257 C C   . GLY B 1 403 ? 11.825  3.276   -26.068 1.00 44.15  ? 403  GLY B C   1 
ATOM   7258 O O   . GLY B 1 403 ? 11.892  4.064   -27.028 1.00 43.96  ? 403  GLY B O   1 
ATOM   7259 N N   . ASP B 1 404 ? 12.461  3.477   -24.913 1.00 44.33  ? 404  ASP B N   1 
ATOM   7260 C CA  . ASP B 1 404 ? 13.137  4.712   -24.611 1.00 44.15  ? 404  ASP B CA  1 
ATOM   7261 C C   . ASP B 1 404 ? 14.407  4.876   -25.452 1.00 44.13  ? 404  ASP B C   1 
ATOM   7262 O O   . ASP B 1 404 ? 14.690  5.945   -26.012 1.00 44.04  ? 404  ASP B O   1 
ATOM   7263 C CB  . ASP B 1 404 ? 13.470  4.749   -23.111 1.00 45.27  ? 404  ASP B CB  1 
ATOM   7264 C CG  . ASP B 1 404 ? 12.233  4.972   -22.217 1.00 46.12  ? 404  ASP B CG  1 
ATOM   7265 O OD1 . ASP B 1 404 ? 11.143  5.279   -22.743 1.00 45.83  ? 404  ASP B OD1 1 
ATOM   7266 O OD2 . ASP B 1 404 ? 12.352  4.864   -20.969 1.00 48.51  ? 404  ASP B OD2 1 
ATOM   7267 N N   . HIS B 1 405 ? 15.185  3.806   -25.529 1.00 44.76  ? 405  HIS B N   1 
ATOM   7268 C CA  . HIS B 1 405 ? 16.471  3.827   -26.190 1.00 44.33  ? 405  HIS B CA  1 
ATOM   7269 C C   . HIS B 1 405 ? 16.259  4.017   -27.676 1.00 43.64  ? 405  HIS B C   1 
ATOM   7270 O O   . HIS B 1 405 ? 16.985  4.767   -28.317 1.00 43.93  ? 405  HIS B O   1 
ATOM   7271 C CB  . HIS B 1 405 ? 17.180  2.519   -25.894 1.00 45.32  ? 405  HIS B CB  1 
ATOM   7272 C CG  . HIS B 1 405 ? 18.434  2.294   -26.681 1.00 45.33  ? 405  HIS B CG  1 
ATOM   7273 N ND1 . HIS B 1 405 ? 19.444  3.230   -26.763 1.00 44.30  ? 405  HIS B ND1 1 
ATOM   7274 C CD2 . HIS B 1 405 ? 18.868  1.206   -27.366 1.00 44.62  ? 405  HIS B CD2 1 
ATOM   7275 C CE1 . HIS B 1 405 ? 20.426  2.746   -27.501 1.00 45.50  ? 405  HIS B CE1 1 
ATOM   7276 N NE2 . HIS B 1 405 ? 20.103  1.519   -27.875 1.00 46.83  ? 405  HIS B NE2 1 
ATOM   7277 N N   . ASN B 1 406 ? 15.222  3.387   -28.207 1.00 43.15  ? 406  ASN B N   1 
ATOM   7278 C CA  . ASN B 1 406 ? 15.032  3.314   -29.650 1.00 42.86  ? 406  ASN B CA  1 
ATOM   7279 C C   . ASN B 1 406 ? 14.119  4.371   -30.243 1.00 42.34  ? 406  ASN B C   1 
ATOM   7280 O O   . ASN B 1 406 ? 14.344  4.785   -31.386 1.00 42.32  ? 406  ASN B O   1 
ATOM   7281 C CB  . ASN B 1 406 ? 14.564  1.917   -30.072 1.00 42.87  ? 406  ASN B CB  1 
ATOM   7282 C CG  . ASN B 1 406 ? 15.670  0.904   -30.004 1.00 43.89  ? 406  ASN B CG  1 
ATOM   7283 O OD1 . ASN B 1 406 ? 16.739  1.104   -30.585 1.00 44.18  ? 406  ASN B OD1 1 
ATOM   7284 N ND2 . ASN B 1 406 ? 15.439  -0.184  -29.273 1.00 43.83  ? 406  ASN B ND2 1 
ATOM   7285 N N   . VAL B 1 407 ? 13.100  4.797   -29.498 1.00 41.98  ? 407  VAL B N   1 
ATOM   7286 C CA  . VAL B 1 407 ? 12.128  5.747   -30.041 1.00 41.31  ? 407  VAL B CA  1 
ATOM   7287 C C   . VAL B 1 407 ? 11.964  7.019   -29.197 1.00 41.69  ? 407  VAL B C   1 
ATOM   7288 O O   . VAL B 1 407 ? 12.257  8.126   -29.677 1.00 41.76  ? 407  VAL B O   1 
ATOM   7289 C CB  . VAL B 1 407 ? 10.751  5.074   -30.252 1.00 41.81  ? 407  VAL B CB  1 
ATOM   7290 C CG1 . VAL B 1 407 ? 9.738   6.076   -30.797 1.00 41.13  ? 407  VAL B CG1 1 
ATOM   7291 C CG2 . VAL B 1 407 ? 10.866  3.863   -31.184 1.00 40.61  ? 407  VAL B CG2 1 
ATOM   7292 N N   . VAL B 1 408 ? 11.532  6.866   -27.939 1.00 41.83  ? 408  VAL B N   1 
ATOM   7293 C CA  . VAL B 1 408 ? 11.103  8.011   -27.139 1.00 41.57  ? 408  VAL B CA  1 
ATOM   7294 C C   . VAL B 1 408 ? 12.227  9.018   -26.891 1.00 42.37  ? 408  VAL B C   1 
ATOM   7295 O O   . VAL B 1 408 ? 12.028  10.225  -27.047 1.00 42.92  ? 408  VAL B O   1 
ATOM   7296 C CB  . VAL B 1 408 ? 10.417  7.594   -25.802 1.00 42.31  ? 408  VAL B CB  1 
ATOM   7297 C CG1 . VAL B 1 408 ? 9.914   8.809   -25.062 1.00 40.08  ? 408  VAL B CG1 1 
ATOM   7298 C CG2 . VAL B 1 408 ? 9.255   6.627   -26.057 1.00 40.96  ? 408  VAL B CG2 1 
ATOM   7299 N N   . CYS B 1 409 ? 13.409  8.548   -26.523 1.00 42.45  ? 409  CYS B N   1 
ATOM   7300 C CA  . CYS B 1 409 ? 14.474  9.496   -26.289 1.00 43.06  ? 409  CYS B CA  1 
ATOM   7301 C C   . CYS B 1 409 ? 15.070  10.079  -27.587 1.00 42.70  ? 409  CYS B C   1 
ATOM   7302 O O   . CYS B 1 409 ? 15.343  11.287  -27.640 1.00 43.61  ? 409  CYS B O   1 
ATOM   7303 C CB  . CYS B 1 409 ? 15.512  8.962   -25.301 1.00 43.84  ? 409  CYS B CB  1 
ATOM   7304 S SG  . CYS B 1 409 ? 14.785  8.698   -23.647 1.00 47.11  ? 409  CYS B SG  1 
ATOM   7305 N N   . PRO B 1 410 ? 15.246  9.256   -28.640 1.00 41.82  ? 410  PRO B N   1 
ATOM   7306 C CA  . PRO B 1 410 ? 15.587  9.868   -29.910 1.00 41.06  ? 410  PRO B CA  1 
ATOM   7307 C C   . PRO B 1 410 ? 14.570  10.925  -30.344 1.00 40.59  ? 410  PRO B C   1 
ATOM   7308 O O   . PRO B 1 410 ? 14.984  11.990  -30.814 1.00 40.46  ? 410  PRO B O   1 
ATOM   7309 C CB  . PRO B 1 410 ? 15.586  8.692   -30.864 1.00 40.51  ? 410  PRO B CB  1 
ATOM   7310 C CG  . PRO B 1 410 ? 16.076  7.601   -30.037 1.00 41.85  ? 410  PRO B CG  1 
ATOM   7311 C CD  . PRO B 1 410 ? 15.446  7.800   -28.690 1.00 42.24  ? 410  PRO B CD  1 
ATOM   7312 N N   . VAL B 1 411 ? 13.269  10.653  -30.179 1.00 39.64  ? 411  VAL B N   1 
ATOM   7313 C CA  . VAL B 1 411 ? 12.253  11.672  -30.495 1.00 39.18  ? 411  VAL B CA  1 
ATOM   7314 C C   . VAL B 1 411 ? 12.458  12.961  -29.668 1.00 39.99  ? 411  VAL B C   1 
ATOM   7315 O O   . VAL B 1 411 ? 12.385  14.064  -30.217 1.00 39.97  ? 411  VAL B O   1 
ATOM   7316 C CB  . VAL B 1 411 ? 10.799  11.167  -30.321 1.00 38.65  ? 411  VAL B CB  1 
ATOM   7317 C CG1 . VAL B 1 411 ? 9.849   12.308  -30.207 1.00 36.32  ? 411  VAL B CG1 1 
ATOM   7318 C CG2 . VAL B 1 411 ? 10.400  10.275  -31.466 1.00 37.85  ? 411  VAL B CG2 1 
ATOM   7319 N N   . ALA B 1 412 ? 12.723  12.807  -28.373 1.00 40.46  ? 412  ALA B N   1 
ATOM   7320 C CA  . ALA B 1 412 ? 12.847  13.939  -27.476 1.00 41.75  ? 412  ALA B CA  1 
ATOM   7321 C C   . ALA B 1 412 ? 14.033  14.813  -27.858 1.00 42.75  ? 412  ALA B C   1 
ATOM   7322 O O   . ALA B 1 412 ? 13.936  16.046  -27.822 1.00 43.64  ? 412  ALA B O   1 
ATOM   7323 C CB  . ALA B 1 412 ? 12.978  13.467  -26.048 1.00 42.46  ? 412  ALA B CB  1 
ATOM   7324 N N   . GLN B 1 413 ? 15.141  14.203  -28.259 1.00 42.94  ? 413  GLN B N   1 
ATOM   7325 C CA  . GLN B 1 413 ? 16.248  15.027  -28.704 1.00 44.65  ? 413  GLN B CA  1 
ATOM   7326 C C   . GLN B 1 413 ? 16.103  15.638  -30.099 1.00 44.04  ? 413  GLN B C   1 
ATOM   7327 O O   . GLN B 1 413 ? 16.632  16.750  -30.358 1.00 44.89  ? 413  GLN B O   1 
ATOM   7328 C CB  . GLN B 1 413 ? 17.608  14.365  -28.501 1.00 45.79  ? 413  GLN B CB  1 
ATOM   7329 C CG  . GLN B 1 413 ? 18.075  13.497  -29.598 1.00 49.10  ? 413  GLN B CG  1 
ATOM   7330 C CD  . GLN B 1 413 ? 19.582  13.333  -29.535 1.00 56.25  ? 413  GLN B CD  1 
ATOM   7331 O OE1 . GLN B 1 413 ? 20.280  14.158  -28.912 1.00 56.55  ? 413  GLN B OE1 1 
ATOM   7332 N NE2 . GLN B 1 413 ? 20.099  12.264  -30.180 1.00 57.18  ? 413  GLN B NE2 1 
ATOM   7333 N N   . LEU B 1 414 ? 15.397  14.940  -30.987 1.00 42.35  ? 414  LEU B N   1 
ATOM   7334 C CA  . LEU B 1 414 ? 15.023  15.552  -32.244 1.00 41.90  ? 414  LEU B CA  1 
ATOM   7335 C C   . LEU B 1 414 ? 14.153  16.784  -31.989 1.00 42.13  ? 414  LEU B C   1 
ATOM   7336 O O   . LEU B 1 414 ? 14.402  17.838  -32.534 1.00 42.74  ? 414  LEU B O   1 
ATOM   7337 C CB  . LEU B 1 414 ? 14.293  14.567  -33.136 1.00 41.34  ? 414  LEU B CB  1 
ATOM   7338 C CG  . LEU B 1 414 ? 13.958  15.149  -34.514 1.00 42.10  ? 414  LEU B CG  1 
ATOM   7339 C CD1 . LEU B 1 414 ? 15.216  15.411  -35.376 1.00 42.86  ? 414  LEU B CD1 1 
ATOM   7340 C CD2 . LEU B 1 414 ? 12.995  14.276  -35.226 1.00 38.75  ? 414  LEU B CD2 1 
ATOM   7341 N N   . ALA B 1 415 ? 13.151  16.657  -31.132 1.00 42.21  ? 415  ALA B N   1 
ATOM   7342 C CA  . ALA B 1 415 ? 12.235  17.747  -30.906 1.00 42.99  ? 415  ALA B CA  1 
ATOM   7343 C C   . ALA B 1 415 ? 12.987  18.967  -30.354 1.00 44.59  ? 415  ALA B C   1 
ATOM   7344 O O   . ALA B 1 415 ? 12.793  20.104  -30.816 1.00 44.72  ? 415  ALA B O   1 
ATOM   7345 C CB  . ALA B 1 415 ? 11.147  17.319  -29.976 1.00 42.52  ? 415  ALA B CB  1 
ATOM   7346 N N   . GLY B 1 416 ? 13.854  18.725  -29.376 1.00 45.38  ? 416  GLY B N   1 
ATOM   7347 C CA  . GLY B 1 416 ? 14.588  19.805  -28.742 1.00 47.10  ? 416  GLY B CA  1 
ATOM   7348 C C   . GLY B 1 416 ? 15.504  20.479  -29.744 1.00 48.02  ? 416  GLY B C   1 
ATOM   7349 O O   . GLY B 1 416 ? 15.563  21.697  -29.827 1.00 48.58  ? 416  GLY B O   1 
ATOM   7350 N N   . ARG B 1 417 ? 16.208  19.687  -30.536 1.00 48.17  ? 417  ARG B N   1 
ATOM   7351 C CA  . ARG B 1 417 ? 17.140  20.270  -31.476 1.00 49.11  ? 417  ARG B CA  1 
ATOM   7352 C C   . ARG B 1 417 ? 16.416  21.097  -32.551 1.00 48.93  ? 417  ARG B C   1 
ATOM   7353 O O   . ARG B 1 417 ? 16.786  22.258  -32.795 1.00 49.85  ? 417  ARG B O   1 
ATOM   7354 C CB  . ARG B 1 417 ? 18.091  19.208  -32.034 1.00 49.56  ? 417  ARG B CB  1 
ATOM   7355 C CG  . ARG B 1 417 ? 19.216  18.861  -31.062 1.00 52.41  ? 417  ARG B CG  1 
ATOM   7356 C CD  . ARG B 1 417 ? 20.153  20.046  -30.936 1.00 60.44  ? 417  ARG B CD  1 
ATOM   7357 N NE  . ARG B 1 417 ? 21.242  19.876  -29.965 1.00 66.38  ? 417  ARG B NE  1 
ATOM   7358 C CZ  . ARG B 1 417 ? 22.324  20.663  -29.916 1.00 69.96  ? 417  ARG B CZ  1 
ATOM   7359 N NH1 . ARG B 1 417 ? 22.457  21.673  -30.784 1.00 70.76  ? 417  ARG B NH1 1 
ATOM   7360 N NH2 . ARG B 1 417 ? 23.279  20.445  -29.007 1.00 71.19  ? 417  ARG B NH2 1 
ATOM   7361 N N   . LEU B 1 418 ? 15.366  20.537  -33.153 1.00 47.40  ? 418  LEU B N   1 
ATOM   7362 C CA  . LEU B 1 418 ? 14.551  21.308  -34.098 1.00 47.69  ? 418  LEU B CA  1 
ATOM   7363 C C   . LEU B 1 418 ? 13.993  22.601  -33.477 1.00 48.71  ? 418  LEU B C   1 
ATOM   7364 O O   . LEU B 1 418 ? 14.090  23.678  -34.067 1.00 49.80  ? 418  LEU B O   1 
ATOM   7365 C CB  . LEU B 1 418 ? 13.411  20.464  -34.674 1.00 46.55  ? 418  LEU B CB  1 
ATOM   7366 C CG  . LEU B 1 418 ? 13.728  19.148  -35.393 1.00 46.57  ? 418  LEU B CG  1 
ATOM   7367 C CD1 . LEU B 1 418 ? 12.461  18.441  -35.799 1.00 45.47  ? 418  LEU B CD1 1 
ATOM   7368 C CD2 . LEU B 1 418 ? 14.605  19.367  -36.602 1.00 47.92  ? 418  LEU B CD2 1 
ATOM   7369 N N   . ALA B 1 419 ? 13.417  22.504  -32.285 1.00 48.98  ? 419  ALA B N   1 
ATOM   7370 C CA  . ALA B 1 419 ? 12.820  23.676  -31.643 1.00 50.40  ? 419  ALA B CA  1 
ATOM   7371 C C   . ALA B 1 419 ? 13.850  24.777  -31.406 1.00 51.79  ? 419  ALA B C   1 
ATOM   7372 O O   . ALA B 1 419 ? 13.633  25.926  -31.780 1.00 53.28  ? 419  ALA B O   1 
ATOM   7373 C CB  . ALA B 1 419 ? 12.115  23.290  -30.331 1.00 50.00  ? 419  ALA B CB  1 
ATOM   7374 N N   . ALA B 1 420 ? 14.978  24.399  -30.808 1.00 52.29  ? 420  ALA B N   1 
ATOM   7375 C CA  . ALA B 1 420 ? 16.097  25.302  -30.519 1.00 53.56  ? 420  ALA B CA  1 
ATOM   7376 C C   . ALA B 1 420 ? 16.661  25.969  -31.775 1.00 54.69  ? 420  ALA B C   1 
ATOM   7377 O O   . ALA B 1 420 ? 17.271  27.043  -31.706 1.00 56.16  ? 420  ALA B O   1 
ATOM   7378 C CB  . ALA B 1 420 ? 17.196  24.539  -29.804 1.00 52.81  ? 420  ALA B CB  1 
ATOM   7379 N N   . GLN B 1 421 ? 16.469  25.336  -32.923 1.00 53.94  ? 421  GLN B N   1 
ATOM   7380 C CA  . GLN B 1 421 ? 17.104  25.822  -34.122 1.00 55.03  ? 421  GLN B CA  1 
ATOM   7381 C C   . GLN B 1 421 ? 16.144  26.368  -35.161 1.00 54.94  ? 421  GLN B C   1 
ATOM   7382 O O   . GLN B 1 421 ? 16.403  26.269  -36.373 1.00 55.12  ? 421  GLN B O   1 
ATOM   7383 C CB  . GLN B 1 421 ? 18.063  24.775  -34.681 1.00 55.09  ? 421  GLN B CB  1 
ATOM   7384 C CG  . GLN B 1 421 ? 19.401  24.828  -33.920 1.00 57.64  ? 421  GLN B CG  1 
ATOM   7385 C CD  . GLN B 1 421 ? 19.982  23.466  -33.711 1.00 59.36  ? 421  GLN B CD  1 
ATOM   7386 O OE1 . GLN B 1 421 ? 20.195  23.017  -32.568 1.00 60.41  ? 421  GLN B OE1 1 
ATOM   7387 N NE2 . GLN B 1 421 ? 20.229  22.774  -34.812 1.00 59.26  ? 421  GLN B NE2 1 
ATOM   7388 N N   . GLY B 1 422 ? 15.040  26.937  -34.667 1.00 54.58  ? 422  GLY B N   1 
ATOM   7389 C CA  . GLY B 1 422 ? 14.123  27.723  -35.481 1.00 54.38  ? 422  GLY B CA  1 
ATOM   7390 C C   . GLY B 1 422 ? 12.856  27.049  -35.986 1.00 53.15  ? 422  GLY B C   1 
ATOM   7391 O O   . GLY B 1 422 ? 11.951  27.747  -36.450 1.00 54.43  ? 422  GLY B O   1 
ATOM   7392 N N   . ALA B 1 423 ? 12.774  25.715  -35.921 1.00 50.55  ? 423  ALA B N   1 
ATOM   7393 C CA  . ALA B 1 423 ? 11.572  25.017  -36.384 1.00 48.61  ? 423  ALA B CA  1 
ATOM   7394 C C   . ALA B 1 423 ? 10.399  25.210  -35.446 1.00 48.32  ? 423  ALA B C   1 
ATOM   7395 O O   . ALA B 1 423 ? 10.559  25.570  -34.284 1.00 49.09  ? 423  ALA B O   1 
ATOM   7396 C CB  . ALA B 1 423 ? 11.829  23.545  -36.550 1.00 47.16  ? 423  ALA B CB  1 
ATOM   7397 N N   . ARG B 1 424 ? 9.217   24.935  -35.966 1.00 47.42  ? 424  ARG B N   1 
ATOM   7398 C CA  . ARG B 1 424 ? 8.003   24.947  -35.198 1.00 46.92  ? 424  ARG B CA  1 
ATOM   7399 C C   . ARG B 1 424 ? 7.623   23.496  -34.966 1.00 44.60  ? 424  ARG B C   1 
ATOM   7400 O O   . ARG B 1 424 ? 7.394   22.733  -35.904 1.00 43.46  ? 424  ARG B O   1 
ATOM   7401 C CB  . ARG B 1 424 ? 6.954   25.650  -36.022 1.00 48.44  ? 424  ARG B CB  1 
ATOM   7402 C CG  . ARG B 1 424 ? 5.594   25.823  -35.402 1.00 51.70  ? 424  ARG B CG  1 
ATOM   7403 C CD  . ARG B 1 424 ? 4.789   26.750  -36.353 1.00 57.94  ? 424  ARG B CD  1 
ATOM   7404 N NE  . ARG B 1 424 ? 3.669   27.417  -35.703 1.00 60.89  ? 424  ARG B NE  1 
ATOM   7405 C CZ  . ARG B 1 424 ? 3.781   28.215  -34.647 1.00 61.80  ? 424  ARG B CZ  1 
ATOM   7406 N NH1 . ARG B 1 424 ? 4.950   28.446  -34.077 1.00 61.60  ? 424  ARG B NH1 1 
ATOM   7407 N NH2 . ARG B 1 424 ? 2.704   28.763  -34.146 1.00 64.57  ? 424  ARG B NH2 1 
ATOM   7408 N N   . VAL B 1 425 ? 7.574   23.107  -33.705 1.00 43.34  ? 425  VAL B N   1 
ATOM   7409 C CA  . VAL B 1 425 ? 7.431   21.704  -33.359 1.00 41.27  ? 425  VAL B CA  1 
ATOM   7410 C C   . VAL B 1 425 ? 6.155   21.477  -32.559 1.00 40.81  ? 425  VAL B C   1 
ATOM   7411 O O   . VAL B 1 425 ? 5.849   22.245  -31.657 1.00 41.72  ? 425  VAL B O   1 
ATOM   7412 C CB  . VAL B 1 425 ? 8.679   21.244  -32.556 1.00 40.83  ? 425  VAL B CB  1 
ATOM   7413 C CG1 . VAL B 1 425 ? 8.661   19.729  -32.278 1.00 39.74  ? 425  VAL B CG1 1 
ATOM   7414 C CG2 . VAL B 1 425 ? 9.929   21.647  -33.293 1.00 39.29  ? 425  VAL B CG2 1 
ATOM   7415 N N   . TYR B 1 426 ? 5.411   20.432  -32.892 1.00 39.75  ? 426  TYR B N   1 
ATOM   7416 C CA  . TYR B 1 426 ? 4.276   20.008  -32.064 1.00 39.50  ? 426  TYR B CA  1 
ATOM   7417 C C   . TYR B 1 426 ? 4.495   18.553  -31.682 1.00 39.26  ? 426  TYR B C   1 
ATOM   7418 O O   . TYR B 1 426 ? 4.841   17.731  -32.549 1.00 38.52  ? 426  TYR B O   1 
ATOM   7419 C CB  . TYR B 1 426 ? 2.952   20.168  -32.811 1.00 38.84  ? 426  TYR B CB  1 
ATOM   7420 C CG  . TYR B 1 426 ? 2.541   21.598  -33.080 1.00 38.62  ? 426  TYR B CG  1 
ATOM   7421 C CD1 . TYR B 1 426 ? 2.888   22.228  -34.272 1.00 35.63  ? 426  TYR B CD1 1 
ATOM   7422 C CD2 . TYR B 1 426 ? 1.772   22.325  -32.144 1.00 38.40  ? 426  TYR B CD2 1 
ATOM   7423 C CE1 . TYR B 1 426 ? 2.498   23.538  -34.534 1.00 36.48  ? 426  TYR B CE1 1 
ATOM   7424 C CE2 . TYR B 1 426 ? 1.390   23.638  -32.393 1.00 38.97  ? 426  TYR B CE2 1 
ATOM   7425 C CZ  . TYR B 1 426 ? 1.764   24.242  -33.597 1.00 39.18  ? 426  TYR B CZ  1 
ATOM   7426 O OH  . TYR B 1 426 ? 1.392   25.543  -33.861 1.00 40.61  ? 426  TYR B OH  1 
ATOM   7427 N N   . ALA B 1 427 ? 4.308   18.223  -30.402 1.00 39.55  ? 427  ALA B N   1 
ATOM   7428 C CA  . ALA B 1 427 ? 4.545   16.851  -29.974 1.00 39.38  ? 427  ALA B CA  1 
ATOM   7429 C C   . ALA B 1 427 ? 3.360   16.191  -29.269 1.00 40.56  ? 427  ALA B C   1 
ATOM   7430 O O   . ALA B 1 427 ? 2.506   16.869  -28.668 1.00 40.59  ? 427  ALA B O   1 
ATOM   7431 C CB  . ALA B 1 427 ? 5.781   16.770  -29.116 1.00 38.57  ? 427  ALA B CB  1 
ATOM   7432 N N   . TYR B 1 428 ? 3.342   14.858  -29.321 1.00 40.53  ? 428  TYR B N   1 
ATOM   7433 C CA  . TYR B 1 428 ? 2.281   14.089  -28.696 1.00 41.73  ? 428  TYR B CA  1 
ATOM   7434 C C   . TYR B 1 428 ? 2.786   12.785  -28.109 1.00 42.05  ? 428  TYR B C   1 
ATOM   7435 O O   . TYR B 1 428 ? 3.873   12.301  -28.438 1.00 41.12  ? 428  TYR B O   1 
ATOM   7436 C CB  . TYR B 1 428 ? 1.156   13.762  -29.702 1.00 41.60  ? 428  TYR B CB  1 
ATOM   7437 C CG  . TYR B 1 428 ? 1.585   12.812  -30.819 1.00 41.03  ? 428  TYR B CG  1 
ATOM   7438 C CD1 . TYR B 1 428 ? 1.633   11.422  -30.613 1.00 41.73  ? 428  TYR B CD1 1 
ATOM   7439 C CD2 . TYR B 1 428 ? 1.940   13.304  -32.075 1.00 39.65  ? 428  TYR B CD2 1 
ATOM   7440 C CE1 . TYR B 1 428 ? 2.037   10.543  -31.637 1.00 40.18  ? 428  TYR B CE1 1 
ATOM   7441 C CE2 . TYR B 1 428 ? 2.331   12.463  -33.095 1.00 39.41  ? 428  TYR B CE2 1 
ATOM   7442 C CZ  . TYR B 1 428 ? 2.382   11.080  -32.875 1.00 41.08  ? 428  TYR B CZ  1 
ATOM   7443 O OH  . TYR B 1 428 ? 2.785   10.252  -33.896 1.00 40.30  ? 428  TYR B OH  1 
ATOM   7444 N N   . ILE B 1 429 ? 1.953   12.226  -27.236 1.00 43.24  ? 429  ILE B N   1 
ATOM   7445 C CA  . ILE B 1 429 ? 2.034   10.848  -26.830 1.00 43.34  ? 429  ILE B CA  1 
ATOM   7446 C C   . ILE B 1 429 ? 0.645   10.264  -27.000 1.00 44.36  ? 429  ILE B C   1 
ATOM   7447 O O   . ILE B 1 429 ? -0.373  10.861  -26.573 1.00 45.33  ? 429  ILE B O   1 
ATOM   7448 C CB  . ILE B 1 429 ? 2.575   10.682  -25.396 1.00 44.18  ? 429  ILE B CB  1 
ATOM   7449 C CG1 . ILE B 1 429 ? 2.806   9.186   -25.078 1.00 44.89  ? 429  ILE B CG1 1 
ATOM   7450 C CG2 . ILE B 1 429 ? 1.664   11.363  -24.374 1.00 44.98  ? 429  ILE B CG2 1 
ATOM   7451 C CD1 . ILE B 1 429 ? 3.591   8.913   -23.772 1.00 45.73  ? 429  ILE B CD1 1 
ATOM   7452 N N   . PHE B 1 430 ? 0.604   9.111   -27.657 1.00 44.30  ? 430  PHE B N   1 
ATOM   7453 C CA  . PHE B 1 430 ? -0.642  8.483   -28.054 1.00 45.47  ? 430  PHE B CA  1 
ATOM   7454 C C   . PHE B 1 430 ? -0.920  7.317   -27.094 1.00 46.78  ? 430  PHE B C   1 
ATOM   7455 O O   . PHE B 1 430 ? -0.094  6.404   -26.975 1.00 47.46  ? 430  PHE B O   1 
ATOM   7456 C CB  . PHE B 1 430 ? -0.512  8.012   -29.513 1.00 44.69  ? 430  PHE B CB  1 
ATOM   7457 C CG  . PHE B 1 430 ? -1.764  7.416   -30.071 1.00 45.28  ? 430  PHE B CG  1 
ATOM   7458 C CD1 . PHE B 1 430 ? -2.047  6.054   -29.895 1.00 45.82  ? 430  PHE B CD1 1 
ATOM   7459 C CD2 . PHE B 1 430 ? -2.666  8.209   -30.776 1.00 46.00  ? 430  PHE B CD2 1 
ATOM   7460 C CE1 . PHE B 1 430 ? -3.231  5.480   -30.413 1.00 46.44  ? 430  PHE B CE1 1 
ATOM   7461 C CE2 . PHE B 1 430 ? -3.869  7.662   -31.289 1.00 47.21  ? 430  PHE B CE2 1 
ATOM   7462 C CZ  . PHE B 1 430 ? -4.145  6.286   -31.109 1.00 47.61  ? 430  PHE B CZ  1 
ATOM   7463 N N   . GLU B 1 431 ? -2.067  7.330   -26.418 1.00 47.86  ? 431  GLU B N   1 
ATOM   7464 C CA  . GLU B 1 431 ? -2.274  6.437   -25.263 1.00 49.28  ? 431  GLU B CA  1 
ATOM   7465 C C   . GLU B 1 431 ? -3.524  5.574   -25.333 1.00 50.63  ? 431  GLU B C   1 
ATOM   7466 O O   . GLU B 1 431 ? -3.847  4.886   -24.364 1.00 51.63  ? 431  GLU B O   1 
ATOM   7467 C CB  . GLU B 1 431 ? -2.345  7.235   -23.954 1.00 49.85  ? 431  GLU B CB  1 
ATOM   7468 C CG  . GLU B 1 431 ? -1.132  8.081   -23.659 1.00 50.78  ? 431  GLU B CG  1 
ATOM   7469 C CD  . GLU B 1 431 ? -1.218  8.816   -22.341 1.00 53.37  ? 431  GLU B CD  1 
ATOM   7470 O OE1 . GLU B 1 431 ? -2.299  9.373   -22.036 1.00 55.62  ? 431  GLU B OE1 1 
ATOM   7471 O OE2 . GLU B 1 431 ? -0.193  8.845   -21.617 1.00 53.41  ? 431  GLU B OE2 1 
ATOM   7472 N N   . HIS B 1 432 ? -4.242  5.617   -26.447 1.00 50.43  ? 432  HIS B N   1 
ATOM   7473 C CA  . HIS B 1 432 ? -5.426  4.793   -26.562 1.00 52.12  ? 432  HIS B CA  1 
ATOM   7474 C C   . HIS B 1 432 ? -5.101  3.435   -27.185 1.00 51.93  ? 432  HIS B C   1 
ATOM   7475 O O   . HIS B 1 432 ? -4.572  3.385   -28.284 1.00 51.23  ? 432  HIS B O   1 
ATOM   7476 C CB  . HIS B 1 432 ? -6.509  5.489   -27.379 1.00 52.31  ? 432  HIS B CB  1 
ATOM   7477 C CG  . HIS B 1 432 ? -7.659  4.595   -27.698 1.00 54.71  ? 432  HIS B CG  1 
ATOM   7478 N ND1 . HIS B 1 432 ? -8.603  4.241   -26.759 1.00 57.34  ? 432  HIS B ND1 1 
ATOM   7479 C CD2 . HIS B 1 432 ? -7.992  3.937   -28.836 1.00 55.97  ? 432  HIS B CD2 1 
ATOM   7480 C CE1 . HIS B 1 432 ? -9.484  3.422   -27.312 1.00 58.93  ? 432  HIS B CE1 1 
ATOM   7481 N NE2 . HIS B 1 432 ? -9.138  3.225   -28.573 1.00 58.38  ? 432  HIS B NE2 1 
ATOM   7482 N N   . ARG B 1 433 ? -5.434  2.349   -26.489 1.00 53.04  ? 433  ARG B N   1 
ATOM   7483 C CA  . ARG B 1 433 ? -5.309  0.996   -27.037 1.00 53.46  ? 433  ARG B CA  1 
ATOM   7484 C C   . ARG B 1 433 ? -6.592  0.578   -27.767 1.00 54.80  ? 433  ARG B C   1 
ATOM   7485 O O   . ARG B 1 433 ? -7.701  0.653   -27.205 1.00 56.27  ? 433  ARG B O   1 
ATOM   7486 C CB  . ARG B 1 433 ? -5.014  -0.002  -25.920 1.00 54.56  ? 433  ARG B CB  1 
ATOM   7487 C CG  . ARG B 1 433 ? -4.922  -1.455  -26.365 1.00 55.82  ? 433  ARG B CG  1 
ATOM   7488 C CD  . ARG B 1 433 ? -4.791  -2.361  -25.166 1.00 57.07  ? 433  ARG B CD  1 
ATOM   7489 N NE  . ARG B 1 433 ? -5.111  -3.756  -25.452 1.00 58.98  ? 433  ARG B NE  1 
ATOM   7490 C CZ  . ARG B 1 433 ? -4.207  -4.701  -25.703 1.00 59.87  ? 433  ARG B CZ  1 
ATOM   7491 N NH1 . ARG B 1 433 ? -2.902  -4.402  -25.729 1.00 57.77  ? 433  ARG B NH1 1 
ATOM   7492 N NH2 . ARG B 1 433 ? -4.612  -5.948  -25.923 1.00 59.22  ? 433  ARG B NH2 1 
ATOM   7493 N N   . ALA B 1 434 ? -6.425  0.115   -29.007 1.00 54.30  ? 434  ALA B N   1 
ATOM   7494 C CA  . ALA B 1 434 ? -7.536  -0.250  -29.872 1.00 55.11  ? 434  ALA B CA  1 
ATOM   7495 C C   . ALA B 1 434 ? -8.290  -1.420  -29.274 1.00 57.59  ? 434  ALA B C   1 
ATOM   7496 O O   . ALA B 1 434 ? -7.692  -2.437  -28.929 1.00 58.24  ? 434  ALA B O   1 
ATOM   7497 C CB  . ALA B 1 434 ? -7.036  -0.604  -31.243 1.00 53.81  ? 434  ALA B CB  1 
ATOM   7498 N N   . SER B 1 435 ? -9.603  -1.256  -29.139 1.00 59.14  ? 435  SER B N   1 
ATOM   7499 C CA  . SER B 1 435 ? -10.486 -2.308  -28.672 1.00 61.34  ? 435  SER B CA  1 
ATOM   7500 C C   . SER B 1 435 ? -10.339 -3.593  -29.487 1.00 61.68  ? 435  SER B C   1 
ATOM   7501 O O   . SER B 1 435 ? -10.546 -4.681  -28.966 1.00 63.22  ? 435  SER B O   1 
ATOM   7502 C CB  . SER B 1 435 ? -11.942 -1.819  -28.712 1.00 62.89  ? 435  SER B CB  1 
ATOM   7503 O OG  . SER B 1 435 ? -12.332 -1.474  -30.035 1.00 62.68  ? 435  SER B OG  1 
ATOM   7504 N N   . THR B 1 436 ? -9.972  -3.454  -30.760 1.00 60.85  ? 436  THR B N   1 
ATOM   7505 C CA  . THR B 1 436 ? -9.819  -4.591  -31.691 1.00 61.17  ? 436  THR B CA  1 
ATOM   7506 C C   . THR B 1 436 ? -8.438  -5.254  -31.682 1.00 60.08  ? 436  THR B C   1 
ATOM   7507 O O   . THR B 1 436 ? -8.228  -6.225  -32.416 1.00 60.70  ? 436  THR B O   1 
ATOM   7508 C CB  . THR B 1 436 ? -10.094 -4.156  -33.144 1.00 60.37  ? 436  THR B CB  1 
ATOM   7509 O OG1 . THR B 1 436 ? -9.162  -3.124  -33.526 1.00 59.73  ? 436  THR B OG1 1 
ATOM   7510 C CG2 . THR B 1 436 ? -11.535 -3.650  -33.292 1.00 61.86  ? 436  THR B CG2 1 
ATOM   7511 N N   . LEU B 1 437 ? -7.507  -4.732  -30.872 1.00 58.58  ? 437  LEU B N   1 
ATOM   7512 C CA  . LEU B 1 437 ? -6.118  -5.207  -30.829 1.00 57.19  ? 437  LEU B CA  1 
ATOM   7513 C C   . LEU B 1 437 ? -5.974  -6.700  -30.495 1.00 58.67  ? 437  LEU B C   1 
ATOM   7514 O O   . LEU B 1 437 ? -6.647  -7.211  -29.596 1.00 60.38  ? 437  LEU B O   1 
ATOM   7515 C CB  . LEU B 1 437 ? -5.324  -4.366  -29.835 1.00 56.26  ? 437  LEU B CB  1 
ATOM   7516 C CG  . LEU B 1 437 ? -3.818  -4.156  -30.055 1.00 54.59  ? 437  LEU B CG  1 
ATOM   7517 C CD1 . LEU B 1 437 ? -3.462  -4.147  -31.500 1.00 54.46  ? 437  LEU B CD1 1 
ATOM   7518 C CD2 . LEU B 1 437 ? -3.378  -2.863  -29.440 1.00 52.88  ? 437  LEU B CD2 1 
ATOM   7519 N N   . THR B 1 438 ? -5.108  -7.406  -31.219 1.00 57.89  ? 438  THR B N   1 
ATOM   7520 C CA  . THR B 1 438 ? -4.977  -8.856  -30.993 1.00 59.25  ? 438  THR B CA  1 
ATOM   7521 C C   . THR B 1 438 ? -3.751  -9.275  -30.181 1.00 58.43  ? 438  THR B C   1 
ATOM   7522 O O   . THR B 1 438 ? -3.683  -10.408 -29.702 1.00 59.79  ? 438  THR B O   1 
ATOM   7523 C CB  . THR B 1 438 ? -5.053  -9.655  -32.305 1.00 59.83  ? 438  THR B CB  1 
ATOM   7524 O OG1 . THR B 1 438 ? -4.201  -9.056  -33.293 1.00 58.22  ? 438  THR B OG1 1 
ATOM   7525 C CG2 . THR B 1 438 ? -6.474  -9.666  -32.810 1.00 61.16  ? 438  THR B CG2 1 
ATOM   7526 N N   . TRP B 1 439 ? -2.788  -8.361  -30.043 1.00 56.19  ? 439  TRP B N   1 
ATOM   7527 C CA  . TRP B 1 439 ? -1.672  -8.533  -29.120 1.00 55.50  ? 439  TRP B CA  1 
ATOM   7528 C C   . TRP B 1 439 ? -2.200  -8.525  -27.683 1.00 56.83  ? 439  TRP B C   1 
ATOM   7529 O O   . TRP B 1 439 ? -3.233  -7.910  -27.412 1.00 57.55  ? 439  TRP B O   1 
ATOM   7530 C CB  . TRP B 1 439 ? -0.657  -7.413  -29.304 1.00 53.45  ? 439  TRP B CB  1 
ATOM   7531 C CG  . TRP B 1 439 ? 0.011   -7.392  -30.645 1.00 52.00  ? 439  TRP B CG  1 
ATOM   7532 C CD1 . TRP B 1 439 ? -0.303  -6.585  -31.696 1.00 50.79  ? 439  TRP B CD1 1 
ATOM   7533 C CD2 . TRP B 1 439 ? 1.115   -8.205  -31.079 1.00 51.36  ? 439  TRP B CD2 1 
ATOM   7534 N NE1 . TRP B 1 439 ? 0.528   -6.844  -32.761 1.00 49.61  ? 439  TRP B NE1 1 
ATOM   7535 C CE2 . TRP B 1 439 ? 1.410   -7.831  -32.410 1.00 50.03  ? 439  TRP B CE2 1 
ATOM   7536 C CE3 . TRP B 1 439 ? 1.874   -9.220  -30.477 1.00 52.10  ? 439  TRP B CE3 1 
ATOM   7537 C CZ2 . TRP B 1 439 ? 2.434   -8.434  -33.154 1.00 49.17  ? 439  TRP B CZ2 1 
ATOM   7538 C CZ3 . TRP B 1 439 ? 2.895   -9.814  -31.210 1.00 51.49  ? 439  TRP B CZ3 1 
ATOM   7539 C CH2 . TRP B 1 439 ? 3.164   -9.419  -32.538 1.00 50.82  ? 439  TRP B CH2 1 
ATOM   7540 N N   . PRO B 1 440 ? -1.504  -9.200  -26.750 1.00 57.49  ? 440  PRO B N   1 
ATOM   7541 C CA  . PRO B 1 440 ? -2.013  -9.269  -25.369 1.00 58.76  ? 440  PRO B CA  1 
ATOM   7542 C C   . PRO B 1 440 ? -1.981  -7.930  -24.613 1.00 58.17  ? 440  PRO B C   1 
ATOM   7543 O O   . PRO B 1 440 ? -1.247  -6.995  -24.993 1.00 56.12  ? 440  PRO B O   1 
ATOM   7544 C CB  . PRO B 1 440 ? -1.077  -10.273 -24.703 1.00 59.58  ? 440  PRO B CB  1 
ATOM   7545 C CG  . PRO B 1 440 ? 0.178   -10.183 -25.480 1.00 58.36  ? 440  PRO B CG  1 
ATOM   7546 C CD  . PRO B 1 440 ? -0.201  -9.871  -26.896 1.00 57.08  ? 440  PRO B CD  1 
ATOM   7547 N N   . LEU B 1 441 ? -2.761  -7.860  -23.537 1.00 59.70  ? 441  LEU B N   1 
ATOM   7548 C CA  . LEU B 1 441 ? -2.910  -6.633  -22.755 1.00 59.67  ? 441  LEU B CA  1 
ATOM   7549 C C   . LEU B 1 441 ? -1.611  -6.056  -22.205 1.00 58.13  ? 441  LEU B C   1 
ATOM   7550 O O   . LEU B 1 441 ? -1.482  -4.838  -22.026 1.00 57.53  ? 441  LEU B O   1 
ATOM   7551 C CB  . LEU B 1 441 ? -3.896  -6.849  -21.610 1.00 62.05  ? 441  LEU B CB  1 
ATOM   7552 C CG  . LEU B 1 441 ? -5.356  -6.862  -22.082 1.00 65.63  ? 441  LEU B CG  1 
ATOM   7553 C CD1 . LEU B 1 441 ? -6.252  -7.820  -21.237 1.00 70.06  ? 441  LEU B CD1 1 
ATOM   7554 C CD2 . LEU B 1 441 ? -5.931  -5.430  -22.138 1.00 66.31  ? 441  LEU B CD2 1 
ATOM   7555 N N   . TRP B 1 442 ? -0.639  -6.914  -21.942 1.00 57.81  ? 442  TRP B N   1 
ATOM   7556 C CA  . TRP B 1 442 ? 0.568   -6.442  -21.289 1.00 56.32  ? 442  TRP B CA  1 
ATOM   7557 C C   . TRP B 1 442 ? 1.446   -5.609  -22.223 1.00 54.01  ? 442  TRP B C   1 
ATOM   7558 O O   . TRP B 1 442 ? 2.322   -4.858  -21.769 1.00 53.07  ? 442  TRP B O   1 
ATOM   7559 C CB  . TRP B 1 442 ? 1.333   -7.604  -20.649 1.00 57.46  ? 442  TRP B CB  1 
ATOM   7560 C CG  . TRP B 1 442 ? 1.998   -8.569  -21.603 1.00 56.59  ? 442  TRP B CG  1 
ATOM   7561 C CD1 . TRP B 1 442 ? 1.593   -9.840  -21.903 1.00 57.63  ? 442  TRP B CD1 1 
ATOM   7562 C CD2 . TRP B 1 442 ? 3.207   -8.347  -22.342 1.00 53.84  ? 442  TRP B CD2 1 
ATOM   7563 N NE1 . TRP B 1 442 ? 2.473   -10.416 -22.787 1.00 56.95  ? 442  TRP B NE1 1 
ATOM   7564 C CE2 . TRP B 1 442 ? 3.471   -9.520  -23.071 1.00 54.71  ? 442  TRP B CE2 1 
ATOM   7565 C CE3 . TRP B 1 442 ? 4.092   -7.261  -22.459 1.00 51.45  ? 442  TRP B CE3 1 
ATOM   7566 C CZ2 . TRP B 1 442 ? 4.592   -9.646  -23.906 1.00 54.43  ? 442  TRP B CZ2 1 
ATOM   7567 C CZ3 . TRP B 1 442 ? 5.188   -7.374  -23.294 1.00 50.35  ? 442  TRP B CZ3 1 
ATOM   7568 C CH2 . TRP B 1 442 ? 5.434   -8.559  -24.013 1.00 50.84  ? 442  TRP B CH2 1 
ATOM   7569 N N   . MET B 1 443 ? 1.205   -5.727  -23.526 1.00 52.81  ? 443  MET B N   1 
ATOM   7570 C CA  . MET B 1 443 ? 1.969   -4.956  -24.497 1.00 50.74  ? 443  MET B CA  1 
ATOM   7571 C C   . MET B 1 443 ? 1.464   -3.525  -24.584 1.00 49.83  ? 443  MET B C   1 
ATOM   7572 O O   . MET B 1 443 ? 2.131   -2.666  -25.156 1.00 48.47  ? 443  MET B O   1 
ATOM   7573 C CB  . MET B 1 443 ? 1.936   -5.609  -25.875 1.00 50.15  ? 443  MET B CB  1 
ATOM   7574 C CG  . MET B 1 443 ? 2.814   -6.829  -25.984 1.00 51.57  ? 443  MET B CG  1 
ATOM   7575 S SD  . MET B 1 443 ? 2.908   -7.476  -27.658 1.00 52.95  ? 443  MET B SD  1 
ATOM   7576 C CE  . MET B 1 443 ? 3.993   -8.890  -27.437 1.00 52.04  ? 443  MET B CE  1 
ATOM   7577 N N   . GLY B 1 444 ? 0.276   -3.281  -24.037 1.00 50.61  ? 444  GLY B N   1 
ATOM   7578 C CA  . GLY B 1 444 ? -0.273  -1.944  -23.980 1.00 50.06  ? 444  GLY B CA  1 
ATOM   7579 C C   . GLY B 1 444 ? -0.676  -1.373  -25.324 1.00 49.21  ? 444  GLY B C   1 
ATOM   7580 O O   . GLY B 1 444 ? -1.593  -1.884  -25.968 1.00 50.32  ? 444  GLY B O   1 
ATOM   7581 N N   . VAL B 1 445 ? -0.017  -0.283  -25.718 1.00 47.73  ? 445  VAL B N   1 
ATOM   7582 C CA  . VAL B 1 445 ? -0.283  0.398   -26.975 1.00 46.34  ? 445  VAL B CA  1 
ATOM   7583 C C   . VAL B 1 445 ? 1.034   0.275   -27.692 1.00 45.96  ? 445  VAL B C   1 
ATOM   7584 O O   . VAL B 1 445 ? 1.953   1.040   -27.423 1.00 45.99  ? 445  VAL B O   1 
ATOM   7585 C CB  . VAL B 1 445 ? -0.631  1.898   -26.767 1.00 45.78  ? 445  VAL B CB  1 
ATOM   7586 C CG1 . VAL B 1 445 ? -1.001  2.565   -28.096 1.00 43.43  ? 445  VAL B CG1 1 
ATOM   7587 C CG2 . VAL B 1 445 ? -1.766  2.069   -25.748 1.00 45.78  ? 445  VAL B CG2 1 
ATOM   7588 N N   . PRO B 1 446 ? 1.159   -0.739  -28.559 1.00 46.38  ? 446  PRO B N   1 
ATOM   7589 C CA  . PRO B 1 446 ? 2.473   -1.078  -29.115 1.00 45.46  ? 446  PRO B CA  1 
ATOM   7590 C C   . PRO B 1 446 ? 2.836   -0.233  -30.321 1.00 44.51  ? 446  PRO B C   1 
ATOM   7591 O O   . PRO B 1 446 ? 1.986   0.434   -30.900 1.00 44.81  ? 446  PRO B O   1 
ATOM   7592 C CB  . PRO B 1 446 ? 2.328   -2.560  -29.518 1.00 45.91  ? 446  PRO B CB  1 
ATOM   7593 C CG  . PRO B 1 446 ? 0.949   -3.000  -28.993 1.00 47.59  ? 446  PRO B CG  1 
ATOM   7594 C CD  . PRO B 1 446 ? 0.139   -1.753  -28.890 1.00 47.25  ? 446  PRO B CD  1 
ATOM   7595 N N   . HIS B 1 447 ? 4.109   -0.277  -30.685 1.00 44.18  ? 447  HIS B N   1 
ATOM   7596 C CA  . HIS B 1 447 ? 4.652   0.374   -31.859 1.00 43.37  ? 447  HIS B CA  1 
ATOM   7597 C C   . HIS B 1 447 ? 3.791   0.097   -33.091 1.00 43.47  ? 447  HIS B C   1 
ATOM   7598 O O   . HIS B 1 447 ? 3.595   -1.057  -33.467 1.00 44.66  ? 447  HIS B O   1 
ATOM   7599 C CB  . HIS B 1 447 ? 6.053   -0.188  -32.039 1.00 43.44  ? 447  HIS B CB  1 
ATOM   7600 C CG  . HIS B 1 447 ? 6.885   0.527   -33.052 1.00 44.19  ? 447  HIS B CG  1 
ATOM   7601 N ND1 . HIS B 1 447 ? 7.329   1.821   -32.876 1.00 43.17  ? 447  HIS B ND1 1 
ATOM   7602 C CD2 . HIS B 1 447 ? 7.388   0.112   -34.240 1.00 44.05  ? 447  HIS B CD2 1 
ATOM   7603 C CE1 . HIS B 1 447 ? 8.057   2.177   -33.920 1.00 43.39  ? 447  HIS B CE1 1 
ATOM   7604 N NE2 . HIS B 1 447 ? 8.117   1.154   -34.757 1.00 42.94  ? 447  HIS B NE2 1 
ATOM   7605 N N   . GLY B 1 448 ? 3.238   1.150   -33.692 1.00 42.93  ? 448  GLY B N   1 
ATOM   7606 C CA  . GLY B 1 448 ? 2.463   1.022   -34.934 1.00 42.37  ? 448  GLY B CA  1 
ATOM   7607 C C   . GLY B 1 448 ? 0.956   1.159   -34.768 1.00 43.28  ? 448  GLY B C   1 
ATOM   7608 O O   . GLY B 1 448 ? 0.235   1.319   -35.755 1.00 43.33  ? 448  GLY B O   1 
ATOM   7609 N N   . TYR B 1 449 ? 0.458   1.120   -33.536 1.00 43.58  ? 449  TYR B N   1 
ATOM   7610 C CA  . TYR B 1 449 ? -1.001  1.020   -33.355 1.00 44.40  ? 449  TYR B CA  1 
ATOM   7611 C C   . TYR B 1 449 ? -1.797  2.340   -33.244 1.00 44.33  ? 449  TYR B C   1 
ATOM   7612 O O   . TYR B 1 449 ? -2.949  2.346   -32.849 1.00 44.60  ? 449  TYR B O   1 
ATOM   7613 C CB  . TYR B 1 449 ? -1.356  -0.050  -32.310 1.00 45.10  ? 449  TYR B CB  1 
ATOM   7614 C CG  . TYR B 1 449 ? -1.072  -1.386  -32.903 1.00 44.11  ? 449  TYR B CG  1 
ATOM   7615 C CD1 . TYR B 1 449 ? 0.182   -1.969  -32.792 1.00 43.29  ? 449  TYR B CD1 1 
ATOM   7616 C CD2 . TYR B 1 449 ? -2.025  -2.022  -33.667 1.00 44.88  ? 449  TYR B CD2 1 
ATOM   7617 C CE1 . TYR B 1 449 ? 0.458   -3.190  -33.388 1.00 44.11  ? 449  TYR B CE1 1 
ATOM   7618 C CE2 . TYR B 1 449 ? -1.769  -3.246  -34.274 1.00 45.73  ? 449  TYR B CE2 1 
ATOM   7619 C CZ  . TYR B 1 449 ? -0.525  -3.823  -34.137 1.00 45.53  ? 449  TYR B CZ  1 
ATOM   7620 O OH  . TYR B 1 449 ? -0.282  -5.032  -34.762 1.00 46.42  ? 449  TYR B OH  1 
ATOM   7621 N N   . GLU B 1 450 ? -1.168  3.439   -33.656 1.00 43.51  ? 450  GLU B N   1 
ATOM   7622 C CA  . GLU B 1 450 ? -1.870  4.700   -33.846 1.00 43.74  ? 450  GLU B CA  1 
ATOM   7623 C C   . GLU B 1 450 ? -2.296  4.882   -35.315 1.00 44.17  ? 450  GLU B C   1 
ATOM   7624 O O   . GLU B 1 450 ? -3.232  5.643   -35.612 1.00 45.08  ? 450  GLU B O   1 
ATOM   7625 C CB  . GLU B 1 450 ? -0.988  5.865   -33.409 1.00 42.24  ? 450  GLU B CB  1 
ATOM   7626 C CG  . GLU B 1 450 ? -0.044  6.363   -34.471 1.00 41.17  ? 450  GLU B CG  1 
ATOM   7627 C CD  . GLU B 1 450 ? 1.259   5.563   -34.586 1.00 41.73  ? 450  GLU B CD  1 
ATOM   7628 O OE1 . GLU B 1 450 ? 1.302   4.376   -34.168 1.00 41.15  ? 450  GLU B OE1 1 
ATOM   7629 O OE2 . GLU B 1 450 ? 2.246   6.141   -35.110 1.00 40.50  ? 450  GLU B OE2 1 
ATOM   7630 N N   . ILE B 1 451 ? -1.618  4.178   -36.222 1.00 43.47  ? 451  ILE B N   1 
ATOM   7631 C CA  . ILE B 1 451 ? -1.778  4.399   -37.658 1.00 43.14  ? 451  ILE B CA  1 
ATOM   7632 C C   . ILE B 1 451 ? -3.233  4.246   -38.091 1.00 44.61  ? 451  ILE B C   1 
ATOM   7633 O O   . ILE B 1 451 ? -3.844  5.180   -38.586 1.00 45.55  ? 451  ILE B O   1 
ATOM   7634 C CB  . ILE B 1 451 ? -0.829  3.499   -38.478 1.00 42.34  ? 451  ILE B CB  1 
ATOM   7635 C CG1 . ILE B 1 451 ? 0.637   3.788   -38.087 1.00 41.40  ? 451  ILE B CG1 1 
ATOM   7636 C CG2 . ILE B 1 451 ? -1.030  3.747   -39.955 1.00 41.02  ? 451  ILE B CG2 1 
ATOM   7637 C CD1 . ILE B 1 451 ? 1.615   2.737   -38.507 1.00 39.88  ? 451  ILE B CD1 1 
ATOM   7638 N N   . GLU B 1 452 ? -3.737  3.032   -37.950 1.00 45.80  ? 452  GLU B N   1 
ATOM   7639 C CA  . GLU B 1 452 ? -5.145  2.688   -37.826 1.00 47.26  ? 452  GLU B CA  1 
ATOM   7640 C C   . GLU B 1 452 ? -6.082  3.890   -37.576 1.00 47.57  ? 452  GLU B C   1 
ATOM   7641 O O   . GLU B 1 452 ? -7.108  4.045   -38.248 1.00 48.72  ? 452  GLU B O   1 
ATOM   7642 C CB  . GLU B 1 452 ? -5.169  1.807   -36.596 1.00 48.69  ? 452  GLU B CB  1 
ATOM   7643 C CG  . GLU B 1 452 ? -6.173  0.755   -36.498 1.00 52.73  ? 452  GLU B CG  1 
ATOM   7644 C CD  . GLU B 1 452 ? -5.735  -0.328  -35.519 1.00 55.30  ? 452  GLU B CD  1 
ATOM   7645 O OE1 . GLU B 1 452 ? -4.566  -0.766  -35.586 1.00 53.09  ? 452  GLU B OE1 1 
ATOM   7646 O OE2 . GLU B 1 452 ? -6.580  -0.770  -34.709 1.00 60.22  ? 452  GLU B OE2 1 
ATOM   7647 N N   . PHE B 1 453 ? -5.729  4.721   -36.591 1.00 46.18  ? 453  PHE B N   1 
ATOM   7648 C CA  . PHE B 1 453 ? -6.562  5.839   -36.158 1.00 46.03  ? 453  PHE B CA  1 
ATOM   7649 C C   . PHE B 1 453 ? -6.372  7.113   -36.966 1.00 45.05  ? 453  PHE B C   1 
ATOM   7650 O O   . PHE B 1 453 ? -7.344  7.778   -37.297 1.00 45.94  ? 453  PHE B O   1 
ATOM   7651 C CB  . PHE B 1 453 ? -6.346  6.118   -34.662 1.00 45.96  ? 453  PHE B CB  1 
ATOM   7652 C CG  . PHE B 1 453 ? -6.838  5.019   -33.784 1.00 46.50  ? 453  PHE B CG  1 
ATOM   7653 C CD1 . PHE B 1 453 ? -8.183  4.935   -33.449 1.00 47.44  ? 453  PHE B CD1 1 
ATOM   7654 C CD2 . PHE B 1 453 ? -5.971  4.034   -33.331 1.00 45.54  ? 453  PHE B CD2 1 
ATOM   7655 C CE1 . PHE B 1 453 ? -8.660  3.910   -32.635 1.00 48.50  ? 453  PHE B CE1 1 
ATOM   7656 C CE2 . PHE B 1 453 ? -6.433  2.996   -32.526 1.00 46.59  ? 453  PHE B CE2 1 
ATOM   7657 C CZ  . PHE B 1 453 ? -7.791  2.937   -32.178 1.00 49.15  ? 453  PHE B CZ  1 
ATOM   7658 N N   . ILE B 1 454 ? -5.119  7.466   -37.240 1.00 43.47  ? 454  ILE B N   1 
ATOM   7659 C CA  . ILE B 1 454 ? -4.803  8.590   -38.092 1.00 42.65  ? 454  ILE B CA  1 
ATOM   7660 C C   . ILE B 1 454 ? -5.438  8.390   -39.468 1.00 43.42  ? 454  ILE B C   1 
ATOM   7661 O O   . ILE B 1 454 ? -5.992  9.335   -40.011 1.00 44.26  ? 454  ILE B O   1 
ATOM   7662 C CB  . ILE B 1 454 ? -3.287  8.756   -38.284 1.00 41.68  ? 454  ILE B CB  1 
ATOM   7663 C CG1 . ILE B 1 454 ? -2.519  8.745   -36.943 1.00 41.29  ? 454  ILE B CG1 1 
ATOM   7664 C CG2 . ILE B 1 454 ? -2.973  9.984   -39.153 1.00 40.51  ? 454  ILE B CG2 1 
ATOM   7665 C CD1 . ILE B 1 454 ? -2.958  9.773   -35.952 1.00 43.53  ? 454  ILE B CD1 1 
ATOM   7666 N N   . PHE B 1 455 ? -5.362  7.174   -40.024 1.00 43.48  ? 455  PHE B N   1 
ATOM   7667 C CA  . PHE B 1 455 ? -5.941  6.872   -41.351 1.00 43.99  ? 455  PHE B CA  1 
ATOM   7668 C C   . PHE B 1 455 ? -7.472  6.765   -41.359 1.00 45.52  ? 455  PHE B C   1 
ATOM   7669 O O   . PHE B 1 455 ? -8.072  6.719   -42.414 1.00 45.98  ? 455  PHE B O   1 
ATOM   7670 C CB  . PHE B 1 455 ? -5.289  5.641   -42.003 1.00 43.61  ? 455  PHE B CB  1 
ATOM   7671 C CG  . PHE B 1 455 ? -4.006  5.951   -42.730 1.00 41.84  ? 455  PHE B CG  1 
ATOM   7672 C CD1 . PHE B 1 455 ? -2.785  5.949   -42.057 1.00 41.93  ? 455  PHE B CD1 1 
ATOM   7673 C CD2 . PHE B 1 455 ? -4.012  6.265   -44.072 1.00 42.32  ? 455  PHE B CD2 1 
ATOM   7674 C CE1 . PHE B 1 455 ? -1.566  6.259   -42.719 1.00 39.77  ? 455  PHE B CE1 1 
ATOM   7675 C CE2 . PHE B 1 455 ? -2.789  6.571   -44.752 1.00 42.08  ? 455  PHE B CE2 1 
ATOM   7676 C CZ  . PHE B 1 455 ? -1.574  6.566   -44.063 1.00 39.52  ? 455  PHE B CZ  1 
ATOM   7677 N N   . GLY B 1 456 ? -8.091  6.730   -40.185 1.00 46.32  ? 456  GLY B N   1 
ATOM   7678 C CA  . GLY B 1 456 ? -9.537  6.822   -40.079 1.00 48.53  ? 456  GLY B CA  1 
ATOM   7679 C C   . GLY B 1 456 ? -10.318 5.527   -40.218 1.00 50.51  ? 456  GLY B C   1 
ATOM   7680 O O   . GLY B 1 456 ? -11.538 5.550   -40.435 1.00 52.16  ? 456  GLY B O   1 
ATOM   7681 N N   . LEU B 1 457 ? -9.634  4.399   -40.055 1.00 50.27  ? 457  LEU B N   1 
ATOM   7682 C CA  . LEU B 1 457 ? -10.271 3.099   -40.179 1.00 52.14  ? 457  LEU B CA  1 
ATOM   7683 C C   . LEU B 1 457 ? -11.467 2.869   -39.250 1.00 54.77  ? 457  LEU B C   1 
ATOM   7684 O O   . LEU B 1 457 ? -12.419 2.205   -39.641 1.00 56.77  ? 457  LEU B O   1 
ATOM   7685 C CB  . LEU B 1 457 ? -9.249  1.982   -40.013 1.00 51.07  ? 457  LEU B CB  1 
ATOM   7686 C CG  . LEU B 1 457 ? -8.607  1.508   -41.306 1.00 49.45  ? 457  LEU B CG  1 
ATOM   7687 C CD1 . LEU B 1 457 ? -7.600  2.554   -41.817 1.00 45.92  ? 457  LEU B CD1 1 
ATOM   7688 C CD2 . LEU B 1 457 ? -7.928  0.181   -41.021 1.00 49.03  ? 457  LEU B CD2 1 
ATOM   7689 N N   . PRO B 1 458 ? -11.444 3.420   -38.028 1.00 55.55  ? 458  PRO B N   1 
ATOM   7690 C CA  . PRO B 1 458 ? -12.633 3.175   -37.225 1.00 58.19  ? 458  PRO B CA  1 
ATOM   7691 C C   . PRO B 1 458 ? -13.937 3.677   -37.840 1.00 60.93  ? 458  PRO B C   1 
ATOM   7692 O O   . PRO B 1 458 ? -15.003 3.318   -37.347 1.00 63.58  ? 458  PRO B O   1 
ATOM   7693 C CB  . PRO B 1 458 ? -12.334 3.928   -35.943 1.00 58.11  ? 458  PRO B CB  1 
ATOM   7694 C CG  . PRO B 1 458 ? -10.833 3.930   -35.856 1.00 54.96  ? 458  PRO B CG  1 
ATOM   7695 C CD  . PRO B 1 458 ? -10.368 4.056   -37.246 1.00 53.83  ? 458  PRO B CD  1 
ATOM   7696 N N   . LEU B 1 459 ? -13.875 4.472   -38.909 1.00 61.37  ? 459  LEU B N   1 
ATOM   7697 C CA  . LEU B 1 459 ? -15.103 4.994   -39.543 1.00 64.00  ? 459  LEU B CA  1 
ATOM   7698 C C   . LEU B 1 459 ? -15.806 3.961   -40.423 1.00 65.87  ? 459  LEU B C   1 
ATOM   7699 O O   . LEU B 1 459 ? -16.927 4.179   -40.885 1.00 67.29  ? 459  LEU B O   1 
ATOM   7700 C CB  . LEU B 1 459 ? -14.805 6.241   -40.376 1.00 63.28  ? 459  LEU B CB  1 
ATOM   7701 C CG  . LEU B 1 459 ? -14.660 7.626   -39.744 1.00 63.65  ? 459  LEU B CG  1 
ATOM   7702 C CD1 . LEU B 1 459 ? -13.498 7.735   -38.731 1.00 62.77  ? 459  LEU B CD1 1 
ATOM   7703 C CD2 . LEU B 1 459 ? -14.460 8.628   -40.870 1.00 63.38  ? 459  LEU B CD2 1 
ATOM   7704 N N   . ASP B 1 460 ? -15.121 2.851   -40.672 1.00 66.19  ? 460  ASP B N   1 
ATOM   7705 C CA  . ASP B 1 460 ? -15.705 1.710   -41.368 1.00 68.54  ? 460  ASP B CA  1 
ATOM   7706 C C   . ASP B 1 460 ? -16.458 0.869   -40.343 1.00 70.66  ? 460  ASP B C   1 
ATOM   7707 O O   . ASP B 1 460 ? -15.845 0.235   -39.480 1.00 70.46  ? 460  ASP B O   1 
ATOM   7708 C CB  . ASP B 1 460 ? -14.606 0.886   -42.063 1.00 67.01  ? 460  ASP B CB  1 
ATOM   7709 C CG  . ASP B 1 460 ? -15.162 -0.151  -43.041 1.00 69.40  ? 460  ASP B CG  1 
ATOM   7710 O OD1 . ASP B 1 460 ? -16.393 -0.451  -43.016 1.00 71.87  ? 460  ASP B OD1 1 
ATOM   7711 O OD2 . ASP B 1 460 ? -14.351 -0.678  -43.839 1.00 68.17  ? 460  ASP B OD2 1 
ATOM   7712 N N   . PRO B 1 461 ? -17.794 0.867   -40.422 1.00 73.67  ? 461  PRO B N   1 
ATOM   7713 C CA  . PRO B 1 461 ? -18.582 0.190   -39.383 1.00 75.97  ? 461  PRO B CA  1 
ATOM   7714 C C   . PRO B 1 461 ? -18.348 -1.328  -39.344 1.00 76.60  ? 461  PRO B C   1 
ATOM   7715 O O   . PRO B 1 461 ? -18.464 -1.941  -38.279 1.00 77.88  ? 461  PRO B O   1 
ATOM   7716 C CB  . PRO B 1 461 ? -20.040 0.512   -39.768 1.00 78.42  ? 461  PRO B CB  1 
ATOM   7717 C CG  . PRO B 1 461 ? -19.958 1.629   -40.781 1.00 77.54  ? 461  PRO B CG  1 
ATOM   7718 C CD  . PRO B 1 461 ? -18.651 1.415   -41.490 1.00 75.10  ? 461  PRO B CD  1 
ATOM   7719 N N   . SER B 1 462 ? -18.016 -1.917  -40.491 1.00 76.14  ? 462  SER B N   1 
ATOM   7720 C CA  . SER B 1 462 ? -17.706 -3.346  -40.588 1.00 76.45  ? 462  SER B CA  1 
ATOM   7721 C C   . SER B 1 462 ? -16.445 -3.773  -39.804 1.00 75.24  ? 462  SER B C   1 
ATOM   7722 O O   . SER B 1 462 ? -16.212 -4.973  -39.618 1.00 76.03  ? 462  SER B O   1 
ATOM   7723 C CB  . SER B 1 462 ? -17.561 -3.749  -42.061 1.00 76.29  ? 462  SER B CB  1 
ATOM   7724 O OG  . SER B 1 462 ? -16.364 -3.244  -42.632 1.00 72.79  ? 462  SER B OG  1 
ATOM   7725 N N   . LEU B 1 463 ? -15.633 -2.809  -39.356 1.00 73.01  ? 463  LEU B N   1 
ATOM   7726 C CA  . LEU B 1 463 ? -14.411 -3.138  -38.627 1.00 71.43  ? 463  LEU B CA  1 
ATOM   7727 C C   . LEU B 1 463 ? -14.582 -3.220  -37.097 1.00 72.40  ? 463  LEU B C   1 
ATOM   7728 O O   . LEU B 1 463 ? -13.626 -3.514  -36.365 1.00 71.39  ? 463  LEU B O   1 
ATOM   7729 C CB  . LEU B 1 463 ? -13.267 -2.202  -39.025 1.00 68.83  ? 463  LEU B CB  1 
ATOM   7730 C CG  . LEU B 1 463 ? -12.645 -2.353  -40.427 1.00 67.73  ? 463  LEU B CG  1 
ATOM   7731 C CD1 . LEU B 1 463 ? -11.513 -1.332  -40.606 1.00 64.70  ? 463  LEU B CD1 1 
ATOM   7732 C CD2 . LEU B 1 463 ? -12.137 -3.777  -40.721 1.00 65.13  ? 463  LEU B CD2 1 
ATOM   7733 N N   . ASN B 1 464 ? -15.806 -2.977  -36.634 1.00 74.26  ? 464  ASN B N   1 
ATOM   7734 C CA  . ASN B 1 464 ? -16.196 -3.161  -35.228 1.00 75.70  ? 464  ASN B CA  1 
ATOM   7735 C C   . ASN B 1 464 ? -15.458 -2.308  -34.179 1.00 73.20  ? 464  ASN B C   1 
ATOM   7736 O O   . ASN B 1 464 ? -15.312 -2.719  -33.023 1.00 73.69  ? 464  ASN B O   1 
ATOM   7737 C CB  . ASN B 1 464 ? -16.156 -4.656  -34.843 1.00 77.83  ? 464  ASN B CB  1 
ATOM   7738 C CG  . ASN B 1 464 ? -17.263 -5.470  -35.511 1.00 83.04  ? 464  ASN B CG  1 
ATOM   7739 O OD1 . ASN B 1 464 ? -18.445 -5.340  -35.176 1.00 86.59  ? 464  ASN B OD1 1 
ATOM   7740 N ND2 . ASN B 1 464 ? -16.878 -6.328  -36.455 1.00 86.54  ? 464  ASN B ND2 1 
ATOM   7741 N N   . TYR B 1 465 ? -15.006 -1.116  -34.567 1.00 70.30  ? 465  TYR B N   1 
ATOM   7742 C CA  . TYR B 1 465 ? -14.494 -0.151  -33.579 1.00 67.68  ? 465  TYR B CA  1 
ATOM   7743 C C   . TYR B 1 465 ? -15.671 0.490   -32.838 1.00 68.99  ? 465  TYR B C   1 
ATOM   7744 O O   . TYR B 1 465 ? -16.729 0.686   -33.422 1.00 70.51  ? 465  TYR B O   1 
ATOM   7745 C CB  . TYR B 1 465 ? -13.674 0.939   -34.259 1.00 65.08  ? 465  TYR B CB  1 
ATOM   7746 C CG  . TYR B 1 465 ? -12.341 0.517   -34.815 1.00 61.06  ? 465  TYR B CG  1 
ATOM   7747 C CD1 . TYR B 1 465 ? -11.167 0.726   -34.093 1.00 59.05  ? 465  TYR B CD1 1 
ATOM   7748 C CD2 . TYR B 1 465 ? -12.242 -0.059  -36.073 1.00 59.38  ? 465  TYR B CD2 1 
ATOM   7749 C CE1 . TYR B 1 465 ? -9.922  0.360   -34.610 1.00 57.41  ? 465  TYR B CE1 1 
ATOM   7750 C CE2 . TYR B 1 465 ? -11.012 -0.434  -36.608 1.00 56.72  ? 465  TYR B CE2 1 
ATOM   7751 C CZ  . TYR B 1 465 ? -9.846  -0.219  -35.879 1.00 57.49  ? 465  TYR B CZ  1 
ATOM   7752 O OH  . TYR B 1 465 ? -8.614  -0.584  -36.414 1.00 53.90  ? 465  TYR B OH  1 
ATOM   7753 N N   . THR B 1 466 ? -15.488 0.814   -31.561 1.00 68.60  ? 466  THR B N   1 
ATOM   7754 C CA  . THR B 1 466 ? -16.533 1.467   -30.762 1.00 69.91  ? 466  THR B CA  1 
ATOM   7755 C C   . THR B 1 466 ? -16.823 2.887   -31.234 1.00 69.49  ? 466  THR B C   1 
ATOM   7756 O O   . THR B 1 466 ? -15.990 3.517   -31.862 1.00 67.70  ? 466  THR B O   1 
ATOM   7757 C CB  . THR B 1 466 ? -16.174 1.555   -29.246 1.00 70.16  ? 466  THR B CB  1 
ATOM   7758 O OG1 . THR B 1 466 ? -15.260 2.640   -29.009 1.00 67.50  ? 466  THR B OG1 1 
ATOM   7759 C CG2 . THR B 1 466 ? -15.598 0.248   -28.730 1.00 69.72  ? 466  THR B CG2 1 
ATOM   7760 N N   . THR B 1 467 ? -18.007 3.384   -30.898 1.00 71.36  ? 467  THR B N   1 
ATOM   7761 C CA  . THR B 1 467 ? -18.419 4.749   -31.200 1.00 71.30  ? 467  THR B CA  1 
ATOM   7762 C C   . THR B 1 467 ? -17.411 5.799   -30.747 1.00 69.53  ? 467  THR B C   1 
ATOM   7763 O O   . THR B 1 467 ? -17.106 6.733   -31.498 1.00 68.56  ? 467  THR B O   1 
ATOM   7764 C CB  . THR B 1 467 ? -19.754 5.025   -30.524 1.00 74.02  ? 467  THR B CB  1 
ATOM   7765 O OG1 . THR B 1 467 ? -20.694 4.076   -31.023 1.00 76.36  ? 467  THR B OG1 1 
ATOM   7766 C CG2 . THR B 1 467 ? -20.247 6.443   -30.797 1.00 73.74  ? 467  THR B CG2 1 
ATOM   7767 N N   . GLU B 1 468 ? -16.920 5.656   -29.514 1.00 69.20  ? 468  GLU B N   1 
ATOM   7768 C CA  . GLU B 1 468 ? -15.904 6.546   -28.957 1.00 67.59  ? 468  GLU B CA  1 
ATOM   7769 C C   . GLU B 1 468 ? -14.649 6.583   -29.862 1.00 64.61  ? 468  GLU B C   1 
ATOM   7770 O O   . GLU B 1 468 ? -14.057 7.647   -30.081 1.00 63.12  ? 468  GLU B O   1 
ATOM   7771 C CB  . GLU B 1 468 ? -15.534 6.098   -27.531 1.00 68.39  ? 468  GLU B CB  1 
ATOM   7772 C CG  . GLU B 1 468 ? -16.597 6.366   -26.448 1.00 73.53  ? 468  GLU B CG  1 
ATOM   7773 C CD  . GLU B 1 468 ? -17.722 5.293   -26.378 1.00 79.77  ? 468  GLU B CD  1 
ATOM   7774 O OE1 . GLU B 1 468 ? -17.826 4.429   -27.288 1.00 81.13  ? 468  GLU B OE1 1 
ATOM   7775 O OE2 . GLU B 1 468 ? -18.511 5.317   -25.399 1.00 82.42  ? 468  GLU B OE2 1 
ATOM   7776 N N   . GLU B 1 469 ? -14.275 5.420   -30.400 1.00 63.26  ? 469  GLU B N   1 
ATOM   7777 C CA  . GLU B 1 469 ? -13.124 5.302   -31.277 1.00 60.71  ? 469  GLU B CA  1 
ATOM   7778 C C   . GLU B 1 469 ? -13.320 6.007   -32.619 1.00 60.23  ? 469  GLU B C   1 
ATOM   7779 O O   . GLU B 1 469 ? -12.357 6.530   -33.196 1.00 58.87  ? 469  GLU B O   1 
ATOM   7780 C CB  . GLU B 1 469 ? -12.754 3.838   -31.481 1.00 60.26  ? 469  GLU B CB  1 
ATOM   7781 C CG  . GLU B 1 469 ? -12.152 3.201   -30.248 1.00 59.78  ? 469  GLU B CG  1 
ATOM   7782 C CD  . GLU B 1 469 ? -11.915 1.706   -30.401 1.00 59.46  ? 469  GLU B CD  1 
ATOM   7783 O OE1 . GLU B 1 469 ? -12.836 0.985   -30.859 1.00 60.32  ? 469  GLU B OE1 1 
ATOM   7784 O OE2 . GLU B 1 469 ? -10.808 1.245   -30.039 1.00 57.58  ? 469  GLU B OE2 1 
ATOM   7785 N N   . ARG B 1 470 ? -14.554 6.028   -33.110 1.00 61.40  ? 470  ARG B N   1 
ATOM   7786 C CA  . ARG B 1 470 ? -14.863 6.710   -34.364 1.00 61.29  ? 470  ARG B CA  1 
ATOM   7787 C C   . ARG B 1 470 ? -14.683 8.230   -34.221 1.00 59.93  ? 470  ARG B C   1 
ATOM   7788 O O   . ARG B 1 470 ? -13.983 8.857   -35.018 1.00 58.58  ? 470  ARG B O   1 
ATOM   7789 C CB  . ARG B 1 470 ? -16.270 6.369   -34.837 1.00 63.65  ? 470  ARG B CB  1 
ATOM   7790 C CG  . ARG B 1 470 ? -16.507 6.722   -36.280 1.00 66.95  ? 470  ARG B CG  1 
ATOM   7791 C CD  . ARG B 1 470 ? -17.651 7.730   -36.434 1.00 74.22  ? 470  ARG B CD  1 
ATOM   7792 N NE  . ARG B 1 470 ? -18.975 7.135   -36.258 1.00 80.09  ? 470  ARG B NE  1 
ATOM   7793 C CZ  . ARG B 1 470 ? -19.985 7.730   -35.617 1.00 84.66  ? 470  ARG B CZ  1 
ATOM   7794 N NH1 . ARG B 1 470 ? -19.824 8.938   -35.072 1.00 84.89  ? 470  ARG B NH1 1 
ATOM   7795 N NH2 . ARG B 1 470 ? -21.158 7.114   -35.507 1.00 86.59  ? 470  ARG B NH2 1 
ATOM   7796 N N   . ILE B 1 471 ? -15.297 8.803   -33.189 1.00 60.35  ? 471  ILE B N   1 
ATOM   7797 C CA  . ILE B 1 471 ? -15.126 10.214  -32.832 1.00 59.35  ? 471  ILE B CA  1 
ATOM   7798 C C   . ILE B 1 471 ? -13.643 10.547  -32.625 1.00 57.11  ? 471  ILE B C   1 
ATOM   7799 O O   . ILE B 1 471 ? -13.159 11.572  -33.101 1.00 56.36  ? 471  ILE B O   1 
ATOM   7800 C CB  . ILE B 1 471 ? -15.930 10.557  -31.556 1.00 61.20  ? 471  ILE B CB  1 
ATOM   7801 C CG1 . ILE B 1 471 ? -17.439 10.459  -31.829 1.00 63.54  ? 471  ILE B CG1 1 
ATOM   7802 C CG2 . ILE B 1 471 ? -15.561 11.933  -31.009 1.00 59.63  ? 471  ILE B CG2 1 
ATOM   7803 C CD1 . ILE B 1 471 ? -18.252 10.115  -30.587 1.00 66.15  ? 471  ILE B CD1 1 
ATOM   7804 N N   . PHE B 1 472 ? -12.927 9.667   -31.932 1.00 55.73  ? 472  PHE B N   1 
ATOM   7805 C CA  . PHE B 1 472 ? -11.502 9.839   -31.709 1.00 53.48  ? 472  PHE B CA  1 
ATOM   7806 C C   . PHE B 1 472 ? -10.727 9.903   -33.032 1.00 52.33  ? 472  PHE B C   1 
ATOM   7807 O O   . PHE B 1 472 ? -9.883  10.795  -33.227 1.00 50.86  ? 472  PHE B O   1 
ATOM   7808 C CB  . PHE B 1 472 ? -10.984 8.713   -30.810 1.00 53.01  ? 472  PHE B CB  1 
ATOM   7809 C CG  . PHE B 1 472 ? -9.518  8.798   -30.483 1.00 50.58  ? 472  PHE B CG  1 
ATOM   7810 C CD1 . PHE B 1 472 ? -8.938  9.997   -30.073 1.00 49.88  ? 472  PHE B CD1 1 
ATOM   7811 C CD2 . PHE B 1 472 ? -8.727  7.656   -30.541 1.00 48.82  ? 472  PHE B CD2 1 
ATOM   7812 C CE1 . PHE B 1 472 ? -7.585  10.064  -29.761 1.00 48.89  ? 472  PHE B CE1 1 
ATOM   7813 C CE2 . PHE B 1 472 ? -7.375  7.702   -30.224 1.00 48.62  ? 472  PHE B CE2 1 
ATOM   7814 C CZ  . PHE B 1 472 ? -6.796  8.912   -29.833 1.00 48.79  ? 472  PHE B CZ  1 
ATOM   7815 N N   . ALA B 1 473 ? -11.012 8.969   -33.943 1.00 52.31  ? 473  ALA B N   1 
ATOM   7816 C CA  . ALA B 1 473 ? -10.325 8.977   -35.229 1.00 51.11  ? 473  ALA B CA  1 
ATOM   7817 C C   . ALA B 1 473 ? -10.653 10.241  -36.034 1.00 51.57  ? 473  ALA B C   1 
ATOM   7818 O O   . ALA B 1 473 ? -9.792  10.766  -36.741 1.00 50.61  ? 473  ALA B O   1 
ATOM   7819 C CB  . ALA B 1 473 ? -10.621 7.730   -36.021 1.00 51.19  ? 473  ALA B CB  1 
ATOM   7820 N N   . GLN B 1 474 ? -11.887 10.733  -35.916 1.00 53.45  ? 474  GLN B N   1 
ATOM   7821 C CA  . GLN B 1 474 ? -12.278 11.965  -36.590 1.00 54.27  ? 474  GLN B CA  1 
ATOM   7822 C C   . GLN B 1 474 ? -11.448 13.154  -36.075 1.00 53.48  ? 474  GLN B C   1 
ATOM   7823 O O   . GLN B 1 474 ? -11.035 14.018  -36.856 1.00 53.49  ? 474  GLN B O   1 
ATOM   7824 C CB  . GLN B 1 474 ? -13.790 12.201  -36.480 1.00 56.41  ? 474  GLN B CB  1 
ATOM   7825 C CG  . GLN B 1 474 ? -14.621 11.306  -37.426 1.00 59.40  ? 474  GLN B CG  1 
ATOM   7826 C CD  . GLN B 1 474 ? -16.153 11.369  -37.194 1.00 65.03  ? 474  GLN B CD  1 
ATOM   7827 O OE1 . GLN B 1 474 ? -16.649 11.102  -36.097 1.00 66.87  ? 474  GLN B OE1 1 
ATOM   7828 N NE2 . GLN B 1 474 ? -16.895 11.698  -38.245 1.00 66.87  ? 474  GLN B NE2 1 
ATOM   7829 N N   . ARG B 1 475 ? -11.174 13.165  -34.773 1.00 53.15  ? 475  ARG B N   1 
ATOM   7830 C CA  . ARG B 1 475 ? -10.352 14.183  -34.161 1.00 52.82  ? 475  ARG B CA  1 
ATOM   7831 C C   . ARG B 1 475 ? -8.918  14.085  -34.697 1.00 50.99  ? 475  ARG B C   1 
ATOM   7832 O O   . ARG B 1 475 ? -8.299  15.090  -35.025 1.00 50.55  ? 475  ARG B O   1 
ATOM   7833 C CB  . ARG B 1 475 ? -10.342 14.020  -32.636 1.00 53.23  ? 475  ARG B CB  1 
ATOM   7834 C CG  . ARG B 1 475 ? -11.166 15.023  -31.825 1.00 56.62  ? 475  ARG B CG  1 
ATOM   7835 C CD  . ARG B 1 475 ? -11.165 14.686  -30.284 1.00 57.46  ? 475  ARG B CD  1 
ATOM   7836 N NE  . ARG B 1 475 ? -9.847  14.932  -29.688 1.00 55.05  ? 475  ARG B NE  1 
ATOM   7837 C CZ  . ARG B 1 475 ? -9.271  14.192  -28.746 1.00 52.22  ? 475  ARG B CZ  1 
ATOM   7838 N NH1 . ARG B 1 475 ? -9.876  13.126  -28.255 1.00 50.41  ? 475  ARG B NH1 1 
ATOM   7839 N NH2 . ARG B 1 475 ? -8.060  14.519  -28.307 1.00 51.19  ? 475  ARG B NH2 1 
ATOM   7840 N N   . LEU B 1 476 ? -8.381  12.879  -34.788 1.00 49.99  ? 476  LEU B N   1 
ATOM   7841 C CA  . LEU B 1 476 ? -6.996  12.759  -35.205 1.00 48.68  ? 476  LEU B CA  1 
ATOM   7842 C C   . LEU B 1 476 ? -6.806  13.132  -36.660 1.00 48.31  ? 476  LEU B C   1 
ATOM   7843 O O   . LEU B 1 476 ? -5.801  13.757  -37.004 1.00 47.60  ? 476  LEU B O   1 
ATOM   7844 C CB  . LEU B 1 476 ? -6.445  11.376  -34.921 1.00 47.99  ? 476  LEU B CB  1 
ATOM   7845 C CG  . LEU B 1 476 ? -6.469  11.044  -33.435 1.00 49.00  ? 476  LEU B CG  1 
ATOM   7846 C CD1 . LEU B 1 476 ? -6.335  9.547   -33.295 1.00 51.30  ? 476  LEU B CD1 1 
ATOM   7847 C CD2 . LEU B 1 476 ? -5.367  11.755  -32.697 1.00 47.58  ? 476  LEU B CD2 1 
ATOM   7848 N N   . MET B 1 477 ? -7.782  12.790  -37.502 1.00 48.86  ? 477  MET B N   1 
ATOM   7849 C CA  . MET B 1 477 ? -7.677  13.088  -38.922 1.00 48.65  ? 477  MET B CA  1 
ATOM   7850 C C   . MET B 1 477 ? -7.695  14.589  -39.089 1.00 48.94  ? 477  MET B C   1 
ATOM   7851 O O   . MET B 1 477 ? -7.032  15.133  -39.975 1.00 48.71  ? 477  MET B O   1 
ATOM   7852 C CB  . MET B 1 477 ? -8.824  12.468  -39.721 1.00 50.03  ? 477  MET B CB  1 
ATOM   7853 C CG  . MET B 1 477 ? -8.783  10.936  -39.921 1.00 50.75  ? 477  MET B CG  1 
ATOM   7854 S SD  . MET B 1 477 ? -10.392 10.277  -40.482 1.00 56.82  ? 477  MET B SD  1 
ATOM   7855 C CE  . MET B 1 477 ? -10.375 10.723  -42.195 1.00 54.90  ? 477  MET B CE  1 
ATOM   7856 N N   . LYS B 1 478 ? -8.439  15.256  -38.216 1.00 49.48  ? 478  LYS B N   1 
ATOM   7857 C CA  . LYS B 1 478 ? -8.522  16.708  -38.253 1.00 50.22  ? 478  LYS B CA  1 
ATOM   7858 C C   . LYS B 1 478 ? -7.205  17.400  -37.800 1.00 48.44  ? 478  LYS B C   1 
ATOM   7859 O O   . LYS B 1 478 ? -6.822  18.419  -38.374 1.00 48.16  ? 478  LYS B O   1 
ATOM   7860 C CB  . LYS B 1 478 ? -9.765  17.229  -37.496 1.00 51.71  ? 478  LYS B CB  1 
ATOM   7861 C CG  . LYS B 1 478 ? -10.253 18.593  -38.030 1.00 56.02  ? 478  LYS B CG  1 
ATOM   7862 C CD  . LYS B 1 478 ? -11.684 18.995  -37.571 1.00 63.51  ? 478  LYS B CD  1 
ATOM   7863 C CE  . LYS B 1 478 ? -12.825 18.313  -38.393 1.00 68.32  ? 478  LYS B CE  1 
ATOM   7864 N NZ  . LYS B 1 478 ? -12.774 18.527  -39.899 1.00 69.43  ? 478  LYS B NZ  1 
ATOM   7865 N N   . TYR B 1 479 ? -6.515  16.839  -36.804 1.00 46.79  ? 479  TYR B N   1 
ATOM   7866 C CA  . TYR B 1 479 ? -5.251  17.407  -36.346 1.00 45.71  ? 479  TYR B CA  1 
ATOM   7867 C C   . TYR B 1 479 ? -4.225  17.293  -37.458 1.00 44.88  ? 479  TYR B C   1 
ATOM   7868 O O   . TYR B 1 479 ? -3.556  18.281  -37.792 1.00 44.95  ? 479  TYR B O   1 
ATOM   7869 C CB  . TYR B 1 479 ? -4.676  16.649  -35.153 1.00 45.08  ? 479  TYR B CB  1 
ATOM   7870 C CG  . TYR B 1 479 ? -5.406  16.784  -33.851 1.00 45.39  ? 479  TYR B CG  1 
ATOM   7871 C CD1 . TYR B 1 479 ? -5.931  18.014  -33.430 1.00 46.93  ? 479  TYR B CD1 1 
ATOM   7872 C CD2 . TYR B 1 479 ? -5.523  15.695  -33.003 1.00 44.02  ? 479  TYR B CD2 1 
ATOM   7873 C CE1 . TYR B 1 479 ? -6.601  18.132  -32.211 1.00 47.01  ? 479  TYR B CE1 1 
ATOM   7874 C CE2 . TYR B 1 479 ? -6.190  15.808  -31.790 1.00 46.42  ? 479  TYR B CE2 1 
ATOM   7875 C CZ  . TYR B 1 479 ? -6.727  17.023  -31.401 1.00 46.62  ? 479  TYR B CZ  1 
ATOM   7876 O OH  . TYR B 1 479 ? -7.390  17.108  -30.198 1.00 49.14  ? 479  TYR B OH  1 
ATOM   7877 N N   . TRP B 1 480 ? -4.100  16.078  -38.012 1.00 43.73  ? 480  TRP B N   1 
ATOM   7878 C CA  . TRP B 1 480 ? -3.099  15.778  -39.038 1.00 42.37  ? 480  TRP B CA  1 
ATOM   7879 C C   . TRP B 1 480 ? -3.310  16.604  -40.320 1.00 42.92  ? 480  TRP B C   1 
ATOM   7880 O O   . TRP B 1 480 ? -2.340  17.123  -40.881 1.00 42.05  ? 480  TRP B O   1 
ATOM   7881 C CB  . TRP B 1 480 ? -3.076  14.287  -39.355 1.00 41.47  ? 480  TRP B CB  1 
ATOM   7882 C CG  . TRP B 1 480 ? -1.987  13.500  -38.706 1.00 39.71  ? 480  TRP B CG  1 
ATOM   7883 C CD1 . TRP B 1 480 ? -0.989  12.829  -39.343 1.00 38.80  ? 480  TRP B CD1 1 
ATOM   7884 C CD2 . TRP B 1 480 ? -1.795  13.263  -37.305 1.00 39.76  ? 480  TRP B CD2 1 
ATOM   7885 N NE1 . TRP B 1 480 ? -0.180  12.182  -38.435 1.00 37.24  ? 480  TRP B NE1 1 
ATOM   7886 C CE2 . TRP B 1 480 ? -0.650  12.434  -37.174 1.00 38.94  ? 480  TRP B CE2 1 
ATOM   7887 C CE3 . TRP B 1 480 ? -2.473  13.665  -36.148 1.00 40.61  ? 480  TRP B CE3 1 
ATOM   7888 C CZ2 . TRP B 1 480 ? -0.167  12.007  -35.928 1.00 37.57  ? 480  TRP B CZ2 1 
ATOM   7889 C CZ3 . TRP B 1 480 ? -1.994  13.238  -34.910 1.00 39.66  ? 480  TRP B CZ3 1 
ATOM   7890 C CH2 . TRP B 1 480 ? -0.844  12.418  -34.814 1.00 38.54  ? 480  TRP B CH2 1 
ATOM   7891 N N   . THR B 1 481 ? -4.569  16.740  -40.755 1.00 43.51  ? 481  THR B N   1 
ATOM   7892 C CA  . THR B 1 481 ? -4.868  17.492  -41.961 1.00 44.00  ? 481  THR B CA  1 
ATOM   7893 C C   . THR B 1 481 ? -4.884  18.997  -41.671 1.00 45.19  ? 481  THR B C   1 
ATOM   7894 O O   . THR B 1 481 ? -4.550  19.797  -42.533 1.00 45.48  ? 481  THR B O   1 
ATOM   7895 C CB  . THR B 1 481 ? -6.209  17.077  -42.594 1.00 45.13  ? 481  THR B CB  1 
ATOM   7896 O OG1 . THR B 1 481 ? -7.259  17.202  -41.630 1.00 46.99  ? 481  THR B OG1 1 
ATOM   7897 C CG2 . THR B 1 481 ? -6.167  15.655  -43.116 1.00 43.94  ? 481  THR B CG2 1 
ATOM   7898 N N   . ASN B 1 482 ? -5.283  19.395  -40.464 1.00 45.87  ? 482  ASN B N   1 
ATOM   7899 C CA  . ASN B 1 482 ? -5.085  20.790  -40.065 1.00 46.83  ? 482  ASN B CA  1 
ATOM   7900 C C   . ASN B 1 482 ? -3.633  21.173  -40.119 1.00 45.65  ? 482  ASN B C   1 
ATOM   7901 O O   . ASN B 1 482 ? -3.286  22.261  -40.594 1.00 45.98  ? 482  ASN B O   1 
ATOM   7902 C CB  . ASN B 1 482 ? -5.627  21.085  -38.675 1.00 47.52  ? 482  ASN B CB  1 
ATOM   7903 C CG  . ASN B 1 482 ? -7.102  21.366  -38.690 1.00 49.96  ? 482  ASN B CG  1 
ATOM   7904 O OD1 . ASN B 1 482 ? -7.685  21.684  -39.734 1.00 50.81  ? 482  ASN B OD1 1 
ATOM   7905 N ND2 . ASN B 1 482 ? -7.728  21.229  -37.534 1.00 53.20  ? 482  ASN B ND2 1 
ATOM   7906 N N   . PHE B 1 483 ? -2.793  20.260  -39.645 1.00 44.28  ? 483  PHE B N   1 
ATOM   7907 C CA  . PHE B 1 483 ? -1.377  20.453  -39.721 1.00 43.79  ? 483  PHE B CA  1 
ATOM   7908 C C   . PHE B 1 483 ? -0.888  20.519  -41.175 1.00 44.45  ? 483  PHE B C   1 
ATOM   7909 O O   . PHE B 1 483 ? -0.152  21.441  -41.529 1.00 44.59  ? 483  PHE B O   1 
ATOM   7910 C CB  . PHE B 1 483 ? -0.637  19.381  -38.947 1.00 42.44  ? 483  PHE B CB  1 
ATOM   7911 C CG  . PHE B 1 483 ? 0.852   19.467  -39.093 1.00 40.44  ? 483  PHE B CG  1 
ATOM   7912 C CD1 . PHE B 1 483 ? 1.581   20.432  -38.378 1.00 38.46  ? 483  PHE B CD1 1 
ATOM   7913 C CD2 . PHE B 1 483 ? 1.528   18.582  -39.934 1.00 36.80  ? 483  PHE B CD2 1 
ATOM   7914 C CE1 . PHE B 1 483 ? 2.971   20.508  -38.498 1.00 38.15  ? 483  PHE B CE1 1 
ATOM   7915 C CE2 . PHE B 1 483 ? 2.920   18.648  -40.069 1.00 36.95  ? 483  PHE B CE2 1 
ATOM   7916 C CZ  . PHE B 1 483 ? 3.646   19.614  -39.359 1.00 37.49  ? 483  PHE B CZ  1 
ATOM   7917 N N   . ALA B 1 484 ? -1.306  19.580  -42.025 1.00 44.60  ? 484  ALA B N   1 
ATOM   7918 C CA  . ALA B 1 484 ? -0.913  19.648  -43.437 1.00 45.40  ? 484  ALA B CA  1 
ATOM   7919 C C   . ALA B 1 484 ? -1.325  20.992  -44.064 1.00 47.67  ? 484  ALA B C   1 
ATOM   7920 O O   . ALA B 1 484 ? -0.583  21.592  -44.861 1.00 47.94  ? 484  ALA B O   1 
ATOM   7921 C CB  . ALA B 1 484 ? -1.504  18.500  -44.218 1.00 44.67  ? 484  ALA B CB  1 
ATOM   7922 N N   . ARG B 1 485 ? -2.506  21.462  -43.687 1.00 49.40  ? 485  ARG B N   1 
ATOM   7923 C CA  . ARG B 1 485 ? -3.074  22.647  -44.304 1.00 52.52  ? 485  ARG B CA  1 
ATOM   7924 C C   . ARG B 1 485 ? -2.343  23.925  -43.903 1.00 52.82  ? 485  ARG B C   1 
ATOM   7925 O O   . ARG B 1 485 ? -2.145  24.781  -44.749 1.00 53.59  ? 485  ARG B O   1 
ATOM   7926 C CB  . ARG B 1 485 ? -4.577  22.753  -43.996 1.00 53.97  ? 485  ARG B CB  1 
ATOM   7927 C CG  . ARG B 1 485 ? -5.398  23.405  -45.091 1.00 59.70  ? 485  ARG B CG  1 
ATOM   7928 C CD  . ARG B 1 485 ? -6.928  23.292  -44.811 1.00 68.28  ? 485  ARG B CD  1 
ATOM   7929 N NE  . ARG B 1 485 ? -7.508  21.988  -45.194 1.00 71.92  ? 485  ARG B NE  1 
ATOM   7930 C CZ  . ARG B 1 485 ? -7.828  21.001  -44.343 1.00 72.59  ? 485  ARG B CZ  1 
ATOM   7931 N NH1 . ARG B 1 485 ? -7.641  21.144  -43.031 1.00 71.93  ? 485  ARG B NH1 1 
ATOM   7932 N NH2 . ARG B 1 485 ? -8.352  19.861  -44.804 1.00 72.30  ? 485  ARG B NH2 1 
ATOM   7933 N N   . THR B 1 486 ? -1.933  24.028  -42.630 1.00 52.46  ? 486  THR B N   1 
ATOM   7934 C CA  . THR B 1 486 ? -1.513  25.294  -42.033 1.00 53.32  ? 486  THR B CA  1 
ATOM   7935 C C   . THR B 1 486 ? -0.169  25.245  -41.281 1.00 52.91  ? 486  THR B C   1 
ATOM   7936 O O   . THR B 1 486 ? 0.412   26.298  -40.945 1.00 53.70  ? 486  THR B O   1 
ATOM   7937 C CB  . THR B 1 486 ? -2.576  25.809  -41.013 1.00 54.72  ? 486  THR B CB  1 
ATOM   7938 O OG1 . THR B 1 486 ? -2.735  24.853  -39.953 1.00 53.61  ? 486  THR B OG1 1 
ATOM   7939 C CG2 . THR B 1 486 ? -3.943  26.092  -41.673 1.00 54.97  ? 486  THR B CG2 1 
ATOM   7940 N N   . GLY B 1 487 ? 0.306   24.038  -40.978 1.00 51.38  ? 487  GLY B N   1 
ATOM   7941 C CA  . GLY B 1 487 ? 1.475   23.877  -40.110 1.00 50.22  ? 487  GLY B CA  1 
ATOM   7942 C C   . GLY B 1 487 ? 1.134   23.961  -38.630 1.00 50.97  ? 487  GLY B C   1 
ATOM   7943 O O   . GLY B 1 487 ? 2.029   23.920  -37.791 1.00 50.36  ? 487  GLY B O   1 
ATOM   7944 N N   . ASP B 1 488 ? -0.165  24.084  -38.316 1.00 52.19  ? 488  ASP B N   1 
ATOM   7945 C CA  . ASP B 1 488 ? -0.675  24.174  -36.949 1.00 52.65  ? 488  ASP B CA  1 
ATOM   7946 C C   . ASP B 1 488 ? -1.807  23.152  -36.846 1.00 53.03  ? 488  ASP B C   1 
ATOM   7947 O O   . ASP B 1 488 ? -2.765  23.230  -37.601 1.00 53.87  ? 488  ASP B O   1 
ATOM   7948 C CB  . ASP B 1 488 ? -1.166  25.605  -36.671 1.00 53.89  ? 488  ASP B CB  1 
ATOM   7949 C CG  . ASP B 1 488 ? -1.676  25.813  -35.247 1.00 54.56  ? 488  ASP B CG  1 
ATOM   7950 O OD1 . ASP B 1 488 ? -1.777  24.844  -34.470 1.00 53.71  ? 488  ASP B OD1 1 
ATOM   7951 O OD2 . ASP B 1 488 ? -2.001  26.970  -34.894 1.00 56.62  ? 488  ASP B OD2 1 
ATOM   7952 N N   . PRO B 1 489 ? -1.704  22.185  -35.919 1.00 52.91  ? 489  PRO B N   1 
ATOM   7953 C CA  . PRO B 1 489 ? -2.724  21.131  -35.837 1.00 53.67  ? 489  PRO B CA  1 
ATOM   7954 C C   . PRO B 1 489 ? -4.031  21.571  -35.177 1.00 56.40  ? 489  PRO B C   1 
ATOM   7955 O O   . PRO B 1 489 ? -4.970  20.779  -35.088 1.00 56.58  ? 489  PRO B O   1 
ATOM   7956 C CB  . PRO B 1 489 ? -2.051  20.072  -34.968 1.00 52.21  ? 489  PRO B CB  1 
ATOM   7957 C CG  . PRO B 1 489 ? -1.121  20.858  -34.093 1.00 51.74  ? 489  PRO B CG  1 
ATOM   7958 C CD  . PRO B 1 489 ? -0.633  21.997  -34.924 1.00 51.66  ? 489  PRO B CD  1 
ATOM   7959 N N   . ASN B 1 490 ? -4.090  22.811  -34.706 1.00 59.13  ? 490  ASN B N   1 
ATOM   7960 C CA  . ASN B 1 490 ? -5.254  23.269  -33.978 1.00 62.65  ? 490  ASN B CA  1 
ATOM   7961 C C   . ASN B 1 490 ? -6.360  23.644  -34.936 1.00 65.73  ? 490  ASN B C   1 
ATOM   7962 O O   . ASN B 1 490 ? -6.090  24.120  -36.035 1.00 65.69  ? 490  ASN B O   1 
ATOM   7963 C CB  . ASN B 1 490 ? -4.902  24.453  -33.088 1.00 63.01  ? 490  ASN B CB  1 
ATOM   7964 C CG  . ASN B 1 490 ? -4.089  24.052  -31.878 1.00 61.77  ? 490  ASN B CG  1 
ATOM   7965 O OD1 . ASN B 1 490 ? -4.621  23.546  -30.893 1.00 62.05  ? 490  ASN B OD1 1 
ATOM   7966 N ND2 . ASN B 1 490 ? -2.793  24.299  -31.936 1.00 60.10  ? 490  ASN B ND2 1 
ATOM   7967 N N   . ASP B 1 491 ? -7.601  23.414  -34.515 1.00 69.63  ? 491  ASP B N   1 
ATOM   7968 C CA  . ASP B 1 491 ? -8.770  23.726  -35.329 1.00 73.92  ? 491  ASP B CA  1 
ATOM   7969 C C   . ASP B 1 491 ? -9.004  25.238  -35.280 1.00 76.93  ? 491  ASP B C   1 
ATOM   7970 O O   . ASP B 1 491 ? -9.398  25.761  -34.230 1.00 77.92  ? 491  ASP B O   1 
ATOM   7971 C CB  . ASP B 1 491 ? -10.005 22.950  -34.828 1.00 75.23  ? 491  ASP B CB  1 
ATOM   7972 C CG  . ASP B 1 491 ? -11.045 22.698  -35.930 1.00 78.22  ? 491  ASP B CG  1 
ATOM   7973 O OD1 . ASP B 1 491 ? -11.447 23.652  -36.645 1.00 81.02  ? 491  ASP B OD1 1 
ATOM   7974 O OD2 . ASP B 1 491 ? -11.481 21.533  -36.071 1.00 80.51  ? 491  ASP B OD2 1 
ATOM   7975 N N   . PRO B 1 492 ? -8.759  25.943  -36.414 1.00 78.89  ? 492  PRO B N   1 
ATOM   7976 C CA  . PRO B 1 492 ? -8.848  27.414  -36.457 1.00 81.91  ? 492  PRO B CA  1 
ATOM   7977 C C   . PRO B 1 492 ? -10.279 27.967  -36.305 1.00 85.32  ? 492  PRO B C   1 
ATOM   7978 O O   . PRO B 1 492 ? -10.457 29.188  -36.313 1.00 86.98  ? 492  PRO B O   1 
ATOM   7979 C CB  . PRO B 1 492 ? -8.252  27.771  -37.829 1.00 81.84  ? 492  PRO B CB  1 
ATOM   7980 C CG  . PRO B 1 492 ? -8.513  26.555  -38.680 1.00 80.26  ? 492  PRO B CG  1 
ATOM   7981 C CD  . PRO B 1 492 ? -8.470  25.369  -37.748 1.00 78.28  ? 492  PRO B CD  1 
ATOM   7982 N N   . ARG B 1 493 ? -11.266 27.068  -36.188 1.00 86.85  ? 493  ARG B N   1 
ATOM   7983 C CA  . ARG B 1 493 ? -12.647 27.385  -35.761 1.00 90.19  ? 493  ARG B CA  1 
ATOM   7984 C C   . ARG B 1 493 ? -12.989 26.502  -34.545 1.00 90.43  ? 493  ARG B C   1 
ATOM   7985 O O   . ARG B 1 493 ? -12.870 25.271  -34.610 1.00 89.39  ? 493  ARG B O   1 
ATOM   7986 C CB  . ARG B 1 493 ? -13.651 27.156  -36.910 1.00 91.38  ? 493  ARG B CB  1 
ATOM   7987 N N   . ASP B 1 494 ? -13.430 27.129  -33.453 1.00 92.29  ? 494  ASP B N   1 
ATOM   7988 C CA  . ASP B 1 494 ? -13.306 26.541  -32.105 1.00 92.20  ? 494  ASP B CA  1 
ATOM   7989 C C   . ASP B 1 494 ? -11.897 26.950  -31.597 1.00 90.65  ? 494  ASP B C   1 
ATOM   7990 O O   . ASP B 1 494 ? -10.905 26.306  -31.973 1.00 88.89  ? 494  ASP B O   1 
ATOM   7991 C CB  . ASP B 1 494 ? -13.521 24.998  -32.124 1.00 91.12  ? 494  ASP B CB  1 
ATOM   7992 C CG  . ASP B 1 494 ? -13.062 24.303  -30.833 1.00 90.81  ? 494  ASP B CG  1 
ATOM   7993 O OD1 . ASP B 1 494 ? -13.773 24.377  -29.801 1.00 92.70  ? 494  ASP B OD1 1 
ATOM   7994 O OD2 . ASP B 1 494 ? -11.987 23.668  -30.862 1.00 88.26  ? 494  ASP B OD2 1 
ATOM   7995 N N   . SER B 1 495 ? -11.754 28.005  -30.778 1.00 91.29  ? 495  SER B N   1 
ATOM   7996 C CA  . SER B 1 495 ? -12.794 28.840  -30.110 1.00 93.32  ? 495  SER B CA  1 
ATOM   7997 C C   . SER B 1 495 ? -12.951 28.465  -28.626 1.00 93.16  ? 495  SER B C   1 
ATOM   7998 O O   . SER B 1 495 ? -13.041 29.340  -27.758 1.00 94.32  ? 495  SER B O   1 
ATOM   7999 C CB  . SER B 1 495 ? -14.153 28.869  -30.848 1.00 95.09  ? 495  SER B CB  1 
ATOM   8000 N N   . LYS B 1 496 ? -12.991 27.160  -28.355 1.00 91.46  ? 496  LYS B N   1 
ATOM   8001 C CA  . LYS B 1 496 ? -12.859 26.625  -26.999 1.00 90.31  ? 496  LYS B CA  1 
ATOM   8002 C C   . LYS B 1 496 ? -11.512 25.910  -26.960 1.00 87.13  ? 496  LYS B C   1 
ATOM   8003 O O   . LYS B 1 496 ? -10.955 25.553  -28.021 1.00 85.86  ? 496  LYS B O   1 
ATOM   8004 C CB  . LYS B 1 496 ? -14.022 25.662  -26.656 1.00 91.14  ? 496  LYS B CB  1 
ATOM   8005 N N   . SER B 1 497 ? -10.987 25.721  -25.748 1.00 85.46  ? 497  SER B N   1 
ATOM   8006 C CA  . SER B 1 497 ? -9.669  25.077  -25.514 1.00 81.78  ? 497  SER B CA  1 
ATOM   8007 C C   . SER B 1 497 ? -9.587  23.515  -25.818 1.00 78.78  ? 497  SER B C   1 
ATOM   8008 O O   . SER B 1 497 ? -10.265 22.996  -26.733 1.00 78.91  ? 497  SER B O   1 
ATOM   8009 C CB  . SER B 1 497 ? -9.227  25.397  -24.069 1.00 82.21  ? 497  SER B CB  1 
ATOM   8010 O OG  . SER B 1 497 ? -9.297  26.789  -23.801 1.00 82.91  ? 497  SER B OG  1 
ATOM   8011 N N   . PRO B 1 498 ? -8.665  22.790  -25.143 1.00 75.34  ? 498  PRO B N   1 
ATOM   8012 C CA  . PRO B 1 498 ? -7.392  23.359  -24.715 1.00 72.42  ? 498  PRO B CA  1 
ATOM   8013 C C   . PRO B 1 498 ? -6.589  23.383  -26.003 1.00 68.51  ? 498  PRO B C   1 
ATOM   8014 O O   . PRO B 1 498 ? -6.738  22.482  -26.830 1.00 67.07  ? 498  PRO B O   1 
ATOM   8015 C CB  . PRO B 1 498 ? -6.838  22.327  -23.716 1.00 71.67  ? 498  PRO B CB  1 
ATOM   8016 C CG  . PRO B 1 498 ? -7.989  21.413  -23.400 1.00 73.82  ? 498  PRO B CG  1 
ATOM   8017 C CD  . PRO B 1 498 ? -8.855  21.419  -24.634 1.00 74.92  ? 498  PRO B CD  1 
ATOM   8018 N N   . GLN B 1 499 ? -5.793  24.420  -26.211 1.00 65.70  ? 499  GLN B N   1 
ATOM   8019 C CA  . GLN B 1 499 ? -5.036  24.501  -27.447 1.00 61.85  ? 499  GLN B CA  1 
ATOM   8020 C C   . GLN B 1 499 ? -3.782  23.629  -27.316 1.00 57.59  ? 499  GLN B C   1 
ATOM   8021 O O   . GLN B 1 499 ? -3.184  23.570  -26.254 1.00 57.25  ? 499  GLN B O   1 
ATOM   8022 C CB  . GLN B 1 499 ? -4.720  25.975  -27.780 1.00 63.17  ? 499  GLN B CB  1 
ATOM   8023 C CG  . GLN B 1 499 ? -5.944  26.808  -28.202 1.00 65.03  ? 499  GLN B CG  1 
ATOM   8024 C CD  . GLN B 1 499 ? -6.223  26.780  -29.719 1.00 67.34  ? 499  GLN B CD  1 
ATOM   8025 O OE1 . GLN B 1 499 ? -5.388  27.223  -30.536 1.00 67.17  ? 499  GLN B OE1 1 
ATOM   8026 N NE2 . GLN B 1 499 ? -7.413  26.296  -30.096 1.00 65.99  ? 499  GLN B NE2 1 
ATOM   8027 N N   . TRP B 1 500 ? -3.436  22.919  -28.384 1.00 53.69  ? 500  TRP B N   1 
ATOM   8028 C CA  . TRP B 1 500 ? -2.160  22.191  -28.510 1.00 50.09  ? 500  TRP B CA  1 
ATOM   8029 C C   . TRP B 1 500 ? -0.962  23.179  -28.636 1.00 48.48  ? 500  TRP B C   1 
ATOM   8030 O O   . TRP B 1 500 ? -0.790  23.806  -29.678 1.00 48.30  ? 500  TRP B O   1 
ATOM   8031 C CB  . TRP B 1 500 ? -2.230  21.301  -29.762 1.00 48.52  ? 500  TRP B CB  1 
ATOM   8032 C CG  . TRP B 1 500 ? -1.123  20.269  -29.904 1.00 47.00  ? 500  TRP B CG  1 
ATOM   8033 C CD1 . TRP B 1 500 ? 0.133   20.318  -29.353 1.00 44.77  ? 500  TRP B CD1 1 
ATOM   8034 C CD2 . TRP B 1 500 ? -1.170  19.050  -30.680 1.00 45.47  ? 500  TRP B CD2 1 
ATOM   8035 N NE1 . TRP B 1 500 ? 0.852   19.197  -29.719 1.00 44.36  ? 500  TRP B NE1 1 
ATOM   8036 C CE2 . TRP B 1 500 ? 0.084   18.414  -30.539 1.00 44.66  ? 500  TRP B CE2 1 
ATOM   8037 C CE3 . TRP B 1 500 ? -2.155  18.432  -31.465 1.00 45.57  ? 500  TRP B CE3 1 
ATOM   8038 C CZ2 . TRP B 1 500 ? 0.377   17.179  -31.148 1.00 44.96  ? 500  TRP B CZ2 1 
ATOM   8039 C CZ3 . TRP B 1 500 ? -1.866  17.209  -32.076 1.00 44.91  ? 500  TRP B CZ3 1 
ATOM   8040 C CH2 . TRP B 1 500 ? -0.604  16.595  -31.913 1.00 44.03  ? 500  TRP B CH2 1 
ATOM   8041 N N   . PRO B 1 501 ? -0.141  23.339  -27.583 1.00 47.15  ? 501  PRO B N   1 
ATOM   8042 C CA  . PRO B 1 501 ? 0.926   24.334  -27.716 1.00 46.60  ? 501  PRO B CA  1 
ATOM   8043 C C   . PRO B 1 501 ? 2.141   23.815  -28.478 1.00 44.98  ? 501  PRO B C   1 
ATOM   8044 O O   . PRO B 1 501 ? 2.375   22.586  -28.540 1.00 43.47  ? 501  PRO B O   1 
ATOM   8045 C CB  . PRO B 1 501 ? 1.326   24.640  -26.267 1.00 46.57  ? 501  PRO B CB  1 
ATOM   8046 C CG  . PRO B 1 501 ? 0.437   23.831  -25.410 1.00 47.73  ? 501  PRO B CG  1 
ATOM   8047 C CD  . PRO B 1 501 ? -0.121  22.724  -26.251 1.00 47.18  ? 501  PRO B CD  1 
ATOM   8048 N N   . PRO B 1 502 ? 2.918   24.738  -29.070 1.00 44.87  ? 502  PRO B N   1 
ATOM   8049 C CA  . PRO B 1 502 ? 4.141   24.249  -29.703 1.00 43.80  ? 502  PRO B CA  1 
ATOM   8050 C C   . PRO B 1 502 ? 5.084   23.692  -28.638 1.00 43.48  ? 502  PRO B C   1 
ATOM   8051 O O   . PRO B 1 502 ? 5.093   24.167  -27.498 1.00 44.03  ? 502  PRO B O   1 
ATOM   8052 C CB  . PRO B 1 502 ? 4.736   25.500  -30.359 1.00 44.13  ? 502  PRO B CB  1 
ATOM   8053 C CG  . PRO B 1 502 ? 3.606   26.481  -30.440 1.00 46.10  ? 502  PRO B CG  1 
ATOM   8054 C CD  . PRO B 1 502 ? 2.701   26.176  -29.293 1.00 45.74  ? 502  PRO B CD  1 
ATOM   8055 N N   . TYR B 1 503 ? 5.847   22.673  -29.008 1.00 42.53  ? 503  TYR B N   1 
ATOM   8056 C CA  . TYR B 1 503 ? 6.912   22.187  -28.165 1.00 42.97  ? 503  TYR B CA  1 
ATOM   8057 C C   . TYR B 1 503 ? 8.105   23.148  -28.223 1.00 43.95  ? 503  TYR B C   1 
ATOM   8058 O O   . TYR B 1 503 ? 8.474   23.612  -29.301 1.00 44.58  ? 503  TYR B O   1 
ATOM   8059 C CB  . TYR B 1 503 ? 7.309   20.784  -28.616 1.00 41.87  ? 503  TYR B CB  1 
ATOM   8060 C CG  . TYR B 1 503 ? 8.408   20.164  -27.797 1.00 41.72  ? 503  TYR B CG  1 
ATOM   8061 C CD1 . TYR B 1 503 ? 9.744   20.489  -28.032 1.00 40.79  ? 503  TYR B CD1 1 
ATOM   8062 C CD2 . TYR B 1 503 ? 8.111   19.242  -26.795 1.00 39.98  ? 503  TYR B CD2 1 
ATOM   8063 C CE1 . TYR B 1 503 ? 10.748  19.916  -27.279 1.00 42.67  ? 503  TYR B CE1 1 
ATOM   8064 C CE2 . TYR B 1 503 ? 9.102   18.673  -26.035 1.00 41.10  ? 503  TYR B CE2 1 
ATOM   8065 C CZ  . TYR B 1 503 ? 10.422  19.011  -26.277 1.00 42.11  ? 503  TYR B CZ  1 
ATOM   8066 O OH  . TYR B 1 503 ? 11.420  18.438  -25.530 1.00 41.90  ? 503  TYR B OH  1 
ATOM   8067 N N   . THR B 1 504 ? 8.697   23.459  -27.070 1.00 45.14  ? 504  THR B N   1 
ATOM   8068 C CA  . THR B 1 504 ? 9.848   24.369  -27.006 1.00 46.39  ? 504  THR B CA  1 
ATOM   8069 C C   . THR B 1 504 ? 10.872  23.787  -26.044 1.00 47.06  ? 504  THR B C   1 
ATOM   8070 O O   . THR B 1 504 ? 10.545  22.917  -25.262 1.00 46.28  ? 504  THR B O   1 
ATOM   8071 C CB  . THR B 1 504 ? 9.455   25.771  -26.474 1.00 47.91  ? 504  THR B CB  1 
ATOM   8072 O OG1 . THR B 1 504 ? 9.047   25.653  -25.104 1.00 48.30  ? 504  THR B OG1 1 
ATOM   8073 C CG2 . THR B 1 504 ? 8.331   26.429  -27.313 1.00 47.02  ? 504  THR B CG2 1 
ATOM   8074 N N   . THR B 1 505 ? 12.106  24.277  -26.074 1.00 48.98  ? 505  THR B N   1 
ATOM   8075 C CA  . THR B 1 505 ? 13.129  23.734  -25.168 1.00 50.54  ? 505  THR B CA  1 
ATOM   8076 C C   . THR B 1 505 ? 12.927  24.221  -23.731 1.00 51.82  ? 505  THR B C   1 
ATOM   8077 O O   . THR B 1 505 ? 13.145  23.461  -22.798 1.00 52.28  ? 505  THR B O   1 
ATOM   8078 C CB  . THR B 1 505 ? 14.597  23.981  -25.647 1.00 51.22  ? 505  THR B CB  1 
ATOM   8079 O OG1 . THR B 1 505 ? 14.800  25.377  -25.933 1.00 54.58  ? 505  THR B OG1 1 
ATOM   8080 C CG2 . THR B 1 505 ? 14.918  23.155  -26.883 1.00 48.53  ? 505  THR B CG2 1 
ATOM   8081 N N   . ALA B 1 506 ? 12.481  25.465  -23.564 1.00 53.02  ? 506  ALA B N   1 
ATOM   8082 C CA  . ALA B 1 506 ? 12.068  25.962  -22.246 1.00 54.37  ? 506  ALA B CA  1 
ATOM   8083 C C   . ALA B 1 506 ? 10.960  25.087  -21.626 1.00 54.17  ? 506  ALA B C   1 
ATOM   8084 O O   . ALA B 1 506 ? 11.243  24.256  -20.736 1.00 54.40  ? 506  ALA B O   1 
ATOM   8085 C CB  . ALA B 1 506 ? 11.605  27.408  -22.342 1.00 55.72  ? 506  ALA B CB  1 
ATOM   8086 N N   . ALA B 1 507 ? 9.721   25.256  -22.118 1.00 52.96  ? 507  ALA B N   1 
ATOM   8087 C CA  . ALA B 1 507 ? 8.547   24.622  -21.519 1.00 52.24  ? 507  ALA B CA  1 
ATOM   8088 C C   . ALA B 1 507 ? 8.362   23.117  -21.807 1.00 50.77  ? 507  ALA B C   1 
ATOM   8089 O O   . ALA B 1 507 ? 7.830   22.407  -20.972 1.00 51.53  ? 507  ALA B O   1 
ATOM   8090 C CB  . ALA B 1 507 ? 7.283   25.404  -21.868 1.00 52.34  ? 507  ALA B CB  1 
ATOM   8091 N N   . GLN B 1 508 ? 8.781   22.635  -22.970 1.00 49.26  ? 508  GLN B N   1 
ATOM   8092 C CA  . GLN B 1 508 ? 8.659   21.208  -23.321 1.00 48.17  ? 508  GLN B CA  1 
ATOM   8093 C C   . GLN B 1 508 ? 7.236   20.660  -23.274 1.00 47.64  ? 508  GLN B C   1 
ATOM   8094 O O   . GLN B 1 508 ? 7.005   19.537  -22.823 1.00 47.95  ? 508  GLN B O   1 
ATOM   8095 C CB  . GLN B 1 508 ? 9.573   20.346  -22.454 1.00 48.04  ? 508  GLN B CB  1 
ATOM   8096 C CG  . GLN B 1 508 ? 11.045  20.617  -22.677 1.00 49.56  ? 508  GLN B CG  1 
ATOM   8097 C CD  . GLN B 1 508 ? 11.925  20.016  -21.599 1.00 50.24  ? 508  GLN B CD  1 
ATOM   8098 O OE1 . GLN B 1 508 ? 12.042  18.792  -21.492 1.00 50.33  ? 508  GLN B OE1 1 
ATOM   8099 N NE2 . GLN B 1 508 ? 12.560  20.873  -20.805 1.00 49.58  ? 508  GLN B NE2 1 
ATOM   8100 N N   . GLN B 1 509 ? 6.289   21.444  -23.764 1.00 47.16  ? 509  GLN B N   1 
ATOM   8101 C CA  . GLN B 1 509 ? 4.905   21.027  -23.783 1.00 46.28  ? 509  GLN B CA  1 
ATOM   8102 C C   . GLN B 1 509 ? 4.593   20.060  -24.920 1.00 45.33  ? 509  GLN B C   1 
ATOM   8103 O O   . GLN B 1 509 ? 5.047   20.230  -26.061 1.00 44.28  ? 509  GLN B O   1 
ATOM   8104 C CB  . GLN B 1 509 ? 3.997   22.250  -23.840 1.00 47.18  ? 509  GLN B CB  1 
ATOM   8105 C CG  . GLN B 1 509 ? 4.044   23.059  -22.562 1.00 47.87  ? 509  GLN B CG  1 
ATOM   8106 C CD  . GLN B 1 509 ? 3.320   24.382  -22.655 1.00 48.14  ? 509  GLN B CD  1 
ATOM   8107 O OE1 . GLN B 1 509 ? 3.626   25.216  -23.506 1.00 48.20  ? 509  GLN B OE1 1 
ATOM   8108 N NE2 . GLN B 1 509 ? 2.369   24.592  -21.755 1.00 49.37  ? 509  GLN B NE2 1 
ATOM   8109 N N   . TYR B 1 510 ? 3.812   19.040  -24.583 1.00 45.00  ? 510  TYR B N   1 
ATOM   8110 C CA  . TYR B 1 510 ? 3.301   18.064  -25.536 1.00 44.58  ? 510  TYR B CA  1 
ATOM   8111 C C   . TYR B 1 510 ? 1.915   17.623  -25.067 1.00 45.21  ? 510  TYR B C   1 
ATOM   8112 O O   . TYR B 1 510 ? 1.516   17.932  -23.941 1.00 46.96  ? 510  TYR B O   1 
ATOM   8113 C CB  . TYR B 1 510 ? 4.242   16.863  -25.639 1.00 43.20  ? 510  TYR B CB  1 
ATOM   8114 C CG  . TYR B 1 510 ? 4.359   16.047  -24.368 1.00 44.42  ? 510  TYR B CG  1 
ATOM   8115 C CD1 . TYR B 1 510 ? 5.225   16.432  -23.347 1.00 45.01  ? 510  TYR B CD1 1 
ATOM   8116 C CD2 . TYR B 1 510 ? 3.617   14.876  -24.195 1.00 44.92  ? 510  TYR B CD2 1 
ATOM   8117 C CE1 . TYR B 1 510 ? 5.340   15.688  -22.186 1.00 46.09  ? 510  TYR B CE1 1 
ATOM   8118 C CE2 . TYR B 1 510 ? 3.724   14.118  -23.029 1.00 45.92  ? 510  TYR B CE2 1 
ATOM   8119 C CZ  . TYR B 1 510 ? 4.594   14.531  -22.028 1.00 47.76  ? 510  TYR B CZ  1 
ATOM   8120 O OH  . TYR B 1 510 ? 4.723   13.787  -20.867 1.00 49.67  ? 510  TYR B OH  1 
ATOM   8121 N N   . VAL B 1 511 ? 1.170   16.910  -25.907 1.00 44.48  ? 511  VAL B N   1 
ATOM   8122 C CA  . VAL B 1 511 ? -0.200  16.556  -25.545 1.00 44.43  ? 511  VAL B CA  1 
ATOM   8123 C C   . VAL B 1 511 ? -0.446  15.050  -25.566 1.00 44.56  ? 511  VAL B C   1 
ATOM   8124 O O   . VAL B 1 511 ? 0.207   14.305  -26.308 1.00 43.17  ? 511  VAL B O   1 
ATOM   8125 C CB  . VAL B 1 511 ? -1.235  17.249  -26.455 1.00 44.97  ? 511  VAL B CB  1 
ATOM   8126 C CG1 . VAL B 1 511 ? -1.133  18.763  -26.372 1.00 43.84  ? 511  VAL B CG1 1 
ATOM   8127 C CG2 . VAL B 1 511 ? -1.117  16.758  -27.895 1.00 43.64  ? 511  VAL B CG2 1 
ATOM   8128 N N   . SER B 1 512 ? -1.390  14.607  -24.744 1.00 45.70  ? 512  SER B N   1 
ATOM   8129 C CA  . SER B 1 512 ? -1.804  13.214  -24.744 1.00 46.38  ? 512  SER B CA  1 
ATOM   8130 C C   . SER B 1 512 ? -2.930  13.003  -25.754 1.00 46.63  ? 512  SER B C   1 
ATOM   8131 O O   . SER B 1 512 ? -3.953  13.680  -25.721 1.00 46.82  ? 512  SER B O   1 
ATOM   8132 C CB  . SER B 1 512 ? -2.255  12.784  -23.357 1.00 47.21  ? 512  SER B CB  1 
ATOM   8133 O OG  . SER B 1 512 ? -3.369  13.561  -22.955 1.00 51.66  ? 512  SER B OG  1 
ATOM   8134 N N   . LEU B 1 513 ? -2.724  12.081  -26.684 1.00 46.32  ? 513  LEU B N   1 
ATOM   8135 C CA  . LEU B 1 513 ? -3.794  11.765  -27.614 1.00 46.92  ? 513  LEU B CA  1 
ATOM   8136 C C   . LEU B 1 513 ? -4.458  10.514  -27.077 1.00 48.18  ? 513  LEU B C   1 
ATOM   8137 O O   . LEU B 1 513 ? -3.833  9.459   -27.002 1.00 47.99  ? 513  LEU B O   1 
ATOM   8138 C CB  . LEU B 1 513 ? -3.243  11.579  -29.043 1.00 45.58  ? 513  LEU B CB  1 
ATOM   8139 C CG  . LEU B 1 513 ? -2.521  12.764  -29.702 1.00 43.05  ? 513  LEU B CG  1 
ATOM   8140 C CD1 . LEU B 1 513 ? -2.085  12.439  -31.122 1.00 37.98  ? 513  LEU B CD1 1 
ATOM   8141 C CD2 . LEU B 1 513 ? -3.395  14.032  -29.677 1.00 41.65  ? 513  LEU B CD2 1 
ATOM   8142 N N   . ASN B 1 514 ? -5.695  10.660  -26.627 1.00 50.42  ? 514  ASN B N   1 
ATOM   8143 C CA  . ASN B 1 514 ? -6.501  9.542   -26.150 1.00 52.79  ? 514  ASN B CA  1 
ATOM   8144 C C   . ASN B 1 514 ? -7.972  9.954   -26.160 1.00 55.26  ? 514  ASN B C   1 
ATOM   8145 O O   . ASN B 1 514 ? -8.303  11.000  -26.729 1.00 55.91  ? 514  ASN B O   1 
ATOM   8146 C CB  . ASN B 1 514 ? -6.054  9.075   -24.761 1.00 53.09  ? 514  ASN B CB  1 
ATOM   8147 C CG  . ASN B 1 514 ? -6.195  10.148  -23.713 1.00 54.63  ? 514  ASN B CG  1 
ATOM   8148 O OD1 . ASN B 1 514 ? -7.184  10.880  -23.681 1.00 56.39  ? 514  ASN B OD1 1 
ATOM   8149 N ND2 . ASN B 1 514 ? -5.197  10.253  -22.841 1.00 55.45  ? 514  ASN B ND2 1 
ATOM   8150 N N   . LEU B 1 515 ? -8.848  9.161   -25.530 1.00 57.29  ? 515  LEU B N   1 
ATOM   8151 C CA  . LEU B 1 515 ? -10.297 9.393   -25.633 1.00 59.53  ? 515  LEU B CA  1 
ATOM   8152 C C   . LEU B 1 515 ? -10.768 10.625  -24.888 1.00 60.82  ? 515  LEU B C   1 
ATOM   8153 O O   . LEU B 1 515 ? -11.837 11.150  -25.199 1.00 62.55  ? 515  LEU B O   1 
ATOM   8154 C CB  . LEU B 1 515 ? -11.109 8.182   -25.162 1.00 61.07  ? 515  LEU B CB  1 
ATOM   8155 C CG  . LEU B 1 515 ? -10.885 6.849   -25.883 1.00 61.09  ? 515  LEU B CG  1 
ATOM   8156 C CD1 . LEU B 1 515 ? -11.913 5.840   -25.404 1.00 61.56  ? 515  LEU B CD1 1 
ATOM   8157 C CD2 . LEU B 1 515 ? -10.935 7.009   -27.405 1.00 59.27  ? 515  LEU B CD2 1 
ATOM   8158 N N   . LYS B 1 516 ? -9.989  11.069  -23.901 1.00 60.42  ? 516  LYS B N   1 
ATOM   8159 C CA  . LYS B 1 516 ? -10.296 12.304  -23.165 1.00 61.70  ? 516  LYS B CA  1 
ATOM   8160 C C   . LYS B 1 516 ? -9.872  13.508  -24.013 1.00 59.61  ? 516  LYS B C   1 
ATOM   8161 O O   . LYS B 1 516 ? -9.043  13.360  -24.899 1.00 58.29  ? 516  LYS B O   1 
ATOM   8162 C CB  . LYS B 1 516 ? -9.620  12.301  -21.778 1.00 62.10  ? 516  LYS B CB  1 
ATOM   8163 C CG  . LYS B 1 516 ? -9.953  11.054  -20.926 1.00 66.50  ? 516  LYS B CG  1 
ATOM   8164 C CD  . LYS B 1 516 ? -9.543  11.194  -19.437 1.00 73.61  ? 516  LYS B CD  1 
ATOM   8165 C CE  . LYS B 1 516 ? -7.992  11.094  -19.215 1.00 75.03  ? 516  LYS B CE  1 
ATOM   8166 N NZ  . LYS B 1 516 ? -7.599  10.764  -17.793 1.00 76.76  ? 516  LYS B NZ  1 
ATOM   8167 N N   . PRO B 1 517 ? -10.460 14.692  -23.775 1.00 60.20  ? 517  PRO B N   1 
ATOM   8168 C CA  . PRO B 1 517 ? -9.965  15.900  -24.469 1.00 59.17  ? 517  PRO B CA  1 
ATOM   8169 C C   . PRO B 1 517 ? -8.458  16.112  -24.240 1.00 56.88  ? 517  PRO B C   1 
ATOM   8170 O O   . PRO B 1 517 ? -7.932  15.663  -23.224 1.00 56.52  ? 517  PRO B O   1 
ATOM   8171 C CB  . PRO B 1 517 ? -10.748 17.045  -23.791 1.00 60.97  ? 517  PRO B CB  1 
ATOM   8172 C CG  . PRO B 1 517 ? -11.938 16.409  -23.198 1.00 62.19  ? 517  PRO B CG  1 
ATOM   8173 C CD  . PRO B 1 517 ? -11.560 14.996  -22.844 1.00 61.97  ? 517  PRO B CD  1 
ATOM   8174 N N   . LEU B 1 518 ? -7.780  16.770  -25.176 1.00 55.39  ? 518  LEU B N   1 
ATOM   8175 C CA  . LEU B 1 518 ? -6.341  17.061  -25.051 1.00 53.94  ? 518  LEU B CA  1 
ATOM   8176 C C   . LEU B 1 518 ? -5.914  17.473  -23.649 1.00 54.81  ? 518  LEU B C   1 
ATOM   8177 O O   . LEU B 1 518 ? -6.509  18.369  -23.037 1.00 56.05  ? 518  LEU B O   1 
ATOM   8178 C CB  . LEU B 1 518 ? -5.921  18.200  -25.982 1.00 53.33  ? 518  LEU B CB  1 
ATOM   8179 C CG  . LEU B 1 518 ? -5.613  18.031  -27.466 1.00 51.74  ? 518  LEU B CG  1 
ATOM   8180 C CD1 . LEU B 1 518 ? -4.926  19.288  -27.927 1.00 51.84  ? 518  LEU B CD1 1 
ATOM   8181 C CD2 . LEU B 1 518 ? -4.747  16.854  -27.762 1.00 47.11  ? 518  LEU B CD2 1 
ATOM   8182 N N   . GLU B 1 519 ? -4.863  16.834  -23.157 1.00 54.11  ? 519  GLU B N   1 
ATOM   8183 C CA  . GLU B 1 519 ? -4.220  17.254  -21.913 1.00 54.83  ? 519  GLU B CA  1 
ATOM   8184 C C   . GLU B 1 519 ? -2.786  17.751  -22.229 1.00 52.63  ? 519  GLU B C   1 
ATOM   8185 O O   . GLU B 1 519 ? -2.055  17.110  -22.983 1.00 51.35  ? 519  GLU B O   1 
ATOM   8186 C CB  . GLU B 1 519 ? -4.217  16.075  -20.934 1.00 55.55  ? 519  GLU B CB  1 
ATOM   8187 C CG  . GLU B 1 519 ? -3.496  16.315  -19.624 1.00 58.92  ? 519  GLU B CG  1 
ATOM   8188 C CD  . GLU B 1 519 ? -3.609  15.132  -18.667 1.00 62.50  ? 519  GLU B CD  1 
ATOM   8189 O OE1 . GLU B 1 519 ? -4.671  15.046  -17.986 1.00 66.42  ? 519  GLU B OE1 1 
ATOM   8190 O OE2 . GLU B 1 519 ? -2.645  14.316  -18.589 1.00 60.15  ? 519  GLU B OE2 1 
ATOM   8191 N N   . VAL B 1 520 ? -2.398  18.893  -21.680 1.00 52.38  ? 520  VAL B N   1 
ATOM   8192 C CA  . VAL B 1 520 ? -1.049  19.436  -21.915 1.00 51.04  ? 520  VAL B CA  1 
ATOM   8193 C C   . VAL B 1 520 ? -0.072  18.966  -20.828 1.00 50.50  ? 520  VAL B C   1 
ATOM   8194 O O   . VAL B 1 520 ? -0.274  19.254  -19.660 1.00 51.71  ? 520  VAL B O   1 
ATOM   8195 C CB  . VAL B 1 520 ? -1.047  21.001  -22.029 1.00 51.32  ? 520  VAL B CB  1 
ATOM   8196 C CG1 . VAL B 1 520 ? 0.349   21.504  -22.337 1.00 51.41  ? 520  VAL B CG1 1 
ATOM   8197 C CG2 . VAL B 1 520 ? -1.983  21.467  -23.124 1.00 50.85  ? 520  VAL B CG2 1 
ATOM   8198 N N   . ARG B 1 521 ? 0.974   18.244  -21.213 1.00 49.06  ? 521  ARG B N   1 
ATOM   8199 C CA  . ARG B 1 521 ? 1.995   17.794  -20.268 1.00 49.24  ? 521  ARG B CA  1 
ATOM   8200 C C   . ARG B 1 521 ? 3.341   18.443  -20.559 1.00 49.35  ? 521  ARG B C   1 
ATOM   8201 O O   . ARG B 1 521 ? 3.571   18.976  -21.641 1.00 49.19  ? 521  ARG B O   1 
ATOM   8202 C CB  . ARG B 1 521 ? 2.138   16.285  -20.317 1.00 48.59  ? 521  ARG B CB  1 
ATOM   8203 C CG  . ARG B 1 521 ? 0.955   15.555  -19.745 1.00 49.74  ? 521  ARG B CG  1 
ATOM   8204 C CD  . ARG B 1 521 ? 1.047   14.079  -19.989 1.00 49.44  ? 521  ARG B CD  1 
ATOM   8205 N NE  . ARG B 1 521 ? -0.255  13.447  -19.769 1.00 50.00  ? 521  ARG B NE  1 
ATOM   8206 C CZ  . ARG B 1 521 ? -0.589  12.220  -20.170 1.00 49.45  ? 521  ARG B CZ  1 
ATOM   8207 N NH1 . ARG B 1 521 ? 0.273   11.441  -20.827 1.00 46.58  ? 521  ARG B NH1 1 
ATOM   8208 N NH2 . ARG B 1 521 ? -1.810  11.774  -19.921 1.00 50.97  ? 521  ARG B NH2 1 
ATOM   8209 N N   . ARG B 1 522 ? 4.243   18.408  -19.593 1.00 50.35  ? 522  ARG B N   1 
ATOM   8210 C CA  . ARG B 1 522 ? 5.534   19.054  -19.765 1.00 50.56  ? 522  ARG B CA  1 
ATOM   8211 C C   . ARG B 1 522 ? 6.646   18.063  -19.507 1.00 50.58  ? 522  ARG B C   1 
ATOM   8212 O O   . ARG B 1 522 ? 6.636   17.367  -18.492 1.00 51.11  ? 522  ARG B O   1 
ATOM   8213 C CB  . ARG B 1 522 ? 5.650   20.266  -18.853 1.00 51.07  ? 522  ARG B CB  1 
ATOM   8214 C CG  . ARG B 1 522 ? 4.850   21.448  -19.343 1.00 52.65  ? 522  ARG B CG  1 
ATOM   8215 C CD  . ARG B 1 522 ? 4.864   22.646  -18.390 1.00 56.78  ? 522  ARG B CD  1 
ATOM   8216 N NE  . ARG B 1 522 ? 6.174   23.291  -18.344 1.00 59.23  ? 522  ARG B NE  1 
ATOM   8217 C CZ  . ARG B 1 522 ? 6.429   24.464  -17.767 1.00 61.86  ? 522  ARG B CZ  1 
ATOM   8218 N NH1 . ARG B 1 522 ? 5.458   25.152  -17.185 1.00 63.07  ? 522  ARG B NH1 1 
ATOM   8219 N NH2 . ARG B 1 522 ? 7.667   24.955  -17.778 1.00 61.43  ? 522  ARG B NH2 1 
ATOM   8220 N N   . GLY B 1 523 ? 7.590   17.990  -20.437 1.00 50.43  ? 523  GLY B N   1 
ATOM   8221 C CA  . GLY B 1 523 ? 8.772   17.160  -20.257 1.00 50.98  ? 523  GLY B CA  1 
ATOM   8222 C C   . GLY B 1 523 ? 8.504   15.771  -20.771 1.00 51.28  ? 523  GLY B C   1 
ATOM   8223 O O   . GLY B 1 523 ? 7.763   14.996  -20.153 1.00 51.75  ? 523  GLY B O   1 
ATOM   8224 N N   . LEU B 1 524 ? 9.089   15.465  -21.926 1.00 51.14  ? 524  LEU B N   1 
ATOM   8225 C CA  . LEU B 1 524 ? 8.885   14.190  -22.566 1.00 51.23  ? 524  LEU B CA  1 
ATOM   8226 C C   . LEU B 1 524 ? 9.866   13.210  -21.994 1.00 51.41  ? 524  LEU B C   1 
ATOM   8227 O O   . LEU B 1 524 ? 10.993  13.086  -22.493 1.00 51.27  ? 524  LEU B O   1 
ATOM   8228 C CB  . LEU B 1 524 ? 9.108   14.322  -24.059 1.00 51.19  ? 524  LEU B CB  1 
ATOM   8229 C CG  . LEU B 1 524 ? 8.635   13.175  -24.953 1.00 52.86  ? 524  LEU B CG  1 
ATOM   8230 C CD1 . LEU B 1 524 ? 7.120   13.032  -24.902 1.00 55.23  ? 524  LEU B CD1 1 
ATOM   8231 C CD2 . LEU B 1 524 ? 9.075   13.478  -26.367 1.00 53.31  ? 524  LEU B CD2 1 
ATOM   8232 N N   . ARG B 1 525 ? 9.436   12.528  -20.932 1.00 51.80  ? 525  ARG B N   1 
ATOM   8233 C CA  . ARG B 1 525 ? 10.271  11.574  -20.237 1.00 52.32  ? 525  ARG B CA  1 
ATOM   8234 C C   . ARG B 1 525 ? 11.643  12.220  -19.922 1.00 52.09  ? 525  ARG B C   1 
ATOM   8235 O O   . ARG B 1 525 ? 12.707  11.691  -20.246 1.00 51.55  ? 525  ARG B O   1 
ATOM   8236 C CB  . ARG B 1 525 ? 10.393  10.303  -21.085 1.00 52.05  ? 525  ARG B CB  1 
ATOM   8237 C CG  . ARG B 1 525 ? 10.485  9.070   -20.249 1.00 55.58  ? 525  ARG B CG  1 
ATOM   8238 C CD  . ARG B 1 525 ? 10.023  7.845   -20.985 1.00 58.92  ? 525  ARG B CD  1 
ATOM   8239 N NE  . ARG B 1 525 ? 8.565   7.748   -21.105 1.00 62.64  ? 525  ARG B NE  1 
ATOM   8240 C CZ  . ARG B 1 525 ? 7.912   6.643   -21.490 1.00 64.48  ? 525  ARG B CZ  1 
ATOM   8241 N NH1 . ARG B 1 525 ? 8.575   5.522   -21.775 1.00 63.82  ? 525  ARG B NH1 1 
ATOM   8242 N NH2 . ARG B 1 525 ? 6.582   6.648   -21.584 1.00 66.24  ? 525  ARG B NH2 1 
ATOM   8243 N N   . ALA B 1 526 ? 11.596  13.380  -19.277 1.00 52.30  ? 526  ALA B N   1 
ATOM   8244 C CA  . ALA B 1 526 ? 12.777  14.242  -19.175 1.00 52.21  ? 526  ALA B CA  1 
ATOM   8245 C C   . ALA B 1 526 ? 13.985  13.668  -18.437 1.00 52.38  ? 526  ALA B C   1 
ATOM   8246 O O   . ALA B 1 526 ? 15.097  13.765  -18.943 1.00 52.21  ? 526  ALA B O   1 
ATOM   8247 C CB  . ALA B 1 526 ? 12.404  15.601  -18.613 1.00 52.73  ? 526  ALA B CB  1 
ATOM   8248 N N   . GLN B 1 527 ? 13.784  13.097  -17.252 1.00 53.09  ? 527  GLN B N   1 
ATOM   8249 C CA  . GLN B 1 527 ? 14.924  12.595  -16.463 1.00 54.23  ? 527  GLN B CA  1 
ATOM   8250 C C   . GLN B 1 527 ? 15.535  11.382  -17.164 1.00 53.22  ? 527  GLN B C   1 
ATOM   8251 O O   . GLN B 1 527 ? 16.755  11.252  -17.269 1.00 53.82  ? 527  GLN B O   1 
ATOM   8252 C CB  . GLN B 1 527 ? 14.541  12.236  -15.012 1.00 55.48  ? 527  GLN B CB  1 
ATOM   8253 C CG  . GLN B 1 527 ? 14.122  13.402  -14.118 1.00 58.91  ? 527  GLN B CG  1 
ATOM   8254 C CD  . GLN B 1 527 ? 15.234  14.463  -13.943 1.00 64.19  ? 527  GLN B CD  1 
ATOM   8255 O OE1 . GLN B 1 527 ? 15.135  15.572  -14.500 1.00 65.30  ? 527  GLN B OE1 1 
ATOM   8256 N NE2 . GLN B 1 527 ? 16.293  14.124  -13.168 1.00 64.30  ? 527  GLN B NE2 1 
ATOM   8257 N N   . THR B 1 528 ? 14.674  10.511  -17.665 1.00 51.76  ? 528  THR B N   1 
ATOM   8258 C CA  . THR B 1 528 ? 15.116  9.304   -18.323 1.00 50.89  ? 528  THR B CA  1 
ATOM   8259 C C   . THR B 1 528 ? 15.871  9.598   -19.618 1.00 49.85  ? 528  THR B C   1 
ATOM   8260 O O   . THR B 1 528 ? 16.904  8.979   -19.871 1.00 50.18  ? 528  THR B O   1 
ATOM   8261 C CB  . THR B 1 528 ? 13.939  8.315   -18.530 1.00 50.41  ? 528  THR B CB  1 
ATOM   8262 O OG1 . THR B 1 528 ? 13.583  7.742   -17.261 1.00 51.51  ? 528  THR B OG1 1 
ATOM   8263 C CG2 . THR B 1 528 ? 14.323  7.205   -19.473 1.00 49.30  ? 528  THR B CG2 1 
ATOM   8264 N N   . CYS B 1 529 ? 15.379  10.535  -20.428 1.00 48.48  ? 529  CYS B N   1 
ATOM   8265 C CA  . CYS B 1 529 ? 16.076  10.858  -21.685 1.00 47.84  ? 529  CYS B CA  1 
ATOM   8266 C C   . CYS B 1 529 ? 17.418  11.560  -21.462 1.00 47.67  ? 529  CYS B C   1 
ATOM   8267 O O   . CYS B 1 529 ? 18.383  11.313  -22.194 1.00 47.05  ? 529  CYS B O   1 
ATOM   8268 C CB  . CYS B 1 529 ? 15.164  11.578  -22.689 1.00 46.83  ? 529  CYS B CB  1 
ATOM   8269 S SG  . CYS B 1 529 ? 13.810  10.473  -23.212 1.00 49.72  ? 529  CYS B SG  1 
ATOM   8270 N N   . ALA B 1 530 ? 17.482  12.403  -20.435 1.00 47.60  ? 530  ALA B N   1 
ATOM   8271 C CA  . ALA B 1 530 ? 18.761  12.938  -19.977 1.00 48.76  ? 530  ALA B CA  1 
ATOM   8272 C C   . ALA B 1 530 ? 19.757  11.794  -19.730 1.00 49.42  ? 530  ALA B C   1 
ATOM   8273 O O   . ALA B 1 530 ? 20.923  11.880  -20.117 1.00 49.68  ? 530  ALA B O   1 
ATOM   8274 C CB  . ALA B 1 530 ? 18.579  13.768  -18.714 1.00 49.54  ? 530  ALA B CB  1 
ATOM   8275 N N   . PHE B 1 531 ? 19.277  10.714  -19.115 1.00 49.27  ? 531  PHE B N   1 
ATOM   8276 C CA  . PHE B 1 531 ? 20.094  9.535   -18.940 1.00 50.07  ? 531  PHE B CA  1 
ATOM   8277 C C   . PHE B 1 531 ? 20.627  9.006   -20.275 1.00 50.04  ? 531  PHE B C   1 
ATOM   8278 O O   . PHE B 1 531 ? 21.835  8.772   -20.402 1.00 50.87  ? 531  PHE B O   1 
ATOM   8279 C CB  . PHE B 1 531 ? 19.354  8.444   -18.170 1.00 49.73  ? 531  PHE B CB  1 
ATOM   8280 C CG  . PHE B 1 531 ? 20.109  7.160   -18.100 1.00 50.03  ? 531  PHE B CG  1 
ATOM   8281 C CD1 . PHE B 1 531 ? 21.170  7.011   -17.217 1.00 51.93  ? 531  PHE B CD1 1 
ATOM   8282 C CD2 . PHE B 1 531 ? 19.785  6.106   -18.934 1.00 48.89  ? 531  PHE B CD2 1 
ATOM   8283 C CE1 . PHE B 1 531 ? 21.891  5.816   -17.154 1.00 51.17  ? 531  PHE B CE1 1 
ATOM   8284 C CE2 . PHE B 1 531 ? 20.495  4.911   -18.878 1.00 50.04  ? 531  PHE B CE2 1 
ATOM   8285 C CZ  . PHE B 1 531 ? 21.551  4.770   -17.980 1.00 51.43  ? 531  PHE B CZ  1 
ATOM   8286 N N   . TRP B 1 532 ? 19.736  8.844   -21.258 1.00 49.01  ? 532  TRP B N   1 
ATOM   8287 C CA  . TRP B 1 532 ? 20.108  8.304   -22.569 1.00 49.09  ? 532  TRP B CA  1 
ATOM   8288 C C   . TRP B 1 532 ? 20.858  9.270   -23.477 1.00 49.96  ? 532  TRP B C   1 
ATOM   8289 O O   . TRP B 1 532 ? 21.724  8.844   -24.224 1.00 50.34  ? 532  TRP B O   1 
ATOM   8290 C CB  . TRP B 1 532 ? 18.892  7.784   -23.329 1.00 47.28  ? 532  TRP B CB  1 
ATOM   8291 C CG  . TRP B 1 532 ? 18.300  6.547   -22.757 1.00 46.12  ? 532  TRP B CG  1 
ATOM   8292 C CD1 . TRP B 1 532 ? 17.174  6.464   -22.007 1.00 45.39  ? 532  TRP B CD1 1 
ATOM   8293 C CD2 . TRP B 1 532 ? 18.791  5.204   -22.897 1.00 45.07  ? 532  TRP B CD2 1 
ATOM   8294 N NE1 . TRP B 1 532 ? 16.913  5.150   -21.679 1.00 45.24  ? 532  TRP B NE1 1 
ATOM   8295 C CE2 . TRP B 1 532 ? 17.897  4.359   -22.207 1.00 44.85  ? 532  TRP B CE2 1 
ATOM   8296 C CE3 . TRP B 1 532 ? 19.893  4.636   -23.544 1.00 44.53  ? 532  TRP B CE3 1 
ATOM   8297 C CZ2 . TRP B 1 532 ? 18.075  2.980   -22.132 1.00 46.03  ? 532  TRP B CZ2 1 
ATOM   8298 C CZ3 . TRP B 1 532 ? 20.065  3.262   -23.482 1.00 46.03  ? 532  TRP B CZ3 1 
ATOM   8299 C CH2 . TRP B 1 532 ? 19.159  2.447   -22.780 1.00 47.42  ? 532  TRP B CH2 1 
ATOM   8300 N N   . ASN B 1 533 ? 20.523  10.556  -23.423 1.00 50.82  ? 533  ASN B N   1 
ATOM   8301 C CA  . ASN B 1 533 ? 21.049  11.529  -24.388 1.00 51.49  ? 533  ASN B CA  1 
ATOM   8302 C C   . ASN B 1 533 ? 22.269  12.292  -23.904 1.00 53.62  ? 533  ASN B C   1 
ATOM   8303 O O   . ASN B 1 533 ? 23.075  12.784  -24.712 1.00 53.76  ? 533  ASN B O   1 
ATOM   8304 C CB  . ASN B 1 533 ? 19.954  12.503  -24.820 1.00 50.67  ? 533  ASN B CB  1 
ATOM   8305 C CG  . ASN B 1 533 ? 18.766  11.788  -25.434 1.00 49.73  ? 533  ASN B CG  1 
ATOM   8306 O OD1 . ASN B 1 533 ? 18.902  10.663  -25.886 1.00 49.92  ? 533  ASN B OD1 1 
ATOM   8307 N ND2 . ASN B 1 533 ? 17.594  12.424  -25.426 1.00 49.78  ? 533  ASN B ND2 1 
ATOM   8308 N N   . ARG B 1 534 ? 22.410  12.387  -22.585 1.00 55.31  ? 534  ARG B N   1 
ATOM   8309 C CA  . ARG B 1 534 ? 23.497  13.161  -22.011 1.00 57.35  ? 534  ARG B CA  1 
ATOM   8310 C C   . ARG B 1 534 ? 24.503  12.296  -21.274 1.00 59.11  ? 534  ARG B C   1 
ATOM   8311 O O   . ARG B 1 534 ? 25.704  12.531  -21.399 1.00 60.69  ? 534  ARG B O   1 
ATOM   8312 C CB  . ARG B 1 534 ? 22.968  14.285  -21.121 1.00 57.65  ? 534  ARG B CB  1 
ATOM   8313 C CG  . ARG B 1 534 ? 22.295  15.410  -21.892 1.00 57.98  ? 534  ARG B CG  1 
ATOM   8314 C CD  . ARG B 1 534 ? 21.493  16.271  -20.966 1.00 60.32  ? 534  ARG B CD  1 
ATOM   8315 N NE  . ARG B 1 534 ? 21.682  17.694  -21.261 1.00 64.03  ? 534  ARG B NE  1 
ATOM   8316 C CZ  . ARG B 1 534 ? 20.769  18.482  -21.840 1.00 63.92  ? 534  ARG B CZ  1 
ATOM   8317 N NH1 . ARG B 1 534 ? 19.562  18.009  -22.193 1.00 59.54  ? 534  ARG B NH1 1 
ATOM   8318 N NH2 . ARG B 1 534 ? 21.069  19.762  -22.055 1.00 63.74  ? 534  ARG B NH2 1 
ATOM   8319 N N   . PHE B 1 535 ? 24.041  11.292  -20.528 1.00 59.53  ? 535  PHE B N   1 
ATOM   8320 C CA  . PHE B 1 535 ? 24.972  10.518  -19.725 1.00 61.32  ? 535  PHE B CA  1 
ATOM   8321 C C   . PHE B 1 535 ? 25.558  9.328   -20.439 1.00 62.60  ? 535  PHE B C   1 
ATOM   8322 O O   . PHE B 1 535 ? 26.774  9.162   -20.501 1.00 63.67  ? 535  PHE B O   1 
ATOM   8323 C CB  . PHE B 1 535 ? 24.387  10.054  -18.393 1.00 61.44  ? 535  PHE B CB  1 
ATOM   8324 C CG  . PHE B 1 535 ? 25.368  9.268   -17.577 1.00 60.30  ? 535  PHE B CG  1 
ATOM   8325 C CD1 . PHE B 1 535 ? 26.459  9.901   -16.996 1.00 59.06  ? 535  PHE B CD1 1 
ATOM   8326 C CD2 . PHE B 1 535 ? 25.241  7.894   -17.447 1.00 58.48  ? 535  PHE B CD2 1 
ATOM   8327 C CE1 . PHE B 1 535 ? 27.388  9.192   -16.273 1.00 59.62  ? 535  PHE B CE1 1 
ATOM   8328 C CE2 . PHE B 1 535 ? 26.174  7.172   -16.716 1.00 59.85  ? 535  PHE B CE2 1 
ATOM   8329 C CZ  . PHE B 1 535 ? 27.244  7.825   -16.126 1.00 60.44  ? 535  PHE B CZ  1 
ATOM   8330 N N   . LEU B 1 536 ? 24.690  8.479   -20.949 1.00 63.08  ? 536  LEU B N   1 
ATOM   8331 C CA  . LEU B 1 536 ? 25.146  7.239   -21.529 1.00 65.29  ? 536  LEU B CA  1 
ATOM   8332 C C   . LEU B 1 536 ? 26.171  7.419   -22.661 1.00 67.22  ? 536  LEU B C   1 
ATOM   8333 O O   . LEU B 1 536 ? 27.162  6.694   -22.677 1.00 67.89  ? 536  LEU B O   1 
ATOM   8334 C CB  . LEU B 1 536 ? 23.965  6.372   -21.955 1.00 63.83  ? 536  LEU B CB  1 
ATOM   8335 C CG  . LEU B 1 536 ? 24.269  4.895   -21.766 1.00 65.31  ? 536  LEU B CG  1 
ATOM   8336 C CD1 . LEU B 1 536 ? 24.522  4.559   -20.298 1.00 67.15  ? 536  LEU B CD1 1 
ATOM   8337 C CD2 . LEU B 1 536 ? 23.141  4.091   -22.300 1.00 65.06  ? 536  LEU B CD2 1 
ATOM   8338 N N   . PRO B 1 537 ? 25.951  8.384   -23.595 1.00 68.37  ? 537  PRO B N   1 
ATOM   8339 C CA  . PRO B 1 537 ? 26.963  8.621   -24.624 1.00 70.77  ? 537  PRO B CA  1 
ATOM   8340 C C   . PRO B 1 537 ? 28.319  8.887   -23.997 1.00 74.72  ? 537  PRO B C   1 
ATOM   8341 O O   . PRO B 1 537 ? 29.320  8.388   -24.489 1.00 76.09  ? 537  PRO B O   1 
ATOM   8342 C CB  . PRO B 1 537 ? 26.466  9.892   -25.328 1.00 69.62  ? 537  PRO B CB  1 
ATOM   8343 C CG  . PRO B 1 537 ? 25.023  9.855   -25.169 1.00 67.28  ? 537  PRO B CG  1 
ATOM   8344 C CD  . PRO B 1 537 ? 24.797  9.285   -23.788 1.00 67.27  ? 537  PRO B CD  1 
ATOM   8345 N N   . LYS B 1 538 ? 28.332  9.639   -22.897 1.00 77.80  ? 538  LYS B N   1 
ATOM   8346 C CA  . LYS B 1 538 ? 29.548  9.980   -22.163 1.00 81.88  ? 538  LYS B CA  1 
ATOM   8347 C C   . LYS B 1 538 ? 30.227  8.751   -21.544 1.00 84.83  ? 538  LYS B C   1 
ATOM   8348 O O   . LYS B 1 538 ? 31.253  8.888   -20.900 1.00 86.64  ? 538  LYS B O   1 
ATOM   8349 C CB  . LYS B 1 538 ? 29.197  10.985  -21.067 1.00 81.88  ? 538  LYS B CB  1 
ATOM   8350 C CG  . LYS B 1 538 ? 30.266  11.982  -20.719 1.00 84.72  ? 538  LYS B CG  1 
ATOM   8351 C CD  . LYS B 1 538 ? 29.976  13.363  -21.306 1.00 86.32  ? 538  LYS B CD  1 
ATOM   8352 C CE  . LYS B 1 538 ? 30.452  14.455  -20.338 1.00 89.54  ? 538  LYS B CE  1 
ATOM   8353 N NZ  . LYS B 1 538 ? 30.889  15.706  -21.025 1.00 90.61  ? 538  LYS B NZ  1 
ATOM   8354 N N   . LEU B 1 539 ? 29.685  7.554   -21.764 1.00 86.82  ? 539  LEU B N   1 
ATOM   8355 C CA  . LEU B 1 539 ? 30.115  6.396   -20.975 1.00 90.88  ? 539  LEU B CA  1 
ATOM   8356 C C   . LEU B 1 539 ? 31.370  5.601   -21.379 1.00 95.26  ? 539  LEU B C   1 
ATOM   8357 O O   . LEU B 1 539 ? 32.418  5.929   -20.846 1.00 97.49  ? 539  LEU B O   1 
ATOM   8358 C CB  . LEU B 1 539 ? 28.961  5.474   -20.572 1.00 89.38  ? 539  LEU B CB  1 
ATOM   8359 C CG  . LEU B 1 539 ? 28.867  5.216   -19.069 1.00 88.85  ? 539  LEU B CG  1 
ATOM   8360 C CD1 . LEU B 1 539 ? 27.823  4.174   -18.785 1.00 87.44  ? 539  LEU B CD1 1 
ATOM   8361 C CD2 . LEU B 1 539 ? 30.180  4.793   -18.474 1.00 89.67  ? 539  LEU B CD2 1 
ATOM   8362 N N   . LEU B 1 540 ? 31.371  4.632   -22.308 1.00 98.63  ? 540  LEU B N   1 
ATOM   8363 C CA  . LEU B 1 540 ? 30.683  4.566   -23.618 1.00 100.70 ? 540  LEU B CA  1 
ATOM   8364 C C   . LEU B 1 540 ? 31.239  5.558   -24.657 1.00 103.32 ? 540  LEU B C   1 
ATOM   8365 O O   . LEU B 1 540 ? 31.592  5.145   -25.763 1.00 103.78 ? 540  LEU B O   1 
ATOM   8366 C CB  . LEU B 1 540 ? 29.148  4.500   -23.568 1.00 98.61  ? 540  LEU B CB  1 
ATOM   8367 C CG  . LEU B 1 540 ? 28.544  3.528   -24.603 1.00 97.79  ? 540  LEU B CG  1 
ATOM   8368 C CD1 . LEU B 1 540 ? 28.828  2.066   -24.232 1.00 98.97  ? 540  LEU B CD1 1 
ATOM   8369 C CD2 . LEU B 1 540 ? 27.042  3.747   -24.827 1.00 95.56  ? 540  LEU B CD2 1 
ATOM   8370 N N   . SER B 1 541 ? 31.327  6.848   -24.303 1.00 81.98  ? 541  SER B N   1 
ATOM   8371 C CA  . SER B 1 541 ? 32.170  7.828   -25.042 1.00 85.09  ? 541  SER B CA  1 
ATOM   8372 C C   . SER B 1 541 ? 33.613  7.606   -24.611 1.00 87.24  ? 541  SER B C   1 
ATOM   8373 O O   . SER B 1 541 ? 34.131  6.499   -24.786 1.00 87.84  ? 541  SER B O   1 
ATOM   8374 C CB  . SER B 1 541 ? 31.738  9.297   -24.792 1.00 85.08  ? 541  SER B CB  1 
ATOM   8375 O OG  . SER B 1 541 ? 32.654  10.253  -25.326 1.00 84.89  ? 541  SER B OG  1 
ATOM   8376 N N   . ALA B 1 542 ? 34.240  8.629   -24.020 1.00 89.87  ? 542  ALA B N   1 
ATOM   8377 C CA  . ALA B 1 542 ? 35.622  8.534   -23.522 1.00 92.34  ? 542  ALA B CA  1 
ATOM   8378 C C   . ALA B 1 542 ? 35.831  7.443   -22.422 1.00 94.01  ? 542  ALA B C   1 
ATOM   8379 O O   . ALA B 1 542 ? 36.051  7.790   -21.250 1.00 94.16  ? 542  ALA B O   1 
ATOM   8380 C CB  . ALA B 1 542 ? 36.112  9.935   -23.043 1.00 92.24  ? 542  ALA B CB  1 
ATOM   8381 N N   . THR B 1 543 ? 35.729  6.154   -22.828 1.00 95.85  ? 543  THR B N   1 
ATOM   8382 C CA  . THR B 1 543 ? 36.009  4.897   -22.033 1.00 97.63  ? 543  THR B CA  1 
ATOM   8383 C C   . THR B 1 543 ? 34.984  3.698   -22.180 1.00 98.57  ? 543  THR B C   1 
ATOM   8384 O O   . THR B 1 543 ? 34.206  3.443   -21.246 1.00 98.65  ? 543  THR B O   1 
ATOM   8385 C CB  . THR B 1 543 ? 36.400  5.159   -20.491 1.00 97.86  ? 543  THR B CB  1 
ATOM   8386 O OG1 . THR B 1 543 ? 37.082  4.018   -19.945 1.00 98.73  ? 543  THR B OG1 1 
ATOM   8387 C CG2 . THR B 1 543 ? 35.173  5.482   -19.592 1.00 97.89  ? 543  THR B CG2 1 
ATOM   8388 N N   . ALA B 1 544 ? 34.973  2.941   -23.297 1.00 99.51  ? 544  ALA B N   1 
ATOM   8389 C CA  . ALA B 1 544 ? 35.831  3.104   -24.487 1.00 100.32 ? 544  ALA B CA  1 
ATOM   8390 C C   . ALA B 1 544 ? 35.073  3.795   -25.629 1.00 100.55 ? 544  ALA B C   1 
ATOM   8391 O O   . ALA B 1 544 ? 35.650  4.547   -26.430 1.00 100.62 ? 544  ALA B O   1 
ATOM   8392 C CB  . ALA B 1 544 ? 36.335  1.737   -24.989 1.00 100.46 ? 544  ALA B CB  1 
HETATM 8393 C C1  . NAG C 2 .   ? 25.292  35.571  -0.721  1.00 69.41  ? 1542 NAG A C1  1 
HETATM 8394 C C2  . NAG C 2 .   ? 25.345  35.830  -2.258  1.00 76.26  ? 1542 NAG A C2  1 
HETATM 8395 C C3  . NAG C 2 .   ? 26.656  35.310  -2.908  1.00 76.77  ? 1542 NAG A C3  1 
HETATM 8396 C C4  . NAG C 2 .   ? 27.907  35.715  -2.112  1.00 77.22  ? 1542 NAG A C4  1 
HETATM 8397 C C5  . NAG C 2 .   ? 27.720  35.287  -0.640  1.00 76.53  ? 1542 NAG A C5  1 
HETATM 8398 C C6  . NAG C 2 .   ? 28.975  35.501  0.242   1.00 77.87  ? 1542 NAG A C6  1 
HETATM 8399 C C7  . NAG C 2 .   ? 23.097  36.040  -3.366  1.00 81.32  ? 1542 NAG A C7  1 
HETATM 8400 C C8  . NAG C 2 .   ? 21.927  35.288  -3.962  1.00 81.72  ? 1542 NAG A C8  1 
HETATM 8401 N N2  . NAG C 2 .   ? 24.124  35.293  -2.893  1.00 78.82  ? 1542 NAG A N2  1 
HETATM 8402 O O3  . NAG C 2 .   ? 26.818  35.724  -4.254  1.00 76.29  ? 1542 NAG A O3  1 
HETATM 8403 O O4  . NAG C 2 .   ? 29.076  35.168  -2.714  1.00 77.47  ? 1542 NAG A O4  1 
HETATM 8404 O O5  . NAG C 2 .   ? 26.546  35.913  -0.099  1.00 72.99  ? 1542 NAG A O5  1 
HETATM 8405 O O6  . NAG C 2 .   ? 29.040  36.803  0.809   1.00 78.23  ? 1542 NAG A O6  1 
HETATM 8406 O O7  . NAG C 2 .   ? 23.062  37.285  -3.342  1.00 82.20  ? 1542 NAG A O7  1 
HETATM 8407 C C1  . NAG D 2 .   ? 12.064  34.200  25.551  1.00 75.42  ? 1543 NAG A C1  1 
HETATM 8408 C C2  . NAG D 2 .   ? 13.450  34.888  25.558  1.00 82.59  ? 1543 NAG A C2  1 
HETATM 8409 C C3  . NAG D 2 .   ? 13.457  36.227  26.319  1.00 83.55  ? 1543 NAG A C3  1 
HETATM 8410 C C4  . NAG D 2 .   ? 12.345  37.106  25.721  1.00 83.89  ? 1543 NAG A C4  1 
HETATM 8411 C C5  . NAG D 2 .   ? 10.986  36.426  25.995  1.00 83.74  ? 1543 NAG A C5  1 
HETATM 8412 C C6  . NAG D 2 .   ? 9.818   37.231  25.383  1.00 85.07  ? 1543 NAG A C6  1 
HETATM 8413 C C7  . NAG D 2 .   ? 15.141  33.195  25.111  1.00 85.71  ? 1543 NAG A C7  1 
HETATM 8414 C C8  . NAG D 2 .   ? 16.178  32.232  25.628  1.00 86.23  ? 1543 NAG A C8  1 
HETATM 8415 N N2  . NAG D 2 .   ? 14.478  33.944  26.003  1.00 83.93  ? 1543 NAG A N2  1 
HETATM 8416 O O3  . NAG D 2 .   ? 14.722  36.865  26.233  1.00 83.53  ? 1543 NAG A O3  1 
HETATM 8417 O O4  . NAG D 2 .   ? 12.395  38.446  26.199  1.00 84.15  ? 1543 NAG A O4  1 
HETATM 8418 O O5  . NAG D 2 .   ? 10.927  35.068  25.515  1.00 79.55  ? 1543 NAG A O5  1 
HETATM 8419 O O6  . NAG D 2 .   ? 8.606   36.971  26.075  1.00 85.65  ? 1543 NAG A O6  1 
HETATM 8420 O O7  . NAG D 2 .   ? 14.926  33.269  23.897  1.00 86.50  ? 1543 NAG A O7  1 
HETATM 8421 O O1  . P6G E 3 .   ? 16.534  10.064  -12.028 1.00 70.21  ? 1544 P6G A O1  1 
HETATM 8422 C C2  . P6G E 3 .   ? 18.022  10.190  -12.603 1.00 68.53  ? 1544 P6G A C2  1 
HETATM 8423 C C3  . P6G E 3 .   ? 18.263  11.250  -13.515 1.00 66.68  ? 1544 P6G A C3  1 
HETATM 8424 O O4  . P6G E 3 .   ? 19.074  10.708  -14.582 1.00 65.48  ? 1544 P6G A O4  1 
HETATM 8425 C C5  . P6G E 3 .   ? 20.414  11.430  -14.983 1.00 62.97  ? 1544 P6G A C5  1 
HETATM 8426 C C6  . P6G E 3 .   ? 21.536  10.578  -15.355 1.00 60.71  ? 1544 P6G A C6  1 
HETATM 8427 O O7  . P6G E 3 .   ? 21.770  9.459   -14.445 1.00 60.82  ? 1544 P6G A O7  1 
HETATM 8428 C C8  . P6G E 3 .   ? 23.276  9.061   -14.151 1.00 58.40  ? 1544 P6G A C8  1 
HETATM 8429 C C9  . P6G E 3 .   ? 23.703  7.687   -14.368 1.00 57.82  ? 1544 P6G A C9  1 
HETATM 8430 O O10 . P6G E 3 .   ? 23.440  6.844   -13.244 1.00 57.46  ? 1544 P6G A O10 1 
HETATM 8431 C C11 . P6G E 3 .   ? 22.649  5.483   -13.499 1.00 60.53  ? 1544 P6G A C11 1 
HETATM 8432 C C12 . P6G E 3 .   ? 22.281  4.754   -12.205 1.00 63.36  ? 1544 P6G A C12 1 
HETATM 8433 O O13 . P6G E 3 .   ? 21.153  5.418   -11.621 1.00 65.23  ? 1544 P6G A O13 1 
HETATM 8434 C C14 . P6G E 3 .   ? 20.522  4.554   -10.518 1.00 65.90  ? 1544 P6G A C14 1 
HETATM 8435 C C15 . P6G E 3 .   ? 19.119  4.699   -10.246 1.00 67.36  ? 1544 P6G A C15 1 
HETATM 8436 O O16 . P6G E 3 .   ? 18.838  6.101   -10.062 1.00 68.75  ? 1544 P6G A O16 1 
HETATM 8437 C C17 . P6G E 3 .   ? 18.041  6.783   -11.222 1.00 69.47  ? 1544 P6G A C17 1 
HETATM 8438 C C18 . P6G E 3 .   ? 16.722  6.069   -11.612 1.00 71.95  ? 1544 P6G A C18 1 
HETATM 8439 O O19 . P6G E 3 .   ? 15.554  6.536   -12.323 1.00 73.77  ? 1544 P6G A O19 1 
HETATM 8440 N N3  . TZ4 F 4 .   ? 40.355  29.603  7.701   1.00 64.72  ? 1545 TZ4 A N3  1 
HETATM 8441 C C19 . TZ4 F 4 .   ? 40.157  28.432  8.411   1.00 66.48  ? 1545 TZ4 A C19 1 
HETATM 8442 C C18 . TZ4 F 4 .   ? 41.167  27.882  9.273   1.00 65.85  ? 1545 TZ4 A C18 1 
HETATM 8443 C C17 . TZ4 F 4 .   ? 40.915  26.709  9.959   1.00 64.77  ? 1545 TZ4 A C17 1 
HETATM 8444 C C16 . TZ4 F 4 .   ? 39.667  25.975  9.870   1.00 64.41  ? 1545 TZ4 A C16 1 
HETATM 8445 C C14 . TZ4 F 4 .   ? 38.660  26.528  9.005   1.00 64.86  ? 1545 TZ4 A C14 1 
HETATM 8446 C C15 . TZ4 F 4 .   ? 38.950  27.753  8.290   1.00 66.27  ? 1545 TZ4 A C15 1 
HETATM 8447 C C7  . TZ4 F 4 .   ? 37.494  25.769  8.668   1.00 65.26  ? 1545 TZ4 A C7  1 
HETATM 8448 C C8  . TZ4 F 4 .   ? 36.491  26.436  7.748   1.00 66.39  ? 1545 TZ4 A C8  1 
HETATM 8449 C C9  . TZ4 F 4 .   ? 35.718  27.495  8.280   1.00 67.07  ? 1545 TZ4 A C9  1 
HETATM 8450 C C10 . TZ4 F 4 .   ? 34.806  28.175  7.461   1.00 66.79  ? 1545 TZ4 A C10 1 
HETATM 8451 C C11 . TZ4 F 4 .   ? 34.658  27.791  6.120   1.00 66.50  ? 1545 TZ4 A C11 1 
HETATM 8452 C C12 . TZ4 F 4 .   ? 35.427  26.743  5.585   1.00 66.63  ? 1545 TZ4 A C12 1 
HETATM 8453 C C13 . TZ4 F 4 .   ? 36.346  26.065  6.392   1.00 66.75  ? 1545 TZ4 A C13 1 
HETATM 8454 C C4  . TZ4 F 4 .   ? 39.477  24.620  10.399  1.00 63.55  ? 1545 TZ4 A C4  1 
HETATM 8455 C C3  . TZ4 F 4 .   ? 40.440  23.959  11.253  1.00 60.31  ? 1545 TZ4 A C3  1 
HETATM 8456 C C2  . TZ4 F 4 .   ? 40.275  22.664  11.694  1.00 59.96  ? 1545 TZ4 A C2  1 
HETATM 8457 C C1  . TZ4 F 4 .   ? 39.117  21.922  11.320  1.00 60.10  ? 1545 TZ4 A C1  1 
HETATM 8458 N N1  . TZ4 F 4 .   ? 38.939  20.632  11.756  1.00 60.69  ? 1545 TZ4 A N1  1 
HETATM 8459 C C6  . TZ4 F 4 .   ? 38.291  23.861  10.027  1.00 63.50  ? 1545 TZ4 A C6  1 
HETATM 8460 C C5  . TZ4 F 4 .   ? 38.156  22.512  10.506  1.00 61.58  ? 1545 TZ4 A C5  1 
HETATM 8461 N N2  . TZ4 F 4 .   ? 37.346  24.504  9.175   1.00 63.24  ? 1545 TZ4 A N2  1 
HETATM 8462 C C20 . TZ4 F 4 .   ? 36.132  23.764  8.720   1.00 59.61  ? 1545 TZ4 A C20 1 
HETATM 8463 C C21 . TZ4 F 4 .   ? 35.173  23.022  9.629   1.00 55.08  ? 1545 TZ4 A C21 1 
HETATM 8464 C C22 . TZ4 F 4 .   ? 33.799  23.412  9.111   1.00 52.51  ? 1545 TZ4 A C22 1 
HETATM 8465 C C23 . TZ4 F 4 .   ? 32.878  22.234  8.843   1.00 48.44  ? 1545 TZ4 A C23 1 
HETATM 8466 C C24 . TZ4 F 4 .   ? 31.951  21.931  10.014  1.00 43.92  ? 1545 TZ4 A C24 1 
HETATM 8467 C C25 . TZ4 F 4 .   ? 30.751  22.846  10.169  1.00 40.84  ? 1545 TZ4 A C25 1 
HETATM 8468 C C26 . TZ4 F 4 .   ? 29.512  22.031  10.424  1.00 40.69  ? 1545 TZ4 A C26 1 
HETATM 8469 N N4  . TZ4 F 4 .   ? 29.536  20.901  11.147  1.00 40.27  ? 1545 TZ4 A N4  1 
HETATM 8470 N N5  . TZ4 F 4 .   ? 28.297  20.461  11.179  1.00 37.82  ? 1545 TZ4 A N5  1 
HETATM 8471 N N6  . TZ4 F 4 .   ? 27.488  21.284  10.507  1.00 38.87  ? 1545 TZ4 A N6  1 
HETATM 8472 C C27 . TZ4 F 4 .   ? 28.219  22.309  9.993   1.00 39.62  ? 1545 TZ4 A C27 1 
HETATM 8473 C C28 . TZ4 F 4 .   ? 26.023  21.178  10.284  1.00 36.18  ? 1545 TZ4 A C28 1 
HETATM 8474 C C29 . TZ4 F 4 .   ? 25.164  22.067  11.208  1.00 35.89  ? 1545 TZ4 A C29 1 
HETATM 8475 N N7  . TZ4 F 4 .   ? 25.251  21.765  12.661  1.00 36.69  ? 1545 TZ4 A N7  1 
HETATM 8476 C C30 . TZ4 F 4 .   ? 26.444  21.765  13.385  1.00 36.63  ? 1545 TZ4 A C30 1 
HETATM 8477 C C31 . TZ4 F 4 .   ? 26.634  20.630  14.252  1.00 38.24  ? 1545 TZ4 A C31 1 
HETATM 8478 C C32 . TZ4 F 4 .   ? 25.731  19.486  14.312  1.00 38.77  ? 1545 TZ4 A C32 1 
HETATM 8479 C C33 . TZ4 F 4 .   ? 27.873  20.510  14.991  1.00 37.93  ? 1545 TZ4 A C33 1 
HETATM 8480 C C34 . TZ4 F 4 .   ? 28.195  19.276  15.694  1.00 38.59  ? 1545 TZ4 A C34 1 
HETATM 8481 C C35 . TZ4 F 4 .   ? 27.317  18.209  15.707  1.00 37.81  ? 1545 TZ4 A C35 1 
HETATM 8482 C C36 . TZ4 F 4 .   ? 26.071  18.328  15.002  1.00 39.43  ? 1545 TZ4 A C36 1 
HETATM 8483 N N8  . TZ4 F 4 .   ? 28.841  21.453  14.936  1.00 36.87  ? 1545 TZ4 A N8  1 
HETATM 8484 C C37 . TZ4 F 4 .   ? 28.679  22.531  14.127  1.00 37.16  ? 1545 TZ4 A C37 1 
HETATM 8485 C C38 . TZ4 F 4 .   ? 29.710  23.562  14.189  1.00 37.19  ? 1545 TZ4 A C38 1 
HETATM 8486 C C39 . TZ4 F 4 .   ? 27.481  22.744  13.343  1.00 35.87  ? 1545 TZ4 A C39 1 
HETATM 8487 C C40 . TZ4 F 4 .   ? 27.374  24.029  12.693  1.00 35.40  ? 1545 TZ4 A C40 1 
HETATM 8488 C C41 . TZ4 F 4 .   ? 28.373  24.981  12.784  1.00 35.51  ? 1545 TZ4 A C41 1 
HETATM 8489 C C42 . TZ4 F 4 .   ? 29.650  24.664  13.356  1.00 35.18  ? 1545 TZ4 A C42 1 
HETATM 8490 N N3  . TZ4 G 4 .   ? 14.908  -17.437 -38.210 1.00 75.69  ? 1545 TZ4 B N3  1 
HETATM 8491 C C19 . TZ4 G 4 .   ? 14.854  -16.197 -38.820 1.00 75.01  ? 1545 TZ4 B C19 1 
HETATM 8492 C C18 . TZ4 G 4 .   ? 15.349  -15.995 -40.148 1.00 74.27  ? 1545 TZ4 B C18 1 
HETATM 8493 C C17 . TZ4 G 4 .   ? 15.262  -14.726 -40.711 1.00 73.93  ? 1545 TZ4 B C17 1 
HETATM 8494 C C16 . TZ4 G 4 .   ? 14.685  -13.575 -40.042 1.00 71.91  ? 1545 TZ4 B C16 1 
HETATM 8495 C C14 . TZ4 G 4 .   ? 14.206  -13.797 -38.705 1.00 71.45  ? 1545 TZ4 B C14 1 
HETATM 8496 C C15 . TZ4 G 4 .   ? 14.301  -15.119 -38.135 1.00 73.57  ? 1545 TZ4 B C15 1 
HETATM 8497 C C7  . TZ4 G 4 .   ? 13.783  -12.703 -37.897 1.00 70.79  ? 1545 TZ4 B C7  1 
HETATM 8498 C C8  . TZ4 G 4 .   ? 13.328  -13.032 -36.485 1.00 70.56  ? 1545 TZ4 B C8  1 
HETATM 8499 C C9  . TZ4 G 4 .   ? 12.017  -13.511 -36.274 1.00 70.25  ? 1545 TZ4 B C9  1 
HETATM 8500 C C10 . TZ4 G 4 .   ? 11.602  -13.844 -34.978 1.00 70.16  ? 1545 TZ4 B C10 1 
HETATM 8501 C C11 . TZ4 G 4 .   ? 12.487  -13.695 -33.897 1.00 70.10  ? 1545 TZ4 B C11 1 
HETATM 8502 C C12 . TZ4 G 4 .   ? 13.799  -13.234 -34.099 1.00 70.07  ? 1545 TZ4 B C12 1 
HETATM 8503 C C13 . TZ4 G 4 .   ? 14.217  -12.899 -35.392 1.00 70.01  ? 1545 TZ4 B C13 1 
HETATM 8504 C C4  . TZ4 G 4 .   ? 14.708  -12.221 -40.588 1.00 70.71  ? 1545 TZ4 B C4  1 
HETATM 8505 C C3  . TZ4 G 4 .   ? 15.351  -11.889 -41.832 1.00 69.63  ? 1545 TZ4 B C3  1 
HETATM 8506 C C2  . TZ4 G 4 .   ? 15.594  -10.597 -42.239 1.00 69.50  ? 1545 TZ4 B C2  1 
HETATM 8507 C C1  . TZ4 G 4 .   ? 15.179  -9.518  -41.406 1.00 70.91  ? 1545 TZ4 B C1  1 
HETATM 8508 N N1  . TZ4 G 4 .   ? 15.394  -8.200  -41.771 1.00 70.78  ? 1545 TZ4 B N1  1 
HETATM 8509 C C6  . TZ4 G 4 .   ? 14.285  -11.130 -39.753 1.00 70.11  ? 1545 TZ4 B C6  1 
HETATM 8510 C C5  . TZ4 G 4 .   ? 14.545  -9.801  -40.195 1.00 70.36  ? 1545 TZ4 B C5  1 
HETATM 8511 N N2  . TZ4 G 4 .   ? 13.828  -11.438 -38.440 1.00 69.83  ? 1545 TZ4 B N2  1 
HETATM 8512 C C20 . TZ4 G 4 .   ? 13.404  -10.295 -37.571 1.00 66.65  ? 1545 TZ4 B C20 1 
HETATM 8513 C C21 . TZ4 G 4 .   ? 12.161  -9.482  -37.890 1.00 62.73  ? 1545 TZ4 B C21 1 
HETATM 8514 C C22 . TZ4 G 4 .   ? 11.541  -9.044  -36.549 1.00 60.62  ? 1545 TZ4 B C22 1 
HETATM 8515 C C23 . TZ4 G 4 .   ? 11.844  -7.613  -36.089 1.00 55.84  ? 1545 TZ4 B C23 1 
HETATM 8516 C C24 . TZ4 G 4 .   ? 10.702  -6.603  -36.266 1.00 51.48  ? 1545 TZ4 B C24 1 
HETATM 8517 C C25 . TZ4 G 4 .   ? 9.400   -6.911  -35.519 1.00 49.07  ? 1545 TZ4 B C25 1 
HETATM 8518 C C26 . TZ4 G 4 .   ? 8.594   -5.689  -35.173 1.00 47.34  ? 1545 TZ4 B C26 1 
HETATM 8519 N N4  . TZ4 G 4 .   ? 8.584   -4.609  -35.955 1.00 47.69  ? 1545 TZ4 B N4  1 
HETATM 8520 N N5  . TZ4 G 4 .   ? 7.789   -3.752  -35.361 1.00 47.43  ? 1545 TZ4 B N5  1 
HETATM 8521 N N6  . TZ4 G 4 .   ? 7.282   -4.259  -34.231 1.00 46.99  ? 1545 TZ4 B N6  1 
HETATM 8522 C C27 . TZ4 G 4 .   ? 7.776   -5.507  -34.060 1.00 47.67  ? 1545 TZ4 B C27 1 
HETATM 8523 C C28 . TZ4 G 4 .   ? 6.353   -3.638  -33.260 1.00 45.79  ? 1545 TZ4 B C28 1 
HETATM 8524 C C29 . TZ4 G 4 .   ? 4.833   -3.904  -33.457 1.00 46.70  ? 1545 TZ4 B C29 1 
HETATM 8525 N N7  . TZ4 G 4 .   ? 4.249   -3.486  -34.770 1.00 47.27  ? 1545 TZ4 B N7  1 
HETATM 8526 C C30 . TZ4 G 4 .   ? 4.759   -3.916  -36.000 1.00 47.99  ? 1545 TZ4 B C30 1 
HETATM 8527 C C31 . TZ4 G 4 .   ? 4.971   -2.891  -36.989 1.00 48.14  ? 1545 TZ4 B C31 1 
HETATM 8528 C C32 . TZ4 G 4 .   ? 4.625   -1.495  -36.825 1.00 47.93  ? 1545 TZ4 B C32 1 
HETATM 8529 C C33 . TZ4 G 4 .   ? 5.562   -3.255  -38.254 1.00 48.10  ? 1545 TZ4 B C33 1 
HETATM 8530 C C34 . TZ4 G 4 .   ? 5.854   -2.268  -39.258 1.00 46.98  ? 1545 TZ4 B C34 1 
HETATM 8531 C C35 . TZ4 G 4 .   ? 5.533   -0.948  -39.046 1.00 47.33  ? 1545 TZ4 B C35 1 
HETATM 8532 C C36 . TZ4 G 4 .   ? 4.906   -0.560  -37.813 1.00 47.89  ? 1545 TZ4 B C36 1 
HETATM 8533 N N8  . TZ4 G 4 .   ? 5.864   -4.526  -38.565 1.00 48.62  ? 1545 TZ4 B N8  1 
HETATM 8534 C C37 . TZ4 G 4 .   ? 5.672   -5.504  -37.654 1.00 48.01  ? 1545 TZ4 B C37 1 
HETATM 8535 C C38 . TZ4 G 4 .   ? 6.058   -6.831  -38.048 1.00 48.62  ? 1545 TZ4 B C38 1 
HETATM 8536 C C39 . TZ4 G 4 .   ? 5.094   -5.264  -36.365 1.00 48.38  ? 1545 TZ4 B C39 1 
HETATM 8537 C C40 . TZ4 G 4 .   ? 4.863   -6.438  -35.546 1.00 49.15  ? 1545 TZ4 B C40 1 
HETATM 8538 C C41 . TZ4 G 4 .   ? 5.237   -7.694  -35.976 1.00 50.38  ? 1545 TZ4 B C41 1 
HETATM 8539 C C42 . TZ4 G 4 .   ? 6.105   -7.822  -37.101 1.00 49.05  ? 1545 TZ4 B C42 1 
HETATM 8540 O O   . HOH H 5 .   ? 29.782  10.943  54.494  1.00 25.21  ? 2001 HOH A O   1 
HETATM 8541 O O   . HOH H 5 .   ? 23.945  19.590  50.420  1.00 34.06  ? 2002 HOH A O   1 
HETATM 8542 O O   . HOH H 5 .   ? 23.993  9.022   48.387  1.00 27.96  ? 2003 HOH A O   1 
HETATM 8543 O O   . HOH H 5 .   ? 28.098  4.334   47.145  1.00 21.70  ? 2004 HOH A O   1 
HETATM 8544 O O   . HOH H 5 .   ? 42.429  0.761   44.896  1.00 16.48  ? 2005 HOH A O   1 
HETATM 8545 O O   . HOH H 5 .   ? 41.573  1.113   39.831  1.00 32.44  ? 2006 HOH A O   1 
HETATM 8546 O O   . HOH H 5 .   ? 26.198  19.543  46.202  1.00 31.89  ? 2007 HOH A O   1 
HETATM 8547 O O   . HOH H 5 .   ? 25.285  22.600  34.942  1.00 36.10  ? 2008 HOH A O   1 
HETATM 8548 O O   . HOH H 5 .   ? 19.545  23.775  38.766  1.00 34.22  ? 2009 HOH A O   1 
HETATM 8549 O O   . HOH H 5 .   ? 39.871  15.421  39.362  1.00 34.61  ? 2010 HOH A O   1 
HETATM 8550 O O   . HOH H 5 .   ? 13.734  23.823  35.112  1.00 44.32  ? 2011 HOH A O   1 
HETATM 8551 O O   . HOH H 5 .   ? 8.358   21.336  40.605  1.00 47.85  ? 2012 HOH A O   1 
HETATM 8552 O O   . HOH H 5 .   ? 11.171  17.815  34.201  1.00 33.39  ? 2013 HOH A O   1 
HETATM 8553 O O   . HOH H 5 .   ? 36.794  5.504   2.736   1.00 33.15  ? 2014 HOH A O   1 
HETATM 8554 O O   . HOH H 5 .   ? 38.409  4.292   34.513  1.00 32.71  ? 2015 HOH A O   1 
HETATM 8555 O O   . HOH H 5 .   ? 40.794  12.493  33.639  1.00 35.04  ? 2016 HOH A O   1 
HETATM 8556 O O   . HOH H 5 .   ? 45.560  8.111   29.892  1.00 30.72  ? 2017 HOH A O   1 
HETATM 8557 O O   . HOH H 5 .   ? 56.742  14.796  25.949  1.00 25.68  ? 2018 HOH A O   1 
HETATM 8558 O O   . HOH H 5 .   ? 49.895  5.954   27.916  1.00 31.31  ? 2019 HOH A O   1 
HETATM 8559 O O   . HOH H 5 .   ? 42.421  13.423  36.008  1.00 35.74  ? 2020 HOH A O   1 
HETATM 8560 O O   . HOH H 5 .   ? 43.390  12.888  40.939  1.00 36.92  ? 2021 HOH A O   1 
HETATM 8561 O O   . HOH H 5 .   ? 47.219  2.768   40.872  1.00 23.58  ? 2022 HOH A O   1 
HETATM 8562 O O   . HOH H 5 .   ? 38.401  8.610   47.770  1.00 24.85  ? 2023 HOH A O   1 
HETATM 8563 O O   . HOH H 5 .   ? 26.358  23.234  37.931  1.00 40.00  ? 2024 HOH A O   1 
HETATM 8564 O O   . HOH H 5 .   ? 33.318  19.385  29.247  1.00 30.47  ? 2025 HOH A O   1 
HETATM 8565 O O   . HOH H 5 .   ? 37.015  16.728  38.642  1.00 26.46  ? 2026 HOH A O   1 
HETATM 8566 O O   . HOH H 5 .   ? 38.568  3.752   38.363  1.00 38.48  ? 2027 HOH A O   1 
HETATM 8567 O O   . HOH H 5 .   ? 41.256  16.804  21.517  1.00 23.93  ? 2028 HOH A O   1 
HETATM 8568 O O   . HOH H 5 .   ? 40.681  27.535  17.044  1.00 31.36  ? 2029 HOH A O   1 
HETATM 8569 O O   . HOH H 5 .   ? 21.626  34.380  17.352  1.00 37.13  ? 2030 HOH A O   1 
HETATM 8570 O O   . HOH H 5 .   ? 33.532  31.157  20.060  1.00 45.74  ? 2031 HOH A O   1 
HETATM 8571 O O   . HOH H 5 .   ? 24.222  23.800  23.272  1.00 41.20  ? 2032 HOH A O   1 
HETATM 8572 O O   . HOH H 5 .   ? 30.133  20.526  19.048  1.00 28.20  ? 2033 HOH A O   1 
HETATM 8573 O O   . HOH H 5 .   ? 32.468  23.679  16.418  1.00 29.72  ? 2034 HOH A O   1 
HETATM 8574 O O   . HOH H 5 .   ? 34.697  4.071   1.783   1.00 35.50  ? 2035 HOH A O   1 
HETATM 8575 O O   . HOH H 5 .   ? 29.940  25.055  32.602  1.00 39.42  ? 2036 HOH A O   1 
HETATM 8576 O O   . HOH H 5 .   ? 50.835  2.970   4.768   1.00 34.06  ? 2037 HOH A O   1 
HETATM 8577 O O   . HOH H 5 .   ? 39.721  24.496  34.584  1.00 39.11  ? 2038 HOH A O   1 
HETATM 8578 O O   . HOH H 5 .   ? 46.214  21.036  28.085  1.00 32.24  ? 2039 HOH A O   1 
HETATM 8579 O O   . HOH H 5 .   ? 43.689  15.476  25.149  1.00 32.31  ? 2040 HOH A O   1 
HETATM 8580 O O   . HOH H 5 .   ? 42.212  13.880  31.568  1.00 45.84  ? 2041 HOH A O   1 
HETATM 8581 O O   . HOH H 5 .   ? 32.729  16.991  32.446  1.00 29.53  ? 2042 HOH A O   1 
HETATM 8582 O O   . HOH H 5 .   ? 11.484  13.670  43.896  1.00 29.32  ? 2043 HOH A O   1 
HETATM 8583 O O   . HOH H 5 .   ? 12.640  8.989   42.005  1.00 32.67  ? 2044 HOH A O   1 
HETATM 8584 O O   . HOH H 5 .   ? 49.069  -3.010  14.392  1.00 42.55  ? 2045 HOH A O   1 
HETATM 8585 O O   . HOH H 5 .   ? 29.506  12.133  24.649  1.00 26.65  ? 2046 HOH A O   1 
HETATM 8586 O O   . HOH H 5 .   ? 33.339  23.800  13.876  1.00 35.86  ? 2047 HOH A O   1 
HETATM 8587 O O   . HOH H 5 .   ? 40.107  20.231  16.192  1.00 28.76  ? 2048 HOH A O   1 
HETATM 8588 O O   . HOH H 5 .   ? 31.292  19.774  13.216  1.00 48.16  ? 2049 HOH A O   1 
HETATM 8589 O O   . HOH H 5 .   ? 31.282  21.484  16.512  1.00 24.57  ? 2050 HOH A O   1 
HETATM 8590 O O   . HOH H 5 .   ? 35.524  17.578  24.575  1.00 20.02  ? 2051 HOH A O   1 
HETATM 8591 O O   . HOH H 5 .   ? 25.526  22.812  29.860  1.00 31.76  ? 2052 HOH A O   1 
HETATM 8592 O O   . HOH H 5 .   ? 25.402  18.763  28.741  1.00 31.68  ? 2053 HOH A O   1 
HETATM 8593 O O   . HOH H 5 .   ? 29.359  18.018  19.960  1.00 28.65  ? 2054 HOH A O   1 
HETATM 8594 O O   . HOH H 5 .   ? 26.206  15.716  18.464  1.00 27.50  ? 2055 HOH A O   1 
HETATM 8595 O O   . HOH H 5 .   ? 14.163  5.110   37.079  1.00 34.71  ? 2056 HOH A O   1 
HETATM 8596 O O   . HOH H 5 .   ? 32.214  16.992  29.775  1.00 26.19  ? 2057 HOH A O   1 
HETATM 8597 O O   . HOH H 5 .   ? 33.256  14.596  17.263  1.00 30.08  ? 2058 HOH A O   1 
HETATM 8598 O O   . HOH H 5 .   ? 44.035  19.111  16.321  1.00 30.93  ? 2059 HOH A O   1 
HETATM 8599 O O   . HOH H 5 .   ? 43.023  7.534   14.047  1.00 30.15  ? 2060 HOH A O   1 
HETATM 8600 O O   . HOH H 5 .   ? 13.768  21.601  0.270   1.00 29.24  ? 2061 HOH A O   1 
HETATM 8601 O O   . HOH H 5 .   ? 47.612  7.586   17.970  1.00 24.04  ? 2062 HOH A O   1 
HETATM 8602 O O   . HOH H 5 .   ? 40.164  1.693   26.175  1.00 34.18  ? 2063 HOH A O   1 
HETATM 8603 O O   . HOH H 5 .   ? 40.437  -1.874  24.059  1.00 29.32  ? 2064 HOH A O   1 
HETATM 8604 O O   . HOH H 5 .   ? 34.950  -2.853  32.690  1.00 38.22  ? 2065 HOH A O   1 
HETATM 8605 O O   . HOH H 5 .   ? 37.202  6.301   38.256  1.00 48.65  ? 2066 HOH A O   1 
HETATM 8606 O O   . HOH H 5 .   ? 36.948  1.853   34.320  1.00 30.44  ? 2067 HOH A O   1 
HETATM 8607 O O   . HOH H 5 .   ? 36.687  1.979   36.965  1.00 34.54  ? 2068 HOH A O   1 
HETATM 8608 O O   . HOH H 5 .   ? 27.895  -1.181  37.421  1.00 26.44  ? 2069 HOH A O   1 
HETATM 8609 O O   . HOH H 5 .   ? 25.537  4.414   46.155  1.00 18.76  ? 2070 HOH A O   1 
HETATM 8610 O O   . HOH H 5 .   ? 22.086  -2.309  39.290  1.00 28.58  ? 2071 HOH A O   1 
HETATM 8611 O O   . HOH H 5 .   ? 16.893  -2.491  33.974  1.00 28.95  ? 2072 HOH A O   1 
HETATM 8612 O O   . HOH H 5 .   ? 19.418  0.975   27.972  1.00 26.93  ? 2073 HOH A O   1 
HETATM 8613 O O   . HOH H 5 .   ? 32.629  -7.251  14.272  1.00 32.89  ? 2074 HOH A O   1 
HETATM 8614 O O   . HOH H 5 .   ? 37.379  -6.297  16.522  1.00 31.61  ? 2075 HOH A O   1 
HETATM 8615 O O   . HOH H 5 .   ? 26.914  -5.339  21.669  1.00 43.19  ? 2076 HOH A O   1 
HETATM 8616 O O   . HOH H 5 .   ? 28.957  -0.085  29.577  1.00 25.85  ? 2077 HOH A O   1 
HETATM 8617 O O   . HOH H 5 .   ? 28.135  3.247   2.664   1.00 31.16  ? 2078 HOH A O   1 
HETATM 8618 O O   . HOH H 5 .   ? 32.351  2.296   3.517   1.00 34.94  ? 2079 HOH A O   1 
HETATM 8619 O O   . HOH H 5 .   ? 31.148  8.437   6.677   1.00 30.10  ? 2080 HOH A O   1 
HETATM 8620 O O   . HOH H 5 .   ? 33.947  5.013   6.560   1.00 25.30  ? 2081 HOH A O   1 
HETATM 8621 O O   . HOH H 5 .   ? 37.560  9.709   4.431   1.00 24.22  ? 2082 HOH A O   1 
HETATM 8622 O O   . HOH H 5 .   ? 41.628  7.228   2.934   1.00 33.29  ? 2083 HOH A O   1 
HETATM 8623 O O   . HOH H 5 .   ? 43.341  5.815   0.607   1.00 42.26  ? 2084 HOH A O   1 
HETATM 8624 O O   . HOH H 5 .   ? 51.257  7.044   3.178   1.00 24.65  ? 2085 HOH A O   1 
HETATM 8625 O O   . HOH H 5 .   ? 46.537  1.893   3.379   1.00 37.70  ? 2086 HOH A O   1 
HETATM 8626 O O   . HOH H 5 .   ? 46.751  10.587  10.842  1.00 28.99  ? 2087 HOH A O   1 
HETATM 8627 O O   . HOH H 5 .   ? 50.829  3.073   7.428   1.00 32.72  ? 2088 HOH A O   1 
HETATM 8628 O O   . HOH H 5 .   ? 52.525  13.433  3.544   1.00 33.37  ? 2089 HOH A O   1 
HETATM 8629 O O   . HOH H 5 .   ? 54.947  14.942  3.845   1.00 30.72  ? 2090 HOH A O   1 
HETATM 8630 O O   . HOH H 5 .   ? 58.940  18.984  1.546   1.00 37.69  ? 2091 HOH A O   1 
HETATM 8631 O O   . HOH H 5 .   ? 52.782  16.472  24.314  1.00 21.99  ? 2092 HOH A O   1 
HETATM 8632 O O   . HOH H 5 .   ? 49.867  23.626  25.046  1.00 41.40  ? 2093 HOH A O   1 
HETATM 8633 O O   . HOH H 5 .   ? 41.584  26.573  19.602  1.00 28.41  ? 2094 HOH A O   1 
HETATM 8634 O O   . HOH H 5 .   ? 48.494  25.543  23.353  1.00 39.78  ? 2095 HOH A O   1 
HETATM 8635 O O   . HOH H 5 .   ? 43.206  27.763  14.943  1.00 34.35  ? 2096 HOH A O   1 
HETATM 8636 O O   . HOH H 5 .   ? 40.927  16.691  12.618  1.00 24.94  ? 2097 HOH A O   1 
HETATM 8637 O O   . HOH H 5 .   ? 50.338  25.199  4.530   1.00 43.19  ? 2098 HOH A O   1 
HETATM 8638 O O   . HOH H 5 .   ? 43.759  21.936  0.213   1.00 52.04  ? 2099 HOH A O   1 
HETATM 8639 O O   . HOH H 5 .   ? 39.111  15.992  1.010   1.00 37.54  ? 2100 HOH A O   1 
HETATM 8640 O O   . HOH H 5 .   ? 37.263  19.637  -4.722  1.00 28.32  ? 2101 HOH A O   1 
HETATM 8641 O O   . HOH H 5 .   ? 38.950  21.937  2.573   1.00 43.88  ? 2102 HOH A O   1 
HETATM 8642 O O   . HOH H 5 .   ? 32.652  20.915  6.104   1.00 38.69  ? 2103 HOH A O   1 
HETATM 8643 O O   . HOH H 5 .   ? 36.787  13.043  6.927   1.00 35.14  ? 2104 HOH A O   1 
HETATM 8644 O O   . HOH H 5 .   ? 44.120  11.265  9.581   1.00 32.74  ? 2105 HOH A O   1 
HETATM 8645 O O   . HOH H 5 .   ? 38.586  15.484  12.633  1.00 24.63  ? 2106 HOH A O   1 
HETATM 8646 O O   . HOH H 5 .   ? 43.420  9.668   11.483  1.00 32.98  ? 2107 HOH A O   1 
HETATM 8647 O O   . HOH H 5 .   ? 43.735  0.638   5.963   1.00 25.51  ? 2108 HOH A O   1 
HETATM 8648 O O   . HOH H 5 .   ? 45.476  1.330   16.363  1.00 30.72  ? 2109 HOH A O   1 
HETATM 8649 O O   . HOH H 5 .   ? 46.550  -1.029  16.928  1.00 24.45  ? 2110 HOH A O   1 
HETATM 8650 O O   . HOH H 5 .   ? 32.485  0.954   -2.030  1.00 47.26  ? 2111 HOH A O   1 
HETATM 8651 O O   . HOH H 5 .   ? 11.864  22.940  6.869   1.00 43.48  ? 2112 HOH A O   1 
HETATM 8652 O O   . HOH H 5 .   ? 18.662  15.231  4.478   1.00 24.51  ? 2113 HOH A O   1 
HETATM 8653 O O   . HOH H 5 .   ? 22.561  20.465  7.380   1.00 32.73  ? 2114 HOH A O   1 
HETATM 8654 O O   . HOH H 5 .   ? 20.488  17.947  2.767   1.00 26.26  ? 2115 HOH A O   1 
HETATM 8655 O O   . HOH H 5 .   ? 30.115  27.153  -6.390  1.00 34.76  ? 2116 HOH A O   1 
HETATM 8656 O O   . HOH H 5 .   ? 30.713  32.650  -1.225  1.00 35.95  ? 2117 HOH A O   1 
HETATM 8657 O O   . HOH H 5 .   ? 26.069  29.182  -15.076 1.00 23.89  ? 2118 HOH A O   1 
HETATM 8658 O O   . HOH H 5 .   ? 31.682  25.920  -12.769 1.00 27.35  ? 2119 HOH A O   1 
HETATM 8659 O O   . HOH H 5 .   ? 34.926  23.575  -7.517  1.00 32.97  ? 2120 HOH A O   1 
HETATM 8660 O O   . HOH H 5 .   ? 30.590  16.483  1.016   1.00 32.08  ? 2121 HOH A O   1 
HETATM 8661 O O   . HOH H 5 .   ? 15.858  14.061  -8.423  1.00 31.67  ? 2122 HOH A O   1 
HETATM 8662 O O   . HOH H 5 .   ? 15.221  16.216  -9.709  1.00 28.38  ? 2123 HOH A O   1 
HETATM 8663 O O   . HOH H 5 .   ? 6.155   22.387  -14.191 1.00 34.94  ? 2124 HOH A O   1 
HETATM 8664 O O   . HOH H 5 .   ? 13.916  29.855  -8.437  1.00 11.74  ? 2125 HOH A O   1 
HETATM 8665 O O   . HOH H 5 .   ? 17.434  19.655  -0.509  1.00 25.41  ? 2126 HOH A O   1 
HETATM 8666 O O   . HOH H 5 .   ? 18.145  21.550  1.741   1.00 32.67  ? 2127 HOH A O   1 
HETATM 8667 O O   . HOH H 5 .   ? 6.440   18.054  7.106   1.00 46.28  ? 2128 HOH A O   1 
HETATM 8668 O O   . HOH H 5 .   ? 6.826   21.233  11.780  1.00 40.46  ? 2129 HOH A O   1 
HETATM 8669 O O   . HOH H 5 .   ? 14.615  21.429  14.164  1.00 29.15  ? 2130 HOH A O   1 
HETATM 8670 O O   . HOH H 5 .   ? 11.860  28.026  12.395  1.00 33.39  ? 2131 HOH A O   1 
HETATM 8671 O O   . HOH H 5 .   ? 20.923  33.084  10.452  1.00 26.64  ? 2132 HOH A O   1 
HETATM 8672 O O   . HOH H 5 .   ? 19.805  28.264  16.089  1.00 47.91  ? 2133 HOH A O   1 
HETATM 8673 O O   . HOH H 5 .   ? 15.340  32.839  6.932   1.00 35.06  ? 2134 HOH A O   1 
HETATM 8674 O O   . HOH H 5 .   ? 17.806  24.173  1.008   1.00 34.84  ? 2135 HOH A O   1 
HETATM 8675 O O   . HOH H 5 .   ? 13.969  23.790  2.094   1.00 23.46  ? 2136 HOH A O   1 
HETATM 8676 O O   . HOH H 5 .   ? 19.005  12.132  13.352  1.00 26.35  ? 2137 HOH A O   1 
HETATM 8677 O O   . HOH H 5 .   ? 21.236  15.403  13.084  1.00 36.51  ? 2138 HOH A O   1 
HETATM 8678 O O   . HOH H 5 .   ? 17.115  25.832  18.026  1.00 43.75  ? 2139 HOH A O   1 
HETATM 8679 O O   . HOH H 5 .   ? 19.669  20.420  18.634  1.00 28.31  ? 2140 HOH A O   1 
HETATM 8680 O O   . HOH H 5 .   ? 17.757  15.178  28.814  1.00 32.03  ? 2141 HOH A O   1 
HETATM 8681 O O   . HOH H 5 .   ? 16.309  23.436  33.218  1.00 51.42  ? 2142 HOH A O   1 
HETATM 8682 O O   . HOH H 5 .   ? 10.554  25.846  26.057  1.00 37.19  ? 2143 HOH A O   1 
HETATM 8683 O O   . HOH H 5 .   ? 5.345   24.298  17.001  1.00 30.89  ? 2144 HOH A O   1 
HETATM 8684 O O   . HOH H 5 .   ? 8.408   11.876  27.760  1.00 29.64  ? 2145 HOH A O   1 
HETATM 8685 O O   . HOH H 5 .   ? 0.832   11.136  18.335  1.00 32.91  ? 2146 HOH A O   1 
HETATM 8686 O O   . HOH H 5 .   ? 11.489  1.371   10.731  1.00 29.41  ? 2147 HOH A O   1 
HETATM 8687 O O   . HOH H 5 .   ? 9.719   -2.783  6.757   1.00 24.89  ? 2148 HOH A O   1 
HETATM 8688 O O   . HOH H 5 .   ? 3.103   16.258  18.762  1.00 24.18  ? 2149 HOH A O   1 
HETATM 8689 O O   . HOH H 5 .   ? 5.565   19.191  11.477  1.00 39.46  ? 2150 HOH A O   1 
HETATM 8690 O O   . HOH H 5 .   ? 1.069   5.787   8.285   1.00 30.19  ? 2151 HOH A O   1 
HETATM 8691 O O   . HOH H 5 .   ? 10.436  10.850  3.480   1.00 35.00  ? 2152 HOH A O   1 
HETATM 8692 O O   . HOH H 5 .   ? 5.919   6.022   0.733   1.00 30.19  ? 2153 HOH A O   1 
HETATM 8693 O O   . HOH H 5 .   ? 15.297  2.273   1.636   1.00 39.98  ? 2154 HOH A O   1 
HETATM 8694 O O   . HOH H 5 .   ? 12.590  12.451  2.292   1.00 44.33  ? 2155 HOH A O   1 
HETATM 8695 O O   . HOH H 5 .   ? 14.780  8.412   -4.326  1.00 27.47  ? 2156 HOH A O   1 
HETATM 8696 O O   . HOH H 5 .   ? 38.099  4.426   -13.811 1.00 33.00  ? 2157 HOH A O   1 
HETATM 8697 O O   . HOH H 5 .   ? 31.035  35.045  -4.996  1.00 63.22  ? 2158 HOH A O   1 
HETATM 8698 O O   . HOH H 5 .   ? 13.757  8.488   -13.258 1.00 55.64  ? 2159 HOH A O   1 
HETATM 8699 O O   . HOH H 5 .   ? 39.197  19.141  9.678   1.00 50.52  ? 2160 HOH A O   1 
HETATM 8700 O O   . HOH I 5 .   ? 0.467   19.354  -64.255 1.00 24.22  ? 2001 HOH B O   1 
HETATM 8701 O O   . HOH I 5 .   ? 0.832   17.062  -65.779 1.00 35.02  ? 2002 HOH B O   1 
HETATM 8702 O O   . HOH I 5 .   ? 0.226   16.485  -68.128 1.00 28.95  ? 2003 HOH B O   1 
HETATM 8703 O O   . HOH I 5 .   ? 4.059   10.589  -65.247 1.00 32.94  ? 2004 HOH B O   1 
HETATM 8704 O O   . HOH I 5 .   ? -6.165  -2.099  -75.149 1.00 33.79  ? 2005 HOH B O   1 
HETATM 8705 O O   . HOH I 5 .   ? -0.238  -12.359 -50.987 1.00 31.07  ? 2006 HOH B O   1 
HETATM 8706 O O   . HOH I 5 .   ? 9.058   1.346   -68.534 1.00 27.28  ? 2007 HOH B O   1 
HETATM 8707 O O   . HOH I 5 .   ? 15.205  2.423   -62.244 1.00 40.19  ? 2008 HOH B O   1 
HETATM 8708 O O   . HOH I 5 .   ? 16.863  -3.860  -66.087 1.00 27.91  ? 2009 HOH B O   1 
HETATM 8709 O O   . HOH I 5 .   ? 31.910  13.394  -42.953 1.00 33.40  ? 2010 HOH B O   1 
HETATM 8710 O O   . HOH I 5 .   ? 4.462   1.368   -69.375 1.00 22.30  ? 2011 HOH B O   1 
HETATM 8711 O O   . HOH I 5 .   ? 12.080  4.058   -74.733 1.00 21.46  ? 2012 HOH B O   1 
HETATM 8712 O O   . HOH I 5 .   ? -0.742  7.426   -72.825 1.00 22.92  ? 2013 HOH B O   1 
HETATM 8713 O O   . HOH I 5 .   ? -1.173  6.669   -76.914 1.00 31.27  ? 2014 HOH B O   1 
HETATM 8714 O O   . HOH I 5 .   ? -4.845  1.556   -73.473 1.00 24.59  ? 2015 HOH B O   1 
HETATM 8715 O O   . HOH I 5 .   ? -2.790  -0.787  -61.290 1.00 26.34  ? 2016 HOH B O   1 
HETATM 8716 O O   . HOH I 5 .   ? 7.359   -8.210  -44.773 1.00 32.68  ? 2017 HOH B O   1 
HETATM 8717 O O   . HOH I 5 .   ? 4.230   -13.861 -37.944 1.00 33.97  ? 2018 HOH B O   1 
HETATM 8718 O O   . HOH I 5 .   ? -1.596  -11.073 -45.661 1.00 34.80  ? 2019 HOH B O   1 
HETATM 8719 O O   . HOH I 5 .   ? 4.722   -3.770  -42.827 1.00 34.02  ? 2020 HOH B O   1 
HETATM 8720 O O   . HOH I 5 .   ? 6.233   -8.189  -41.562 1.00 37.50  ? 2021 HOH B O   1 
HETATM 8721 O O   . HOH I 5 .   ? -5.155  -6.909  -47.322 1.00 36.58  ? 2022 HOH B O   1 
HETATM 8722 O O   . HOH I 5 .   ? 29.868  0.799   -35.953 1.00 26.26  ? 2023 HOH B O   1 
HETATM 8723 O O   . HOH I 5 .   ? 2.851   -12.163 -50.958 1.00 32.52  ? 2024 HOH B O   1 
HETATM 8724 O O   . HOH I 5 .   ? 33.304  5.086   -47.857 1.00 31.45  ? 2025 HOH B O   1 
HETATM 8725 O O   . HOH I 5 .   ? 4.840   -13.301 -53.595 1.00 26.23  ? 2026 HOH B O   1 
HETATM 8726 O O   . HOH I 5 .   ? 13.203  -4.133  -55.902 1.00 32.99  ? 2027 HOH B O   1 
HETATM 8727 O O   . HOH I 5 .   ? 10.149  -6.165  -64.329 1.00 31.76  ? 2028 HOH B O   1 
HETATM 8728 O O   . HOH I 5 .   ? 6.502   -0.155  -64.950 1.00 37.74  ? 2029 HOH B O   1 
HETATM 8729 O O   . HOH I 5 .   ? 31.162  11.197  -44.262 1.00 32.39  ? 2030 HOH B O   1 
HETATM 8730 O O   . HOH I 5 .   ? 32.719  11.727  -47.415 1.00 39.87  ? 2031 HOH B O   1 
HETATM 8731 O O   . HOH I 5 .   ? -4.095  24.391  -51.304 1.00 30.56  ? 2032 HOH B O   1 
HETATM 8732 O O   . HOH I 5 .   ? 4.641   4.647   -48.419 1.00 39.46  ? 2033 HOH B O   1 
HETATM 8733 O O   . HOH I 5 .   ? 4.574   2.267   -40.954 1.00 27.86  ? 2034 HOH B O   1 
HETATM 8734 O O   . HOH I 5 .   ? 10.786  -0.013  -43.849 1.00 26.49  ? 2035 HOH B O   1 
HETATM 8735 O O   . HOH I 5 .   ? 13.570  -8.139  -46.177 1.00 34.64  ? 2036 HOH B O   1 
HETATM 8736 O O   . HOH I 5 .   ? 8.652   -8.649  -40.057 1.00 32.11  ? 2037 HOH B O   1 
HETATM 8737 O O   . HOH I 5 .   ? -5.206  -2.216  -48.828 1.00 36.31  ? 2038 HOH B O   1 
HETATM 8738 O O   . HOH I 5 .   ? -3.256  0.934   -48.526 1.00 35.13  ? 2039 HOH B O   1 
HETATM 8739 O O   . HOH I 5 .   ? -3.492  -5.294  -44.982 1.00 33.60  ? 2040 HOH B O   1 
HETATM 8740 O O   . HOH I 5 .   ? 4.714   -0.767  -43.531 1.00 34.22  ? 2041 HOH B O   1 
HETATM 8741 O O   . HOH I 5 .   ? -8.900  -0.865  -45.291 1.00 36.63  ? 2042 HOH B O   1 
HETATM 8742 O O   . HOH I 5 .   ? 1.438   -1.742  -19.772 1.00 17.53  ? 2043 HOH B O   1 
HETATM 8743 O O   . HOH I 5 .   ? 1.848   0.076   -53.121 1.00 37.58  ? 2044 HOH B O   1 
HETATM 8744 O O   . HOH I 5 .   ? 15.755  10.024  -56.651 1.00 29.07  ? 2045 HOH B O   1 
HETATM 8745 O O   . HOH I 5 .   ? 5.217   8.366   -64.157 1.00 23.57  ? 2046 HOH B O   1 
HETATM 8746 O O   . HOH I 5 .   ? 0.236   19.631  -47.209 1.00 19.32  ? 2047 HOH B O   1 
HETATM 8747 O O   . HOH I 5 .   ? 22.716  15.642  -45.954 1.00 30.31  ? 2048 HOH B O   1 
HETATM 8748 O O   . HOH I 5 .   ? 22.386  17.347  -48.049 1.00 34.04  ? 2049 HOH B O   1 
HETATM 8749 O O   . HOH I 5 .   ? 6.445   16.712  -53.721 1.00 35.44  ? 2050 HOH B O   1 
HETATM 8750 O O   . HOH I 5 .   ? 13.597  6.944   -33.575 1.00 33.74  ? 2051 HOH B O   1 
HETATM 8751 O O   . HOH I 5 .   ? 17.554  5.544   -34.855 1.00 27.82  ? 2052 HOH B O   1 
HETATM 8752 O O   . HOH I 5 .   ? 23.882  5.969   -34.664 1.00 37.72  ? 2053 HOH B O   1 
HETATM 8753 O O   . HOH I 5 .   ? 22.705  0.921   -36.410 1.00 30.83  ? 2054 HOH B O   1 
HETATM 8754 O O   . HOH I 5 .   ? 19.163  -1.026  -37.431 1.00 24.87  ? 2055 HOH B O   1 
HETATM 8755 O O   . HOH I 5 .   ? 27.623  2.020   -37.761 1.00 28.89  ? 2056 HOH B O   1 
HETATM 8756 O O   . HOH I 5 .   ? 32.968  4.900   -41.614 1.00 21.75  ? 2057 HOH B O   1 
HETATM 8757 O O   . HOH I 5 .   ? 34.633  -2.031  -43.487 1.00 23.23  ? 2058 HOH B O   1 
HETATM 8758 O O   . HOH I 5 .   ? 25.494  -2.832  -46.846 1.00 21.70  ? 2059 HOH B O   1 
HETATM 8759 O O   . HOH I 5 .   ? 33.505  2.078   -47.456 1.00 36.03  ? 2060 HOH B O   1 
HETATM 8760 O O   . HOH I 5 .   ? 38.763  -4.251  -61.805 1.00 45.61  ? 2061 HOH B O   1 
HETATM 8761 O O   . HOH I 5 .   ? 36.893  -9.187  -53.835 1.00 34.03  ? 2062 HOH B O   1 
HETATM 8762 O O   . HOH I 5 .   ? 15.805  -19.215 -51.998 1.00 27.11  ? 2063 HOH B O   1 
HETATM 8763 O O   . HOH I 5 .   ? 17.068  -8.379  -48.710 1.00 35.21  ? 2064 HOH B O   1 
HETATM 8764 O O   . HOH I 5 .   ? 17.462  -5.514  -43.755 1.00 39.18  ? 2065 HOH B O   1 
HETATM 8765 O O   . HOH I 5 .   ? 20.070  -10.780 -33.954 1.00 36.99  ? 2066 HOH B O   1 
HETATM 8766 O O   . HOH I 5 .   ? 23.073  -5.867  -33.762 1.00 39.24  ? 2067 HOH B O   1 
HETATM 8767 O O   . HOH I 5 .   ? 24.367  -2.415  -44.286 1.00 39.07  ? 2068 HOH B O   1 
HETATM 8768 O O   . HOH I 5 .   ? 16.574  -3.127  -42.963 1.00 38.67  ? 2069 HOH B O   1 
HETATM 8769 O O   . HOH I 5 .   ? 31.938  9.525   -46.042 1.00 28.07  ? 2070 HOH B O   1 
HETATM 8770 O O   . HOH I 5 .   ? 25.887  10.209  -29.683 1.00 38.38  ? 2071 HOH B O   1 
HETATM 8771 O O   . HOH I 5 .   ? -2.729  0.657   -22.241 1.00 33.33  ? 2072 HOH B O   1 
HETATM 8772 O O   . HOH I 5 .   ? 5.770   -2.198  -29.164 1.00 27.10  ? 2073 HOH B O   1 
HETATM 8773 O O   . HOH I 5 .   ? 6.661   4.225   -25.196 1.00 31.45  ? 2074 HOH B O   1 
HETATM 8774 O O   . HOH I 5 .   ? 6.772   -18.248 -22.152 1.00 29.36  ? 2075 HOH B O   1 
HETATM 8775 O O   . HOH I 5 .   ? 24.096  -8.469  -27.315 1.00 32.54  ? 2076 HOH B O   1 
HETATM 8776 O O   . HOH I 5 .   ? 24.033  -1.618  -31.521 1.00 32.41  ? 2077 HOH B O   1 
HETATM 8777 O O   . HOH I 5 .   ? 29.579  -4.189  -26.688 1.00 39.55  ? 2078 HOH B O   1 
HETATM 8778 O O   . HOH I 5 .   ? 10.444  -7.094  -5.066  1.00 26.77  ? 2079 HOH B O   1 
HETATM 8779 O O   . HOH I 5 .   ? 3.059   -0.465  -18.470 1.00 30.76  ? 2080 HOH B O   1 
HETATM 8780 O O   . HOH I 5 .   ? 5.444   -1.660  -22.189 1.00 23.54  ? 2081 HOH B O   1 
HETATM 8781 O O   . HOH I 5 .   ? 14.207  29.731  -30.675 1.00 30.60  ? 2082 HOH B O   1 
HETATM 8782 O O   . HOH I 5 .   ? 7.204   28.004  -32.013 1.00 33.73  ? 2083 HOH B O   1 
HETATM 8783 O O   . HOH I 5 .   ? -0.183  27.162  -32.260 1.00 29.10  ? 2084 HOH B O   1 
HETATM 8784 O O   . HOH I 5 .   ? -4.098  -6.832  -34.060 1.00 47.59  ? 2085 HOH B O   1 
HETATM 8785 O O   . HOH I 5 .   ? -0.722  -2.581  -19.582 1.00 33.89  ? 2086 HOH B O   1 
HETATM 8786 O O   . HOH I 5 .   ? 3.839   3.792   -33.797 1.00 26.55  ? 2087 HOH B O   1 
HETATM 8787 O O   . HOH I 5 .   ? 3.274   7.596   -33.107 1.00 31.50  ? 2088 HOH B O   1 
HETATM 8788 O O   . HOH I 5 .   ? -2.422  0.767   -36.504 1.00 29.00  ? 2089 HOH B O   1 
HETATM 8789 O O   . HOH I 5 .   ? -5.370  -4.004  -34.911 1.00 34.87  ? 2090 HOH B O   1 
HETATM 8790 O O   . HOH I 5 .   ? -7.786  7.573   -44.832 1.00 35.76  ? 2091 HOH B O   1 
HETATM 8791 O O   . HOH I 5 .   ? -18.269 -8.272  -36.302 1.00 38.74  ? 2092 HOH B O   1 
HETATM 8792 O O   . HOH I 5 .   ? -15.339 -8.011  -37.639 1.00 44.25  ? 2093 HOH B O   1 
HETATM 8793 O O   . HOH I 5 .   ? 3.673   20.162  -28.505 1.00 25.81  ? 2094 HOH B O   1 
HETATM 8794 O O   . HOH I 5 .   ? 6.493   24.218  -24.975 1.00 20.21  ? 2095 HOH B O   1 
HETATM 8795 O O   . HOH I 5 .   ? 8.323   24.980  -31.612 1.00 30.44  ? 2096 HOH B O   1 
HETATM 8796 O O   . HOH I 5 .   ? 12.502  26.441  -28.236 1.00 26.81  ? 2097 HOH B O   1 
HETATM 8797 O O   . HOH I 5 .   ? 12.320  27.363  -25.692 1.00 49.53  ? 2098 HOH B O   1 
HETATM 8798 O O   . HOH I 5 .   ? 11.161  16.982  -23.066 1.00 25.36  ? 2099 HOH B O   1 
HETATM 8799 O O   . HOH I 5 .   ? 5.715   14.522  -18.536 1.00 21.35  ? 2100 HOH B O   1 
HETATM 8800 O O   . HOH I 5 .   ? 1.600   21.408  -18.325 1.00 29.51  ? 2101 HOH B O   1 
HETATM 8801 O O   . HOH I 5 .   ? 12.789  15.124  -22.782 1.00 15.80  ? 2102 HOH B O   1 
HETATM 8802 O O   . HOH I 5 .   ? 5.309   9.030   -20.276 1.00 27.55  ? 2103 HOH B O   1 
HETATM 8803 O O   . HOH I 5 .   ? 6.829   11.680  -19.171 1.00 35.13  ? 2104 HOH B O   1 
HETATM 8804 O O   . HOH I 5 .   ? 11.781  10.599  -16.957 1.00 35.30  ? 2105 HOH B O   1 
HETATM 8805 O O   . HOH I 5 .   ? 17.578  -7.393  -40.322 1.00 43.68  ? 2106 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 3   ? 1.0077 1.0793 0.6469 0.1141  0.0060  -0.0205 3   ARG A N   
2    C CA  . ARG A 3   ? 0.9868 1.0684 0.6433 0.1162  0.0206  -0.0096 3   ARG A CA  
3    C C   . ARG A 3   ? 0.9829 1.0596 0.6426 0.1222  0.0289  -0.0199 3   ARG A C   
4    O O   . ARG A 3   ? 1.0080 1.0811 0.6442 0.1303  0.0314  -0.0305 3   ARG A O   
5    C CB  . ARG A 3   ? 1.0013 1.0972 0.6412 0.1206  0.0298  0.0013  3   ARG A CB  
6    C CG  . ARG A 3   ? 1.0089 1.1094 0.6380 0.1178  0.0221  0.0110  3   ARG A CG  
7    C CD  . ARG A 3   ? 1.0081 1.1077 0.6615 0.1103  0.0166  0.0221  3   ARG A CD  
8    N NE  . ARG A 3   ? 1.0338 1.1279 0.6874 0.1064  0.0007  0.0164  3   ARG A NE  
9    C CZ  . ARG A 3   ? 1.0277 1.1211 0.7017 0.1009  -0.0063 0.0230  3   ARG A CZ  
10   N NH1 . ARG A 3   ? 0.9992 1.0935 0.6935 0.0987  0.0007  0.0351  3   ARG A NH1 
11   N NH2 . ARG A 3   ? 1.0287 1.1209 0.7022 0.0973  -0.0206 0.0175  3   ARG A NH2 
12   N N   . GLU A 4   ? 0.9508 1.0270 0.6370 0.1196  0.0332  -0.0176 4   GLU A N   
13   C CA  . GLU A 4   ? 0.9212 0.9979 0.6362 0.1105  0.0304  -0.0080 4   GLU A CA  
14   C C   . GLU A 4   ? 0.8948 0.9847 0.6279 0.1089  0.0426  0.0049  4   GLU A C   
15   O O   . GLU A 4   ? 0.9002 1.0010 0.6266 0.1087  0.0487  0.0160  4   GLU A O   
16   C CB  . GLU A 4   ? 0.9245 0.9993 0.6405 0.1036  0.0189  -0.0021 4   GLU A CB  
17   C CG  . GLU A 4   ? 0.9183 0.9894 0.6622 0.0959  0.0146  0.0029  4   GLU A CG  
18   C CD  . GLU A 4   ? 0.9572 1.0240 0.7016 0.0906  0.0004  0.0019  4   GLU A CD  
19   O OE1 . GLU A 4   ? 0.9738 1.0465 0.7030 0.0915  -0.0044 0.0065  4   GLU A OE1 
20   O OE2 . GLU A 4   ? 0.9577 1.0171 0.7178 0.0855  -0.0060 -0.0029 4   GLU A OE2 
21   N N   . ASP A 5   ? 0.8625 0.9509 0.6179 0.1070  0.0456  0.0038  5   ASP A N   
22   C CA  . ASP A 5   ? 0.8394 0.9413 0.6115 0.1048  0.0570  0.0142  5   ASP A CA  
23   C C   . ASP A 5   ? 0.8322 0.9361 0.6130 0.0962  0.0563  0.0289  5   ASP A C   
24   O O   . ASP A 5   ? 0.8186 0.9131 0.6129 0.0902  0.0487  0.0305  5   ASP A O   
25   C CB  . ASP A 5   ? 0.8134 0.9134 0.6070 0.1044  0.0588  0.0096  5   ASP A CB  
26   C CG  . ASP A 5   ? 0.7907 0.9073 0.6016 0.1011  0.0700  0.0199  5   ASP A CG  
27   O OD1 . ASP A 5   ? 0.7969 0.9222 0.6072 0.0959  0.0750  0.0320  5   ASP A OD1 
28   O OD2 . ASP A 5   ? 0.7524 0.8734 0.5775 0.1033  0.0737  0.0162  5   ASP A OD2 
29   N N   . PRO A 6   ? 0.8429 0.9583 0.6149 0.0958  0.0648  0.0398  6   PRO A N   
30   C CA  . PRO A 6   ? 0.8344 0.9484 0.6095 0.0887  0.0649  0.0545  6   PRO A CA  
31   C C   . PRO A 6   ? 0.8041 0.9151 0.6041 0.0800  0.0670  0.0613  6   PRO A C   
32   O O   . PRO A 6   ? 0.8014 0.9046 0.6052 0.0745  0.0644  0.0711  6   PRO A O   
33   C CB  . PRO A 6   ? 0.8584 0.9861 0.6179 0.0905  0.0757  0.0634  6   PRO A CB  
34   C CG  . PRO A 6   ? 0.8577 0.9985 0.6171 0.0965  0.0844  0.0555  6   PRO A CG  
35   C CD  . PRO A 6   ? 0.8614 0.9915 0.6191 0.1027  0.0757  0.0392  6   PRO A CD  
36   N N   . GLN A 7   ? 0.7769 0.8931 0.5924 0.0795  0.0712  0.0560  7   GLN A N   
37   C CA  . GLN A 7   ? 0.7483 0.8630 0.5861 0.0710  0.0732  0.0614  7   GLN A CA  
38   C C   . GLN A 7   ? 0.7150 0.8149 0.5660 0.0689  0.0629  0.0555  7   GLN A C   
39   O O   . GLN A 7   ? 0.6978 0.7934 0.5656 0.0621  0.0629  0.0594  7   GLN A O   
40   C CB  . GLN A 7   ? 0.7529 0.8840 0.6016 0.0715  0.0825  0.0596  7   GLN A CB  
41   C CG  . GLN A 7   ? 0.7699 0.9030 0.6412 0.0617  0.0852  0.0653  7   GLN A CG  
42   C CD  . GLN A 7   ? 0.8134 0.9472 0.6851 0.0510  0.0907  0.0800  7   GLN A CD  
43   O OE1 . GLN A 7   ? 0.8484 0.9897 0.7061 0.0509  0.0969  0.0877  7   GLN A OE1 
44   N NE2 . GLN A 7   ? 0.7961 0.9209 0.6827 0.0418  0.0886  0.0839  7   GLN A NE2 
45   N N   . LEU A 8   ? 0.6985 0.7907 0.5409 0.0741  0.0540  0.0463  8   LEU A N   
46   C CA  . LEU A 8   ? 0.6611 0.7417 0.5156 0.0719  0.0446  0.0405  8   LEU A CA  
47   C C   . LEU A 8   ? 0.6607 0.7336 0.5107 0.0705  0.0360  0.0446  8   LEU A C   
48   O O   . LEU A 8   ? 0.6601 0.7257 0.5176 0.0692  0.0274  0.0396  8   LEU A O   
49   C CB  . LEU A 8   ? 0.6521 0.7292 0.5040 0.0772  0.0403  0.0265  8   LEU A CB  
50   C CG  . LEU A 8   ? 0.6239 0.7088 0.4823 0.0807  0.0485  0.0223  8   LEU A CG  
51   C CD1 . LEU A 8   ? 0.5999 0.6795 0.4470 0.0888  0.0460  0.0090  8   LEU A CD1 
52   C CD2 . LEU A 8   ? 0.5714 0.6559 0.4529 0.0749  0.0497  0.0248  8   LEU A CD2 
53   N N   . LEU A 9   ? 0.6610 0.7364 0.4988 0.0709  0.0384  0.0545  9   LEU A N   
54   C CA  . LEU A 9   ? 0.6594 0.7296 0.4917 0.0715  0.0306  0.0599  9   LEU A CA  
55   C C   . LEU A 9   ? 0.6475 0.7115 0.4870 0.0673  0.0343  0.0728  9   LEU A C   
56   O O   . LEU A 9   ? 0.6479 0.7137 0.4814 0.0654  0.0426  0.0817  9   LEU A O   
57   C CB  . LEU A 9   ? 0.6814 0.7570 0.4901 0.0768  0.0286  0.0607  9   LEU A CB  
58   C CG  . LEU A 9   ? 0.6894 0.7684 0.4853 0.0813  0.0255  0.0473  9   LEU A CG  
59   C CD1 . LEU A 9   ? 0.6991 0.7842 0.4688 0.0865  0.0253  0.0491  9   LEU A CD1 
60   C CD2 . LEU A 9   ? 0.6668 0.7395 0.4700 0.0799  0.0140  0.0368  9   LEU A CD2 
61   N N   . VAL A 10  ? 0.6340 0.6902 0.4857 0.0659  0.0283  0.0738  10  VAL A N   
62   C CA  . VAL A 10  ? 0.6323 0.6785 0.4907 0.0627  0.0314  0.0845  10  VAL A CA  
63   C C   . VAL A 10  ? 0.6334 0.6749 0.4929 0.0669  0.0227  0.0876  10  VAL A C   
64   O O   . VAL A 10  ? 0.6225 0.6696 0.4859 0.0691  0.0142  0.0797  10  VAL A O   
65   C CB  . VAL A 10  ? 0.6168 0.6587 0.4938 0.0563  0.0354  0.0815  10  VAL A CB  
66   C CG1 . VAL A 10  ? 0.6264 0.6547 0.5100 0.0534  0.0364  0.0898  10  VAL A CG1 
67   C CG2 . VAL A 10  ? 0.6228 0.6719 0.4995 0.0521  0.0448  0.0819  10  VAL A CG2 
68   N N   . ARG A 11  ? 0.6341 0.6655 0.4899 0.0680  0.0249  0.0994  11  ARG A N   
69   C CA  . ARG A 11  ? 0.6254 0.6532 0.4823 0.0740  0.0178  0.1040  11  ARG A CA  
70   C C   . ARG A 11  ? 0.6246 0.6384 0.4939 0.0722  0.0202  0.1076  11  ARG A C   
71   O O   . ARG A 11  ? 0.6389 0.6406 0.5074 0.0670  0.0281  0.1127  11  ARG A O   
72   C CB  . ARG A 11  ? 0.6444 0.6710 0.4828 0.0802  0.0172  0.1153  11  ARG A CB  
73   C CG  . ARG A 11  ? 0.6490 0.6720 0.4890 0.0882  0.0109  0.1220  11  ARG A CG  
74   C CD  . ARG A 11  ? 0.6565 0.6797 0.4775 0.0961  0.0088  0.1334  11  ARG A CD  
75   N NE  . ARG A 11  ? 0.6515 0.6929 0.4623 0.0992  0.0014  0.1291  11  ARG A NE  
76   C CZ  . ARG A 11  ? 0.6482 0.7035 0.4621 0.1045  -0.0094 0.1262  11  ARG A CZ  
77   N NH1 . ARG A 11  ? 0.6473 0.7174 0.4491 0.1057  -0.0160 0.1219  11  ARG A NH1 
78   N NH2 . ARG A 11  ? 0.6240 0.6797 0.4529 0.1082  -0.0137 0.1274  11  ARG A NH2 
79   N N   . VAL A 12  ? 0.6124 0.6284 0.4926 0.0761  0.0135  0.1048  12  VAL A N   
80   C CA  . VAL A 12  ? 0.6066 0.6097 0.4969 0.0767  0.0153  0.1078  12  VAL A CA  
81   C C   . VAL A 12  ? 0.6188 0.6224 0.5067 0.0873  0.0097  0.1148  12  VAL A C   
82   O O   . VAL A 12  ? 0.6397 0.6547 0.5186 0.0929  0.0043  0.1175  12  VAL A O   
83   C CB  . VAL A 12  ? 0.5848 0.5910 0.4933 0.0714  0.0141  0.0974  12  VAL A CB  
84   C CG1 . VAL A 12  ? 0.5814 0.5854 0.4926 0.0624  0.0206  0.0927  12  VAL A CG1 
85   C CG2 . VAL A 12  ? 0.5573 0.5811 0.4730 0.0730  0.0052  0.0891  12  VAL A CG2 
86   N N   . ARG A 13  ? 0.6085 0.6010 0.5037 0.0906  0.0110  0.1176  13  ARG A N   
87   C CA  . ARG A 13  ? 0.6241 0.6156 0.5162 0.1027  0.0074  0.1258  13  ARG A CA  
88   C C   . ARG A 13  ? 0.6284 0.6434 0.5242 0.1110  -0.0026 0.1259  13  ARG A C   
89   O O   . ARG A 13  ? 0.6568 0.6723 0.5420 0.1208  -0.0048 0.1353  13  ARG A O   
90   C CB  . ARG A 13  ? 0.6238 0.5987 0.5231 0.1055  0.0113  0.1272  13  ARG A CB  
91   C CG  . ARG A 13  ? 0.6302 0.6057 0.5284 0.1203  0.0080  0.1350  13  ARG A CG  
92   C CD  . ARG A 13  ? 0.6297 0.5898 0.5079 0.1284  0.0102  0.1477  13  ARG A CD  
93   N NE  . ARG A 13  ? 0.6578 0.6199 0.5342 0.1447  0.0068  0.1559  13  ARG A NE  
94   C CZ  . ARG A 13  ? 0.6737 0.6619 0.5533 0.1534  -0.0017 0.1582  13  ARG A CZ  
95   N NH1 . ARG A 13  ? 0.6369 0.6497 0.5210 0.1465  -0.0081 0.1518  13  ARG A NH1 
96   N NH2 . ARG A 13  ? 0.6908 0.6807 0.5689 0.1696  -0.0039 0.1668  13  ARG A NH2 
97   N N   . GLY A 14  ? 0.6144 0.6491 0.5236 0.1074  -0.0090 0.1166  14  GLY A N   
98   C CA  . GLY A 14  ? 0.6169 0.6571 0.5327 0.0964  -0.0094 0.1053  14  GLY A CA  
99   C C   . GLY A 14  ? 0.6370 0.6946 0.5443 0.0965  -0.0170 0.1028  14  GLY A C   
100  O O   . GLY A 14  ? 0.6424 0.7184 0.5549 0.0995  -0.0260 0.1018  14  GLY A O   
101  N N   . GLY A 15  ? 0.6418 0.6946 0.5352 0.0930  -0.0135 0.1023  15  GLY A N   
102  C CA  . GLY A 15  ? 0.6533 0.7193 0.5349 0.0926  -0.0195 0.0988  15  GLY A CA  
103  C C   . GLY A 15  ? 0.6542 0.7141 0.5300 0.0854  -0.0134 0.0918  15  GLY A C   
104  O O   . GLY A 15  ? 0.6447 0.6921 0.5254 0.0814  -0.0049 0.0922  15  GLY A O   
105  N N   . GLN A 16  ? 0.6577 0.7270 0.5230 0.0838  -0.0178 0.0850  16  GLN A N   
106  C CA  . GLN A 16  ? 0.6662 0.7319 0.5239 0.0793  -0.0118 0.0784  16  GLN A CA  
107  C C   . GLN A 16  ? 0.6425 0.7069 0.5133 0.0731  -0.0121 0.0662  16  GLN A C   
108  O O   . GLN A 16  ? 0.6440 0.7140 0.5234 0.0711  -0.0202 0.0600  16  GLN A O   
109  C CB  . GLN A 16  ? 0.6865 0.7604 0.5236 0.0819  -0.0153 0.0765  16  GLN A CB  
110  C CG  . GLN A 16  ? 0.7181 0.7898 0.5391 0.0870  -0.0106 0.0891  16  GLN A CG  
111  C CD  . GLN A 16  ? 0.7688 0.8493 0.5678 0.0900  -0.0143 0.0876  16  GLN A CD  
112  O OE1 . GLN A 16  ? 0.7840 0.8750 0.5785 0.0919  -0.0251 0.0843  16  GLN A OE1 
113  N NE2 . GLN A 16  ? 0.7736 0.8514 0.5582 0.0901  -0.0053 0.0903  16  GLN A NE2 
114  N N   . LEU A 17  ? 0.6268 0.6847 0.4990 0.0700  -0.0034 0.0635  17  LEU A N   
115  C CA  . LEU A 17  ? 0.6041 0.6601 0.4868 0.0655  -0.0032 0.0527  17  LEU A CA  
116  C C   . LEU A 17  ? 0.6169 0.6742 0.4876 0.0661  0.0008  0.0457  17  LEU A C   
117  O O   . LEU A 17  ? 0.6286 0.6875 0.4886 0.0680  0.0080  0.0511  17  LEU A O   
118  C CB  . LEU A 17  ? 0.5770 0.6256 0.4758 0.0619  0.0033  0.0551  17  LEU A CB  
119  C CG  . LEU A 17  ? 0.5589 0.6035 0.4692 0.0622  0.0015  0.0617  17  LEU A CG  
120  C CD1 . LEU A 17  ? 0.5431 0.5786 0.4643 0.0582  0.0089  0.0638  17  LEU A CD1 
121  C CD2 . LEU A 17  ? 0.5508 0.6011 0.4706 0.0616  -0.0076 0.0563  17  LEU A CD2 
122  N N   . ARG A 18  ? 0.6201 0.6764 0.4916 0.0646  -0.0037 0.0341  18  ARG A N   
123  C CA  . ARG A 18  ? 0.6367 0.6920 0.4990 0.0666  0.0013  0.0263  18  ARG A CA  
124  C C   . ARG A 18  ? 0.6219 0.6719 0.4999 0.0640  0.0046  0.0212  18  ARG A C   
125  O O   . ARG A 18  ? 0.6175 0.6625 0.5047 0.0608  -0.0017 0.0157  18  ARG A O   
126  C CB  . ARG A 18  ? 0.6509 0.7057 0.4958 0.0686  -0.0060 0.0163  18  ARG A CB  
127  C CG  . ARG A 18  ? 0.6984 0.7518 0.5287 0.0735  0.0004  0.0088  18  ARG A CG  
128  C CD  . ARG A 18  ? 0.7633 0.8122 0.5729 0.0755  -0.0071 -0.0025 18  ARG A CD  
129  N NE  . ARG A 18  ? 0.8136 0.8571 0.6295 0.0693  -0.0189 -0.0078 18  ARG A NE  
130  C CZ  . ARG A 18  ? 0.8358 0.8843 0.6453 0.0664  -0.0290 -0.0067 18  ARG A CZ  
131  N NH1 . ARG A 18  ? 0.8100 0.8674 0.6046 0.0700  -0.0294 -0.0010 18  ARG A NH1 
132  N NH2 . ARG A 18  ? 0.8454 0.8913 0.6640 0.0594  -0.0388 -0.0109 18  ARG A NH2 
133  N N   . GLY A 19  ? 0.6155 0.6681 0.4964 0.0651  0.0144  0.0237  19  GLY A N   
134  C CA  . GLY A 19  ? 0.6034 0.6535 0.4982 0.0636  0.0179  0.0196  19  GLY A CA  
135  C C   . GLY A 19  ? 0.6183 0.6683 0.5045 0.0691  0.0206  0.0102  19  GLY A C   
136  O O   . GLY A 19  ? 0.6366 0.6862 0.5049 0.0736  0.0187  0.0049  19  GLY A O   
137  N N   . ILE A 20  ? 0.6082 0.6585 0.5062 0.0695  0.0249  0.0079  20  ILE A N   
138  C CA  . ILE A 20  ? 0.6237 0.6724 0.5153 0.0764  0.0274  -0.0013 20  ILE A CA  
139  C C   . ILE A 20  ? 0.6209 0.6824 0.5214 0.0791  0.0376  0.0025  20  ILE A C   
140  O O   . ILE A 20  ? 0.6048 0.6711 0.5219 0.0734  0.0400  0.0091  20  ILE A O   
141  C CB  . ILE A 20  ? 0.6231 0.6570 0.5188 0.0756  0.0199  -0.0101 20  ILE A CB  
142  C CG1 . ILE A 20  ? 0.6413 0.6703 0.5283 0.0846  0.0230  -0.0194 20  ILE A CG1 
143  C CG2 . ILE A 20  ? 0.5953 0.6284 0.5121 0.0692  0.0189  -0.0055 20  ILE A CG2 
144  C CD1 . ILE A 20  ? 0.6313 0.6401 0.5108 0.0846  0.0144  -0.0299 20  ILE A CD1 
145  N N   . ARG A 21  ? 0.6404 0.7085 0.5291 0.0877  0.0434  -0.0017 21  ARG A N   
146  C CA  . ARG A 21  ? 0.6516 0.7362 0.5486 0.0916  0.0533  0.0015  21  ARG A CA  
147  C C   . ARG A 21  ? 0.6499 0.7285 0.5554 0.0964  0.0518  -0.0056 21  ARG A C   
148  O O   . ARG A 21  ? 0.6697 0.7361 0.5628 0.1043  0.0489  -0.0155 21  ARG A O   
149  C CB  . ARG A 21  ? 0.6743 0.7697 0.5539 0.1003  0.0605  0.0000  21  ARG A CB  
150  C CG  . ARG A 21  ? 0.7041 0.8219 0.5902 0.1058  0.0719  0.0034  21  ARG A CG  
151  C CD  . ARG A 21  ? 0.7947 0.9172 0.6591 0.1179  0.0772  -0.0025 21  ARG A CD  
152  N NE  . ARG A 21  ? 0.8561 1.0041 0.7236 0.1246  0.0894  0.0014  21  ARG A NE  
153  C CZ  . ARG A 21  ? 0.9080 1.0651 0.7826 0.1346  0.0940  -0.0030 21  ARG A CZ  
154  N NH1 . ARG A 21  ? 0.9268 1.0664 0.8055 0.1386  0.0874  -0.0112 21  ARG A NH1 
155  N NH2 . ARG A 21  ? 0.8995 1.0844 0.7777 0.1407  0.1055  0.0015  21  ARG A NH2 
156  N N   . LEU A 22  ? 0.6341 0.7188 0.5592 0.0913  0.0529  -0.0007 22  LEU A N   
157  C CA  . LEU A 22  ? 0.6401 0.7202 0.5733 0.0964  0.0516  -0.0061 22  LEU A CA  
158  C C   . LEU A 22  ? 0.6485 0.7505 0.5900 0.1032  0.0606  -0.0035 22  LEU A C   
159  O O   . LEU A 22  ? 0.6463 0.7682 0.5929 0.0995  0.0675  0.0043  22  LEU A O   
160  C CB  . LEU A 22  ? 0.6170 0.6885 0.5657 0.0871  0.0454  -0.0035 22  LEU A CB  
161  C CG  . LEU A 22  ? 0.6111 0.6631 0.5558 0.0809  0.0360  -0.0062 22  LEU A CG  
162  C CD1 . LEU A 22  ? 0.5942 0.6443 0.5559 0.0722  0.0330  -0.0014 22  LEU A CD1 
163  C CD2 . LEU A 22  ? 0.6096 0.6433 0.5421 0.0868  0.0304  -0.0166 22  LEU A CD2 
164  N N   . LYS A 23  ? 0.6642 0.7623 0.6068 0.1129  0.0604  -0.0097 23  LYS A N   
165  C CA  . LYS A 23  ? 0.6751 0.7954 0.6273 0.1213  0.0681  -0.0076 23  LYS A CA  
166  C C   . LYS A 23  ? 0.6486 0.7767 0.6224 0.1147  0.0663  -0.0022 23  LYS A C   
167  O O   . LYS A 23  ? 0.6449 0.7554 0.6220 0.1135  0.0594  -0.0055 23  LYS A O   
168  C CB  . LYS A 23  ? 0.7019 0.8121 0.6409 0.1383  0.0690  -0.0174 23  LYS A CB  
169  C CG  . LYS A 23  ? 0.7614 0.8949 0.6956 0.1515  0.0796  -0.0174 23  LYS A CG  
170  C CD  . LYS A 23  ? 0.8462 0.9643 0.7644 0.1704  0.0803  -0.0283 23  LYS A CD  
171  C CE  . LYS A 23  ? 0.8554 0.9773 0.7876 0.1785  0.0801  -0.0280 23  LYS A CE  
172  N NZ  . LYS A 23  ? 0.8502 1.0125 0.8018 0.1813  0.0889  -0.0191 23  LYS A NZ  
173  N N   . ALA A 24  ? 0.6330 0.7876 0.6209 0.1092  0.0722  0.0063  24  ALA A N   
174  C CA  . ALA A 24  ? 0.6143 0.7819 0.6216 0.1052  0.0715  0.0107  24  ALA A CA  
175  C C   . ALA A 24  ? 0.6158 0.8115 0.6291 0.1173  0.0793  0.0117  24  ALA A C   
176  O O   . ALA A 24  ? 0.6329 0.8401 0.6368 0.1251  0.0862  0.0110  24  ALA A O   
177  C CB  . ALA A 24  ? 0.5922 0.7686 0.6112 0.0879  0.0715  0.0196  24  ALA A CB  
178  N N   . PRO A 25  ? 0.6094 0.8176 0.6379 0.1197  0.0783  0.0136  25  PRO A N   
179  C CA  . PRO A 25  ? 0.6094 0.8473 0.6451 0.1332  0.0854  0.0149  25  PRO A CA  
180  C C   . PRO A 25  ? 0.6069 0.8786 0.6479 0.1298  0.0949  0.0220  25  PRO A C   
181  O O   . PRO A 25  ? 0.6207 0.9114 0.6581 0.1443  0.1026  0.0207  25  PRO A O   
182  C CB  . PRO A 25  ? 0.5936 0.8430 0.6482 0.1298  0.0813  0.0188  25  PRO A CB  
183  C CG  . PRO A 25  ? 0.5963 0.8120 0.6473 0.1212  0.0716  0.0157  25  PRO A CG  
184  C CD  . PRO A 25  ? 0.5952 0.7910 0.6339 0.1111  0.0703  0.0146  25  PRO A CD  
185  N N   . GLY A 26  ? 0.5932 0.8717 0.6416 0.1110  0.0948  0.0295  26  GLY A N   
186  C CA  . GLY A 26  ? 0.5933 0.9034 0.6471 0.1048  0.1038  0.0376  26  GLY A CA  
187  C C   . GLY A 26  ? 0.6078 0.9099 0.6429 0.1063  0.1087  0.0368  26  GLY A C   
188  O O   . GLY A 26  ? 0.6132 0.9417 0.6498 0.1043  0.1174  0.0432  26  GLY A O   
189  N N   . GLY A 27  ? 0.6101 0.8772 0.6279 0.1091  0.1028  0.0296  27  GLY A N   
190  C CA  . GLY A 27  ? 0.6210 0.8773 0.6192 0.1099  0.1055  0.0284  27  GLY A CA  
191  C C   . GLY A 27  ? 0.6185 0.8394 0.6052 0.1027  0.0964  0.0250  27  GLY A C   
192  O O   . GLY A 27  ? 0.6101 0.8128 0.6027 0.0989  0.0883  0.0221  27  GLY A O   
193  N N   . PRO A 28  ? 0.6210 0.8339 0.5912 0.1009  0.0979  0.0258  28  PRO A N   
194  C CA  . PRO A 28  ? 0.6138 0.7966 0.5725 0.0960  0.0892  0.0224  28  PRO A CA  
195  C C   . PRO A 28  ? 0.5979 0.7728 0.5660 0.0796  0.0850  0.0300  28  PRO A C   
196  O O   . PRO A 28  ? 0.5969 0.7879 0.5734 0.0699  0.0902  0.0394  28  PRO A O   
197  C CB  . PRO A 28  ? 0.6337 0.8160 0.5717 0.1007  0.0931  0.0218  28  PRO A CB  
198  C CG  . PRO A 28  ? 0.6348 0.8484 0.5770 0.1011  0.1046  0.0295  28  PRO A CG  
199  C CD  . PRO A 28  ? 0.6323 0.8653 0.5925 0.1058  0.1077  0.0291  28  PRO A CD  
200  N N   . VAL A 29  ? 0.5845 0.7348 0.5507 0.0767  0.0758  0.0260  29  VAL A N   
201  C CA  . VAL A 29  ? 0.5727 0.7111 0.5427 0.0640  0.0716  0.0320  29  VAL A CA  
202  C C   . VAL A 29  ? 0.5744 0.6931 0.5292 0.0650  0.0656  0.0292  29  VAL A C   
203  O O   . VAL A 29  ? 0.5803 0.6907 0.5240 0.0738  0.0623  0.0209  29  VAL A O   
204  C CB  . VAL A 29  ? 0.5612 0.6925 0.5471 0.0575  0.0663  0.0318  29  VAL A CB  
205  C CG1 . VAL A 29  ? 0.5424 0.6949 0.5436 0.0528  0.0715  0.0369  29  VAL A CG1 
206  C CG2 . VAL A 29  ? 0.5628 0.6805 0.5482 0.0653  0.0598  0.0224  29  VAL A CG2 
207  N N   . SER A 30  ? 0.5696 0.6808 0.5234 0.0562  0.0640  0.0363  30  SER A N   
208  C CA  . SER A 30  ? 0.5705 0.6654 0.5128 0.0567  0.0573  0.0350  30  SER A CA  
209  C C   . SER A 30  ? 0.5471 0.6271 0.4986 0.0531  0.0493  0.0324  30  SER A C   
210  O O   . SER A 30  ? 0.5311 0.6105 0.4953 0.0463  0.0498  0.0363  30  SER A O   
211  C CB  . SER A 30  ? 0.5764 0.6711 0.5116 0.0511  0.0602  0.0451  30  SER A CB  
212  O OG  . SER A 30  ? 0.6236 0.7318 0.5479 0.0544  0.0675  0.0481  30  SER A OG  
213  N N   . ALA A 31  ? 0.5427 0.6115 0.4874 0.0568  0.0419  0.0258  31  ALA A N   
214  C CA  . ALA A 31  ? 0.5262 0.5831 0.4797 0.0529  0.0347  0.0242  31  ALA A CA  
215  C C   . ALA A 31  ? 0.5330 0.5819 0.4781 0.0528  0.0279  0.0242  31  ALA A C   
216  O O   . ALA A 31  ? 0.5536 0.6020 0.4850 0.0573  0.0253  0.0199  31  ALA A O   
217  C CB  . ALA A 31  ? 0.5164 0.5692 0.4756 0.0558  0.0317  0.0161  31  ALA A CB  
218  N N   . PHE A 32  ? 0.5188 0.5621 0.4716 0.0482  0.0249  0.0290  32  PHE A N   
219  C CA  . PHE A 32  ? 0.5108 0.5498 0.4587 0.0484  0.0184  0.0306  32  PHE A CA  
220  C C   . PHE A 32  ? 0.5065 0.5400 0.4667 0.0454  0.0131  0.0281  32  PHE A C   
221  O O   . PHE A 32  ? 0.5064 0.5371 0.4760 0.0423  0.0148  0.0330  32  PHE A O   
222  C CB  . PHE A 32  ? 0.5069 0.5457 0.4510 0.0474  0.0215  0.0408  32  PHE A CB  
223  C CG  . PHE A 32  ? 0.5113 0.5560 0.4424 0.0496  0.0269  0.0445  32  PHE A CG  
224  C CD1 . PHE A 32  ? 0.4961 0.5462 0.4294 0.0472  0.0353  0.0473  32  PHE A CD1 
225  C CD2 . PHE A 32  ? 0.5216 0.5685 0.4378 0.0539  0.0237  0.0451  32  PHE A CD2 
226  C CE1 . PHE A 32  ? 0.5006 0.5585 0.4221 0.0489  0.0411  0.0512  32  PHE A CE1 
227  C CE2 . PHE A 32  ? 0.5195 0.5725 0.4221 0.0562  0.0293  0.0487  32  PHE A CE2 
228  C CZ  . PHE A 32  ? 0.5103 0.5688 0.4157 0.0537  0.0384  0.0519  32  PHE A CZ  
229  N N   . LEU A 33  ? 0.5078 0.5388 0.4669 0.0460  0.0071  0.0204  33  LEU A N   
230  C CA  . LEU A 33  ? 0.4899 0.5163 0.4605 0.0424  0.0027  0.0176  33  LEU A CA  
231  C C   . LEU A 33  ? 0.4915 0.5192 0.4620 0.0408  -0.0051 0.0179  33  LEU A C   
232  O O   . LEU A 33  ? 0.5044 0.5348 0.4641 0.0424  -0.0093 0.0161  33  LEU A O   
233  C CB  . LEU A 33  ? 0.4905 0.5117 0.4604 0.0432  0.0016  0.0092  33  LEU A CB  
234  C CG  . LEU A 33  ? 0.4833 0.5069 0.4534 0.0466  0.0089  0.0083  33  LEU A CG  
235  C CD1 . LEU A 33  ? 0.4805 0.4970 0.4471 0.0499  0.0071  -0.0002 33  LEU A CD1 
236  C CD2 . LEU A 33  ? 0.4374 0.4644 0.4207 0.0434  0.0138  0.0140  33  LEU A CD2 
237  N N   . GLY A 34  ? 0.4803 0.5079 0.4629 0.0377  -0.0070 0.0204  34  GLY A N   
238  C CA  . GLY A 34  ? 0.4849 0.5179 0.4705 0.0361  -0.0140 0.0215  34  GLY A CA  
239  C C   . GLY A 34  ? 0.4967 0.5368 0.4780 0.0400  -0.0148 0.0286  34  GLY A C   
240  O O   . GLY A 34  ? 0.5067 0.5544 0.4847 0.0399  -0.0217 0.0283  34  GLY A O   
241  N N   . ILE A 35  ? 0.5004 0.5377 0.4812 0.0430  -0.0083 0.0354  35  ILE A N   
242  C CA  . ILE A 35  ? 0.5071 0.5479 0.4833 0.0479  -0.0085 0.0435  35  ILE A CA  
243  C C   . ILE A 35  ? 0.5087 0.5527 0.4965 0.0491  -0.0104 0.0474  35  ILE A C   
244  O O   . ILE A 35  ? 0.5100 0.5474 0.5057 0.0478  -0.0059 0.0482  35  ILE A O   
245  C CB  . ILE A 35  ? 0.5096 0.5425 0.4799 0.0498  -0.0004 0.0498  35  ILE A CB  
246  C CG1 . ILE A 35  ? 0.4926 0.5246 0.4539 0.0485  0.0036  0.0466  35  ILE A CG1 
247  C CG2 . ILE A 35  ? 0.5171 0.5505 0.4804 0.0557  -0.0008 0.0589  35  ILE A CG2 
248  C CD1 . ILE A 35  ? 0.4620 0.4876 0.4220 0.0468  0.0121  0.0518  35  ILE A CD1 
249  N N   . PRO A 36  ? 0.5119 0.5677 0.5006 0.0518  -0.0169 0.0498  36  PRO A N   
250  C CA  . PRO A 36  ? 0.5038 0.5666 0.5045 0.0543  -0.0184 0.0538  36  PRO A CA  
251  C C   . PRO A 36  ? 0.5123 0.5666 0.5107 0.0615  -0.0122 0.0619  36  PRO A C   
252  O O   . PRO A 36  ? 0.5373 0.5876 0.5242 0.0662  -0.0107 0.0671  36  PRO A O   
253  C CB  . PRO A 36  ? 0.5124 0.5929 0.5126 0.0559  -0.0272 0.0551  36  PRO A CB  
254  C CG  . PRO A 36  ? 0.5182 0.5971 0.5019 0.0578  -0.0286 0.0553  36  PRO A CG  
255  C CD  . PRO A 36  ? 0.5179 0.5830 0.4963 0.0529  -0.0234 0.0489  36  PRO A CD  
256  N N   . PHE A 37  ? 0.5072 0.5569 0.5145 0.0626  -0.0084 0.0632  37  PHE A N   
257  C CA  . PHE A 37  ? 0.5138 0.5522 0.5168 0.0701  -0.0028 0.0704  37  PHE A CA  
258  C C   . PHE A 37  ? 0.5220 0.5696 0.5330 0.0780  -0.0041 0.0748  37  PHE A C   
259  O O   . PHE A 37  ? 0.5444 0.5825 0.5500 0.0868  -0.0002 0.0812  37  PHE A O   
260  C CB  . PHE A 37  ? 0.5106 0.5299 0.5116 0.0659  0.0046  0.0689  37  PHE A CB  
261  C CG  . PHE A 37  ? 0.4953 0.5149 0.5076 0.0609  0.0055  0.0635  37  PHE A CG  
262  C CD1 . PHE A 37  ? 0.4984 0.5139 0.5153 0.0654  0.0085  0.0656  37  PHE A CD1 
263  C CD2 . PHE A 37  ? 0.4685 0.4911 0.4854 0.0526  0.0040  0.0565  37  PHE A CD2 
264  C CE1 . PHE A 37  ? 0.4679 0.4841 0.4940 0.0609  0.0097  0.0610  37  PHE A CE1 
265  C CE2 . PHE A 37  ? 0.4568 0.4791 0.4830 0.0483  0.0048  0.0524  37  PHE A CE2 
266  C CZ  . PHE A 37  ? 0.4591 0.4788 0.4901 0.0520  0.0076  0.0548  37  PHE A CZ  
267  N N   . ALA A 38  ? 0.5151 0.5812 0.5385 0.0753  -0.0093 0.0717  38  ALA A N   
268  C CA  . ALA A 38  ? 0.5127 0.5942 0.5457 0.0831  -0.0108 0.0763  38  ALA A CA  
269  C C   . ALA A 38  ? 0.5118 0.6195 0.5525 0.0805  -0.0199 0.0758  38  ALA A C   
270  O O   . ALA A 38  ? 0.5076 0.6183 0.5474 0.0705  -0.0248 0.0698  38  ALA A O   
271  C CB  . ALA A 38  ? 0.5032 0.5822 0.5461 0.0814  -0.0064 0.0738  38  ALA A CB  
272  N N   . GLU A 39  ? 0.5118 0.6383 0.5596 0.0895  -0.0222 0.0821  39  GLU A N   
273  C CA  . GLU A 39  ? 0.5137 0.6695 0.5725 0.0856  -0.0310 0.0821  39  GLU A CA  
274  C C   . GLU A 39  ? 0.5011 0.6625 0.5727 0.0739  -0.0314 0.0759  39  GLU A C   
275  O O   . GLU A 39  ? 0.5035 0.6555 0.5795 0.0752  -0.0245 0.0754  39  GLU A O   
276  C CB  . GLU A 39  ? 0.5207 0.6982 0.5865 0.0990  -0.0324 0.0910  39  GLU A CB  
277  C CG  . GLU A 39  ? 0.5453 0.7240 0.5987 0.1087  -0.0358 0.0974  39  GLU A CG  
278  C CD  . GLU A 39  ? 0.5773 0.7701 0.6275 0.0992  -0.0458 0.0940  39  GLU A CD  
279  O OE1 . GLU A 39  ? 0.6081 0.8272 0.6713 0.0925  -0.0531 0.0924  39  GLU A OE1 
280  O OE2 . GLU A 39  ? 0.5794 0.7571 0.6139 0.0974  -0.0464 0.0923  39  GLU A OE2 
281  N N   . PRO A 40  ? 0.4940 0.6679 0.5694 0.0620  -0.0395 0.0711  40  PRO A N   
282  C CA  . PRO A 40  ? 0.4861 0.6625 0.5720 0.0503  -0.0399 0.0661  40  PRO A CA  
283  C C   . PRO A 40  ? 0.4816 0.6742 0.5826 0.0549  -0.0359 0.0711  40  PRO A C   
284  O O   . PRO A 40  ? 0.4904 0.7088 0.6003 0.0613  -0.0388 0.0773  40  PRO A O   
285  C CB  . PRO A 40  ? 0.4899 0.6817 0.5772 0.0388  -0.0506 0.0625  40  PRO A CB  
286  C CG  . PRO A 40  ? 0.4998 0.6838 0.5713 0.0423  -0.0538 0.0616  40  PRO A CG  
287  C CD  . PRO A 40  ? 0.4958 0.6792 0.5640 0.0580  -0.0485 0.0697  40  PRO A CD  
288  N N   . PRO A 41  ? 0.4746 0.6533 0.5780 0.0529  -0.0289 0.0687  41  PRO A N   
289  C CA  . PRO A 41  ? 0.4706 0.6625 0.5857 0.0589  -0.0236 0.0732  41  PRO A CA  
290  C C   . PRO A 41  ? 0.4575 0.6743 0.5882 0.0477  -0.0281 0.0733  41  PRO A C   
291  O O   . PRO A 41  ? 0.4416 0.6566 0.5783 0.0433  -0.0235 0.0722  41  PRO A O   
292  C CB  . PRO A 41  ? 0.4656 0.6301 0.5739 0.0600  -0.0149 0.0699  41  PRO A CB  
293  C CG  . PRO A 41  ? 0.4726 0.6198 0.5738 0.0479  -0.0178 0.0628  41  PRO A CG  
294  C CD  . PRO A 41  ? 0.4736 0.6240 0.5676 0.0472  -0.0248 0.0624  41  PRO A CD  
295  N N   . VAL A 42  ? 0.4553 0.6961 0.5919 0.0429  -0.0371 0.0751  42  VAL A N   
296  C CA  . VAL A 42  ? 0.4483 0.7117 0.5982 0.0285  -0.0431 0.0748  42  VAL A CA  
297  C C   . VAL A 42  ? 0.4549 0.7587 0.6216 0.0339  -0.0452 0.0830  42  VAL A C   
298  O O   . VAL A 42  ? 0.4660 0.7799 0.6323 0.0493  -0.0440 0.0885  42  VAL A O   
299  C CB  . VAL A 42  ? 0.4540 0.7117 0.5961 0.0143  -0.0533 0.0686  42  VAL A CB  
300  C CG1 . VAL A 42  ? 0.4618 0.6818 0.5877 0.0110  -0.0504 0.0607  42  VAL A CG1 
301  C CG2 . VAL A 42  ? 0.4321 0.7047 0.5703 0.0197  -0.0606 0.0711  42  VAL A CG2 
302  N N   . GLY A 43  ? 0.4531 0.7808 0.6345 0.0215  -0.0484 0.0845  43  GLY A N   
303  C CA  . GLY A 43  ? 0.4585 0.8298 0.6580 0.0251  -0.0509 0.0927  43  GLY A CA  
304  C C   . GLY A 43  ? 0.4653 0.8450 0.6708 0.0446  -0.0401 0.0991  43  GLY A C   
305  O O   . GLY A 43  ? 0.4634 0.8268 0.6674 0.0461  -0.0311 0.0975  43  GLY A O   
306  N N   . SER A 44  ? 0.4747 0.8782 0.6852 0.0606  -0.0409 0.1061  44  SER A N   
307  C CA  . SER A 44  ? 0.4814 0.8934 0.6965 0.0816  -0.0306 0.1124  44  SER A CA  
308  C C   . SER A 44  ? 0.4855 0.8532 0.6816 0.0932  -0.0212 0.1085  44  SER A C   
309  O O   . SER A 44  ? 0.4882 0.8524 0.6824 0.1109  -0.0123 0.1119  44  SER A O   
310  C CB  . SER A 44  ? 0.4868 0.9311 0.7091 0.0975  -0.0343 0.1209  44  SER A CB  
311  O OG  . SER A 44  ? 0.5056 0.9252 0.7103 0.1087  -0.0358 0.1204  44  SER A OG  
312  N N   . ARG A 45  ? 0.4907 0.8247 0.6725 0.0825  -0.0233 0.1009  45  ARG A N   
313  C CA  . ARG A 45  ? 0.4982 0.7923 0.6618 0.0910  -0.0166 0.0974  45  ARG A CA  
314  C C   . ARG A 45  ? 0.4784 0.7460 0.6368 0.0818  -0.0106 0.0909  45  ARG A C   
315  O O   . ARG A 45  ? 0.4832 0.7197 0.6279 0.0879  -0.0043 0.0880  45  ARG A O   
316  C CB  . ARG A 45  ? 0.5144 0.7925 0.6646 0.0887  -0.0232 0.0950  45  ARG A CB  
317  C CG  . ARG A 45  ? 0.5764 0.8362 0.7131 0.1063  -0.0187 0.0985  45  ARG A CG  
318  C CD  . ARG A 45  ? 0.6473 0.9030 0.7738 0.1049  -0.0263 0.0986  45  ARG A CD  
319  N NE  . ARG A 45  ? 0.7269 1.0095 0.8586 0.1182  -0.0301 0.1071  45  ARG A NE  
320  C CZ  . ARG A 45  ? 0.7599 1.0434 0.8823 0.1230  -0.0359 0.1102  45  ARG A CZ  
321  N NH1 . ARG A 45  ? 0.7532 1.0642 0.8816 0.1365  -0.0394 0.1189  45  ARG A NH1 
322  N NH2 . ARG A 45  ? 0.7664 1.0252 0.8736 0.1151  -0.0382 0.1051  45  ARG A NH2 
323  N N   . ARG A 46  ? 0.4535 0.7339 0.6225 0.0668  -0.0128 0.0891  46  ARG A N   
324  C CA  . ARG A 46  ? 0.4336 0.6943 0.5995 0.0593  -0.0070 0.0845  46  ARG A CA  
325  C C   . ARG A 46  ? 0.4312 0.6874 0.5954 0.0742  0.0038  0.0869  46  ARG A C   
326  O O   . ARG A 46  ? 0.4362 0.7171 0.6094 0.0859  0.0066  0.0930  46  ARG A O   
327  C CB  . ARG A 46  ? 0.4227 0.7027 0.6014 0.0422  -0.0111 0.0846  46  ARG A CB  
328  C CG  . ARG A 46  ? 0.4069 0.6687 0.5825 0.0335  -0.0063 0.0809  46  ARG A CG  
329  C CD  . ARG A 46  ? 0.3952 0.6793 0.5843 0.0182  -0.0094 0.0833  46  ARG A CD  
330  N NE  . ARG A 46  ? 0.3965 0.6760 0.5840 0.0014  -0.0194 0.0796  46  ARG A NE  
331  C CZ  . ARG A 46  ? 0.3919 0.6884 0.5894 -0.0150 -0.0244 0.0814  46  ARG A CZ  
332  N NH1 . ARG A 46  ? 0.4051 0.7280 0.6165 -0.0167 -0.0200 0.0876  46  ARG A NH1 
333  N NH2 . ARG A 46  ? 0.3734 0.6603 0.5661 -0.0297 -0.0336 0.0770  46  ARG A NH2 
334  N N   . PHE A 47  ? 0.4287 0.6538 0.5808 0.0739  0.0096  0.0819  47  PHE A N   
335  C CA  . PHE A 47  ? 0.4291 0.6420 0.5744 0.0873  0.0196  0.0823  47  PHE A CA  
336  C C   . PHE A 47  ? 0.4495 0.6482 0.5834 0.1049  0.0230  0.0843  47  PHE A C   
337  O O   . PHE A 47  ? 0.4613 0.6406 0.5847 0.1150  0.0308  0.0830  47  PHE A O   
338  C CB  . PHE A 47  ? 0.4248 0.6656 0.5830 0.0910  0.0249  0.0867  47  PHE A CB  
339  C CG  . PHE A 47  ? 0.4097 0.6682 0.5803 0.0734  0.0213  0.0868  47  PHE A CG  
340  C CD1 . PHE A 47  ? 0.3922 0.6281 0.5560 0.0598  0.0207  0.0814  47  PHE A CD1 
341  C CD2 . PHE A 47  ? 0.3775 0.6754 0.5662 0.0702  0.0185  0.0929  47  PHE A CD2 
342  C CE1 . PHE A 47  ? 0.3637 0.6125 0.5369 0.0439  0.0175  0.0821  47  PHE A CE1 
343  C CE2 . PHE A 47  ? 0.3642 0.6762 0.5630 0.0524  0.0152  0.0935  47  PHE A CE2 
344  C CZ  . PHE A 47  ? 0.3563 0.6416 0.5464 0.0394  0.0147  0.0881  47  PHE A CZ  
345  N N   . MET A 48  ? 0.4547 0.6607 0.5888 0.1083  0.0169  0.0873  48  MET A N   
346  C CA  . MET A 48  ? 0.4755 0.6682 0.5982 0.1253  0.0196  0.0907  48  MET A CA  
347  C C   . MET A 48  ? 0.4795 0.6341 0.5839 0.1221  0.0199  0.0862  48  MET A C   
348  O O   . MET A 48  ? 0.4650 0.6117 0.5680 0.1076  0.0151  0.0817  48  MET A O   
349  C CB  . MET A 48  ? 0.4777 0.6983 0.6086 0.1318  0.0129  0.0973  48  MET A CB  
350  C CG  . MET A 48  ? 0.5023 0.7634 0.6514 0.1388  0.0135  0.1035  48  MET A CG  
351  S SD  . MET A 48  ? 0.5947 0.8521 0.7387 0.1645  0.0253  0.1079  48  MET A SD  
352  C CE  . MET A 48  ? 0.5567 0.8123 0.6923 0.1827  0.0219  0.1149  48  MET A CE  
353  N N   . PRO A 49  ? 0.4998 0.6306 0.5897 0.1357  0.0257  0.0877  49  PRO A N   
354  C CA  . PRO A 49  ? 0.5152 0.6121 0.5878 0.1328  0.0260  0.0851  49  PRO A CA  
355  C C   . PRO A 49  ? 0.5184 0.6230 0.5914 0.1275  0.0179  0.0870  49  PRO A C   
356  O O   . PRO A 49  ? 0.5208 0.6530 0.6036 0.1318  0.0128  0.0918  49  PRO A O   
357  C CB  . PRO A 49  ? 0.5347 0.6113 0.5933 0.1508  0.0324  0.0891  49  PRO A CB  
358  C CG  . PRO A 49  ? 0.5302 0.6248 0.5970 0.1630  0.0374  0.0914  49  PRO A CG  
359  C CD  . PRO A 49  ? 0.5156 0.6507 0.6041 0.1552  0.0322  0.0926  49  PRO A CD  
360  N N   . PRO A 50  ? 0.5248 0.6074 0.5875 0.1178  0.0167  0.0831  50  PRO A N   
361  C CA  . PRO A 50  ? 0.5243 0.6143 0.5859 0.1128  0.0095  0.0842  50  PRO A CA  
362  C C   . PRO A 50  ? 0.5535 0.6382 0.6048 0.1261  0.0095  0.0914  50  PRO A C   
363  O O   . PRO A 50  ? 0.5713 0.6330 0.6107 0.1362  0.0158  0.0941  50  PRO A O   
364  C CB  . PRO A 50  ? 0.5167 0.5841 0.5696 0.1004  0.0102  0.0782  50  PRO A CB  
365  C CG  . PRO A 50  ? 0.5182 0.5602 0.5622 0.1033  0.0181  0.0767  50  PRO A CG  
366  C CD  . PRO A 50  ? 0.5204 0.5746 0.5733 0.1099  0.0212  0.0774  50  PRO A CD  
367  N N   . GLU A 51  ? 0.5608 0.6651 0.6153 0.1260  0.0021  0.0945  51  GLU A N   
368  C CA  . GLU A 51  ? 0.5855 0.6853 0.6288 0.1369  0.0006  0.1016  51  GLU A CA  
369  C C   . GLU A 51  ? 0.5774 0.6642 0.6097 0.1267  -0.0023 0.0990  51  GLU A C   
370  O O   . GLU A 51  ? 0.5551 0.6510 0.5930 0.1136  -0.0068 0.0929  51  GLU A O   
371  C CB  . GLU A 51  ? 0.5940 0.7288 0.6482 0.1449  -0.0061 0.1076  51  GLU A CB  
372  C CG  . GLU A 51  ? 0.6568 0.8103 0.7241 0.1557  -0.0028 0.1108  51  GLU A CG  
373  C CD  . GLU A 51  ? 0.7330 0.9207 0.8095 0.1680  -0.0084 0.1191  51  GLU A CD  
374  O OE1 . GLU A 51  ? 0.7369 0.9556 0.8262 0.1586  -0.0170 0.1183  51  GLU A OE1 
375  O OE2 . GLU A 51  ? 0.7748 0.9580 0.8453 0.1871  -0.0044 0.1265  51  GLU A OE2 
376  N N   . PRO A 52  ? 0.5950 0.6601 0.6108 0.1331  0.0006  0.1039  52  PRO A N   
377  C CA  . PRO A 52  ? 0.5945 0.6493 0.5987 0.1251  -0.0013 0.1030  52  PRO A CA  
378  C C   . PRO A 52  ? 0.5814 0.6622 0.5907 0.1195  -0.0106 0.1013  52  PRO A C   
379  O O   . PRO A 52  ? 0.5787 0.6837 0.5952 0.1263  -0.0163 0.1054  52  PRO A O   
380  C CB  . PRO A 52  ? 0.6191 0.6553 0.6067 0.1372  0.0020  0.1121  52  PRO A CB  
381  C CG  . PRO A 52  ? 0.6268 0.6481 0.6135 0.1472  0.0086  0.1143  52  PRO A CG  
382  C CD  . PRO A 52  ? 0.6088 0.6569 0.6146 0.1489  0.0063  0.1113  52  PRO A CD  
383  N N   . LYS A 53  ? 0.5742 0.6502 0.5792 0.1074  -0.0121 0.0952  53  LYS A N   
384  C CA  . LYS A 53  ? 0.5716 0.6668 0.5771 0.1016  -0.0207 0.0924  53  LYS A CA  
385  C C   . LYS A 53  ? 0.5969 0.6979 0.5908 0.1111  -0.0244 0.1005  53  LYS A C   
386  O O   . LYS A 53  ? 0.6200 0.7016 0.5997 0.1161  -0.0194 0.1058  53  LYS A O   
387  C CB  . LYS A 53  ? 0.5647 0.6487 0.5643 0.0894  -0.0199 0.0843  53  LYS A CB  
388  C CG  . LYS A 53  ? 0.5549 0.6520 0.5491 0.0841  -0.0279 0.0806  53  LYS A CG  
389  C CD  . LYS A 53  ? 0.5380 0.6571 0.5453 0.0779  -0.0361 0.0758  53  LYS A CD  
390  C CE  . LYS A 53  ? 0.5239 0.6536 0.5229 0.0725  -0.0448 0.0716  53  LYS A CE  
391  N NZ  . LYS A 53  ? 0.5129 0.6593 0.5237 0.0630  -0.0525 0.0657  53  LYS A NZ  
392  N N   . ARG A 54  ? 0.5996 0.7275 0.5993 0.1127  -0.0334 0.1019  54  ARG A N   
393  C CA  . ARG A 54  ? 0.6177 0.7555 0.6073 0.1221  -0.0384 0.1099  54  ARG A CA  
394  C C   . ARG A 54  ? 0.6253 0.7566 0.5992 0.1149  -0.0409 0.1065  54  ARG A C   
395  O O   . ARG A 54  ? 0.6171 0.7499 0.5929 0.1027  -0.0434 0.0969  54  ARG A O   
396  C CB  . ARG A 54  ? 0.6199 0.7924 0.6225 0.1252  -0.0479 0.1123  54  ARG A CB  
397  C CG  . ARG A 54  ? 0.6478 0.8304 0.6630 0.1380  -0.0450 0.1192  54  ARG A CG  
398  C CD  . ARG A 54  ? 0.7313 0.9486 0.7535 0.1469  -0.0541 0.1265  54  ARG A CD  
399  N NE  . ARG A 54  ? 0.7783 1.0275 0.8202 0.1372  -0.0613 0.1218  54  ARG A NE  
400  C CZ  . ARG A 54  ? 0.7946 1.0600 0.8547 0.1407  -0.0588 0.1234  54  ARG A CZ  
401  N NH1 . ARG A 54  ? 0.7973 1.0487 0.8577 0.1547  -0.0492 0.1284  54  ARG A NH1 
402  N NH2 . ARG A 54  ? 0.7870 1.0820 0.8643 0.1297  -0.0656 0.1197  54  ARG A NH2 
403  N N   . PRO A 55  ? 0.6408 0.7639 0.5980 0.1230  -0.0398 0.1145  55  PRO A N   
404  C CA  . PRO A 55  ? 0.6498 0.7658 0.5907 0.1166  -0.0405 0.1113  55  PRO A CA  
405  C C   . PRO A 55  ? 0.6489 0.7866 0.5907 0.1085  -0.0509 0.1036  55  PRO A C   
406  O O   . PRO A 55  ? 0.6476 0.8095 0.5985 0.1106  -0.0596 0.1050  55  PRO A O   
407  C CB  . PRO A 55  ? 0.6619 0.7715 0.5860 0.1283  -0.0392 0.1234  55  PRO A CB  
408  C CG  . PRO A 55  ? 0.6767 0.7736 0.6052 0.1387  -0.0330 0.1310  55  PRO A CG  
409  C CD  . PRO A 55  ? 0.6571 0.7713 0.6074 0.1382  -0.0359 0.1265  55  PRO A CD  
410  N N   . TRP A 56  ? 0.6492 0.7784 0.5816 0.0992  -0.0501 0.0953  56  TRP A N   
411  C CA  . TRP A 56  ? 0.6525 0.7967 0.5813 0.0913  -0.0598 0.0870  56  TRP A CA  
412  C C   . TRP A 56  ? 0.6787 0.8226 0.5853 0.0942  -0.0620 0.0893  56  TRP A C   
413  O O   . TRP A 56  ? 0.6958 0.8269 0.5904 0.1013  -0.0550 0.0976  56  TRP A O   
414  C CB  . TRP A 56  ? 0.6381 0.7731 0.5717 0.0793  -0.0582 0.0744  56  TRP A CB  
415  C CG  . TRP A 56  ? 0.6453 0.7580 0.5703 0.0780  -0.0478 0.0724  56  TRP A CG  
416  C CD1 . TRP A 56  ? 0.6624 0.7680 0.5704 0.0761  -0.0459 0.0683  56  TRP A CD1 
417  C CD2 . TRP A 56  ? 0.6275 0.7241 0.5604 0.0784  -0.0378 0.0744  56  TRP A CD2 
418  N NE1 . TRP A 56  ? 0.6490 0.7376 0.5557 0.0751  -0.0353 0.0682  56  TRP A NE1 
419  C CE2 . TRP A 56  ? 0.6297 0.7122 0.5514 0.0758  -0.0306 0.0718  56  TRP A CE2 
420  C CE3 . TRP A 56  ? 0.6085 0.7021 0.5563 0.0806  -0.0342 0.0779  56  TRP A CE3 
421  C CZ2 . TRP A 56  ? 0.6133 0.6802 0.5391 0.0742  -0.0209 0.0730  56  TRP A CZ2 
422  C CZ3 . TRP A 56  ? 0.5919 0.6671 0.5418 0.0793  -0.0246 0.0783  56  TRP A CZ3 
423  C CH2 . TRP A 56  ? 0.5998 0.6625 0.5392 0.0755  -0.0185 0.0761  56  TRP A CH2 
424  N N   . SER A 57  ? 0.6866 0.8439 0.5866 0.0884  -0.0717 0.0822  57  SER A N   
425  C CA  . SER A 57  ? 0.7065 0.8641 0.5836 0.0907  -0.0740 0.0832  57  SER A CA  
426  C C   . SER A 57  ? 0.7066 0.8540 0.5736 0.0813  -0.0733 0.0700  57  SER A C   
427  O O   . SER A 57  ? 0.6948 0.8408 0.5725 0.0725  -0.0756 0.0601  57  SER A O   
428  C CB  . SER A 57  ? 0.7244 0.9069 0.5977 0.0937  -0.0869 0.0869  57  SER A CB  
429  O OG  . SER A 57  ? 0.7146 0.9112 0.5971 0.0831  -0.0969 0.0768  57  SER A OG  
430  N N   . GLY A 58  ? 0.7220 0.8620 0.5676 0.0839  -0.0698 0.0702  58  GLY A N   
431  C CA  . GLY A 58  ? 0.7235 0.8530 0.5569 0.0778  -0.0674 0.0582  58  GLY A CA  
432  C C   . GLY A 58  ? 0.7077 0.8199 0.5501 0.0758  -0.0554 0.0558  58  GLY A C   
433  O O   . GLY A 58  ? 0.6937 0.8004 0.5486 0.0787  -0.0486 0.0639  58  GLY A O   
434  N N   . VAL A 59  ? 0.7087 0.8121 0.5439 0.0712  -0.0531 0.0444  59  VAL A N   
435  C CA  . VAL A 59  ? 0.6944 0.7840 0.5364 0.0699  -0.0419 0.0421  59  VAL A CA  
436  C C   . VAL A 59  ? 0.6818 0.7674 0.5411 0.0631  -0.0446 0.0337  59  VAL A C   
437  O O   . VAL A 59  ? 0.6871 0.7714 0.5417 0.0580  -0.0514 0.0229  59  VAL A O   
438  C CB  . VAL A 59  ? 0.7052 0.7884 0.5283 0.0714  -0.0358 0.0360  59  VAL A CB  
439  C CG1 . VAL A 59  ? 0.6868 0.7601 0.5192 0.0706  -0.0243 0.0349  59  VAL A CG1 
440  C CG2 . VAL A 59  ? 0.7163 0.8047 0.5203 0.0775  -0.0334 0.0446  59  VAL A CG2 
441  N N   . LEU A 60  ? 0.6659 0.7479 0.5436 0.0628  -0.0394 0.0389  60  LEU A N   
442  C CA  . LEU A 60  ? 0.6542 0.7320 0.5486 0.0568  -0.0405 0.0327  60  LEU A CA  
443  C C   . LEU A 60  ? 0.6626 0.7280 0.5533 0.0549  -0.0343 0.0241  60  LEU A C   
444  O O   . LEU A 60  ? 0.6685 0.7291 0.5556 0.0582  -0.0248 0.0273  60  LEU A O   
445  C CB  . LEU A 60  ? 0.6340 0.7114 0.5465 0.0582  -0.0362 0.0410  60  LEU A CB  
446  C CG  . LEU A 60  ? 0.6102 0.6859 0.5409 0.0523  -0.0378 0.0364  60  LEU A CG  
447  C CD1 . LEU A 60  ? 0.5904 0.6761 0.5356 0.0540  -0.0407 0.0436  60  LEU A CD1 
448  C CD2 . LEU A 60  ? 0.5986 0.6617 0.5353 0.0511  -0.0286 0.0347  60  LEU A CD2 
449  N N   . ASP A 61  ? 0.6656 0.7263 0.5568 0.0496  -0.0396 0.0136  61  ASP A N   
450  C CA  . ASP A 61  ? 0.6700 0.7184 0.5593 0.0493  -0.0339 0.0059  61  ASP A CA  
451  C C   . ASP A 61  ? 0.6435 0.6874 0.5518 0.0479  -0.0276 0.0089  61  ASP A C   
452  O O   . ASP A 61  ? 0.6319 0.6766 0.5547 0.0432  -0.0315 0.0094  61  ASP A O   
453  C CB  . ASP A 61  ? 0.6918 0.7318 0.5729 0.0446  -0.0414 -0.0063 61  ASP A CB  
454  C CG  . ASP A 61  ? 0.7327 0.7587 0.6106 0.0467  -0.0351 -0.0140 61  ASP A CG  
455  O OD1 . ASP A 61  ? 0.7309 0.7528 0.6245 0.0454  -0.0308 -0.0126 61  ASP A OD1 
456  O OD2 . ASP A 61  ? 0.7844 0.8044 0.6435 0.0508  -0.0341 -0.0211 61  ASP A OD2 
457  N N   . ALA A 62  ? 0.6280 0.6686 0.5359 0.0515  -0.0179 0.0108  62  ALA A N   
458  C CA  . ALA A 62  ? 0.6027 0.6399 0.5269 0.0498  -0.0119 0.0137  62  ALA A CA  
459  C C   . ALA A 62  ? 0.5999 0.6309 0.5229 0.0514  -0.0066 0.0072  62  ALA A C   
460  O O   . ALA A 62  ? 0.5916 0.6246 0.5197 0.0529  0.0015  0.0110  62  ALA A O   
461  C CB  . ALA A 62  ? 0.5929 0.6338 0.5214 0.0515  -0.0055 0.0245  62  ALA A CB  
462  N N   . THR A 63  ? 0.6039 0.6274 0.5202 0.0510  -0.0115 -0.0026 63  THR A N   
463  C CA  . THR A 63  ? 0.6042 0.6205 0.5159 0.0550  -0.0071 -0.0097 63  THR A CA  
464  C C   . THR A 63  ? 0.5994 0.6053 0.5211 0.0518  -0.0099 -0.0145 63  THR A C   
465  O O   . THR A 63  ? 0.6098 0.6088 0.5290 0.0562  -0.0063 -0.0196 63  THR A O   
466  C CB  . THR A 63  ? 0.6329 0.6442 0.5224 0.0597  -0.0091 -0.0182 63  THR A CB  
467  O OG1 . THR A 63  ? 0.6413 0.6427 0.5247 0.0546  -0.0194 -0.0254 63  THR A OG1 
468  C CG2 . THR A 63  ? 0.6295 0.6514 0.5064 0.0629  -0.0070 -0.0133 63  THR A CG2 
469  N N   . THR A 64  ? 0.5852 0.5904 0.5176 0.0448  -0.0159 -0.0124 64  THR A N   
470  C CA  . THR A 64  ? 0.5799 0.5753 0.5213 0.0407  -0.0187 -0.0157 64  THR A CA  
471  C C   . THR A 64  ? 0.5592 0.5612 0.5189 0.0357  -0.0185 -0.0082 64  THR A C   
472  O O   . THR A 64  ? 0.5517 0.5635 0.5154 0.0344  -0.0195 -0.0021 64  THR A O   
473  C CB  . THR A 64  ? 0.5906 0.5758 0.5235 0.0351  -0.0281 -0.0230 64  THR A CB  
474  O OG1 . THR A 64  ? 0.6026 0.5987 0.5396 0.0294  -0.0342 -0.0188 64  THR A OG1 
475  C CG2 . THR A 64  ? 0.6214 0.5972 0.5327 0.0397  -0.0293 -0.0317 64  THR A CG2 
476  N N   . PHE A 65  ? 0.5494 0.5456 0.5190 0.0339  -0.0171 -0.0086 65  PHE A N   
477  C CA  . PHE A 65  ? 0.5234 0.5247 0.5085 0.0295  -0.0168 -0.0025 65  PHE A CA  
478  C C   . PHE A 65  ? 0.5266 0.5308 0.5147 0.0231  -0.0244 -0.0022 65  PHE A C   
479  O O   . PHE A 65  ? 0.5416 0.5389 0.5223 0.0193  -0.0307 -0.0081 65  PHE A O   
480  C CB  . PHE A 65  ? 0.5062 0.5006 0.4992 0.0290  -0.0142 -0.0033 65  PHE A CB  
481  C CG  . PHE A 65  ? 0.5070 0.5051 0.5026 0.0341  -0.0065 -0.0010 65  PHE A CG  
482  C CD1 . PHE A 65  ? 0.4777 0.4848 0.4798 0.0338  -0.0019 0.0059  65  PHE A CD1 
483  C CD2 . PHE A 65  ? 0.4930 0.4856 0.4841 0.0392  -0.0039 -0.0054 65  PHE A CD2 
484  C CE1 . PHE A 65  ? 0.4701 0.4818 0.4750 0.0362  0.0047  0.0083  65  PHE A CE1 
485  C CE2 . PHE A 65  ? 0.4804 0.4805 0.4756 0.0432  0.0028  -0.0028 65  PHE A CE2 
486  C CZ  . PHE A 65  ? 0.4916 0.5021 0.4941 0.0407  0.0070  0.0041  65  PHE A CZ  
487  N N   . GLN A 66  ? 0.5167 0.5311 0.5155 0.0217  -0.0239 0.0046  66  GLN A N   
488  C CA  . GLN A 66  ? 0.5169 0.5391 0.5214 0.0161  -0.0305 0.0062  66  GLN A CA  
489  C C   . GLN A 66  ? 0.5087 0.5289 0.5249 0.0104  -0.0313 0.0068  66  GLN A C   
490  O O   . GLN A 66  ? 0.4952 0.5064 0.5139 0.0111  -0.0270 0.0059  66  GLN A O   
491  C CB  . GLN A 66  ? 0.5184 0.5543 0.5267 0.0197  -0.0298 0.0135  66  GLN A CB  
492  C CG  . GLN A 66  ? 0.5547 0.5957 0.5508 0.0218  -0.0341 0.0124  66  GLN A CG  
493  C CD  . GLN A 66  ? 0.6008 0.6504 0.5974 0.0153  -0.0438 0.0104  66  GLN A CD  
494  O OE1 . GLN A 66  ? 0.5999 0.6507 0.6059 0.0082  -0.0471 0.0094  66  GLN A OE1 
495  N NE2 . GLN A 66  ? 0.5770 0.6341 0.5636 0.0169  -0.0486 0.0102  66  GLN A NE2 
496  N N   . ASN A 67  ? 0.5067 0.5370 0.5298 0.0044  -0.0369 0.0088  67  ASN A N   
497  C CA  . ASN A 67  ? 0.4959 0.5265 0.5296 -0.0022 -0.0378 0.0102  67  ASN A CA  
498  C C   . ASN A 67  ? 0.4802 0.5102 0.5228 0.0017  -0.0303 0.0146  67  ASN A C   
499  O O   . ASN A 67  ? 0.4654 0.5000 0.5096 0.0082  -0.0254 0.0185  67  ASN A O   
500  C CB  . ASN A 67  ? 0.4944 0.5429 0.5369 -0.0078 -0.0434 0.0139  67  ASN A CB  
501  C CG  . ASN A 67  ? 0.5289 0.5796 0.5628 -0.0138 -0.0523 0.0094  67  ASN A CG  
502  O OD1 . ASN A 67  ? 0.5336 0.5678 0.5559 -0.0183 -0.0558 0.0022  67  ASN A OD1 
503  N ND2 . ASN A 67  ? 0.5349 0.6058 0.5735 -0.0137 -0.0565 0.0135  67  ASN A ND2 
504  N N   . VAL A 68  ? 0.4779 0.5007 0.5248 -0.0030 -0.0298 0.0138  68  VAL A N   
505  C CA  . VAL A 68  ? 0.4622 0.4849 0.5169 -0.0011 -0.0239 0.0175  68  VAL A CA  
506  C C   . VAL A 68  ? 0.4644 0.5023 0.5304 -0.0040 -0.0244 0.0229  68  VAL A C   
507  O O   . VAL A 68  ? 0.4751 0.5214 0.5445 -0.0108 -0.0300 0.0231  68  VAL A O   
508  C CB  . VAL A 68  ? 0.4671 0.4755 0.5196 -0.0040 -0.0234 0.0147  68  VAL A CB  
509  C CG1 . VAL A 68  ? 0.4439 0.4534 0.5039 -0.0031 -0.0183 0.0186  68  VAL A CG1 
510  C CG2 . VAL A 68  ? 0.4675 0.4638 0.5094 0.0013  -0.0221 0.0097  68  VAL A CG2 
511  N N   . CYS A 69  ? 0.4522 0.4947 0.5237 0.0010  -0.0185 0.0271  69  CYS A N   
512  C CA  . CYS A 69  ? 0.4493 0.5069 0.5310 0.0006  -0.0175 0.0322  69  CYS A CA  
513  C C   . CYS A 69  ? 0.4559 0.5143 0.5433 -0.0078 -0.0189 0.0327  69  CYS A C   
514  O O   . CYS A 69  ? 0.4635 0.5078 0.5471 -0.0107 -0.0182 0.0302  69  CYS A O   
515  C CB  . CYS A 69  ? 0.4393 0.4968 0.5221 0.0088  -0.0105 0.0355  69  CYS A CB  
516  S SG  . CYS A 69  ? 0.4671 0.5255 0.5433 0.0180  -0.0094 0.0373  69  CYS A SG  
517  N N   . TYR A 70  ? 0.4611 0.5370 0.5577 -0.0119 -0.0212 0.0365  70  TYR A N   
518  C CA  . TYR A 70  ? 0.4720 0.5498 0.5737 -0.0222 -0.0232 0.0376  70  TYR A CA  
519  C C   . TYR A 70  ? 0.4703 0.5462 0.5756 -0.0213 -0.0169 0.0406  70  TYR A C   
520  O O   . TYR A 70  ? 0.4659 0.5467 0.5731 -0.0128 -0.0111 0.0429  70  TYR A O   
521  C CB  . TYR A 70  ? 0.4714 0.5748 0.5843 -0.0272 -0.0269 0.0421  70  TYR A CB  
522  C CG  . TYR A 70  ? 0.4844 0.5882 0.5990 -0.0420 -0.0333 0.0416  70  TYR A CG  
523  C CD1 . TYR A 70  ? 0.5033 0.6104 0.6151 -0.0493 -0.0418 0.0387  70  TYR A CD1 
524  C CD2 . TYR A 70  ? 0.5067 0.6056 0.6238 -0.0493 -0.0311 0.0439  70  TYR A CD2 
525  C CE1 . TYR A 70  ? 0.5084 0.6119 0.6195 -0.0647 -0.0481 0.0376  70  TYR A CE1 
526  C CE2 . TYR A 70  ? 0.5144 0.6100 0.6314 -0.0639 -0.0368 0.0438  70  TYR A CE2 
527  C CZ  . TYR A 70  ? 0.5379 0.6346 0.6516 -0.0720 -0.0454 0.0404  70  TYR A CZ  
528  O OH  . TYR A 70  ? 0.5813 0.6712 0.6931 -0.0882 -0.0513 0.0402  70  TYR A OH  
529  N N   . GLN A 71  ? 0.4778 0.5431 0.5813 -0.0289 -0.0175 0.0404  71  GLN A N   
530  C CA  . GLN A 71  ? 0.4720 0.5201 0.5692 -0.0259 -0.0134 0.0391  71  GLN A CA  
531  C C   . GLN A 71  ? 0.4923 0.5288 0.5868 -0.0347 -0.0154 0.0397  71  GLN A C   
532  O O   . GLN A 71  ? 0.5000 0.5287 0.5911 -0.0423 -0.0212 0.0377  71  GLN A O   
533  C CB  . GLN A 71  ? 0.4652 0.5009 0.5546 -0.0175 -0.0114 0.0350  71  GLN A CB  
534  C CG  . GLN A 71  ? 0.4393 0.4567 0.5197 -0.0183 -0.0143 0.0303  71  GLN A CG  
535  C CD  . GLN A 71  ? 0.4328 0.4448 0.5083 -0.0100 -0.0112 0.0277  71  GLN A CD  
536  O OE1 . GLN A 71  ? 0.4505 0.4524 0.5219 -0.0077 -0.0095 0.0264  71  GLN A OE1 
537  N NE2 . GLN A 71  ? 0.3944 0.4144 0.4705 -0.0054 -0.0103 0.0278  71  GLN A NE2 
538  N N   . TYR A 72  ? 0.5052 0.5400 0.6003 -0.0339 -0.0108 0.0428  72  TYR A N   
539  C CA  . TYR A 72  ? 0.5306 0.5521 0.6213 -0.0407 -0.0120 0.0444  72  TYR A CA  
540  C C   . TYR A 72  ? 0.5477 0.5467 0.6276 -0.0376 -0.0146 0.0394  72  TYR A C   
541  O O   . TYR A 72  ? 0.5376 0.5333 0.6144 -0.0288 -0.0125 0.0363  72  TYR A O   
542  C CB  . TYR A 72  ? 0.5288 0.5550 0.6212 -0.0389 -0.0060 0.0490  72  TYR A CB  
543  C CG  . TYR A 72  ? 0.5565 0.5678 0.6428 -0.0441 -0.0067 0.0515  72  TYR A CG  
544  C CD1 . TYR A 72  ? 0.5606 0.5584 0.6392 -0.0378 -0.0053 0.0501  72  TYR A CD1 
545  C CD2 . TYR A 72  ? 0.5925 0.6033 0.6802 -0.0557 -0.0092 0.0559  72  TYR A CD2 
546  C CE1 . TYR A 72  ? 0.5837 0.5679 0.6558 -0.0412 -0.0062 0.0532  72  TYR A CE1 
547  C CE2 . TYR A 72  ? 0.6005 0.5949 0.6808 -0.0602 -0.0098 0.0590  72  TYR A CE2 
548  C CZ  . TYR A 72  ? 0.6129 0.5938 0.6852 -0.0521 -0.0083 0.0577  72  TYR A CZ  
549  O OH  . TYR A 72  ? 0.6700 0.6346 0.7341 -0.0551 -0.0091 0.0617  72  TYR A OH  
550  N N   . VAL A 73  ? 0.5801 0.5638 0.6540 -0.0448 -0.0193 0.0388  73  VAL A N   
551  C CA  . VAL A 73  ? 0.6008 0.5617 0.6633 -0.0408 -0.0218 0.0342  73  VAL A CA  
552  C C   . VAL A 73  ? 0.6244 0.5725 0.6822 -0.0410 -0.0203 0.0380  73  VAL A C   
553  O O   . VAL A 73  ? 0.6344 0.5799 0.6925 -0.0502 -0.0211 0.0428  73  VAL A O   
554  C CB  . VAL A 73  ? 0.6159 0.5637 0.6714 -0.0478 -0.0284 0.0301  73  VAL A CB  
555  C CG1 . VAL A 73  ? 0.6106 0.5331 0.6525 -0.0420 -0.0303 0.0252  73  VAL A CG1 
556  C CG2 . VAL A 73  ? 0.6044 0.5667 0.6640 -0.0478 -0.0305 0.0270  73  VAL A CG2 
557  N N   . ASP A 74  ? 0.6407 0.5821 0.6940 -0.0314 -0.0182 0.0364  74  ASP A N   
558  C CA  . ASP A 74  ? 0.6653 0.5959 0.7135 -0.0299 -0.0172 0.0404  74  ASP A CA  
559  C C   . ASP A 74  ? 0.7028 0.6090 0.7405 -0.0339 -0.0215 0.0406  74  ASP A C   
560  O O   . ASP A 74  ? 0.7132 0.6053 0.7436 -0.0306 -0.0246 0.0352  74  ASP A O   
561  C CB  . ASP A 74  ? 0.6565 0.5884 0.7032 -0.0187 -0.0148 0.0385  74  ASP A CB  
562  C CG  . ASP A 74  ? 0.6683 0.5966 0.7119 -0.0169 -0.0134 0.0436  74  ASP A CG  
563  O OD1 . ASP A 74  ? 0.6720 0.5826 0.7072 -0.0152 -0.0159 0.0451  74  ASP A OD1 
564  O OD2 . ASP A 74  ? 0.6722 0.6147 0.7206 -0.0167 -0.0098 0.0461  74  ASP A OD2 
565  N N   . THR A 75  ? 0.7437 0.6437 0.7793 -0.0408 -0.0214 0.0470  75  THR A N   
566  C CA  . THR A 75  ? 0.7957 0.6684 0.8192 -0.0453 -0.0253 0.0485  75  THR A CA  
567  C C   . THR A 75  ? 0.8164 0.6777 0.8332 -0.0420 -0.0239 0.0550  75  THR A C   
568  O O   . THR A 75  ? 0.8447 0.6810 0.8502 -0.0454 -0.0268 0.0577  75  THR A O   
569  C CB  . THR A 75  ? 0.8155 0.6846 0.8395 -0.0615 -0.0286 0.0505  75  THR A CB  
570  O OG1 . THR A 75  ? 0.7983 0.6954 0.8360 -0.0681 -0.0254 0.0548  75  THR A OG1 
571  C CG2 . THR A 75  ? 0.8293 0.6895 0.8488 -0.0635 -0.0336 0.0424  75  THR A CG2 
572  N N   . LEU A 76  ? 0.8080 0.6857 0.8302 -0.0352 -0.0199 0.0575  76  LEU A N   
573  C CA  . LEU A 76  ? 0.8271 0.6968 0.8424 -0.0301 -0.0191 0.0633  76  LEU A CA  
574  C C   . LEU A 76  ? 0.8530 0.6981 0.8561 -0.0205 -0.0223 0.0620  76  LEU A C   
575  O O   . LEU A 76  ? 0.8710 0.6983 0.8645 -0.0208 -0.0236 0.0681  76  LEU A O   
576  C CB  . LEU A 76  ? 0.8039 0.6955 0.8257 -0.0236 -0.0152 0.0642  76  LEU A CB  
577  C CG  . LEU A 76  ? 0.8246 0.7114 0.8393 -0.0189 -0.0149 0.0706  76  LEU A CG  
578  C CD1 . LEU A 76  ? 0.8181 0.6985 0.8281 -0.0290 -0.0139 0.0793  76  LEU A CD1 
579  C CD2 . LEU A 76  ? 0.7949 0.7018 0.8142 -0.0121 -0.0124 0.0695  76  LEU A CD2 
580  N N   . TYR A 77  ? 0.8581 0.7028 0.8613 -0.0111 -0.0233 0.0546  77  TYR A N   
581  C CA  . TYR A 77  ? 0.8807 0.7044 0.8727 0.0007  -0.0256 0.0528  77  TYR A CA  
582  C C   . TYR A 77  ? 0.8917 0.7022 0.8784 0.0025  -0.0279 0.0445  77  TYR A C   
583  O O   . TYR A 77  ? 0.8835 0.7036 0.8732 0.0122  -0.0268 0.0388  77  TYR A O   
584  C CB  . TYR A 77  ? 0.8653 0.7043 0.8612 0.0143  -0.0239 0.0527  77  TYR A CB  
585  C CG  . TYR A 77  ? 0.8595 0.7085 0.8570 0.0146  -0.0227 0.0603  77  TYR A CG  
586  C CD1 . TYR A 77  ? 0.8797 0.7097 0.8664 0.0151  -0.0244 0.0676  77  TYR A CD1 
587  C CD2 . TYR A 77  ? 0.8200 0.6956 0.8277 0.0145  -0.0200 0.0601  77  TYR A CD2 
588  C CE1 . TYR A 77  ? 0.8930 0.7328 0.8796 0.0157  -0.0235 0.0748  77  TYR A CE1 
589  C CE2 . TYR A 77  ? 0.8349 0.7193 0.8421 0.0147  -0.0193 0.0663  77  TYR A CE2 
590  C CZ  . TYR A 77  ? 0.8646 0.7324 0.8615 0.0155  -0.0211 0.0737  77  TYR A CZ  
591  O OH  . TYR A 77  ? 0.8590 0.7360 0.8539 0.0159  -0.0206 0.0801  77  TYR A OH  
592  N N   . PRO A 78  ? 0.9146 0.7031 0.8927 -0.0076 -0.0311 0.0440  78  PRO A N   
593  C CA  . PRO A 78  ? 0.9209 0.6972 0.8929 -0.0090 -0.0338 0.0355  78  PRO A CA  
594  C C   . PRO A 78  ? 0.9270 0.6823 0.8857 0.0063  -0.0348 0.0298  78  PRO A C   
595  O O   . PRO A 78  ? 0.9524 0.6814 0.8979 0.0118  -0.0362 0.0327  78  PRO A O   
596  C CB  . PRO A 78  ? 0.9504 0.7071 0.9153 -0.0258 -0.0376 0.0380  78  PRO A CB  
597  C CG  . PRO A 78  ? 0.9692 0.7132 0.9288 -0.0271 -0.0370 0.0476  78  PRO A CG  
598  C CD  . PRO A 78  ? 0.9334 0.7068 0.9058 -0.0194 -0.0324 0.0518  78  PRO A CD  
599  N N   . GLY A 79  ? 0.8964 0.6631 0.8578 0.0138  -0.0336 0.0222  79  GLY A N   
600  C CA  . GLY A 79  ? 0.8805 0.6316 0.8300 0.0300  -0.0334 0.0163  79  GLY A CA  
601  C C   . GLY A 79  ? 0.8335 0.6073 0.7920 0.0453  -0.0292 0.0181  79  GLY A C   
602  O O   . GLY A 79  ? 0.8308 0.6031 0.7844 0.0596  -0.0277 0.0134  79  GLY A O   
603  N N   . PHE A 80  ? 0.7822 0.5782 0.7537 0.0414  -0.0275 0.0248  80  PHE A N   
604  C CA  . PHE A 80  ? 0.7418 0.5604 0.7223 0.0523  -0.0246 0.0277  80  PHE A CA  
605  C C   . PHE A 80  ? 0.7106 0.5576 0.7035 0.0526  -0.0215 0.0235  80  PHE A C   
606  O O   . PHE A 80  ? 0.6865 0.5466 0.6877 0.0415  -0.0209 0.0233  80  PHE A O   
607  C CB  . PHE A 80  ? 0.7301 0.5567 0.7161 0.0465  -0.0246 0.0362  80  PHE A CB  
608  C CG  . PHE A 80  ? 0.6975 0.5502 0.6936 0.0542  -0.0225 0.0393  80  PHE A CG  
609  C CD1 . PHE A 80  ? 0.6758 0.5290 0.6688 0.0696  -0.0226 0.0405  80  PHE A CD1 
610  C CD2 . PHE A 80  ? 0.6652 0.5422 0.6734 0.0458  -0.0206 0.0411  80  PHE A CD2 
611  C CE1 . PHE A 80  ? 0.6584 0.5380 0.6612 0.0751  -0.0215 0.0435  80  PHE A CE1 
612  C CE2 . PHE A 80  ? 0.6480 0.5475 0.6639 0.0510  -0.0194 0.0434  80  PHE A CE2 
613  C CZ  . PHE A 80  ? 0.6474 0.5497 0.6613 0.0648  -0.0202 0.0447  80  PHE A CZ  
614  N N   . GLU A 81  ? 0.7030 0.5601 0.6970 0.0659  -0.0193 0.0209  81  GLU A N   
615  C CA  . GLU A 81  ? 0.6860 0.5671 0.6895 0.0666  -0.0162 0.0172  81  GLU A CA  
616  C C   . GLU A 81  ? 0.6436 0.5509 0.6614 0.0590  -0.0144 0.0212  81  GLU A C   
617  O O   . GLU A 81  ? 0.6140 0.5351 0.6384 0.0532  -0.0126 0.0188  81  GLU A O   
618  C CB  . GLU A 81  ? 0.6988 0.5864 0.7003 0.0826  -0.0138 0.0144  81  GLU A CB  
619  C CG  . GLU A 81  ? 0.7464 0.6653 0.7606 0.0833  -0.0099 0.0136  81  GLU A CG  
620  C CD  . GLU A 81  ? 0.8616 0.7823 0.8710 0.0915  -0.0070 0.0072  81  GLU A CD  
621  O OE1 . GLU A 81  ? 0.9209 0.8209 0.9169 0.1018  -0.0076 0.0034  81  GLU A OE1 
622  O OE2 . GLU A 81  ? 0.8521 0.7934 0.8695 0.0877  -0.0041 0.0061  81  GLU A OE2 
623  N N   . GLY A 82  ? 0.6314 0.5436 0.6522 0.0592  -0.0152 0.0271  82  GLY A N   
624  C CA  . GLY A 82  ? 0.5966 0.5302 0.6280 0.0524  -0.0138 0.0303  82  GLY A CA  
625  C C   . GLY A 82  ? 0.5760 0.5099 0.6105 0.0395  -0.0133 0.0299  82  GLY A C   
626  O O   . GLY A 82  ? 0.5582 0.5087 0.6003 0.0347  -0.0113 0.0301  82  GLY A O   
627  N N   . THR A 83  ? 0.5808 0.4961 0.6088 0.0339  -0.0153 0.0296  83  THR A N   
628  C CA  . THR A 83  ? 0.5691 0.4871 0.6009 0.0225  -0.0149 0.0295  83  THR A CA  
629  C C   . THR A 83  ? 0.5743 0.4897 0.6048 0.0210  -0.0154 0.0238  83  THR A C   
630  O O   . THR A 83  ? 0.5630 0.4913 0.5999 0.0163  -0.0138 0.0227  83  THR A O   
631  C CB  . THR A 83  ? 0.5752 0.4798 0.6029 0.0142  -0.0168 0.0341  83  THR A CB  
632  O OG1 . THR A 83  ? 0.6133 0.4939 0.6299 0.0168  -0.0199 0.0332  83  THR A OG1 
633  C CG2 . THR A 83  ? 0.5494 0.4602 0.5787 0.0139  -0.0159 0.0403  83  THR A CG2 
634  N N   . GLU A 84  ? 0.5967 0.4945 0.6175 0.0256  -0.0176 0.0201  84  GLU A N   
635  C CA  . GLU A 84  ? 0.6077 0.5011 0.6246 0.0235  -0.0188 0.0143  84  GLU A CA  
636  C C   . GLU A 84  ? 0.5845 0.4966 0.6071 0.0282  -0.0156 0.0114  84  GLU A C   
637  O O   . GLU A 84  ? 0.5933 0.5099 0.6166 0.0239  -0.0159 0.0086  84  GLU A O   
638  C CB  . GLU A 84  ? 0.6405 0.5085 0.6428 0.0281  -0.0218 0.0098  84  GLU A CB  
639  C CG  . GLU A 84  ? 0.7115 0.5551 0.7052 0.0210  -0.0257 0.0124  84  GLU A CG  
640  C CD  . GLU A 84  ? 0.7814 0.6242 0.7771 0.0054  -0.0287 0.0129  84  GLU A CD  
641  O OE1 . GLU A 84  ? 0.8007 0.6601 0.8033 0.0012  -0.0283 0.0105  84  GLU A OE1 
642  O OE2 . GLU A 84  ? 0.8210 0.6471 0.8114 -0.0029 -0.0315 0.0162  84  GLU A OE2 
643  N N   . MET A 85  ? 0.5630 0.4877 0.5901 0.0359  -0.0125 0.0127  85  MET A N   
644  C CA  . MET A 85  ? 0.5358 0.4784 0.5683 0.0384  -0.0091 0.0109  85  MET A CA  
645  C C   . MET A 85  ? 0.5187 0.4736 0.5589 0.0296  -0.0079 0.0127  85  MET A C   
646  O O   . MET A 85  ? 0.5109 0.4758 0.5530 0.0300  -0.0057 0.0112  85  MET A O   
647  C CB  . MET A 85  ? 0.5289 0.4854 0.5662 0.0462  -0.0064 0.0128  85  MET A CB  
648  C CG  . MET A 85  ? 0.5138 0.4808 0.5589 0.0416  -0.0061 0.0179  85  MET A CG  
649  S SD  . MET A 85  ? 0.5055 0.4905 0.5561 0.0501  -0.0044 0.0201  85  MET A SD  
650  C CE  . MET A 85  ? 0.4708 0.4740 0.5267 0.0491  -0.0002 0.0179  85  MET A CE  
651  N N   . TRP A 86  ? 0.5059 0.4597 0.5495 0.0224  -0.0089 0.0164  86  TRP A N   
652  C CA  . TRP A 86  ? 0.4823 0.4469 0.5322 0.0162  -0.0072 0.0182  86  TRP A CA  
653  C C   . TRP A 86  ? 0.4855 0.4460 0.5347 0.0099  -0.0096 0.0176  86  TRP A C   
654  O O   . TRP A 86  ? 0.4661 0.4360 0.5200 0.0065  -0.0084 0.0188  86  TRP A O   
655  C CB  . TRP A 86  ? 0.4730 0.4431 0.5274 0.0133  -0.0057 0.0225  86  TRP A CB  
656  C CG  . TRP A 86  ? 0.4689 0.4452 0.5245 0.0181  -0.0045 0.0234  86  TRP A CG  
657  C CD1 . TRP A 86  ? 0.4628 0.4355 0.5165 0.0208  -0.0060 0.0258  86  TRP A CD1 
658  C CD2 . TRP A 86  ? 0.4645 0.4531 0.5234 0.0203  -0.0019 0.0225  86  TRP A CD2 
659  N NE1 . TRP A 86  ? 0.4620 0.4463 0.5187 0.0248  -0.0049 0.0263  86  TRP A NE1 
660  C CE2 . TRP A 86  ? 0.4496 0.4438 0.5097 0.0237  -0.0023 0.0242  86  TRP A CE2 
661  C CE3 . TRP A 86  ? 0.4452 0.4406 0.5057 0.0191  0.0006  0.0210  86  TRP A CE3 
662  C CZ2 . TRP A 86  ? 0.4447 0.4531 0.5088 0.0249  -0.0005 0.0242  86  TRP A CZ2 
663  C CZ3 . TRP A 86  ? 0.4499 0.4567 0.5132 0.0200  0.0028  0.0213  86  TRP A CZ3 
664  C CH2 . TRP A 86  ? 0.4602 0.4743 0.5259 0.0222  0.0022  0.0227  86  TRP A CH2 
665  N N   . ASN A 87  ? 0.4969 0.4432 0.5396 0.0083  -0.0134 0.0158  87  ASN A N   
666  C CA  . ASN A 87  ? 0.5127 0.4559 0.5548 0.0004  -0.0167 0.0154  87  ASN A CA  
667  C C   . ASN A 87  ? 0.5175 0.4653 0.5575 0.0012  -0.0179 0.0114  87  ASN A C   
668  O O   . ASN A 87  ? 0.5213 0.4696 0.5574 0.0083  -0.0162 0.0082  87  ASN A O   
669  C CB  . ASN A 87  ? 0.5365 0.4599 0.5705 -0.0032 -0.0208 0.0148  87  ASN A CB  
670  C CG  . ASN A 87  ? 0.5497 0.4716 0.5872 -0.0090 -0.0205 0.0209  87  ASN A CG  
671  O OD1 . ASN A 87  ? 0.5657 0.5026 0.6117 -0.0108 -0.0173 0.0249  87  ASN A OD1 
672  N ND2 . ASN A 87  ? 0.5167 0.4190 0.5461 -0.0119 -0.0235 0.0217  87  ASN A ND2 
673  N N   . PRO A 88  ? 0.5183 0.4717 0.5610 -0.0060 -0.0207 0.0120  88  PRO A N   
674  C CA  . PRO A 88  ? 0.5143 0.4729 0.5540 -0.0051 -0.0225 0.0086  88  PRO A CA  
675  C C   . PRO A 88  ? 0.5370 0.4803 0.5638 -0.0020 -0.0254 0.0021  88  PRO A C   
676  O O   . PRO A 88  ? 0.5548 0.4810 0.5744 -0.0053 -0.0288 -0.0001 88  PRO A O   
677  C CB  . PRO A 88  ? 0.5036 0.4704 0.5485 -0.0144 -0.0263 0.0108  88  PRO A CB  
678  C CG  . PRO A 88  ? 0.4973 0.4709 0.5515 -0.0176 -0.0235 0.0167  88  PRO A CG  
679  C CD  . PRO A 88  ? 0.5142 0.4737 0.5641 -0.0147 -0.0218 0.0166  88  PRO A CD  
680  N N   . ASN A 89  ? 0.5379 0.4861 0.5605 0.0043  -0.0238 -0.0008 89  ASN A N   
681  C CA  . ASN A 89  ? 0.5533 0.4885 0.5622 0.0090  -0.0255 -0.0075 89  ASN A CA  
682  C C   . ASN A 89  ? 0.5616 0.5005 0.5643 0.0060  -0.0296 -0.0109 89  ASN A C   
683  O O   . ASN A 89  ? 0.5864 0.5165 0.5763 0.0105  -0.0306 -0.0168 89  ASN A O   
684  C CB  . ASN A 89  ? 0.5431 0.4806 0.5501 0.0201  -0.0198 -0.0085 89  ASN A CB  
685  C CG  . ASN A 89  ? 0.5480 0.5041 0.5609 0.0230  -0.0154 -0.0055 89  ASN A CG  
686  O OD1 . ASN A 89  ? 0.5247 0.4912 0.5446 0.0181  -0.0158 -0.0017 89  ASN A OD1 
687  N ND2 . ASN A 89  ? 0.5517 0.5117 0.5613 0.0312  -0.0108 -0.0068 89  ASN A ND2 
688  N N   . ARG A 90  ? 0.5523 0.5052 0.5636 -0.0007 -0.0318 -0.0070 90  ARG A N   
689  C CA  . ARG A 90  ? 0.5574 0.5154 0.5637 -0.0055 -0.0375 -0.0093 90  ARG A CA  
690  C C   . ARG A 90  ? 0.5434 0.5081 0.5581 -0.0169 -0.0426 -0.0061 90  ARG A C   
691  O O   . ARG A 90  ? 0.5299 0.4960 0.5540 -0.0201 -0.0406 -0.0016 90  ARG A O   
692  C CB  . ARG A 90  ? 0.5514 0.5263 0.5601 0.0001  -0.0347 -0.0066 90  ARG A CB  
693  C CG  . ARG A 90  ? 0.5746 0.5473 0.5767 0.0102  -0.0288 -0.0083 90  ARG A CG  
694  C CD  . ARG A 90  ? 0.6336 0.5917 0.6191 0.0137  -0.0308 -0.0163 90  ARG A CD  
695  N NE  . ARG A 90  ? 0.7084 0.6728 0.6848 0.0147  -0.0333 -0.0184 90  ARG A NE  
696  C CZ  . ARG A 90  ? 0.7936 0.7467 0.7537 0.0145  -0.0378 -0.0260 90  ARG A CZ  
697  N NH1 . ARG A 90  ? 0.7884 0.7493 0.7400 0.0153  -0.0404 -0.0273 90  ARG A NH1 
698  N NH2 . ARG A 90  ? 0.8504 0.7828 0.8012 0.0139  -0.0399 -0.0323 90  ARG A NH2 
699  N N   . GLU A 91  ? 0.5500 0.5204 0.5613 -0.0232 -0.0492 -0.0080 91  GLU A N   
700  C CA  . GLU A 91  ? 0.5539 0.5370 0.5755 -0.0344 -0.0540 -0.0039 91  GLU A CA  
701  C C   . GLU A 91  ? 0.5269 0.5313 0.5655 -0.0317 -0.0489 0.0045  91  GLU A C   
702  O O   . GLU A 91  ? 0.5209 0.5353 0.5624 -0.0225 -0.0442 0.0071  91  GLU A O   
703  C CB  . GLU A 91  ? 0.5705 0.5629 0.5872 -0.0401 -0.0617 -0.0065 91  GLU A CB  
704  C CG  . GLU A 91  ? 0.6125 0.6194 0.6394 -0.0537 -0.0681 -0.0030 91  GLU A CG  
705  C CD  . GLU A 91  ? 0.6699 0.6935 0.6946 -0.0582 -0.0760 -0.0042 91  GLU A CD  
706  O OE1 . GLU A 91  ? 0.6620 0.6765 0.6715 -0.0537 -0.0784 -0.0104 91  GLU A OE1 
707  O OE2 . GLU A 91  ? 0.6833 0.7308 0.7215 -0.0656 -0.0798 0.0014  91  GLU A OE2 
708  N N   . LEU A 92  ? 0.5156 0.5255 0.5644 -0.0397 -0.0494 0.0088  92  LEU A N   
709  C CA  . LEU A 92  ? 0.4930 0.5240 0.5570 -0.0378 -0.0451 0.0164  92  LEU A CA  
710  C C   . LEU A 92  ? 0.4925 0.5477 0.5639 -0.0406 -0.0496 0.0195  92  LEU A C   
711  O O   . LEU A 92  ? 0.5067 0.5669 0.5783 -0.0517 -0.0570 0.0184  92  LEU A O   
712  C CB  . LEU A 92  ? 0.4913 0.5204 0.5624 -0.0451 -0.0435 0.0201  92  LEU A CB  
713  C CG  . LEU A 92  ? 0.5007 0.5087 0.5658 -0.0412 -0.0389 0.0186  92  LEU A CG  
714  C CD1 . LEU A 92  ? 0.5010 0.5071 0.5714 -0.0495 -0.0382 0.0229  92  LEU A CD1 
715  C CD2 . LEU A 92  ? 0.4731 0.4852 0.5409 -0.0290 -0.0314 0.0204  92  LEU A CD2 
716  N N   . SER A 93  ? 0.4756 0.5453 0.5524 -0.0306 -0.0455 0.0235  93  SER A N   
717  C CA  . SER A 93  ? 0.4656 0.5609 0.5508 -0.0302 -0.0488 0.0280  93  SER A CA  
718  C C   . SER A 93  ? 0.4487 0.5573 0.5427 -0.0188 -0.0415 0.0345  93  SER A C   
719  O O   . SER A 93  ? 0.4388 0.5347 0.5287 -0.0107 -0.0348 0.0343  93  SER A O   
720  C CB  . SER A 93  ? 0.4771 0.5721 0.5515 -0.0285 -0.0547 0.0240  93  SER A CB  
721  O OG  . SER A 93  ? 0.4728 0.5929 0.5542 -0.0251 -0.0575 0.0292  93  SER A OG  
722  N N   . GLU A 94  ? 0.4456 0.5799 0.5514 -0.0183 -0.0430 0.0403  94  GLU A N   
723  C CA  . GLU A 94  ? 0.4319 0.5779 0.5440 -0.0059 -0.0365 0.0463  94  GLU A CA  
724  C C   . GLU A 94  ? 0.4381 0.5810 0.5413 0.0043  -0.0367 0.0464  94  GLU A C   
725  O O   . GLU A 94  ? 0.4393 0.5797 0.5415 0.0158  -0.0303 0.0498  94  GLU A O   
726  C CB  . GLU A 94  ? 0.4262 0.6028 0.5537 -0.0067 -0.0378 0.0529  94  GLU A CB  
727  C CG  . GLU A 94  ? 0.4250 0.6066 0.5620 -0.0100 -0.0325 0.0558  94  GLU A CG  
728  C CD  . GLU A 94  ? 0.4419 0.6578 0.5951 -0.0106 -0.0334 0.0627  94  GLU A CD  
729  O OE1 . GLU A 94  ? 0.4540 0.6849 0.6136 -0.0236 -0.0409 0.0631  94  GLU A OE1 
730  O OE2 . GLU A 94  ? 0.4548 0.6830 0.6140 0.0018  -0.0267 0.0678  94  GLU A OE2 
731  N N   . ASP A 95  ? 0.4424 0.5841 0.5378 -0.0003 -0.0440 0.0426  95  ASP A N   
732  C CA  . ASP A 95  ? 0.4494 0.5846 0.5330 0.0077  -0.0444 0.0419  95  ASP A CA  
733  C C   . ASP A 95  ? 0.4496 0.5580 0.5215 0.0091  -0.0394 0.0367  95  ASP A C   
734  O O   . ASP A 95  ? 0.4616 0.5579 0.5239 0.0036  -0.0430 0.0304  95  ASP A O   
735  C CB  . ASP A 95  ? 0.4624 0.6068 0.5406 0.0014  -0.0544 0.0391  95  ASP A CB  
736  C CG  . ASP A 95  ? 0.4790 0.6201 0.5445 0.0100  -0.0551 0.0394  95  ASP A CG  
737  O OD1 . ASP A 95  ? 0.4861 0.6153 0.5464 0.0195  -0.0477 0.0415  95  ASP A OD1 
738  O OD2 . ASP A 95  ? 0.5179 0.6683 0.5777 0.0066  -0.0633 0.0378  95  ASP A OD2 
739  N N   . CYS A 96  ? 0.4374 0.5369 0.5093 0.0168  -0.0313 0.0393  96  CYS A N   
740  C CA  . CYS A 96  ? 0.4399 0.5184 0.5043 0.0168  -0.0264 0.0352  96  CYS A CA  
741  C C   . CYS A 96  ? 0.4384 0.5074 0.4966 0.0257  -0.0195 0.0380  96  CYS A C   
742  O O   . CYS A 96  ? 0.4424 0.4969 0.4957 0.0254  -0.0152 0.0353  96  CYS A O   
743  C CB  . CYS A 96  ? 0.4373 0.5107 0.5087 0.0115  -0.0238 0.0340  96  CYS A CB  
744  S SG  . CYS A 96  ? 0.4334 0.5152 0.5152 0.0172  -0.0173 0.0403  96  CYS A SG  
745  N N   . LEU A 97  ? 0.4310 0.5083 0.4892 0.0333  -0.0187 0.0437  97  LEU A N   
746  C CA  . LEU A 97  ? 0.4282 0.4945 0.4797 0.0409  -0.0123 0.0472  97  LEU A CA  
747  C C   . LEU A 97  ? 0.4360 0.4945 0.4747 0.0422  -0.0125 0.0463  97  LEU A C   
748  O O   . LEU A 97  ? 0.4459 0.5095 0.4787 0.0475  -0.0144 0.0503  97  LEU A O   
749  C CB  . LEU A 97  ? 0.4325 0.5077 0.4882 0.0498  -0.0106 0.0541  97  LEU A CB  
750  C CG  . LEU A 97  ? 0.4168 0.4994 0.4842 0.0496  -0.0084 0.0550  97  LEU A CG  
751  C CD1 . LEU A 97  ? 0.3874 0.4770 0.4574 0.0609  -0.0051 0.0615  97  LEU A CD1 
752  C CD2 . LEU A 97  ? 0.4129 0.4790 0.4792 0.0454  -0.0030 0.0512  97  LEU A CD2 
753  N N   . TYR A 98  ? 0.4319 0.4793 0.4663 0.0377  -0.0104 0.0414  98  TYR A N   
754  C CA  . TYR A 98  ? 0.4368 0.4787 0.4596 0.0383  -0.0098 0.0399  98  TYR A CA  
755  C C   . TYR A 98  ? 0.4276 0.4575 0.4484 0.0374  -0.0030 0.0395  98  TYR A C   
756  O O   . TYR A 98  ? 0.4143 0.4401 0.4420 0.0348  -0.0006 0.0383  98  TYR A O   
757  C CB  . TYR A 98  ? 0.4447 0.4890 0.4642 0.0335  -0.0156 0.0330  98  TYR A CB  
758  C CG  . TYR A 98  ? 0.4572 0.5149 0.4785 0.0321  -0.0236 0.0332  98  TYR A CG  
759  C CD1 . TYR A 98  ? 0.4712 0.5350 0.4827 0.0350  -0.0276 0.0342  98  TYR A CD1 
760  C CD2 . TYR A 98  ? 0.4484 0.5140 0.4809 0.0276  -0.0272 0.0329  98  TYR A CD2 
761  C CE1 . TYR A 98  ? 0.4646 0.5429 0.4780 0.0329  -0.0358 0.0345  98  TYR A CE1 
762  C CE2 . TYR A 98  ? 0.4610 0.5420 0.4964 0.0250  -0.0349 0.0335  98  TYR A CE2 
763  C CZ  . TYR A 98  ? 0.4535 0.5409 0.4795 0.0275  -0.0395 0.0341  98  TYR A CZ  
764  O OH  . TYR A 98  ? 0.4504 0.5552 0.4798 0.0241  -0.0479 0.0348  98  TYR A OH  
765  N N   . LEU A 99  ? 0.4431 0.4687 0.4543 0.0390  0.0002  0.0410  99  LEU A N   
766  C CA  . LEU A 99  ? 0.4428 0.4603 0.4526 0.0367  0.0064  0.0408  99  LEU A CA  
767  C C   . LEU A 99  ? 0.4590 0.4781 0.4611 0.0362  0.0076  0.0378  99  LEU A C   
768  O O   . LEU A 99  ? 0.4606 0.4846 0.4555 0.0384  0.0039  0.0362  99  LEU A O   
769  C CB  . LEU A 99  ? 0.4414 0.4505 0.4479 0.0384  0.0115  0.0475  99  LEU A CB  
770  C CG  . LEU A 99  ? 0.4556 0.4627 0.4517 0.0431  0.0125  0.0542  99  LEU A CG  
771  C CD1 . LEU A 99  ? 0.4451 0.4524 0.4321 0.0414  0.0156  0.0548  99  LEU A CD1 
772  C CD2 . LEU A 99  ? 0.4336 0.4283 0.4273 0.0453  0.0167  0.0602  99  LEU A CD2 
773  N N   . ASN A 100 ? 0.4586 0.4751 0.4622 0.0335  0.0126  0.0370  100 ASN A N   
774  C CA  . ASN A 100 ? 0.4621 0.4825 0.4604 0.0338  0.0151  0.0342  100 ASN A CA  
775  C C   . ASN A 100 ? 0.4734 0.4938 0.4689 0.0316  0.0220  0.0394  100 ASN A C   
776  O O   . ASN A 100 ? 0.4781 0.4934 0.4784 0.0276  0.0248  0.0426  100 ASN A O   
777  C CB  . ASN A 100 ? 0.4558 0.4768 0.4605 0.0327  0.0140  0.0277  100 ASN A CB  
778  C CG  . ASN A 100 ? 0.4633 0.4818 0.4721 0.0322  0.0075  0.0236  100 ASN A CG  
779  O OD1 . ASN A 100 ? 0.4688 0.4884 0.4720 0.0335  0.0027  0.0212  100 ASN A OD1 
780  N ND2 . ASN A 100 ? 0.4328 0.4485 0.4510 0.0293  0.0072  0.0230  100 ASN A ND2 
781  N N   . VAL A 101 ? 0.4794 0.5056 0.4664 0.0335  0.0248  0.0401  101 VAL A N   
782  C CA  . VAL A 101 ? 0.4782 0.5066 0.4624 0.0302  0.0316  0.0457  101 VAL A CA  
783  C C   . VAL A 101 ? 0.4917 0.5321 0.4748 0.0319  0.0351  0.0423  101 VAL A C   
784  O O   . VAL A 101 ? 0.4987 0.5428 0.4739 0.0375  0.0335  0.0383  101 VAL A O   
785  C CB  . VAL A 101 ? 0.4947 0.5193 0.4674 0.0315  0.0330  0.0530  101 VAL A CB  
786  C CG1 . VAL A 101 ? 0.4909 0.5173 0.4601 0.0262  0.0404  0.0595  101 VAL A CG1 
787  C CG2 . VAL A 101 ? 0.4720 0.4854 0.4454 0.0323  0.0299  0.0567  101 VAL A CG2 
788  N N   . TRP A 102 ? 0.4892 0.5361 0.4796 0.0274  0.0398  0.0437  102 TRP A N   
789  C CA  . TRP A 102 ? 0.4994 0.5611 0.4894 0.0296  0.0447  0.0424  102 TRP A CA  
790  C C   . TRP A 102 ? 0.5155 0.5838 0.5036 0.0231  0.0515  0.0507  102 TRP A C   
791  O O   . TRP A 102 ? 0.5052 0.5683 0.4984 0.0147  0.0526  0.0554  102 TRP A O   
792  C CB  . TRP A 102 ? 0.4885 0.5575 0.4906 0.0296  0.0446  0.0380  102 TRP A CB  
793  C CG  . TRP A 102 ? 0.4887 0.5522 0.4917 0.0362  0.0392  0.0299  102 TRP A CG  
794  C CD1 . TRP A 102 ? 0.4944 0.5623 0.4927 0.0445  0.0393  0.0239  102 TRP A CD1 
795  C CD2 . TRP A 102 ? 0.4725 0.5241 0.4806 0.0346  0.0332  0.0272  102 TRP A CD2 
796  N NE1 . TRP A 102 ? 0.5221 0.5790 0.5216 0.0473  0.0333  0.0177  102 TRP A NE1 
797  C CE2 . TRP A 102 ? 0.4917 0.5402 0.4979 0.0409  0.0295  0.0200  102 TRP A CE2 
798  C CE3 . TRP A 102 ? 0.4710 0.5137 0.4840 0.0289  0.0309  0.0302  102 TRP A CE3 
799  C CZ2 . TRP A 102 ? 0.4808 0.5186 0.4907 0.0401  0.0236  0.0165  102 TRP A CZ2 
800  C CZ3 . TRP A 102 ? 0.4492 0.4838 0.4666 0.0293  0.0255  0.0265  102 TRP A CZ3 
801  C CH2 . TRP A 102 ? 0.4620 0.4948 0.4783 0.0341  0.0219  0.0202  102 TRP A CH2 
802  N N   . THR A 103 ? 0.5292 0.6082 0.5088 0.0264  0.0562  0.0526  103 THR A N   
803  C CA  . THR A 103 ? 0.5511 0.6388 0.5288 0.0194  0.0634  0.0611  103 THR A CA  
804  C C   . THR A 103 ? 0.5565 0.6667 0.5350 0.0237  0.0695  0.0597  103 THR A C   
805  O O   . THR A 103 ? 0.5596 0.6737 0.5347 0.0339  0.0680  0.0523  103 THR A O   
806  C CB  . THR A 103 ? 0.5677 0.6450 0.5309 0.0184  0.0644  0.0682  103 THR A CB  
807  O OG1 . THR A 103 ? 0.6031 0.6879 0.5546 0.0270  0.0654  0.0661  103 THR A OG1 
808  C CG2 . THR A 103 ? 0.5695 0.6269 0.5301 0.0196  0.0577  0.0680  103 THR A CG2 
809  N N   . PRO A 104 ? 0.5641 0.6892 0.5467 0.0159  0.0765  0.0669  104 PRO A N   
810  C CA  . PRO A 104 ? 0.5775 0.7274 0.5603 0.0206  0.0836  0.0671  104 PRO A CA  
811  C C   . PRO A 104 ? 0.5965 0.7457 0.5620 0.0302  0.0854  0.0657  104 PRO A C   
812  O O   . PRO A 104 ? 0.6048 0.7369 0.5585 0.0299  0.0820  0.0679  104 PRO A O   
813  C CB  . PRO A 104 ? 0.5845 0.7465 0.5718 0.0072  0.0903  0.0777  104 PRO A CB  
814  C CG  . PRO A 104 ? 0.5710 0.7192 0.5674 -0.0035 0.0857  0.0789  104 PRO A CG  
815  C CD  . PRO A 104 ? 0.5679 0.6893 0.5574 0.0019  0.0779  0.0740  104 PRO A CD  
816  N N   . TYR A 105 ? 0.6044 0.7724 0.5679 0.0396  0.0903  0.0619  105 TYR A N   
817  C CA  . TYR A 105 ? 0.6280 0.7975 0.5733 0.0488  0.0930  0.0601  105 TYR A CA  
818  C C   . TYR A 105 ? 0.6525 0.8494 0.5974 0.0486  0.1041  0.0664  105 TYR A C   
819  O O   . TYR A 105 ? 0.6544 0.8727 0.6112 0.0518  0.1087  0.0649  105 TYR A O   
820  C CB  . TYR A 105 ? 0.6218 0.7844 0.5608 0.0625  0.0882  0.0476  105 TYR A CB  
821  C CG  . TYR A 105 ? 0.6197 0.7810 0.5373 0.0726  0.0896  0.0434  105 TYR A CG  
822  C CD1 . TYR A 105 ? 0.6056 0.7463 0.5100 0.0754  0.0812  0.0381  105 TYR A CD1 
823  C CD2 . TYR A 105 ? 0.6175 0.7998 0.5281 0.0796  0.0991  0.0443  105 TYR A CD2 
824  C CE1 . TYR A 105 ? 0.6065 0.7455 0.4897 0.0840  0.0814  0.0334  105 TYR A CE1 
825  C CE2 . TYR A 105 ? 0.6315 0.8114 0.5200 0.0895  0.1002  0.0394  105 TYR A CE2 
826  C CZ  . TYR A 105 ? 0.6215 0.7787 0.4959 0.0912  0.0909  0.0338  105 TYR A CZ  
827  O OH  . TYR A 105 ? 0.6181 0.7723 0.4696 0.0998  0.0910  0.0285  105 TYR A OH  
828  N N   . PRO A 106 ? 0.6749 0.8727 0.6063 0.0449  0.1087  0.0746  106 PRO A N   
829  C CA  . PRO A 106 ? 0.6881 0.8627 0.6063 0.0411  0.1036  0.0786  106 PRO A CA  
830  C C   . PRO A 106 ? 0.6856 0.8463 0.6142 0.0274  0.1004  0.0854  106 PRO A C   
831  O O   . PRO A 106 ? 0.6758 0.8479 0.6196 0.0187  0.1036  0.0887  106 PRO A O   
832  C CB  . PRO A 106 ? 0.7064 0.8923 0.6090 0.0406  0.1119  0.0872  106 PRO A CB  
833  C CG  . PRO A 106 ? 0.7060 0.9210 0.6205 0.0364  0.1220  0.0920  106 PRO A CG  
834  C CD  . PRO A 106 ? 0.6892 0.9138 0.6171 0.0453  0.1200  0.0811  106 PRO A CD  
835  N N   . ARG A 107 ? 0.7011 0.8381 0.6212 0.0261  0.0939  0.0872  107 ARG A N   
836  C CA  . ARG A 107 ? 0.7132 0.8323 0.6394 0.0152  0.0908  0.0931  107 ARG A CA  
837  C C   . ARG A 107 ? 0.7345 0.8601 0.6628 0.0017  0.0985  0.1046  107 ARG A C   
838  O O   . ARG A 107 ? 0.7524 0.8903 0.6711 0.0005  0.1058  0.1117  107 ARG A O   
839  C CB  . ARG A 107 ? 0.7193 0.8152 0.6324 0.0183  0.0845  0.0953  107 ARG A CB  
840  C CG  . ARG A 107 ? 0.7341 0.8216 0.6482 0.0278  0.0754  0.0846  107 ARG A CG  
841  C CD  . ARG A 107 ? 0.7648 0.8323 0.6712 0.0295  0.0687  0.0877  107 ARG A CD  
842  N NE  . ARG A 107 ? 0.7951 0.8603 0.6831 0.0324  0.0703  0.0953  107 ARG A NE  
843  C CZ  . ARG A 107 ? 0.8053 0.8759 0.6806 0.0412  0.0674  0.0914  107 ARG A CZ  
844  N NH1 . ARG A 107 ? 0.7989 0.8756 0.6775 0.0474  0.0631  0.0795  107 ARG A NH1 
845  N NH2 . ARG A 107 ? 0.8245 0.8930 0.6824 0.0436  0.0686  0.0993  107 ARG A NH2 
846  N N   . PRO A 108 ? 0.7355 0.8525 0.6754 -0.0093 0.0968  0.1066  108 PRO A N   
847  C CA  . PRO A 108 ? 0.7505 0.8727 0.6948 -0.0252 0.1029  0.1163  108 PRO A CA  
848  C C   . PRO A 108 ? 0.7844 0.8954 0.7115 -0.0313 0.1077  0.1286  108 PRO A C   
849  O O   . PRO A 108 ? 0.7910 0.8799 0.7041 -0.0253 0.1038  0.1304  108 PRO A O   
850  C CB  . PRO A 108 ? 0.7415 0.8440 0.6946 -0.0334 0.0971  0.1144  108 PRO A CB  
851  C CG  . PRO A 108 ? 0.7164 0.8145 0.6756 -0.0216 0.0896  0.1029  108 PRO A CG  
852  C CD  . PRO A 108 ? 0.7158 0.8150 0.6634 -0.0076 0.0884  0.0995  108 PRO A CD  
853  N N   . ALA A 109 ? 0.8037 0.9308 0.7324 -0.0432 0.1159  0.1375  109 ALA A N   
854  C CA  . ALA A 109 ? 0.8387 0.9559 0.7514 -0.0519 0.1215  0.1510  109 ALA A CA  
855  C C   . ALA A 109 ? 0.8520 0.9337 0.7582 -0.0630 0.1180  0.1571  109 ALA A C   
856  O O   . ALA A 109 ? 0.8642 0.9212 0.7526 -0.0602 0.1170  0.1637  109 ALA A O   
857  C CB  . ALA A 109 ? 0.8475 0.9952 0.7662 -0.0636 0.1317  0.1590  109 ALA A CB  
858  N N   . SER A 110 ? 0.8435 0.9232 0.7635 -0.0748 0.1162  0.1547  110 SER A N   
859  C CA  . SER A 110 ? 0.8554 0.9014 0.7696 -0.0865 0.1132  0.1589  110 SER A CA  
860  C C   . SER A 110 ? 0.8290 0.8587 0.7504 -0.0785 0.1043  0.1476  110 SER A C   
861  O O   . SER A 110 ? 0.8021 0.8510 0.7375 -0.0701 0.1012  0.1375  110 SER A O   
862  C CB  . SER A 110 ? 0.8627 0.9188 0.7855 -0.1081 0.1176  0.1647  110 SER A CB  
863  O OG  . SER A 110 ? 0.8545 0.9409 0.7987 -0.1084 0.1164  0.1562  110 SER A OG  
864  N N   . PRO A 111 ? 0.8367 0.8303 0.7475 -0.0806 0.1006  0.1497  111 PRO A N   
865  C CA  . PRO A 111 ? 0.8148 0.7923 0.7303 -0.0717 0.0929  0.1400  111 PRO A CA  
866  C C   . PRO A 111 ? 0.7883 0.7794 0.7225 -0.0779 0.0900  0.1311  111 PRO A C   
867  O O   . PRO A 111 ? 0.7999 0.7902 0.7376 -0.0945 0.0919  0.1339  111 PRO A O   
868  C CB  . PRO A 111 ? 0.8407 0.7777 0.7398 -0.0758 0.0919  0.1462  111 PRO A CB  
869  C CG  . PRO A 111 ? 0.8702 0.8010 0.7525 -0.0781 0.0975  0.1586  111 PRO A CG  
870  C CD  . PRO A 111 ? 0.8682 0.8325 0.7595 -0.0886 0.1038  0.1617  111 PRO A CD  
871  N N   . THR A 112 ? 0.7460 0.7484 0.6909 -0.0653 0.0851  0.1208  112 THR A N   
872  C CA  . THR A 112 ? 0.7121 0.7323 0.6748 -0.0683 0.0825  0.1127  112 THR A CA  
873  C C   . THR A 112 ? 0.6926 0.6919 0.6574 -0.0661 0.0761  0.1058  112 THR A C   
874  O O   . THR A 112 ? 0.6942 0.6766 0.6523 -0.0547 0.0726  0.1035  112 THR A O   
875  C CB  . THR A 112 ? 0.6914 0.7404 0.6643 -0.0557 0.0821  0.1061  112 THR A CB  
876  O OG1 . THR A 112 ? 0.7162 0.7831 0.6841 -0.0551 0.0886  0.1122  112 THR A OG1 
877  C CG2 . THR A 112 ? 0.6639 0.7346 0.6547 -0.0592 0.0806  0.0999  112 THR A CG2 
878  N N   . PRO A 113 ? 0.6746 0.6770 0.6487 -0.0771 0.0745  0.1027  113 PRO A N   
879  C CA  . PRO A 113 ? 0.6601 0.6462 0.6366 -0.0744 0.0688  0.0954  113 PRO A CA  
880  C C   . PRO A 113 ? 0.6296 0.6241 0.6133 -0.0578 0.0645  0.0874  113 PRO A C   
881  O O   . PRO A 113 ? 0.6110 0.6313 0.6051 -0.0521 0.0647  0.0841  113 PRO A O   
882  C CB  . PRO A 113 ? 0.6571 0.6564 0.6447 -0.0885 0.0680  0.0932  113 PRO A CB  
883  C CG  . PRO A 113 ? 0.6777 0.6826 0.6614 -0.1037 0.0734  0.1022  113 PRO A CG  
884  C CD  . PRO A 113 ? 0.6799 0.6967 0.6596 -0.0947 0.0781  0.1073  113 PRO A CD  
885  N N   . VAL A 114 ? 0.6140 0.5857 0.5915 -0.0506 0.0609  0.0847  114 VAL A N   
886  C CA  . VAL A 114 ? 0.5788 0.5540 0.5611 -0.0364 0.0566  0.0783  114 VAL A CA  
887  C C   . VAL A 114 ? 0.5657 0.5410 0.5574 -0.0374 0.0526  0.0711  114 VAL A C   
888  O O   . VAL A 114 ? 0.5763 0.5352 0.5643 -0.0449 0.0521  0.0708  114 VAL A O   
889  C CB  . VAL A 114 ? 0.5869 0.5404 0.5569 -0.0272 0.0555  0.0811  114 VAL A CB  
890  C CG1 . VAL A 114 ? 0.5528 0.5116 0.5284 -0.0144 0.0506  0.0751  114 VAL A CG1 
891  C CG2 . VAL A 114 ? 0.6004 0.5535 0.5595 -0.0261 0.0592  0.0890  114 VAL A CG2 
892  N N   . LEU A 115 ? 0.5406 0.5332 0.5430 -0.0300 0.0497  0.0652  115 LEU A N   
893  C CA  . LEU A 115 ? 0.5225 0.5152 0.5328 -0.0294 0.0457  0.0590  115 LEU A CA  
894  C C   . LEU A 115 ? 0.5115 0.5000 0.5222 -0.0174 0.0422  0.0552  115 LEU A C   
895  O O   . LEU A 115 ? 0.5108 0.5101 0.5230 -0.0099 0.0414  0.0541  115 LEU A O   
896  C CB  . LEU A 115 ? 0.5053 0.5221 0.5280 -0.0316 0.0453  0.0560  115 LEU A CB  
897  C CG  . LEU A 115 ? 0.5315 0.5566 0.5586 -0.0448 0.0466  0.0578  115 LEU A CG  
898  C CD1 . LEU A 115 ? 0.5360 0.5906 0.5759 -0.0435 0.0470  0.0564  115 LEU A CD1 
899  C CD2 . LEU A 115 ? 0.5706 0.5822 0.5973 -0.0498 0.0431  0.0543  115 LEU A CD2 
900  N N   . ILE A 116 ? 0.5043 0.4775 0.5129 -0.0160 0.0401  0.0533  116 ILE A N   
901  C CA  . ILE A 116 ? 0.4885 0.4601 0.4990 -0.0059 0.0367  0.0503  116 ILE A CA  
902  C C   . ILE A 116 ? 0.4741 0.4506 0.4934 -0.0061 0.0337  0.0448  116 ILE A C   
903  O O   . ILE A 116 ? 0.4869 0.4543 0.5049 -0.0110 0.0338  0.0437  116 ILE A O   
904  C CB  . ILE A 116 ? 0.5021 0.4548 0.5034 -0.0012 0.0372  0.0532  116 ILE A CB  
905  C CG1 . ILE A 116 ? 0.5157 0.4625 0.5069 0.0000  0.0399  0.0597  116 ILE A CG1 
906  C CG2 . ILE A 116 ? 0.4741 0.4303 0.4801 0.0082  0.0336  0.0504  116 ILE A CG2 
907  C CD1 . ILE A 116 ? 0.4900 0.4142 0.4695 0.0032  0.0415  0.0641  116 ILE A CD1 
908  N N   . TRP A 117 ? 0.4488 0.4379 0.4751 -0.0009 0.0309  0.0414  117 TRP A N   
909  C CA  . TRP A 117 ? 0.4357 0.4291 0.4695 -0.0003 0.0280  0.0371  117 TRP A CA  
910  C C   . TRP A 117 ? 0.4297 0.4163 0.4635 0.0049  0.0257  0.0360  117 TRP A C   
911  O O   . TRP A 117 ? 0.4227 0.4095 0.4547 0.0103  0.0247  0.0370  117 TRP A O   
912  C CB  . TRP A 117 ? 0.4302 0.4378 0.4700 0.0027  0.0263  0.0343  117 TRP A CB  
913  C CG  . TRP A 117 ? 0.4365 0.4468 0.4827 0.0041  0.0230  0.0307  117 TRP A CG  
914  C CD1 . TRP A 117 ? 0.4370 0.4473 0.4852 0.0091  0.0197  0.0281  117 TRP A CD1 
915  C CD2 . TRP A 117 ? 0.4423 0.4552 0.4927 -0.0003 0.0224  0.0297  117 TRP A CD2 
916  N NE1 . TRP A 117 ? 0.4416 0.4531 0.4946 0.0084  0.0177  0.0261  117 TRP A NE1 
917  C CE2 . TRP A 117 ? 0.4506 0.4645 0.5050 0.0032  0.0192  0.0271  117 TRP A CE2 
918  C CE3 . TRP A 117 ? 0.4415 0.4562 0.4920 -0.0079 0.0240  0.0310  117 TRP A CE3 
919  C CZ2 . TRP A 117 ? 0.4386 0.4555 0.4968 0.0009  0.0175  0.0261  117 TRP A CZ2 
920  C CZ3 . TRP A 117 ? 0.4310 0.4499 0.4856 -0.0107 0.0218  0.0293  117 TRP A CZ3 
921  C CH2 . TRP A 117 ? 0.4442 0.4644 0.5025 -0.0057 0.0187  0.0271  117 TRP A CH2 
922  N N   . ILE A 118 ? 0.4289 0.4115 0.4649 0.0030  0.0250  0.0340  118 ILE A N   
923  C CA  . ILE A 118 ? 0.4245 0.4045 0.4623 0.0075  0.0234  0.0331  118 ILE A CA  
924  C C   . ILE A 118 ? 0.4249 0.4114 0.4694 0.0063  0.0208  0.0300  118 ILE A C   
925  O O   . ILE A 118 ? 0.4347 0.4192 0.4788 0.0021  0.0212  0.0289  118 ILE A O   
926  C CB  . ILE A 118 ? 0.4227 0.3893 0.4541 0.0079  0.0259  0.0341  118 ILE A CB  
927  C CG1 . ILE A 118 ? 0.4367 0.3923 0.4590 0.0085  0.0288  0.0378  118 ILE A CG1 
928  C CG2 . ILE A 118 ? 0.4130 0.3815 0.4474 0.0141  0.0250  0.0341  118 ILE A CG2 
929  C CD1 . ILE A 118 ? 0.3957 0.3342 0.4091 0.0118  0.0316  0.0390  118 ILE A CD1 
930  N N   . TYR A 119 ? 0.4103 0.4034 0.4595 0.0095  0.0178  0.0288  119 TYR A N   
931  C CA  . TYR A 119 ? 0.4152 0.4122 0.4693 0.0085  0.0153  0.0268  119 TYR A CA  
932  C C   . TYR A 119 ? 0.4211 0.4150 0.4759 0.0075  0.0156  0.0269  119 TYR A C   
933  O O   . TYR A 119 ? 0.4134 0.4037 0.4663 0.0094  0.0173  0.0282  119 TYR A O   
934  C CB  . TYR A 119 ? 0.4138 0.4145 0.4704 0.0111  0.0119  0.0254  119 TYR A CB  
935  C CG  . TYR A 119 ? 0.4200 0.4213 0.4771 0.0131  0.0105  0.0265  119 TYR A CG  
936  C CD1 . TYR A 119 ? 0.4257 0.4280 0.4863 0.0124  0.0099  0.0276  119 TYR A CD1 
937  C CD2 . TYR A 119 ? 0.4122 0.4155 0.4665 0.0155  0.0096  0.0269  119 TYR A CD2 
938  C CE1 . TYR A 119 ? 0.4099 0.4172 0.4729 0.0140  0.0083  0.0292  119 TYR A CE1 
939  C CE2 . TYR A 119 ? 0.4426 0.4496 0.4981 0.0172  0.0074  0.0282  119 TYR A CE2 
940  C CZ  . TYR A 119 ? 0.4287 0.4388 0.4895 0.0163  0.0067  0.0295  119 TYR A CZ  
941  O OH  . TYR A 119 ? 0.4088 0.4266 0.4723 0.0178  0.0044  0.0314  119 TYR A OH  
942  N N   . GLY A 120 ? 0.4180 0.4141 0.4751 0.0055  0.0140  0.0258  120 GLY A N   
943  C CA  . GLY A 120 ? 0.4196 0.4143 0.4770 0.0045  0.0139  0.0261  120 GLY A CA  
944  C C   . GLY A 120 ? 0.4192 0.4165 0.4806 0.0055  0.0114  0.0268  120 GLY A C   
945  O O   . GLY A 120 ? 0.4210 0.4198 0.4842 0.0069  0.0095  0.0265  120 GLY A O   
946  N N   . GLY A 121 ? 0.4212 0.4185 0.4830 0.0040  0.0112  0.0277  121 GLY A N   
947  C CA  . GLY A 121 ? 0.4161 0.4152 0.4812 0.0031  0.0095  0.0294  121 GLY A CA  
948  C C   . GLY A 121 ? 0.4120 0.4143 0.4777 0.0029  0.0123  0.0317  121 GLY A C   
949  O O   . GLY A 121 ? 0.4132 0.4208 0.4833 0.0020  0.0116  0.0337  121 GLY A O   
950  N N   . GLY A 122 ? 0.4048 0.4047 0.4658 0.0035  0.0154  0.0312  122 GLY A N   
951  C CA  . GLY A 122 ? 0.4074 0.4098 0.4668 0.0044  0.0189  0.0328  122 GLY A CA  
952  C C   . GLY A 122 ? 0.4153 0.4234 0.4778 0.0085  0.0217  0.0344  122 GLY A C   
953  O O   . GLY A 122 ? 0.4091 0.4238 0.4730 0.0097  0.0246  0.0367  122 GLY A O   
954  N N   . PHE A 123 ? 0.4113 0.4184 0.4748 0.0110  0.0210  0.0337  123 PHE A N   
955  C CA  . PHE A 123 ? 0.4181 0.4329 0.4857 0.0156  0.0223  0.0359  123 PHE A CA  
956  C C   . PHE A 123 ? 0.4165 0.4449 0.4935 0.0130  0.0196  0.0388  123 PHE A C   
957  O O   . PHE A 123 ? 0.4152 0.4545 0.4970 0.0169  0.0208  0.0414  123 PHE A O   
958  C CB  . PHE A 123 ? 0.4223 0.4359 0.4852 0.0217  0.0280  0.0365  123 PHE A CB  
959  C CG  . PHE A 123 ? 0.4204 0.4186 0.4727 0.0241  0.0304  0.0337  123 PHE A CG  
960  C CD1 . PHE A 123 ? 0.4207 0.4133 0.4705 0.0276  0.0304  0.0340  123 PHE A CD1 
961  C CD2 . PHE A 123 ? 0.4075 0.3961 0.4513 0.0221  0.0325  0.0310  123 PHE A CD2 
962  C CE1 . PHE A 123 ? 0.4248 0.4008 0.4637 0.0282  0.0326  0.0319  123 PHE A CE1 
963  C CE2 . PHE A 123 ? 0.4262 0.3991 0.4591 0.0223  0.0342  0.0282  123 PHE A CE2 
964  C CZ  . PHE A 123 ? 0.4448 0.4107 0.4753 0.0249  0.0343  0.0287  123 PHE A CZ  
965  N N   . TYR A 124 ? 0.4045 0.4322 0.4836 0.0065  0.0160  0.0388  124 TYR A N   
966  C CA  . TYR A 124 ? 0.4140 0.4517 0.5005 0.0016  0.0129  0.0414  124 TYR A CA  
967  C C   . TYR A 124 ? 0.4219 0.4535 0.5079 -0.0022 0.0071  0.0390  124 TYR A C   
968  O O   . TYR A 124 ? 0.4266 0.4630 0.5167 -0.0076 0.0032  0.0400  124 TYR A O   
969  C CB  . TYR A 124 ? 0.4103 0.4504 0.4979 -0.0034 0.0141  0.0443  124 TYR A CB  
970  C CG  . TYR A 124 ? 0.4189 0.4458 0.5011 -0.0071 0.0115  0.0427  124 TYR A CG  
971  C CD1 . TYR A 124 ? 0.4247 0.4464 0.5076 -0.0128 0.0064  0.0428  124 TYR A CD1 
972  C CD2 . TYR A 124 ? 0.4367 0.4555 0.5121 -0.0043 0.0136  0.0409  124 TYR A CD2 
973  C CE1 . TYR A 124 ? 0.4470 0.4556 0.5241 -0.0139 0.0042  0.0417  124 TYR A CE1 
974  C CE2 . TYR A 124 ? 0.4494 0.4589 0.5206 -0.0062 0.0108  0.0401  124 TYR A CE2 
975  C CZ  . TYR A 124 ? 0.4474 0.4518 0.5195 -0.0101 0.0064  0.0407  124 TYR A CZ  
976  O OH  . TYR A 124 ? 0.4430 0.4377 0.5104 -0.0097 0.0040  0.0402  124 TYR A OH  
977  N N   . SER A 125 ? 0.4191 0.4398 0.4992 0.0000  0.0067  0.0356  125 SER A N   
978  C CA  . SER A 125 ? 0.4231 0.4377 0.5011 -0.0017 0.0022  0.0328  125 SER A CA  
979  C C   . SER A 125 ? 0.4249 0.4345 0.4982 0.0028  0.0031  0.0300  125 SER A C   
980  O O   . SER A 125 ? 0.4127 0.4221 0.4843 0.0060  0.0069  0.0304  125 SER A O   
981  C CB  . SER A 125 ? 0.4270 0.4327 0.5025 -0.0057 -0.0002 0.0325  125 SER A CB  
982  O OG  . SER A 125 ? 0.4313 0.4322 0.5036 -0.0034 0.0021  0.0322  125 SER A OG  
983  N N   . GLY A 126 ? 0.4273 0.4321 0.4976 0.0027  -0.0002 0.0272  126 GLY A N   
984  C CA  . GLY A 126 ? 0.4332 0.4354 0.4994 0.0065  0.0009  0.0249  126 GLY A CA  
985  C C   . GLY A 126 ? 0.4369 0.4413 0.5007 0.0080  -0.0013 0.0236  126 GLY A C   
986  O O   . GLY A 126 ? 0.4319 0.4419 0.4982 0.0064  -0.0037 0.0247  126 GLY A O   
987  N N   . ALA A 127 ? 0.4417 0.4437 0.5008 0.0110  -0.0004 0.0215  127 ALA A N   
988  C CA  . ALA A 127 ? 0.4546 0.4584 0.5093 0.0130  -0.0021 0.0201  127 ALA A CA  
989  C C   . ALA A 127 ? 0.4591 0.4625 0.5095 0.0165  0.0012  0.0193  127 ALA A C   
990  O O   . ALA A 127 ? 0.4673 0.4691 0.5182 0.0170  0.0030  0.0184  127 ALA A O   
991  C CB  . ALA A 127 ? 0.4623 0.4616 0.5135 0.0111  -0.0072 0.0164  127 ALA A CB  
992  N N   . ALA A 128 ? 0.4639 0.4703 0.5101 0.0187  0.0021  0.0203  128 ALA A N   
993  C CA  . ALA A 128 ? 0.4590 0.4666 0.5011 0.0209  0.0059  0.0206  128 ALA A CA  
994  C C   . ALA A 128 ? 0.4644 0.4717 0.5010 0.0238  0.0047  0.0164  128 ALA A C   
995  O O   . ALA A 128 ? 0.4832 0.4941 0.5166 0.0262  0.0082  0.0165  128 ALA A O   
996  C CB  . ALA A 128 ? 0.4588 0.4682 0.4971 0.0223  0.0079  0.0244  128 ALA A CB  
997  N N   . SER A 129 ? 0.4606 0.4631 0.4952 0.0235  0.0001  0.0126  129 SER A N   
998  C CA  . SER A 129 ? 0.4595 0.4580 0.4859 0.0272  -0.0013 0.0076  129 SER A CA  
999  C C   . SER A 129 ? 0.4645 0.4574 0.4912 0.0299  -0.0007 0.0048  129 SER A C   
1000 O O   . SER A 129 ? 0.4774 0.4655 0.4961 0.0349  -0.0011 0.0003  129 SER A O   
1001 C CB  . SER A 129 ? 0.4635 0.4571 0.4840 0.0250  -0.0073 0.0044  129 SER A CB  
1002 O OG  . SER A 129 ? 0.4261 0.4165 0.4526 0.0194  -0.0110 0.0051  129 SER A OG  
1003 N N   . LEU A 130 ? 0.4557 0.4487 0.4902 0.0275  0.0000  0.0074  130 LEU A N   
1004 C CA  . LEU A 130 ? 0.4646 0.4537 0.5001 0.0308  0.0003  0.0061  130 LEU A CA  
1005 C C   . LEU A 130 ? 0.4735 0.4704 0.5077 0.0375  0.0044  0.0053  130 LEU A C   
1006 O O   . LEU A 130 ? 0.4659 0.4740 0.5026 0.0370  0.0084  0.0079  130 LEU A O   
1007 C CB  . LEU A 130 ? 0.4553 0.4459 0.4990 0.0267  0.0006  0.0099  130 LEU A CB  
1008 C CG  . LEU A 130 ? 0.4605 0.4466 0.5071 0.0205  -0.0024 0.0116  130 LEU A CG  
1009 C CD1 . LEU A 130 ? 0.4520 0.4403 0.5047 0.0180  -0.0011 0.0151  130 LEU A CD1 
1010 C CD2 . LEU A 130 ? 0.4464 0.4205 0.4878 0.0190  -0.0071 0.0088  130 LEU A CD2 
1011 N N   . ASP A 131 ? 0.5013 0.4921 0.5312 0.0440  0.0038  0.0021  131 ASP A N   
1012 C CA  . ASP A 131 ? 0.5088 0.5090 0.5381 0.0524  0.0079  0.0014  131 ASP A CA  
1013 C C   . ASP A 131 ? 0.4938 0.5119 0.5336 0.0506  0.0117  0.0063  131 ASP A C   
1014 O O   . ASP A 131 ? 0.5027 0.5344 0.5433 0.0537  0.0160  0.0071  131 ASP A O   
1015 C CB  . ASP A 131 ? 0.5192 0.5084 0.5433 0.0606  0.0062  -0.0018 131 ASP A CB  
1016 C CG  . ASP A 131 ? 0.5645 0.5377 0.5746 0.0651  0.0041  -0.0081 131 ASP A CG  
1017 O OD1 . ASP A 131 ? 0.5802 0.5519 0.5853 0.0608  0.0030  -0.0100 131 ASP A OD1 
1018 O OD2 . ASP A 131 ? 0.6389 0.6001 0.6416 0.0735  0.0034  -0.0114 131 ASP A OD2 
1019 N N   . VAL A 132 ? 0.4806 0.4992 0.5276 0.0450  0.0102  0.0095  132 VAL A N   
1020 C CA  . VAL A 132 ? 0.4708 0.5050 0.5267 0.0414  0.0128  0.0137  132 VAL A CA  
1021 C C   . VAL A 132 ? 0.4658 0.5056 0.5231 0.0339  0.0155  0.0163  132 VAL A C   
1022 O O   . VAL A 132 ? 0.4651 0.5164 0.5279 0.0294  0.0178  0.0194  132 VAL A O   
1023 C CB  . VAL A 132 ? 0.4629 0.4949 0.5239 0.0377  0.0101  0.0160  132 VAL A CB  
1024 C CG1 . VAL A 132 ? 0.4725 0.5045 0.5335 0.0461  0.0085  0.0154  132 VAL A CG1 
1025 C CG2 . VAL A 132 ? 0.4550 0.4725 0.5137 0.0321  0.0071  0.0158  132 VAL A CG2 
1026 N N   . TYR A 133 ? 0.4701 0.5010 0.5218 0.0322  0.0148  0.0153  133 TYR A N   
1027 C CA  . TYR A 133 ? 0.4663 0.5003 0.5174 0.0269  0.0175  0.0184  133 TYR A CA  
1028 C C   . TYR A 133 ? 0.4706 0.5105 0.5160 0.0302  0.0207  0.0182  133 TYR A C   
1029 O O   . TYR A 133 ? 0.4798 0.5199 0.5224 0.0267  0.0228  0.0212  133 TYR A O   
1030 C CB  . TYR A 133 ? 0.4596 0.4829 0.5092 0.0228  0.0152  0.0192  133 TYR A CB  
1031 C CG  . TYR A 133 ? 0.4513 0.4693 0.5054 0.0198  0.0127  0.0195  133 TYR A CG  
1032 C CD1 . TYR A 133 ? 0.4139 0.4369 0.4728 0.0176  0.0133  0.0207  133 TYR A CD1 
1033 C CD2 . TYR A 133 ? 0.4455 0.4553 0.4987 0.0188  0.0097  0.0190  133 TYR A CD2 
1034 C CE1 . TYR A 133 ? 0.4124 0.4303 0.4736 0.0150  0.0111  0.0211  133 TYR A CE1 
1035 C CE2 . TYR A 133 ? 0.4040 0.4102 0.4607 0.0161  0.0081  0.0198  133 TYR A CE2 
1036 C CZ  . TYR A 133 ? 0.4196 0.4289 0.4795 0.0145  0.0090  0.0208  133 TYR A CZ  
1037 O OH  . TYR A 133 ? 0.3750 0.3806 0.4366 0.0120  0.0077  0.0217  133 TYR A OH  
1038 N N   . ASP A 134 ? 0.4788 0.5229 0.5214 0.0378  0.0215  0.0150  134 ASP A N   
1039 C CA  . ASP A 134 ? 0.4851 0.5355 0.5206 0.0424  0.0250  0.0142  134 ASP A CA  
1040 C C   . ASP A 134 ? 0.4844 0.5504 0.5237 0.0381  0.0307  0.0196  134 ASP A C   
1041 O O   . ASP A 134 ? 0.4780 0.5584 0.5251 0.0378  0.0333  0.0216  134 ASP A O   
1042 C CB  . ASP A 134 ? 0.4932 0.5447 0.5248 0.0528  0.0253  0.0094  134 ASP A CB  
1043 C CG  . ASP A 134 ? 0.5179 0.5745 0.5398 0.0590  0.0290  0.0074  134 ASP A CG  
1044 O OD1 . ASP A 134 ? 0.5795 0.6414 0.5985 0.0552  0.0318  0.0106  134 ASP A OD1 
1045 O OD2 . ASP A 134 ? 0.5457 0.5997 0.5613 0.0685  0.0294  0.0025  134 ASP A OD2 
1046 N N   . GLY A 135 ? 0.4792 0.5428 0.5126 0.0344  0.0324  0.0225  135 GLY A N   
1047 C CA  . GLY A 135 ? 0.4665 0.5411 0.5016 0.0284  0.0376  0.0285  135 GLY A CA  
1048 C C   . GLY A 135 ? 0.4654 0.5566 0.4980 0.0328  0.0433  0.0295  135 GLY A C   
1049 O O   . GLY A 135 ? 0.4550 0.5569 0.4893 0.0267  0.0481  0.0352  135 GLY A O   
1050 N N   . ARG A 136 ? 0.4702 0.5631 0.4979 0.0433  0.0432  0.0241  136 ARG A N   
1051 C CA  . ARG A 136 ? 0.4842 0.5931 0.5076 0.0496  0.0493  0.0244  136 ARG A CA  
1052 C C   . ARG A 136 ? 0.4821 0.6153 0.5172 0.0466  0.0548  0.0294  136 ARG A C   
1053 O O   . ARG A 136 ? 0.4913 0.6393 0.5247 0.0445  0.0610  0.0340  136 ARG A O   
1054 C CB  . ARG A 136 ? 0.4910 0.5949 0.5051 0.0627  0.0483  0.0167  136 ARG A CB  
1055 C CG  . ARG A 136 ? 0.5144 0.6212 0.5346 0.0708  0.0473  0.0127  136 ARG A CG  
1056 C CD  . ARG A 136 ? 0.5626 0.6580 0.5694 0.0838  0.0462  0.0045  136 ARG A CD  
1057 N NE  . ARG A 136 ? 0.6173 0.6878 0.6146 0.0815  0.0391  -0.0004 136 ARG A NE  
1058 C CZ  . ARG A 136 ? 0.6537 0.7095 0.6353 0.0885  0.0369  -0.0077 136 ARG A CZ  
1059 N NH1 . ARG A 136 ? 0.6328 0.6687 0.6081 0.0838  0.0297  -0.0112 136 ARG A NH1 
1060 N NH2 . ARG A 136 ? 0.6685 0.7299 0.6403 0.1000  0.0418  -0.0116 136 ARG A NH2 
1061 N N   . PHE A 137 ? 0.4722 0.6106 0.5189 0.0452  0.0525  0.0293  137 PHE A N   
1062 C CA  . PHE A 137 ? 0.4673 0.6324 0.5265 0.0426  0.0567  0.0337  137 PHE A CA  
1063 C C   . PHE A 137 ? 0.4695 0.6410 0.5335 0.0269  0.0587  0.0410  137 PHE A C   
1064 O O   . PHE A 137 ? 0.4713 0.6658 0.5403 0.0229  0.0645  0.0462  137 PHE A O   
1065 C CB  . PHE A 137 ? 0.4520 0.6216 0.5211 0.0465  0.0528  0.0315  137 PHE A CB  
1066 C CG  . PHE A 137 ? 0.4537 0.6090 0.5160 0.0602  0.0496  0.0246  137 PHE A CG  
1067 C CD1 . PHE A 137 ? 0.4285 0.5949 0.4881 0.0745  0.0534  0.0217  137 PHE A CD1 
1068 C CD2 . PHE A 137 ? 0.4500 0.5797 0.5077 0.0588  0.0431  0.0209  137 PHE A CD2 
1069 C CE1 . PHE A 137 ? 0.4254 0.5738 0.4760 0.0869  0.0503  0.0148  137 PHE A CE1 
1070 C CE2 . PHE A 137 ? 0.4286 0.5428 0.4787 0.0698  0.0399  0.0147  137 PHE A CE2 
1071 C CZ  . PHE A 137 ? 0.4255 0.5474 0.4713 0.0837  0.0434  0.0115  137 PHE A CZ  
1072 N N   . LEU A 138 ? 0.4656 0.6168 0.5275 0.0179  0.0543  0.0416  138 LEU A N   
1073 C CA  . LEU A 138 ? 0.4799 0.6305 0.5428 0.0032  0.0561  0.0479  138 LEU A CA  
1074 C C   . LEU A 138 ? 0.4951 0.6457 0.5483 0.0011  0.0615  0.0526  138 LEU A C   
1075 O O   . LEU A 138 ? 0.5034 0.6657 0.5587 -0.0090 0.0660  0.0590  138 LEU A O   
1076 C CB  . LEU A 138 ? 0.4779 0.6043 0.5382 -0.0035 0.0508  0.0469  138 LEU A CB  
1077 C CG  . LEU A 138 ? 0.4678 0.5966 0.5376 -0.0071 0.0463  0.0450  138 LEU A CG  
1078 C CD1 . LEU A 138 ? 0.4378 0.5412 0.5026 -0.0087 0.0414  0.0423  138 LEU A CD1 
1079 C CD2 . LEU A 138 ? 0.4721 0.6169 0.5493 -0.0204 0.0482  0.0500  138 LEU A CD2 
1080 N N   . ALA A 139 ? 0.5068 0.6447 0.5488 0.0102  0.0608  0.0494  139 ALA A N   
1081 C CA  . ALA A 139 ? 0.5242 0.6619 0.5550 0.0105  0.0655  0.0534  139 ALA A CA  
1082 C C   . ALA A 139 ? 0.5353 0.7005 0.5686 0.0130  0.0729  0.0563  139 ALA A C   
1083 O O   . ALA A 139 ? 0.5526 0.7263 0.5837 0.0047  0.0784  0.0638  139 ALA A O   
1084 C CB  . ALA A 139 ? 0.5207 0.6417 0.5392 0.0205  0.0619  0.0482  139 ALA A CB  
1085 N N   . GLN A 140 ? 0.5361 0.7152 0.5738 0.0246  0.0736  0.0509  140 GLN A N   
1086 C CA  . GLN A 140 ? 0.5372 0.7437 0.5762 0.0308  0.0813  0.0528  140 GLN A CA  
1087 C C   . GLN A 140 ? 0.5381 0.7721 0.5930 0.0215  0.0851  0.0591  140 GLN A C   
1088 O O   . GLN A 140 ? 0.5497 0.8054 0.6057 0.0177  0.0925  0.0654  140 GLN A O   
1089 C CB  . GLN A 140 ? 0.5335 0.7428 0.5701 0.0484  0.0807  0.0444  140 GLN A CB  
1090 C CG  . GLN A 140 ? 0.5439 0.7752 0.5755 0.0592  0.0890  0.0444  140 GLN A CG  
1091 C CD  . GLN A 140 ? 0.5505 0.8187 0.5979 0.0578  0.0956  0.0501  140 GLN A CD  
1092 O OE1 . GLN A 140 ? 0.5364 0.8148 0.5987 0.0558  0.0927  0.0504  140 GLN A OE1 
1093 N NE2 . GLN A 140 ? 0.5309 0.8211 0.5748 0.0589  0.1046  0.0550  140 GLN A NE2 
1094 N N   . VAL A 141 ? 0.5283 0.7634 0.5953 0.0176  0.0801  0.0577  141 VAL A N   
1095 C CA  . VAL A 141 ? 0.5244 0.7895 0.6075 0.0097  0.0826  0.0629  141 VAL A CA  
1096 C C   . VAL A 141 ? 0.5355 0.7969 0.6203 -0.0110 0.0827  0.0703  141 VAL A C   
1097 O O   . VAL A 141 ? 0.5409 0.8277 0.6332 -0.0209 0.0879  0.0773  141 VAL A O   
1098 C CB  . VAL A 141 ? 0.5125 0.7841 0.6076 0.0152  0.0771  0.0586  141 VAL A CB  
1099 C CG1 . VAL A 141 ? 0.4913 0.7954 0.6034 0.0048  0.0784  0.0646  141 VAL A CG1 
1100 C CG2 . VAL A 141 ? 0.4978 0.7729 0.5900 0.0363  0.0779  0.0520  141 VAL A CG2 
1101 N N   . GLU A 142 ? 0.5365 0.7659 0.6135 -0.0176 0.0772  0.0688  142 GLU A N   
1102 C CA  . GLU A 142 ? 0.5474 0.7674 0.6233 -0.0364 0.0769  0.0749  142 GLU A CA  
1103 C C   . GLU A 142 ? 0.5608 0.7627 0.6215 -0.0414 0.0807  0.0801  142 GLU A C   
1104 O O   . GLU A 142 ? 0.5699 0.7630 0.6274 -0.0570 0.0817  0.0862  142 GLU A O   
1105 C CB  . GLU A 142 ? 0.5424 0.7414 0.6198 -0.0421 0.0692  0.0710  142 GLU A CB  
1106 C CG  . GLU A 142 ? 0.5527 0.7734 0.6456 -0.0431 0.0658  0.0690  142 GLU A CG  
1107 C CD  . GLU A 142 ? 0.6046 0.8549 0.7086 -0.0578 0.0689  0.0758  142 GLU A CD  
1108 O OE1 . GLU A 142 ? 0.6420 0.8902 0.7408 -0.0709 0.0732  0.0823  142 GLU A OE1 
1109 O OE2 . GLU A 142 ? 0.6234 0.8999 0.7415 -0.0567 0.0670  0.0752  142 GLU A OE2 
1110 N N   . GLY A 143 ? 0.5622 0.7584 0.6125 -0.0283 0.0827  0.0778  143 GLY A N   
1111 C CA  . GLY A 143 ? 0.5721 0.7510 0.6069 -0.0307 0.0855  0.0828  143 GLY A CA  
1112 C C   . GLY A 143 ? 0.5760 0.7199 0.6017 -0.0329 0.0795  0.0813  143 GLY A C   
1113 O O   . GLY A 143 ? 0.5989 0.7256 0.6121 -0.0375 0.0811  0.0869  143 GLY A O   
1114 N N   . ALA A 144 ? 0.5543 0.6879 0.5855 -0.0290 0.0729  0.0743  144 ALA A N   
1115 C CA  . ALA A 144 ? 0.5525 0.6557 0.5767 -0.0311 0.0678  0.0731  144 ALA A CA  
1116 C C   . ALA A 144 ? 0.5484 0.6356 0.5614 -0.0194 0.0654  0.0705  144 ALA A C   
1117 O O   . ALA A 144 ? 0.5441 0.6411 0.5559 -0.0084 0.0654  0.0664  144 ALA A O   
1118 C CB  . ALA A 144 ? 0.5348 0.6342 0.5686 -0.0321 0.0621  0.0673  144 ALA A CB  
1119 N N   . VAL A 145 ? 0.5490 0.6117 0.5530 -0.0218 0.0632  0.0730  145 VAL A N   
1120 C CA  . VAL A 145 ? 0.5394 0.5878 0.5355 -0.0114 0.0592  0.0703  145 VAL A CA  
1121 C C   . VAL A 145 ? 0.5322 0.5700 0.5348 -0.0093 0.0533  0.0642  145 VAL A C   
1122 O O   . VAL A 145 ? 0.5348 0.5593 0.5380 -0.0162 0.0524  0.0655  145 VAL A O   
1123 C CB  . VAL A 145 ? 0.5591 0.5896 0.5412 -0.0129 0.0607  0.0776  145 VAL A CB  
1124 C CG1 . VAL A 145 ? 0.5510 0.5703 0.5268 -0.0020 0.0557  0.0750  145 VAL A CG1 
1125 C CG2 . VAL A 145 ? 0.5537 0.5953 0.5281 -0.0154 0.0670  0.0845  145 VAL A CG2 
1126 N N   . LEU A 146 ? 0.5246 0.5680 0.5313 -0.0004 0.0495  0.0575  146 LEU A N   
1127 C CA  . LEU A 146 ? 0.5162 0.5518 0.5295 0.0011  0.0444  0.0523  146 LEU A CA  
1128 C C   . LEU A 146 ? 0.5100 0.5346 0.5182 0.0086  0.0400  0.0503  146 LEU A C   
1129 O O   . LEU A 146 ? 0.5117 0.5408 0.5149 0.0151  0.0389  0.0487  146 LEU A O   
1130 C CB  . LEU A 146 ? 0.5036 0.5534 0.5273 0.0034  0.0431  0.0467  146 LEU A CB  
1131 C CG  . LEU A 146 ? 0.5099 0.5529 0.5409 0.0010  0.0392  0.0435  146 LEU A CG  
1132 C CD1 . LEU A 146 ? 0.5157 0.5735 0.5563 -0.0025 0.0399  0.0424  146 LEU A CD1 
1133 C CD2 . LEU A 146 ? 0.5104 0.5471 0.5419 0.0087  0.0341  0.0383  146 LEU A CD2 
1134 N N   . VAL A 147 ? 0.5051 0.5166 0.5144 0.0074  0.0375  0.0502  147 VAL A N   
1135 C CA  . VAL A 147 ? 0.5052 0.5091 0.5119 0.0139  0.0334  0.0492  147 VAL A CA  
1136 C C   . VAL A 147 ? 0.4974 0.4991 0.5125 0.0141  0.0299  0.0446  147 VAL A C   
1137 O O   . VAL A 147 ? 0.5009 0.4978 0.5194 0.0090  0.0310  0.0446  147 VAL A O   
1138 C CB  . VAL A 147 ? 0.5176 0.5070 0.5156 0.0143  0.0347  0.0555  147 VAL A CB  
1139 C CG1 . VAL A 147 ? 0.5181 0.5041 0.5159 0.0218  0.0302  0.0548  147 VAL A CG1 
1140 C CG2 . VAL A 147 ? 0.5215 0.5116 0.5094 0.0141  0.0382  0.0613  147 VAL A CG2 
1141 N N   . SER A 148 ? 0.4890 0.4940 0.5064 0.0193  0.0254  0.0409  148 SER A N   
1142 C CA  . SER A 148 ? 0.4678 0.4705 0.4923 0.0195  0.0222  0.0377  148 SER A CA  
1143 C C   . SER A 148 ? 0.4710 0.4736 0.4948 0.0242  0.0181  0.0378  148 SER A C   
1144 O O   . SER A 148 ? 0.4809 0.4882 0.5002 0.0273  0.0159  0.0374  148 SER A O   
1145 C CB  . SER A 148 ? 0.4589 0.4683 0.4894 0.0189  0.0205  0.0326  148 SER A CB  
1146 O OG  . SER A 148 ? 0.4426 0.4568 0.4700 0.0229  0.0181  0.0296  148 SER A OG  
1147 N N   . MET A 149 ? 0.4644 0.4631 0.4922 0.0247  0.0172  0.0385  149 MET A N   
1148 C CA  . MET A 149 ? 0.4609 0.4634 0.4904 0.0290  0.0135  0.0395  149 MET A CA  
1149 C C   . MET A 149 ? 0.4520 0.4589 0.4903 0.0273  0.0104  0.0362  149 MET A C   
1150 O O   . MET A 149 ? 0.4486 0.4522 0.4907 0.0241  0.0120  0.0343  149 MET A O   
1151 C CB  . MET A 149 ? 0.4643 0.4600 0.4903 0.0330  0.0160  0.0447  149 MET A CB  
1152 C CG  . MET A 149 ? 0.4673 0.4575 0.4976 0.0326  0.0180  0.0442  149 MET A CG  
1153 S SD  . MET A 149 ? 0.5113 0.4895 0.5387 0.0259  0.0225  0.0427  149 MET A SD  
1154 C CE  . MET A 149 ? 0.4665 0.4293 0.4816 0.0275  0.0268  0.0483  149 MET A CE  
1155 N N   . ASN A 150 ? 0.4464 0.4612 0.4874 0.0288  0.0058  0.0359  150 ASN A N   
1156 C CA  . ASN A 150 ? 0.4383 0.4584 0.4876 0.0267  0.0032  0.0347  150 ASN A CA  
1157 C C   . ASN A 150 ? 0.4385 0.4603 0.4903 0.0312  0.0057  0.0392  150 ASN A C   
1158 O O   . ASN A 150 ? 0.4406 0.4625 0.4880 0.0367  0.0066  0.0431  150 ASN A O   
1159 C CB  . ASN A 150 ? 0.4382 0.4671 0.4893 0.0247  -0.0032 0.0326  150 ASN A CB  
1160 C CG  . ASN A 150 ? 0.4586 0.4826 0.5060 0.0209  -0.0057 0.0270  150 ASN A CG  
1161 O OD1 . ASN A 150 ? 0.4512 0.4681 0.4966 0.0206  -0.0026 0.0251  150 ASN A OD1 
1162 N ND2 . ASN A 150 ? 0.4424 0.4703 0.4883 0.0183  -0.0116 0.0244  150 ASN A ND2 
1163 N N   . TYR A 151 ? 0.4252 0.4477 0.4829 0.0298  0.0071  0.0389  151 TYR A N   
1164 C CA  . TYR A 151 ? 0.4229 0.4489 0.4833 0.0352  0.0097  0.0426  151 TYR A CA  
1165 C C   . TYR A 151 ? 0.4195 0.4568 0.4896 0.0318  0.0078  0.0421  151 TYR A C   
1166 O O   . TYR A 151 ? 0.4205 0.4555 0.4925 0.0251  0.0063  0.0389  151 TYR A O   
1167 C CB  . TYR A 151 ? 0.4268 0.4381 0.4808 0.0374  0.0157  0.0430  151 TYR A CB  
1168 C CG  . TYR A 151 ? 0.4217 0.4266 0.4763 0.0314  0.0172  0.0394  151 TYR A CG  
1169 C CD1 . TYR A 151 ? 0.4159 0.4153 0.4679 0.0260  0.0166  0.0366  151 TYR A CD1 
1170 C CD2 . TYR A 151 ? 0.4320 0.4383 0.4897 0.0317  0.0193  0.0393  151 TYR A CD2 
1171 C CE1 . TYR A 151 ? 0.4275 0.4233 0.4805 0.0212  0.0173  0.0340  151 TYR A CE1 
1172 C CE2 . TYR A 151 ? 0.4221 0.4232 0.4793 0.0264  0.0202  0.0364  151 TYR A CE2 
1173 C CZ  . TYR A 151 ? 0.4257 0.4219 0.4808 0.0212  0.0188  0.0339  151 TYR A CZ  
1174 O OH  . TYR A 151 ? 0.4259 0.4192 0.4810 0.0167  0.0191  0.0317  151 TYR A OH  
1175 N N   . ARG A 152 ? 0.4169 0.4671 0.4928 0.0364  0.0079  0.0458  152 ARG A N   
1176 C CA  . ARG A 152 ? 0.4094 0.4742 0.4955 0.0321  0.0062  0.0466  152 ARG A CA  
1177 C C   . ARG A 152 ? 0.4086 0.4666 0.4949 0.0297  0.0105  0.0453  152 ARG A C   
1178 O O   . ARG A 152 ? 0.4234 0.4709 0.5038 0.0347  0.0158  0.0452  152 ARG A O   
1179 C CB  . ARG A 152 ? 0.4144 0.4984 0.5079 0.0387  0.0062  0.0516  152 ARG A CB  
1180 C CG  . ARG A 152 ? 0.4053 0.5029 0.5015 0.0386  -0.0002 0.0533  152 ARG A CG  
1181 C CD  . ARG A 152 ? 0.3805 0.4977 0.4835 0.0476  0.0005  0.0592  152 ARG A CD  
1182 N NE  . ARG A 152 ? 0.3986 0.5039 0.4926 0.0597  0.0054  0.0616  152 ARG A NE  
1183 C CZ  . ARG A 152 ? 0.4140 0.5304 0.5103 0.0717  0.0075  0.0671  152 ARG A CZ  
1184 N NH1 . ARG A 152 ? 0.4196 0.5640 0.5290 0.0732  0.0052  0.0710  152 ARG A NH1 
1185 N NH2 . ARG A 152 ? 0.4215 0.5211 0.5066 0.0823  0.0119  0.0690  152 ARG A NH2 
1186 N N   . VAL A 153 ? 0.3978 0.4604 0.4895 0.0217  0.0080  0.0442  153 VAL A N   
1187 C CA  . VAL A 153 ? 0.3941 0.4509 0.4851 0.0189  0.0115  0.0435  153 VAL A CA  
1188 C C   . VAL A 153 ? 0.3980 0.4713 0.4983 0.0159  0.0118  0.0469  153 VAL A C   
1189 O O   . VAL A 153 ? 0.4014 0.4914 0.5095 0.0148  0.0086  0.0497  153 VAL A O   
1190 C CB  . VAL A 153 ? 0.3994 0.4431 0.4861 0.0122  0.0090  0.0397  153 VAL A CB  
1191 C CG1 . VAL A 153 ? 0.4041 0.4344 0.4826 0.0151  0.0101  0.0369  153 VAL A CG1 
1192 C CG2 . VAL A 153 ? 0.3794 0.4263 0.4692 0.0052  0.0026  0.0386  153 VAL A CG2 
1193 N N   . GLY A 154 ? 0.3949 0.4653 0.4942 0.0140  0.0154  0.0473  154 GLY A N   
1194 C CA  . GLY A 154 ? 0.3906 0.4770 0.4981 0.0103  0.0167  0.0512  154 GLY A CA  
1195 C C   . GLY A 154 ? 0.3979 0.5037 0.5122 0.0184  0.0200  0.0553  154 GLY A C   
1196 O O   . GLY A 154 ? 0.3961 0.4970 0.5052 0.0289  0.0236  0.0547  154 GLY A O   
1197 N N   . THR A 155 ? 0.3896 0.5174 0.5153 0.0135  0.0188  0.0597  155 THR A N   
1198 C CA  . THR A 155 ? 0.3904 0.5419 0.5248 0.0214  0.0221  0.0645  155 THR A CA  
1199 C C   . THR A 155 ? 0.3983 0.5512 0.5318 0.0300  0.0196  0.0643  155 THR A C   
1200 O O   . THR A 155 ? 0.4142 0.5707 0.5460 0.0431  0.0245  0.0660  155 THR A O   
1201 C CB  . THR A 155 ? 0.3904 0.5686 0.5389 0.0119  0.0194  0.0697  155 THR A CB  
1202 O OG1 . THR A 155 ? 0.3875 0.5613 0.5373 -0.0004 0.0106  0.0678  155 THR A OG1 
1203 C CG2 . THR A 155 ? 0.3686 0.5501 0.5184 0.0064  0.0242  0.0722  155 THR A CG2 
1204 N N   . PHE A 156 ? 0.3886 0.5360 0.5211 0.0234  0.0122  0.0619  156 PHE A N   
1205 C CA  . PHE A 156 ? 0.3872 0.5381 0.5187 0.0300  0.0088  0.0624  156 PHE A CA  
1206 C C   . PHE A 156 ? 0.3985 0.5303 0.5183 0.0418  0.0138  0.0608  156 PHE A C   
1207 O O   . PHE A 156 ? 0.4071 0.5450 0.5265 0.0526  0.0148  0.0638  156 PHE A O   
1208 C CB  . PHE A 156 ? 0.3812 0.5257 0.5103 0.0202  0.0005  0.0590  156 PHE A CB  
1209 C CG  . PHE A 156 ? 0.3681 0.5237 0.5051 0.0062  -0.0047 0.0595  156 PHE A CG  
1210 C CD1 . PHE A 156 ? 0.3589 0.5420 0.5077 0.0023  -0.0091 0.0637  156 PHE A CD1 
1211 C CD2 . PHE A 156 ? 0.3299 0.4690 0.4625 -0.0031 -0.0050 0.0564  156 PHE A CD2 
1212 C CE1 . PHE A 156 ? 0.3726 0.5646 0.5281 -0.0126 -0.0140 0.0645  156 PHE A CE1 
1213 C CE2 . PHE A 156 ? 0.3658 0.5112 0.5037 -0.0163 -0.0095 0.0573  156 PHE A CE2 
1214 C CZ  . PHE A 156 ? 0.3750 0.5462 0.5242 -0.0221 -0.0141 0.0612  156 PHE A CZ  
1215 N N   . GLY A 157 ? 0.3951 0.5037 0.5052 0.0395  0.0166  0.0566  157 GLY A N   
1216 C CA  . GLY A 157 ? 0.4022 0.4905 0.5003 0.0478  0.0209  0.0548  157 GLY A CA  
1217 C C   . GLY A 157 ? 0.4144 0.4993 0.5083 0.0572  0.0286  0.0558  157 GLY A C   
1218 O O   . GLY A 157 ? 0.4298 0.5009 0.5142 0.0665  0.0321  0.0557  157 GLY A O   
1219 N N   . PHE A 158 ? 0.4139 0.5094 0.5133 0.0548  0.0316  0.0566  158 PHE A N   
1220 C CA  . PHE A 158 ? 0.4213 0.5076 0.5126 0.0619  0.0392  0.0555  158 PHE A CA  
1221 C C   . PHE A 158 ? 0.4338 0.5417 0.5328 0.0675  0.0444  0.0594  158 PHE A C   
1222 O O   . PHE A 158 ? 0.4502 0.5504 0.5406 0.0766  0.0513  0.0583  158 PHE A O   
1223 C CB  . PHE A 158 ? 0.4146 0.4800 0.4963 0.0541  0.0396  0.0505  158 PHE A CB  
1224 C CG  . PHE A 158 ? 0.4053 0.4503 0.4785 0.0514  0.0365  0.0471  158 PHE A CG  
1225 C CD1 . PHE A 158 ? 0.4087 0.4351 0.4696 0.0589  0.0400  0.0456  158 PHE A CD1 
1226 C CD2 . PHE A 158 ? 0.3568 0.4011 0.4335 0.0418  0.0305  0.0457  158 PHE A CD2 
1227 C CE1 . PHE A 158 ? 0.3806 0.3903 0.4342 0.0552  0.0376  0.0434  158 PHE A CE1 
1228 C CE2 . PHE A 158 ? 0.3673 0.3963 0.4369 0.0399  0.0285  0.0431  158 PHE A CE2 
1229 C CZ  . PHE A 158 ? 0.3782 0.3913 0.4370 0.0460  0.0320  0.0424  158 PHE A CZ  
1230 N N   . LEU A 159 ? 0.4303 0.5652 0.5445 0.0621  0.0412  0.0638  159 LEU A N   
1231 C CA  . LEU A 159 ? 0.4379 0.5992 0.5618 0.0675  0.0463  0.0688  159 LEU A CA  
1232 C C   . LEU A 159 ? 0.4519 0.6168 0.5726 0.0860  0.0519  0.0708  159 LEU A C   
1233 O O   . LEU A 159 ? 0.4628 0.6306 0.5852 0.0922  0.0487  0.0726  159 LEU A O   
1234 C CB  . LEU A 159 ? 0.4280 0.6198 0.5698 0.0578  0.0407  0.0739  159 LEU A CB  
1235 C CG  . LEU A 159 ? 0.4253 0.6500 0.5800 0.0604  0.0459  0.0801  159 LEU A CG  
1236 C CD1 . LEU A 159 ? 0.3992 0.6429 0.5670 0.0427  0.0406  0.0835  159 LEU A CD1 
1237 C CD2 . LEU A 159 ? 0.3925 0.6411 0.5553 0.0756  0.0479  0.0850  159 LEU A CD2 
1238 N N   . ALA A 160 ? 0.4651 0.6297 0.5801 0.0956  0.0605  0.0707  160 ALA A N   
1239 C CA  . ALA A 160 ? 0.4834 0.6439 0.5910 0.1148  0.0666  0.0715  160 ALA A CA  
1240 C C   . ALA A 160 ? 0.4913 0.6771 0.6051 0.1257  0.0749  0.0755  160 ALA A C   
1241 O O   . ALA A 160 ? 0.4895 0.6796 0.6028 0.1205  0.0791  0.0747  160 ALA A O   
1242 C CB  . ALA A 160 ? 0.4947 0.6146 0.5797 0.1189  0.0698  0.0647  160 ALA A CB  
1243 N N   . LEU A 161 ? 0.5097 0.7135 0.6294 0.1417  0.0774  0.0803  161 LEU A N   
1244 C CA  . LEU A 161 ? 0.5300 0.7528 0.6512 0.1582  0.0873  0.0835  161 LEU A CA  
1245 C C   . LEU A 161 ? 0.5534 0.7484 0.6558 0.1785  0.0926  0.0808  161 LEU A C   
1246 O O   . LEU A 161 ? 0.5561 0.7621 0.6629 0.1923  0.0921  0.0855  161 LEU A O   
1247 C CB  . LEU A 161 ? 0.5190 0.7906 0.6642 0.1611  0.0861  0.0924  161 LEU A CB  
1248 C CG  . LEU A 161 ? 0.5203 0.8169 0.6817 0.1401  0.0822  0.0951  161 LEU A CG  
1249 C CD1 . LEU A 161 ? 0.5348 0.8759 0.7200 0.1370  0.0772  0.1033  161 LEU A CD1 
1250 C CD2 . LEU A 161 ? 0.5309 0.8350 0.6898 0.1406  0.0917  0.0950  161 LEU A CD2 
1251 N N   . PRO A 162 ? 0.5725 0.7296 0.6526 0.1795  0.0970  0.0732  162 PRO A N   
1252 C CA  . PRO A 162 ? 0.6007 0.7209 0.6586 0.1945  0.1006  0.0692  162 PRO A CA  
1253 C C   . PRO A 162 ? 0.6282 0.7616 0.6859 0.2198  0.1079  0.0740  162 PRO A C   
1254 O O   . PRO A 162 ? 0.6324 0.7900 0.6957 0.2296  0.1155  0.0762  162 PRO A O   
1255 C CB  . PRO A 162 ? 0.6102 0.6996 0.6477 0.1904  0.1055  0.0609  162 PRO A CB  
1256 C CG  . PRO A 162 ? 0.5850 0.6850 0.6329 0.1681  0.0999  0.0600  162 PRO A CG  
1257 C CD  . PRO A 162 ? 0.5626 0.7090 0.6362 0.1656  0.0984  0.0680  162 PRO A CD  
1258 N N   . GLY A 163 ? 0.6521 0.7708 0.7036 0.2309  0.1056  0.0762  163 GLY A N   
1259 C CA  . GLY A 163 ? 0.6782 0.8063 0.7279 0.2570  0.1119  0.0813  163 GLY A CA  
1260 C C   . GLY A 163 ? 0.6712 0.8416 0.7448 0.2610  0.1063  0.0910  163 GLY A C   
1261 O O   . GLY A 163 ? 0.6951 0.8703 0.7670 0.2821  0.1087  0.0963  163 GLY A O   
1262 N N   . SER A 164 ? 0.6450 0.8456 0.7399 0.2410  0.0985  0.0935  164 SER A N   
1263 C CA  . SER A 164 ? 0.6336 0.8746 0.7511 0.2406  0.0912  0.1021  164 SER A CA  
1264 C C   . SER A 164 ? 0.6443 0.8667 0.7561 0.2382  0.0823  0.1032  164 SER A C   
1265 O O   . SER A 164 ? 0.6573 0.8360 0.7497 0.2323  0.0810  0.0974  164 SER A O   
1266 C CB  . SER A 164 ? 0.6004 0.8767 0.7402 0.2186  0.0857  0.1037  164 SER A CB  
1267 O OG  . SER A 164 ? 0.5741 0.8268 0.7092 0.1965  0.0779  0.0983  164 SER A OG  
1268 N N   . ARG A 165 ? 0.6418 0.8996 0.7708 0.2422  0.0763  0.1112  165 ARG A N   
1269 C CA  A ARG A 165 ? 0.6465 0.8967 0.7733 0.2399  0.0672  0.1138  165 ARG A CA  
1270 C CA  B ARG A 165 ? 0.6453 0.8907 0.7701 0.2387  0.0673  0.1129  165 ARG A CA  
1271 C C   . ARG A 165 ? 0.6202 0.8799 0.7581 0.2128  0.0571  0.1112  165 ARG A C   
1272 O O   . ARG A 165 ? 0.6203 0.8551 0.7486 0.2028  0.0510  0.1082  165 ARG A O   
1273 C CB  A ARG A 165 ? 0.6551 0.9455 0.7966 0.2573  0.0651  0.1239  165 ARG A CB  
1274 C CB  B ARG A 165 ? 0.6604 0.9308 0.7921 0.2590  0.0656  0.1223  165 ARG A CB  
1275 C CG  A ARG A 165 ? 0.6967 0.9672 0.8245 0.2734  0.0626  0.1283  165 ARG A CG  
1276 C CG  B ARG A 165 ? 0.6774 0.9294 0.7998 0.2580  0.0573  0.1244  165 ARG A CG  
1277 C CD  A ARG A 165 ? 0.7096 1.0270 0.8562 0.2824  0.0557  0.1385  165 ARG A CD  
1278 C CD  B ARG A 165 ? 0.7384 0.9538 0.8377 0.2808  0.0627  0.1266  165 ARG A CD  
1279 N NE  A ARG A 165 ? 0.7053 1.0360 0.8615 0.2605  0.0433  0.1382  165 ARG A NE  
1280 N NE  B ARG A 165 ? 0.7505 0.9113 0.8250 0.2762  0.0679  0.1184  165 ARG A NE  
1281 C CZ  A ARG A 165 ? 0.6828 1.0587 0.8626 0.2461  0.0365  0.1406  165 ARG A CZ  
1282 C CZ  B ARG A 165 ? 0.7825 0.9042 0.8337 0.2935  0.0741  0.1186  165 ARG A CZ  
1283 N NH1 A ARG A 165 ? 0.6730 1.0891 0.8716 0.2508  0.0408  0.1444  165 ARG A NH1 
1284 N NH1 B ARG A 165 ? 0.8044 0.9349 0.8537 0.3182  0.0763  0.1267  165 ARG A NH1 
1285 N NH2 A ARG A 165 ? 0.6622 1.0427 0.8461 0.2268  0.0254  0.1391  165 ARG A NH2 
1286 N NH2 B ARG A 165 ? 0.7781 0.8518 0.8075 0.2862  0.0778  0.1109  165 ARG A NH2 
1287 N N   . GLU A 166 ? 0.5952 0.8919 0.7531 0.2017  0.0558  0.1128  166 GLU A N   
1288 C CA  . GLU A 166 ? 0.5706 0.8833 0.7415 0.1780  0.0460  0.1118  166 GLU A CA  
1289 C C   . GLU A 166 ? 0.5535 0.8361 0.7154 0.1580  0.0451  0.1034  166 GLU A C   
1290 O O   . GLU A 166 ? 0.5442 0.8267 0.7101 0.1400  0.0365  0.1012  166 GLU A O   
1291 C CB  . GLU A 166 ? 0.5672 0.9324 0.7631 0.1734  0.0445  0.1180  166 GLU A CB  
1292 C CG  . GLU A 166 ? 0.6103 1.0144 0.8192 0.1923  0.0442  0.1273  166 GLU A CG  
1293 C CD  . GLU A 166 ? 0.6722 1.0868 0.8807 0.2163  0.0566  0.1309  166 GLU A CD  
1294 O OE1 . GLU A 166 ? 0.6782 1.0663 0.8735 0.2201  0.0660  0.1256  166 GLU A OE1 
1295 O OE2 . GLU A 166 ? 0.6981 1.1489 0.9192 0.2326  0.0567  0.1391  166 GLU A OE2 
1296 N N   . ALA A 167 ? 0.5473 0.8051 0.6967 0.1617  0.0537  0.0987  167 ALA A N   
1297 C CA  . ALA A 167 ? 0.5298 0.7585 0.6694 0.1452  0.0531  0.0912  167 ALA A CA  
1298 C C   . ALA A 167 ? 0.5364 0.7254 0.6539 0.1543  0.0610  0.0857  167 ALA A C   
1299 O O   . ALA A 167 ? 0.5366 0.7207 0.6499 0.1539  0.0675  0.0827  167 ALA A O   
1300 C CB  . ALA A 167 ? 0.5123 0.7635 0.6653 0.1306  0.0533  0.0914  167 ALA A CB  
1301 N N   . PRO A 168 ? 0.5416 0.7017 0.6439 0.1618  0.0602  0.0844  168 PRO A N   
1302 C CA  . PRO A 168 ? 0.5594 0.6810 0.6396 0.1709  0.0674  0.0796  168 PRO A CA  
1303 C C   . PRO A 168 ? 0.5564 0.6512 0.6263 0.1551  0.0673  0.0718  168 PRO A C   
1304 O O   . PRO A 168 ? 0.5803 0.6484 0.6334 0.1602  0.0735  0.0671  168 PRO A O   
1305 C CB  . PRO A 168 ? 0.5713 0.6709 0.6395 0.1795  0.0650  0.0816  168 PRO A CB  
1306 C CG  . PRO A 168 ? 0.5522 0.6720 0.6340 0.1682  0.0550  0.0848  168 PRO A CG  
1307 C CD  . PRO A 168 ? 0.5379 0.7008 0.6421 0.1631  0.0529  0.0881  168 PRO A CD  
1308 N N   . GLY A 169 ? 0.5348 0.6358 0.6134 0.1368  0.0601  0.0703  169 GLY A N   
1309 C CA  . GLY A 169 ? 0.5222 0.5999 0.5919 0.1225  0.0592  0.0637  169 GLY A CA  
1310 C C   . GLY A 169 ? 0.5232 0.5698 0.5791 0.1184  0.0562  0.0605  169 GLY A C   
1311 O O   . GLY A 169 ? 0.5339 0.5705 0.5830 0.1281  0.0564  0.0632  169 GLY A O   
1312 N N   . ASN A 170 ? 0.5174 0.5504 0.5696 0.1041  0.0536  0.0556  170 ASN A N   
1313 C CA  . ASN A 170 ? 0.5150 0.5224 0.5562 0.0972  0.0508  0.0526  170 ASN A CA  
1314 C C   . ASN A 170 ? 0.5030 0.5168 0.5492 0.0955  0.0449  0.0560  170 ASN A C   
1315 O O   . ASN A 170 ? 0.5196 0.5133 0.5554 0.0941  0.0442  0.0553  170 ASN A O   
1316 C CB  . ASN A 170 ? 0.5343 0.5102 0.5556 0.1050  0.0562  0.0503  170 ASN A CB  
1317 C CG  . ASN A 170 ? 0.5483 0.5124 0.5601 0.1049  0.0614  0.0452  170 ASN A CG  
1318 O OD1 . ASN A 170 ? 0.5291 0.4981 0.5448 0.0939  0.0598  0.0420  170 ASN A OD1 
1319 N ND2 . ASN A 170 ? 0.5643 0.5110 0.5619 0.1179  0.0677  0.0444  170 ASN A ND2 
1320 N N   . VAL A 171 ? 0.4857 0.5273 0.5470 0.0951  0.0407  0.0597  171 VAL A N   
1321 C CA  . VAL A 171 ? 0.4688 0.5165 0.5326 0.0949  0.0351  0.0628  171 VAL A CA  
1322 C C   . VAL A 171 ? 0.4605 0.4992 0.5225 0.0815  0.0303  0.0591  171 VAL A C   
1323 O O   . VAL A 171 ? 0.4643 0.4978 0.5218 0.0814  0.0272  0.0605  171 VAL A O   
1324 C CB  . VAL A 171 ? 0.4600 0.5406 0.5391 0.0985  0.0311  0.0679  171 VAL A CB  
1325 C CG1 . VAL A 171 ? 0.4653 0.5560 0.5459 0.1145  0.0367  0.0723  171 VAL A CG1 
1326 C CG2 . VAL A 171 ? 0.4258 0.5265 0.5187 0.0853  0.0269  0.0662  171 VAL A CG2 
1327 N N   . GLY A 172 ? 0.4460 0.4828 0.5105 0.0711  0.0299  0.0548  172 GLY A N   
1328 C CA  . GLY A 172 ? 0.4397 0.4666 0.5014 0.0602  0.0263  0.0511  172 GLY A CA  
1329 C C   . GLY A 172 ? 0.4476 0.4499 0.4955 0.0605  0.0292  0.0496  172 GLY A C   
1330 O O   . GLY A 172 ? 0.4394 0.4358 0.4840 0.0555  0.0267  0.0488  172 GLY A O   
1331 N N   . LEU A 173 ? 0.4643 0.4522 0.5035 0.0661  0.0347  0.0491  173 LEU A N   
1332 C CA  . LEU A 173 ? 0.4861 0.4485 0.5107 0.0657  0.0376  0.0480  173 LEU A CA  
1333 C C   . LEU A 173 ? 0.5009 0.4573 0.5194 0.0730  0.0375  0.0529  173 LEU A C   
1334 O O   . LEU A 173 ? 0.5093 0.4510 0.5192 0.0684  0.0374  0.0532  173 LEU A O   
1335 C CB  . LEU A 173 ? 0.4992 0.4453 0.5136 0.0699  0.0432  0.0456  173 LEU A CB  
1336 C CG  . LEU A 173 ? 0.5040 0.4492 0.5193 0.0607  0.0432  0.0405  173 LEU A CG  
1337 C CD1 . LEU A 173 ? 0.5030 0.4329 0.5066 0.0665  0.0488  0.0380  173 LEU A CD1 
1338 C CD2 . LEU A 173 ? 0.4536 0.3897 0.4659 0.0481  0.0404  0.0376  173 LEU A CD2 
1339 N N   . LEU A 174 ? 0.4967 0.4666 0.5200 0.0841  0.0375  0.0572  174 LEU A N   
1340 C CA  . LEU A 174 ? 0.5037 0.4723 0.5224 0.0929  0.0366  0.0629  174 LEU A CA  
1341 C C   . LEU A 174 ? 0.4988 0.4787 0.5222 0.0859  0.0307  0.0639  174 LEU A C   
1342 O O   . LEU A 174 ? 0.5078 0.4766 0.5218 0.0875  0.0305  0.0672  174 LEU A O   
1343 C CB  . LEU A 174 ? 0.5005 0.4859 0.5254 0.1071  0.0377  0.0675  174 LEU A CB  
1344 C CG  . LEU A 174 ? 0.5156 0.4871 0.5316 0.1197  0.0447  0.0678  174 LEU A CG  
1345 C CD1 . LEU A 174 ? 0.4565 0.4509 0.4810 0.1351  0.0453  0.0735  174 LEU A CD1 
1346 C CD2 . LEU A 174 ? 0.5084 0.4443 0.5038 0.1239  0.0486  0.0685  174 LEU A CD2 
1347 N N   . ASP A 175 ? 0.4807 0.4808 0.5168 0.0782  0.0262  0.0612  175 ASP A N   
1348 C CA  . ASP A 175 ? 0.4779 0.4847 0.5160 0.0704  0.0209  0.0602  175 ASP A CA  
1349 C C   . ASP A 175 ? 0.4794 0.4661 0.5069 0.0638  0.0232  0.0582  175 ASP A C   
1350 O O   . ASP A 175 ? 0.4879 0.4718 0.5094 0.0634  0.0219  0.0604  175 ASP A O   
1351 C CB  . ASP A 175 ? 0.4573 0.4811 0.5074 0.0616  0.0164  0.0561  175 ASP A CB  
1352 C CG  . ASP A 175 ? 0.4878 0.5344 0.5497 0.0653  0.0139  0.0584  175 ASP A CG  
1353 O OD1 . ASP A 175 ? 0.4962 0.5507 0.5585 0.0757  0.0144  0.0636  175 ASP A OD1 
1354 O OD2 . ASP A 175 ? 0.4778 0.5353 0.5489 0.0577  0.0114  0.0557  175 ASP A OD2 
1355 N N   . GLN A 176 ? 0.4778 0.4521 0.5029 0.0585  0.0265  0.0545  176 GLN A N   
1356 C CA  . GLN A 176 ? 0.4871 0.4465 0.5044 0.0507  0.0283  0.0528  176 GLN A CA  
1357 C C   . GLN A 176 ? 0.5108 0.4515 0.5145 0.0548  0.0316  0.0575  176 GLN A C   
1358 O O   . GLN A 176 ? 0.5163 0.4516 0.5143 0.0499  0.0318  0.0590  176 GLN A O   
1359 C CB  . GLN A 176 ? 0.4876 0.4391 0.5049 0.0440  0.0304  0.0482  176 GLN A CB  
1360 C CG  . GLN A 176 ? 0.4691 0.4356 0.4979 0.0390  0.0274  0.0441  176 GLN A CG  
1361 C CD  . GLN A 176 ? 0.4929 0.4514 0.5199 0.0343  0.0297  0.0405  176 GLN A CD  
1362 O OE1 . GLN A 176 ? 0.5113 0.4528 0.5283 0.0329  0.0329  0.0400  176 GLN A OE1 
1363 N NE2 . GLN A 176 ? 0.4705 0.4402 0.5060 0.0315  0.0277  0.0380  176 GLN A NE2 
1364 N N   . ARG A 177 ? 0.5279 0.4582 0.5258 0.0641  0.0346  0.0599  177 ARG A N   
1365 C CA  . ARG A 177 ? 0.5501 0.4585 0.5329 0.0695  0.0380  0.0649  177 ARG A CA  
1366 C C   . ARG A 177 ? 0.5492 0.4653 0.5303 0.0741  0.0354  0.0709  177 ARG A C   
1367 O O   . ARG A 177 ? 0.5677 0.4690 0.5376 0.0714  0.0370  0.0745  177 ARG A O   
1368 C CB  . ARG A 177 ? 0.5722 0.4685 0.5485 0.0816  0.0417  0.0664  177 ARG A CB  
1369 C CG  . ARG A 177 ? 0.5965 0.4639 0.5543 0.0874  0.0455  0.0713  177 ARG A CG  
1370 C CD  . ARG A 177 ? 0.6392 0.4935 0.5896 0.1008  0.0496  0.0717  177 ARG A CD  
1371 N NE  . ARG A 177 ? 0.6742 0.5085 0.6165 0.0946  0.0531  0.0652  177 ARG A NE  
1372 C CZ  . ARG A 177 ? 0.6874 0.5127 0.6243 0.1045  0.0570  0.0628  177 ARG A CZ  
1373 N NH1 . ARG A 177 ? 0.6746 0.5119 0.6155 0.1214  0.0583  0.0667  177 ARG A NH1 
1374 N NH2 . ARG A 177 ? 0.6756 0.4817 0.6032 0.0976  0.0596  0.0564  177 ARG A NH2 
1375 N N   . LEU A 178 ? 0.5292 0.4690 0.5211 0.0799  0.0312  0.0720  178 LEU A N   
1376 C CA  . LEU A 178 ? 0.5323 0.4824 0.5226 0.0844  0.0276  0.0771  178 LEU A CA  
1377 C C   . LEU A 178 ? 0.5349 0.4857 0.5227 0.0738  0.0262  0.0756  178 LEU A C   
1378 O O   . LEU A 178 ? 0.5466 0.4909 0.5243 0.0753  0.0267  0.0807  178 LEU A O   
1379 C CB  . LEU A 178 ? 0.5140 0.4919 0.5175 0.0896  0.0223  0.0774  178 LEU A CB  
1380 C CG  . LEU A 178 ? 0.5240 0.5158 0.5260 0.0950  0.0174  0.0826  178 LEU A CG  
1381 C CD1 . LEU A 178 ? 0.5567 0.5332 0.5451 0.1067  0.0201  0.0908  178 LEU A CD1 
1382 C CD2 . LEU A 178 ? 0.5070 0.5277 0.5232 0.0982  0.0115  0.0824  178 LEU A CD2 
1383 N N   . ALA A 179 ? 0.5275 0.4861 0.5238 0.0639  0.0251  0.0690  179 ALA A N   
1384 C CA  . ALA A 179 ? 0.5248 0.4854 0.5194 0.0550  0.0246  0.0670  179 ALA A CA  
1385 C C   . ALA A 179 ? 0.5429 0.4834 0.5263 0.0499  0.0298  0.0696  179 ALA A C   
1386 O O   . ALA A 179 ? 0.5614 0.5022 0.5393 0.0458  0.0306  0.0717  179 ALA A O   
1387 C CB  . ALA A 179 ? 0.5029 0.4745 0.5084 0.0475  0.0225  0.0598  179 ALA A CB  
1388 N N   . LEU A 180 ? 0.5501 0.4731 0.5292 0.0495  0.0334  0.0694  180 LEU A N   
1389 C CA  . LEU A 180 ? 0.5690 0.4706 0.5359 0.0433  0.0378  0.0723  180 LEU A CA  
1390 C C   . LEU A 180 ? 0.5958 0.4845 0.5491 0.0502  0.0394  0.0807  180 LEU A C   
1391 O O   . LEU A 180 ? 0.6040 0.4852 0.5488 0.0440  0.0417  0.0847  180 LEU A O   
1392 C CB  . LEU A 180 ? 0.5774 0.4611 0.5407 0.0401  0.0407  0.0690  180 LEU A CB  
1393 C CG  . LEU A 180 ? 0.5607 0.4538 0.5347 0.0330  0.0395  0.0615  180 LEU A CG  
1394 C CD1 . LEU A 180 ? 0.5591 0.4306 0.5241 0.0259  0.0426  0.0594  180 LEU A CD1 
1395 C CD2 . LEU A 180 ? 0.5386 0.4512 0.5226 0.0248  0.0372  0.0587  180 LEU A CD2 
1396 N N   . GLN A 181 ? 0.5995 0.4872 0.5511 0.0633  0.0384  0.0839  181 GLN A N   
1397 C CA  . GLN A 181 ? 0.6328 0.5102 0.5717 0.0720  0.0392  0.0926  181 GLN A CA  
1398 C C   . GLN A 181 ? 0.6272 0.5201 0.5655 0.0697  0.0366  0.0959  181 GLN A C   
1399 O O   . GLN A 181 ? 0.6406 0.5208 0.5658 0.0683  0.0390  0.1026  181 GLN A O   
1400 C CB  . GLN A 181 ? 0.6434 0.5236 0.5832 0.0880  0.0378  0.0955  181 GLN A CB  
1401 C CG  . GLN A 181 ? 0.7026 0.5605 0.6365 0.0924  0.0421  0.0937  181 GLN A CG  
1402 C CD  . GLN A 181 ? 0.7276 0.5931 0.6655 0.1090  0.0416  0.0955  181 GLN A CD  
1403 O OE1 . GLN A 181 ? 0.7358 0.6300 0.6873 0.1139  0.0371  0.0955  181 GLN A OE1 
1404 N NE2 . GLN A 181 ? 0.7635 0.6032 0.6891 0.1174  0.0463  0.0968  181 GLN A NE2 
1405 N N   . TRP A 182 ? 0.6014 0.5205 0.5529 0.0688  0.0318  0.0909  182 TRP A N   
1406 C CA  . TRP A 182 ? 0.5863 0.5211 0.5374 0.0659  0.0291  0.0913  182 TRP A CA  
1407 C C   . TRP A 182 ? 0.5879 0.5163 0.5332 0.0548  0.0333  0.0916  182 TRP A C   
1408 O O   . TRP A 182 ? 0.5971 0.5279 0.5336 0.0547  0.0339  0.0963  182 TRP A O   
1409 C CB  . TRP A 182 ? 0.5608 0.5196 0.5260 0.0645  0.0236  0.0839  182 TRP A CB  
1410 C CG  . TRP A 182 ? 0.5488 0.5226 0.5114 0.0636  0.0201  0.0834  182 TRP A CG  
1411 C CD1 . TRP A 182 ? 0.5394 0.5268 0.5006 0.0705  0.0145  0.0856  182 TRP A CD1 
1412 C CD2 . TRP A 182 ? 0.5279 0.5053 0.4882 0.0558  0.0219  0.0804  182 TRP A CD2 
1413 N NE1 . TRP A 182 ? 0.5341 0.5310 0.4904 0.0672  0.0127  0.0835  182 TRP A NE1 
1414 C CE2 . TRP A 182 ? 0.5354 0.5264 0.4912 0.0589  0.0176  0.0803  182 TRP A CE2 
1415 C CE3 . TRP A 182 ? 0.5223 0.4944 0.4839 0.0468  0.0268  0.0779  182 TRP A CE3 
1416 C CZ2 . TRP A 182 ? 0.5482 0.5460 0.4995 0.0544  0.0188  0.0773  182 TRP A CZ2 
1417 C CZ3 . TRP A 182 ? 0.5313 0.5130 0.4907 0.0425  0.0279  0.0756  182 TRP A CZ3 
1418 C CH2 . TRP A 182 ? 0.5427 0.5361 0.4962 0.0469  0.0243  0.0752  182 TRP A CH2 
1419 N N   . VAL A 183 ? 0.5754 0.4983 0.5257 0.0455  0.0361  0.0868  183 VAL A N   
1420 C CA  . VAL A 183 ? 0.5761 0.4961 0.5224 0.0345  0.0402  0.0878  183 VAL A CA  
1421 C C   . VAL A 183 ? 0.6068 0.5038 0.5367 0.0331  0.0448  0.0970  183 VAL A C   
1422 O O   . VAL A 183 ? 0.6212 0.5195 0.5438 0.0282  0.0475  0.1019  183 VAL A O   
1423 C CB  . VAL A 183 ? 0.5647 0.4863 0.5207 0.0246  0.0414  0.0811  183 VAL A CB  
1424 C CG1 . VAL A 183 ? 0.5603 0.4760 0.5114 0.0125  0.0463  0.0840  183 VAL A CG1 
1425 C CG2 . VAL A 183 ? 0.5327 0.4765 0.5025 0.0249  0.0376  0.0734  183 VAL A CG2 
1426 N N   . GLN A 184 ? 0.6175 0.4926 0.5402 0.0381  0.0458  0.0997  184 GLN A N   
1427 C CA  . GLN A 184 ? 0.6550 0.5035 0.5597 0.0376  0.0499  0.1087  184 GLN A CA  
1428 C C   . GLN A 184 ? 0.6647 0.5175 0.5597 0.0451  0.0493  0.1172  184 GLN A C   
1429 O O   . GLN A 184 ? 0.6768 0.5185 0.5593 0.0393  0.0531  0.1246  184 GLN A O   
1430 C CB  . GLN A 184 ? 0.6699 0.4920 0.5664 0.0450  0.0511  0.1098  184 GLN A CB  
1431 C CG  . GLN A 184 ? 0.6747 0.4839 0.5735 0.0356  0.0529  0.1031  184 GLN A CG  
1432 C CD  . GLN A 184 ? 0.6903 0.4870 0.5824 0.0183  0.0566  0.1047  184 GLN A CD  
1433 O OE1 . GLN A 184 ? 0.6357 0.4498 0.5393 0.0069  0.0561  0.0994  184 GLN A OE1 
1434 N NE2 . GLN A 184 ? 0.7112 0.4780 0.5843 0.0160  0.0602  0.1125  184 GLN A NE2 
1435 N N   . GLU A 185 ? 0.6541 0.5241 0.5547 0.0572  0.0443  0.1164  185 GLU A N   
1436 C CA  . GLU A 185 ? 0.6724 0.5459 0.5623 0.0652  0.0429  0.1247  185 GLU A CA  
1437 C C   . GLU A 185 ? 0.6534 0.5468 0.5442 0.0585  0.0427  0.1238  185 GLU A C   
1438 O O   . GLU A 185 ? 0.6714 0.5607 0.5489 0.0586  0.0449  0.1319  185 GLU A O   
1439 C CB  . GLU A 185 ? 0.6712 0.5568 0.5651 0.0805  0.0371  0.1254  185 GLU A CB  
1440 C CG  . GLU A 185 ? 0.7356 0.6198 0.6150 0.0898  0.0358  0.1359  185 GLU A CG  
1441 C CD  . GLU A 185 ? 0.7878 0.6837 0.6701 0.1058  0.0299  0.1386  185 GLU A CD  
1442 O OE1 . GLU A 185 ? 0.7987 0.7057 0.6954 0.1097  0.0271  0.1324  185 GLU A OE1 
1443 O OE2 . GLU A 185 ? 0.8142 0.7097 0.6843 0.1144  0.0282  0.1477  185 GLU A OE2 
1444 N N   . ASN A 186 ? 0.6177 0.5313 0.5230 0.0533  0.0406  0.1142  186 ASN A N   
1445 C CA  . ASN A 186 ? 0.5983 0.5333 0.5045 0.0513  0.0392  0.1118  186 ASN A CA  
1446 C C   . ASN A 186 ? 0.5896 0.5317 0.4992 0.0396  0.0439  0.1086  186 ASN A C   
1447 O O   . ASN A 186 ? 0.5926 0.5474 0.4971 0.0390  0.0449  0.1095  186 ASN A O   
1448 C CB  . ASN A 186 ? 0.5733 0.5285 0.4905 0.0574  0.0320  0.1041  186 ASN A CB  
1449 C CG  . ASN A 186 ? 0.5843 0.5398 0.4991 0.0693  0.0269  0.1082  186 ASN A CG  
1450 O OD1 . ASN A 186 ? 0.6021 0.5606 0.5057 0.0757  0.0249  0.1148  186 ASN A OD1 
1451 N ND2 . ASN A 186 ? 0.5570 0.5113 0.4824 0.0728  0.0247  0.1048  186 ASN A ND2 
1452 N N   . ILE A 187 ? 0.5815 0.5169 0.4991 0.0309  0.0467  0.1050  187 ILE A N   
1453 C CA  . ILE A 187 ? 0.5685 0.5167 0.4931 0.0208  0.0501  0.1010  187 ILE A CA  
1454 C C   . ILE A 187 ? 0.5912 0.5408 0.5052 0.0144  0.0562  0.1087  187 ILE A C   
1455 O O   . ILE A 187 ? 0.5867 0.5547 0.5055 0.0101  0.0588  0.1059  187 ILE A O   
1456 C CB  . ILE A 187 ? 0.5540 0.4970 0.4895 0.0124  0.0511  0.0957  187 ILE A CB  
1457 C CG1 . ILE A 187 ? 0.5306 0.4953 0.4785 0.0078  0.0514  0.0886  187 ILE A CG1 
1458 C CG2 . ILE A 187 ? 0.5718 0.4944 0.4993 0.0024  0.0561  0.1021  187 ILE A CG2 
1459 C CD1 . ILE A 187 ? 0.5117 0.4912 0.4677 0.0163  0.0458  0.0804  187 ILE A CD1 
1460 N N   . ALA A 188 ? 0.6141 0.5449 0.5135 0.0144  0.0588  0.1187  188 ALA A N   
1461 C CA  . ALA A 188 ? 0.6320 0.5636 0.5199 0.0080  0.0648  0.1274  188 ALA A CA  
1462 C C   . ALA A 188 ? 0.6321 0.5852 0.5158 0.0148  0.0642  0.1271  188 ALA A C   
1463 O O   . ALA A 188 ? 0.6474 0.6121 0.5272 0.0088  0.0698  0.1306  188 ALA A O   
1464 C CB  . ALA A 188 ? 0.6606 0.5640 0.5315 0.0075  0.0673  0.1388  188 ALA A CB  
1465 N N   . ALA A 189 ? 0.6190 0.5785 0.5032 0.0265  0.0576  0.1226  189 ALA A N   
1466 C CA  . ALA A 189 ? 0.6150 0.5942 0.4947 0.0327  0.0556  0.1197  189 ALA A CA  
1467 C C   . ALA A 189 ? 0.6061 0.6055 0.4958 0.0285  0.0580  0.1111  189 ALA A C   
1468 O O   . ALA A 189 ? 0.6183 0.6325 0.5013 0.0316  0.0594  0.1098  189 ALA A O   
1469 C CB  . ALA A 189 ? 0.5962 0.5790 0.4767 0.0440  0.0468  0.1152  189 ALA A CB  
1470 N N   . PHE A 190 ? 0.5913 0.5914 0.4961 0.0227  0.0584  0.1051  190 PHE A N   
1471 C CA  . PHE A 190 ? 0.5829 0.6017 0.4984 0.0209  0.0598  0.0967  190 PHE A CA  
1472 C C   . PHE A 190 ? 0.5933 0.6175 0.5128 0.0097  0.0676  0.1012  190 PHE A C   
1473 O O   . PHE A 190 ? 0.5859 0.6279 0.5146 0.0079  0.0702  0.0961  190 PHE A O   
1474 C CB  . PHE A 190 ? 0.5581 0.5772 0.4884 0.0226  0.0541  0.0867  190 PHE A CB  
1475 C CG  . PHE A 190 ? 0.5534 0.5700 0.4823 0.0317  0.0461  0.0820  190 PHE A CG  
1476 C CD1 . PHE A 190 ? 0.5681 0.5707 0.4948 0.0346  0.0424  0.0861  190 PHE A CD1 
1477 C CD2 . PHE A 190 ? 0.5273 0.5557 0.4567 0.0371  0.0423  0.0736  190 PHE A CD2 
1478 C CE1 . PHE A 190 ? 0.5425 0.5472 0.4699 0.0422  0.0349  0.0825  190 PHE A CE1 
1479 C CE2 . PHE A 190 ? 0.5300 0.5574 0.4585 0.0431  0.0344  0.0694  190 PHE A CE2 
1480 C CZ  . PHE A 190 ? 0.5424 0.5600 0.4712 0.0453  0.0306  0.0741  190 PHE A CZ  
1481 N N   . GLY A 191 ? 0.6130 0.6220 0.5251 0.0023  0.0712  0.1111  191 GLY A N   
1482 C CA  . GLY A 191 ? 0.6141 0.6268 0.5297 -0.0111 0.0780  0.1164  191 GLY A CA  
1483 C C   . GLY A 191 ? 0.6122 0.6144 0.5390 -0.0197 0.0764  0.1135  191 GLY A C   
1484 O O   . GLY A 191 ? 0.6201 0.6279 0.5524 -0.0321 0.0807  0.1163  191 GLY A O   
1485 N N   . GLY A 192 ? 0.6005 0.5892 0.5308 -0.0136 0.0701  0.1078  192 GLY A N   
1486 C CA  . GLY A 192 ? 0.5989 0.5743 0.5366 -0.0209 0.0685  0.1052  192 GLY A CA  
1487 C C   . GLY A 192 ? 0.6292 0.5767 0.5541 -0.0282 0.0708  0.1137  192 GLY A C   
1488 O O   . GLY A 192 ? 0.6505 0.5850 0.5610 -0.0234 0.0718  0.1211  192 GLY A O   
1489 N N   . ASP A 193 ? 0.6343 0.5715 0.5632 -0.0395 0.0713  0.1126  193 ASP A N   
1490 C CA  . ASP A 193 ? 0.6621 0.5684 0.5775 -0.0480 0.0733  0.1193  193 ASP A CA  
1491 C C   . ASP A 193 ? 0.6676 0.5511 0.5812 -0.0412 0.0689  0.1143  193 ASP A C   
1492 O O   . ASP A 193 ? 0.6492 0.5344 0.5726 -0.0451 0.0664  0.1069  193 ASP A O   
1493 C CB  . ASP A 193 ? 0.6727 0.5819 0.5920 -0.0672 0.0766  0.1212  193 ASP A CB  
1494 C CG  . ASP A 193 ? 0.7063 0.5805 0.6086 -0.0787 0.0791  0.1287  193 ASP A CG  
1495 O OD1 . ASP A 193 ? 0.7139 0.5586 0.6012 -0.0702 0.0782  0.1320  193 ASP A OD1 
1496 O OD2 . ASP A 193 ? 0.7170 0.5933 0.6207 -0.0966 0.0818  0.1316  193 ASP A OD2 
1497 N N   . PRO A 194 ? 0.6889 0.5516 0.5893 -0.0303 0.0680  0.1188  194 PRO A N   
1498 C CA  . PRO A 194 ? 0.6939 0.5384 0.5932 -0.0213 0.0644  0.1142  194 PRO A CA  
1499 C C   . PRO A 194 ? 0.7186 0.5347 0.6101 -0.0320 0.0659  0.1138  194 PRO A C   
1500 O O   . PRO A 194 ? 0.7156 0.5181 0.6070 -0.0264 0.0635  0.1084  194 PRO A O   
1501 C CB  . PRO A 194 ? 0.7107 0.5423 0.5969 -0.0072 0.0638  0.1211  194 PRO A CB  
1502 C CG  . PRO A 194 ? 0.7219 0.5497 0.5960 -0.0139 0.0684  0.1313  194 PRO A CG  
1503 C CD  . PRO A 194 ? 0.7007 0.5568 0.5866 -0.0251 0.0704  0.1288  194 PRO A CD  
1504 N N   . MET A 195 ? 0.7439 0.5517 0.6284 -0.0480 0.0698  0.1193  195 MET A N   
1505 C CA  . MET A 195 ? 0.7804 0.5589 0.6549 -0.0608 0.0708  0.1189  195 MET A CA  
1506 C C   . MET A 195 ? 0.7560 0.5524 0.6452 -0.0748 0.0692  0.1112  195 MET A C   
1507 O O   . MET A 195 ? 0.7790 0.5558 0.6613 -0.0886 0.0694  0.1100  195 MET A O   
1508 C CB  . MET A 195 ? 0.8213 0.5757 0.6774 -0.0722 0.0755  0.1299  195 MET A CB  
1509 C CG  . MET A 195 ? 0.8909 0.6267 0.7309 -0.0580 0.0770  0.1388  195 MET A CG  
1510 S SD  . MET A 195 ? 1.0537 0.7398 0.8647 -0.0685 0.0815  0.1503  195 MET A SD  
1511 C CE  . MET A 195 ? 1.0579 0.7076 0.8604 -0.0638 0.0787  0.1413  195 MET A CE  
1512 N N   . SER A 196 ? 0.7123 0.5452 0.6206 -0.0710 0.0673  0.1061  196 SER A N   
1513 C CA  . SER A 196 ? 0.6824 0.5354 0.6058 -0.0808 0.0652  0.0990  196 SER A CA  
1514 C C   . SER A 196 ? 0.6448 0.5231 0.5843 -0.0671 0.0614  0.0912  196 SER A C   
1515 O O   . SER A 196 ? 0.6228 0.5312 0.5746 -0.0648 0.0617  0.0905  196 SER A O   
1516 C CB  . SER A 196 ? 0.6822 0.5564 0.6116 -0.0971 0.0684  0.1038  196 SER A CB  
1517 O OG  . SER A 196 ? 0.6579 0.5574 0.6039 -0.1043 0.0659  0.0974  196 SER A OG  
1518 N N   . VAL A 197 ? 0.6334 0.4974 0.5714 -0.0581 0.0583  0.0856  197 VAL A N   
1519 C CA  . VAL A 197 ? 0.5983 0.4798 0.5490 -0.0459 0.0545  0.0787  197 VAL A CA  
1520 C C   . VAL A 197 ? 0.5891 0.4701 0.5458 -0.0513 0.0517  0.0713  197 VAL A C   
1521 O O   . VAL A 197 ? 0.6130 0.4680 0.5587 -0.0544 0.0517  0.0699  197 VAL A O   
1522 C CB  . VAL A 197 ? 0.6052 0.4727 0.5491 -0.0295 0.0533  0.0792  197 VAL A CB  
1523 C CG1 . VAL A 197 ? 0.5649 0.4464 0.5211 -0.0202 0.0493  0.0718  197 VAL A CG1 
1524 C CG2 . VAL A 197 ? 0.5822 0.4541 0.5209 -0.0220 0.0548  0.0861  197 VAL A CG2 
1525 N N   . THR A 198 ? 0.5568 0.4650 0.5292 -0.0516 0.0494  0.0666  198 THR A N   
1526 C CA  . THR A 198 ? 0.5392 0.4527 0.5190 -0.0558 0.0462  0.0599  198 THR A CA  
1527 C C   . THR A 198 ? 0.5202 0.4451 0.5094 -0.0426 0.0430  0.0547  198 THR A C   
1528 O O   . THR A 198 ? 0.4969 0.4419 0.4952 -0.0362 0.0423  0.0545  198 THR A O   
1529 C CB  . THR A 198 ? 0.5311 0.4688 0.5218 -0.0681 0.0459  0.0599  198 THR A CB  
1530 O OG1 . THR A 198 ? 0.5463 0.4738 0.5285 -0.0825 0.0486  0.0650  198 THR A OG1 
1531 C CG2 . THR A 198 ? 0.5032 0.4488 0.5015 -0.0719 0.0419  0.0536  198 THR A CG2 
1532 N N   . LEU A 199 ? 0.5259 0.4366 0.5114 -0.0389 0.0414  0.0507  199 LEU A N   
1533 C CA  . LEU A 199 ? 0.5208 0.4416 0.5150 -0.0286 0.0385  0.0463  199 LEU A CA  
1534 C C   . LEU A 199 ? 0.5126 0.4494 0.5167 -0.0345 0.0358  0.0420  199 LEU A C   
1535 O O   . LEU A 199 ? 0.5312 0.4624 0.5318 -0.0448 0.0354  0.0407  199 LEU A O   
1536 C CB  . LEU A 199 ? 0.5253 0.4263 0.5113 -0.0219 0.0388  0.0444  199 LEU A CB  
1537 C CG  . LEU A 199 ? 0.5630 0.4434 0.5366 -0.0147 0.0415  0.0487  199 LEU A CG  
1538 C CD1 . LEU A 199 ? 0.5291 0.3956 0.4973 -0.0061 0.0419  0.0459  199 LEU A CD1 
1539 C CD2 . LEU A 199 ? 0.5666 0.4587 0.5441 -0.0059 0.0413  0.0529  199 LEU A CD2 
1540 N N   . PHE A 200 ? 0.4898 0.4458 0.5053 -0.0282 0.0335  0.0399  200 PHE A N   
1541 C CA  . PHE A 200 ? 0.4779 0.4467 0.5018 -0.0308 0.0305  0.0361  200 PHE A CA  
1542 C C   . PHE A 200 ? 0.4696 0.4446 0.4998 -0.0211 0.0281  0.0335  200 PHE A C   
1543 O O   . PHE A 200 ? 0.4664 0.4426 0.4974 -0.0135 0.0283  0.0346  200 PHE A O   
1544 C CB  . PHE A 200 ? 0.4700 0.4586 0.5017 -0.0381 0.0303  0.0372  200 PHE A CB  
1545 C CG  . PHE A 200 ? 0.4388 0.4459 0.4785 -0.0313 0.0307  0.0382  200 PHE A CG  
1546 C CD1 . PHE A 200 ? 0.4268 0.4311 0.4626 -0.0260 0.0331  0.0408  200 PHE A CD1 
1547 C CD2 . PHE A 200 ? 0.4052 0.4325 0.4551 -0.0302 0.0289  0.0367  200 PHE A CD2 
1548 C CE1 . PHE A 200 ? 0.4207 0.4407 0.4615 -0.0198 0.0336  0.0408  200 PHE A CE1 
1549 C CE2 . PHE A 200 ? 0.3873 0.4295 0.4424 -0.0229 0.0299  0.0370  200 PHE A CE2 
1550 C CZ  . PHE A 200 ? 0.3754 0.4134 0.4254 -0.0181 0.0322  0.0386  200 PHE A CZ  
1551 N N   . GLY A 201 ? 0.4640 0.4421 0.4975 -0.0220 0.0256  0.0304  201 GLY A N   
1552 C CA  . GLY A 201 ? 0.4570 0.4395 0.4956 -0.0146 0.0234  0.0286  201 GLY A CA  
1553 C C   . GLY A 201 ? 0.4572 0.4444 0.4986 -0.0173 0.0209  0.0262  201 GLY A C   
1554 O O   . GLY A 201 ? 0.4675 0.4521 0.5051 -0.0248 0.0207  0.0254  201 GLY A O   
1555 N N   . GLU A 202 ? 0.4466 0.4396 0.4932 -0.0120 0.0187  0.0253  202 GLU A N   
1556 C CA  . GLU A 202 ? 0.4464 0.4445 0.4952 -0.0136 0.0161  0.0240  202 GLU A CA  
1557 C C   . GLU A 202 ? 0.4537 0.4459 0.5010 -0.0095 0.0159  0.0236  202 GLU A C   
1558 O O   . GLU A 202 ? 0.4545 0.4449 0.5035 -0.0045 0.0165  0.0244  202 GLU A O   
1559 C CB  . GLU A 202 ? 0.4366 0.4494 0.4932 -0.0115 0.0138  0.0245  202 GLU A CB  
1560 C CG  . GLU A 202 ? 0.4402 0.4599 0.4992 -0.0119 0.0105  0.0242  202 GLU A CG  
1561 C CD  . GLU A 202 ? 0.4444 0.4604 0.5042 -0.0063 0.0090  0.0244  202 GLU A CD  
1562 O OE1 . GLU A 202 ? 0.4432 0.4532 0.5029 -0.0027 0.0100  0.0245  202 GLU A OE1 
1563 O OE2 . GLU A 202 ? 0.4309 0.4502 0.4909 -0.0062 0.0065  0.0250  202 GLU A OE2 
1564 N N   . SER A 203 ? 0.4590 0.4498 0.5031 -0.0120 0.0149  0.0225  203 SER A N   
1565 C CA  . SER A 203 ? 0.4584 0.4452 0.5005 -0.0087 0.0155  0.0225  203 SER A CA  
1566 C C   . SER A 203 ? 0.4591 0.4359 0.4964 -0.0055 0.0193  0.0225  203 SER A C   
1567 O O   . SER A 203 ? 0.4729 0.4396 0.5022 -0.0076 0.0215  0.0212  203 SER A O   
1568 C CB  . SER A 203 ? 0.4513 0.4451 0.5005 -0.0048 0.0132  0.0243  203 SER A CB  
1569 O OG  . SER A 203 ? 0.4762 0.4696 0.5238 -0.0044 0.0128  0.0252  203 SER A OG  
1570 N N   . ALA A 204 ? 0.4528 0.4325 0.4945 -0.0004 0.0199  0.0242  204 ALA A N   
1571 C CA  . ALA A 204 ? 0.4560 0.4303 0.4951 0.0045  0.0232  0.0251  204 ALA A CA  
1572 C C   . ALA A 204 ? 0.4635 0.4324 0.5002 0.0052  0.0242  0.0257  204 ALA A C   
1573 O O   . ALA A 204 ? 0.4738 0.4342 0.5048 0.0092  0.0273  0.0264  204 ALA A O   
1574 C CB  . ALA A 204 ? 0.4438 0.4270 0.4903 0.0083  0.0226  0.0274  204 ALA A CB  
1575 N N   . GLY A 205 ? 0.4550 0.4290 0.4954 0.0022  0.0220  0.0258  205 GLY A N   
1576 C CA  . GLY A 205 ? 0.4552 0.4252 0.4927 0.0016  0.0232  0.0269  205 GLY A CA  
1577 C C   . GLY A 205 ? 0.4748 0.4328 0.5032 -0.0037 0.0253  0.0259  205 GLY A C   
1578 O O   . GLY A 205 ? 0.4927 0.4387 0.5135 -0.0027 0.0279  0.0271  205 GLY A O   
1579 N N   . ALA A 206 ? 0.4726 0.4329 0.5006 -0.0096 0.0237  0.0238  206 ALA A N   
1580 C CA  . ALA A 206 ? 0.4895 0.4381 0.5078 -0.0166 0.0247  0.0221  206 ALA A CA  
1581 C C   . ALA A 206 ? 0.5057 0.4374 0.5130 -0.0128 0.0278  0.0206  206 ALA A C   
1582 O O   . ALA A 206 ? 0.5244 0.4385 0.5204 -0.0152 0.0301  0.0201  206 ALA A O   
1583 C CB  . ALA A 206 ? 0.4866 0.4442 0.5070 -0.0237 0.0214  0.0201  206 ALA A CB  
1584 N N   . ALA A 207 ? 0.4931 0.4288 0.5028 -0.0065 0.0282  0.0201  207 ALA A N   
1585 C CA  . ALA A 207 ? 0.5096 0.4311 0.5087 -0.0011 0.0320  0.0187  207 ALA A CA  
1586 C C   . ALA A 207 ? 0.5208 0.4333 0.5168 0.0060  0.0351  0.0213  207 ALA A C   
1587 O O   . ALA A 207 ? 0.5386 0.4318 0.5215 0.0088  0.0385  0.0203  207 ALA A O   
1588 C CB  . ALA A 207 ? 0.4980 0.4288 0.5011 0.0041  0.0326  0.0186  207 ALA A CB  
1589 N N   . SER A 208 ? 0.5096 0.4349 0.5163 0.0091  0.0337  0.0247  208 SER A N   
1590 C CA  . SER A 208 ? 0.5145 0.4346 0.5191 0.0160  0.0356  0.0281  208 SER A CA  
1591 C C   . SER A 208 ? 0.5255 0.4274 0.5187 0.0113  0.0371  0.0286  208 SER A C   
1592 O O   . SER A 208 ? 0.5480 0.4330 0.5306 0.0170  0.0403  0.0301  208 SER A O   
1593 C CB  . SER A 208 ? 0.5038 0.4413 0.5205 0.0178  0.0327  0.0310  208 SER A CB  
1594 O OG  . SER A 208 ? 0.4946 0.4464 0.5204 0.0220  0.0315  0.0313  208 SER A OG  
1595 N N   . VAL A 209 ? 0.5148 0.4201 0.5099 0.0011  0.0349  0.0279  209 VAL A N   
1596 C CA  . VAL A 209 ? 0.5260 0.4169 0.5118 -0.0059 0.0362  0.0292  209 VAL A CA  
1597 C C   . VAL A 209 ? 0.5582 0.4239 0.5276 -0.0071 0.0387  0.0264  209 VAL A C   
1598 O O   . VAL A 209 ? 0.5814 0.4261 0.5384 -0.0051 0.0416  0.0285  209 VAL A O   
1599 C CB  . VAL A 209 ? 0.5135 0.4169 0.5057 -0.0174 0.0335  0.0287  209 VAL A CB  
1600 C CG1 . VAL A 209 ? 0.5242 0.4120 0.5056 -0.0281 0.0348  0.0295  209 VAL A CG1 
1601 C CG2 . VAL A 209 ? 0.4967 0.4195 0.5008 -0.0148 0.0321  0.0315  209 VAL A CG2 
1602 N N   . GLY A 210 ? 0.5528 0.4194 0.5207 -0.0096 0.0377  0.0217  210 GLY A N   
1603 C CA  . GLY A 210 ? 0.5754 0.4182 0.5262 -0.0104 0.0399  0.0176  210 GLY A CA  
1604 C C   . GLY A 210 ? 0.5946 0.4217 0.5362 0.0034  0.0445  0.0185  210 GLY A C   
1605 O O   . GLY A 210 ? 0.6374 0.4367 0.5611 0.0041  0.0473  0.0169  210 GLY A O   
1606 N N   . MET A 211 ? 0.5747 0.4189 0.5279 0.0146  0.0452  0.0214  211 MET A N   
1607 C CA  . MET A 211 ? 0.5900 0.4248 0.5370 0.0292  0.0495  0.0234  211 MET A CA  
1608 C C   . MET A 211 ? 0.5971 0.4173 0.5373 0.0330  0.0510  0.0282  211 MET A C   
1609 O O   . MET A 211 ? 0.6185 0.4178 0.5450 0.0429  0.0550  0.0290  211 MET A O   
1610 C CB  . MET A 211 ? 0.5724 0.4329 0.5348 0.0386  0.0495  0.0255  211 MET A CB  
1611 C CG  . MET A 211 ? 0.5980 0.4639 0.5601 0.0386  0.0504  0.0213  211 MET A CG  
1612 S SD  . MET A 211 ? 0.6438 0.5426 0.6259 0.0424  0.0488  0.0240  211 MET A SD  
1613 C CE  . MET A 211 ? 0.6254 0.5259 0.6038 0.0357  0.0486  0.0190  211 MET A CE  
1614 N N   . HIS A 212 ? 0.5811 0.4110 0.5291 0.0259  0.0482  0.0316  212 HIS A N   
1615 C CA  . HIS A 212 ? 0.5965 0.4104 0.5355 0.0276  0.0497  0.0367  212 HIS A CA  
1616 C C   . HIS A 212 ? 0.6331 0.4150 0.5527 0.0193  0.0516  0.0347  212 HIS A C   
1617 O O   . HIS A 212 ? 0.6678 0.4252 0.5727 0.0248  0.0546  0.0379  212 HIS A O   
1618 C CB  . HIS A 212 ? 0.5704 0.4027 0.5209 0.0225  0.0468  0.0409  212 HIS A CB  
1619 C CG  . HIS A 212 ? 0.5352 0.3940 0.5013 0.0310  0.0446  0.0430  212 HIS A CG  
1620 N ND1 . HIS A 212 ? 0.5267 0.3873 0.4927 0.0448  0.0459  0.0468  212 HIS A ND1 
1621 C CD2 . HIS A 212 ? 0.4903 0.3742 0.4718 0.0275  0.0411  0.0415  212 HIS A CD2 
1622 C CE1 . HIS A 212 ? 0.5028 0.3895 0.4839 0.0476  0.0427  0.0475  212 HIS A CE1 
1623 N NE2 . HIS A 212 ? 0.4707 0.3698 0.4606 0.0373  0.0399  0.0441  212 HIS A NE2 
1624 N N   . ILE A 213 ? 0.6418 0.4228 0.5601 0.0059  0.0496  0.0296  213 ILE A N   
1625 C CA  . ILE A 213 ? 0.6763 0.4261 0.5750 -0.0043 0.0506  0.0269  213 ILE A CA  
1626 C C   . ILE A 213 ? 0.7079 0.4293 0.5879 0.0070  0.0547  0.0235  213 ILE A C   
1627 O O   . ILE A 213 ? 0.7463 0.4338 0.6059 0.0049  0.0570  0.0233  213 ILE A O   
1628 C CB  . ILE A 213 ? 0.6731 0.4311 0.5747 -0.0212 0.0468  0.0218  213 ILE A CB  
1629 C CG1 . ILE A 213 ? 0.6494 0.4312 0.5662 -0.0323 0.0437  0.0257  213 ILE A CG1 
1630 C CG2 . ILE A 213 ? 0.6854 0.4097 0.5647 -0.0319 0.0472  0.0173  213 ILE A CG2 
1631 C CD1 . ILE A 213 ? 0.6262 0.4228 0.5492 -0.0470 0.0395  0.0216  213 ILE A CD1 
1632 N N   . LEU A 214 ? 0.6980 0.4328 0.5842 0.0193  0.0560  0.0211  214 LEU A N   
1633 C CA  . LEU A 214 ? 0.7243 0.4361 0.5934 0.0305  0.0604  0.0167  214 LEU A CA  
1634 C C   . LEU A 214 ? 0.7380 0.4446 0.6044 0.0505  0.0648  0.0217  214 LEU A C   
1635 O O   . LEU A 214 ? 0.7601 0.4474 0.6118 0.0630  0.0695  0.0189  214 LEU A O   
1636 C CB  . LEU A 214 ? 0.7097 0.4399 0.5857 0.0317  0.0599  0.0112  214 LEU A CB  
1637 C CG  . LEU A 214 ? 0.7039 0.4378 0.5794 0.0141  0.0555  0.0056  214 LEU A CG  
1638 C CD1 . LEU A 214 ? 0.6518 0.4076 0.5360 0.0174  0.0550  0.0022  214 LEU A CD1 
1639 C CD2 . LEU A 214 ? 0.7107 0.4072 0.5606 0.0051  0.0560  -0.0001 214 LEU A CD2 
1640 N N   . SER A 215 ? 0.7240 0.4485 0.6041 0.0542  0.0634  0.0290  215 SER A N   
1641 C CA  . SER A 215 ? 0.7336 0.4600 0.6144 0.0732  0.0664  0.0348  215 SER A CA  
1642 C C   . SER A 215 ? 0.7681 0.4717 0.6370 0.0735  0.0670  0.0410  215 SER A C   
1643 O O   . SER A 215 ? 0.7508 0.4653 0.6280 0.0633  0.0637  0.0450  215 SER A O   
1644 C CB  . SER A 215 ? 0.6947 0.4628 0.6007 0.0777  0.0636  0.0384  215 SER A CB  
1645 O OG  . SER A 215 ? 0.6670 0.4436 0.5760 0.0965  0.0663  0.0428  215 SER A OG  
1646 N N   . LEU A 216 ? 0.8227 0.4939 0.6711 0.0859  0.0716  0.0422  216 LEU A N   
1647 C CA  . LEU A 216 ? 0.8658 0.5051 0.6966 0.0846  0.0727  0.0478  216 LEU A CA  
1648 C C   . LEU A 216 ? 0.8513 0.5102 0.6941 0.0874  0.0704  0.0572  216 LEU A C   
1649 O O   . LEU A 216 ? 0.8611 0.5127 0.7009 0.0740  0.0686  0.0607  216 LEU A O   
1650 C CB  . LEU A 216 ? 0.9154 0.5146 0.7207 0.1007  0.0783  0.0476  216 LEU A CB  
1651 C CG  . LEU A 216 ? 0.9866 0.5454 0.7695 0.0982  0.0797  0.0536  216 LEU A CG  
1652 C CD1 . LEU A 216 ? 1.0079 0.5432 0.7792 0.0725  0.0776  0.0501  216 LEU A CD1 
1653 C CD2 . LEU A 216 ? 1.0620 0.5815 0.8197 0.1190  0.0855  0.0546  216 LEU A CD2 
1654 N N   . PRO A 217 ? 0.8334 0.5192 0.6901 0.1040  0.0702  0.0614  217 PRO A N   
1655 C CA  . PRO A 217 ? 0.8169 0.5217 0.6836 0.1056  0.0671  0.0697  217 PRO A CA  
1656 C C   . PRO A 217 ? 0.7851 0.5118 0.6659 0.0866  0.0626  0.0692  217 PRO A C   
1657 O O   . PRO A 217 ? 0.7892 0.5220 0.6717 0.0849  0.0608  0.0757  217 PRO A O   
1658 C CB  . PRO A 217 ? 0.7974 0.5348 0.6805 0.1228  0.0663  0.0721  217 PRO A CB  
1659 C CG  . PRO A 217 ? 0.8143 0.5362 0.6873 0.1366  0.0714  0.0684  217 PRO A CG  
1660 C CD  . PRO A 217 ? 0.8254 0.5259 0.6883 0.1217  0.0727  0.0595  217 PRO A CD  
1661 N N   . SER A 218 ? 0.7590 0.4973 0.6489 0.0734  0.0609  0.0619  218 SER A N   
1662 C CA  . SER A 218 ? 0.7312 0.4916 0.6348 0.0578  0.0569  0.0615  218 SER A CA  
1663 C C   . SER A 218 ? 0.7519 0.4907 0.6436 0.0413  0.0575  0.0618  218 SER A C   
1664 O O   . SER A 218 ? 0.7317 0.4856 0.6314 0.0306  0.0555  0.0639  218 SER A O   
1665 C CB  . SER A 218 ? 0.6961 0.4829 0.6167 0.0521  0.0542  0.0547  218 SER A CB  
1666 O OG  . SER A 218 ? 0.6670 0.4792 0.6016 0.0641  0.0530  0.0555  218 SER A OG  
1667 N N   . ARG A 219 ? 0.7889 0.4923 0.6607 0.0393  0.0606  0.0597  219 ARG A N   
1668 C CA  . ARG A 219 ? 0.8156 0.4987 0.6763 0.0205  0.0606  0.0589  219 ARG A CA  
1669 C C   . ARG A 219 ? 0.8256 0.5022 0.6810 0.0139  0.0612  0.0675  219 ARG A C   
1670 O O   . ARG A 219 ? 0.8307 0.5113 0.6882 -0.0038 0.0602  0.0678  219 ARG A O   
1671 C CB  . ARG A 219 ? 0.8551 0.4989 0.6935 0.0192  0.0633  0.0539  219 ARG A CB  
1672 C CG  . ARG A 219 ? 0.8674 0.5203 0.7109 0.0152  0.0618  0.0441  219 ARG A CG  
1673 C CD  . ARG A 219 ? 0.8837 0.5580 0.7400 -0.0055 0.0576  0.0411  219 ARG A CD  
1674 N NE  . ARG A 219 ? 0.9354 0.5835 0.7760 -0.0239 0.0574  0.0406  219 ARG A NE  
1675 C CZ  . ARG A 219 ? 1.0014 0.6215 0.8243 -0.0314 0.0574  0.0338  219 ARG A CZ  
1676 N NH1 . ARG A 219 ? 0.9873 0.6024 0.8055 -0.0209 0.0583  0.0269  219 ARG A NH1 
1677 N NH2 . ARG A 219 ? 1.0467 0.6438 0.8557 -0.0503 0.0566  0.0340  219 ARG A NH2 
1678 N N   . SER A 220 ? 0.8295 0.4987 0.6786 0.0284  0.0629  0.0749  220 SER A N   
1679 C CA  . SER A 220 ? 0.8356 0.4986 0.6781 0.0247  0.0638  0.0843  220 SER A CA  
1680 C C   . SER A 220 ? 0.7931 0.4956 0.6553 0.0213  0.0610  0.0868  220 SER A C   
1681 O O   . SER A 220 ? 0.7967 0.4992 0.6546 0.0183  0.0619  0.0946  220 SER A O   
1682 C CB  . SER A 220 ? 0.8651 0.5071 0.6932 0.0438  0.0662  0.0916  220 SER A CB  
1683 O OG  . SER A 220 ? 0.8553 0.5199 0.6958 0.0622  0.0648  0.0900  220 SER A OG  
1684 N N   . LEU A 221 ? 0.7509 0.4856 0.6330 0.0223  0.0579  0.0805  221 LEU A N   
1685 C CA  . LEU A 221 ? 0.7053 0.4756 0.6048 0.0216  0.0550  0.0816  221 LEU A CA  
1686 C C   . LEU A 221 ? 0.6803 0.4686 0.5907 0.0052  0.0538  0.0777  221 LEU A C   
1687 O O   . LEU A 221 ? 0.6612 0.4753 0.5830 0.0038  0.0522  0.0788  221 LEU A O   
1688 C CB  . LEU A 221 ? 0.6834 0.4782 0.5973 0.0353  0.0521  0.0786  221 LEU A CB  
1689 C CG  . LEU A 221 ? 0.7052 0.4904 0.6123 0.0538  0.0529  0.0825  221 LEU A CG  
1690 C CD1 . LEU A 221 ? 0.6608 0.4746 0.5851 0.0634  0.0497  0.0786  221 LEU A CD1 
1691 C CD2 . LEU A 221 ? 0.6760 0.4545 0.5731 0.0607  0.0534  0.0922  221 LEU A CD2 
1692 N N   . PHE A 222 ? 0.6843 0.4594 0.5905 -0.0068 0.0544  0.0732  222 PHE A N   
1693 C CA  . PHE A 222 ? 0.6708 0.4642 0.5873 -0.0228 0.0532  0.0703  222 PHE A CA  
1694 C C   . PHE A 222 ? 0.7007 0.4700 0.6044 -0.0388 0.0546  0.0698  222 PHE A C   
1695 O O   . PHE A 222 ? 0.7265 0.4624 0.6127 -0.0369 0.0564  0.0700  222 PHE A O   
1696 C CB  . PHE A 222 ? 0.6358 0.4545 0.5694 -0.0209 0.0497  0.0627  222 PHE A CB  
1697 C CG  . PHE A 222 ? 0.6296 0.4333 0.5583 -0.0196 0.0492  0.0563  222 PHE A CG  
1698 C CD1 . PHE A 222 ? 0.6168 0.4109 0.5412 -0.0044 0.0500  0.0553  222 PHE A CD1 
1699 C CD2 . PHE A 222 ? 0.6237 0.4255 0.5521 -0.0331 0.0479  0.0513  222 PHE A CD2 
1700 C CE1 . PHE A 222 ? 0.6221 0.4031 0.5408 -0.0021 0.0504  0.0494  222 PHE A CE1 
1701 C CE2 . PHE A 222 ? 0.6391 0.4267 0.5608 -0.0317 0.0475  0.0451  222 PHE A CE2 
1702 C CZ  . PHE A 222 ? 0.6546 0.4312 0.5710 -0.0157 0.0491  0.0440  222 PHE A CZ  
1703 N N   . HIS A 223 ? 0.7005 0.4865 0.6125 -0.0545 0.0538  0.0691  223 HIS A N   
1704 C CA  . HIS A 223 ? 0.7446 0.5103 0.6449 -0.0726 0.0546  0.0694  223 HIS A CA  
1705 C C   . HIS A 223 ? 0.7352 0.5158 0.6450 -0.0847 0.0511  0.0622  223 HIS A C   
1706 O O   . HIS A 223 ? 0.7718 0.5318 0.6701 -0.0982 0.0503  0.0597  223 HIS A O   
1707 C CB  . HIS A 223 ? 0.7586 0.5264 0.6558 -0.0835 0.0575  0.0782  223 HIS A CB  
1708 C CG  . HIS A 223 ? 0.8020 0.5606 0.6911 -0.0708 0.0604  0.0860  223 HIS A CG  
1709 N ND1 . HIS A 223 ? 0.8463 0.5665 0.7136 -0.0689 0.0631  0.0914  223 HIS A ND1 
1710 C CD2 . HIS A 223 ? 0.8002 0.5822 0.6991 -0.0585 0.0605  0.0889  223 HIS A CD2 
1711 C CE1 . HIS A 223 ? 0.8635 0.5863 0.7285 -0.0558 0.0647  0.0981  223 HIS A CE1 
1712 N NE2 . HIS A 223 ? 0.8332 0.5935 0.7170 -0.0498 0.0629  0.0964  223 HIS A NE2 
1713 N N   . ARG A 224 ? 0.6947 0.5095 0.6240 -0.0799 0.0486  0.0590  224 ARG A N   
1714 C CA  . ARG A 224 ? 0.6825 0.5158 0.6224 -0.0894 0.0449  0.0531  224 ARG A CA  
1715 C C   . ARG A 224 ? 0.6435 0.4983 0.5975 -0.0754 0.0423  0.0482  224 ARG A C   
1716 O O   . ARG A 224 ? 0.6278 0.4888 0.5862 -0.0615 0.0433  0.0500  224 ARG A O   
1717 C CB  . ARG A 224 ? 0.6776 0.5365 0.6283 -0.1037 0.0449  0.0569  224 ARG A CB  
1718 C CG  . ARG A 224 ? 0.7463 0.5868 0.6845 -0.1231 0.0460  0.0603  224 ARG A CG  
1719 C CD  . ARG A 224 ? 0.7914 0.6598 0.7406 -0.1354 0.0477  0.0668  224 ARG A CD  
1720 N NE  . ARG A 224 ? 0.8355 0.7067 0.7838 -0.1270 0.0524  0.0741  224 ARG A NE  
1721 C CZ  . ARG A 224 ? 0.8687 0.7150 0.8013 -0.1317 0.0562  0.0812  224 ARG A CZ  
1722 N NH1 . ARG A 224 ? 0.8976 0.7114 0.8131 -0.1454 0.0563  0.0820  224 ARG A NH1 
1723 N NH2 . ARG A 224 ? 0.8718 0.7244 0.8042 -0.1226 0.0599  0.0877  224 ARG A NH2 
1724 N N   . ALA A 225 ? 0.6208 0.4863 0.5811 -0.0798 0.0388  0.0424  225 ALA A N   
1725 C CA  . ALA A 225 ? 0.5892 0.4685 0.5593 -0.0677 0.0366  0.0380  225 ALA A CA  
1726 C C   . ALA A 225 ? 0.5693 0.4731 0.5518 -0.0742 0.0326  0.0346  225 ALA A C   
1727 O O   . ALA A 225 ? 0.5745 0.4768 0.5535 -0.0881 0.0306  0.0330  225 ALA A O   
1728 C CB  . ALA A 225 ? 0.5995 0.4538 0.5570 -0.0602 0.0372  0.0341  225 ALA A CB  
1729 N N   . VAL A 226 ? 0.5332 0.4590 0.5294 -0.0644 0.0311  0.0338  226 VAL A N   
1730 C CA  . VAL A 226 ? 0.5186 0.4672 0.5264 -0.0670 0.0273  0.0312  226 VAL A CA  
1731 C C   . VAL A 226 ? 0.5069 0.4560 0.5172 -0.0559 0.0256  0.0276  226 VAL A C   
1732 O O   . VAL A 226 ? 0.5085 0.4583 0.5219 -0.0448 0.0268  0.0286  226 VAL A O   
1733 C CB  . VAL A 226 ? 0.5026 0.4788 0.5245 -0.0659 0.0273  0.0344  226 VAL A CB  
1734 C CG1 . VAL A 226 ? 0.4900 0.4894 0.5234 -0.0666 0.0232  0.0321  226 VAL A CG1 
1735 C CG2 . VAL A 226 ? 0.5168 0.4956 0.5369 -0.0772 0.0299  0.0390  226 VAL A CG2 
1736 N N   . LEU A 227 ? 0.5066 0.4559 0.5151 -0.0597 0.0226  0.0238  227 LEU A N   
1737 C CA  . LEU A 227 ? 0.4920 0.4412 0.5014 -0.0508 0.0214  0.0210  227 LEU A CA  
1738 C C   . LEU A 227 ? 0.4746 0.4461 0.4946 -0.0519 0.0171  0.0202  227 LEU A C   
1739 O O   . LEU A 227 ? 0.4845 0.4595 0.5020 -0.0607 0.0141  0.0183  227 LEU A O   
1740 C CB  . LEU A 227 ? 0.5086 0.4343 0.5025 -0.0523 0.0223  0.0171  227 LEU A CB  
1741 C CG  . LEU A 227 ? 0.5200 0.4209 0.5017 -0.0463 0.0267  0.0175  227 LEU A CG  
1742 C CD1 . LEU A 227 ? 0.5227 0.4074 0.4947 -0.0554 0.0284  0.0192  227 LEU A CD1 
1743 C CD2 . LEU A 227 ? 0.4968 0.3807 0.4663 -0.0416 0.0281  0.0132  227 LEU A CD2 
1744 N N   . GLN A 228 ? 0.4574 0.4426 0.4879 -0.0428 0.0166  0.0217  228 GLN A N   
1745 C CA  . GLN A 228 ? 0.4499 0.4551 0.4901 -0.0415 0.0128  0.0219  228 GLN A CA  
1746 C C   . GLN A 228 ? 0.4568 0.4587 0.4956 -0.0353 0.0113  0.0204  228 GLN A C   
1747 O O   . GLN A 228 ? 0.4584 0.4562 0.4988 -0.0271 0.0128  0.0210  228 GLN A O   
1748 C CB  . GLN A 228 ? 0.4347 0.4551 0.4856 -0.0354 0.0133  0.0245  228 GLN A CB  
1749 C CG  . GLN A 228 ? 0.4439 0.4687 0.4959 -0.0408 0.0159  0.0268  228 GLN A CG  
1750 C CD  . GLN A 228 ? 0.4450 0.4851 0.5057 -0.0340 0.0171  0.0288  228 GLN A CD  
1751 O OE1 . GLN A 228 ? 0.4515 0.4936 0.5118 -0.0360 0.0203  0.0311  228 GLN A OE1 
1752 N NE2 . GLN A 228 ? 0.4302 0.4796 0.4971 -0.0256 0.0149  0.0281  228 GLN A NE2 
1753 N N   . SER A 229 ? 0.4597 0.4641 0.4949 -0.0399 0.0082  0.0188  229 SER A N   
1754 C CA  . SER A 229 ? 0.4593 0.4629 0.4929 -0.0347 0.0068  0.0183  229 SER A CA  
1755 C C   . SER A 229 ? 0.4674 0.4549 0.4942 -0.0294 0.0106  0.0173  229 SER A C   
1756 O O   . SER A 229 ? 0.4670 0.4566 0.4976 -0.0226 0.0109  0.0188  229 SER A O   
1757 C CB  . SER A 229 ? 0.4499 0.4677 0.4941 -0.0275 0.0047  0.0211  229 SER A CB  
1758 O OG  . SER A 229 ? 0.4677 0.5030 0.5192 -0.0299 0.0017  0.0225  229 SER A OG  
1759 N N   . GLY A 230 ? 0.4783 0.4499 0.4950 -0.0323 0.0135  0.0151  230 GLY A N   
1760 C CA  . GLY A 230 ? 0.4745 0.4326 0.4848 -0.0258 0.0176  0.0144  230 GLY A CA  
1761 C C   . GLY A 230 ? 0.4960 0.4340 0.4928 -0.0286 0.0207  0.0117  230 GLY A C   
1762 O O   . GLY A 230 ? 0.5020 0.4355 0.4962 -0.0358 0.0201  0.0115  230 GLY A O   
1763 N N   . THR A 231 ? 0.5012 0.4269 0.4888 -0.0226 0.0242  0.0100  231 THR A N   
1764 C CA  . THR A 231 ? 0.5227 0.4251 0.4944 -0.0229 0.0276  0.0069  231 THR A CA  
1765 C C   . THR A 231 ? 0.5243 0.4183 0.4915 -0.0109 0.0329  0.0073  231 THR A C   
1766 O O   . THR A 231 ? 0.5146 0.4207 0.4886 -0.0045 0.0338  0.0089  231 THR A O   
1767 C CB  . THR A 231 ? 0.5513 0.4434 0.5085 -0.0310 0.0258  0.0017  231 THR A CB  
1768 O OG1 . THR A 231 ? 0.5594 0.4581 0.5150 -0.0264 0.0260  0.0005  231 THR A OG1 
1769 C CG2 . THR A 231 ? 0.5258 0.4279 0.4871 -0.0438 0.0203  0.0015  231 THR A CG2 
1770 N N   . PRO A 232 ? 0.5461 0.4192 0.5015 -0.0076 0.0367  0.0064  232 PRO A N   
1771 C CA  . PRO A 232 ? 0.5446 0.4127 0.4965 0.0057  0.0420  0.0072  232 PRO A CA  
1772 C C   . PRO A 232 ? 0.5574 0.4192 0.4974 0.0090  0.0446  0.0027  232 PRO A C   
1773 O O   . PRO A 232 ? 0.5602 0.4303 0.5034 0.0191  0.0482  0.0042  232 PRO A O   
1774 C CB  . PRO A 232 ? 0.5598 0.4055 0.5008 0.0090  0.0450  0.0077  232 PRO A CB  
1775 C CG  . PRO A 232 ? 0.5700 0.4006 0.5008 -0.0046 0.0422  0.0048  232 PRO A CG  
1776 C CD  . PRO A 232 ? 0.5609 0.4143 0.5056 -0.0149 0.0366  0.0054  232 PRO A CD  
1777 N N   . ASN A 233 ? 0.5717 0.4205 0.4979 0.0001  0.0426  -0.0026 233 ASN A N   
1778 C CA  . ASN A 233 ? 0.5907 0.4353 0.5046 0.0015  0.0441  -0.0072 233 ASN A CA  
1779 C C   . ASN A 233 ? 0.5803 0.4505 0.5072 -0.0021 0.0403  -0.0050 233 ASN A C   
1780 O O   . ASN A 233 ? 0.5611 0.4481 0.5042 -0.0069 0.0360  -0.0010 233 ASN A O   
1781 C CB  . ASN A 233 ? 0.6105 0.4316 0.5038 -0.0088 0.0420  -0.0140 233 ASN A CB  
1782 C CG  . ASN A 233 ? 0.6059 0.4353 0.5067 -0.0243 0.0349  -0.0133 233 ASN A CG  
1783 O OD1 . ASN A 233 ? 0.5653 0.3985 0.4765 -0.0269 0.0338  -0.0093 233 ASN A OD1 
1784 N ND2 . ASN A 233 ? 0.5898 0.4246 0.4857 -0.0340 0.0300  -0.0168 233 ASN A ND2 
1785 N N   . GLY A 234 ? 0.5905 0.4622 0.5088 0.0005  0.0420  -0.0075 234 GLY A N   
1786 C CA  . GLY A 234 ? 0.5795 0.4725 0.5073 -0.0024 0.0388  -0.0047 234 GLY A CA  
1787 C C   . GLY A 234 ? 0.5735 0.4803 0.5092 0.0079  0.0438  -0.0004 234 GLY A C   
1788 O O   . GLY A 234 ? 0.5828 0.4857 0.5188 0.0174  0.0493  0.0006  234 GLY A O   
1789 N N   . PRO A 235 ? 0.5561 0.4801 0.4989 0.0060  0.0417  0.0030  235 PRO A N   
1790 C CA  . PRO A 235 ? 0.5472 0.4838 0.4942 0.0135  0.0468  0.0070  235 PRO A CA  
1791 C C   . PRO A 235 ? 0.5263 0.4787 0.4929 0.0174  0.0477  0.0136  235 PRO A C   
1792 O O   . PRO A 235 ? 0.5277 0.4918 0.4986 0.0231  0.0524  0.0172  235 PRO A O   
1793 C CB  . PRO A 235 ? 0.5460 0.4920 0.4905 0.0080  0.0435  0.0085  235 PRO A CB  
1794 C CG  . PRO A 235 ? 0.5448 0.4917 0.4944 -0.0012 0.0355  0.0082  235 PRO A CG  
1795 C CD  . PRO A 235 ? 0.5500 0.4817 0.4950 -0.0035 0.0347  0.0034  235 PRO A CD  
1796 N N   . TRP A 236 ? 0.5078 0.4619 0.4859 0.0140  0.0434  0.0152  236 TRP A N   
1797 C CA  . TRP A 236 ? 0.4843 0.4536 0.4799 0.0156  0.0426  0.0210  236 TRP A CA  
1798 C C   . TRP A 236 ? 0.4823 0.4493 0.4842 0.0199  0.0434  0.0215  236 TRP A C   
1799 O O   . TRP A 236 ? 0.4694 0.4490 0.4837 0.0225  0.0436  0.0258  236 TRP A O   
1800 C CB  . TRP A 236 ? 0.4621 0.4391 0.4669 0.0083  0.0362  0.0235  236 TRP A CB  
1801 C CG  . TRP A 236 ? 0.4585 0.4286 0.4626 0.0031  0.0314  0.0207  236 TRP A CG  
1802 C CD1 . TRP A 236 ? 0.4750 0.4409 0.4714 -0.0026 0.0280  0.0179  236 TRP A CD1 
1803 C CD2 . TRP A 236 ? 0.4749 0.4439 0.4865 0.0027  0.0296  0.0209  236 TRP A CD2 
1804 N NE1 . TRP A 236 ? 0.4525 0.4163 0.4524 -0.0069 0.0245  0.0166  236 TRP A NE1 
1805 C CE2 . TRP A 236 ? 0.4636 0.4284 0.4721 -0.0035 0.0257  0.0184  236 TRP A CE2 
1806 C CE3 . TRP A 236 ? 0.4757 0.4484 0.4961 0.0068  0.0306  0.0232  236 TRP A CE3 
1807 C CZ2 . TRP A 236 ? 0.4476 0.4118 0.4615 -0.0055 0.0237  0.0184  236 TRP A CZ2 
1808 C CZ3 . TRP A 236 ? 0.4797 0.4500 0.5039 0.0052  0.0283  0.0228  236 TRP A CZ3 
1809 C CH2 . TRP A 236 ? 0.4556 0.4216 0.4764 -0.0009 0.0253  0.0205  236 TRP A CH2 
1810 N N   . ALA A 237 ? 0.4899 0.4407 0.4828 0.0198  0.0435  0.0176  237 ALA A N   
1811 C CA  . ALA A 237 ? 0.4855 0.4333 0.4835 0.0230  0.0435  0.0189  237 ALA A CA  
1812 C C   . ALA A 237 ? 0.4906 0.4375 0.4867 0.0343  0.0492  0.0203  237 ALA A C   
1813 O O   . ALA A 237 ? 0.4849 0.4354 0.4882 0.0384  0.0490  0.0232  237 ALA A O   
1814 C CB  . ALA A 237 ? 0.4945 0.4260 0.4843 0.0174  0.0412  0.0157  237 ALA A CB  
1815 N N   . THR A 238 ? 0.4981 0.4412 0.4842 0.0404  0.0545  0.0185  238 THR A N   
1816 C CA  . THR A 238 ? 0.5129 0.4570 0.4974 0.0532  0.0606  0.0201  238 THR A CA  
1817 C C   . THR A 238 ? 0.5238 0.4837 0.5104 0.0591  0.0657  0.0220  238 THR A C   
1818 O O   . THR A 238 ? 0.5341 0.5017 0.5214 0.0526  0.0645  0.0220  238 THR A O   
1819 C CB  . THR A 238 ? 0.5405 0.4570 0.5056 0.0595  0.0644  0.0154  238 THR A CB  
1820 O OG1 . THR A 238 ? 0.5563 0.4575 0.5040 0.0563  0.0659  0.0094  238 THR A OG1 
1821 C CG2 . THR A 238 ? 0.5144 0.4169 0.4783 0.0541  0.0603  0.0152  238 THR A CG2 
1822 N N   . VAL A 239 ? 0.5260 0.4925 0.5140 0.0718  0.0714  0.0243  239 VAL A N   
1823 C CA  . VAL A 239 ? 0.5274 0.5098 0.5160 0.0791  0.0779  0.0262  239 VAL A CA  
1824 C C   . VAL A 239 ? 0.5553 0.5290 0.5332 0.0956  0.0854  0.0249  239 VAL A C   
1825 O O   . VAL A 239 ? 0.5581 0.5206 0.5344 0.1016  0.0848  0.0252  239 VAL A O   
1826 C CB  . VAL A 239 ? 0.5096 0.5253 0.5205 0.0764  0.0768  0.0339  239 VAL A CB  
1827 C CG1 . VAL A 239 ? 0.4681 0.4903 0.4848 0.0618  0.0714  0.0351  239 VAL A CG1 
1828 C CG2 . VAL A 239 ? 0.4613 0.4881 0.4868 0.0792  0.0736  0.0383  239 VAL A CG2 
1829 N N   . SER A 240 ? 0.5732 0.5508 0.5425 0.1039  0.0928  0.0236  240 SER A N   
1830 C CA  . SER A 240 ? 0.5984 0.5710 0.5584 0.1225  0.1010  0.0230  240 SER A CA  
1831 C C   . SER A 240 ? 0.5838 0.5860 0.5647 0.1316  0.1024  0.0311  240 SER A C   
1832 O O   . SER A 240 ? 0.5582 0.5877 0.5598 0.1229  0.0982  0.0371  240 SER A O   
1833 C CB  . SER A 240 ? 0.6110 0.5841 0.5570 0.1297  0.1092  0.0197  240 SER A CB  
1834 O OG  . SER A 240 ? 0.5951 0.6021 0.5574 0.1257  0.1107  0.0258  240 SER A OG  
1835 N N   . ALA A 241 ? 0.6106 0.6061 0.5847 0.1491  0.1079  0.0314  241 ALA A N   
1836 C CA  . ALA A 241 ? 0.6069 0.6340 0.5995 0.1608  0.1104  0.0394  241 ALA A CA  
1837 C C   . ALA A 241 ? 0.5947 0.6597 0.6026 0.1594  0.1144  0.0444  241 ALA A C   
1838 O O   . ALA A 241 ? 0.5760 0.6724 0.6067 0.1526  0.1104  0.0514  241 ALA A O   
1839 C CB  . ALA A 241 ? 0.6289 0.6416 0.6080 0.1829  0.1174  0.0386  241 ALA A CB  
1840 N N   . GLY A 242 ? 0.6097 0.6705 0.6038 0.1642  0.1219  0.0407  242 GLY A N   
1841 C CA  . GLY A 242 ? 0.6020 0.6980 0.6082 0.1635  0.1271  0.0459  242 GLY A CA  
1842 C C   . GLY A 242 ? 0.5749 0.6890 0.5983 0.1423  0.1196  0.0502  242 GLY A C   
1843 O O   . GLY A 242 ? 0.5605 0.7110 0.6043 0.1390  0.1204  0.0581  242 GLY A O   
1844 N N   . GLU A 243 ? 0.5629 0.6519 0.5780 0.1279  0.1123  0.0454  243 GLU A N   
1845 C CA  . GLU A 243 ? 0.5422 0.6433 0.5694 0.1094  0.1058  0.0488  243 GLU A CA  
1846 C C   . GLU A 243 ? 0.5218 0.6393 0.5705 0.1020  0.0982  0.0543  243 GLU A C   
1847 O O   . GLU A 243 ? 0.5055 0.6483 0.5709 0.0921  0.0958  0.0606  243 GLU A O   
1848 C CB  . GLU A 243 ? 0.5492 0.6213 0.5606 0.0981  0.1010  0.0423  243 GLU A CB  
1849 C CG  . GLU A 243 ? 0.5320 0.6109 0.5539 0.0799  0.0932  0.0455  243 GLU A CG  
1850 C CD  . GLU A 243 ? 0.5390 0.6421 0.5679 0.0744  0.0967  0.0517  243 GLU A CD  
1851 O OE1 . GLU A 243 ? 0.5382 0.6560 0.5643 0.0838  0.1056  0.0536  243 GLU A OE1 
1852 O OE2 . GLU A 243 ? 0.5351 0.6425 0.5723 0.0605  0.0905  0.0551  243 GLU A OE2 
1853 N N   . ALA A 244 ? 0.5202 0.6229 0.5673 0.1066  0.0944  0.0521  244 ALA A N   
1854 C CA  . ALA A 244 ? 0.5038 0.6227 0.5693 0.1021  0.0876  0.0571  244 ALA A CA  
1855 C C   . ALA A 244 ? 0.5055 0.6632 0.5896 0.1090  0.0910  0.0650  244 ALA A C   
1856 O O   . ALA A 244 ? 0.4924 0.6731 0.5946 0.0984  0.0854  0.0703  244 ALA A O   
1857 C CB  . ALA A 244 ? 0.5039 0.6000 0.5621 0.1072  0.0840  0.0538  244 ALA A CB  
1858 N N   . ARG A 245 ? 0.5169 0.6826 0.5964 0.1265  0.1001  0.0658  245 ARG A N   
1859 C CA  . ARG A 245 ? 0.5132 0.7202 0.6110 0.1339  0.1044  0.0738  245 ARG A CA  
1860 C C   . ARG A 245 ? 0.5011 0.7343 0.6115 0.1196  0.1049  0.0788  245 ARG A C   
1861 O O   . ARG A 245 ? 0.4881 0.7539 0.6192 0.1123  0.1016  0.0860  245 ARG A O   
1862 C CB  . ARG A 245 ? 0.5314 0.7412 0.6198 0.1572  0.1155  0.0734  245 ARG A CB  
1863 C CG  . ARG A 245 ? 0.5110 0.7685 0.6194 0.1657  0.1212  0.0823  245 ARG A CG  
1864 C CD  . ARG A 245 ? 0.5408 0.8015 0.6416 0.1927  0.1309  0.0825  245 ARG A CD  
1865 N NE  . ARG A 245 ? 0.5354 0.7776 0.6317 0.2030  0.1264  0.0814  245 ARG A NE  
1866 C CZ  . ARG A 245 ? 0.5245 0.7934 0.6394 0.2065  0.1215  0.0883  245 ARG A CZ  
1867 N NH1 . ARG A 245 ? 0.4992 0.8160 0.6397 0.2000  0.1200  0.0967  245 ARG A NH1 
1868 N NH2 . ARG A 245 ? 0.5425 0.7901 0.6499 0.2156  0.1176  0.0872  245 ARG A NH2 
1869 N N   . ARG A 246 ? 0.5067 0.7249 0.6034 0.1149  0.1087  0.0752  246 ARG A N   
1870 C CA  . ARG A 246 ? 0.4981 0.7369 0.6030 0.1017  0.1099  0.0803  246 ARG A CA  
1871 C C   . ARG A 246 ? 0.4783 0.7210 0.5967 0.0812  0.0993  0.0835  246 ARG A C   
1872 O O   . ARG A 246 ? 0.4678 0.7413 0.6037 0.0718  0.0985  0.0912  246 ARG A O   
1873 C CB  . ARG A 246 ? 0.5100 0.7267 0.5942 0.1008  0.1147  0.0752  246 ARG A CB  
1874 C CG  . ARG A 246 ? 0.5261 0.7652 0.6156 0.0913  0.1188  0.0815  246 ARG A CG  
1875 C CD  . ARG A 246 ? 0.5429 0.7563 0.6111 0.0866  0.1203  0.0764  246 ARG A CD  
1876 N NE  . ARG A 246 ? 0.5374 0.7231 0.6003 0.0733  0.1099  0.0723  246 ARG A NE  
1877 C CZ  . ARG A 246 ? 0.5183 0.7077 0.5912 0.0563  0.1027  0.0768  246 ARG A CZ  
1878 N NH1 . ARG A 246 ? 0.4718 0.6900 0.5603 0.0479  0.1040  0.0858  246 ARG A NH1 
1879 N NH2 . ARG A 246 ? 0.5002 0.6635 0.5666 0.0476  0.0941  0.0724  246 ARG A NH2 
1880 N N   . ARG A 247 ? 0.4685 0.6805 0.5785 0.0744  0.0913  0.0777  247 ARG A N   
1881 C CA  . ARG A 247 ? 0.4519 0.6623 0.5713 0.0568  0.0813  0.0794  247 ARG A CA  
1882 C C   . ARG A 247 ? 0.4429 0.6765 0.5809 0.0543  0.0759  0.0840  247 ARG A C   
1883 O O   . ARG A 247 ? 0.4310 0.6801 0.5816 0.0397  0.0709  0.0888  247 ARG A O   
1884 C CB  . ARG A 247 ? 0.4464 0.6211 0.5525 0.0526  0.0750  0.0721  247 ARG A CB  
1885 C CG  . ARG A 247 ? 0.4556 0.6087 0.5438 0.0527  0.0785  0.0675  247 ARG A CG  
1886 C CD  . ARG A 247 ? 0.4285 0.5524 0.5070 0.0465  0.0715  0.0615  247 ARG A CD  
1887 N NE  . ARG A 247 ? 0.4245 0.5296 0.4858 0.0467  0.0741  0.0571  247 ARG A NE  
1888 C CZ  . ARG A 247 ? 0.4195 0.5007 0.4705 0.0418  0.0691  0.0518  247 ARG A CZ  
1889 N NH1 . ARG A 247 ? 0.3846 0.4570 0.4405 0.0371  0.0620  0.0502  247 ARG A NH1 
1890 N NH2 . ARG A 247 ? 0.4083 0.4761 0.4440 0.0417  0.0713  0.0482  247 ARG A NH2 
1891 N N   . ALA A 248 ? 0.4477 0.6824 0.5862 0.0680  0.0765  0.0827  248 ALA A N   
1892 C CA  . ALA A 248 ? 0.4446 0.7032 0.5998 0.0677  0.0712  0.0872  248 ALA A CA  
1893 C C   . ALA A 248 ? 0.4455 0.7461 0.6189 0.0649  0.0745  0.0957  248 ALA A C   
1894 O O   . ALA A 248 ? 0.4460 0.7671 0.6346 0.0523  0.0677  0.1001  248 ALA A O   
1895 C CB  . ALA A 248 ? 0.4525 0.7057 0.6031 0.0859  0.0730  0.0855  248 ALA A CB  
1896 N N   . THR A 249 ? 0.4508 0.7642 0.6219 0.0762  0.0850  0.0978  249 THR A N   
1897 C CA  . THR A 249 ? 0.4564 0.8133 0.6451 0.0754  0.0899  0.1065  249 THR A CA  
1898 C C   . THR A 249 ? 0.4522 0.8176 0.6480 0.0529  0.0867  0.1107  249 THR A C   
1899 O O   . THR A 249 ? 0.4428 0.8423 0.6577 0.0424  0.0842  0.1183  249 THR A O   
1900 C CB  . THR A 249 ? 0.4754 0.8416 0.6568 0.0942  0.1033  0.1071  249 THR A CB  
1901 O OG1 . THR A 249 ? 0.4883 0.8467 0.6631 0.1159  0.1063  0.1040  249 THR A OG1 
1902 C CG2 . THR A 249 ? 0.4641 0.8787 0.6646 0.0927  0.1093  0.1168  249 THR A CG2 
1903 N N   . LEU A 250 ? 0.4567 0.7908 0.6366 0.0456  0.0867  0.1062  250 LEU A N   
1904 C CA  . LEU A 250 ? 0.4532 0.7884 0.6357 0.0256  0.0841  0.1102  250 LEU A CA  
1905 C C   . LEU A 250 ? 0.4501 0.7817 0.6416 0.0085  0.0720  0.1108  250 LEU A C   
1906 O O   . LEU A 250 ? 0.4522 0.8056 0.6570 -0.0071 0.0690  0.1177  250 LEU A O   
1907 C CB  . LEU A 250 ? 0.4540 0.7558 0.6160 0.0241  0.0864  0.1053  250 LEU A CB  
1908 C CG  . LEU A 250 ? 0.4547 0.7525 0.6155 0.0053  0.0843  0.1098  250 LEU A CG  
1909 C CD1 . LEU A 250 ? 0.4172 0.7540 0.5946 -0.0045 0.0883  0.1207  250 LEU A CD1 
1910 C CD2 . LEU A 250 ? 0.4267 0.6986 0.5670 0.0081  0.0885  0.1060  250 LEU A CD2 
1911 N N   . LEU A 251 ? 0.4500 0.7544 0.6336 0.0112  0.0651  0.1036  251 LEU A N   
1912 C CA  . LEU A 251 ? 0.4440 0.7434 0.6338 -0.0022 0.0539  0.1029  251 LEU A CA  
1913 C C   . LEU A 251 ? 0.4432 0.7817 0.6532 -0.0060 0.0513  0.1095  251 LEU A C   
1914 O O   . LEU A 251 ? 0.4388 0.7869 0.6578 -0.0238 0.0446  0.1130  251 LEU A O   
1915 C CB  . LEU A 251 ? 0.4384 0.7095 0.6179 0.0050  0.0486  0.0949  251 LEU A CB  
1916 C CG  . LEU A 251 ? 0.4379 0.7071 0.6236 -0.0088 0.0375  0.0943  251 LEU A CG  
1917 C CD1 . LEU A 251 ? 0.4125 0.6529 0.5883 -0.0227 0.0324  0.0912  251 LEU A CD1 
1918 C CD2 . LEU A 251 ? 0.4416 0.7052 0.6261 -0.0001 0.0327  0.0902  251 LEU A CD2 
1919 N N   . ALA A 252 ? 0.4485 0.8094 0.6651 0.0109  0.0564  0.1113  252 ALA A N   
1920 C CA  . ALA A 252 ? 0.4532 0.8569 0.6904 0.0100  0.0544  0.1182  252 ALA A CA  
1921 C C   . ALA A 252 ? 0.4602 0.8937 0.7112 -0.0064 0.0560  0.1266  252 ALA A C   
1922 O O   . ALA A 252 ? 0.4536 0.9015 0.7161 -0.0238 0.0476  0.1299  252 ALA A O   
1923 C CB  . ALA A 252 ? 0.4541 0.8769 0.6945 0.0337  0.0620  0.1198  252 ALA A CB  
1924 N N   . ARG A 253 ? 0.4781 0.9188 0.7262 -0.0020 0.0667  0.1299  253 ARG A N   
1925 C CA  . ARG A 253 ? 0.4949 0.9597 0.7529 -0.0184 0.0697  0.1384  253 ARG A CA  
1926 C C   . ARG A 253 ? 0.4984 0.9444 0.7545 -0.0440 0.0601  0.1388  253 ARG A C   
1927 O O   . ARG A 253 ? 0.4980 0.9703 0.7690 -0.0615 0.0563  0.1459  253 ARG A O   
1928 C CB  . ARG A 253 ? 0.5042 0.9623 0.7503 -0.0102 0.0817  0.1390  253 ARG A CB  
1929 C CG  . ARG A 253 ? 0.5367 1.0303 0.7908 0.0075  0.0933  0.1437  253 ARG A CG  
1930 C CD  . ARG A 253 ? 0.6340 1.1249 0.8768 0.0106  0.1048  0.1456  253 ARG A CD  
1931 N NE  . ARG A 253 ? 0.7024 1.2425 0.9605 0.0185  0.1153  0.1544  253 ARG A NE  
1932 C CZ  . ARG A 253 ? 0.7247 1.2813 0.9831 0.0433  0.1242  0.1533  253 ARG A CZ  
1933 N NH1 . ARG A 253 ? 0.7181 1.2423 0.9606 0.0617  0.1237  0.1437  253 ARG A NH1 
1934 N NH2 . ARG A 253 ? 0.7174 1.3226 0.9914 0.0498  0.1339  0.1622  253 ARG A NH2 
1935 N N   . LEU A 254 ? 0.5061 0.9066 0.7433 -0.0460 0.0564  0.1313  254 LEU A N   
1936 C CA  . LEU A 254 ? 0.5179 0.8946 0.7496 -0.0674 0.0482  0.1311  254 LEU A CA  
1937 C C   . LEU A 254 ? 0.5247 0.9079 0.7664 -0.0814 0.0364  0.1309  254 LEU A C   
1938 O O   . LEU A 254 ? 0.5300 0.9098 0.7736 -0.1021 0.0307  0.1342  254 LEU A O   
1939 C CB  . LEU A 254 ? 0.5103 0.8394 0.7205 -0.0634 0.0466  0.1229  254 LEU A CB  
1940 C CG  . LEU A 254 ? 0.5105 0.8275 0.7073 -0.0524 0.0565  0.1222  254 LEU A CG  
1941 C CD1 . LEU A 254 ? 0.4981 0.7722 0.6759 -0.0479 0.0532  0.1136  254 LEU A CD1 
1942 C CD2 . LEU A 254 ? 0.5109 0.8395 0.7085 -0.0639 0.0621  0.1308  254 LEU A CD2 
1943 N N   . VAL A 255 ? 0.5326 0.9235 0.7789 -0.0701 0.0327  0.1269  255 VAL A N   
1944 C CA  . VAL A 255 ? 0.5487 0.9511 0.8046 -0.0814 0.0216  0.1266  255 VAL A CA  
1945 C C   . VAL A 255 ? 0.5666 1.0226 0.8451 -0.0801 0.0233  0.1348  255 VAL A C   
1946 O O   . VAL A 255 ? 0.5701 1.0447 0.8591 -0.0869 0.0145  0.1354  255 VAL A O   
1947 C CB  . VAL A 255 ? 0.5370 0.9145 0.7829 -0.0703 0.0154  0.1174  255 VAL A CB  
1948 C CG1 . VAL A 255 ? 0.5225 0.8519 0.7481 -0.0714 0.0139  0.1099  255 VAL A CG1 
1949 C CG2 . VAL A 255 ? 0.5222 0.9122 0.7698 -0.0460 0.0221  0.1166  255 VAL A CG2 
1950 N N   . GLY A 256 ? 0.5876 1.0691 0.8731 -0.0721 0.0347  0.1413  256 GLY A N   
1951 C CA  . GLY A 256 ? 0.6054 1.1356 0.9090 -0.0585 0.0411  0.1479  256 GLY A CA  
1952 C C   . GLY A 256 ? 0.6162 1.1860 0.9399 -0.0651 0.0328  0.1524  256 GLY A C   
1953 O O   . GLY A 256 ? 0.6277 1.2067 0.9592 -0.0888 0.0247  0.1556  256 GLY A O   
1954 N N   . CYS A 257 ? 0.6251 1.2183 0.9567 -0.0450 0.0341  0.1529  257 CYS A N   
1955 C CA  . CYS A 257 ? 0.6317 1.2118 0.9527 -0.0159 0.0428  0.1488  257 CYS A CA  
1956 C C   . CYS A 257 ? 0.6665 1.2543 0.9846 -0.0010 0.0579  0.1517  257 CYS A C   
1957 O O   . CYS A 257 ? 0.6667 1.2174 0.9652 0.0115  0.0635  0.1450  257 CYS A O   
1958 C CB  . CYS A 257 ? 0.6166 1.1433 0.9155 -0.0102 0.0380  0.1379  257 CYS A CB  
1959 S SG  . CYS A 257 ? 0.5391 1.0604 0.8393 -0.0173 0.0224  0.1339  257 CYS A SG  
1960 N N   . PRO A 258 ? 0.7034 1.3413 1.0410 -0.0021 0.0643  0.1617  258 PRO A N   
1961 C CA  . PRO A 258 ? 0.7324 1.3847 1.0683 0.0146  0.0796  0.1651  258 PRO A CA  
1962 C C   . PRO A 258 ? 0.7597 1.4053 1.0871 0.0467  0.0861  0.1608  258 PRO A C   
1963 O O   . PRO A 258 ? 0.7622 1.4423 1.1042 0.0597  0.0854  0.1652  258 PRO A O   
1964 C CB  . PRO A 258 ? 0.7356 1.4508 1.0985 0.0059  0.0825  0.1775  258 PRO A CB  
1965 C CG  . PRO A 258 ? 0.7224 1.4611 1.1021 -0.0039 0.0689  0.1796  258 PRO A CG  
1966 C CD  . PRO A 258 ? 0.7053 1.3917 1.0678 -0.0193 0.0573  0.1705  258 PRO A CD  
1967 N N   . PRO A 259 ? 0.7846 1.3850 1.0876 0.0588  0.0921  0.1525  259 PRO A N   
1968 C CA  . PRO A 259 ? 0.8030 1.3818 1.0905 0.0869  0.0986  0.1465  259 PRO A CA  
1969 C C   . PRO A 259 ? 0.8185 1.4375 1.1177 0.1118  0.1070  0.1524  259 PRO A C   
1970 O O   . PRO A 259 ? 0.8312 1.4358 1.1223 0.1324  0.1069  0.1487  259 PRO A O   
1971 C CB  . PRO A 259 ? 0.8123 1.3568 1.0779 0.0892  0.1074  0.1410  259 PRO A CB  
1972 C CG  . PRO A 259 ? 0.7989 1.3206 1.0610 0.0623  0.0987  0.1392  259 PRO A CG  
1973 C CD  . PRO A 259 ? 0.7883 1.3519 1.0753 0.0430  0.0921  0.1483  259 PRO A CD  
1974 N N   . GLY A 264 ? 0.7366 1.4877 1.0650 0.2302  0.1438  0.1725  264 GLY A N   
1975 C CA  . GLY A 264 ? 0.7204 1.4377 1.0439 0.2014  0.1300  0.1672  264 GLY A CA  
1976 C C   . GLY A 264 ? 0.7199 1.3723 1.0156 0.2089  0.1253  0.1563  264 GLY A C   
1977 O O   . GLY A 264 ? 0.7224 1.3285 0.9977 0.1986  0.1254  0.1479  264 GLY A O   
1978 N N   . ASN A 265 ? 0.7171 1.3684 1.0127 0.2263  0.1211  0.1572  265 ASN A N   
1979 C CA  . ASN A 265 ? 0.7102 1.3032 0.9800 0.2352  0.1174  0.1484  265 ASN A CA  
1980 C C   . ASN A 265 ? 0.6790 1.2396 0.9434 0.2101  0.1037  0.1430  265 ASN A C   
1981 O O   . ASN A 265 ? 0.6605 1.2418 0.9408 0.1852  0.0956  0.1457  265 ASN A O   
1982 C CB  . ASN A 265 ? 0.7303 1.3300 0.9990 0.2644  0.1185  0.1521  265 ASN A CB  
1983 C CG  . ASN A 265 ? 0.7248 1.3727 1.0198 0.2604  0.1077  0.1615  265 ASN A CG  
1984 O OD1 . ASN A 265 ? 0.7088 1.3604 1.0131 0.2353  0.0953  0.1614  265 ASN A OD1 
1985 N ND2 . ASN A 265 ? 0.7396 1.4238 1.0454 0.2863  0.1124  0.1693  265 ASN A ND2 
1986 N N   . ASP A 266 ? 0.6678 1.1775 0.9091 0.2173  0.1015  0.1356  266 ASP A N   
1987 C CA  . ASP A 266 ? 0.6387 1.1100 0.8696 0.1968  0.0912  0.1288  266 ASP A CA  
1988 C C   . ASP A 266 ? 0.6159 1.1028 0.8601 0.1851  0.0776  0.1322  266 ASP A C   
1989 O O   . ASP A 266 ? 0.6024 1.0726 0.8450 0.1630  0.0688  0.1282  266 ASP A O   
1990 C CB  . ASP A 266 ? 0.6517 1.0660 0.8537 0.2086  0.0942  0.1204  266 ASP A CB  
1991 C CG  . ASP A 266 ? 0.6697 1.0575 0.8541 0.2114  0.1046  0.1141  266 ASP A CG  
1992 O OD1 . ASP A 266 ? 0.6573 1.0672 0.8509 0.2011  0.1085  0.1158  266 ASP A OD1 
1993 O OD2 . ASP A 266 ? 0.6909 1.0350 0.8511 0.2232  0.1086  0.1074  266 ASP A OD2 
1994 N N   . THR A 267 ? 0.6106 1.1288 0.8664 0.2010  0.0760  0.1393  267 THR A N   
1995 C CA  . THR A 267 ? 0.5872 1.1236 0.8548 0.1918  0.0628  0.1429  267 THR A CA  
1996 C C   . THR A 267 ? 0.5630 1.1362 0.8525 0.1655  0.0556  0.1463  267 THR A C   
1997 O O   . THR A 267 ? 0.5557 1.1180 0.8449 0.1453  0.0445  0.1432  267 THR A O   
1998 C CB  . THR A 267 ? 0.5964 1.1649 0.8734 0.2159  0.0628  0.1512  267 THR A CB  
1999 O OG1 . THR A 267 ? 0.6062 1.1384 0.8612 0.2418  0.0711  0.1486  267 THR A OG1 
2000 C CG2 . THR A 267 ? 0.5770 1.1571 0.8612 0.2071  0.0484  0.1539  267 THR A CG2 
2001 N N   . GLU A 268 ? 0.5527 1.1680 0.8596 0.1660  0.0623  0.1526  268 GLU A N   
2002 C CA  . GLU A 268 ? 0.5338 1.1871 0.8622 0.1406  0.0565  0.1572  268 GLU A CA  
2003 C C   . GLU A 268 ? 0.5113 1.1275 0.8287 0.1142  0.0524  0.1498  268 GLU A C   
2004 O O   . GLU A 268 ? 0.4990 1.1252 0.8258 0.0901  0.0420  0.1504  268 GLU A O   
2005 C CB  . GLU A 268 ? 0.5366 1.2373 0.8826 0.1478  0.0674  0.1652  268 GLU A CB  
2006 C CG  . GLU A 268 ? 0.5520 1.3169 0.9284 0.1356  0.0610  0.1754  268 GLU A CG  
2007 C CD  . GLU A 268 ? 0.5952 1.4103 0.9900 0.1425  0.0728  0.1842  268 GLU A CD  
2008 O OE1 . GLU A 268 ? 0.6079 1.4767 1.0236 0.1554  0.0733  0.1934  268 GLU A OE1 
2009 O OE2 . GLU A 268 ? 0.5899 1.3935 0.9786 0.1355  0.0818  0.1824  268 GLU A OE2 
2010 N N   . LEU A 269 ? 0.4984 1.0710 0.7948 0.1196  0.0602  0.1427  269 LEU A N   
2011 C CA  . LEU A 269 ? 0.4789 1.0195 0.7650 0.0986  0.0585  0.1368  269 LEU A CA  
2012 C C   . LEU A 269 ? 0.4721 0.9733 0.7449 0.0882  0.0477  0.1294  269 LEU A C   
2013 O O   . LEU A 269 ? 0.4650 0.9574 0.7388 0.0654  0.0400  0.1272  269 LEU A O   
2014 C CB  . LEU A 269 ? 0.4857 0.9989 0.7547 0.1092  0.0709  0.1324  269 LEU A CB  
2015 C CG  . LEU A 269 ? 0.4761 0.9547 0.7318 0.0917  0.0710  0.1265  269 LEU A CG  
2016 C CD1 . LEU A 269 ? 0.4937 0.9642 0.7386 0.1029  0.0839  0.1253  269 LEU A CD1 
2017 C CD2 . LEU A 269 ? 0.4829 0.9121 0.7196 0.0879  0.0645  0.1176  269 LEU A CD2 
2018 N N   . ILE A 270 ? 0.4661 0.9427 0.7254 0.1054  0.0476  0.1259  270 ILE A N   
2019 C CA  . ILE A 270 ? 0.4514 0.8942 0.6983 0.0975  0.0383  0.1197  270 ILE A CA  
2020 C C   . ILE A 270 ? 0.4413 0.9120 0.7029 0.0848  0.0262  0.1233  270 ILE A C   
2021 O O   . ILE A 270 ? 0.4340 0.8877 0.6916 0.0663  0.0174  0.1188  270 ILE A O   
2022 C CB  . ILE A 270 ? 0.4614 0.8730 0.6904 0.1181  0.0416  0.1164  270 ILE A CB  
2023 C CG1 . ILE A 270 ? 0.4729 0.8489 0.6839 0.1244  0.0514  0.1106  270 ILE A CG1 
2024 C CG2 . ILE A 270 ? 0.4411 0.8267 0.6603 0.1110  0.0318  0.1119  270 ILE A CG2 
2025 C CD1 . ILE A 270 ? 0.5079 0.8696 0.7064 0.1498  0.0594  0.1105  270 ILE A CD1 
2026 N N   . ALA A 271 ? 0.4361 0.9507 0.7146 0.0946  0.0254  0.1313  271 ALA A N   
2027 C CA  . ALA A 271 ? 0.4343 0.9813 0.7282 0.0813  0.0133  0.1352  271 ALA A CA  
2028 C C   . ALA A 271 ? 0.4270 0.9796 0.7285 0.0524  0.0075  0.1340  271 ALA A C   
2029 O O   . ALA A 271 ? 0.4228 0.9684 0.7228 0.0353  -0.0039 0.1308  271 ALA A O   
2030 C CB  . ALA A 271 ? 0.4266 1.0287 0.7413 0.0956  0.0144  0.1454  271 ALA A CB  
2031 N N   . CYS A 272 ? 0.4278 0.9908 0.7357 0.0472  0.0157  0.1366  272 CYS A N   
2032 C CA  . CYS A 272 ? 0.4288 0.9967 0.7433 0.0201  0.0113  0.1369  272 CYS A CA  
2033 C C   . CYS A 272 ? 0.4169 0.9315 0.7109 0.0077  0.0077  0.1275  272 CYS A C   
2034 O O   . CYS A 272 ? 0.4145 0.9212 0.7076 -0.0124 -0.0026 0.1248  272 CYS A O   
2035 C CB  . CYS A 272 ? 0.4370 1.0326 0.7634 0.0190  0.0217  0.1435  272 CYS A CB  
2036 S SG  . CYS A 272 ? 0.4842 1.0814 0.8162 -0.0141 0.0182  0.1453  272 CYS A SG  
2037 N N   . LEU A 273 ? 0.4075 0.8854 0.6842 0.0202  0.0158  0.1222  273 LEU A N   
2038 C CA  . LEU A 273 ? 0.4022 0.8315 0.6596 0.0119  0.0125  0.1134  273 LEU A CA  
2039 C C   . LEU A 273 ? 0.4023 0.8178 0.6538 0.0071  0.0012  0.1089  273 LEU A C   
2040 O O   . LEU A 273 ? 0.3990 0.7868 0.6406 -0.0073 -0.0048 0.1031  273 LEU A O   
2041 C CB  . LEU A 273 ? 0.3999 0.7958 0.6400 0.0286  0.0219  0.1087  273 LEU A CB  
2042 C CG  . LEU A 273 ? 0.3939 0.7792 0.6290 0.0261  0.0307  0.1084  273 LEU A CG  
2043 C CD1 . LEU A 273 ? 0.3965 0.7530 0.6147 0.0442  0.0392  0.1037  273 LEU A CD1 
2044 C CD2 . LEU A 273 ? 0.3878 0.7494 0.6166 0.0053  0.0252  0.1048  273 LEU A CD2 
2045 N N   A ARG A 274 ? 0.3989 0.8342 0.6556 0.0200  -0.0014 0.1118  274 ARG A N   
2046 N N   B ARG A 274 ? 0.4016 0.8375 0.6586 0.0198  -0.0015 0.1118  274 ARG A N   
2047 C CA  A ARG A 274 ? 0.3974 0.8212 0.6469 0.0187  -0.0113 0.1080  274 ARG A CA  
2048 C CA  B ARG A 274 ? 0.4029 0.8263 0.6523 0.0185  -0.0113 0.1079  274 ARG A CA  
2049 C C   A ARG A 274 ? 0.4036 0.8438 0.6613 -0.0036 -0.0233 0.1081  274 ARG A C   
2050 C C   B ARG A 274 ? 0.4065 0.8504 0.6655 -0.0022 -0.0235 0.1087  274 ARG A C   
2051 O O   A ARG A 274 ? 0.4098 0.8299 0.6569 -0.0110 -0.0318 0.1024  274 ARG A O   
2052 O O   B ARG A 274 ? 0.4127 0.8425 0.6629 -0.0074 -0.0325 0.1040  274 ARG A O   
2053 C CB  A ARG A 274 ? 0.3930 0.8348 0.6454 0.0398  -0.0104 0.1124  274 ARG A CB  
2054 C CB  B ARG A 274 ? 0.4012 0.8347 0.6499 0.0412  -0.0094 0.1112  274 ARG A CB  
2055 C CG  A ARG A 274 ? 0.3813 0.7873 0.6146 0.0511  -0.0109 0.1073  274 ARG A CG  
2056 C CG  B ARG A 274 ? 0.4055 0.7980 0.6337 0.0499  -0.0096 0.1050  274 ARG A CG  
2057 C CD  A ARG A 274 ? 0.3557 0.7691 0.5878 0.0763  -0.0048 0.1121  274 ARG A CD  
2058 C CD  B ARG A 274 ? 0.4116 0.7888 0.6307 0.0724  0.0011  0.1058  274 ARG A CD  
2059 N NE  A ARG A 274 ? 0.3282 0.7895 0.5786 0.0823  -0.0084 0.1205  274 ARG A NE  
2060 N NE  B ARG A 274 ? 0.4095 0.8094 0.6336 0.0914  0.0015  0.1123  274 ARG A NE  
2061 C CZ  A ARG A 274 ? 0.2957 0.7779 0.5523 0.1035  -0.0012 0.1271  274 ARG A CZ  
2062 C CZ  B ARG A 274 ? 0.4170 0.7969 0.6285 0.1115  0.0077  0.1127  274 ARG A CZ  
2063 N NH1 A ARG A 274 ? 0.2778 0.7335 0.5219 0.1196  0.0098  0.1253  274 ARG A NH1 
2064 N NH1 B ARG A 274 ? 0.3873 0.7251 0.5809 0.1138  0.0137  0.1066  274 ARG A NH1 
2065 N NH2 A ARG A 274 ? 0.2624 0.7916 0.5371 0.1086  -0.0053 0.1352  274 ARG A NH2 
2066 N NH2 B ARG A 274 ? 0.4288 0.8303 0.6449 0.1293  0.0076  0.1195  274 ARG A NH2 
2067 N N   . THR A 275 ? 0.4047 0.8808 0.6804 -0.0149 -0.0237 0.1144  275 THR A N   
2068 C CA  . THR A 275 ? 0.4127 0.9047 0.6962 -0.0385 -0.0352 0.1147  275 THR A CA  
2069 C C   . THR A 275 ? 0.4207 0.8784 0.6933 -0.0581 -0.0367 0.1091  275 THR A C   
2070 O O   . THR A 275 ? 0.4309 0.8884 0.7038 -0.0784 -0.0464 0.1073  275 THR A O   
2071 C CB  . THR A 275 ? 0.4103 0.9581 0.7189 -0.0455 -0.0359 0.1247  275 THR A CB  
2072 O OG1 . THR A 275 ? 0.3986 0.9518 0.7130 -0.0467 -0.0252 0.1288  275 THR A OG1 
2073 C CG2 . THR A 275 ? 0.3932 0.9787 0.7139 -0.0253 -0.0349 0.1312  275 THR A CG2 
2074 N N   . ARG A 276 ? 0.4248 0.8532 0.6870 -0.0521 -0.0274 0.1066  276 ARG A N   
2075 C CA  . ARG A 276 ? 0.4376 0.8340 0.6892 -0.0691 -0.0286 0.1022  276 ARG A CA  
2076 C C   . ARG A 276 ? 0.4444 0.7997 0.6768 -0.0720 -0.0354 0.0926  276 ARG A C   
2077 O O   . ARG A 276 ? 0.4367 0.7772 0.6597 -0.0567 -0.0344 0.0887  276 ARG A O   
2078 C CB  . ARG A 276 ? 0.4334 0.8156 0.6808 -0.0625 -0.0169 0.1035  276 ARG A CB  
2079 C CG  . ARG A 276 ? 0.4482 0.8688 0.7128 -0.0634 -0.0098 0.1128  276 ARG A CG  
2080 C CD  . ARG A 276 ? 0.4992 0.9342 0.7729 -0.0885 -0.0155 0.1170  276 ARG A CD  
2081 N NE  . ARG A 276 ? 0.5645 1.0474 0.8589 -0.0904 -0.0103 0.1272  276 ARG A NE  
2082 C CZ  . ARG A 276 ? 0.5841 1.1122 0.8972 -0.0918 -0.0147 0.1330  276 ARG A CZ  
2083 N NH1 . ARG A 276 ? 0.5733 1.1044 0.8862 -0.0918 -0.0251 0.1295  276 ARG A NH1 
2084 N NH2 . ARG A 276 ? 0.5923 1.1653 0.9247 -0.0933 -0.0086 0.1428  276 ARG A NH2 
2085 N N   . PRO A 277 ? 0.4583 0.7943 0.6839 -0.0917 -0.0421 0.0891  277 PRO A N   
2086 C CA  . PRO A 277 ? 0.4632 0.7602 0.6698 -0.0936 -0.0478 0.0798  277 PRO A CA  
2087 C C   . PRO A 277 ? 0.4531 0.7163 0.6462 -0.0808 -0.0395 0.0757  277 PRO A C   
2088 O O   . PRO A 277 ? 0.4508 0.7120 0.6460 -0.0791 -0.0316 0.0790  277 PRO A O   
2089 C CB  . PRO A 277 ? 0.4813 0.7655 0.6841 -0.1172 -0.0549 0.0782  277 PRO A CB  
2090 C CG  . PRO A 277 ? 0.4848 0.8091 0.7072 -0.1295 -0.0555 0.0872  277 PRO A CG  
2091 C CD  . PRO A 277 ? 0.4657 0.8129 0.6995 -0.1126 -0.0441 0.0938  277 PRO A CD  
2092 N N   . ALA A 278 ? 0.4511 0.6893 0.6302 -0.0725 -0.0414 0.0688  278 ALA A N   
2093 C CA  . ALA A 278 ? 0.4483 0.6559 0.6150 -0.0618 -0.0345 0.0648  278 ALA A CA  
2094 C C   . ALA A 278 ? 0.4535 0.6399 0.6148 -0.0706 -0.0317 0.0644  278 ALA A C   
2095 O O   . ALA A 278 ? 0.4402 0.6210 0.6005 -0.0628 -0.0235 0.0661  278 ALA A O   
2096 C CB  . ALA A 278 ? 0.4449 0.6290 0.5971 -0.0554 -0.0380 0.0575  278 ALA A CB  
2097 N N   . GLN A 279 ? 0.4770 0.6506 0.6335 -0.0867 -0.0385 0.0623  279 GLN A N   
2098 C CA  . GLN A 279 ? 0.4960 0.6436 0.6440 -0.0937 -0.0364 0.0617  279 GLN A CA  
2099 C C   . GLN A 279 ? 0.5003 0.6655 0.6589 -0.0966 -0.0296 0.0697  279 GLN A C   
2100 O O   . GLN A 279 ? 0.5089 0.6578 0.6615 -0.0950 -0.0243 0.0708  279 GLN A O   
2101 C CB  . GLN A 279 ? 0.5163 0.6442 0.6553 -0.1105 -0.0452 0.0581  279 GLN A CB  
2102 C CG  . GLN A 279 ? 0.5158 0.6106 0.6423 -0.1145 -0.0435 0.0569  279 GLN A CG  
2103 C CD  . GLN A 279 ? 0.5258 0.5961 0.6404 -0.0991 -0.0396 0.0513  279 GLN A CD  
2104 O OE1 . GLN A 279 ? 0.5283 0.5886 0.6352 -0.0924 -0.0427 0.0447  279 GLN A OE1 
2105 N NE2 . GLN A 279 ? 0.5100 0.5716 0.6228 -0.0941 -0.0329 0.0542  279 GLN A NE2 
2106 N N   . ASP A 280 ? 0.5032 0.7041 0.6774 -0.0998 -0.0297 0.0757  280 ASP A N   
2107 C CA  . ASP A 280 ? 0.5094 0.7335 0.6953 -0.1024 -0.0229 0.0840  280 ASP A CA  
2108 C C   . ASP A 280 ? 0.4914 0.7169 0.6766 -0.0844 -0.0122 0.0852  280 ASP A C   
2109 O O   . ASP A 280 ? 0.4930 0.7189 0.6783 -0.0854 -0.0056 0.0894  280 ASP A O   
2110 C CB  . ASP A 280 ? 0.5171 0.7828 0.7210 -0.1090 -0.0258 0.0901  280 ASP A CB  
2111 C CG  . ASP A 280 ? 0.5593 0.8404 0.7721 -0.1270 -0.0256 0.0975  280 ASP A CG  
2112 O OD1 . ASP A 280 ? 0.6138 0.8866 0.8236 -0.1266 -0.0181 0.1009  280 ASP A OD1 
2113 O OD2 . ASP A 280 ? 0.6012 0.9022 0.8231 -0.1424 -0.0333 0.1000  280 ASP A OD2 
2114 N N   . LEU A 281 ? 0.4779 0.7027 0.6607 -0.0683 -0.0107 0.0814  281 LEU A N   
2115 C CA  . LEU A 281 ? 0.4645 0.6846 0.6432 -0.0518 -0.0014 0.0811  281 LEU A CA  
2116 C C   . LEU A 281 ? 0.4641 0.6497 0.6279 -0.0519 0.0004  0.0768  281 LEU A C   
2117 O O   . LEU A 281 ? 0.4634 0.6460 0.6243 -0.0473 0.0076  0.0787  281 LEU A O   
2118 C CB  . LEU A 281 ? 0.4574 0.6819 0.6355 -0.0357 -0.0006 0.0786  281 LEU A CB  
2119 C CG  . LEU A 281 ? 0.4545 0.7154 0.6474 -0.0329 -0.0025 0.0836  281 LEU A CG  
2120 C CD1 . LEU A 281 ? 0.4545 0.7163 0.6447 -0.0152 -0.0007 0.0821  281 LEU A CD1 
2121 C CD2 . LEU A 281 ? 0.4515 0.7449 0.6587 -0.0338 0.0036  0.0916  281 LEU A CD2 
2122 N N   . VAL A 282 ? 0.4699 0.6310 0.6240 -0.0571 -0.0063 0.0711  282 VAL A N   
2123 C CA  . VAL A 282 ? 0.4694 0.5993 0.6100 -0.0566 -0.0055 0.0672  282 VAL A CA  
2124 C C   . VAL A 282 ? 0.4829 0.6080 0.6225 -0.0672 -0.0038 0.0718  282 VAL A C   
2125 O O   . VAL A 282 ? 0.4796 0.5927 0.6123 -0.0624 0.0012  0.0722  282 VAL A O   
2126 C CB  . VAL A 282 ? 0.4749 0.5813 0.6054 -0.0586 -0.0127 0.0602  282 VAL A CB  
2127 C CG1 . VAL A 282 ? 0.4647 0.5425 0.5830 -0.0593 -0.0125 0.0574  282 VAL A CG1 
2128 C CG2 . VAL A 282 ? 0.4545 0.5616 0.5830 -0.0461 -0.0125 0.0560  282 VAL A CG2 
2129 N N   . ASP A 283 ? 0.4940 0.6289 0.6398 -0.0820 -0.0082 0.0759  283 ASP A N   
2130 C CA  . ASP A 283 ? 0.5145 0.6451 0.6591 -0.0937 -0.0066 0.0817  283 ASP A CA  
2131 C C   . ASP A 283 ? 0.5127 0.6596 0.6616 -0.0883 0.0030  0.0878  283 ASP A C   
2132 O O   . ASP A 283 ? 0.5222 0.6597 0.6660 -0.0947 0.0054  0.0920  283 ASP A O   
2133 C CB  . ASP A 283 ? 0.5301 0.6729 0.6823 -0.1123 -0.0125 0.0860  283 ASP A CB  
2134 C CG  . ASP A 283 ? 0.5585 0.6780 0.7017 -0.1211 -0.0225 0.0797  283 ASP A CG  
2135 O OD1 . ASP A 283 ? 0.5269 0.6172 0.6566 -0.1138 -0.0244 0.0728  283 ASP A OD1 
2136 O OD2 . ASP A 283 ? 0.5963 0.7283 0.7460 -0.1360 -0.0286 0.0818  283 ASP A OD2 
2137 N N   . HIS A 284 ? 0.5045 0.6742 0.6613 -0.0760 0.0085  0.0883  284 HIS A N   
2138 C CA  . HIS A 284 ? 0.5065 0.6919 0.6659 -0.0695 0.0182  0.0933  284 HIS A CA  
2139 C C   . HIS A 284 ? 0.4991 0.6739 0.6496 -0.0522 0.0240  0.0884  284 HIS A C   
2140 O O   . HIS A 284 ? 0.4959 0.6768 0.6440 -0.0462 0.0317  0.0909  284 HIS A O   
2141 C CB  . HIS A 284 ? 0.5027 0.7277 0.6789 -0.0706 0.0215  0.0999  284 HIS A CB  
2142 C CG  . HIS A 284 ? 0.5221 0.7614 0.7076 -0.0899 0.0171  0.1063  284 HIS A CG  
2143 N ND1 . HIS A 284 ? 0.5269 0.7758 0.7205 -0.0995 0.0085  0.1056  284 HIS A ND1 
2144 C CD2 . HIS A 284 ? 0.5387 0.7836 0.7257 -0.1027 0.0199  0.1138  284 HIS A CD2 
2145 C CE1 . HIS A 284 ? 0.5400 0.7994 0.7399 -0.1183 0.0059  0.1120  284 HIS A CE1 
2146 N NE2 . HIS A 284 ? 0.5453 0.8021 0.7415 -0.1206 0.0130  0.1174  284 HIS A NE2 
2147 N N   . GLU A 285 ? 0.5026 0.6612 0.6474 -0.0450 0.0202  0.0815  285 GLU A N   
2148 C CA  . GLU A 285 ? 0.5116 0.6568 0.6469 -0.0308 0.0244  0.0763  285 GLU A CA  
2149 C C   . GLU A 285 ? 0.5174 0.6499 0.6422 -0.0289 0.0297  0.0767  285 GLU A C   
2150 O O   . GLU A 285 ? 0.5078 0.6431 0.6282 -0.0186 0.0364  0.0758  285 GLU A O   
2151 C CB  . GLU A 285 ? 0.5064 0.6297 0.6348 -0.0296 0.0181  0.0697  285 GLU A CB  
2152 C CG  . GLU A 285 ? 0.5322 0.6481 0.6551 -0.0168 0.0205  0.0649  285 GLU A CG  
2153 C CD  . GLU A 285 ? 0.5562 0.6516 0.6722 -0.0172 0.0147  0.0592  285 GLU A CD  
2154 O OE1 . GLU A 285 ? 0.5826 0.6753 0.7006 -0.0254 0.0084  0.0587  285 GLU A OE1 
2155 O OE2 . GLU A 285 ? 0.5775 0.6594 0.6855 -0.0099 0.0166  0.0552  285 GLU A OE2 
2156 N N   . TRP A 286 ? 0.5320 0.6498 0.6514 -0.0387 0.0263  0.0781  286 TRP A N   
2157 C CA  . TRP A 286 ? 0.5555 0.6586 0.6634 -0.0372 0.0293  0.0782  286 TRP A CA  
2158 C C   . TRP A 286 ? 0.5510 0.6703 0.6596 -0.0374 0.0369  0.0843  286 TRP A C   
2159 O O   . TRP A 286 ? 0.5503 0.6625 0.6487 -0.0321 0.0412  0.0835  286 TRP A O   
2160 C CB  . TRP A 286 ? 0.5762 0.6583 0.6779 -0.0463 0.0231  0.0786  286 TRP A CB  
2161 C CG  . TRP A 286 ? 0.6658 0.7320 0.7553 -0.0451 0.0244  0.0794  286 TRP A CG  
2162 C CD1 . TRP A 286 ? 0.7368 0.7985 0.8218 -0.0531 0.0248  0.0859  286 TRP A CD1 
2163 C CD2 . TRP A 286 ? 0.7377 0.7910 0.8176 -0.0360 0.0249  0.0741  286 TRP A CD2 
2164 N NE1 . TRP A 286 ? 0.7749 0.8225 0.8480 -0.0483 0.0254  0.0850  286 TRP A NE1 
2165 C CE2 . TRP A 286 ? 0.7709 0.8141 0.8412 -0.0384 0.0252  0.0776  286 TRP A CE2 
2166 C CE3 . TRP A 286 ? 0.7710 0.8207 0.8492 -0.0270 0.0249  0.0672  286 TRP A CE3 
2167 C CZ2 . TRP A 286 ? 0.7888 0.8208 0.8488 -0.0319 0.0249  0.0742  286 TRP A CZ2 
2168 C CZ3 . TRP A 286 ? 0.8074 0.8447 0.8752 -0.0218 0.0249  0.0636  286 TRP A CZ3 
2169 C CH2 . TRP A 286 ? 0.8033 0.8332 0.8626 -0.0243 0.0247  0.0670  286 TRP A CH2 
2170 N N   . HIS A 287 ? 0.5528 0.6955 0.6734 -0.0438 0.0384  0.0904  287 HIS A N   
2171 C CA  . HIS A 287 ? 0.5606 0.7232 0.6839 -0.0456 0.0460  0.0976  287 HIS A CA  
2172 C C   . HIS A 287 ? 0.5455 0.7243 0.6684 -0.0312 0.0551  0.0966  287 HIS A C   
2173 O O   . HIS A 287 ? 0.5538 0.7508 0.6781 -0.0311 0.0626  0.1023  287 HIS A O   
2174 C CB  . HIS A 287 ? 0.5724 0.7564 0.7097 -0.0593 0.0442  0.1052  287 HIS A CB  
2175 C CG  . HIS A 287 ? 0.6290 0.7936 0.7630 -0.0745 0.0364  0.1070  287 HIS A CG  
2176 N ND1 . HIS A 287 ? 0.6751 0.8408 0.8170 -0.0847 0.0287  0.1066  287 HIS A ND1 
2177 C CD2 . HIS A 287 ? 0.6774 0.8189 0.7992 -0.0805 0.0350  0.1090  287 HIS A CD2 
2178 C CE1 . HIS A 287 ? 0.7025 0.8446 0.8364 -0.0963 0.0232  0.1078  287 HIS A CE1 
2179 N NE2 . HIS A 287 ? 0.7128 0.8400 0.8348 -0.0935 0.0269  0.1097  287 HIS A NE2 
2180 N N   . VAL A 288 ? 0.5211 0.6923 0.6407 -0.0190 0.0550  0.0895  288 VAL A N   
2181 C CA  . VAL A 288 ? 0.5121 0.6938 0.6289 -0.0042 0.0635  0.0878  288 VAL A CA  
2182 C C   . VAL A 288 ? 0.5137 0.6729 0.6119 0.0035  0.0668  0.0819  288 VAL A C   
2183 O O   . VAL A 288 ? 0.5056 0.6672 0.5972 0.0157  0.0737  0.0793  288 VAL A O   
2184 C CB  . VAL A 288 ? 0.5047 0.6969 0.6301 0.0058  0.0629  0.0853  288 VAL A CB  
2185 C CG1 . VAL A 288 ? 0.4801 0.6992 0.6243 -0.0025 0.0592  0.0914  288 VAL A CG1 
2186 C CG2 . VAL A 288 ? 0.4925 0.6580 0.6097 0.0097  0.0570  0.0774  288 VAL A CG2 
2187 N N   . LEU A 289 ? 0.5222 0.6594 0.6113 -0.0035 0.0616  0.0799  289 LEU A N   
2188 C CA  . LEU A 289 ? 0.5402 0.6577 0.6120 0.0022  0.0633  0.0744  289 LEU A CA  
2189 C C   . LEU A 289 ? 0.5573 0.6834 0.6206 0.0045  0.0712  0.0777  289 LEU A C   
2190 O O   . LEU A 289 ? 0.5587 0.6957 0.6256 -0.0038 0.0724  0.0851  289 LEU A O   
2191 C CB  . LEU A 289 ? 0.5310 0.6268 0.5966 -0.0049 0.0555  0.0722  289 LEU A CB  
2192 C CG  . LEU A 289 ? 0.5368 0.6191 0.6048 -0.0040 0.0488  0.0666  289 LEU A CG  
2193 C CD1 . LEU A 289 ? 0.5114 0.5775 0.5755 -0.0112 0.0418  0.0664  289 LEU A CD1 
2194 C CD2 . LEU A 289 ? 0.5314 0.6032 0.5909 0.0060  0.0508  0.0593  289 LEU A CD2 
2195 N N   . PRO A 290 ? 0.5757 0.6958 0.6262 0.0156  0.0769  0.0723  290 PRO A N   
2196 C CA  . PRO A 290 ? 0.5955 0.7258 0.6369 0.0196  0.0855  0.0749  290 PRO A CA  
2197 C C   . PRO A 290 ? 0.6107 0.7330 0.6410 0.0113  0.0841  0.0780  290 PRO A C   
2198 O O   . PRO A 290 ? 0.6197 0.7560 0.6469 0.0106  0.0906  0.0836  290 PRO A O   
2199 C CB  . PRO A 290 ? 0.6044 0.7232 0.6314 0.0334  0.0906  0.0665  290 PRO A CB  
2200 C CG  . PRO A 290 ? 0.5884 0.6872 0.6152 0.0344  0.0835  0.0597  290 PRO A CG  
2201 C CD  . PRO A 290 ? 0.5725 0.6726 0.6135 0.0234  0.0750  0.0633  290 PRO A CD  
2202 N N   . GLN A 291 ? 0.6212 0.7228 0.6456 0.0058  0.0759  0.0749  291 GLN A N   
2203 C CA  . GLN A 291 ? 0.6421 0.7363 0.6567 -0.0014 0.0733  0.0788  291 GLN A CA  
2204 C C   . GLN A 291 ? 0.6344 0.7168 0.6552 -0.0104 0.0638  0.0809  291 GLN A C   
2205 O O   . GLN A 291 ? 0.6336 0.7104 0.6631 -0.0104 0.0588  0.0771  291 GLN A O   
2206 C CB  . GLN A 291 ? 0.6586 0.7378 0.6530 0.0039  0.0736  0.0721  291 GLN A CB  
2207 C CG  . GLN A 291 ? 0.6942 0.7781 0.6772 0.0144  0.0827  0.0676  291 GLN A CG  
2208 C CD  . GLN A 291 ? 0.7320 0.8060 0.7146 0.0226  0.0826  0.0587  291 GLN A CD  
2209 O OE1 . GLN A 291 ? 0.7525 0.8151 0.7411 0.0197  0.0753  0.0555  291 GLN A OE1 
2210 N NE2 . GLN A 291 ? 0.7249 0.8024 0.6995 0.0336  0.0911  0.0551  291 GLN A NE2 
2211 N N   . GLU A 292 ? 0.6406 0.7184 0.6554 -0.0172 0.0615  0.0869  292 GLU A N   
2212 C CA  . GLU A 292 ? 0.6377 0.6994 0.6525 -0.0227 0.0526  0.0877  292 GLU A CA  
2213 C C   . GLU A 292 ? 0.6213 0.6690 0.6285 -0.0167 0.0481  0.0786  292 GLU A C   
2214 O O   . GLU A 292 ? 0.6267 0.6718 0.6206 -0.0124 0.0501  0.0751  292 GLU A O   
2215 C CB  . GLU A 292 ? 0.6584 0.7166 0.6641 -0.0286 0.0521  0.0962  292 GLU A CB  
2216 C CG  . GLU A 292 ? 0.7109 0.7513 0.7146 -0.0325 0.0434  0.0982  292 GLU A CG  
2217 C CD  . GLU A 292 ? 0.8008 0.8363 0.7949 -0.0381 0.0431  0.1083  292 GLU A CD  
2218 O OE1 . GLU A 292 ? 0.8286 0.8739 0.8143 -0.0383 0.0494  0.1128  292 GLU A OE1 
2219 O OE2 . GLU A 292 ? 0.8322 0.8527 0.8256 -0.0416 0.0367  0.1118  292 GLU A OE2 
2220 N N   . SER A 293 ? 0.5946 0.6342 0.6098 -0.0170 0.0421  0.0747  293 SER A N   
2221 C CA  . SER A 293 ? 0.5789 0.6085 0.5888 -0.0124 0.0385  0.0665  293 SER A CA  
2222 C C   . SER A 293 ? 0.5564 0.5771 0.5735 -0.0139 0.0312  0.0646  293 SER A C   
2223 O O   . SER A 293 ? 0.5535 0.5742 0.5797 -0.0176 0.0292  0.0679  293 SER A O   
2224 C CB  . SER A 293 ? 0.5766 0.6094 0.5862 -0.0062 0.0433  0.0600  293 SER A CB  
2225 O OG  . SER A 293 ? 0.5909 0.6309 0.6140 -0.0057 0.0446  0.0606  293 SER A OG  
2226 N N   . ILE A 294 ? 0.5442 0.5577 0.5561 -0.0115 0.0274  0.0593  294 ILE A N   
2227 C CA  . ILE A 294 ? 0.5225 0.5302 0.5412 -0.0111 0.0220  0.0559  294 ILE A CA  
2228 C C   . ILE A 294 ? 0.5117 0.5180 0.5288 -0.0079 0.0232  0.0485  294 ILE A C   
2229 O O   . ILE A 294 ? 0.5147 0.5210 0.5226 -0.0062 0.0267  0.0456  294 ILE A O   
2230 C CB  . ILE A 294 ? 0.5287 0.5305 0.5440 -0.0114 0.0158  0.0578  294 ILE A CB  
2231 C CG1 . ILE A 294 ? 0.5280 0.5308 0.5316 -0.0104 0.0148  0.0560  294 ILE A CG1 
2232 C CG2 . ILE A 294 ? 0.5380 0.5362 0.5542 -0.0143 0.0142  0.0655  294 ILE A CG2 
2233 C CD1 . ILE A 294 ? 0.5059 0.5068 0.5079 -0.0094 0.0084  0.0567  294 ILE A CD1 
2234 N N   . PHE A 295 ? 0.4947 0.4984 0.5194 -0.0073 0.0204  0.0456  295 PHE A N   
2235 C CA  . PHE A 295 ? 0.4813 0.4823 0.5055 -0.0052 0.0215  0.0397  295 PHE A CA  
2236 C C   . PHE A 295 ? 0.4829 0.4860 0.5059 -0.0018 0.0279  0.0385  295 PHE A C   
2237 O O   . PHE A 295 ? 0.4841 0.4816 0.4995 0.0006  0.0304  0.0338  295 PHE A O   
2238 C CB  . PHE A 295 ? 0.4831 0.4800 0.4982 -0.0063 0.0192  0.0357  295 PHE A CB  
2239 C CG  . PHE A 295 ? 0.4876 0.4818 0.5063 -0.0069 0.0165  0.0318  295 PHE A CG  
2240 C CD1 . PHE A 295 ? 0.4763 0.4672 0.4982 -0.0050 0.0194  0.0293  295 PHE A CD1 
2241 C CD2 . PHE A 295 ? 0.4767 0.4732 0.4961 -0.0091 0.0113  0.0314  295 PHE A CD2 
2242 C CE1 . PHE A 295 ? 0.4580 0.4465 0.4826 -0.0062 0.0174  0.0266  295 PHE A CE1 
2243 C CE2 . PHE A 295 ? 0.4629 0.4595 0.4864 -0.0102 0.0095  0.0285  295 PHE A CE2 
2244 C CZ  . PHE A 295 ? 0.4585 0.4504 0.4842 -0.0092 0.0127  0.0262  295 PHE A CZ  
2245 N N   . ARG A 296 ? 0.4719 0.4830 0.5020 -0.0017 0.0303  0.0429  296 ARG A N   
2246 C CA  . ARG A 296 ? 0.4745 0.4917 0.5069 0.0030  0.0361  0.0427  296 ARG A CA  
2247 C C   . ARG A 296 ? 0.4643 0.4896 0.5100 0.0019  0.0348  0.0458  296 ARG A C   
2248 O O   . ARG A 296 ? 0.4737 0.5022 0.5255 -0.0036 0.0315  0.0499  296 ARG A O   
2249 C CB  . ARG A 296 ? 0.4732 0.4976 0.4996 0.0048  0.0421  0.0453  296 ARG A CB  
2250 C CG  . ARG A 296 ? 0.4755 0.4917 0.4862 0.0061  0.0436  0.0416  296 ARG A CG  
2251 C CD  . ARG A 296 ? 0.4780 0.4832 0.4798 0.0112  0.0458  0.0346  296 ARG A CD  
2252 N NE  . ARG A 296 ? 0.5249 0.5216 0.5095 0.0114  0.0472  0.0305  296 ARG A NE  
2253 C CZ  . ARG A 296 ? 0.5314 0.5193 0.5083 0.0064  0.0418  0.0270  296 ARG A CZ  
2254 N NH1 . ARG A 296 ? 0.5404 0.5278 0.5259 0.0018  0.0354  0.0275  296 ARG A NH1 
2255 N NH2 . ARG A 296 ? 0.5270 0.5082 0.4873 0.0060  0.0427  0.0232  296 ARG A NH2 
2256 N N   . PHE A 297 ? 0.4509 0.4785 0.5000 0.0070  0.0370  0.0439  297 PHE A N   
2257 C CA  . PHE A 297 ? 0.4365 0.4723 0.4973 0.0064  0.0349  0.0460  297 PHE A CA  
2258 C C   . PHE A 297 ? 0.4423 0.4919 0.5078 0.0124  0.0404  0.0483  297 PHE A C   
2259 O O   . PHE A 297 ? 0.4511 0.4977 0.5090 0.0199  0.0456  0.0460  297 PHE A O   
2260 C CB  . PHE A 297 ? 0.4298 0.4561 0.4906 0.0074  0.0311  0.0420  297 PHE A CB  
2261 C CG  . PHE A 297 ? 0.4302 0.4449 0.4851 0.0039  0.0273  0.0393  297 PHE A CG  
2262 C CD1 . PHE A 297 ? 0.3805 0.3941 0.4385 -0.0012 0.0226  0.0411  297 PHE A CD1 
2263 C CD2 . PHE A 297 ? 0.3939 0.3987 0.4395 0.0057  0.0283  0.0351  297 PHE A CD2 
2264 C CE1 . PHE A 297 ? 0.3941 0.3999 0.4476 -0.0026 0.0192  0.0392  297 PHE A CE1 
2265 C CE2 . PHE A 297 ? 0.3879 0.3865 0.4297 0.0021  0.0245  0.0332  297 PHE A CE2 
2266 C CZ  . PHE A 297 ? 0.3583 0.3589 0.4048 -0.0012 0.0200  0.0354  297 PHE A CZ  
2267 N N   . SER A 298 ? 0.4350 0.4997 0.5125 0.0092  0.0390  0.0527  298 SER A N   
2268 C CA  . SER A 298 ? 0.4341 0.5185 0.5188 0.0139  0.0441  0.0566  298 SER A CA  
2269 C C   . SER A 298 ? 0.4394 0.5257 0.5245 0.0245  0.0465  0.0548  298 SER A C   
2270 O O   . SER A 298 ? 0.4547 0.5489 0.5379 0.0337  0.0532  0.0557  298 SER A O   
2271 C CB  . SER A 298 ? 0.4268 0.5280 0.5247 0.0054  0.0408  0.0621  298 SER A CB  
2272 O OG  . SER A 298 ? 0.4432 0.5444 0.5396 -0.0031 0.0408  0.0656  298 SER A OG  
2273 N N   . PHE A 299 ? 0.4279 0.5069 0.5147 0.0243  0.0415  0.0525  299 PHE A N   
2274 C CA  . PHE A 299 ? 0.4130 0.4942 0.5006 0.0340  0.0430  0.0521  299 PHE A CA  
2275 C C   . PHE A 299 ? 0.4159 0.4744 0.4927 0.0361  0.0414  0.0471  299 PHE A C   
2276 O O   . PHE A 299 ? 0.4181 0.4704 0.4963 0.0305  0.0359  0.0457  299 PHE A O   
2277 C CB  . PHE A 299 ? 0.3892 0.4896 0.4906 0.0316  0.0387  0.0561  299 PHE A CB  
2278 C CG  . PHE A 299 ? 0.3843 0.5104 0.4970 0.0297  0.0412  0.0618  299 PHE A CG  
2279 C CD1 . PHE A 299 ? 0.3741 0.5165 0.4900 0.0410  0.0476  0.0648  299 PHE A CD1 
2280 C CD2 . PHE A 299 ? 0.3650 0.4983 0.4840 0.0170  0.0378  0.0645  299 PHE A CD2 
2281 C CE1 . PHE A 299 ? 0.3841 0.5543 0.5117 0.0392  0.0507  0.0708  299 PHE A CE1 
2282 C CE2 . PHE A 299 ? 0.3634 0.5214 0.4929 0.0135  0.0406  0.0706  299 PHE A CE2 
2283 C CZ  . PHE A 299 ? 0.3605 0.5394 0.4954 0.0245  0.0471  0.0740  299 PHE A CZ  
2284 N N   . VAL A 300 ? 0.4237 0.4694 0.4888 0.0438  0.0466  0.0443  300 VAL A N   
2285 C CA  . VAL A 300 ? 0.4286 0.4512 0.4817 0.0441  0.0457  0.0397  300 VAL A CA  
2286 C C   . VAL A 300 ? 0.4488 0.4618 0.4933 0.0560  0.0506  0.0390  300 VAL A C   
2287 O O   . VAL A 300 ? 0.4496 0.4750 0.4977 0.0653  0.0548  0.0421  300 VAL A O   
2288 C CB  . VAL A 300 ? 0.4307 0.4400 0.4738 0.0380  0.0458  0.0357  300 VAL A CB  
2289 C CG1 . VAL A 300 ? 0.4101 0.4279 0.4609 0.0282  0.0412  0.0373  300 VAL A CG1 
2290 C CG2 . VAL A 300 ? 0.4468 0.4535 0.4801 0.0439  0.0524  0.0344  300 VAL A CG2 
2291 N N   . PRO A 301 ? 0.4596 0.4505 0.4925 0.0558  0.0501  0.0356  301 PRO A N   
2292 C CA  . PRO A 301 ? 0.4740 0.4516 0.4965 0.0671  0.0547  0.0354  301 PRO A CA  
2293 C C   . PRO A 301 ? 0.4962 0.4711 0.5099 0.0761  0.0617  0.0339  301 PRO A C   
2294 O O   . PRO A 301 ? 0.5016 0.4722 0.5091 0.0713  0.0630  0.0305  301 PRO A O   
2295 C CB  . PRO A 301 ? 0.4768 0.4290 0.4866 0.0613  0.0530  0.0314  301 PRO A CB  
2296 C CG  . PRO A 301 ? 0.4700 0.4316 0.4906 0.0506  0.0465  0.0323  301 PRO A CG  
2297 C CD  . PRO A 301 ? 0.4549 0.4355 0.4862 0.0461  0.0450  0.0332  301 PRO A CD  
2298 N N   . VAL A 302 ? 0.5063 0.4841 0.5188 0.0900  0.0663  0.0365  302 VAL A N   
2299 C CA  . VAL A 302 ? 0.5284 0.5049 0.5322 0.1016  0.0740  0.0353  302 VAL A CA  
2300 C C   . VAL A 302 ? 0.5672 0.5116 0.5496 0.1119  0.0784  0.0317  302 VAL A C   
2301 O O   . VAL A 302 ? 0.5770 0.5095 0.5565 0.1157  0.0767  0.0336  302 VAL A O   
2302 C CB  . VAL A 302 ? 0.5164 0.5254 0.5363 0.1115  0.0769  0.0418  302 VAL A CB  
2303 C CG1 . VAL A 302 ? 0.5065 0.5214 0.5331 0.1194  0.0746  0.0466  302 VAL A CG1 
2304 C CG2 . VAL A 302 ? 0.5353 0.5459 0.5466 0.1253  0.0859  0.0410  302 VAL A CG2 
2305 N N   . VAL A 303 ? 0.5837 0.5127 0.5497 0.1165  0.0840  0.0265  303 VAL A N   
2306 C CA  . VAL A 303 ? 0.6195 0.5153 0.5626 0.1269  0.0888  0.0224  303 VAL A CA  
2307 C C   . VAL A 303 ? 0.6417 0.5479 0.5872 0.1477  0.0950  0.0272  303 VAL A C   
2308 O O   . VAL A 303 ? 0.6489 0.5669 0.5930 0.1589  0.1018  0.0270  303 VAL A O   
2309 C CB  . VAL A 303 ? 0.6379 0.5122 0.5602 0.1244  0.0922  0.0143  303 VAL A CB  
2310 C CG1 . VAL A 303 ? 0.6702 0.5048 0.5661 0.1333  0.0963  0.0093  303 VAL A CG1 
2311 C CG2 . VAL A 303 ? 0.6146 0.4855 0.5376 0.1045  0.0855  0.0109  303 VAL A CG2 
2312 N N   . ASP A 304 ? 0.6495 0.5538 0.5993 0.1530  0.0926  0.0321  304 ASP A N   
2313 C CA  . ASP A 304 ? 0.6631 0.5845 0.6202 0.1720  0.0965  0.0385  304 ASP A CA  
2314 C C   . ASP A 304 ? 0.7068 0.5949 0.6407 0.1897  0.1026  0.0368  304 ASP A C   
2315 O O   . ASP A 304 ? 0.7167 0.6170 0.6536 0.2091  0.1073  0.0417  304 ASP A O   
2316 C CB  . ASP A 304 ? 0.6437 0.5865 0.6199 0.1684  0.0896  0.0457  304 ASP A CB  
2317 C CG  . ASP A 304 ? 0.6708 0.5858 0.6376 0.1585  0.0840  0.0448  304 ASP A CG  
2318 O OD1 . ASP A 304 ? 0.6794 0.5624 0.6287 0.1498  0.0841  0.0386  304 ASP A OD1 
2319 O OD2 . ASP A 304 ? 0.6713 0.5989 0.6488 0.1588  0.0794  0.0506  304 ASP A OD2 
2320 N N   . GLY A 305 ? 0.7343 0.5808 0.6451 0.1830  0.1024  0.0302  305 GLY A N   
2321 C CA  . GLY A 305 ? 0.7851 0.5919 0.6706 0.1970  0.1071  0.0284  305 GLY A CA  
2322 C C   . GLY A 305 ? 0.7988 0.5972 0.6856 0.2008  0.1036  0.0353  305 GLY A C   
2323 O O   . GLY A 305 ? 0.8341 0.6024 0.7017 0.2156  0.1077  0.0363  305 GLY A O   
2324 N N   . ASP A 306 ? 0.7676 0.5912 0.6754 0.1881  0.0962  0.0402  306 ASP A N   
2325 C CA  . ASP A 306 ? 0.7700 0.5898 0.6802 0.1897  0.0921  0.0471  306 ASP A CA  
2326 C C   . ASP A 306 ? 0.7560 0.5655 0.6668 0.1674  0.0853  0.0455  306 ASP A C   
2327 O O   . ASP A 306 ? 0.7850 0.5566 0.6756 0.1619  0.0856  0.0430  306 ASP A O   
2328 C CB  . ASP A 306 ? 0.7502 0.6138 0.6849 0.1988  0.0898  0.0556  306 ASP A CB  
2329 C CG  . ASP A 306 ? 0.7724 0.6337 0.7083 0.2024  0.0855  0.0632  306 ASP A CG  
2330 O OD1 . ASP A 306 ? 0.7928 0.6179 0.7103 0.1990  0.0850  0.0630  306 ASP A OD1 
2331 O OD2 . ASP A 306 ? 0.7809 0.6782 0.7361 0.2080  0.0823  0.0698  306 ASP A OD2 
2332 N N   . PHE A 307 ? 0.7106 0.5526 0.6435 0.1546  0.0793  0.0471  307 PHE A N   
2333 C CA  . PHE A 307 ? 0.6912 0.5272 0.6258 0.1343  0.0736  0.0450  307 PHE A CA  
2334 C C   . PHE A 307 ? 0.7095 0.5197 0.6286 0.1234  0.0751  0.0368  307 PHE A C   
2335 O O   . PHE A 307 ? 0.7255 0.5100 0.6322 0.1123  0.0734  0.0348  307 PHE A O   
2336 C CB  . PHE A 307 ? 0.6465 0.5197 0.6053 0.1236  0.0678  0.0464  307 PHE A CB  
2337 C CG  . PHE A 307 ? 0.6105 0.4806 0.5721 0.1071  0.0621  0.0460  307 PHE A CG  
2338 C CD1 . PHE A 307 ? 0.5861 0.4422 0.5413 0.0923  0.0610  0.0402  307 PHE A CD1 
2339 C CD2 . PHE A 307 ? 0.5981 0.4807 0.5682 0.1068  0.0579  0.0516  307 PHE A CD2 
2340 C CE1 . PHE A 307 ? 0.5374 0.3934 0.4960 0.0780  0.0563  0.0402  307 PHE A CE1 
2341 C CE2 . PHE A 307 ? 0.5719 0.4525 0.5438 0.0923  0.0535  0.0512  307 PHE A CE2 
2342 C CZ  . PHE A 307 ? 0.5391 0.4069 0.5057 0.0784  0.0531  0.0456  307 PHE A CZ  
2343 N N   . LEU A 308 ? 0.7086 0.5274 0.6285 0.1261  0.0783  0.0323  308 LEU A N   
2344 C CA  . LEU A 308 ? 0.7235 0.5207 0.6281 0.1169  0.0795  0.0242  308 LEU A CA  
2345 C C   . LEU A 308 ? 0.7619 0.5370 0.6466 0.1331  0.0871  0.0208  308 LEU A C   
2346 O O   . LEU A 308 ? 0.7608 0.5558 0.6519 0.1445  0.0914  0.0211  308 LEU A O   
2347 C CB  . LEU A 308 ? 0.6888 0.5131 0.6084 0.1059  0.0767  0.0217  308 LEU A CB  
2348 C CG  . LEU A 308 ? 0.6636 0.4993 0.5955 0.0876  0.0694  0.0221  308 LEU A CG  
2349 C CD1 . LEU A 308 ? 0.6292 0.4889 0.5734 0.0800  0.0674  0.0202  308 LEU A CD1 
2350 C CD2 . LEU A 308 ? 0.6739 0.4798 0.5899 0.0747  0.0672  0.0180  308 LEU A CD2 
2351 N N   . SER A 309 ? 0.8048 0.5383 0.6648 0.1343  0.0891  0.0178  309 SER A N   
2352 C CA  . SER A 309 ? 0.8488 0.5561 0.6869 0.1529  0.0968  0.0148  309 SER A CA  
2353 C C   . SER A 309 ? 0.8611 0.5641 0.6881 0.1526  0.1006  0.0062  309 SER A C   
2354 O O   . SER A 309 ? 0.8834 0.5787 0.6984 0.1706  0.1079  0.0040  309 SER A O   
2355 C CB  . SER A 309 ? 0.8920 0.5518 0.7045 0.1548  0.0979  0.0145  309 SER A CB  
2356 O OG  . SER A 309 ? 0.9184 0.5496 0.7151 0.1348  0.0945  0.0078  309 SER A OG  
2357 N N   . ASP A 310 ? 0.8473 0.5576 0.6788 0.1330  0.0956  0.0017  310 ASP A N   
2358 C CA  . ASP A 310 ? 0.8518 0.5620 0.6744 0.1297  0.0976  -0.0060 310 ASP A CA  
2359 C C   . ASP A 310 ? 0.8176 0.5535 0.6580 0.1094  0.0903  -0.0060 310 ASP A C   
2360 O O   . ASP A 310 ? 0.7889 0.5388 0.6462 0.0995  0.0846  -0.0010 310 ASP A O   
2361 C CB  . ASP A 310 ? 0.8980 0.5597 0.6868 0.1270  0.0994  -0.0150 310 ASP A CB  
2362 C CG  . ASP A 310 ? 0.9293 0.5846 0.7014 0.1335  0.1047  -0.0231 310 ASP A CG  
2363 O OD1 . ASP A 310 ? 0.9282 0.6180 0.7156 0.1366  0.1064  -0.0217 310 ASP A OD1 
2364 O OD2 . ASP A 310 ? 0.9732 0.5869 0.7152 0.1349  0.1072  -0.0309 310 ASP A OD2 
2365 N N   . THR A 311 ? 0.8178 0.5600 0.6539 0.1041  0.0907  -0.0115 311 THR A N   
2366 C CA  . THR A 311 ? 0.7951 0.5613 0.6471 0.0870  0.0840  -0.0110 311 THR A CA  
2367 C C   . THR A 311 ? 0.8000 0.5506 0.6490 0.0691  0.0768  -0.0125 311 THR A C   
2368 O O   . THR A 311 ? 0.8409 0.5563 0.6676 0.0660  0.0772  -0.0175 311 THR A O   
2369 C CB  . THR A 311 ? 0.8094 0.5767 0.65