data_2XUJ
# 
_entry.id   2XUJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XUJ         
PDBE  EBI-45833    
WWPDB D_1290045833 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (10 MTH)' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (1 MTH)' 
PDB 2XUG unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (1 WK)' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (10 MTH)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XUJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-10-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourne, Y.'  1 
'Radic, Z.'   2 
'Taylor, P.'  3 
'Marchot, P.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Conformational Remodeling of Femtomolar Inhibitor-Acetylcholinesterase Complexes in the Crystalline State' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            132 
_citation.page_first                18292 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21090615 
_citation.pdbx_database_id_DOI      10.1021/JA106820E 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bourne, Y.'  1 
primary 'Radic, Z.'   2 
primary 'Taylor, P.'  3 
primary 'Marchot, P.' 4 
# 
_cell.entry_id           2XUJ 
_cell.length_a           79.191 
_cell.length_b           112.741 
_cell.length_c           226.067 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XUJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 59672.395 2   3.1.1.7 YES 'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE 221.208   1   ?       ?   ?                                   ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331   1   ?       ?   ?                                   ? 
4 non-polymer syn 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-5-YL]HEXYL]-PHENANTHRIDINIUM' 
661.860   2   ?       ?   ?                                   ? 
5 water       nat water 18.015    134 ?       ?   ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSAFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSAFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 ALA n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BLACK6CBA CROSS F1' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                'BRAIN (CDNA)' 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       LAMBDA-ZAP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'LAMBDA-FIX CDNA, GENOMIC DNA' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XUJ A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2XUJ B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2XUJ ALA A 337 ? UNP P21836 TYR 368 'engineered mutation' 337 1 
2 2XUJ ALA B 337 ? UNP P21836 TYR 368 'engineered mutation' 337 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                            'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                            'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                            'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                            'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE ?                            'C8 H15 N O6'    221.208 
P6G non-polymer         . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking' y PHENYLALANINE ?                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                            'C9 H11 N O3'    181.189 
TZ5 non-polymer         . 
'3,8-DIAMINO-6-PHENYL-5-[6-[1-[2-[(1,2,3,4-TETRAHYDRO-9-ACRIDINYL)AMINO]ETHYL]-1H-1,2,3-TRIAZOL-5-YL]HEXYL]-PHENANTHRIDINIUM' ? 
'C42 H45 N8 1'   661.860 
VAL 'L-peptide linking' y VALINE ?                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2XUJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.08 
_exptl_crystal.density_percent_sol   69.6 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM PEG-600 25-35% (V/V) IN 50-100 MM HEPES, PH 6.0-7.0, OR WITH PEG-550 MME 30% (V/V) IN 50 MM NA ACETATE, PH 7.5
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2003-07-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
_diffrn_source.pdbx_wavelength             0.931 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XUJ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   59477 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.40 
_reflns.B_iso_Wilson_estimate        65.8 
_reflns.pdbx_redundancy              3.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.72 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.60 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XUJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     58015 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    99.56 
_refine.ls_R_factor_obs                          0.20789 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20700 
_refine.ls_R_factor_R_free                       0.24981 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1211 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.918 
_refine.B_iso_mean                               57.009 
_refine.aniso_B[1][1]                            0.19 
_refine.aniso_B[2][2]                            7.83 
_refine.aniso_B[3][3]                            -8.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.337 
_refine.pdbx_overall_ESU_R_Free                  0.258 
_refine.overall_SU_ML                            0.204 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             21.561 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8332 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         133 
_refine_hist.number_atoms_solvent             134 
_refine_hist.number_atoms_total               8599 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 8797  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.468  1.974  ? 12033 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.656  5.000  ? 1081  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.127 22.743 ? 401   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.711 15.000 ? 1265  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.572 15.000 ? 77    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.102  0.200  ? 1275  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.022  ? 6958  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.517  1.500  ? 5368  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.985  2.000  ? 8654  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.552  3.000  ? 3429  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.614  4.500  ? 3372  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1954 0.12 0.50  'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 1954 0.12 0.50  'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 1839 0.38 5.00  'loose positional'  1 3 'X-RAY DIFFRACTION' ? ? ? 
2 B 1839 0.38 5.00  'loose positional'  1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 1954 0.44 2.00  'medium thermal'    1 5 'X-RAY DIFFRACTION' ? ? ? 
2 B 1954 0.44 2.00  'medium thermal'    1 6 'X-RAY DIFFRACTION' ? ? ? 
1 A 1839 0.73 10.00 'loose thermal'     1 7 'X-RAY DIFFRACTION' ? ? ? 
2 B 1839 0.73 10.00 'loose thermal'     1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.650 
_refine_ls_shell.d_res_low                        2.718 
_refine_ls_shell.number_reflns_R_work             4167 
_refine_ls_shell.R_factor_R_work                  0.295 
_refine_ls_shell.percent_reflns_obs               99.70 
_refine_ls_shell.R_factor_R_free                  0.283 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.722500 -0.406300 -0.559400 -0.396500 -0.906300 0.146300 -0.566400 0.116100 -0.815900 1.56500 25.65000 -12.46000 
2 given ? 0.722500 -0.406300 -0.559400 -0.396500 -0.906300 0.146300 -0.566400 0.116100 -0.815900 1.56500 25.65000 -12.46000 
3 given ? 0.722500 -0.406300 -0.559400 -0.396500 -0.906300 0.146300 -0.566400 0.116100 -0.815900 1.56500 25.65000 -12.46000 
4 given ? 0.722500 -0.406300 -0.559400 -0.396500 -0.906300 0.146300 -0.566400 0.116100 -0.815900 1.56500 25.65000 -12.46000 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 16  A 56  1 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 16  B 56  1 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 60  A 74  2 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 60  B 74  2 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 80  A 255 3 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 80  B 255 3 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 265 A 490 4 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 265 B 490 4 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 508 A 539 5 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 508 B 539 5 5 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2XUJ 
_struct.title                     'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XUJ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, HYDROLASE FOLD, CLICK CHEMISTRY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? LEU A 214 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? TYR A 341 ? GLY A 335 TYR A 341 5 ? 7  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? LEU A 539 ? ARG A 525 LEU A 539 1 ? 15 
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 GLY B 154 ? LEU B 159 ? GLY B 154 LEU B 159 1 ? 6  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P40 40 GLU B 285 ? LEU B 289 ? GLU B 285 LEU B 289 5 ? 5  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? TYR B 341 ? GLY B 335 TYR B 341 1 ? 7  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 53 ARG B 534 ? LEU B 539 ? ARG B 534 LEU B 539 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 69  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf2 disulf ? ? A CYS 257 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf3 disulf ? ? A CYS 409 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf4 disulf ? ? B CYS 69  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf5 disulf ? ? B CYS 257 SG ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf6 disulf ? ? B CYS 409 SG ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.073 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 1   A . ? GLU 1   A GLY 2   A ? GLY 2   A 1 6.97   
2 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 1.57   
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 -5.65  
4 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 12.06  
5 GLY 263 B . ? GLY 263 B GLY 264 B ? GLY 264 B 1 -5.63  
6 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 -27.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NAG A 1542' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE P6G A 1543' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE TZ5 A 1544' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE TZ5 B 1541' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1  ASN A 464 ? ASN A 464  . ? 1_555 ? 
2  AC2 10 LEU A 380 ? LEU A 380  . ? 1_555 ? 
3  AC2 10 HIS A 381 ? HIS A 381  . ? 1_555 ? 
4  AC2 10 GLN A 527 ? GLN A 527  . ? 1_555 ? 
5  AC2 10 PHE A 531 ? PHE A 531  . ? 1_555 ? 
6  AC2 10 PHE A 535 ? PHE A 535  . ? 1_555 ? 
7  AC2 10 ALA B 377 ? ALA B 377  . ? 1_555 ? 
8  AC2 10 LEU B 380 ? LEU B 380  . ? 1_555 ? 
9  AC2 10 HIS B 381 ? HIS B 381  . ? 1_555 ? 
10 AC2 10 GLN B 527 ? GLN B 527  . ? 1_555 ? 
11 AC2 10 PHE B 535 ? PHE B 535  . ? 1_555 ? 
12 AC3 16 TYR A 72  ? TYR A 72   . ? 1_555 ? 
13 AC3 16 TRP A 86  ? TRP A 86   . ? 1_555 ? 
14 AC3 16 GLY A 120 ? GLY A 120  . ? 1_555 ? 
15 AC3 16 GLY A 121 ? GLY A 121  . ? 1_555 ? 
16 AC3 16 TYR A 124 ? TYR A 124  . ? 1_555 ? 
17 AC3 16 GLU A 202 ? GLU A 202  . ? 1_555 ? 
18 AC3 16 GLU A 285 ? GLU A 285  . ? 1_555 ? 
19 AC3 16 TRP A 286 ? TRP A 286  . ? 1_555 ? 
20 AC3 16 ALA A 337 ? ALA A 337  . ? 1_555 ? 
21 AC3 16 PHE A 338 ? PHE A 338  . ? 1_555 ? 
22 AC3 16 TYR A 341 ? TYR A 341  . ? 1_555 ? 
23 AC3 16 GLY A 342 ? GLY A 342  . ? 1_555 ? 
24 AC3 16 TRP A 439 ? TRP A 439  . ? 1_555 ? 
25 AC3 16 HIS A 447 ? HIS A 447  . ? 1_555 ? 
26 AC3 16 HOH G .   ? HOH A 2029 . ? 1_555 ? 
27 AC3 16 HOH G .   ? HOH A 2046 . ? 1_555 ? 
28 AC4 13 TYR B 72  ? TYR B 72   . ? 1_555 ? 
29 AC4 13 TRP B 86  ? TRP B 86   . ? 1_555 ? 
30 AC4 13 GLY B 121 ? GLY B 121  . ? 1_555 ? 
31 AC4 13 TYR B 124 ? TYR B 124  . ? 1_555 ? 
32 AC4 13 GLU B 202 ? GLU B 202  . ? 1_555 ? 
33 AC4 13 GLU B 285 ? GLU B 285  . ? 1_555 ? 
34 AC4 13 TRP B 286 ? TRP B 286  . ? 1_555 ? 
35 AC4 13 ALA B 337 ? ALA B 337  . ? 1_555 ? 
36 AC4 13 PHE B 338 ? PHE B 338  . ? 1_555 ? 
37 AC4 13 TYR B 341 ? TYR B 341  . ? 1_555 ? 
38 AC4 13 GLY B 342 ? GLY B 342  . ? 1_555 ? 
39 AC4 13 TRP B 439 ? TRP B 439  . ? 1_555 ? 
40 AC4 13 HIS B 447 ? HIS B 447  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2XUJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XUJ 
_atom_sites.fract_transf_matrix[1][1]   0.012628 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008870 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004423 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.042  15.012  56.608  1.00 85.61  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.732  15.738  56.657  1.00 86.02  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.623  14.833  56.092  1.00 84.58  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 29.797  14.238  55.023  1.00 83.23  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.814  17.087  55.897  1.00 85.65  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.236  18.309  56.663  1.00 88.09  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 30.792  18.459  58.110  1.00 92.20  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 32.015  18.694  58.263  1.00 92.82  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 30.007  18.348  59.092  1.00 93.37  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.487  14.720  56.789  1.00 84.71  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.165  15.506  57.975  1.00 84.87  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.915  16.330  57.716  1.00 83.84  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.836  15.997  58.205  1.00 84.11  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.065  17.374  56.899  1.00 82.13  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.039  18.413  56.706  1.00 81.79  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.451  18.450  55.297  1.00 79.16  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.496  19.185  55.028  1.00 79.34  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.625  19.792  57.030  1.00 82.99  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 27.057  19.986  58.482  1.00 86.53  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 25.845  20.146  59.400  1.00 90.89  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 26.241  20.400  60.784  1.00 94.34  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 25.432  20.285  61.834  1.00 96.53  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 24.162  19.903  61.681  1.00 96.21  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 25.903  20.541  63.046  1.00 98.54  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.026  17.660  54.400  1.00 76.26  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.660  17.717  53.001  1.00 73.52  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.507  16.790  52.666  1.00 71.67  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.200  15.860  53.406  1.00 72.14  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.851  17.353  52.114  1.00 72.66  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 28.118  18.131  52.382  1.00 74.92  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.317  17.417  51.793  1.00 77.07  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.123  16.847  52.570  1.00 77.74  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.419  17.390  50.546  1.00 76.62  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 23.896  17.051  51.518  1.00 68.81  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.814  16.255  51.012  1.00 66.88  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.349  14.840  50.774  1.00 65.50  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.194  14.644  49.914  1.00 63.98  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.325  16.900  49.722  1.00 65.25  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.089  16.246  49.161  1.00 64.43  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.884  15.024  49.363  1.00 63.11  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.329  16.976  48.484  1.00 63.18  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.874  13.853  51.558  1.00 66.00  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.334  12.464  51.412  1.00 64.90  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 23.133  11.883  50.012  1.00 62.82  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.784  10.902  49.656  1.00 62.43  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.472  11.693  52.419  1.00 66.42  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.325  12.589  52.744  1.00 67.57  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.874  13.978  52.637  1.00 67.81  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.252  12.480  49.218  1.00 61.53  ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.989  11.939  47.889  1.00 59.89  ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 23.108  12.262  46.894  1.00 57.61  ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 23.157  11.711  45.793  1.00 57.09  ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.626  12.401  47.369  1.00 60.41  ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.962  11.445  46.363  1.00 61.60  ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.541  10.105  46.976  1.00 65.38  ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.139  10.025  48.146  1.00 68.15  ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 19.643  9.043   46.185  1.00 65.52  ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 24.024  13.129  47.305  1.00 56.61  ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 25.029  13.662  46.416  1.00 54.21  ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.389  13.059  46.667  1.00 54.16  ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 27.340  13.404  45.975  1.00 53.70  ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 25.103  15.182  46.553  1.00 54.21  ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.816  15.953  46.228  1.00 52.91  ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 24.049  17.422  46.418  1.00 51.78  ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 23.333  15.661  44.810  1.00 50.25  ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.497  12.165  47.649  1.00 54.59  ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.778  11.542  47.947  1.00 54.09  ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.789  10.126  47.420  1.00 53.68  ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 27.016  9.274   47.873  1.00 54.70  ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 28.094  11.583  49.443  1.00 55.52  ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 27.923  12.949  50.140  1.00 56.40  ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 28.153  12.872  51.673  1.00 57.20  ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 28.772  14.068  49.486  1.00 54.26  ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.644  9.895   46.429  1.00 52.26  ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.790  8.582   45.823  1.00 51.68  ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.262  8.229   45.736  1.00 51.39  ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 31.107  9.094   45.430  1.00 50.86  ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 28.160  8.529   44.415  1.00 51.02  ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.413  7.162   43.755  1.00 50.37  ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.654  8.779   44.502  1.00 51.23  ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.559  6.960   46.033  1.00 51.38  ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.893  6.389   45.841  1.00 50.45  ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.899  5.552   44.580  1.00 49.73  ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 31.109  4.610   44.433  1.00 50.19  ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.311  5.530   47.022  1.00 51.62  ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.609  4.779   46.804  1.00 51.23  ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 34.110  4.043   48.049  1.00 50.50  ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.513  4.923   49.149  1.00 49.14  ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.738  5.420   49.316  1.00 50.30  ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 35.995  6.196   50.361  1.00 49.23  ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.709  5.162   48.432  1.00 50.90  ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 32.758  5.946   43.653  1.00 48.73  ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.084  5.121   42.513  1.00 48.67  ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.445  4.536   42.801  1.00 50.22  ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.018  4.776   43.867  1.00 51.48  ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.140  5.903   41.186  1.00 46.64  ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.763  6.377   40.780  1.00 45.25  ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 34.139  7.027   41.274  1.00 46.70  ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 34.978  3.799   41.839  1.00 50.30  ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.241  3.116   42.026  1.00 52.26  ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.540  3.931   42.195  1.00 53.17  ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.546  3.386   42.615  1.00 53.89  ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.448  2.195   40.868  1.00 52.16  ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.263  1.062   41.287  1.00 54.85  ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 38.476  1.023   40.466  1.00 55.63  ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.641  0.817   41.322  1.00 58.46  ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 39.880  -0.307  41.968  1.00 58.14  ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 39.004  -1.291  41.848  1.00 60.55  ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 40.974  -0.442  42.710  1.00 56.48  ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.540  5.209   41.829  1.00 53.47  ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.723  6.041   42.001  1.00 54.35  ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.648  6.802   43.305  1.00 55.82  ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.620  7.459   43.702  1.00 56.93  ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.491  6.719   43.965  1.00 55.74  ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.258  7.428   45.219  1.00 56.87  ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.898  8.097   45.276  1.00 56.50  ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 35.023  7.833   44.449  1.00 56.04  ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.723  8.984   46.242  1.00 56.97  ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.426  9.596   46.473  1.00 56.77  ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 34.156  10.840  45.627  1.00 55.20  ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 35.052  11.606  45.323  1.00 54.95  ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.288  9.947   47.945  1.00 58.69  ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 34.384  8.765   48.867  1.00 60.99  ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.416  9.196   50.311  1.00 66.00  ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 35.355  9.889   50.749  1.00 66.04  ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 33.382  8.800   51.071  1.00 66.77  ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.895  11.032  45.270  1.00 54.09  ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.477  12.182  44.504  1.00 52.60  ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.403  12.935  45.250  1.00 53.24  ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.558  12.318  45.903  1.00 53.77  ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.897  11.728  43.173  1.00 51.25  ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.800  10.855  42.332  1.00 49.90  ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.960  10.063  41.366  1.00 48.34  ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.818  11.729  41.637  1.00 48.82  ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.435  14.261  45.161  1.00 53.16  ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 30.305  15.049  45.595  1.00 54.47  ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.650  15.588  44.341  1.00 53.62  ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 30.311  16.221  43.542  1.00 53.60  ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.731  16.189  46.515  1.00 55.84  ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.560  17.058  47.055  1.00 58.42  ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 30.003  18.190  47.988  1.00 61.97  ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.418  18.501  47.840  1.00 65.05  ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.365  18.178  48.718  1.00 68.04  ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.072  17.556  49.851  1.00 70.06  ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.624  18.486  48.461  1.00 70.39  ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.361  15.314  44.164  1.00 53.51  ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.610  15.818  43.032  1.00 52.50  ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.830  17.043  43.418  1.00 53.73  ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.983  17.556  44.526  1.00 55.13  ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.992  17.514  42.498  1.00 53.42  ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 25.151  18.678  42.726  1.00 54.14  ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.705  18.350  42.372  1.00 54.49  ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.438  17.598  41.428  1.00 53.84  ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.665  19.895  41.917  1.00 53.76  ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.839  21.153  42.211  1.00 55.03  ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.704  19.572  40.423  1.00 52.46  ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.443  22.459  41.704  1.00 55.33  ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.783  18.924  43.139  1.00 56.10  ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.350  18.783  42.924  1.00 56.98  ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.882  19.919  42.014  1.00 56.88  ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 21.022  21.108  42.349  1.00 57.50  ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.659  18.831  44.283  1.00 58.94  ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 19.147  18.693  44.339  1.00 61.19  ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.775  19.104  45.753  1.00 67.32  ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 17.368  19.392  46.005  1.00 72.38  ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 16.651  20.338  45.394  1.00 75.82  ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 17.183  21.090  44.416  1.00 75.59  ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 15.374  20.506  45.738  1.00 76.59  ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.343  19.544  40.855  1.00 55.96  ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.948  20.510  39.839  1.00 55.75  ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.444  20.550  39.662  1.00 56.78  ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.780  19.534  39.835  1.00 57.04  ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.624  20.194  38.502  1.00 54.05  ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 22.146  20.387  38.354  1.00 53.37  ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.596  19.938  36.999  1.00 51.89  ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.583  21.813  38.579  1.00 55.51  ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.918  21.730  39.332  1.00 57.71  ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.510  21.878  38.964  1.00 59.23  ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 16.269  21.458  37.531  1.00 57.66  ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.934  21.926  36.611  1.00 56.77  ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 16.015  23.317  39.149  1.00 60.72  ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.563  23.655  40.570  1.00 65.71  ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.166  25.148  40.737  1.00 71.63  ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 14.237  25.667  39.582  1.00 74.24  ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 12.834  25.120  39.575  1.00 74.58  ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 15.334  20.539  37.361  1.00 57.74  ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.701  20.328  36.080  1.00 57.22  ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 13.270  20.840  36.236  1.00 59.01  ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.812  21.097  37.369  1.00 60.79  ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.729  18.868  35.698  1.00 56.36  ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.561  21.031  35.113  1.00 58.75  ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 11.186  21.552  35.182  1.00 60.00  ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 10.260  20.755  36.104  1.00 60.84  ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.559   21.343  36.922  1.00 61.81  ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.709  21.459  33.735  1.00 59.74  ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.982  21.608  32.928  1.00 58.83  ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 13.051  20.912  33.727  1.00 57.07  ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.271  19.430  35.975  1.00 60.11  ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.386   18.570  36.759  1.00 61.02  ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.902   18.219  38.145  1.00 61.29  ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 9.260   17.455  38.863  1.00 62.29  ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 11.064  18.761  38.512  1.00 59.92  ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.652  18.540  39.825  1.00 59.93  ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 13.160  18.313  39.784  1.00 58.50  ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.788  18.490  38.731  1.00 56.86  ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.756  17.915  40.928  1.00 58.57  ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.221  17.860  41.042  1.00 57.37  ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.860  16.647  40.359  1.00 56.06  ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.191  15.622  40.230  1.00 56.50  ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.448  17.797  42.552  1.00 58.53  ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.195  17.227  43.113  1.00 59.59  ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 13.080  17.568  42.193  1.00 59.89  ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 17.116  16.799  39.900  1.00 54.19  ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.987  15.678  39.482  1.00 53.01  ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.376  15.762  40.124  1.00 52.37  ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.815  16.848  40.545  1.00 52.69  ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 18.176  15.552  37.931  1.00 51.42  ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.878  15.258  37.263  1.00 52.66  ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.778  16.796  37.343  1.00 51.47  ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 20.065  14.621  40.194  1.00 51.18  ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.449  14.607  40.630  1.00 50.44  ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.376  14.718  39.425  1.00 48.71  ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 22.102  14.153  38.379  1.00 47.96  ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.762  13.329  41.381  1.00 51.23  ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 20.891  13.114  42.481  1.00 54.43  ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.473  15.455  39.578  1.00 48.23  ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.506  15.557  38.551  1.00 46.64  ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.890  15.306  39.163  1.00 46.66  ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 26.236  15.871  40.204  1.00 48.43  ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 24.468  16.917  37.915  1.00 46.13  ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.681  14.454  38.522  1.00 45.16  ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 28.079  14.289  38.876  1.00 44.00  ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.861  14.671  37.645  1.00 43.06  ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 29.028  13.865  36.750  1.00 42.41  ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 28.324  12.856  39.327  1.00 44.32  ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.544  12.496  40.548  1.00 43.45  ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 26.219  12.083  40.442  1.00 42.53  ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 28.100  12.651  41.806  1.00 42.22  ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.473  11.784  41.572  1.00 41.77  ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 27.362  12.359  42.938  1.00 43.58  ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 26.041  11.924  42.817  1.00 42.58  ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.273  15.943  37.589  1.00 43.03  ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.899  16.540  36.412  1.00 41.47  ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.408  16.554  36.589  1.00 41.82  ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.889  16.775  37.704  1.00 42.72  ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.375  17.960  36.229  1.00 41.44  ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.849  18.077  36.044  1.00 41.85  ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.441  19.527  35.742  1.00 40.23  ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.274  17.090  34.970  1.00 37.77  ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 32.160  16.289  35.518  1.00 40.72  ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.613  16.305  35.608  1.00 40.83  ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.271  15.171  36.386  1.00 41.81  ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.339  15.367  36.982  1.00 43.06  ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.658  13.987  36.408  1.00 41.49  ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.338  12.803  36.947  1.00 42.26  ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.498  12.500  35.987  1.00 42.72  ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.284  12.403  34.768  1.00 42.98  ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.393  11.602  37.000  1.00 42.03  ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 32.183  11.915  37.883  1.00 41.71  ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 34.126  10.337  37.428  1.00 42.22  ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.960  11.067  37.579  1.00 38.00  ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.735  12.395  36.498  1.00 43.27  ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.809  12.061  35.554  1.00 43.19  ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.889  10.546  35.344  1.00 43.09  ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.891  9.818   36.319  1.00 43.88  ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 39.065  12.537  36.288  1.00 43.98  ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.721  12.340  37.760  1.00 44.52  ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 37.238  12.608  37.869  1.00 44.21  ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.993  10.099  34.098  1.00 42.76  ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 38.103  8.675   33.785  1.00 43.71  ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.449  8.258   33.226  1.00 44.83  ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.741  7.057   33.136  1.00 45.48  ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.990  8.210   32.845  1.00 43.05  ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 37.040  8.819   31.456  1.00 42.53  ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.574  8.095   30.388  1.00 43.73  ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.499  10.077  31.207  1.00 41.20  ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.605  8.629   29.105  1.00 42.94  ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.508  10.618  29.928  1.00 41.30  ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 37.069  9.899   28.868  1.00 41.38  ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 40.276  9.230   32.841  1.00 45.10  ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.621  8.882   32.359  1.00 45.99  ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.679  9.737   33.018  1.00 46.91  ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 42.374  10.797  33.584  1.00 46.88  ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.714  9.006   30.845  1.00 45.05  ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.922  9.281   32.933  1.00 47.30  ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 45.025  10.125  33.334  1.00 48.08  ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 45.133  11.287  32.364  1.00 47.22  ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 45.011  11.096  31.158  1.00 46.79  ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 46.316  9.316   33.403  1.00 49.15  ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.363  8.471   34.642  1.00 51.00  ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.576  9.306   35.891  1.00 53.80  ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.682  9.894   35.979  1.00 58.21  ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.669  9.377   36.768  1.00 50.67  ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 45.349  12.503  32.878  1.00 47.64  ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.335  13.602  31.911  1.00 47.68  ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 46.325  13.312  30.772  1.00 48.44  ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.514  13.152  31.030  1.00 50.21  ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.747  14.817  32.748  1.00 48.49  ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.402  14.425  34.170  1.00 48.28  ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.649  12.956  34.246  1.00 48.11  ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.830  13.210  29.523  1.00 47.51  ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.658  12.782  28.402  1.00 47.89  ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.599  13.883  27.911  1.00 48.49  ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.571  14.257  26.734  1.00 47.88  ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.619  12.458  27.329  1.00 46.65  ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.524  13.456  27.587  1.00 45.39  ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.467  13.585  29.084  1.00 46.48  ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.435  14.383  28.806  1.00 49.52  ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 49.306  15.515  28.490  1.00 50.52  ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.793  15.123  28.407  1.00 52.43  ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 51.178  14.004  28.772  1.00 52.88  ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 49.106  16.638  29.519  1.00 51.03  ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.630  17.031  29.565  1.00 49.61  ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.583  16.196  30.910  1.00 50.12  ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.620  16.047  27.924  1.00 53.42  ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 53.067  15.824  27.848  1.00 55.45  ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.363  14.611  26.994  1.00 55.96  ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.857  14.502  25.877  1.00 55.54  ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 54.140  13.680  27.540  1.00 57.44  ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.535  12.465  26.828  1.00 58.17  ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.346  11.579  26.448  1.00 56.94  ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.510  10.604  25.707  1.00 57.13  ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.527  11.657  27.664  1.00 59.61  ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.906  11.177  28.841  1.00 58.47  ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 52.163  11.925  26.952  1.00 55.84  ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.956  11.125  26.723  1.00 54.86  ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 50.118  11.616  25.550  1.00 52.95  ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 49.110  11.005  25.210  1.00 52.54  ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 50.101  11.042  27.994  1.00 54.71  ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.578  9.991   29.014  1.00 57.62  ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.547  9.845   30.173  1.00 62.52  ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 50.020  8.998   31.277  1.00 67.21  ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 50.919  9.388   32.184  1.00 71.23  ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 51.301  8.559   33.143  1.00 72.81  ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 51.457  10.612  32.128  1.00 72.92  ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.541  12.707  24.918  1.00 52.15  ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.841  13.231  23.744  1.00 49.67  ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.912  12.203  22.628  1.00 49.60  ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.927  11.550  22.457  1.00 51.56  ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.457  14.561  23.324  1.00 49.34  ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.696  15.333  22.294  1.00 46.25  ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.556  16.475  21.778  1.00 45.52  ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 50.239  17.755  22.394  1.00 44.22  ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.905  18.887  22.160  1.00 46.52  ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.937  18.891  21.336  1.00 50.53  ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.551  20.029  22.736  1.00 45.43  ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.832  12.062  21.873  1.00 48.40  ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.712  11.049  20.805  1.00 48.07  ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.645  9.621   21.324  1.00 48.71  ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.415  8.693   20.559  1.00 48.19  ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.812  11.166  19.749  1.00 48.60  ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 50.079  12.560  19.310  1.00 47.50  ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 49.066  13.340  18.764  1.00 45.65  ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.348  13.097  19.430  1.00 47.03  ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.313  14.639  18.348  1.00 44.12  ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.597  14.382  19.029  1.00 48.01  ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.567  15.165  18.484  1.00 45.09  ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.816  9.460   22.628  1.00 49.88  ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.863  8.140   23.236  1.00 52.18  ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.481  7.657   23.716  1.00 50.97  ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.616  8.490   24.070  1.00 50.33  ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.848  8.169   24.386  1.00 53.50  ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.651  6.913   24.475  1.00 59.18  ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.392  7.095   24.103  1.00 64.44  ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 53.031  7.298   25.769  1.00 63.32  ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 47.247  6.326   23.702  1.00 51.11  ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.994  5.753   24.236  1.00 50.44  ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.717  6.248   25.646  1.00 50.31  ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.647  6.532   26.385  1.00 51.13  ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.291  4.238   24.305  1.00 51.30  ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 47.284  3.993   23.242  1.00 51.81  ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 48.081  5.299   23.055  1.00 52.26  ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.446  6.349   26.034  1.00 49.53  ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.195  6.799   27.388  1.00 49.60  ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.618  5.744   28.382  1.00 51.80  ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.508  4.541   28.110  1.00 52.69  ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.682  6.943   27.421  1.00 48.20  ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 42.207  5.927   26.430  1.00 47.94  ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 43.202  6.017   25.322  1.00 48.52  ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 45.109  6.203   29.526  1.00 53.30  ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.367  5.339   30.669  1.00 55.19  ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.298  5.548   31.752  1.00 53.79  ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.954  6.690   32.073  1.00 53.44  ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.748  5.634   31.229  1.00 56.82  ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.831  4.723   30.686  1.00 63.93  ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.199  5.037   31.312  1.00 71.95  ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.519  6.264   31.440  1.00 72.91  ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.934  4.063   31.660  1.00 73.64  ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.780  4.449   32.331  1.00 54.07  ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.749  4.573   33.382  1.00 53.18  ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 43.149  5.549   34.497  1.00 53.24  ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 44.311  5.603   34.887  1.00 54.04  ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.619  3.145   33.936  1.00 54.26  ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 43.151  2.245   32.862  1.00 54.95  ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 44.172  3.040   32.080  1.00 54.99  ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 42.188  6.324   34.991  1.00 52.68  ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.456  7.334   36.016  1.00 52.57  ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.886  6.712   37.341  1.00 54.11  ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 42.193  5.851   37.879  1.00 54.59  ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 41.235  8.221   36.229  1.00 51.09  ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.320  9.131   37.439  1.00 50.53  ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.369  10.181  37.271  1.00 50.40  ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.272  11.251  38.333  1.00 49.79  ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 43.553  11.969  38.381  1.00 49.75  ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 44.031  7.151   37.860  1.00 54.96  ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.537  6.626   39.125  1.00 56.20  ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.656  7.149   40.260  1.00 55.62  ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 43.229  8.309   40.210  1.00 55.09  ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 46.010  7.005   39.330  1.00 57.23  ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 46.999  6.176   38.494  1.00 59.58  ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 48.432  6.307   39.016  1.00 64.97  ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.786  7.721   39.156  1.00 68.39  ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.504  8.422   38.271  1.00 69.53  ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 50.001  7.828   37.170  1.00 69.13  ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 49.738  9.719   38.504  1.00 67.97  ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.367  6.301   41.274  1.00 55.98  ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.471  6.740   42.363  1.00 55.78  ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 42.941  8.022   43.055  1.00 56.25  ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 44.145  8.269   43.157  1.00 57.12  ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.490  5.553   43.339  1.00 56.15  ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.798  4.390   42.492  1.00 56.26  ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.740  4.878   41.416  1.00 56.47  ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 41.993  8.837   43.506  1.00 55.92  ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.310  10.071  44.223  1.00 56.58  ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 41.958  9.918   45.702  1.00 58.03  ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.333  8.924   46.119  1.00 58.62  ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.545  11.248  43.604  1.00 55.33  ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 40.061  11.009  43.601  1.00 54.98  ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 39.177  11.316  44.600  1.00 55.92  ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.289  10.403  42.563  1.00 53.19  ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 37.904  10.941  44.241  1.00 54.25  ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 37.948  10.372  43.000  1.00 52.35  ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.598  9.883   41.310  1.00 51.92  ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.930  9.839   42.236  1.00 51.26  ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.578  9.345   40.553  1.00 51.27  ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 37.259  9.326   41.019  1.00 50.24  ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.362  10.888  46.510  1.00 59.07  ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 41.942  10.872  47.895  1.00 60.45  ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 41.070  12.083  48.206  1.00 60.20  ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 41.029  13.073  47.448  1.00 59.19  ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.140  10.823  48.821  1.00 62.23  ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 43.735  12.096  48.822  1.00 64.02  ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.369  11.989  49.332  1.00 60.88  ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.342  12.950  49.667  1.00 60.31  ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 38.124  12.813  48.771  1.00 58.56  ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.976  11.846  48.000  1.00 57.58  ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 37.246  13.798  48.886  1.00 58.20  ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 36.003  13.822  48.150  1.00 56.62  ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.236  14.735  46.965  1.00 55.51  ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.447  15.944  47.150  1.00 55.97  ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.862  14.357  49.054  1.00 57.50  ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.518  14.339  48.342  1.00 55.75  ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.794  13.542  50.352  1.00 58.24  ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 36.236  14.148  45.764  1.00 54.04  ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.361  14.902  44.520  1.00 53.16  ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 35.101  15.685  44.263  1.00 53.41  ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 34.012  15.112  44.235  1.00 53.42  ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.637  14.001  43.319  1.00 51.85  ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 36.954  14.695  41.978  1.00 50.07  ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 38.068  13.999  41.264  1.00 50.96  ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.772  14.745  41.072  1.00 47.75  ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 35.259  16.995  44.071  1.00 53.89  ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 34.161  17.854  43.687  1.00 53.91  ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.706  17.598  42.245  1.00 52.47  ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.473  17.742  41.284  1.00 52.15  ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.577  19.314  43.847  1.00 55.44  ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 33.472  20.263  43.458  1.00 57.20  ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 33.303  20.507  42.232  1.00 57.42  ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.758  20.725  44.388  1.00 59.91  ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.445  17.246  42.086  1.00 51.99  ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.936  16.865  40.779  1.00 50.41  ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.689  17.684  40.474  1.00 50.58  ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.672  17.150  39.985  1.00 49.85  ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.639  15.376  40.754  1.00 49.92  ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.789  18.987  40.755  1.00 50.91  ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.657  19.896  40.649  1.00 51.19  ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.659  20.787  39.416  1.00 50.72  ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.719  21.556  39.221  1.00 51.40  ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.537  20.825  41.895  1.00 52.99  ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.569  21.825  41.872  1.00 52.77  ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.621  20.021  43.188  1.00 53.82  ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.710  20.734  38.602  1.00 50.04  ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.797  21.614  37.422  1.00 49.17  ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.463  20.887  36.262  1.00 48.23  ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 32.222  19.922  36.461  1.00 47.46  ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.569  22.957  37.674  1.00 50.02  ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.942  22.694  37.944  1.00 50.09  ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 31.012  23.744  38.842  1.00 52.10  ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 31.154  21.360  35.053  1.00 47.38  ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.729  20.817  33.843  1.00 46.15  ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 33.214  21.084  33.809  1.00 47.10  ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.657  22.212  34.010  1.00 48.97  ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 31.045  21.379  32.601  1.00 44.23  ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.722  20.730  32.306  1.00 44.14  ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.630  19.321  32.149  1.00 41.83  ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.551  21.505  32.219  1.00 41.73  ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 28.396  18.708  31.879  1.00 42.10  ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.320  20.915  31.958  1.00 40.97  ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 27.230  19.516  31.792  1.00 42.36  ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.977  20.029  33.567  1.00 47.26  ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.411  20.122  33.457  1.00 47.92  ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.822  20.579  32.038  1.00 47.24  ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.953  20.914  31.210  1.00 46.39  ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 36.007  18.783  33.858  1.00 48.18  ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 37.480  18.794  33.991  1.00 52.15  ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.993  19.680  35.076  1.00 54.91  ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 37.903  19.359  36.255  1.00 55.49  ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 38.579  20.795  34.678  1.00 57.84  ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 37.135  20.643  31.775  1.00 47.27  ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.664  21.255  30.549  1.00 46.41  ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 37.184  20.601  29.272  1.00 44.94  ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.826  19.414  29.249  1.00 44.57  ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 39.174  21.179  30.529  1.00 47.23  ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.832  22.015  31.597  1.00 49.31  ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.369  23.091  31.970  1.00 48.46  ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.968  21.525  32.074  1.00 52.20  ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 37.222  21.375  28.193  1.00 44.51  ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.854  20.879  26.868  1.00 43.31  ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 38.134  20.501  26.142  1.00 44.00  ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 39.149  21.220  26.277  1.00 45.12  ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 36.129  21.965  26.080  1.00 42.93  ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 36.008  21.583  24.634  1.00 41.70  ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.767  22.241  26.677  1.00 41.83  ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 38.111  19.392  25.394  1.00 43.09  ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.309  18.952  24.660  1.00 43.97  ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.814  19.981  23.674  1.00 44.36  ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 39.045  20.762  23.143  1.00 44.55  ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 39.100  17.601  23.998  1.00 43.58  ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.907  16.351  25.250  1.00 45.40  ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 41.125  20.027  23.476  1.00 45.61  ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.691  21.091  22.661  1.00 46.16  ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 41.126  21.027  21.232  1.00 45.71  ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 41.052  19.921  20.645  1.00 45.39  ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 43.229  21.100  22.712  1.00 46.94  ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.725  22.526  22.833  1.00 48.24  ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 44.289  23.019  24.019  1.00 48.51  ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.563  23.399  21.773  1.00 48.80  ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.690  24.362  24.123  1.00 50.39  ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.948  24.702  21.864  1.00 51.12  ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.503  25.187  23.023  1.00 52.23  ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.868  26.517  23.004  1.00 56.49  ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.698  22.182  20.697  1.00 45.30  ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.987  22.208  19.410  1.00 44.90  ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.849  23.558  18.715  1.00 46.38  ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.994  24.615  19.327  1.00 46.56  ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.588  21.640  19.591  1.00 43.88  ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.729  22.411  20.586  1.00 43.80  ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.408  21.753  20.833  1.00 42.57  ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 35.379  22.148  20.267  1.00 45.67  ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.418  20.732  21.658  1.00 39.78  ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.543  23.490  17.420  1.00 47.39  ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.308  24.666  16.586  1.00 48.61  ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.945  25.282  16.904  1.00 48.51  ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.921  24.609  16.835  1.00 47.96  ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 39.433  24.322  15.088  1.00 48.52  ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 39.067  25.478  14.178  1.00 51.98  ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 39.882  26.628  14.113  1.00 54.84  ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 37.881  25.439  13.395  1.00 52.96  ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 39.534  27.718  13.306  1.00 57.81  ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 37.517  26.506  12.574  1.00 55.04  ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 38.352  27.659  12.532  1.00 59.49  ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 38.020  28.742  11.715  1.00 61.93  ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.953  26.562  17.272  1.00 49.68  ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.750  27.274  17.662  1.00 49.73  ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.182  27.913  16.406  1.00 50.71  ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.889  28.641  15.694  1.00 52.32  ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 37.053  28.351  18.743  1.00 50.61  ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.803  29.151  19.127  1.00 50.36  ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.640  27.707  19.977  1.00 50.06  ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.909  27.639  16.124  1.00 50.33  ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.263  28.198  14.939  1.00 50.83  ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 34.077  29.716  15.044  1.00 51.70  ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.444  30.213  15.960  1.00 51.17  ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 32.935  27.478  14.674  1.00 50.04  ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.186  28.011  13.451  1.00 50.72  ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 32.750  28.786  12.651  1.00 52.38  ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.010  27.624  13.282  1.00 52.29  ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.645  30.445  14.097  1.00 53.40  ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 34.423  31.906  14.045  1.00 56.00  ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.792  32.361  12.737  1.00 56.95  ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 34.086  33.457  12.266  1.00 58.66  ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.730  32.741  14.271  1.00 57.35  ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.804  32.210  13.475  1.00 56.55  ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 36.112  32.780  15.760  1.00 57.61  ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.924  31.525  12.162  1.00 56.70  ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.290  31.826  10.882  1.00 57.17  ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.316  32.980  11.033  1.00 58.50  ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.356  33.945  10.269  1.00 59.44  ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.578  30.596  10.331  1.00 56.10  ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 30.795  30.778  9.031   1.00 56.78  ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 31.640  31.438  7.923   1.00 56.94  ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.215  29.437  8.582   1.00 55.36  ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.455  32.884  12.041  1.00 58.57  ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.508  33.958  12.326  1.00 59.32  ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.627  34.433  13.787  1.00 60.16  ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.885  33.976  14.664  1.00 58.78  ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.070  33.541  11.956  1.00 58.66  ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.847  33.208  10.484  1.00 56.60  ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.858  34.211  9.507   1.00 56.46  ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.586  31.897  10.082  1.00 53.48  ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.641  33.915  8.161   1.00 56.58  ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.367  31.581  8.748   1.00 53.79  ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.403  32.592  7.787   1.00 57.66  ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.183  32.274  6.457   1.00 59.15  ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.597  35.341  14.048  1.00 62.05  ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.788  36.019  15.343  1.00 63.14  ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 29.469  36.460  15.988  1.00 63.29  ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 28.668  37.141  15.344  1.00 63.90  ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 31.634  37.238  14.962  1.00 64.96  ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 32.519  36.713  13.858  1.00 64.94  ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 31.699  35.656  13.114  1.00 62.91  ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 29.245  36.032  17.232  1.00 62.50  ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 28.033  36.387  17.976  1.00 62.72  ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.738  35.679  17.581  1.00 61.45  ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 25.674  35.975  18.142  1.00 61.48  ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.828  34.738  16.636  1.00 59.36  ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.650  34.103  16.067  1.00 57.98  ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 25.334  32.846  16.826  1.00 56.61  ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 26.083  31.880  16.758  1.00 55.82  ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.882  33.787  14.582  1.00 57.45  ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.744  33.060  13.907  1.00 55.80  ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.474  33.631  13.834  1.00 55.65  ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.959  31.810  13.325  1.00 54.69  ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.434  32.979  13.204  1.00 55.61  ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.922  31.126  12.680  1.00 54.03  ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.654  31.711  12.627  1.00 56.90  ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 24.208  32.840  17.526  1.00 56.83  ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.833  31.680  18.327  1.00 56.32  ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.912  30.367  17.531  1.00 53.84  ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.244  29.322  18.086  1.00 52.64  ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 22.447  31.883  18.966  1.00 57.95  ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.999  30.755  19.925  1.00 62.40  ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.253  31.261  21.180  1.00 70.12  ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.022  32.498  21.323  1.00 72.71  ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 20.911  30.398  22.034  1.00 72.70  ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.643  30.447  16.228  1.00 52.90  ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.545  29.271  15.367  1.00 50.95  ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.837  28.498  15.273  1.00 49.35  ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.826  27.276  15.216  1.00 48.11  ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.951  29.226  15.262  1.00 49.21  ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 27.286  28.628  15.287  1.00 47.72  ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.830  28.572  16.727  1.00 47.91  ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.347  27.547  17.162  1.00 46.59  ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 28.253  29.412  14.394  1.00 47.94  ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 28.114  30.804  14.681  1.00 48.14  ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.937  29.176  12.928  1.00 46.26  ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.675  29.663  17.476  1.00 49.24  ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 28.213  29.714  18.835  1.00 49.84  ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.659  28.652  19.760  1.00 48.64  ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 28.306  28.316  20.733  1.00 49.53  ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 28.030  31.081  19.481  1.00 51.03  ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 28.536  32.243  18.646  1.00 55.07  ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.990  32.608  18.889  1.00 59.29  ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 30.721  31.828  19.557  1.00 59.41  ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 30.392  33.698  18.398  1.00 62.13  ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 26.488  28.098  19.478  1.00 47.67  ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.936  27.079  20.389  1.00 46.33  ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.722  25.775  20.372  1.00 44.94  ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.479  24.900  21.180  1.00 45.30  ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.477  26.784  20.076  1.00 46.13  ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 24.273  26.213  18.692  1.00 46.09  ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.595  25.647  18.385  1.00 46.63  ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 22.541  24.128  19.309  1.00 44.47  ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.647  25.635  19.437  1.00 44.18  ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.358  24.379  19.249  1.00 42.54  ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.778  24.517  19.765  1.00 42.78  ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.487  23.510  19.903  1.00 40.54  ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.387  24.025  17.762  1.00 42.14  ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 27.049  23.831  17.172  1.00 42.13  ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.415  24.653  16.292  1.00 42.56  ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 26.154  22.735  17.422  1.00 41.98  ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 25.180  24.130  15.966  1.00 42.33  ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.997  22.959  16.659  1.00 41.77  ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 26.225  21.582  18.213  1.00 41.20  ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.925  22.070  16.658  1.00 40.88  ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 25.149  20.715  18.222  1.00 40.25  ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 24.024  20.958  17.445  1.00 39.41  ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 30.182  25.779  20.010  1.00 43.43  ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.536  26.107  20.431  1.00 44.70  ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.780  25.772  21.921  1.00 45.49  ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.822  25.691  22.694  1.00 46.05  ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.830  27.587  20.157  1.00 46.04  ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 32.218  27.862  18.694  1.00 46.37  ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.517  26.932  17.917  1.00 43.16  ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 32.199  29.153  18.314  1.00 43.21  ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 33.061  25.599  22.334  1.00 45.55  ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.346  25.253  23.736  1.00 45.44  ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.811  26.266  24.738  1.00 46.13  ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.912  27.476  24.492  1.00 47.15  ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.877  25.212  23.785  1.00 45.22  ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 35.274  24.854  22.408  1.00 45.19  ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 34.286  25.562  21.511  1.00 45.73  ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.263  25.751  25.851  1.00 45.61  ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.701  26.537  26.959  1.00 45.77  ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.502  26.377  28.265  1.00 46.18  ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 32.087  26.795  29.338  1.00 46.81  ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.236  26.151  27.183  1.00 45.30  ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 30.065  24.674  27.524  1.00 44.64  ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.976  23.889  27.312  1.00 45.93  ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.900  24.294  28.048  1.00 42.86  ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.657  25.745  28.164  1.00 46.41  ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.590  25.609  29.294  1.00 47.13  ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.978  25.837  28.746  1.00 46.92  ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 36.153  25.865  27.540  1.00 46.76  ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.498  24.212  29.936  1.00 46.34  ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 33.298  24.028  30.831  1.00 46.99  ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 33.365  24.854  32.121  1.00 51.45  ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 32.158  24.618  32.890  1.00 55.90  ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.984  25.245  32.687  1.00 60.38  ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.865  26.223  31.767  1.00 59.81  ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.919  24.913  33.435  1.00 60.39  ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.959  25.996  29.615  1.00 47.29  ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.323  26.149  29.173  1.00 47.96  ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.824  25.019  28.240  1.00 47.30  ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.505  23.807  28.423  1.00 46.57  ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 39.196  26.217  30.398  1.00 49.27  ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.604  26.631  30.107  1.00 52.77  ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.470  26.551  31.329  1.00 56.26  ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.896  26.368  32.434  1.00 56.90  ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.706  26.650  31.178  1.00 57.09  ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.587  25.423  27.225  1.00 46.99  ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 40.268  24.471  26.339  1.00 45.79  ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.549  24.002  26.979  1.00 46.31  ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.401  24.822  27.304  1.00 48.24  ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.628  25.131  25.013  1.00 45.37  ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.526  25.507  24.032  1.00 44.66  ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 40.213  25.938  22.769  1.00 44.70  ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.576  24.317  23.752  1.00 42.45  ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.699  22.701  27.149  1.00 45.05  ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.905  22.143  27.721  1.00 45.85  ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 43.090  20.721  27.241  1.00 45.90  ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 42.117  20.032  26.901  1.00 45.45  ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.801  22.137  29.242  1.00 46.73  ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.677  21.197  29.837  1.00 46.01  ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 44.333  20.258  27.234  1.00 46.69  ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.594  18.887  26.823  1.00 46.26  ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 44.125  17.928  27.906  1.00 46.06  ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.907  16.754  27.633  1.00 45.34  ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 46.073  18.683  26.530  1.00 47.40  ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.521  19.187  25.189  1.00 47.78  ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.835  18.577  24.782  1.00 49.24  ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.833  17.451  24.237  1.00 49.05  ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.873  19.224  25.021  1.00 50.98  ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.999  18.466  29.128  1.00 46.52  ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.476  17.783  30.311  1.00 46.17  ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.963  17.899  30.238  1.00 45.04  ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.377  18.828  30.789  1.00 45.68  ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 44.024  18.468  31.583  1.00 47.00  ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.611  17.763  32.886  1.00 48.51  ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.738  16.869  32.876  1.00 47.28  ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 44.168  18.116  33.950  1.00 50.45  ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.325  16.976  29.534  1.00 43.90  ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.884  17.078  29.307  1.00 43.17  ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 39.164  15.730  29.415  1.00 42.66  ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.955  15.646  29.193  1.00 42.84  ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.601  17.695  27.934  1.00 42.69  ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.396  16.794  26.575  1.00 43.43  ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.881  14.675  29.755  1.00 42.34  ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 39.245  13.378  29.780  1.00 41.69  ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 38.369  13.204  31.036  1.00 41.96  ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.733  12.534  32.012  1.00 43.14  ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 40.284  12.273  29.593  1.00 42.12  ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.894  12.258  28.188  1.00 41.88  ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.833  11.074  27.950  1.00 41.61  ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.803  12.287  27.131  1.00 40.37  ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 37.197  13.824  30.991  1.00 41.09  ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 36.227  13.764  32.079  1.00 40.72  ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.876  13.337  31.549  1.00 39.88  ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.587  13.495  30.368  1.00 39.62  ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 36.116  15.148  32.727  1.00 41.09  ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.439  15.635  33.281  1.00 41.81  ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.783  15.426  34.629  1.00 42.59  ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 38.362  16.253  32.464  1.00 40.22  ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 39.004  15.850  35.133  1.00 42.18  ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.580  16.684  32.967  1.00 41.69  ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.890  16.476  34.295  1.00 42.13  ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 41.103  16.900  34.771  1.00 44.62  ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 34.031  12.809  32.419  1.00 39.77  ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.671  12.466  32.011  1.00 38.47  ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.626  13.006  32.979  1.00 38.25  ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.957  13.468  34.063  1.00 38.18  ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.524  10.935  31.808  1.00 37.99  ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.746  9.980   32.960  1.00 37.71  ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.618  10.099  33.937  1.00 35.19  ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.873  8.514   32.451  1.00 37.51  ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.362  12.901  32.582  1.00 37.96  ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 29.245  13.408  33.355  1.00 38.42  ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 28.143  12.356  33.505  1.00 39.71  ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.909  11.563  32.585  1.00 39.81  ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.710  14.663  32.668  1.00 37.51  ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.825  15.565  32.185  1.00 35.43  ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.597  16.075  32.978  1.00 35.89  ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.951  15.715  30.883  1.00 33.32  ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.478  12.350  34.664  1.00 41.07  ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.380  11.433  34.950  1.00 41.91  ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 25.195  12.213  35.498  1.00 43.49  ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.325  12.843  36.545  1.00 44.96  ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.766  10.402  36.026  1.00 42.32  ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.593  9.498   36.310  1.00 41.89  ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.941  9.557   35.581  1.00 42.47  ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 24.052  12.182  34.805  1.00 43.85  ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.792  12.634  35.381  1.00 44.80  ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 22.006  11.435  35.874  1.00 46.58  ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 22.015  10.377  35.224  1.00 46.83  ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.962  13.367  34.356  1.00 44.03  ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.481  14.711  34.011  1.00 43.05  ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 22.102  15.901  34.558  1.00 41.91  ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.479  15.015  33.031  1.00 41.16  ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.809  16.939  33.985  1.00 42.67  ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.651  16.420  33.033  1.00 41.13  ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 24.231  14.240  32.134  1.00 39.98  ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.551  17.065  32.178  1.00 39.38  ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 25.113  14.877  31.287  1.00 38.20  ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 25.274  16.279  31.321  1.00 38.94  ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 21.342  11.584  37.022  1.00 48.24  ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.448  10.549  37.546  1.00 50.35  ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 19.271  11.188  38.264  1.00 51.73  ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 19.360  12.335  38.695  1.00 51.95  ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 21.129  9.605   38.569  1.00 50.95  ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 21.443  10.346  39.749  1.00 53.20  ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.388  9.008   38.034  1.00 50.07  ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 18.171  10.435  38.427  1.00 53.23  ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 17.041  10.905  39.207  1.00 55.07  ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.421  11.282  40.626  1.00 56.55  ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.398  10.758  41.177  1.00 56.60  ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 16.117  9.694   39.233  1.00 55.81  ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 16.368  9.049   37.940  1.00 55.06  ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.857  9.168   37.749  1.00 53.49  ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.647  12.201  41.198  1.00 58.09  ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.792  12.576  42.589  1.00 59.54  ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.467  12.313  43.303  1.00 61.86  ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.465  12.953  43.013  1.00 62.65  ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 17.210  14.039  42.673  1.00 59.11  ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.484  14.546  44.064  1.00 59.40  ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.778  14.782  44.488  1.00 57.70  ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.441  14.827  44.946  1.00 61.06  ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 19.033  15.264  45.760  1.00 58.84  ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.692  15.315  46.213  1.00 61.51  ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 17.986  15.523  46.606  1.00 60.30  ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.232  15.999  47.855  1.00 62.30  ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.448  11.357  44.234  1.00 63.77  ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.578  10.541  44.677  1.00 64.11  ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 16.906  9.438   43.681  1.00 63.68  ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.029  9.029   42.917  1.00 63.80  ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.075  9.943   45.992  1.00 65.67  ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.587  9.857   45.821  1.00 66.50  ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.198  11.008  44.944  1.00 65.88  ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.160  8.984   43.688  1.00 63.67  ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.592  7.841   42.869  1.00 63.89  ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.647  6.667   43.049  1.00 65.38  ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.241  6.367   44.168  1.00 66.71  ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 20.025  7.410   43.199  1.00 63.60  ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 21.109  8.454   42.886  1.00 64.09  ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.499  7.853   42.989  1.00 66.90  ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.736  7.119   44.237  1.00 69.45  ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.205  7.688   45.342  1.00 71.67  ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.477  8.992   45.342  1.00 72.06  ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.393  6.972   46.443  1.00 72.25  ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.294  6.001   41.938  1.00 65.76  ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.270  4.936   41.923  1.00 67.34  ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 16.678  3.694   42.721  1.00 68.48  ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 17.850  3.291   42.700  1.00 67.57  ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.146  4.586   40.429  1.00 66.96  ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.487  5.004   39.816  1.00 64.72  ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.924  6.201   40.610  1.00 64.34  ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 15.705  3.101   43.405  1.00 70.33  ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 15.921  1.891   44.209  1.00 72.17  ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.446  0.701   43.391  1.00 71.98  ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.372  0.002   43.815  1.00 71.62  ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 14.621  1.498   44.957  1.00 74.40  ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.847  0.487   42.221  1.00 71.78  ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 16.236  -0.617  41.356  1.00 71.98  ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.939  -0.118  40.075  1.00 69.69  ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.644  0.986   39.614  1.00 68.66  ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 15.020  -1.510  41.056  1.00 73.73  ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 14.120  -0.867  40.186  1.00 73.93  ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.876  -0.929  39.512  1.00 69.17  ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.751  -0.527  38.400  1.00 66.84  ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 18.005  0.133   37.257  1.00 65.57  ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.877  -0.221  36.965  1.00 66.48  ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.339  -1.855  37.911  1.00 67.73  ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 19.310  -2.745  39.092  1.00 69.59  ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 18.068  -2.358  39.849  1.00 70.66  ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.655  1.081   36.602  1.00 63.64  ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 18.021  1.843   35.549  1.00 62.45  ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.835  1.749   34.272  1.00 60.75  ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 20.057  1.697   34.329  1.00 59.94  ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.863  3.306   35.964  1.00 61.53  ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 17.234  3.338   37.250  1.00 63.49  ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.994  4.052   34.967  1.00 60.74  ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 18.147  1.663   33.119  1.00 60.17  ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.782  1.810   31.825  1.00 58.35  ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.631  3.077   31.714  1.00 55.76  ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 19.258  4.136   32.223  1.00 55.22  ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.582  1.835   30.881  1.00 58.90  ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.700  0.770   31.475  1.00 61.07  ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.819  1.024   32.982  1.00 61.90  ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.769  2.922   31.043  1.00 53.89  ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.831  3.913   30.975  1.00 51.13  ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.965  4.334   29.523  1.00 49.86  ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 22.192  3.512   28.659  1.00 49.98  ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 23.174  3.280   31.454  1.00 51.01  ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 24.341  4.201   31.225  1.00 49.26  ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 23.092  2.861   32.904  1.00 51.43  ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.802  5.618   29.239  1.00 48.99  ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 22.068  6.108   27.907  1.00 47.37  ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.454  6.697   27.971  1.00 46.02  ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.760  7.412   28.911  1.00 46.94  ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 21.058  7.184   27.503  1.00 47.07  ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.549  6.922   27.433  1.00 49.28  ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.905  7.805   26.391  1.00 48.45  ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.230  5.496   27.090  1.00 52.35  ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 24.303  6.402   26.999  1.00 44.84  ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.585  7.097   26.922  1.00 43.85  ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.668  7.942   25.649  1.00 43.05  ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.539  7.414   24.534  1.00 44.28  ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.775  6.136   26.981  1.00 44.13  ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.765  5.375   28.308  1.00 44.72  ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 28.071  6.918   26.812  1.00 42.26  ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.689  4.202   28.360  1.00 46.37  ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.876  9.240   25.811  1.00 41.13  ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.906  10.124  24.684  1.00 40.04  ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 27.325  10.386  24.197  1.00 39.41  ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 28.197  10.701  24.988  1.00 39.30  ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.280  11.436  25.073  1.00 40.15  ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.423  12.541  24.048  1.00 40.53  ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 26.210  13.659  24.141  1.00 40.12  ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.720  12.644  22.814  1.00 41.54  ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 26.042  14.456  23.033  1.00 41.04  ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 25.125  13.861  22.201  1.00 41.63  ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.771  11.833  22.167  1.00 41.19  ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.627  14.278  20.963  1.00 39.69  ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 23.272  12.243  20.947  1.00 41.42  ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.697  13.462  20.355  1.00 41.81  ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.542  10.293  22.882  1.00 38.54  ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.824  10.654  22.285  1.00 35.98  ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.656  11.843  21.354  1.00 35.51  ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 28.008  11.745  20.332  1.00 35.37  ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 29.390  9.499   21.510  1.00 35.40  ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.264  8.205   22.339  1.00 34.20  ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.816  9.817   21.085  1.00 33.09  ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 30.077  7.034   21.785  1.00 28.71  ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 29.251  12.972  21.672  1.00 34.95  ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.957  14.146  20.837  1.00 35.45  ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.553  14.051  19.443  1.00 36.47  ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.443  13.219  19.199  1.00 37.04  ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 29.449  15.423  21.472  1.00 34.42  ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.911  15.432  21.874  1.00 33.08  ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.946  15.541  20.922  1.00 29.56  ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 31.259  15.359  23.230  1.00 31.72  ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 33.304  15.586  21.323  1.00 27.76  ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.578  15.405  23.623  1.00 31.53  ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.588  15.534  22.682  1.00 29.92  ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.866  15.552  23.175  1.00 32.14  ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 29.064  14.904  18.538  1.00 36.64  ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.654  15.036  17.212  1.00 37.50  ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.518  16.295  17.115  1.00 38.07  ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.858  16.910  18.135  1.00 38.87  ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.872  16.696  15.899  1.00 37.97  ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.822  17.796  15.726  1.00 39.01  ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.983  17.427  14.819  1.00 39.65  ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 34.119  17.875  15.043  1.00 39.40  ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.689  16.612  13.798  1.00 39.69  ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.647  16.315  12.730  1.00 40.93  ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.928  15.659  13.229  1.00 42.05  ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.980  15.793  12.598  1.00 43.26  ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.832  14.960  14.368  1.00 41.58  ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.990  14.433  15.081  1.00 41.05  ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 37.072  15.461  15.399  1.00 40.99  ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 38.206  15.087  15.717  1.00 42.05  ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.615  13.301  14.302  1.00 41.06  ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.812  12.068  14.295  1.00 39.96  ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.742  11.273  15.415  1.00 39.70  ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 35.158  11.679  13.146  1.00 39.14  ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 35.000  10.088  15.396  1.00 40.89  ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.426  10.541  13.100  1.00 37.75  ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 34.344  9.724   14.228  1.00 41.51  ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.725  16.736  15.308  1.00 40.26  ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.681  17.826  15.516  1.00 40.34  ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 37.195  18.803  16.588  1.00 40.53  ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.995  19.519  17.151  1.00 41.63  ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.986  18.557  14.195  1.00 40.09  ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 37.042  19.683  13.837  1.00 38.28  ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 37.293  20.985  14.277  1.00 40.68  ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.928  19.471  13.046  1.00 36.76  ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 36.454  22.051  13.964  1.00 38.98  ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 35.061  20.529  12.725  1.00 37.73  ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 35.336  21.822  13.186  1.00 39.90  ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 34.509  22.901  12.892  1.00 39.54  ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.891  18.843  16.857  1.00 39.82  ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 35.350  19.683  17.926  1.00 40.18  ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 34.308  18.907  18.707  1.00 39.85  ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 34.070  17.725  18.438  1.00 39.16  ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.773  21.019  17.396  1.00 40.53  ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.892  20.849  16.290  1.00 39.89  ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.690  19.554  19.688  1.00 39.90  ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.679  18.841  20.481  1.00 39.48  ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 33.029  18.717  21.950  1.00 39.60  ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 34.211  18.752  22.349  1.00 40.19  ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.995  18.574  22.762  1.00 38.49  ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 32.136  18.733  24.194  1.00 38.85  ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.852  18.231  24.775  1.00 38.99  ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.766  18.614  24.310  1.00 39.22  ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.314  20.190  24.551  1.00 39.30  ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.965  17.359  25.768  1.00 38.74  ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.795  16.820  26.434  1.00 38.67  ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 29.110  17.883  27.314  1.00 38.60  ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 28.062  17.613  27.865  1.00 39.15  ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 30.168  15.588  27.266  1.00 37.94  ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.697  19.062  27.456  1.00 38.62  ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 29.133  20.087  28.361  1.00 40.55  ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 28.178  21.074  27.720  1.00 41.07  ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.739  22.015  28.375  1.00 43.52  ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.246  20.906  29.043  1.00 40.81  ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 31.062  21.556  28.094  1.00 39.63  ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.897  20.910  26.437  1.00 41.02  ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 27.098  21.877  25.683  1.00 41.00  ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.647  21.817  26.111  1.00 41.66  ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 25.115  20.733  26.422  1.00 42.39  ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 27.207  21.576  24.182  1.00 40.65  ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.564  21.550  23.466  1.00 39.28  ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.300  21.320  21.999  1.00 41.53  ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.277  22.867  23.637  1.00 39.43  ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.996  22.970  26.101  1.00 42.77  ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.583  23.087  26.492  1.00 43.94  ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.678  22.014  25.874  1.00 43.77  ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.893  21.400  26.585  1.00 45.01  ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 23.057  24.486  26.207  1.00 44.21  ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.536  25.513  27.236  1.00 47.45  ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 24.337  25.157  28.128  1.00 47.60  ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.098  26.694  27.172  1.00 51.68  ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.832  21.738  24.581  1.00 42.70  ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.974  20.786  23.911  1.00 42.11  ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 22.237  19.347  24.303  1.00 42.34  ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.473  18.460  23.903  1.00 42.69  ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 22.010  20.922  22.368  1.00 41.76  ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.515  22.297  21.954  1.00 41.77  ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.386  20.649  21.826  1.00 40.49  ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 23.286  19.076  25.081  1.00 42.22  ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.452  17.672  25.551  1.00 42.28  ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 23.067  17.485  27.044  1.00 42.94  ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.450  16.501  27.685  1.00 43.35  ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.854  17.089  25.247  1.00 41.48  ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.426  17.351  23.858  1.00 41.66  ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.634  17.251  22.707  1.00 41.17  ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.773  17.703  23.694  1.00 41.46  ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 25.172  17.501  21.447  1.00 40.32  ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 27.317  17.978  22.418  1.00 38.72  ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.512  17.871  21.311  1.00 38.89  ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 27.033  18.095  20.053  1.00 37.87  ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.294  18.428  27.573  1.00 43.46  ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.993  18.504  28.996  1.00 44.28  ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 21.099  17.353  29.390  1.00 44.63  ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.943  17.296  28.981  1.00 45.44  ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 21.327  19.854  29.330  1.00 44.54  ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.990  19.980  30.801  1.00 46.54  ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.900  18.936  31.493  1.00 48.25  ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.798  21.110  31.276  1.00 46.34  ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.635  16.424  30.177  1.00 45.10  ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.910  15.179  30.523  1.00 44.59  ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.863  15.298  31.620  1.00 45.07  ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 19.213  14.327  31.963  1.00 45.34  ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.664  16.502  32.143  1.00 45.69  ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.781  16.693  33.292  1.00 46.60  ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 17.338  16.284  32.987  1.00 47.17  ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.665  15.731  33.860  1.00 48.31  ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.872  18.125  33.842  1.00 46.90  ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.933  19.160  33.191  1.00 49.07  ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 18.144  20.563  33.760  1.00 52.96  ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.577  20.879  33.783  1.00 57.07  ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 20.167  21.807  34.546  1.00 58.59  ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 21.483  21.960  34.464  1.00 57.78  ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 19.469  22.572  35.392  1.00 59.64  ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.882  16.527  31.749  1.00 46.62  ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 15.489  16.275  31.344  1.00 46.81  ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 15.210  14.786  31.175  1.00 47.33  ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 14.241  14.257  31.713  1.00 48.58  ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 15.147  17.012  30.065  1.00 45.77  ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.526  18.456  30.084  1.00 46.14  ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.687  19.398  30.648  1.00 45.44  ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.728  18.885  29.525  1.00 45.35  ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 15.030  20.744  30.671  1.00 45.74  ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 17.077  20.248  29.551  1.00 45.71  ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 16.217  21.172  30.124  1.00 45.18  ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 16.060  14.103  30.429  1.00 46.54  ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.916  12.675  30.285  1.00 47.23  ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.923  12.001  31.660  1.00 48.35  ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 15.133  11.086  31.918  1.00 49.01  ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 17.039  12.138  29.407  1.00 46.32  ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.846  12.337  27.908  1.00 45.71  ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 18.165  12.303  27.188  1.00 43.17  ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.912  11.259  27.366  1.00 47.40  ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.803  12.483  32.542  1.00 48.21  ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.919  11.961  33.898  1.00 48.79  ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.639  12.202  34.681  1.00 50.50  ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 15.020  11.255  35.144  1.00 51.85  ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 18.096  12.579  34.606  1.00 47.71  ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 15.223  13.458  34.811  1.00 50.97  ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 14.025  13.770  35.585  1.00 52.59  ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.765  13.115  35.017  1.00 53.88  ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 12.002  12.492  35.769  1.00 55.30  ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.812  15.276  35.703  1.00 52.42  ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.999  15.691  36.921  1.00 54.10  ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.487  15.453  36.815  1.00 56.05  ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.881  15.615  35.747  1.00 56.74  ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.867  15.119  37.945  1.00 55.56  ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.558  13.249  33.704  1.00 53.20  ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 11.293  12.856  33.095  1.00 54.32  ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 11.198  11.369  32.829  1.00 54.96  ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 10.155  10.781  33.069  1.00 56.53  ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.953  13.670  31.804  1.00 54.06  ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.662   13.167  31.159  1.00 54.09  ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.832  15.169  32.111  1.00 53.01  ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 12.266  10.756  32.332  1.00 54.36  ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 12.207  9.325   31.977  1.00 54.97  ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.838  8.397   33.014  1.00 55.37  ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.822  7.171   32.863  1.00 56.07  ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.825  9.090   30.604  1.00 53.57  ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 12.013  9.674   29.462  1.00 55.11  ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.642  9.025   29.288  1.00 58.98  ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 10.459  7.836   29.644  1.00 61.48  ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.736   9.712   28.778  1.00 61.23  ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.394  8.987   34.066  1.00 55.25  ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 14.035  8.226   35.120  1.00 55.94  ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.292  7.529   34.648  1.00 55.05  ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.636  6.462   35.152  1.00 56.29  ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.986  8.140   33.696  1.00 53.39  ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 17.157  7.523   33.088  1.00 52.45  ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.472  8.000   33.711  1.00 51.49  ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.584  9.165   34.141  1.00 50.82  ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 17.158  7.784   31.583  1.00 51.53  ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 19.450  7.089   33.763  1.00 50.76  ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.846  7.451   34.022  1.00 49.69  ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.506  7.795   32.677  1.00 48.45  ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.606  6.956   31.773  1.00 48.01  ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.656  6.316   34.723  1.00 50.35  ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 23.088  6.785   35.043  1.00 48.36  ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.960  5.841   35.979  1.00 51.26  ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.947  9.035   32.541  1.00 47.20  ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.531  9.455   31.289  1.00 46.38  ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.972  9.827   31.551  1.00 45.57  ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.275  10.445  32.559  1.00 45.83  ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.738  10.621  30.695  1.00 46.59  ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 22.076  11.013  29.256  1.00 46.18  ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 20.809  11.303  28.540  1.00 46.08  ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 23.017  12.213  29.214  1.00 44.26  ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.862  9.401   30.661  1.00 45.19  ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 26.292  9.649   30.806  1.00 44.52  ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.794  10.225  29.515  1.00 43.83  ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.470  9.681   28.453  1.00 44.64  ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 27.067  8.355   31.072  1.00 45.15  ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.570  8.624   31.139  1.00 43.63  ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.573  7.689   32.353  1.00 45.85  ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.542  11.330  29.601  1.00 42.64  ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.337  11.839  28.479  1.00 41.22  ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.775  12.064  28.912  1.00 41.34  ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 30.042  12.399  30.066  1.00 42.22  ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.753  13.113  27.904  1.00 41.24  ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.585  14.115  28.887  1.00 40.86  ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.694  11.868  27.972  1.00 40.74  ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 32.160  11.895  28.175  1.00 40.29  ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.782  12.966  27.276  1.00 38.66  ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 32.241  13.262  26.220  1.00 38.73  ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.715  10.605  27.612  1.00 40.10  ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 32.419  10.689  26.152  1.00 41.00  ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 32.082  9.217   25.297  1.00 51.37  ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.287  8.093   26.438  1.00 47.32  ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.943  13.483  27.633  1.00 37.74  ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.752  14.197  26.661  1.00 37.44  ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.741  13.212  26.062  1.00 36.97  ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 36.303  12.411  26.782  1.00 37.81  ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.499  15.381  27.299  1.00 37.23  ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.590  16.512  27.631  1.00 39.32  ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.409  16.462  27.320  1.00 41.57  ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.122  17.562  28.259  1.00 41.77  ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.948  13.272  24.754  1.00 36.31  ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 37.020  12.546  24.136  1.00 36.95  ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.855  13.464  23.266  1.00 37.50  ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 37.347  14.441  22.720  1.00 37.57  ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.462  11.391  23.315  1.00 36.59  ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.558  11.823  22.174  1.00 35.35  ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 34.225  12.187  22.400  1.00 31.67  ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 36.033  11.844  20.858  1.00 34.18  ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 33.389  12.536  21.353  1.00 29.05  ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 35.203  12.232  19.802  1.00 32.31  ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.890  12.574  20.061  1.00 31.04  ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 33.084  12.946  19.003  1.00 32.26  ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 39.136  13.144  23.121  1.00 38.54  ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 40.054  13.994  22.375  1.00 38.77  ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.698  14.044  20.919  1.00 38.84  ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 39.530  13.023  20.272  1.00 39.14  ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.494  13.543  22.517  1.00 39.36  ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 42.128  13.855  23.834  1.00 39.41  ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.443  13.049  23.964  1.00 39.76  ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 43.250  11.623  24.171  1.00 33.97  ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 44.259  10.753  24.197  1.00 40.41  ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.496  11.197  24.002  1.00 40.69  ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 44.056  9.435   24.404  1.00 37.98  ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.598  15.260  20.408  1.00 39.25  ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.263  15.469  19.023  1.00 39.09  ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.499  15.958  18.272  1.00 40.11  ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.565  16.197  18.889  1.00 40.61  ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 38.105  16.445  18.936  1.00 38.90  ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.880  15.775  19.506  1.00 38.72  ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.426  17.763  19.715  1.00 38.85  ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.378  16.088  16.949  1.00 40.21  ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.470  16.625  16.127  1.00 40.97  ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.755  15.803  16.217  1.00 42.69  ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.726  14.561  16.455  1.00 42.70  ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.888  16.486  16.039  1.00 42.95  ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 45.166  15.804  16.049  1.00 43.96  ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 45.303  15.027  17.330  1.00 44.26  ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.737  13.877  17.318  1.00 45.62  ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.342  16.768  15.982  1.00 45.24  ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 46.107  17.855  16.880  1.00 44.39  ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.530  17.291  14.561  1.00 44.76  ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.915  15.649  18.437  1.00 43.29  ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 45.123  15.057  19.742  1.00 42.86  ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.439  13.720  19.859  1.00 42.46  ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.951  12.829  20.522  1.00 43.81  ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.624  15.994  20.818  1.00 42.08  ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 45.142  17.368  20.672  1.00 41.35  ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.395  17.702  21.155  1.00 42.95  ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.390  18.332  20.038  1.00 39.16  ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.903  19.006  20.996  1.00 44.37  ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.872  19.614  19.875  1.00 40.92  ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 46.132  19.961  20.356  1.00 43.03  ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 43.303  13.577  19.187  1.00 41.54  ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.522  12.366  19.262  1.00 41.05  ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.810  11.384  18.153  1.00 41.62  ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.650  10.165  18.344  1.00 41.53  ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 43.234  11.912  16.997  1.00 41.66  ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 43.218  11.143  15.753  1.00 41.76  ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.459  11.190  14.829  1.00 43.55  ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.534  10.438  13.844  1.00 44.25  ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.912  11.429  14.995  1.00 40.86  ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.680  11.026  15.772  1.00 39.26  ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.344  9.672   15.925  1.00 37.79  ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.902  11.981  16.399  1.00 35.99  ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 39.253  9.307   16.657  1.00 37.55  ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.809  11.607  17.148  1.00 35.67  ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.477  10.289  17.280  1.00 35.31  ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.439  12.039  15.146  1.00 43.83  ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.671  12.029  14.383  1.00 44.76  ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 47.297  10.650  14.525  1.00 45.95  ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.452  10.159  15.618  1.00 47.15  ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.613  13.133  14.845  1.00 44.81  ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.953  13.243  14.110  1.00 45.74  ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.454  14.682  14.007  1.00 43.35  ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.997  12.346  14.764  1.00 44.99  ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.630  10.012  13.416  1.00 47.14  ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 48.085  8.636   13.458  1.00 48.38  ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.307  8.451   12.591  1.00 50.34  ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.351  8.938   11.461  1.00 50.78  ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.979  7.703   12.996  1.00 47.72  ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.308  7.767   13.132  1.00 51.85  ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.387  7.253   12.324  1.00 53.71  ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 51.261  5.741   12.373  1.00 54.70  ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.951  5.072   13.133  1.00 55.59  ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.722  7.805   12.807  1.00 54.88  ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.761  9.221   12.206  1.00 55.61  ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 52.905  10.334  13.238  1.00 56.07  ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 53.780  9.349   11.075  1.00 57.19  ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 50.333  5.198   11.563  1.00 54.66  ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.874  3.823   11.720  1.00 55.77  ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 51.033  2.843   11.767  1.00 58.74  ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.958  2.950   10.980  1.00 60.33  ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 49.008  3.611   10.479  1.00 55.05  ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.554  4.979   10.123  1.00 52.94  ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.726  5.830   10.380  1.00 53.69  ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.993  1.917   12.711  1.00 60.13  ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 52.074  0.962   12.888  1.00 63.20  ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 53.045  1.387   13.978  1.00 64.45  ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.842  0.579   14.464  1.00 66.59  ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.988  2.655   14.362  1.00 63.57  ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.884  3.167   15.385  1.00 64.47  ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.356  2.847   16.779  1.00 64.87  ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 52.182  2.477   16.951  1.00 63.89  ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 54.094  4.678   15.225  1.00 63.24  ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 53.083  5.417   15.861  1.00 58.48  ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 54.231  2.998   17.768  1.00 66.57  ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.868  2.791   19.158  1.00 67.23  ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.429  4.121   19.786  1.00 65.08  ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.535  4.148   20.631  1.00 63.91  ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 55.060  2.176   19.907  1.00 70.19  ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 54.868  1.970   21.414  1.00 73.52  ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 56.166  1.451   22.036  1.00 81.45  ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.960  0.933   23.397  1.00 86.47  ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.247  -0.314  23.798  1.00 89.41  ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 56.770  -1.198  22.947  1.00 91.37  ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 56.028  -0.676  25.064  1.00 89.65  ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 54.037  5.219   19.337  1.00 64.68  ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.892  6.518   19.998  1.00 63.28  ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.670  7.293   19.561  1.00 60.76  ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 52.246  8.208   20.260  1.00 60.43  ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 55.136  7.393   19.796  1.00 64.94  ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.456  6.801   20.299  1.00 68.12  ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 57.223  6.012   19.225  1.00 72.01  ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.694  5.753   18.114  1.00 70.82  ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.383  5.641   19.509  1.00 76.14  ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 52.122  6.948   18.398  1.00 59.47  ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.915  7.574   17.870  1.00 56.67  ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 50.148  6.569   16.994  1.00 56.19  ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 50.167  6.659   15.768  1.00 56.61  ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 51.265  8.829   17.087  1.00 56.09  ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.458  5.607   17.624  1.00 55.55  ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.886  4.498   16.858  1.00 55.71  ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.575  4.837   16.168  1.00 54.45  ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 47.034  3.994   15.447  1.00 55.05  ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.634  3.435   17.931  1.00 56.14  ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.408  4.222   19.195  1.00 54.86  ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 49.208  5.478   19.076  1.00 55.04  ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 47.066  6.050   16.409  1.00 52.93  ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.761  6.485   15.918  1.00 51.01  ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.568  5.924   16.684  1.00 50.12  ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.698  4.981   17.480  1.00 50.95  ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 43.401  6.523   16.445  1.00 48.44  ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 42.139  6.089   17.034  1.00 46.89  ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 42.016  6.351   18.545  1.00 46.11  ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 41.082  5.874   19.181  1.00 46.19  ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.859  4.611   16.696  1.00 47.48  ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.452  4.410   15.238  1.00 47.93  ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.858  5.308   14.614  1.00 46.74  ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.776  3.244   14.684  1.00 45.02  ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.926  7.129   19.120  1.00 45.31  ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.921  7.316   20.573  1.00 44.19  ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.643  8.004   21.105  1.00 43.41  ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.265  7.823   22.280  1.00 43.69  ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 44.237  7.958   21.111  1.00 44.52  ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.452  7.234   20.537  1.00 44.75  ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.321  9.455   20.835  1.00 43.29  ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.967  8.776   20.252  1.00 42.23  ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.694  9.380   20.641  1.00 40.29  ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.638  8.302   20.837  1.00 39.43  ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.783  8.391   21.714  1.00 38.18  ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.679  7.284   19.996  1.00 40.12  ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.759  6.142   20.168  1.00 40.65  ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 38.095  5.442   21.450  1.00 40.99  ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 37.206  5.076   22.217  1.00 41.80  ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.814  5.160   18.992  1.00 41.04  ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 37.353  5.770   17.671  1.00 41.51  ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.656  4.793   16.571  1.00 42.04  ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.873  6.197   17.691  1.00 39.36  ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.389  5.298   21.697  1.00 41.44  ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.872  4.670   22.886  1.00 41.85  ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.432  5.412   24.173  1.00 42.14  ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 39.067  4.754   25.171  1.00 43.08  ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.371  4.494   22.769  1.00 42.36  ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.782  3.343   21.825  1.00 44.13  ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.260  3.119   21.909  1.00 45.66  ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 41.096  2.012   22.126  1.00 43.73  ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.426  6.759   24.146  1.00 40.69  ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.942  7.538   25.274  1.00 39.75  ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.482  7.181   25.525  1.00 39.45  ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 37.066  7.035   26.676  1.00 39.66  ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 39.039  9.054   25.023  1.00 39.99  ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.467  9.547   24.795  1.00 41.15  ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 41.435  8.781   25.043  1.00 41.11  ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.610  10.726  24.366  1.00 39.49  ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.696  7.076   24.453  1.00 39.27  ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 35.270  6.722   24.538  1.00 39.40  ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 35.123  5.297   25.065  1.00 41.18  ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 34.244  5.018   25.892  1.00 41.62  ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.616  6.805   23.168  1.00 38.84  ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.582  8.224   22.548  1.00 40.20  ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 34.020  8.191   21.130  1.00 42.94  ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.551  7.106   20.656  1.00 39.41  ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 34.060  9.361   20.428  1.00 36.73  ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.984  4.385   24.615  1.00 41.60  ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.873  3.033   25.123  1.00 43.45  ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 36.137  3.024   26.629  1.00 43.86  ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.660  2.122   27.352  1.00 45.25  ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.848  2.084   24.427  1.00 44.50  ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.692  0.688   24.859  1.00 45.57  ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.622  -0.228  24.096  1.00 50.74  ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 37.132  -0.481  22.742  1.00 51.83  ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.859  -1.000  21.754  1.00 52.82  ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 39.142  -1.323  21.940  1.00 52.40  ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 37.288  -1.183  20.568  1.00 52.45  ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 36.920  3.998   27.092  1.00 42.17  ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.351  3.969   28.465  1.00 42.33  ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 36.213  4.503   29.311  1.00 42.44  ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.925  3.953   30.370  1.00 43.76  ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.649  4.743   28.668  1.00 41.84  ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.268  4.716   30.073  1.00 41.90  ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.658  3.305   30.524  1.00 39.77  ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.460  5.673   30.159  1.00 38.83  ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.547  5.561   28.830  1.00 41.47  ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.347  6.040   29.473  1.00 40.08  ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 33.356  4.863   29.488  1.00 40.40  ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.724  4.589   30.504  1.00 40.63  ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.788  7.230   28.749  1.00 38.18  ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 33.234  4.155   28.375  1.00 40.77  ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 32.390  2.960   28.360  1.00 42.57  ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.798  1.934   29.425  1.00 44.21  ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.923  1.394   30.118  1.00 45.01  ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 32.298  2.331   26.956  1.00 42.84  ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.195  2.883   26.032  1.00 41.39  ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 31.232  4.402   25.872  1.00 38.87  ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 31.282  2.221   24.700  1.00 39.82  ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 34.101  1.707   29.602  1.00 44.97  ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.556  0.721   30.598  1.00 47.52  ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 34.209  1.156   32.026  1.00 47.14  ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.710  0.358   32.849  1.00 48.38  ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 36.061  0.423   30.463  1.00 48.55  ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 36.402  -0.806  29.595  1.00 52.21  ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.769  -0.694  28.877  1.00 55.45  ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.406  0.369   28.862  1.00 58.42  ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 38.202  -1.784  28.270  1.00 54.86  ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.476  2.426   32.289  1.00 45.38  ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 34.159  3.082   33.539  1.00 45.57  ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.682  2.932   33.910  1.00 45.37  ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 32.342  2.848   35.090  1.00 45.76  ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.504  4.587   33.444  1.00 44.30  ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 34.280  5.314   34.729  1.00 45.20  ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 35.199  5.537   35.715  1.00 45.87  ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 33.050  5.894   35.191  1.00 46.48  ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.627  6.222   36.757  1.00 47.26  ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.310  6.464   36.462  1.00 46.97  ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.758  5.992   34.654  1.00 46.88  ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.331  7.139   37.201  1.00 47.52  ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.780  6.669   35.390  1.00 48.06  ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 31.077  7.238   36.655  1.00 48.25  ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.811  2.925   32.906  1.00 44.79  ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 30.381  2.856   33.163  1.00 44.75  ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 30.067  1.452   33.633  1.00 46.54  ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.435  1.286   34.666  1.00 47.36  ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.519  3.324   31.948  1.00 44.14  ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 28.088  2.775   32.033  1.00 42.95  ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.532  4.870   31.843  1.00 41.56  ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.569  0.447   32.919  1.00 47.25  ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.455  -0.930  33.378  1.00 48.72  ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.858  -1.059  34.831  1.00 49.73  ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 30.199  -1.757  35.623  1.00 50.51  ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 31.292  -1.880  32.516  1.00 49.00  ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.697  -2.107  31.146  1.00 49.20  ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 29.329  -2.769  31.181  1.00 50.18  ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 28.327  -2.144  30.864  1.00 48.46  ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 29.289  -4.049  31.545  1.00 53.02  ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.946  -0.395  35.203  1.00 49.13  ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.452  -0.642  36.545  1.00 50.14  ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.708  0.132   37.604  1.00 49.10  ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 31.537  -0.352  38.711  1.00 50.60  ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.953  -0.386  36.661  1.00 50.58  ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.427  -0.450  38.116  1.00 54.00  ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.865  -0.864  38.267  1.00 57.96  ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 36.718  -0.382  37.461  1.00 58.52  ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.127  -1.656  39.205  1.00 57.22  ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 31.263  1.338   37.274  1.00 46.73  ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.808  2.223   38.307  1.00 45.46  ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.357  2.635   38.241  1.00 45.36  ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.781  2.994   39.263  1.00 46.31  ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.690  3.448   38.323  1.00 44.57  ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 33.121  3.104   38.518  1.00 44.06  ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.566  2.949   39.662  1.00 46.68  ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.874  2.975   37.410  1.00 40.02  ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.747  2.605   37.061  1.00 44.73  ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.372  3.112   36.933  1.00 44.41  ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.389  2.601   38.048  1.00 46.30  ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.589  3.382   38.558  1.00 45.95  ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.820  2.956   35.491  1.00 43.33  ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.875  4.116   35.185  1.00 42.47  ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 26.213  1.527   35.224  1.00 43.95  ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.556  5.533   35.261  1.00 40.48  ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.484  1.311   38.422  1.00 47.84  ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.741  0.742   39.562  1.00 49.46  ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.753  1.619   40.820  1.00 49.92  ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.749  1.714   41.510  1.00 51.12  ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 26.253  -0.632  39.891  1.00 50.57  ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.875  2.274   41.105  1.00 49.43  ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.962  3.166   42.249  1.00 49.49  ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.955  4.299   42.144  1.00 49.02  ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.653  4.960   43.132  1.00 50.40  ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.386  3.713   42.414  1.00 48.37  ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.421  4.521   40.956  1.00 48.34  ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.481  5.630   40.735  1.00 47.69  ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 23.104  5.052   40.425  1.00 48.63  ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 22.189  5.786   40.044  1.00 48.61  ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.905  6.488   39.550  1.00 45.24  ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 26.272  7.098   39.675  1.00 44.87  ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.404  6.362   39.359  1.00 44.57  ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 26.426  8.447   40.045  1.00 43.49  ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.685  6.946   39.445  1.00 44.78  ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.688  9.030   40.139  1.00 42.18  ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.819  8.287   39.832  1.00 42.97  ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.974  3.737   40.544  1.00 49.10  ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.707  3.081   40.243  1.00 50.67  ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.442  2.781   38.772  1.00 50.37  ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.327  2.434   38.401  1.00 51.11  ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.457  2.918   37.927  1.00 49.37  ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.362  2.481   36.539  1.00 48.88  ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.567  0.981   36.428  1.00 50.30  ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.285  0.386   37.243  1.00 50.81  ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.915  0.376   35.431  1.00 50.72  ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 22.025  -1.043  35.148  1.00 51.79  ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 23.126  -1.208  34.145  1.00 51.64  ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.944  -0.876  32.967  1.00 50.75  ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.744  -1.562  34.514  1.00 52.61  ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.701  -3.097  34.412  1.00 54.95  ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.755  -3.786  34.516  1.00 53.85  ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.580  -3.617  34.222  1.00 56.32  ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.279  -1.749  34.579  1.00 52.57  ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.340  -1.861  33.571  1.00 51.93  ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.982  -2.869  32.492  1.00 53.08  ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.590  -2.843  31.434  1.00 53.35  ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.572  -2.303  34.369  1.00 52.17  ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 26.065  -2.804  35.675  1.00 52.76  ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.673  -2.290  35.895  1.00 53.16  ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.986  -3.716  32.746  1.00 54.57  ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.546  -4.709  31.773  1.00 56.01  ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.543  -4.135  30.782  1.00 55.22  ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.946  -4.864  30.000  1.00 55.53  ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.977  -5.957  32.481  1.00 59.02  ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.997  -6.750  33.294  1.00 61.24  ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.380  -8.328  33.892  1.00 70.01  ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 23.568  -9.328  32.407  1.00 70.75  ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 22.380  -2.810  30.807  1.00 54.61  ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.480  -2.108  29.909  1.00 53.80  ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 22.023  -0.734  29.563  1.00 52.47  ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.518  0.335   29.999  1.00 52.11  ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 20.108  -1.996  30.524  1.00 54.75  ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 19.220  -1.416  29.590  1.00 56.66  ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 23.068  -0.769  28.749  1.00 52.09  ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.727  0.439   28.282  1.00 49.50  ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 23.419  0.588   26.806  1.00 49.03  ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.697  -0.303  25.999  1.00 49.81  ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 25.260  0.367   28.544  1.00 49.14  ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 26.031  1.380   27.711  1.00 47.18  ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.553  0.538   30.037  1.00 48.28  ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.828  1.729   26.478  1.00 48.11  ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.515  2.121   25.120  1.00 46.98  ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.431  3.285   24.742  1.00 45.65  ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.485  4.298   25.440  1.00 44.99  ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 21.031  2.511   25.008  1.00 47.12  ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 20.219  1.325   25.038  1.00 48.78  ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.747  3.278   23.738  1.00 45.87  ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 24.171  3.116   23.646  1.00 44.98  ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.984  4.178   23.110  1.00 43.54  ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 24.165  5.045   22.167  1.00 43.16  ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 23.396  4.521   21.353  1.00 43.57  ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 26.151  3.588   22.342  1.00 43.53  ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 27.073  2.609   23.054  1.00 43.01  ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 28.238  2.284   22.119  1.00 41.42  ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.581  3.140   24.380  1.00 41.35  ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 24.327  6.363   22.270  1.00 41.76  ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.764  7.254   21.272  1.00 41.09  ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.644  8.457   20.998  1.00 41.08  ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 25.432  8.912   21.851  1.00 40.91  ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 22.267  7.585   21.507  1.00 41.59  ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.968  8.629   22.583  1.00 40.65  ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.504  8.553   23.856  1.00 38.79  ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 21.053  9.660   22.320  1.00 41.32  ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 22.190  9.517   24.820  1.00 37.93  ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.730  10.620  23.302  1.00 39.45  ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.309  10.549  24.539  1.00 37.39  ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.535  8.954   19.775  1.00 40.46  ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 25.369  10.017  19.339  1.00 39.21  ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.874  10.499  18.007  1.00 39.33  ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 24.087  9.806   17.327  1.00 39.29  ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 25.339  11.687  17.632  1.00 37.87  ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.894  12.268  16.415  1.00 38.11  ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 26.122  12.640  15.567  1.00 38.19  ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 27.191  12.944  16.102  1.00 38.36  ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.960  13.451  16.746  1.00 38.11  ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.396  14.203  15.529  1.00 38.04  ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.345  15.282  15.049  1.00 37.53  ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.419  15.422  15.683  1.00 35.58  ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 24.023  15.973  14.048  1.00 37.07  ? 202  GLU A OE2 1 
ATOM   1569 N N   . SER A 1 203 ? 25.982  12.605  14.247  1.00 38.42  ? 203  SER A N   1 
ATOM   1570 C CA  . SER A 1 203 ? 27.082  12.966  13.346  1.00 38.76  ? 203  SER A CA  1 
ATOM   1571 C C   . SER A 1 203 ? 28.385  12.191  13.650  1.00 39.13  ? 203  SER A C   1 
ATOM   1572 O O   . SER A 1 203 ? 28.382  10.960  13.622  1.00 38.93  ? 203  SER A O   1 
ATOM   1573 C CB  . SER A 1 203 ? 27.323  14.467  13.376  1.00 37.97  ? 203  SER A CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 28.288  14.778  12.408  1.00 37.81  ? 203  SER A OG  1 
ATOM   1575 N N   . ALA A 1 204 ? 29.483  12.892  13.973  1.00 39.31  ? 204  ALA A N   1 
ATOM   1576 C CA  . ALA A 1 204 ? 30.750  12.173  14.280  1.00 40.04  ? 204  ALA A CA  1 
ATOM   1577 C C   . ALA A 1 204 ? 30.579  11.219  15.472  1.00 40.45  ? 204  ALA A C   1 
ATOM   1578 O O   . ALA A 1 204 ? 31.169  10.140  15.513  1.00 41.48  ? 204  ALA A O   1 
ATOM   1579 C CB  . ALA A 1 204 ? 31.897  13.147  14.520  1.00 39.77  ? 204  ALA A CB  1 
ATOM   1580 N N   . GLY A 1 205 ? 29.743  11.613  16.432  1.00 40.12  ? 205  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 205 ? 29.401  10.740  17.547  1.00 39.74  ? 205  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 205 ? 28.606  9.537   17.104  1.00 40.19  ? 205  GLY A C   1 
ATOM   1583 O O   . GLY A 1 205 ? 28.758  8.455   17.668  1.00 41.54  ? 205  GLY A O   1 
ATOM   1584 N N   . ALA A 1 206 ? 27.765  9.712   16.091  1.00 39.62  ? 206  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 206 ? 27.004  8.604   15.563  1.00 39.91  ? 206  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 206 ? 27.994  7.649   14.896  1.00 40.35  ? 206  ALA A C   1 
ATOM   1587 O O   . ALA A 1 206 ? 27.924  6.417   15.086  1.00 40.70  ? 206  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 206 ? 25.951  9.084   14.584  1.00 39.79  ? 206  ALA A CB  1 
ATOM   1589 N N   . ALA A 1 207 ? 28.926  8.234   14.147  1.00 39.18  ? 207  ALA A N   1 
ATOM   1590 C CA  . ALA A 1 207 ? 29.978  7.487   13.507  1.00 40.24  ? 207  ALA A CA  1 
ATOM   1591 C C   . ALA A 1 207 ? 30.744  6.703   14.571  1.00 41.50  ? 207  ALA A C   1 
ATOM   1592 O O   . ALA A 1 207 ? 31.034  5.475   14.418  1.00 41.96  ? 207  ALA A O   1 
ATOM   1593 C CB  . ALA A 1 207 ? 30.903  8.429   12.771  1.00 40.05  ? 207  ALA A CB  1 
ATOM   1594 N N   . SER A 1 208 ? 31.044  7.406   15.673  1.00 41.03  ? 208  SER A N   1 
ATOM   1595 C CA  . SER A 1 208 ? 31.676  6.754   16.821  1.00 41.11  ? 208  SER A CA  1 
ATOM   1596 C C   . SER A 1 208 ? 30.871  5.543   17.290  1.00 41.61  ? 208  SER A C   1 
ATOM   1597 O O   . SER A 1 208 ? 31.440  4.437   17.428  1.00 42.53  ? 208  SER A O   1 
ATOM   1598 C CB  . SER A 1 208 ? 31.951  7.747   17.933  1.00 40.45  ? 208  SER A CB  1 
ATOM   1599 O OG  . SER A 1 208 ? 32.638  8.897   17.393  1.00 41.49  ? 208  SER A OG  1 
ATOM   1600 N N   . VAL A 1 209 ? 29.564  5.724   17.499  1.00 40.47  ? 209  VAL A N   1 
ATOM   1601 C CA  . VAL A 1 209 ? 28.730  4.629   18.004  1.00 40.69  ? 209  VAL A CA  1 
ATOM   1602 C C   . VAL A 1 209 ? 28.893  3.396   17.093  1.00 41.96  ? 209  VAL A C   1 
ATOM   1603 O O   . VAL A 1 209 ? 29.111  2.288   17.576  1.00 42.22  ? 209  VAL A O   1 
ATOM   1604 C CB  . VAL A 1 209 ? 27.256  5.072   18.138  1.00 40.37  ? 209  VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 209 ? 26.325  3.889   18.350  1.00 41.32  ? 209  VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 209 ? 27.104  6.049   19.288  1.00 40.46  ? 209  VAL A CG2 1 
ATOM   1607 N N   . GLY A 1 210 ? 28.862  3.636   15.776  1.00 42.03  ? 210  GLY A N   1 
ATOM   1608 C CA  . GLY A 1 210 ? 28.979  2.607   14.767  1.00 43.17  ? 210  GLY A CA  1 
ATOM   1609 C C   . GLY A 1 210 ? 30.326  1.943   14.842  1.00 44.28  ? 210  GLY A C   1 
ATOM   1610 O O   . GLY A 1 210 ? 30.434  0.721   14.730  1.00 46.79  ? 210  GLY A O   1 
ATOM   1611 N N   . MET A 1 211 ? 31.372  2.722   15.060  1.00 43.44  ? 211  MET A N   1 
ATOM   1612 C CA  . MET A 1 211 ? 32.669  2.100   15.262  1.00 43.68  ? 211  MET A CA  1 
ATOM   1613 C C   . MET A 1 211 ? 32.746  1.145   16.458  1.00 43.84  ? 211  MET A C   1 
ATOM   1614 O O   . MET A 1 211 ? 33.415  0.094   16.361  1.00 44.31  ? 211  MET A O   1 
ATOM   1615 C CB  . MET A 1 211 ? 33.790  3.115   15.236  1.00 43.21  ? 211  MET A CB  1 
ATOM   1616 C CG  . MET A 1 211 ? 34.235  3.320   13.790  1.00 45.22  ? 211  MET A CG  1 
ATOM   1617 S SD  . MET A 1 211 ? 34.714  5.006   13.561  1.00 49.46  ? 211  MET A SD  1 
ATOM   1618 C CE  . MET A 1 211 ? 34.553  5.180   11.803  1.00 47.20  ? 211  MET A CE  1 
ATOM   1619 N N   . HIS A 1 212 ? 32.027  1.474   17.543  1.00 42.14  ? 212  HIS A N   1 
ATOM   1620 C CA  . HIS A 1 212 ? 31.964  0.578   18.693  1.00 42.34  ? 212  HIS A CA  1 
ATOM   1621 C C   . HIS A 1 212 ? 31.189  -0.679  18.334  1.00 44.36  ? 212  HIS A C   1 
ATOM   1622 O O   . HIS A 1 212 ? 31.531  -1.765  18.780  1.00 45.21  ? 212  HIS A O   1 
ATOM   1623 C CB  . HIS A 1 212 ? 31.400  1.247   19.925  1.00 39.65  ? 212  HIS A CB  1 
ATOM   1624 C CG  . HIS A 1 212 ? 32.281  2.329   20.447  1.00 39.25  ? 212  HIS A CG  1 
ATOM   1625 N ND1 . HIS A 1 212 ? 33.521  2.066   20.990  1.00 36.92  ? 212  HIS A ND1 1 
ATOM   1626 C CD2 . HIS A 1 212 ? 32.137  3.686   20.450  1.00 32.64  ? 212  HIS A CD2 1 
ATOM   1627 C CE1 . HIS A 1 212 ? 34.086  3.217   21.332  1.00 36.56  ? 212  HIS A CE1 1 
ATOM   1628 N NE2 . HIS A 1 212 ? 33.268  4.210   21.018  1.00 30.69  ? 212  HIS A NE2 1 
ATOM   1629 N N   . ILE A 1 213 ? 30.168  -0.528  17.497  1.00 44.69  ? 213  ILE A N   1 
ATOM   1630 C CA  . ILE A 1 213 ? 29.453  -1.671  17.010  1.00 46.62  ? 213  ILE A CA  1 
ATOM   1631 C C   . ILE A 1 213 ? 30.408  -2.594  16.253  1.00 48.18  ? 213  ILE A C   1 
ATOM   1632 O O   . ILE A 1 213 ? 30.195  -3.799  16.217  1.00 49.84  ? 213  ILE A O   1 
ATOM   1633 C CB  . ILE A 1 213 ? 28.269  -1.260  16.119  1.00 46.23  ? 213  ILE A CB  1 
ATOM   1634 C CG1 . ILE A 1 213 ? 27.194  -0.597  16.964  1.00 45.19  ? 213  ILE A CG1 1 
ATOM   1635 C CG2 . ILE A 1 213 ? 27.654  -2.489  15.435  1.00 48.12  ? 213  ILE A CG2 1 
ATOM   1636 C CD1 . ILE A 1 213 ? 26.093  0.052   16.141  1.00 45.97  ? 213  ILE A CD1 1 
ATOM   1637 N N   . LEU A 1 214 ? 31.465  -2.019  15.677  1.00 48.02  ? 214  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 214 ? 32.297  -2.719  14.697  1.00 49.32  ? 214  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 214 ? 33.631  -3.145  15.272  1.00 50.22  ? 214  LEU A C   1 
ATOM   1640 O O   . LEU A 1 214 ? 34.455  -3.743  14.572  1.00 51.94  ? 214  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 214 ? 32.514  -1.834  13.457  1.00 48.74  ? 214  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 214 ? 31.301  -1.659  12.528  1.00 48.47  ? 214  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 214 ? 31.538  -0.579  11.517  1.00 43.78  ? 214  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 214 ? 30.927  -2.978  11.851  1.00 47.17  ? 214  LEU A CD2 1 
ATOM   1645 N N   . SER A 1 215 ? 33.833  -2.854  16.554  1.00 49.84  ? 215  SER A N   1 
ATOM   1646 C CA  . SER A 1 215 ? 35.090  -3.138  17.226  1.00 50.44  ? 215  SER A CA  1 
ATOM   1647 C C   . SER A 1 215 ? 34.859  -4.129  18.350  1.00 52.44  ? 215  SER A C   1 
ATOM   1648 O O   . SER A 1 215 ? 34.232  -3.793  19.339  1.00 51.82  ? 215  SER A O   1 
ATOM   1649 C CB  . SER A 1 215 ? 35.667  -1.846  17.781  1.00 48.49  ? 215  SER A CB  1 
ATOM   1650 O OG  . SER A 1 215 ? 37.065  -1.921  17.847  1.00 46.93  ? 215  SER A OG  1 
ATOM   1651 N N   . LEU A 1 216 ? 35.363  -5.353  18.193  1.00 55.79  ? 216  LEU A N   1 
ATOM   1652 C CA  . LEU A 1 216 ? 35.149  -6.443  19.170  1.00 58.14  ? 216  LEU A CA  1 
ATOM   1653 C C   . LEU A 1 216 ? 35.265  -6.047  20.646  1.00 57.83  ? 216  LEU A C   1 
ATOM   1654 O O   . LEU A 1 216 ? 34.331  -6.299  21.424  1.00 57.63  ? 216  LEU A O   1 
ATOM   1655 C CB  . LEU A 1 216 ? 36.082  -7.629  18.874  1.00 61.02  ? 216  LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 216 ? 35.445  -8.929  18.365  1.00 65.49  ? 216  LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 216 ? 34.878  -9.756  19.539  1.00 66.89  ? 216  LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 216 ? 34.357  -8.616  17.292  1.00 67.51  ? 216  LEU A CD2 1 
ATOM   1659 N N   . PRO A 1 217 ? 36.398  -5.414  21.041  1.00 57.85  ? 217  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 217 ? 36.555  -5.059  22.459  1.00 57.55  ? 217  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 217 ? 35.528  -4.049  22.993  1.00 55.89  ? 217  PRO A C   1 
ATOM   1662 O O   . PRO A 1 217 ? 35.447  -3.889  24.217  1.00 56.40  ? 217  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 217 ? 37.977  -4.466  22.533  1.00 57.07  ? 217  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 217 ? 38.658  -4.945  21.332  1.00 57.88  ? 217  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 217 ? 37.597  -5.025  20.273  1.00 57.79  ? 217  PRO A CD  1 
ATOM   1666 N N   . SER A 1 218 ? 34.750  -3.394  22.126  1.00 54.14  ? 218  SER A N   1 
ATOM   1667 C CA  . SER A 1 218 ? 33.636  -2.534  22.612  1.00 52.63  ? 218  SER A CA  1 
ATOM   1668 C C   . SER A 1 218 ? 32.259  -3.218  22.700  1.00 53.62  ? 218  SER A C   1 
ATOM   1669 O O   . SER A 1 218 ? 31.373  -2.733  23.399  1.00 52.98  ? 218  SER A O   1 
ATOM   1670 C CB  . SER A 1 218 ? 33.509  -1.249  21.793  1.00 50.74  ? 218  SER A CB  1 
ATOM   1671 O OG  . SER A 1 218 ? 34.730  -0.529  21.755  1.00 48.87  ? 218  SER A OG  1 
ATOM   1672 N N   . ARG A 1 219 ? 32.082  -4.343  22.006  1.00 55.38  ? 219  ARG A N   1 
ATOM   1673 C CA  A ARG A 1 219 ? 30.784  -5.042  21.933  0.50 56.54  ? 219  ARG A CA  1 
ATOM   1674 C CA  B ARG A 1 219 ? 30.758  -4.976  21.949  0.50 56.48  ? 219  ARG A CA  1 
ATOM   1675 C C   . ARG A 1 219 ? 30.255  -5.515  23.292  1.00 57.03  ? 219  ARG A C   1 
ATOM   1676 O O   . ARG A 1 219 ? 29.044  -5.662  23.487  1.00 57.40  ? 219  ARG A O   1 
ATOM   1677 C CB  A ARG A 1 219 ? 30.846  -6.230  20.956  0.50 58.11  ? 219  ARG A CB  1 
ATOM   1678 C CB  B ARG A 1 219 ? 30.678  -6.041  20.847  0.50 57.95  ? 219  ARG A CB  1 
ATOM   1679 C CG  A ARG A 1 219 ? 30.813  -5.835  19.477  0.50 58.38  ? 219  ARG A CG  1 
ATOM   1680 C CG  B ARG A 1 219 ? 30.312  -5.453  19.481  0.50 57.98  ? 219  ARG A CG  1 
ATOM   1681 C CD  A ARG A 1 219 ? 29.574  -4.992  19.121  0.50 57.99  ? 219  ARG A CD  1 
ATOM   1682 C CD  B ARG A 1 219 ? 29.060  -4.544  19.540  0.50 56.48  ? 219  ARG A CD  1 
ATOM   1683 N NE  A ARG A 1 219 ? 28.333  -5.772  19.077  0.50 58.30  ? 219  ARG A NE  1 
ATOM   1684 N NE  B ARG A 1 219 ? 27.806  -5.288  19.726  0.50 57.48  ? 219  ARG A NE  1 
ATOM   1685 C CZ  A ARG A 1 219 ? 27.983  -6.576  18.081  0.50 59.12  ? 219  ARG A CZ  1 
ATOM   1686 C CZ  B ARG A 1 219 ? 27.060  -5.242  20.830  0.50 56.78  ? 219  ARG A CZ  1 
ATOM   1687 N NH1 A ARG A 1 219 ? 28.782  -6.731  17.036  0.50 59.84  ? 219  ARG A NH1 1 
ATOM   1688 N NH1 B ARG A 1 219 ? 27.432  -4.482  21.849  0.50 55.60  ? 219  ARG A NH1 1 
ATOM   1689 N NH2 A ARG A 1 219 ? 26.835  -7.233  18.134  0.50 60.54  ? 219  ARG A NH2 1 
ATOM   1690 N NH2 B ARG A 1 219 ? 25.936  -5.944  20.915  0.50 56.77  ? 219  ARG A NH2 1 
ATOM   1691 N N   . SER A 1 220 ? 31.169  -5.776  24.220  1.00 57.13  ? 220  SER A N   1 
ATOM   1692 C CA  . SER A 1 220 ? 30.783  -6.219  25.565  1.00 57.38  ? 220  SER A CA  1 
ATOM   1693 C C   . SER A 1 220 ? 30.331  -5.089  26.483  1.00 55.19  ? 220  SER A C   1 
ATOM   1694 O O   . SER A 1 220 ? 29.732  -5.342  27.518  1.00 55.34  ? 220  SER A O   1 
ATOM   1695 C CB  . SER A 1 220 ? 31.904  -7.036  26.240  1.00 58.75  ? 220  SER A CB  1 
ATOM   1696 O OG  . SER A 1 220 ? 33.191  -6.579  25.863  1.00 58.55  ? 220  SER A OG  1 
ATOM   1697 N N   . LEU A 1 221 ? 30.612  -3.849  26.094  1.00 53.07  ? 221  LEU A N   1 
ATOM   1698 C CA  . LEU A 1 221 ? 30.365  -2.718  26.956  1.00 51.47  ? 221  LEU A CA  1 
ATOM   1699 C C   . LEU A 1 221 ? 29.070  -1.973  26.646  1.00 50.87  ? 221  LEU A C   1 
ATOM   1700 O O   . LEU A 1 221 ? 28.892  -0.830  27.103  1.00 50.48  ? 221  LEU A O   1 
ATOM   1701 C CB  . LEU A 1 221 ? 31.531  -1.722  26.856  1.00 50.79  ? 221  LEU A CB  1 
ATOM   1702 C CG  . LEU A 1 221 ? 32.983  -2.187  26.724  1.00 50.89  ? 221  LEU A CG  1 
ATOM   1703 C CD1 . LEU A 1 221 ? 33.881  -0.962  26.635  1.00 45.88  ? 221  LEU A CD1 1 
ATOM   1704 C CD2 . LEU A 1 221 ? 33.394  -3.102  27.891  1.00 50.10  ? 221  LEU A CD2 1 
ATOM   1705 N N   . PHE A 1 222 ? 28.195  -2.554  25.831  1.00 51.13  ? 222  PHE A N   1 
ATOM   1706 C CA  . PHE A 1 222 ? 26.883  -1.928  25.536  1.00 50.77  ? 222  PHE A CA  1 
ATOM   1707 C C   . PHE A 1 222 ? 26.005  -2.938  24.847  1.00 52.13  ? 222  PHE A C   1 
ATOM   1708 O O   . PHE A 1 222 ? 26.497  -3.916  24.321  1.00 53.52  ? 222  PHE A O   1 
ATOM   1709 C CB  . PHE A 1 222 ? 26.984  -0.616  24.705  1.00 48.39  ? 222  PHE A CB  1 
ATOM   1710 C CG  . PHE A 1 222 ? 27.403  -0.828  23.273  1.00 47.74  ? 222  PHE A CG  1 
ATOM   1711 C CD1 . PHE A 1 222 ? 28.751  -0.978  22.937  1.00 47.32  ? 222  PHE A CD1 1 
ATOM   1712 C CD2 . PHE A 1 222 ? 26.460  -0.888  22.258  1.00 47.35  ? 222  PHE A CD2 1 
ATOM   1713 C CE1 . PHE A 1 222 ? 29.145  -1.209  21.612  1.00 46.42  ? 222  PHE A CE1 1 
ATOM   1714 C CE2 . PHE A 1 222 ? 26.850  -1.111  20.918  1.00 47.11  ? 222  PHE A CE2 1 
ATOM   1715 C CZ  . PHE A 1 222 ? 28.191  -1.271  20.602  1.00 46.05  ? 222  PHE A CZ  1 
ATOM   1716 N N   . HIS A 1 223 ? 24.708  -2.681  24.826  1.00 52.73  ? 223  HIS A N   1 
ATOM   1717 C CA  . HIS A 1 223 ? 23.757  -3.673  24.367  1.00 54.80  ? 223  HIS A CA  1 
ATOM   1718 C C   . HIS A 1 223 ? 22.933  -3.198  23.200  1.00 54.01  ? 223  HIS A C   1 
ATOM   1719 O O   . HIS A 1 223 ? 22.358  -4.017  22.473  1.00 55.36  ? 223  HIS A O   1 
ATOM   1720 C CB  . HIS A 1 223 ? 22.874  -4.083  25.543  1.00 56.54  ? 223  HIS A CB  1 
ATOM   1721 C CG  . HIS A 1 223 ? 23.674  -4.503  26.734  1.00 60.35  ? 223  HIS A CG  1 
ATOM   1722 N ND1 . HIS A 1 223 ? 24.160  -3.597  27.661  1.00 61.11  ? 223  HIS A ND1 1 
ATOM   1723 C CD2 . HIS A 1 223 ? 24.152  -5.720  27.100  1.00 63.23  ? 223  HIS A CD2 1 
ATOM   1724 C CE1 . HIS A 1 223 ? 24.876  -4.247  28.564  1.00 62.74  ? 223  HIS A CE1 1 
ATOM   1725 N NE2 . HIS A 1 223 ? 24.887  -5.534  28.248  1.00 64.58  ? 223  HIS A NE2 1 
ATOM   1726 N N   . ARG A 1 224 ? 22.908  -1.878  23.016  1.00 51.70  ? 224  ARG A N   1 
ATOM   1727 C CA  . ARG A 1 224 ? 21.999  -1.217  22.101  1.00 51.07  ? 224  ARG A CA  1 
ATOM   1728 C C   . ARG A 1 224 ? 22.603  0.110   21.641  1.00 49.08  ? 224  ARG A C   1 
ATOM   1729 O O   . ARG A 1 224 ? 23.332  0.766   22.393  1.00 48.03  ? 224  ARG A O   1 
ATOM   1730 C CB  . ARG A 1 224 ? 20.654  -0.969  22.789  1.00 51.77  ? 224  ARG A CB  1 
ATOM   1731 C CG  . ARG A 1 224 ? 19.641  -2.063  22.543  1.00 55.90  ? 224  ARG A CG  1 
ATOM   1732 C CD  . ARG A 1 224 ? 18.359  -1.896  23.363  1.00 59.53  ? 224  ARG A CD  1 
ATOM   1733 N NE  . ARG A 1 224 ? 18.630  -1.967  24.792  1.00 63.03  ? 224  ARG A NE  1 
ATOM   1734 C CZ  . ARG A 1 224 ? 18.768  -3.099  25.481  1.00 66.23  ? 224  ARG A CZ  1 
ATOM   1735 N NH1 . ARG A 1 224 ? 18.674  -4.274  24.868  1.00 68.61  ? 224  ARG A NH1 1 
ATOM   1736 N NH2 . ARG A 1 224 ? 19.024  -3.060  26.786  1.00 66.56  ? 224  ARG A NH2 1 
ATOM   1737 N N   . ALA A 1 225 ? 22.284  0.510   20.415  1.00 47.68  ? 225  ALA A N   1 
ATOM   1738 C CA  . ALA A 1 225 ? 22.936  1.639   19.838  1.00 45.83  ? 225  ALA A CA  1 
ATOM   1739 C C   . ALA A 1 225 ? 21.985  2.504   19.005  1.00 45.41  ? 225  ALA A C   1 
ATOM   1740 O O   . ALA A 1 225 ? 21.051  1.993   18.373  1.00 46.27  ? 225  ALA A O   1 
ATOM   1741 C CB  . ALA A 1 225 ? 24.102  1.162   19.006  1.00 46.23  ? 225  ALA A CB  1 
ATOM   1742 N N   . VAL A 1 226 ? 22.237  3.811   19.019  1.00 43.16  ? 226  VAL A N   1 
ATOM   1743 C CA  . VAL A 1 226 ? 21.438  4.760   18.296  1.00 42.54  ? 226  VAL A CA  1 
ATOM   1744 C C   . VAL A 1 226 ? 22.384  5.650   17.486  1.00 41.76  ? 226  VAL A C   1 
ATOM   1745 O O   . VAL A 1 226 ? 23.302  6.254   18.053  1.00 41.48  ? 226  VAL A O   1 
ATOM   1746 C CB  . VAL A 1 226 ? 20.620  5.606   19.270  1.00 42.14  ? 226  VAL A CB  1 
ATOM   1747 C CG1 . VAL A 1 226 ? 19.978  6.807   18.568  1.00 43.35  ? 226  VAL A CG1 1 
ATOM   1748 C CG2 . VAL A 1 226 ? 19.571  4.777   19.940  1.00 43.18  ? 226  VAL A CG2 1 
ATOM   1749 N N   . LEU A 1 227 ? 22.170  5.735   16.170  1.00 41.41  ? 227  LEU A N   1 
ATOM   1750 C CA  . LEU A 1 227 ? 23.033  6.515   15.298  1.00 40.31  ? 227  LEU A CA  1 
ATOM   1751 C C   . LEU A 1 227 ? 22.259  7.662   14.604  1.00 40.02  ? 227  LEU A C   1 
ATOM   1752 O O   . LEU A 1 227 ? 21.509  7.445   13.654  1.00 41.27  ? 227  LEU A O   1 
ATOM   1753 C CB  . LEU A 1 227 ? 23.704  5.583   14.286  1.00 40.85  ? 227  LEU A CB  1 
ATOM   1754 C CG  . LEU A 1 227 ? 24.597  4.437   14.789  1.00 40.66  ? 227  LEU A CG  1 
ATOM   1755 C CD1 . LEU A 1 227 ? 23.819  3.176   15.200  1.00 39.41  ? 227  LEU A CD1 1 
ATOM   1756 C CD2 . LEU A 1 227 ? 25.626  4.084   13.750  1.00 40.18  ? 227  LEU A CD2 1 
ATOM   1757 N N   . GLN A 1 228 ? 22.424  8.882   15.088  1.00 39.08  ? 228  GLN A N   1 
ATOM   1758 C CA  . GLN A 1 228 ? 21.707  10.031  14.526  1.00 38.73  ? 228  GLN A CA  1 
ATOM   1759 C C   . GLN A 1 228 ? 22.576  10.721  13.498  1.00 38.05  ? 228  GLN A C   1 
ATOM   1760 O O   . GLN A 1 228 ? 23.670  11.143  13.846  1.00 38.21  ? 228  GLN A O   1 
ATOM   1761 C CB  . GLN A 1 228 ? 21.347  11.025  15.636  1.00 38.21  ? 228  GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 228 ? 20.419  10.443  16.690  1.00 40.66  ? 228  GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 228 ? 20.323  11.266  17.940  1.00 41.92  ? 228  GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 228 ? 20.134  10.720  19.027  1.00 40.84  ? 228  GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 228 ? 20.428  12.600  17.801  1.00 44.76  ? 228  GLN A NE2 1 
ATOM   1766 N N   . SER A 1 229 ? 22.122  10.825  12.246  1.00 37.86  ? 229  SER A N   1 
ATOM   1767 C CA  . SER A 1 229 ? 22.797  11.668  11.248  1.00 37.80  ? 229  SER A CA  1 
ATOM   1768 C C   . SER A 1 229 ? 24.297  11.355  11.100  1.00 37.89  ? 229  SER A C   1 
ATOM   1769 O O   . SER A 1 229 ? 25.124  12.283  10.936  1.00 37.79  ? 229  SER A O   1 
ATOM   1770 C CB  . SER A 1 229 ? 22.622  13.184  11.560  1.00 37.11  ? 229  SER A CB  1 
ATOM   1771 O OG  . SER A 1 229 ? 21.264  13.535  11.831  1.00 38.06  ? 229  SER A OG  1 
ATOM   1772 N N   . GLY A 1 230 ? 24.658  10.074  11.146  1.00 37.74  ? 230  GLY A N   1 
ATOM   1773 C CA  . GLY A 1 230 ? 26.048  9.693   10.980  1.00 37.87  ? 230  GLY A CA  1 
ATOM   1774 C C   . GLY A 1 230 ? 26.239  8.194   10.975  1.00 39.21  ? 230  GLY A C   1 
ATOM   1775 O O   . GLY A 1 230 ? 25.380  7.458   11.484  1.00 39.24  ? 230  GLY A O   1 
ATOM   1776 N N   . THR A 1 231 ? 27.356  7.742   10.385  1.00 39.82  ? 231  THR A N   1 
ATOM   1777 C CA  . THR A 1 231 ? 27.664  6.299   10.267  1.00 40.69  ? 231  THR A CA  1 
ATOM   1778 C C   . THR A 1 231 ? 29.161  5.977   10.232  1.00 41.17  ? 231  THR A C   1 
ATOM   1779 O O   . THR A 1 231 ? 29.966  6.833   9.900   1.00 41.19  ? 231  THR A O   1 
ATOM   1780 C CB  . THR A 1 231 ? 27.036  5.682   9.014   1.00 41.90  ? 231  THR A CB  1 
ATOM   1781 O OG1 . THR A 1 231 ? 27.685  6.163   7.833   1.00 40.18  ? 231  THR A OG1 1 
ATOM   1782 C CG2 . THR A 1 231 ? 25.561  5.979   8.933   1.00 43.59  ? 231  THR A CG2 1 
ATOM   1783 N N   . PRO A 1 232 ? 29.549  4.731   10.579  1.00 42.43  ? 232  PRO A N   1 
ATOM   1784 C CA  . PRO A 1 232 ? 30.964  4.385   10.472  1.00 42.25  ? 232  PRO A CA  1 
ATOM   1785 C C   . PRO A 1 232 ? 31.421  4.321   9.004   1.00 42.90  ? 232  PRO A C   1 
ATOM   1786 O O   . PRO A 1 232 ? 32.446  4.891   8.667   1.00 42.95  ? 232  PRO A O   1 
ATOM   1787 C CB  . PRO A 1 232 ? 31.030  3.015   11.141  1.00 43.04  ? 232  PRO A CB  1 
ATOM   1788 C CG  . PRO A 1 232 ? 29.678  2.454   11.007  1.00 43.13  ? 232  PRO A CG  1 
ATOM   1789 C CD  . PRO A 1 232 ? 28.735  3.582   11.038  1.00 43.23  ? 232  PRO A CD  1 
ATOM   1790 N N   . ASN A 1 233 ? 30.655  3.625   8.159   1.00 43.61  ? 233  ASN A N   1 
ATOM   1791 C CA  . ASN A 1 233 ? 30.778  3.639   6.693   1.00 43.47  ? 233  ASN A CA  1 
ATOM   1792 C C   . ASN A 1 233 ? 30.537  5.057   6.130   1.00 43.27  ? 233  ASN A C   1 
ATOM   1793 O O   . ASN A 1 233 ? 29.958  5.908   6.819   1.00 41.78  ? 233  ASN A O   1 
ATOM   1794 C CB  . ASN A 1 233 ? 29.734  2.698   6.107   1.00 43.63  ? 233  ASN A CB  1 
ATOM   1795 C CG  . ASN A 1 233 ? 28.338  3.001   6.624   1.00 42.18  ? 233  ASN A CG  1 
ATOM   1796 O OD1 . ASN A 1 233 ? 28.103  3.026   7.848   1.00 39.73  ? 233  ASN A OD1 1 
ATOM   1797 N ND2 . ASN A 1 233 ? 27.407  3.265   5.709   1.00 40.21  ? 233  ASN A ND2 1 
ATOM   1798 N N   . GLY A 1 234 ? 30.960  5.294   4.884   1.00 44.11  ? 234  GLY A N   1 
ATOM   1799 C CA  . GLY A 1 234 ? 30.842  6.613   4.257   1.00 44.12  ? 234  GLY A CA  1 
ATOM   1800 C C   . GLY A 1 234 ? 32.163  7.289   3.903   1.00 44.65  ? 234  GLY A C   1 
ATOM   1801 O O   . GLY A 1 234 ? 33.244  6.802   4.254   1.00 45.30  ? 234  GLY A O   1 
ATOM   1802 N N   . PRO A 1 235 ? 32.093  8.423   3.198   1.00 44.37  ? 235  PRO A N   1 
ATOM   1803 C CA  . PRO A 1 235 ? 33.297  9.071   2.689   1.00 44.39  ? 235  PRO A CA  1 
ATOM   1804 C C   . PRO A 1 235 ? 34.124  9.874   3.724   1.00 43.38  ? 235  PRO A C   1 
ATOM   1805 O O   . PRO A 1 235 ? 35.226  10.375  3.399   1.00 42.93  ? 235  PRO A O   1 
ATOM   1806 C CB  . PRO A 1 235 ? 32.730  10.022  1.622   1.00 44.65  ? 235  PRO A CB  1 
ATOM   1807 C CG  . PRO A 1 235 ? 31.380  10.414  2.157   1.00 43.41  ? 235  PRO A CG  1 
ATOM   1808 C CD  . PRO A 1 235 ? 30.869  9.092   2.714   1.00 44.41  ? 235  PRO A CD  1 
ATOM   1809 N N   . TRP A 1 236 ? 33.615  10.010  4.944   1.00 42.20  ? 236  TRP A N   1 
ATOM   1810 C CA  . TRP A 1 236 ? 34.220  10.987  5.869   1.00 41.24  ? 236  TRP A CA  1 
ATOM   1811 C C   . TRP A 1 236 ? 34.586  10.459  7.264   1.00 40.99  ? 236  TRP A C   1 
ATOM   1812 O O   . TRP A 1 236 ? 35.401  11.062  7.955   1.00 40.67  ? 236  TRP A O   1 
ATOM   1813 C CB  . TRP A 1 236 ? 33.324  12.216  6.004   1.00 39.45  ? 236  TRP A CB  1 
ATOM   1814 C CG  . TRP A 1 236 ? 31.976  11.929  6.613   1.00 39.02  ? 236  TRP A CG  1 
ATOM   1815 C CD1 . TRP A 1 236 ? 30.814  11.725  5.946   1.00 39.25  ? 236  TRP A CD1 1 
ATOM   1816 C CD2 . TRP A 1 236 ? 31.657  11.800  8.008   1.00 39.88  ? 236  TRP A CD2 1 
ATOM   1817 N NE1 . TRP A 1 236 ? 29.784  11.501  6.821   1.00 36.90  ? 236  TRP A NE1 1 
ATOM   1818 C CE2 . TRP A 1 236 ? 30.272  11.535  8.096   1.00 38.50  ? 236  TRP A CE2 1 
ATOM   1819 C CE3 . TRP A 1 236 ? 32.399  11.922  9.200   1.00 40.24  ? 236  TRP A CE3 1 
ATOM   1820 C CZ2 . TRP A 1 236 ? 29.613  11.378  9.320   1.00 38.57  ? 236  TRP A CZ2 1 
ATOM   1821 C CZ3 . TRP A 1 236 ? 31.741  11.767  10.417  1.00 37.83  ? 236  TRP A CZ3 1 
ATOM   1822 C CH2 . TRP A 1 236 ? 30.365  11.486  10.465  1.00 38.01  ? 236  TRP A CH2 1 
ATOM   1823 N N   . ALA A 1 237 ? 33.971  9.358   7.689   1.00 40.85  ? 237  ALA A N   1 
ATOM   1824 C CA  . ALA A 1 237 ? 34.178  8.912   9.057   1.00 40.36  ? 237  ALA A CA  1 
ATOM   1825 C C   . ALA A 1 237 ? 35.503  8.182   9.245   1.00 41.16  ? 237  ALA A C   1 
ATOM   1826 O O   . ALA A 1 237 ? 35.937  8.010   10.374  1.00 41.24  ? 237  ALA A O   1 
ATOM   1827 C CB  . ALA A 1 237 ? 33.019  8.064   9.546   1.00 40.45  ? 237  ALA A CB  1 
ATOM   1828 N N   . THR A 1 238 ? 36.152  7.743   8.168   1.00 41.44  ? 238  THR A N   1 
ATOM   1829 C CA  . THR A 1 238 ? 37.457  7.122   8.336   1.00 42.52  ? 238  THR A CA  1 
ATOM   1830 C C   . THR A 1 238 ? 38.405  7.548   7.244   1.00 43.88  ? 238  THR A C   1 
ATOM   1831 O O   . THR A 1 238 ? 37.965  8.086   6.228   1.00 45.08  ? 238  THR A O   1 
ATOM   1832 C CB  . THR A 1 238 ? 37.404  5.554   8.335   1.00 43.29  ? 238  THR A CB  1 
ATOM   1833 O OG1 . THR A 1 238 ? 36.927  5.085   7.070   1.00 43.61  ? 238  THR A OG1 1 
ATOM   1834 C CG2 . THR A 1 238 ? 36.525  5.041   9.401   1.00 40.98  ? 238  THR A CG2 1 
ATOM   1835 N N   . VAL A 1 239 ? 39.699  7.299   7.452   1.00 44.36  ? 239  VAL A N   1 
ATOM   1836 C CA  . VAL A 1 239 ? 40.692  7.391   6.394   1.00 45.13  ? 239  VAL A CA  1 
ATOM   1837 C C   . VAL A 1 239 ? 41.456  6.082   6.425   1.00 47.22  ? 239  VAL A C   1 
ATOM   1838 O O   . VAL A 1 239 ? 41.419  5.356   7.426   1.00 47.53  ? 239  VAL A O   1 
ATOM   1839 C CB  . VAL A 1 239 ? 41.692  8.567   6.596   1.00 44.91  ? 239  VAL A CB  1 
ATOM   1840 C CG1 . VAL A 1 239 ? 41.028  9.951   6.336   1.00 42.93  ? 239  VAL A CG1 1 
ATOM   1841 C CG2 . VAL A 1 239 ? 42.330  8.505   7.978   1.00 44.05  ? 239  VAL A CG2 1 
ATOM   1842 N N   . SER A 1 240 ? 42.148  5.783   5.329   1.00 48.84  ? 240  SER A N   1 
ATOM   1843 C CA  . SER A 1 240 ? 43.043  4.642   5.245   1.00 50.36  ? 240  SER A CA  1 
ATOM   1844 C C   . SER A 1 240 ? 44.332  4.919   6.017   1.00 50.85  ? 240  SER A C   1 
ATOM   1845 O O   . SER A 1 240 ? 44.626  6.058   6.370   1.00 49.97  ? 240  SER A O   1 
ATOM   1846 C CB  . SER A 1 240 ? 43.394  4.385   3.789   1.00 51.32  ? 240  SER A CB  1 
ATOM   1847 O OG  . SER A 1 240 ? 44.272  5.409   3.358   1.00 52.12  ? 240  SER A OG  1 
ATOM   1848 N N   . ALA A 1 241 ? 45.123  3.871   6.238   1.00 52.88  ? 241  ALA A N   1 
ATOM   1849 C CA  . ALA A 1 241 ? 46.383  4.021   6.945   1.00 53.65  ? 241  ALA A CA  1 
ATOM   1850 C C   . ALA A 1 241 ? 47.302  5.026   6.241   1.00 54.22  ? 241  ALA A C   1 
ATOM   1851 O O   . ALA A 1 241 ? 47.801  5.949   6.878   1.00 53.57  ? 241  ALA A O   1 
ATOM   1852 C CB  . ALA A 1 241 ? 47.064  2.669   7.130   1.00 55.14  ? 241  ALA A CB  1 
ATOM   1853 N N   . GLY A 1 242 ? 47.488  4.852   4.928   1.00 55.58  ? 242  GLY A N   1 
ATOM   1854 C CA  . GLY A 1 242 ? 48.347  5.714   4.110   1.00 55.71  ? 242  GLY A CA  1 
ATOM   1855 C C   . GLY A 1 242 ? 47.910  7.158   4.167   1.00 54.61  ? 242  GLY A C   1 
ATOM   1856 O O   . GLY A 1 242 ? 48.740  8.073   4.241   1.00 55.05  ? 242  GLY A O   1 
ATOM   1857 N N   . GLU A 1 243 ? 46.605  7.385   4.153   1.00 52.95  ? 243  GLU A N   1 
ATOM   1858 C CA  . GLU A 1 243 ? 46.148  8.756   4.104   1.00 51.81  ? 243  GLU A CA  1 
ATOM   1859 C C   . GLU A 1 243 ? 46.365  9.434   5.458   1.00 51.31  ? 243  GLU A C   1 
ATOM   1860 O O   . GLU A 1 243 ? 46.762  10.631  5.515   1.00 51.61  ? 243  GLU A O   1 
ATOM   1861 C CB  . GLU A 1 243 ? 44.704  8.874   3.583   1.00 50.54  ? 243  GLU A CB  1 
ATOM   1862 C CG  . GLU A 1 243 ? 44.136  10.307  3.560   1.00 48.92  ? 243  GLU A CG  1 
ATOM   1863 C CD  . GLU A 1 243 ? 44.893  11.310  2.662   1.00 49.21  ? 243  GLU A CD  1 
ATOM   1864 O OE1 . GLU A 1 243 ? 45.769  10.914  1.858   1.00 50.20  ? 243  GLU A OE1 1 
ATOM   1865 O OE2 . GLU A 1 243 ? 44.593  12.519  2.769   1.00 46.93  ? 243  GLU A OE2 1 
ATOM   1866 N N   . ALA A 1 244 ? 46.139  8.684   6.542   1.00 50.28  ? 244  ALA A N   1 
ATOM   1867 C CA  . ALA A 1 244 ? 46.458  9.210   7.863   1.00 49.55  ? 244  ALA A CA  1 
ATOM   1868 C C   . ALA A 1 244 ? 47.967  9.429   7.990   1.00 51.39  ? 244  ALA A C   1 
ATOM   1869 O O   . ALA A 1 244 ? 48.407  10.430  8.550   1.00 52.18  ? 244  ALA A O   1 
ATOM   1870 C CB  . ALA A 1 244 ? 45.965  8.318   8.934   1.00 48.68  ? 244  ALA A CB  1 
ATOM   1871 N N   . ARG A 1 245 ? 48.766  8.521   7.436   1.00 52.92  ? 245  ARG A N   1 
ATOM   1872 C CA  . ARG A 1 245 ? 50.202  8.689   7.479   1.00 53.94  ? 245  ARG A CA  1 
ATOM   1873 C C   . ARG A 1 245 ? 50.564  9.977   6.752   1.00 54.26  ? 245  ARG A C   1 
ATOM   1874 O O   . ARG A 1 245 ? 51.340  10.782  7.262   1.00 54.82  ? 245  ARG A O   1 
ATOM   1875 C CB  . ARG A 1 245 ? 50.944  7.474   6.898   1.00 55.38  ? 245  ARG A CB  1 
ATOM   1876 C CG  . ARG A 1 245 ? 52.480  7.600   6.948   1.00 55.82  ? 245  ARG A CG  1 
ATOM   1877 C CD  . ARG A 1 245 ? 53.176  6.239   6.797   1.00 58.25  ? 245  ARG A CD  1 
ATOM   1878 N NE  . ARG A 1 245 ? 53.092  5.458   8.029   1.00 56.55  ? 245  ARG A NE  1 
ATOM   1879 C CZ  . ARG A 1 245 ? 53.903  5.623   9.071   1.00 57.43  ? 245  ARG A CZ  1 
ATOM   1880 N NH1 . ARG A 1 245 ? 54.875  6.528   9.038   1.00 57.41  ? 245  ARG A NH1 1 
ATOM   1881 N NH2 . ARG A 1 245 ? 53.739  4.891   10.162  1.00 57.47  ? 245  ARG A NH2 1 
ATOM   1882 N N   . ARG A 1 246 ? 49.984  10.175  5.576   1.00 54.12  ? 246  ARG A N   1 
ATOM   1883 C CA  . ARG A 1 246 ? 50.278  11.366  4.803   1.00 54.70  ? 246  ARG A CA  1 
ATOM   1884 C C   . ARG A 1 246 ? 49.922  12.634  5.573   1.00 53.44  ? 246  ARG A C   1 
ATOM   1885 O O   . ARG A 1 246 ? 50.713  13.586  5.603   1.00 54.22  ? 246  ARG A O   1 
ATOM   1886 C CB  . ARG A 1 246 ? 49.558  11.356  3.453   1.00 54.68  ? 246  ARG A CB  1 
ATOM   1887 C CG  . ARG A 1 246 ? 50.069  12.457  2.521   1.00 55.77  ? 246  ARG A CG  1 
ATOM   1888 C CD  . ARG A 1 246 ? 49.168  12.691  1.317   1.00 55.30  ? 246  ARG A CD  1 
ATOM   1889 N NE  . ARG A 1 246 ? 47.802  13.083  1.672   1.00 52.40  ? 246  ARG A NE  1 
ATOM   1890 C CZ  . ARG A 1 246 ? 47.402  14.331  1.919   1.00 51.19  ? 246  ARG A CZ  1 
ATOM   1891 N NH1 . ARG A 1 246 ? 48.252  15.356  1.889   1.00 51.42  ? 246  ARG A NH1 1 
ATOM   1892 N NH2 . ARG A 1 246 ? 46.137  14.550  2.223   1.00 49.82  ? 246  ARG A NH2 1 
ATOM   1893 N N   . ARG A 1 247 ? 48.747  12.642  6.202   1.00 51.74  ? 247  ARG A N   1 
ATOM   1894 C CA  . ARG A 1 247 ? 48.275  13.850  6.875   1.00 50.22  ? 247  ARG A CA  1 
ATOM   1895 C C   . ARG A 1 247 ? 49.103  14.229  8.103   1.00 50.68  ? 247  ARG A C   1 
ATOM   1896 O O   . ARG A 1 247 ? 49.385  15.419  8.320   1.00 51.30  ? 247  ARG A O   1 
ATOM   1897 C CB  . ARG A 1 247 ? 46.810  13.730  7.232   1.00 48.32  ? 247  ARG A CB  1 
ATOM   1898 C CG  . ARG A 1 247 ? 45.901  13.667  6.030   1.00 46.63  ? 247  ARG A CG  1 
ATOM   1899 C CD  . ARG A 1 247 ? 44.455  13.576  6.461   1.00 42.83  ? 247  ARG A CD  1 
ATOM   1900 N NE  . ARG A 1 247 ? 43.590  13.315  5.321   1.00 43.20  ? 247  ARG A NE  1 
ATOM   1901 C CZ  . ARG A 1 247 ? 42.260  13.290  5.367   1.00 42.31  ? 247  ARG A CZ  1 
ATOM   1902 N NH1 . ARG A 1 247 ? 41.603  13.499  6.507   1.00 40.67  ? 247  ARG A NH1 1 
ATOM   1903 N NH2 . ARG A 1 247 ? 41.585  13.061  4.261   1.00 41.72  ? 247  ARG A NH2 1 
ATOM   1904 N N   . ALA A 1 248 ? 49.500  13.225  8.885   1.00 50.48  ? 248  ALA A N   1 
ATOM   1905 C CA  . ALA A 1 248 ? 50.275  13.444  10.105  1.00 50.72  ? 248  ALA A CA  1 
ATOM   1906 C C   . ALA A 1 248 ? 51.623  14.038  9.747   1.00 52.73  ? 248  ALA A C   1 
ATOM   1907 O O   . ALA A 1 248 ? 52.056  15.028  10.356  1.00 53.35  ? 248  ALA A O   1 
ATOM   1908 C CB  . ALA A 1 248 ? 50.456  12.156  10.862  1.00 50.47  ? 248  ALA A CB  1 
ATOM   1909 N N   . THR A 1 249 ? 52.263  13.419  8.750   1.00 53.83  ? 249  THR A N   1 
ATOM   1910 C CA  . THR A 1 249 ? 53.561  13.811  8.227   1.00 55.06  ? 249  THR A CA  1 
ATOM   1911 C C   . THR A 1 249 ? 53.500  15.227  7.702   1.00 55.17  ? 249  THR A C   1 
ATOM   1912 O O   . THR A 1 249 ? 54.404  16.008  7.975   1.00 56.28  ? 249  THR A O   1 
ATOM   1913 C CB  . THR A 1 249 ? 54.015  12.866  7.091   1.00 56.08  ? 249  THR A CB  1 
ATOM   1914 O OG1 . THR A 1 249 ? 54.080  11.529  7.584   1.00 56.64  ? 249  THR A OG1 1 
ATOM   1915 C CG2 . THR A 1 249 ? 55.362  13.234  6.596   1.00 57.68  ? 249  THR A CG2 1 
ATOM   1916 N N   . LEU A 1 250 ? 52.430  15.559  6.968   1.00 54.30  ? 250  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 250 ? 52.274  16.897  6.400   1.00 54.26  ? 250  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 250 ? 52.110  17.944  7.500   1.00 54.36  ? 250  LEU A C   1 
ATOM   1919 O O   . LEU A 1 250 ? 52.753  19.000  7.450   1.00 55.05  ? 250  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 250 ? 51.140  16.971  5.372   1.00 52.72  ? 250  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 250 ? 50.848  18.375  4.780   1.00 52.73  ? 250  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 250 ? 52.098  19.114  4.319   1.00 53.21  ? 250  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 250 ? 49.822  18.351  3.646   1.00 51.11  ? 250  LEU A CD2 1 
ATOM   1924 N N   . LEU A 1 251 ? 51.277  17.635  8.500   1.00 53.74  ? 251  LEU A N   1 
ATOM   1925 C CA  . LEU A 1 251 ? 51.109  18.504  9.655   1.00 53.54  ? 251  LEU A CA  1 
ATOM   1926 C C   . LEU A 1 251 ? 52.419  18.678  10.396  1.00 55.49  ? 251  LEU A C   1 
ATOM   1927 O O   . LEU A 1 251 ? 52.793  19.797  10.737  1.00 56.30  ? 251  LEU A O   1 
ATOM   1928 C CB  . LEU A 1 251 ? 50.065  17.953  10.622  1.00 52.37  ? 251  LEU A CB  1 
ATOM   1929 C CG  . LEU A 1 251 ? 49.967  18.895  11.831  1.00 52.46  ? 251  LEU A CG  1 
ATOM   1930 C CD1 . LEU A 1 251 ? 48.964  20.019  11.606  1.00 50.78  ? 251  LEU A CD1 1 
ATOM   1931 C CD2 . LEU A 1 251 ? 49.666  18.158  13.086  1.00 52.67  ? 251  LEU A CD2 1 
ATOM   1932 N N   . ALA A 1 252 ? 53.101  17.562  10.651  1.00 56.49  ? 252  ALA A N   1 
ATOM   1933 C CA  . ALA A 1 252 ? 54.396  17.571  11.284  1.00 58.38  ? 252  ALA A CA  1 
ATOM   1934 C C   . ALA A 1 252 ? 55.290  18.579  10.583  1.00 60.55  ? 252  ALA A C   1 
ATOM   1935 O O   . ALA A 1 252 ? 55.898  19.441  11.209  1.00 61.52  ? 252  ALA A O   1 
ATOM   1936 C CB  . ALA A 1 252 ? 55.008  16.184  11.221  1.00 59.38  ? 252  ALA A CB  1 
ATOM   1937 N N   . ARG A 1 253 ? 55.345  18.484  9.265   1.00 61.83  ? 253  ARG A N   1 
ATOM   1938 C CA  . ARG A 1 253 ? 56.177  19.380  8.492   1.00 64.30  ? 253  ARG A CA  1 
ATOM   1939 C C   . ARG A 1 253 ? 55.726  20.826  8.687   1.00 63.57  ? 253  ARG A C   1 
ATOM   1940 O O   . ARG A 1 253 ? 56.544  21.700  8.935   1.00 64.92  ? 253  ARG A O   1 
ATOM   1941 C CB  . ARG A 1 253 ? 56.160  18.972  7.028   1.00 64.89  ? 253  ARG A CB  1 
ATOM   1942 C CG  . ARG A 1 253 ? 57.417  19.338  6.292   1.00 71.19  ? 253  ARG A CG  1 
ATOM   1943 C CD  . ARG A 1 253 ? 57.721  18.348  5.166   1.00 77.93  ? 253  ARG A CD  1 
ATOM   1944 N NE  . ARG A 1 253 ? 56.517  18.026  4.397   1.00 80.54  ? 253  ARG A NE  1 
ATOM   1945 C CZ  . ARG A 1 253 ? 56.217  16.809  3.938   1.00 82.03  ? 253  ARG A CZ  1 
ATOM   1946 N NH1 . ARG A 1 253 ? 55.083  16.623  3.256   1.00 79.44  ? 253  ARG A NH1 1 
ATOM   1947 N NH2 . ARG A 1 253 ? 57.046  15.778  4.171   1.00 82.99  ? 253  ARG A NH2 1 
ATOM   1948 N N   . LEU A 1 254 ? 54.416  21.050  8.623   1.00 61.92  ? 254  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 254 ? 53.835  22.385  8.735   1.00 61.33  ? 254  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 254 ? 54.154  23.118  10.030  1.00 62.01  ? 254  LEU A C   1 
ATOM   1951 O O   . LEU A 1 254 ? 54.212  24.336  10.027  1.00 62.37  ? 254  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 254 ? 52.325  22.345  8.527   1.00 58.92  ? 254  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 254 ? 51.825  22.161  7.099   1.00 58.54  ? 254  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 254 ? 50.339  21.848  7.105   1.00 56.02  ? 254  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 254 ? 52.100  23.375  6.248   1.00 59.72  ? 254  LEU A CD2 1 
ATOM   1956 N N   . VAL A 1 255 ? 54.354  22.382  11.124  1.00 62.56  ? 255  VAL A N   1 
ATOM   1957 C CA  . VAL A 1 255 ? 54.660  22.995  12.434  1.00 63.60  ? 255  VAL A CA  1 
ATOM   1958 C C   . VAL A 1 255 ? 56.149  22.952  12.788  1.00 66.78  ? 255  VAL A C   1 
ATOM   1959 O O   . VAL A 1 255 ? 56.540  23.226  13.929  1.00 67.20  ? 255  VAL A O   1 
ATOM   1960 C CB  . VAL A 1 255 ? 53.846  22.367  13.591  1.00 61.79  ? 255  VAL A CB  1 
ATOM   1961 C CG1 . VAL A 1 255 ? 52.380  22.760  13.496  1.00 58.94  ? 255  VAL A CG1 1 
ATOM   1962 C CG2 . VAL A 1 255 ? 54.010  20.858  13.621  1.00 60.64  ? 255  VAL A CG2 1 
ATOM   1963 N N   . GLY A 1 256 ? 56.971  22.603  11.802  1.00 69.22  ? 256  GLY A N   1 
ATOM   1964 C CA  . GLY A 1 256 ? 58.414  22.587  11.972  1.00 72.91  ? 256  GLY A CA  1 
ATOM   1965 C C   . GLY A 1 256 ? 58.916  21.310  12.605  1.00 74.34  ? 256  GLY A C   1 
ATOM   1966 O O   . GLY A 1 256 ? 59.844  21.338  13.406  1.00 75.64  ? 256  GLY A O   1 
ATOM   1967 N N   . CYS A 1 257 ? 58.301  20.187  12.250  1.00 74.30  ? 257  CYS A N   1 
ATOM   1968 C CA  . CYS A 1 257 ? 58.801  18.894  12.675  1.00 76.02  ? 257  CYS A CA  1 
ATOM   1969 C C   . CYS A 1 257 ? 59.119  18.028  11.473  1.00 78.60  ? 257  CYS A C   1 
ATOM   1970 O O   . CYS A 1 257 ? 58.430  17.038  11.228  1.00 77.81  ? 257  CYS A O   1 
ATOM   1971 C CB  . CYS A 1 257 ? 57.804  18.202  13.597  1.00 73.39  ? 257  CYS A CB  1 
ATOM   1972 S SG  . CYS A 1 257 ? 57.742  18.956  15.202  1.00 71.07  ? 257  CYS A SG  1 
ATOM   1973 N N   . PRO A 1 258 ? 60.176  18.393  10.718  1.00 82.52  ? 258  PRO A N   1 
ATOM   1974 C CA  . PRO A 1 258 ? 60.569  17.586  9.566   1.00 84.70  ? 258  PRO A CA  1 
ATOM   1975 C C   . PRO A 1 258 ? 60.578  16.080  9.861   1.00 85.70  ? 258  PRO A C   1 
ATOM   1976 O O   . PRO A 1 258 ? 61.121  15.652  10.900  1.00 85.97  ? 258  PRO A O   1 
ATOM   1977 C CB  . PRO A 1 258 ? 61.995  18.068  9.262   1.00 87.39  ? 258  PRO A CB  1 
ATOM   1978 C CG  . PRO A 1 258 ? 62.002  19.484  9.691   1.00 86.97  ? 258  PRO A CG  1 
ATOM   1979 C CD  . PRO A 1 258 ? 61.066  19.573  10.891  1.00 84.53  ? 258  PRO A CD  1 
ATOM   1980 N N   . PRO A 1 259 ? 59.908  15.300  8.976   1.00 86.01  ? 259  PRO A N   1 
ATOM   1981 C CA  . PRO A 1 259 ? 60.189  13.872  8.710   1.00 87.27  ? 259  PRO A CA  1 
ATOM   1982 C C   . PRO A 1 259 ? 61.559  13.665  8.024   1.00 90.11  ? 259  PRO A C   1 
ATOM   1983 O O   . PRO A 1 259 ? 62.610  14.020  8.578   1.00 91.76  ? 259  PRO A O   1 
ATOM   1984 C CB  . PRO A 1 259 ? 59.055  13.460  7.741   1.00 85.97  ? 259  PRO A CB  1 
ATOM   1985 C CG  . PRO A 1 259 ? 58.466  14.771  7.221   1.00 84.80  ? 259  PRO A CG  1 
ATOM   1986 C CD  . PRO A 1 259 ? 58.633  15.730  8.354   1.00 84.21  ? 259  PRO A CD  1 
ATOM   1987 N N   . GLY A 1 264 ? 64.502  8.141   8.581   1.00 95.44  ? 264  GLY A N   1 
ATOM   1988 C CA  . GLY A 1 264 ? 63.632  9.150   9.211   1.00 93.10  ? 264  GLY A CA  1 
ATOM   1989 C C   . GLY A 1 264 ? 62.371  8.546   9.894   1.00 90.42  ? 264  GLY A C   1 
ATOM   1990 O O   . GLY A 1 264 ? 61.247  8.650   9.378   1.00 88.63  ? 264  GLY A O   1 
ATOM   1991 N N   . ASN A 1 265 ? 62.581  7.931   11.064  1.00 90.08  ? 265  ASN A N   1 
ATOM   1992 C CA  . ASN A 1 265 ? 61.529  7.172   11.773  1.00 87.23  ? 265  ASN A CA  1 
ATOM   1993 C C   . ASN A 1 265 ? 60.471  8.001   12.515  1.00 83.17  ? 265  ASN A C   1 
ATOM   1994 O O   . ASN A 1 265 ? 60.557  9.233   12.604  1.00 82.52  ? 265  ASN A O   1 
ATOM   1995 C CB  . ASN A 1 265 ? 62.130  6.052   12.675  1.00 89.21  ? 265  ASN A CB  1 
ATOM   1996 C CG  . ASN A 1 265 ? 63.055  6.586   13.794  1.00 91.40  ? 265  ASN A CG  1 
ATOM   1997 O OD1 . ASN A 1 265 ? 62.693  7.492   14.562  1.00 90.69  ? 265  ASN A OD1 1 
ATOM   1998 N ND2 . ASN A 1 265 ? 64.250  5.992   13.900  1.00 94.23  ? 265  ASN A ND2 1 
ATOM   1999 N N   . ASP A 1 266 ? 59.476  7.301   13.044  1.00 79.93  ? 266  ASP A N   1 
ATOM   2000 C CA  . ASP A 1 266 ? 58.295  7.925   13.621  1.00 75.63  ? 266  ASP A CA  1 
ATOM   2001 C C   . ASP A 1 266 ? 58.503  8.498   15.017  1.00 74.69  ? 266  ASP A C   1 
ATOM   2002 O O   . ASP A 1 266 ? 57.833  9.465   15.394  1.00 73.24  ? 266  ASP A O   1 
ATOM   2003 C CB  . ASP A 1 266 ? 57.140  6.931   13.622  1.00 73.84  ? 266  ASP A CB  1 
ATOM   2004 C CG  . ASP A 1 266 ? 56.661  6.604   12.226  1.00 72.43  ? 266  ASP A CG  1 
ATOM   2005 O OD1 . ASP A 1 266 ? 56.807  7.456   11.322  1.00 70.70  ? 266  ASP A OD1 1 
ATOM   2006 O OD2 . ASP A 1 266 ? 56.134  5.495   12.033  1.00 70.58  ? 266  ASP A OD2 1 
ATOM   2007 N N   . THR A 1 267 ? 59.427  7.910   15.774  1.00 75.11  ? 267  THR A N   1 
ATOM   2008 C CA  . THR A 1 267 ? 59.701  8.339   17.139  1.00 74.05  ? 267  THR A CA  1 
ATOM   2009 C C   . THR A 1 267 ? 60.154  9.791   17.193  1.00 73.75  ? 267  THR A C   1 
ATOM   2010 O O   . THR A 1 267 ? 59.595  10.570  17.961  1.00 72.64  ? 267  THR A O   1 
ATOM   2011 C CB  . THR A 1 267 ? 60.733  7.427   17.810  1.00 76.24  ? 267  THR A CB  1 
ATOM   2012 O OG1 . THR A 1 267 ? 60.286  6.073   17.705  1.00 76.08  ? 267  THR A OG1 1 
ATOM   2013 C CG2 . THR A 1 267 ? 60.917  7.782   19.294  1.00 75.96  ? 267  THR A CG2 1 
ATOM   2014 N N   . GLU A 1 268 ? 61.143  10.151  16.373  1.00 74.74  ? 268  GLU A N   1 
ATOM   2015 C CA  . GLU A 1 268 ? 61.663  11.530  16.298  1.00 74.75  ? 268  GLU A CA  1 
ATOM   2016 C C   . GLU A 1 268 ? 60.553  12.547  15.986  1.00 71.45  ? 268  GLU A C   1 
ATOM   2017 O O   . GLU A 1 268 ? 60.489  13.615  16.588  1.00 70.84  ? 268  GLU A O   1 
ATOM   2018 C CB  . GLU A 1 268 ? 62.760  11.657  15.223  1.00 76.97  ? 268  GLU A CB  1 
ATOM   2019 C CG  . GLU A 1 268 ? 64.049  10.923  15.487  1.00 81.74  ? 268  GLU A CG  1 
ATOM   2020 C CD  . GLU A 1 268 ? 65.156  11.298  14.485  1.00 87.88  ? 268  GLU A CD  1 
ATOM   2021 O OE1 . GLU A 1 268 ? 64.861  11.980  13.466  1.00 88.21  ? 268  GLU A OE1 1 
ATOM   2022 O OE2 . GLU A 1 268 ? 66.331  10.911  14.720  1.00 90.41  ? 268  GLU A OE2 1 
ATOM   2023 N N   . LEU A 1 269 ? 59.704  12.188  15.029  1.00 69.01  ? 269  LEU A N   1 
ATOM   2024 C CA  . LEU A 1 269 ? 58.655  13.041  14.499  1.00 66.32  ? 269  LEU A CA  1 
ATOM   2025 C C   . LEU A 1 269 ? 57.549  13.276  15.526  1.00 64.13  ? 269  LEU A C   1 
ATOM   2026 O O   . LEU A 1 269 ? 57.165  14.417  15.799  1.00 63.28  ? 269  LEU A O   1 
ATOM   2027 C CB  . LEU A 1 269 ? 58.084  12.382  13.239  1.00 65.61  ? 269  LEU A CB  1 
ATOM   2028 C CG  . LEU A 1 269 ? 57.060  13.118  12.382  1.00 63.60  ? 269  LEU A CG  1 
ATOM   2029 C CD1 . LEU A 1 269 ? 57.262  12.734  10.952  1.00 64.12  ? 269  LEU A CD1 1 
ATOM   2030 C CD2 . LEU A 1 269 ? 55.632  12.812  12.820  1.00 61.42  ? 269  LEU A CD2 1 
ATOM   2031 N N   . ILE A 1 270 ? 57.037  12.180  16.082  1.00 62.91  ? 270  ILE A N   1 
ATOM   2032 C CA  . ILE A 1 270 ? 56.025  12.233  17.115  1.00 60.40  ? 270  ILE A CA  1 
ATOM   2033 C C   . ILE A 1 270 ? 56.594  12.947  18.334  1.00 60.61  ? 270  ILE A C   1 
ATOM   2034 O O   . ILE A 1 270 ? 55.916  13.764  18.943  1.00 59.84  ? 270  ILE A O   1 
ATOM   2035 C CB  . ILE A 1 270 ? 55.516  10.821  17.440  1.00 60.02  ? 270  ILE A CB  1 
ATOM   2036 C CG1 . ILE A 1 270 ? 54.790  10.268  16.226  1.00 59.06  ? 270  ILE A CG1 1 
ATOM   2037 C CG2 . ILE A 1 270 ? 54.559  10.829  18.609  1.00 57.84  ? 270  ILE A CG2 1 
ATOM   2038 C CD1 . ILE A 1 270 ? 54.835  8.789   16.131  1.00 61.24  ? 270  ILE A CD1 1 
ATOM   2039 N N   . ALA A 1 271 ? 57.852  12.683  18.658  1.00 61.97  ? 271  ALA A N   1 
ATOM   2040 C CA  . ALA A 1 271 ? 58.488  13.373  19.775  1.00 62.84  ? 271  ALA A CA  1 
ATOM   2041 C C   . ALA A 1 271 ? 58.490  14.881  19.560  1.00 62.84  ? 271  ALA A C   1 
ATOM   2042 O O   . ALA A 1 271 ? 58.192  15.649  20.480  1.00 62.45  ? 271  ALA A O   1 
ATOM   2043 C CB  . ALA A 1 271 ? 59.892  12.855  20.014  1.00 64.68  ? 271  ALA A CB  1 
ATOM   2044 N N   . CYS A 1 272 ? 58.801  15.292  18.334  1.00 63.36  ? 272  CYS A N   1 
ATOM   2045 C CA  . CYS A 1 272 ? 58.825  16.690  17.970  1.00 63.71  ? 272  CYS A CA  1 
ATOM   2046 C C   . CYS A 1 272 ? 57.417  17.299  18.058  1.00 61.38  ? 272  CYS A C   1 
ATOM   2047 O O   . CYS A 1 272 ? 57.250  18.381  18.626  1.00 61.60  ? 272  CYS A O   1 
ATOM   2048 C CB  . CYS A 1 272 ? 59.425  16.849  16.575  1.00 65.22  ? 272  CYS A CB  1 
ATOM   2049 S SG  . CYS A 1 272 ? 59.591  18.550  16.004  1.00 68.81  ? 272  CYS A SG  1 
ATOM   2050 N N   . LEU A 1 273 ? 56.410  16.607  17.512  1.00 59.11  ? 273  LEU A N   1 
ATOM   2051 C CA  . LEU A 1 273 ? 55.023  17.049  17.628  1.00 56.25  ? 273  LEU A CA  1 
ATOM   2052 C C   . LEU A 1 273 ? 54.632  17.238  19.086  1.00 55.68  ? 273  LEU A C   1 
ATOM   2053 O O   . LEU A 1 273 ? 53.963  18.212  19.439  1.00 55.01  ? 273  LEU A O   1 
ATOM   2054 C CB  . LEU A 1 273 ? 54.070  16.051  16.975  1.00 54.63  ? 273  LEU A CB  1 
ATOM   2055 C CG  . LEU A 1 273 ? 53.935  16.110  15.453  1.00 53.73  ? 273  LEU A CG  1 
ATOM   2056 C CD1 . LEU A 1 273 ? 53.047  14.981  14.945  1.00 50.85  ? 273  LEU A CD1 1 
ATOM   2057 C CD2 . LEU A 1 273 ? 53.393  17.453  15.001  1.00 52.00  ? 273  LEU A CD2 1 
ATOM   2058 N N   . ARG A 1 274 ? 55.068  16.318  19.942  1.00 55.84  ? 274  ARG A N   1 
ATOM   2059 C CA  . ARG A 1 274 ? 54.765  16.418  21.366  1.00 55.06  ? 274  ARG A CA  1 
ATOM   2060 C C   . ARG A 1 274 ? 55.399  17.634  22.023  1.00 56.13  ? 274  ARG A C   1 
ATOM   2061 O O   . ARG A 1 274 ? 55.007  18.010  23.112  1.00 56.22  ? 274  ARG A O   1 
ATOM   2062 C CB  . ARG A 1 274 ? 55.170  15.151  22.104  1.00 54.95  ? 274  ARG A CB  1 
ATOM   2063 C CG  . ARG A 1 274 ? 54.288  13.973  21.799  1.00 54.24  ? 274  ARG A CG  1 
ATOM   2064 C CD  . ARG A 1 274 ? 54.391  12.880  22.859  1.00 55.59  ? 274  ARG A CD  1 
ATOM   2065 N NE  . ARG A 1 274 ? 55.789  12.568  23.154  1.00 59.64  ? 274  ARG A NE  1 
ATOM   2066 C CZ  . ARG A 1 274 ? 56.488  11.589  22.585  1.00 58.95  ? 274  ARG A CZ  1 
ATOM   2067 N NH1 . ARG A 1 274 ? 55.912  10.799  21.691  1.00 58.82  ? 274  ARG A NH1 1 
ATOM   2068 N NH2 . ARG A 1 274 ? 57.759  11.405  22.920  1.00 58.64  ? 274  ARG A NH2 1 
ATOM   2069 N N   . THR A 1 275 ? 56.381  18.253  21.381  1.00 57.83  ? 275  THR A N   1 
ATOM   2070 C CA  . THR A 1 275 ? 56.993  19.428  21.977  1.00 59.29  ? 275  THR A CA  1 
ATOM   2071 C C   . THR A 1 275 ? 56.255  20.672  21.537  1.00 58.65  ? 275  THR A C   1 
ATOM   2072 O O   . THR A 1 275 ? 56.545  21.746  22.026  1.00 60.28  ? 275  THR A O   1 
ATOM   2073 C CB  . THR A 1 275 ? 58.493  19.597  21.625  1.00 61.58  ? 275  THR A CB  1 
ATOM   2074 O OG1 . THR A 1 275 ? 58.620  19.966  20.255  1.00 63.11  ? 275  THR A OG1 1 
ATOM   2075 C CG2 . THR A 1 275 ? 59.279  18.334  21.856  1.00 62.51  ? 275  THR A CG2 1 
ATOM   2076 N N   . ARG A 1 276 ? 55.304  20.533  20.619  1.00 57.18  ? 276  ARG A N   1 
ATOM   2077 C CA  . ARG A 1 276 ? 54.627  21.686  20.025  1.00 56.59  ? 276  ARG A CA  1 
ATOM   2078 C C   . ARG A 1 276 ? 53.418  22.121  20.834  1.00 55.43  ? 276  ARG A C   1 
ATOM   2079 O O   . ARG A 1 276 ? 52.652  21.281  21.298  1.00 54.84  ? 276  ARG A O   1 
ATOM   2080 C CB  . ARG A 1 276 ? 54.224  21.394  18.576  1.00 55.65  ? 276  ARG A CB  1 
ATOM   2081 C CG  . ARG A 1 276 ? 55.389  21.404  17.595  1.00 58.25  ? 276  ARG A CG  1 
ATOM   2082 C CD  . ARG A 1 276 ? 56.114  22.755  17.619  1.00 63.24  ? 276  ARG A CD  1 
ATOM   2083 N NE  . ARG A 1 276 ? 57.379  22.709  16.885  1.00 68.95  ? 276  ARG A NE  1 
ATOM   2084 C CZ  . ARG A 1 276 ? 58.577  22.431  17.414  1.00 72.17  ? 276  ARG A CZ  1 
ATOM   2085 N NH1 . ARG A 1 276 ? 58.706  22.173  18.715  1.00 71.55  ? 276  ARG A NH1 1 
ATOM   2086 N NH2 . ARG A 1 276 ? 59.664  22.424  16.631  1.00 74.18  ? 276  ARG A NH2 1 
ATOM   2087 N N   . PRO A 1 277 ? 53.243  23.437  21.024  1.00 55.84  ? 277  PRO A N   1 
ATOM   2088 C CA  . PRO A 1 277 ? 52.081  23.929  21.765  1.00 54.73  ? 277  PRO A CA  1 
ATOM   2089 C C   . PRO A 1 277 ? 50.789  23.387  21.156  1.00 53.17  ? 277  PRO A C   1 
ATOM   2090 O O   . PRO A 1 277 ? 50.695  23.243  19.937  1.00 53.25  ? 277  PRO A O   1 
ATOM   2091 C CB  . PRO A 1 277 ? 52.151  25.448  21.557  1.00 55.46  ? 277  PRO A CB  1 
ATOM   2092 C CG  . PRO A 1 277 ? 53.589  25.736  21.293  1.00 57.42  ? 277  PRO A CG  1 
ATOM   2093 C CD  . PRO A 1 277 ? 54.135  24.529  20.589  1.00 57.44  ? 277  PRO A CD  1 
ATOM   2094 N N   . ALA A 1 278 ? 49.787  23.105  21.973  1.00 52.17  ? 278  ALA A N   1 
ATOM   2095 C CA  . ALA A 1 278 ? 48.552  22.575  21.423  1.00 50.95  ? 278  ALA A CA  1 
ATOM   2096 C C   . ALA A 1 278 ? 47.907  23.505  20.367  1.00 50.94  ? 278  ALA A C   1 
ATOM   2097 O O   . ALA A 1 278 ? 47.380  23.027  19.349  1.00 49.85  ? 278  ALA A O   1 
ATOM   2098 C CB  . ALA A 1 278 ? 47.582  22.233  22.535  1.00 50.33  ? 278  ALA A CB  1 
ATOM   2099 N N   . GLN A 1 279 ? 47.969  24.821  20.599  1.00 51.91  ? 279  GLN A N   1 
ATOM   2100 C CA  . GLN A 1 279 ? 47.350  25.787  19.697  1.00 51.85  ? 279  GLN A CA  1 
ATOM   2101 C C   . GLN A 1 279 ? 47.984  25.768  18.305  1.00 52.96  ? 279  GLN A C   1 
ATOM   2102 O O   . GLN A 1 279 ? 47.297  26.000  17.307  1.00 52.73  ? 279  GLN A O   1 
ATOM   2103 C CB  . GLN A 1 279 ? 47.393  27.190  20.297  1.00 53.28  ? 279  GLN A CB  1 
ATOM   2104 C CG  . GLN A 1 279 ? 46.476  28.213  19.631  1.00 52.54  ? 279  GLN A CG  1 
ATOM   2105 C CD  . GLN A 1 279 ? 45.037  27.743  19.529  1.00 51.28  ? 279  GLN A CD  1 
ATOM   2106 O OE1 . GLN A 1 279 ? 44.415  27.330  20.524  1.00 49.71  ? 279  GLN A OE1 1 
ATOM   2107 N NE2 . GLN A 1 279 ? 44.494  27.804  18.315  1.00 50.13  ? 279  GLN A NE2 1 
ATOM   2108 N N   . ASP A 1 280 ? 49.284  25.482  18.233  1.00 54.61  ? 280  ASP A N   1 
ATOM   2109 C CA  . ASP A 1 280 ? 49.955  25.284  16.940  1.00 55.51  ? 280  ASP A CA  1 
ATOM   2110 C C   . ASP A 1 280 ? 49.386  24.120  16.144  1.00 53.69  ? 280  ASP A C   1 
ATOM   2111 O O   . ASP A 1 280 ? 49.187  24.250  14.941  1.00 53.60  ? 280  ASP A O   1 
ATOM   2112 C CB  . ASP A 1 280 ? 51.469  25.141  17.099  1.00 57.53  ? 280  ASP A CB  1 
ATOM   2113 C CG  . ASP A 1 280 ? 52.119  26.441  17.485  1.00 61.60  ? 280  ASP A CG  1 
ATOM   2114 O OD1 . ASP A 1 280 ? 51.380  27.387  17.848  1.00 64.34  ? 280  ASP A OD1 1 
ATOM   2115 O OD2 . ASP A 1 280 ? 53.361  26.534  17.431  1.00 65.09  ? 280  ASP A OD2 1 
ATOM   2116 N N   . LEU A 1 281 ? 49.099  22.997  16.794  1.00 52.10  ? 281  LEU A N   1 
ATOM   2117 C CA  . LEU A 1 281 ? 48.526  21.890  16.042  1.00 51.16  ? 281  LEU A CA  1 
ATOM   2118 C C   . LEU A 1 281 ? 47.160  22.290  15.491  1.00 50.23  ? 281  LEU A C   1 
ATOM   2119 O O   . LEU A 1 281 ? 46.881  22.114  14.295  1.00 50.16  ? 281  LEU A O   1 
ATOM   2120 C CB  . LEU A 1 281 ? 48.464  20.603  16.863  1.00 50.58  ? 281  LEU A CB  1 
ATOM   2121 C CG  . LEU A 1 281 ? 49.784  20.139  17.495  1.00 51.24  ? 281  LEU A CG  1 
ATOM   2122 C CD1 . LEU A 1 281 ? 49.659  18.712  17.957  1.00 51.57  ? 281  LEU A CD1 1 
ATOM   2123 C CD2 . LEU A 1 281 ? 50.941  20.252  16.540  1.00 51.95  ? 281  LEU A CD2 1 
ATOM   2124 N N   . VAL A 1 282 ? 46.336  22.890  16.342  1.00 49.51  ? 282  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 282 ? 45.029  23.353  15.914  1.00 48.59  ? 282  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 282 ? 45.166  24.365  14.758  1.00 49.59  ? 282  VAL A C   1 
ATOM   2127 O O   . VAL A 1 282 ? 44.489  24.211  13.740  1.00 49.11  ? 282  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 282 ? 44.182  23.898  17.107  1.00 48.12  ? 282  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 282 ? 42.904  24.577  16.622  1.00 47.40  ? 282  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 282 ? 43.831  22.772  18.042  1.00 46.88  ? 282  VAL A CG2 1 
ATOM   2131 N N   . ASP A 1 283 ? 46.052  25.357  14.892  1.00 50.84  ? 283  ASP A N   1 
ATOM   2132 C CA  . ASP A 1 283 ? 46.252  26.348  13.824  1.00 52.40  ? 283  ASP A CA  1 
ATOM   2133 C C   . ASP A 1 283 ? 46.606  25.757  12.450  1.00 52.74  ? 283  ASP A C   1 
ATOM   2134 O O   . ASP A 1 283 ? 46.502  26.457  11.458  1.00 52.95  ? 283  ASP A O   1 
ATOM   2135 C CB  . ASP A 1 283 ? 47.330  27.389  14.189  1.00 54.33  ? 283  ASP A CB  1 
ATOM   2136 C CG  . ASP A 1 283 ? 46.922  28.321  15.342  1.00 55.16  ? 283  ASP A CG  1 
ATOM   2137 O OD1 . ASP A 1 283 ? 45.749  28.317  15.778  1.00 52.03  ? 283  ASP A OD1 1 
ATOM   2138 O OD2 . ASP A 1 283 ? 47.816  29.058  15.827  1.00 58.59  ? 283  ASP A OD2 1 
ATOM   2139 N N   . HIS A 1 284 ? 47.028  24.491  12.382  1.00 53.08  ? 284  HIS A N   1 
ATOM   2140 C CA  . HIS A 1 284 ? 47.522  23.925  11.114  1.00 54.02  ? 284  HIS A CA  1 
ATOM   2141 C C   . HIS A 1 284 ? 46.750  22.727  10.609  1.00 53.54  ? 284  HIS A C   1 
ATOM   2142 O O   . HIS A 1 284 ? 46.858  22.365  9.458   1.00 53.86  ? 284  HIS A O   1 
ATOM   2143 C CB  . HIS A 1 284 ? 49.011  23.602  11.196  1.00 55.44  ? 284  HIS A CB  1 
ATOM   2144 C CG  . HIS A 1 284 ? 49.884  24.813  11.215  1.00 56.49  ? 284  HIS A CG  1 
ATOM   2145 N ND1 . HIS A 1 284 ? 50.207  25.509  10.070  1.00 57.45  ? 284  HIS A ND1 1 
ATOM   2146 C CD2 . HIS A 1 284 ? 50.487  25.462  12.238  1.00 56.10  ? 284  HIS A CD2 1 
ATOM   2147 C CE1 . HIS A 1 284 ? 50.969  26.538  10.388  1.00 59.07  ? 284  HIS A CE1 1 
ATOM   2148 N NE2 . HIS A 1 284 ? 51.168  26.521  11.695  1.00 58.82  ? 284  HIS A NE2 1 
ATOM   2149 N N   . GLU A 1 285 ? 45.979  22.119  11.492  1.00 53.69  ? 285  GLU A N   1 
ATOM   2150 C CA  . GLU A 1 285 ? 44.989  21.082  11.177  1.00 53.87  ? 285  GLU A CA  1 
ATOM   2151 C C   . GLU A 1 285 ? 44.266  21.112  9.801   1.00 54.37  ? 285  GLU A C   1 
ATOM   2152 O O   . GLU A 1 285 ? 44.215  20.097  9.121   1.00 54.10  ? 285  GLU A O   1 
ATOM   2153 C CB  . GLU A 1 285 ? 43.931  21.188  12.243  1.00 52.69  ? 285  GLU A CB  1 
ATOM   2154 C CG  . GLU A 1 285 ? 43.579  19.915  12.844  1.00 54.10  ? 285  GLU A CG  1 
ATOM   2155 C CD  . GLU A 1 285 ? 42.355  20.041  13.698  1.00 54.34  ? 285  GLU A CD  1 
ATOM   2156 O OE1 . GLU A 1 285 ? 41.874  21.170  13.928  1.00 54.34  ? 285  GLU A OE1 1 
ATOM   2157 O OE2 . GLU A 1 285 ? 41.870  18.986  14.125  1.00 56.43  ? 285  GLU A OE2 1 
ATOM   2158 N N   . TRP A 1 286 ? 43.687  22.259  9.419   1.00 55.66  ? 286  TRP A N   1 
ATOM   2159 C CA  . TRP A 1 286 ? 42.850  22.399  8.195   1.00 56.82  ? 286  TRP A CA  1 
ATOM   2160 C C   . TRP A 1 286 ? 43.688  22.252  6.919   1.00 57.43  ? 286  TRP A C   1 
ATOM   2161 O O   . TRP A 1 286 ? 43.161  21.947  5.847   1.00 57.92  ? 286  TRP A O   1 
ATOM   2162 C CB  . TRP A 1 286 ? 42.135  23.777  8.195   1.00 57.78  ? 286  TRP A CB  1 
ATOM   2163 C CG  . TRP A 1 286 ? 41.156  24.118  7.012   1.00 62.99  ? 286  TRP A CG  1 
ATOM   2164 C CD1 . TRP A 1 286 ? 39.819  23.758  6.902   1.00 65.19  ? 286  TRP A CD1 1 
ATOM   2165 C CD2 . TRP A 1 286 ? 41.437  24.918  5.833   1.00 68.28  ? 286  TRP A CD2 1 
ATOM   2166 N NE1 . TRP A 1 286 ? 39.272  24.268  5.740   1.00 66.33  ? 286  TRP A NE1 1 
ATOM   2167 C CE2 . TRP A 1 286 ? 40.234  24.976  5.062   1.00 69.30  ? 286  TRP A CE2 1 
ATOM   2168 C CE3 . TRP A 1 286 ? 42.586  25.580  5.347   1.00 72.45  ? 286  TRP A CE3 1 
ATOM   2169 C CZ2 . TRP A 1 286 ? 40.153  25.675  3.823   1.00 72.29  ? 286  TRP A CZ2 1 
ATOM   2170 C CZ3 . TRP A 1 286 ? 42.509  26.281  4.101   1.00 74.66  ? 286  TRP A CZ3 1 
ATOM   2171 C CH2 . TRP A 1 286 ? 41.294  26.319  3.363   1.00 74.86  ? 286  TRP A CH2 1 
ATOM   2172 N N   . HIS A 1 287 ? 44.994  22.454  7.043   1.00 57.77  ? 287  HIS A N   1 
ATOM   2173 C CA  . HIS A 1 287 ? 45.872  22.494  5.893   1.00 58.47  ? 287  HIS A CA  1 
ATOM   2174 C C   . HIS A 1 287 ? 46.340  21.157  5.323   1.00 58.04  ? 287  HIS A C   1 
ATOM   2175 O O   . HIS A 1 287 ? 47.071  21.144  4.326   1.00 58.74  ? 287  HIS A O   1 
ATOM   2176 C CB  . HIS A 1 287 ? 47.072  23.368  6.221   1.00 60.17  ? 287  HIS A CB  1 
ATOM   2177 C CG  . HIS A 1 287 ? 46.697  24.778  6.533   1.00 62.64  ? 287  HIS A CG  1 
ATOM   2178 N ND1 . HIS A 1 287 ? 47.083  25.414  7.694   1.00 65.27  ? 287  HIS A ND1 1 
ATOM   2179 C CD2 . HIS A 1 287 ? 45.938  25.667  5.850   1.00 64.35  ? 287  HIS A CD2 1 
ATOM   2180 C CE1 . HIS A 1 287 ? 46.597  26.641  7.704   1.00 66.24  ? 287  HIS A CE1 1 
ATOM   2181 N NE2 . HIS A 1 287 ? 45.891  26.817  6.600   1.00 67.26  ? 287  HIS A NE2 1 
ATOM   2182 N N   . VAL A 1 288 ? 45.934  20.042  5.930   1.00 56.26  ? 288  VAL A N   1 
ATOM   2183 C CA  . VAL A 1 288 ? 46.395  18.746  5.436   1.00 56.13  ? 288  VAL A CA  1 
ATOM   2184 C C   . VAL A 1 288 ? 45.408  18.014  4.523   1.00 55.40  ? 288  VAL A C   1 
ATOM   2185 O O   . VAL A 1 288 ? 45.719  16.919  4.074   1.00 55.93  ? 288  VAL A O   1 
ATOM   2186 C CB  . VAL A 1 288 ? 46.876  17.799  6.565   1.00 56.03  ? 288  VAL A CB  1 
ATOM   2187 C CG1 . VAL A 1 288 ? 47.881  18.502  7.457   1.00 56.71  ? 288  VAL A CG1 1 
ATOM   2188 C CG2 . VAL A 1 288 ? 45.702  17.256  7.377   1.00 53.87  ? 288  VAL A CG2 1 
ATOM   2189 N N   . LEU A 1 289 ? 44.241  18.602  4.242   1.00 53.96  ? 289  LEU A N   1 
ATOM   2190 C CA  . LEU A 1 289 ? 43.230  17.933  3.391   1.00 53.28  ? 289  LEU A CA  1 
ATOM   2191 C C   . LEU A 1 289 ? 43.684  17.859  1.935   1.00 54.26  ? 289  LEU A C   1 
ATOM   2192 O O   . LEU A 1 289 ? 44.334  18.774  1.454   1.00 55.06  ? 289  LEU A O   1 
ATOM   2193 C CB  . LEU A 1 289 ? 41.866  18.625  3.482   1.00 51.83  ? 289  LEU A CB  1 
ATOM   2194 C CG  . LEU A 1 289 ? 41.055  18.347  4.758   1.00 50.94  ? 289  LEU A CG  1 
ATOM   2195 C CD1 . LEU A 1 289 ? 39.928  19.354  4.902   1.00 47.43  ? 289  LEU A CD1 1 
ATOM   2196 C CD2 . LEU A 1 289 ? 40.563  16.847  4.892   1.00 48.09  ? 289  LEU A CD2 1 
ATOM   2197 N N   . PRO A 1 290 ? 43.370  16.759  1.241   1.00 54.17  ? 290  PRO A N   1 
ATOM   2198 C CA  . PRO A 1 290 ? 43.915  16.629  -0.110  1.00 55.71  ? 290  PRO A CA  1 
ATOM   2199 C C   . PRO A 1 290 ? 43.233  17.484  -1.200  1.00 55.90  ? 290  PRO A C   1 
ATOM   2200 O O   . PRO A 1 290 ? 43.807  17.675  -2.261  1.00 57.39  ? 290  PRO A O   1 
ATOM   2201 C CB  . PRO A 1 290 ? 43.777  15.128  -0.404  1.00 55.73  ? 290  PRO A CB  1 
ATOM   2202 C CG  . PRO A 1 290 ? 42.696  14.661  0.501   1.00 54.24  ? 290  PRO A CG  1 
ATOM   2203 C CD  . PRO A 1 290 ? 42.828  15.487  1.743   1.00 53.39  ? 290  PRO A CD  1 
ATOM   2204 N N   . GLN A 1 291 ? 42.029  17.977  -0.956  1.00 55.08  ? 291  GLN A N   1 
ATOM   2205 C CA  . GLN A 1 291 ? 41.316  18.794  -1.938  1.00 56.06  ? 291  GLN A CA  1 
ATOM   2206 C C   . GLN A 1 291 ? 40.548  19.879  -1.195  1.00 55.44  ? 291  GLN A C   1 
ATOM   2207 O O   . GLN A 1 291 ? 40.272  19.727  -0.014  1.00 54.55  ? 291  GLN A O   1 
ATOM   2208 C CB  . GLN A 1 291 ? 40.308  17.967  -2.759  1.00 55.83  ? 291  GLN A CB  1 
ATOM   2209 C CG  . GLN A 1 291 ? 40.808  16.673  -3.369  1.00 57.74  ? 291  GLN A CG  1 
ATOM   2210 C CD  . GLN A 1 291 ? 40.688  15.482  -2.405  1.00 59.73  ? 291  GLN A CD  1 
ATOM   2211 O OE1 . GLN A 1 291 ? 40.001  15.554  -1.367  1.00 58.91  ? 291  GLN A OE1 1 
ATOM   2212 N NE2 . GLN A 1 291 ? 41.364  14.380  -2.741  1.00 60.28  ? 291  GLN A NE2 1 
ATOM   2213 N N   . GLU A 1 292 ? 40.208  20.972  -1.882  1.00 56.31  ? 292  GLU A N   1 
ATOM   2214 C CA  . GLU A 1 292 ? 39.224  21.913  -1.381  1.00 56.04  ? 292  GLU A CA  1 
ATOM   2215 C C   . GLU A 1 292 ? 37.987  21.047  -1.168  1.00 54.81  ? 292  GLU A C   1 
ATOM   2216 O O   . GLU A 1 292 ? 37.695  20.200  -2.011  1.00 55.04  ? 292  GLU A O   1 
ATOM   2217 C CB  . GLU A 1 292 ? 38.975  23.008  -2.421  1.00 57.44  ? 292  GLU A CB  1 
ATOM   2218 C CG  . GLU A 1 292 ? 37.949  24.091  -2.023  1.00 60.45  ? 292  GLU A CG  1 
ATOM   2219 C CD  . GLU A 1 292 ? 37.838  25.233  -3.053  1.00 66.67  ? 292  GLU A CD  1 
ATOM   2220 O OE1 . GLU A 1 292 ? 38.662  25.280  -4.005  1.00 69.19  ? 292  GLU A OE1 1 
ATOM   2221 O OE2 . GLU A 1 292 ? 36.924  26.094  -2.913  1.00 68.07  ? 292  GLU A OE2 1 
ATOM   2222 N N   . SER A 1 293 ? 37.297  21.188  -0.034  1.00 53.46  ? 293  SER A N   1 
ATOM   2223 C CA  . SER A 1 293 ? 36.180  20.268  0.241   1.00 52.95  ? 293  SER A CA  1 
ATOM   2224 C C   . SER A 1 293 ? 35.266  20.662  1.397   1.00 52.32  ? 293  SER A C   1 
ATOM   2225 O O   . SER A 1 293 ? 35.597  21.542  2.183   1.00 52.83  ? 293  SER A O   1 
ATOM   2226 C CB  . SER A 1 293 ? 36.677  18.831  0.437   1.00 52.40  ? 293  SER A CB  1 
ATOM   2227 O OG  . SER A 1 293 ? 37.572  18.736  1.519   1.00 52.27  ? 293  SER A OG  1 
ATOM   2228 N N   . ILE A 1 294 ? 34.100  20.024  1.471   1.00 51.44  ? 294  ILE A N   1 
ATOM   2229 C CA  . ILE A 1 294 ? 33.236  20.158  2.636   1.00 50.12  ? 294  ILE A CA  1 
ATOM   2230 C C   . ILE A 1 294 ? 32.832  18.783  3.111   1.00 49.01  ? 294  ILE A C   1 
ATOM   2231 O O   . ILE A 1 294 ? 32.890  17.804  2.351   1.00 48.73  ? 294  ILE A O   1 
ATOM   2232 C CB  . ILE A 1 294 ? 31.954  20.955  2.357   1.00 50.90  ? 294  ILE A CB  1 
ATOM   2233 C CG1 . ILE A 1 294 ? 31.105  20.269  1.302   1.00 50.67  ? 294  ILE A CG1 1 
ATOM   2234 C CG2 . ILE A 1 294 ? 32.260  22.425  1.975   1.00 52.59  ? 294  ILE A CG2 1 
ATOM   2235 C CD1 . ILE A 1 294 ? 29.710  20.627  1.460   1.00 53.13  ? 294  ILE A CD1 1 
ATOM   2236 N N   . PHE A 1 295 ? 32.434  18.721  4.379   1.00 47.33  ? 295  PHE A N   1 
ATOM   2237 C CA  . PHE A 1 295 ? 32.100  17.471  5.024   1.00 46.13  ? 295  PHE A CA  1 
ATOM   2238 C C   . PHE A 1 295 ? 33.287  16.495  4.905   1.00 45.83  ? 295  PHE A C   1 
ATOM   2239 O O   . PHE A 1 295 ? 33.119  15.277  4.718   1.00 45.81  ? 295  PHE A O   1 
ATOM   2240 C CB  . PHE A 1 295 ? 30.791  16.899  4.457   1.00 46.16  ? 295  PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 295 ? 29.919  16.251  5.499   1.00 48.26  ? 295  PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 295 ? 30.455  15.311  6.414   1.00 49.08  ? 295  PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 295 ? 28.566  16.543  5.569   1.00 47.91  ? 295  PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 295 ? 29.661  14.722  7.382   1.00 46.45  ? 295  PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 295 ? 27.763  15.924  6.533   1.00 46.96  ? 295  PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 295 ? 28.317  15.039  7.443   1.00 46.52  ? 295  PHE A CZ  1 
ATOM   2247 N N   . ARG A 1 296 ? 34.491  17.059  4.984   1.00 45.00  ? 296  ARG A N   1 
ATOM   2248 C CA  . ARG A 1 296 ? 35.718  16.277  5.200   1.00 44.72  ? 296  ARG A CA  1 
ATOM   2249 C C   . ARG A 1 296 ? 36.509  16.924  6.338   1.00 43.86  ? 296  ARG A C   1 
ATOM   2250 O O   . ARG A 1 296 ? 36.521  18.169  6.493   1.00 44.13  ? 296  ARG A O   1 
ATOM   2251 C CB  . ARG A 1 296 ? 36.581  16.208  3.935   1.00 45.42  ? 296  ARG A CB  1 
ATOM   2252 C CG  . ARG A 1 296 ? 35.921  15.576  2.729   1.00 45.84  ? 296  ARG A CG  1 
ATOM   2253 C CD  . ARG A 1 296 ? 35.743  14.068  2.896   1.00 45.84  ? 296  ARG A CD  1 
ATOM   2254 N NE  . ARG A 1 296 ? 35.225  13.437  1.678   1.00 46.29  ? 296  ARG A NE  1 
ATOM   2255 C CZ  . ARG A 1 296 ? 33.934  13.384  1.351   1.00 46.43  ? 296  ARG A CZ  1 
ATOM   2256 N NH1 . ARG A 1 296 ? 33.021  13.938  2.138   1.00 46.54  ? 296  ARG A NH1 1 
ATOM   2257 N NH2 . ARG A 1 296 ? 33.552  12.785  0.231   1.00 46.88  ? 296  ARG A NH2 1 
ATOM   2258 N N   . PHE A 1 297 ? 37.175  16.090  7.121   1.00 42.21  ? 297  PHE A N   1 
ATOM   2259 C CA  . PHE A 1 297 ? 37.832  16.533  8.327   1.00 41.22  ? 297  PHE A CA  1 
ATOM   2260 C C   . PHE A 1 297 ? 39.215  15.881  8.394   1.00 42.30  ? 297  PHE A C   1 
ATOM   2261 O O   . PHE A 1 297 ? 39.373  14.696  8.036   1.00 42.99  ? 297  PHE A O   1 
ATOM   2262 C CB  . PHE A 1 297 ? 36.978  16.173  9.564   1.00 40.07  ? 297  PHE A CB  1 
ATOM   2263 C CG  . PHE A 1 297 ? 35.492  16.444  9.398   1.00 40.10  ? 297  PHE A CG  1 
ATOM   2264 C CD1 . PHE A 1 297 ? 34.987  17.765  9.406   1.00 40.16  ? 297  PHE A CD1 1 
ATOM   2265 C CD2 . PHE A 1 297 ? 34.592  15.395  9.232   1.00 37.91  ? 297  PHE A CD2 1 
ATOM   2266 C CE1 . PHE A 1 297 ? 33.633  18.003  9.257   1.00 37.95  ? 297  PHE A CE1 1 
ATOM   2267 C CE2 . PHE A 1 297 ? 33.229  15.643  9.069   1.00 35.62  ? 297  PHE A CE2 1 
ATOM   2268 C CZ  . PHE A 1 297 ? 32.750  16.937  9.083   1.00 35.40  ? 297  PHE A CZ  1 
ATOM   2269 N N   . SER A 1 298 ? 40.210  16.624  8.883   1.00 42.51  ? 298  SER A N   1 
ATOM   2270 C CA  . SER A 1 298 ? 41.609  16.208  8.724   1.00 43.58  ? 298  SER A CA  1 
ATOM   2271 C C   . SER A 1 298 ? 41.988  14.959  9.501   1.00 43.74  ? 298  SER A C   1 
ATOM   2272 O O   . SER A 1 298 ? 42.668  14.079  8.969   1.00 45.66  ? 298  SER A O   1 
ATOM   2273 C CB  . SER A 1 298 ? 42.560  17.335  9.092   1.00 44.04  ? 298  SER A CB  1 
ATOM   2274 O OG  . SER A 1 298 ? 42.138  18.557  8.504   1.00 45.25  ? 298  SER A OG  1 
ATOM   2275 N N   . PHE A 1 299 ? 41.565  14.871  10.756  1.00 42.63  ? 299  PHE A N   1 
ATOM   2276 C CA  . PHE A 1 299 ? 42.025  13.801  11.634  1.00 42.06  ? 299  PHE A CA  1 
ATOM   2277 C C   . PHE A 1 299 ? 40.829  13.020  12.167  1.00 41.43  ? 299  PHE A C   1 
ATOM   2278 O O   . PHE A 1 299 ? 40.059  13.540  12.975  1.00 42.22  ? 299  PHE A O   1 
ATOM   2279 C CB  . PHE A 1 299 ? 42.935  14.395  12.723  1.00 41.69  ? 299  PHE A CB  1 
ATOM   2280 C CG  . PHE A 1 299 ? 44.204  14.975  12.157  1.00 41.37  ? 299  PHE A CG  1 
ATOM   2281 C CD1 . PHE A 1 299 ? 45.240  14.145  11.754  1.00 41.51  ? 299  PHE A CD1 1 
ATOM   2282 C CD2 . PHE A 1 299 ? 44.329  16.343  11.939  1.00 41.42  ? 299  PHE A CD2 1 
ATOM   2283 C CE1 . PHE A 1 299 ? 46.404  14.666  11.172  1.00 42.41  ? 299  PHE A CE1 1 
ATOM   2284 C CE2 . PHE A 1 299 ? 45.488  16.875  11.351  1.00 41.77  ? 299  PHE A CE2 1 
ATOM   2285 C CZ  . PHE A 1 299 ? 46.533  16.027  10.971  1.00 41.24  ? 299  PHE A CZ  1 
ATOM   2286 N N   . VAL A 1 300 ? 40.651  11.806  11.661  1.00 40.46  ? 300  VAL A N   1 
ATOM   2287 C CA  . VAL A 1 300 ? 39.447  11.000  11.868  1.00 39.29  ? 300  VAL A CA  1 
ATOM   2288 C C   . VAL A 1 300 ? 39.853  9.526   12.083  1.00 39.86  ? 300  VAL A C   1 
ATOM   2289 O O   . VAL A 1 300 ? 41.016  9.186   11.916  1.00 40.63  ? 300  VAL A O   1 
ATOM   2290 C CB  . VAL A 1 300 ? 38.469  11.149  10.660  1.00 39.45  ? 300  VAL A CB  1 
ATOM   2291 C CG1 . VAL A 1 300 ? 38.117  12.666  10.380  1.00 39.02  ? 300  VAL A CG1 1 
ATOM   2292 C CG2 . VAL A 1 300 ? 39.037  10.536  9.409   1.00 39.55  ? 300  VAL A CG2 1 
ATOM   2293 N N   . PRO A 1 301 ? 38.919  8.648   12.481  1.00 39.66  ? 301  PRO A N   1 
ATOM   2294 C CA  . PRO A 1 301 ? 39.325  7.254   12.685  1.00 40.53  ? 301  PRO A CA  1 
ATOM   2295 C C   . PRO A 1 301 ? 40.131  6.706   11.514  1.00 42.22  ? 301  PRO A C   1 
ATOM   2296 O O   . PRO A 1 301 ? 39.796  6.969   10.349  1.00 43.19  ? 301  PRO A O   1 
ATOM   2297 C CB  . PRO A 1 301 ? 37.998  6.533   12.830  1.00 39.78  ? 301  PRO A CB  1 
ATOM   2298 C CG  . PRO A 1 301 ? 37.143  7.542   13.561  1.00 39.05  ? 301  PRO A CG  1 
ATOM   2299 C CD  . PRO A 1 301 ? 37.579  8.905   13.039  1.00 39.04  ? 301  PRO A CD  1 
ATOM   2300 N N   . VAL A 1 302 ? 41.220  6.009   11.807  1.00 42.92  ? 302  VAL A N   1 
ATOM   2301 C CA  . VAL A 1 302 ? 41.993  5.386   10.752  1.00 44.73  ? 302  VAL A CA  1 
ATOM   2302 C C   . VAL A 1 302 ? 41.709  3.884   10.755  1.00 46.69  ? 302  VAL A C   1 
ATOM   2303 O O   . VAL A 1 302 ? 41.548  3.264   11.824  1.00 46.80  ? 302  VAL A O   1 
ATOM   2304 C CB  . VAL A 1 302 ? 43.513  5.653   10.902  1.00 45.33  ? 302  VAL A CB  1 
ATOM   2305 C CG1 . VAL A 1 302 ? 44.002  5.253   12.267  1.00 45.99  ? 302  VAL A CG1 1 
ATOM   2306 C CG2 . VAL A 1 302 ? 44.297  4.905   9.865   1.00 45.96  ? 302  VAL A CG2 1 
ATOM   2307 N N   . VAL A 1 303 ? 41.650  3.304   9.560   1.00 48.16  ? 303  VAL A N   1 
ATOM   2308 C CA  . VAL A 1 303 ? 41.471  1.868   9.419   1.00 49.57  ? 303  VAL A CA  1 
ATOM   2309 C C   . VAL A 1 303 ? 42.831  1.274   9.705   1.00 51.53  ? 303  VAL A C   1 
ATOM   2310 O O   . VAL A 1 303 ? 43.664  1.124   8.803   1.00 53.01  ? 303  VAL A O   1 
ATOM   2311 C CB  . VAL A 1 303 ? 40.941  1.504   8.017   1.00 50.32  ? 303  VAL A CB  1 
ATOM   2312 C CG1 . VAL A 1 303 ? 40.889  -0.022  7.810   1.00 50.90  ? 303  VAL A CG1 1 
ATOM   2313 C CG2 . VAL A 1 303 ? 39.559  2.137   7.800   1.00 47.73  ? 303  VAL A CG2 1 
ATOM   2314 N N   . ASP A 1 304 ? 43.052  0.969   10.982  1.00 51.94  ? 304  ASP A N   1 
ATOM   2315 C CA  . ASP A 1 304 ? 44.372  0.597   11.484  1.00 53.38  ? 304  ASP A CA  1 
ATOM   2316 C C   . ASP A 1 304 ? 44.633  -0.894  11.513  1.00 55.07  ? 304  ASP A C   1 
ATOM   2317 O O   . ASP A 1 304 ? 45.752  -1.305  11.803  1.00 56.07  ? 304  ASP A O   1 
ATOM   2318 C CB  . ASP A 1 304 ? 44.599  1.170   12.886  1.00 52.57  ? 304  ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 304 ? 43.502  0.769   13.882  1.00 53.28  ? 304  ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 304 ? 42.451  0.215   13.454  1.00 52.20  ? 304  ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 304 ? 43.695  1.043   15.099  1.00 53.54  ? 304  ASP A OD2 1 
ATOM   2322 N N   . GLY A 1 305 ? 43.614  -1.696  11.213  1.00 55.65  ? 305  GLY A N   1 
ATOM   2323 C CA  . GLY A 1 305 ? 43.730  -3.157  11.324  1.00 58.27  ? 305  GLY A CA  1 
ATOM   2324 C C   . GLY A 1 305 ? 43.827  -3.570  12.788  1.00 59.01  ? 305  GLY A C   1 
ATOM   2325 O O   . GLY A 1 305 ? 44.394  -4.610  13.106  1.00 60.43  ? 305  GLY A O   1 
ATOM   2326 N N   . ASP A 1 306 ? 43.276  -2.730  13.671  1.00 57.59  ? 306  ASP A N   1 
ATOM   2327 C CA  . ASP A 1 306 ? 43.307  -2.932  15.119  1.00 57.96  ? 306  ASP A CA  1 
ATOM   2328 C C   . ASP A 1 306 ? 41.914  -2.654  15.717  1.00 56.35  ? 306  ASP A C   1 
ATOM   2329 O O   . ASP A 1 306 ? 41.105  -3.594  15.869  1.00 57.58  ? 306  ASP A O   1 
ATOM   2330 C CB  . ASP A 1 306 ? 44.376  -2.030  15.764  1.00 57.58  ? 306  ASP A CB  1 
ATOM   2331 C CG  . ASP A 1 306 ? 44.596  -2.325  17.263  1.00 58.95  ? 306  ASP A CG  1 
ATOM   2332 O OD1 . ASP A 1 306 ? 43.946  -3.249  17.834  1.00 59.18  ? 306  ASP A OD1 1 
ATOM   2333 O OD2 . ASP A 1 306 ? 45.442  -1.615  17.861  1.00 58.32  ? 306  ASP A OD2 1 
ATOM   2334 N N   . PHE A 1 307 ? 41.647  -1.387  16.054  1.00 53.43  ? 307  PHE A N   1 
ATOM   2335 C CA  . PHE A 1 307 ? 40.318  -0.957  16.477  1.00 51.72  ? 307  PHE A CA  1 
ATOM   2336 C C   . PHE A 1 307 ? 39.326  -1.347  15.398  1.00 52.01  ? 307  PHE A C   1 
ATOM   2337 O O   . PHE A 1 307 ? 38.236  -1.837  15.673  1.00 51.52  ? 307  PHE A O   1 
ATOM   2338 C CB  . PHE A 1 307 ? 40.268  0.568   16.670  1.00 50.05  ? 307  PHE A CB  1 
ATOM   2339 C CG  . PHE A 1 307 ? 39.110  1.030   17.494  1.00 47.53  ? 307  PHE A CG  1 
ATOM   2340 C CD1 . PHE A 1 307 ? 37.852  1.128   16.947  1.00 44.31  ? 307  PHE A CD1 1 
ATOM   2341 C CD2 . PHE A 1 307 ? 39.277  1.338   18.844  1.00 48.30  ? 307  PHE A CD2 1 
ATOM   2342 C CE1 . PHE A 1 307 ? 36.774  1.521   17.721  1.00 42.95  ? 307  PHE A CE1 1 
ATOM   2343 C CE2 . PHE A 1 307 ? 38.191  1.763   19.632  1.00 45.78  ? 307  PHE A CE2 1 
ATOM   2344 C CZ  . PHE A 1 307 ? 36.940  1.850   19.058  1.00 43.73  ? 307  PHE A CZ  1 
ATOM   2345 N N   . LEU A 1 308 ? 39.739  -1.100  14.157  1.00 52.64  ? 308  LEU A N   1 
ATOM   2346 C CA  . LEU A 1 308 ? 38.978  -1.405  12.968  1.00 52.55  ? 308  LEU A CA  1 
ATOM   2347 C C   . LEU A 1 308 ? 39.749  -2.452  12.179  1.00 54.78  ? 308  LEU A C   1 
ATOM   2348 O O   . LEU A 1 308 ? 40.734  -2.129  11.519  1.00 55.35  ? 308  LEU A O   1 
ATOM   2349 C CB  . LEU A 1 308 ? 38.815  -0.125  12.152  1.00 50.63  ? 308  LEU A CB  1 
ATOM   2350 C CG  . LEU A 1 308 ? 37.857  0.899   12.743  1.00 48.45  ? 308  LEU A CG  1 
ATOM   2351 C CD1 . LEU A 1 308 ? 37.753  2.176   11.863  1.00 45.01  ? 308  LEU A CD1 1 
ATOM   2352 C CD2 . LEU A 1 308 ? 36.492  0.244   12.934  1.00 47.35  ? 308  LEU A CD2 1 
ATOM   2353 N N   . SER A 1 309 ? 39.319  -3.711  12.248  1.00 56.50  ? 309  SER A N   1 
ATOM   2354 C CA  . SER A 1 309 ? 40.117  -4.780  11.666  1.00 58.95  ? 309  SER A CA  1 
ATOM   2355 C C   . SER A 1 309 ? 40.121  -4.702  10.150  1.00 59.69  ? 309  SER A C   1 
ATOM   2356 O O   . SER A 1 309 ? 40.981  -5.287  9.489   1.00 61.75  ? 309  SER A O   1 
ATOM   2357 C CB  . SER A 1 309 ? 39.687  -6.164  12.173  1.00 60.96  ? 309  SER A CB  1 
ATOM   2358 O OG  . SER A 1 309 ? 38.298  -6.369  12.028  1.00 62.24  ? 309  SER A OG  1 
ATOM   2359 N N   . ASP A 1 310 ? 39.163  -3.959  9.610   1.00 58.48  ? 310  ASP A N   1 
ATOM   2360 C CA  . ASP A 1 310 ? 39.060  -3.684  8.182   1.00 58.51  ? 310  ASP A CA  1 
ATOM   2361 C C   . ASP A 1 310 ? 38.302  -2.345  8.031   1.00 56.76  ? 310  ASP A C   1 
ATOM   2362 O O   . ASP A 1 310 ? 37.987  -1.687  9.027   1.00 54.77  ? 310  ASP A O   1 
ATOM   2363 C CB  . ASP A 1 310 ? 38.320  -4.838  7.494   1.00 59.66  ? 310  ASP A CB  1 
ATOM   2364 C CG  . ASP A 1 310 ? 38.679  -4.985  6.019   1.00 61.32  ? 310  ASP A CG  1 
ATOM   2365 O OD1 . ASP A 1 310 ? 38.959  -3.943  5.359   1.00 60.31  ? 310  ASP A OD1 1 
ATOM   2366 O OD2 . ASP A 1 310 ? 38.660  -6.141  5.519   1.00 58.74  ? 310  ASP A OD2 1 
ATOM   2367 N N   . THR A 1 311 ? 38.022  -1.936  6.798   1.00 57.11  ? 311  THR A N   1 
ATOM   2368 C CA  . THR A 1 311 ? 37.184  -0.768  6.543   1.00 55.87  ? 311  THR A CA  1 
ATOM   2369 C C   . THR A 1 311 ? 35.799  -1.001  7.120   1.00 55.77  ? 311  THR A C   1 
ATOM   2370 O O   . THR A 1 311 ? 35.360  -2.152  7.182   1.00 57.19  ? 311  THR A O   1 
ATOM   2371 C CB  . THR A 1 311 ? 37.002  -0.525  5.023   1.00 56.59  ? 311  THR A CB  1 
ATOM   2372 O OG1 . THR A 1 311 ? 36.073  -1.485  4.495   1.00 57.55  ? 311  THR A OG1 1 
ATOM   2373 C CG2 . THR A 1 311 ? 38.338  -0.625  4.267   1.00 57.23  ? 311  THR A CG2 1 
ATOM   2374 N N   . PRO A 1 312 ? 35.085  0.078   7.517   1.00 54.74  ? 312  PRO A N   1 
ATOM   2375 C CA  . PRO A 1 312 ? 33.712  -0.118  7.985   1.00 54.88  ? 312  PRO A CA  1 
ATOM   2376 C C   . PRO A 1 312 ? 32.812  -0.840  6.969   1.00 56.89  ? 312  PRO A C   1 
ATOM   2377 O O   . PRO A 1 312 ? 32.111  -1.789  7.352   1.00 57.76  ? 312  PRO A O   1 
ATOM   2378 C CB  . PRO A 1 312 ? 33.222  1.307   8.254   1.00 53.10  ? 312  PRO A CB  1 
ATOM   2379 C CG  . PRO A 1 312 ? 34.450  2.062   8.544   1.00 52.47  ? 312  PRO A CG  1 
ATOM   2380 C CD  . PRO A 1 312 ? 35.477  1.498   7.602   1.00 53.35  ? 312  PRO A CD  1 
ATOM   2381 N N   . GLU A 1 313 ? 32.853  -0.443  5.692   1.00 57.88  ? 313  GLU A N   1 
ATOM   2382 C CA  . GLU A 1 313 ? 32.034  -1.131  4.680   1.00 60.22  ? 313  GLU A CA  1 
ATOM   2383 C C   . GLU A 1 313 ? 32.329  -2.648  4.582   1.00 61.76  ? 313  GLU A C   1 
ATOM   2384 O O   . GLU A 1 313 ? 31.414  -3.447  4.412   1.00 62.86  ? 313  GLU A O   1 
ATOM   2385 C CB  . GLU A 1 313 ? 32.016  -0.415  3.304   1.00 60.77  ? 313  GLU A CB  1 
ATOM   2386 C CG  . GLU A 1 313 ? 33.173  -0.743  2.351   1.00 66.20  ? 313  GLU A CG  1 
ATOM   2387 C CD  . GLU A 1 313 ? 32.797  -0.662  0.845   1.00 71.87  ? 313  GLU A CD  1 
ATOM   2388 O OE1 . GLU A 1 313 ? 31.923  -1.451  0.389   1.00 73.89  ? 313  GLU A OE1 1 
ATOM   2389 O OE2 . GLU A 1 313 ? 33.411  0.168   0.113   1.00 72.86  ? 313  GLU A OE2 1 
ATOM   2390 N N   . ALA A 1 314 ? 33.582  -3.050  4.739   1.00 61.97  ? 314  ALA A N   1 
ATOM   2391 C CA  . ALA A 1 314 ? 33.889  -4.470  4.729   1.00 63.91  ? 314  ALA A CA  1 
ATOM   2392 C C   . ALA A 1 314 ? 33.241  -5.178  5.920   1.00 64.44  ? 314  ALA A C   1 
ATOM   2393 O O   . ALA A 1 314 ? 32.763  -6.307  5.802   1.00 66.43  ? 314  ALA A O   1 
ATOM   2394 C CB  . ALA A 1 314 ? 35.378  -4.696  4.709   1.00 64.27  ? 314  ALA A CB  1 
ATOM   2395 N N   . LEU A 1 315 ? 33.204  -4.505  7.067   1.00 63.32  ? 315  LEU A N   1 
ATOM   2396 C CA  . LEU A 1 315 ? 32.664  -5.108  8.294   1.00 63.35  ? 315  LEU A CA  1 
ATOM   2397 C C   . LEU A 1 315 ? 31.132  -5.122  8.349   1.00 63.83  ? 315  LEU A C   1 
ATOM   2398 O O   . LEU A 1 315 ? 30.542  -6.073  8.848   1.00 65.08  ? 315  LEU A O   1 
ATOM   2399 C CB  . LEU A 1 315 ? 33.269  -4.453  9.535   1.00 61.29  ? 315  LEU A CB  1 
ATOM   2400 C CG  . LEU A 1 315 ? 34.802  -4.436  9.543   1.00 60.86  ? 315  LEU A CG  1 
ATOM   2401 C CD1 . LEU A 1 315 ? 35.349  -3.347  10.463  1.00 56.84  ? 315  LEU A CD1 1 
ATOM   2402 C CD2 . LEU A 1 315 ? 35.407  -5.813  9.862   1.00 59.30  ? 315  LEU A CD2 1 
ATOM   2403 N N   . ILE A 1 316 ? 30.474  -4.082  7.837   1.00 63.49  ? 316  ILE A N   1 
ATOM   2404 C CA  . ILE A 1 316 ? 29.016  -4.161  7.722   1.00 64.40  ? 316  ILE A CA  1 
ATOM   2405 C C   . ILE A 1 316 ? 28.552  -5.179  6.653   1.00 67.17  ? 316  ILE A C   1 
ATOM   2406 O O   . ILE A 1 316 ? 27.428  -5.674  6.738   1.00 67.84  ? 316  ILE A O   1 
ATOM   2407 C CB  . ILE A 1 316 ? 28.304  -2.777  7.587   1.00 61.96  ? 316  ILE A CB  1 
ATOM   2408 C CG1 . ILE A 1 316 ? 28.365  -2.233  6.160   1.00 62.38  ? 316  ILE A CG1 1 
ATOM   2409 C CG2 . ILE A 1 316 ? 28.845  -1.782  8.613   1.00 60.68  ? 316  ILE A CG2 1 
ATOM   2410 C CD1 . ILE A 1 316 ? 27.913  -0.718  6.034   1.00 61.20  ? 316  ILE A CD1 1 
ATOM   2411 N N   . ASN A 1 317 ? 29.405  -5.489  5.670   1.00 69.06  ? 317  ASN A N   1 
ATOM   2412 C CA  . ASN A 1 317 ? 29.040  -6.457  4.628   1.00 72.61  ? 317  ASN A CA  1 
ATOM   2413 C C   . ASN A 1 317 ? 29.123  -7.884  5.131   1.00 75.04  ? 317  ASN A C   1 
ATOM   2414 O O   . ASN A 1 317 ? 28.409  -8.744  4.628   1.00 77.16  ? 317  ASN A O   1 
ATOM   2415 C CB  . ASN A 1 317 ? 29.865  -6.308  3.330   1.00 73.32  ? 317  ASN A CB  1 
ATOM   2416 C CG  . ASN A 1 317 ? 29.621  -4.969  2.623   1.00 74.08  ? 317  ASN A CG  1 
ATOM   2417 O OD1 . ASN A 1 317 ? 28.708  -4.217  2.997   1.00 75.43  ? 317  ASN A OD1 1 
ATOM   2418 N ND2 . ASN A 1 317 ? 30.448  -4.654  1.610   1.00 74.47  ? 317  ASN A ND2 1 
ATOM   2419 N N   . THR A 1 318 ? 29.972  -8.133  6.128   1.00 75.16  ? 318  THR A N   1 
ATOM   2420 C CA  . THR A 1 318 ? 30.266  -9.508  6.531   1.00 78.09  ? 318  THR A CA  1 
ATOM   2421 C C   . THR A 1 318 ? 30.073  -9.777  8.015   1.00 77.88  ? 318  THR A C   1 
ATOM   2422 O O   . THR A 1 318 ? 30.202  -10.929 8.473   1.00 79.77  ? 318  THR A O   1 
ATOM   2423 C CB  . THR A 1 318 ? 31.696  -9.902  6.156   1.00 79.12  ? 318  THR A CB  1 
ATOM   2424 O OG1 . THR A 1 318 ? 32.591  -8.887  6.628   1.00 77.98  ? 318  THR A OG1 1 
ATOM   2425 C CG2 . THR A 1 318 ? 31.831  -10.044 4.644   1.00 80.67  ? 318  THR A CG2 1 
ATOM   2426 N N   . GLY A 1 319 ? 29.767  -8.724  8.760   1.00 75.54  ? 319  GLY A N   1 
ATOM   2427 C CA  . GLY A 1 319 ? 29.507  -8.854  10.186  1.00 75.74  ? 319  GLY A CA  1 
ATOM   2428 C C   . GLY A 1 319 ? 28.201  -9.567  10.505  1.00 77.30  ? 319  GLY A C   1 
ATOM   2429 O O   . GLY A 1 319 ? 27.210  -9.461  9.766   1.00 77.54  ? 319  GLY A O   1 
ATOM   2430 N N   . ASP A 1 320 ? 28.221  -10.309 11.610  1.00 78.49  ? 320  ASP A N   1 
ATOM   2431 C CA  . ASP A 1 320 ? 27.050  -10.997 12.137  1.00 79.96  ? 320  ASP A CA  1 
ATOM   2432 C C   . ASP A 1 320 ? 26.455  -10.103 13.214  1.00 77.91  ? 320  ASP A C   1 
ATOM   2433 O O   . ASP A 1 320 ? 27.091  -9.839  14.234  1.00 77.15  ? 320  ASP A O   1 
ATOM   2434 C CB  . ASP A 1 320 ? 27.460  -12.363 12.723  1.00 82.50  ? 320  ASP A CB  1 
ATOM   2435 C CG  . ASP A 1 320 ? 26.292  -13.125 13.375  1.00 84.59  ? 320  ASP A CG  1 
ATOM   2436 O OD1 . ASP A 1 320 ? 25.139  -12.637 13.368  1.00 83.81  ? 320  ASP A OD1 1 
ATOM   2437 O OD2 . ASP A 1 320 ? 26.535  -14.237 13.899  1.00 87.85  ? 320  ASP A OD2 1 
ATOM   2438 N N   . PHE A 1 321 ? 25.239  -9.625  12.985  1.00 77.28  ? 321  PHE A N   1 
ATOM   2439 C CA  . PHE A 1 321 ? 24.591  -8.748  13.960  1.00 75.50  ? 321  PHE A CA  1 
ATOM   2440 C C   . PHE A 1 321 ? 23.293  -9.380  14.454  1.00 77.48  ? 321  PHE A C   1 
ATOM   2441 O O   . PHE A 1 321 ? 22.307  -8.679  14.707  1.00 76.48  ? 321  PHE A O   1 
ATOM   2442 C CB  . PHE A 1 321 ? 24.380  -7.336  13.384  1.00 72.89  ? 321  PHE A CB  1 
ATOM   2443 C CG  . PHE A 1 321 ? 25.578  -6.800  12.645  1.00 70.14  ? 321  PHE A CG  1 
ATOM   2444 C CD1 . PHE A 1 321 ? 26.650  -6.251  13.335  1.00 68.11  ? 321  PHE A CD1 1 
ATOM   2445 C CD2 . PHE A 1 321 ? 25.645  -6.865  11.256  1.00 69.72  ? 321  PHE A CD2 1 
ATOM   2446 C CE1 . PHE A 1 321 ? 27.764  -5.759  12.654  1.00 66.77  ? 321  PHE A CE1 1 
ATOM   2447 C CE2 . PHE A 1 321 ? 26.759  -6.379  10.567  1.00 68.66  ? 321  PHE A CE2 1 
ATOM   2448 C CZ  . PHE A 1 321 ? 27.817  -5.823  11.272  1.00 66.94  ? 321  PHE A CZ  1 
ATOM   2449 N N   . GLN A 1 322 ? 23.316  -10.718 14.565  1.00 80.66  ? 322  GLN A N   1 
ATOM   2450 C CA  . GLN A 1 322 ? 22.306  -11.487 15.277  1.00 83.02  ? 322  GLN A CA  1 
ATOM   2451 C C   . GLN A 1 322 ? 22.143  -10.769 16.611  1.00 81.60  ? 322  GLN A C   1 
ATOM   2452 O O   . GLN A 1 322 ? 23.121  -10.323 17.235  1.00 80.39  ? 322  GLN A O   1 
ATOM   2453 C CB  . GLN A 1 322 ? 22.778  -12.922 15.503  1.00 86.23  ? 322  GLN A CB  1 
ATOM   2454 C CG  . GLN A 1 322 ? 21.747  -14.020 15.154  1.00 91.23  ? 322  GLN A CG  1 
ATOM   2455 C CD  . GLN A 1 322 ? 21.595  -14.229 13.636  1.00 95.50  ? 322  GLN A CD  1 
ATOM   2456 O OE1 . GLN A 1 322 ? 22.555  -14.584 12.934  1.00 96.39  ? 322  GLN A OE1 1 
ATOM   2457 N NE2 . GLN A 1 322 ? 20.382  -14.008 13.128  1.00 96.58  ? 322  GLN A NE2 1 
ATOM   2458 N N   . ASP A 1 323 ? 20.907  -10.684 17.065  1.00 81.83  ? 323  ASP A N   1 
ATOM   2459 C CA  . ASP A 1 323 ? 20.474  -9.483  17.766  1.00 79.89  ? 323  ASP A CA  1 
ATOM   2460 C C   . ASP A 1 323 ? 21.400  -8.383  18.342  1.00 76.01  ? 323  ASP A C   1 
ATOM   2461 O O   . ASP A 1 323 ? 22.109  -8.525  19.344  1.00 75.74  ? 323  ASP A O   1 
ATOM   2462 C CB  . ASP A 1 323 ? 19.146  -9.630  18.513  1.00 82.11  ? 323  ASP A CB  1 
ATOM   2463 C CG  . ASP A 1 323 ? 18.070  -8.687  17.925  1.00 84.03  ? 323  ASP A CG  1 
ATOM   2464 O OD1 . ASP A 1 323 ? 17.350  -8.019  18.717  1.00 85.63  ? 323  ASP A OD1 1 
ATOM   2465 O OD2 . ASP A 1 323 ? 17.988  -8.584  16.663  1.00 85.34  ? 323  ASP A OD2 1 
ATOM   2466 N N   . LEU A 1 324 ? 21.365  -7.301  17.588  1.00 72.55  ? 324  LEU A N   1 
ATOM   2467 C CA  . LEU A 1 324 ? 21.816  -6.011  17.971  1.00 68.34  ? 324  LEU A CA  1 
ATOM   2468 C C   . LEU A 1 324 ? 20.588  -5.197  17.638  1.00 66.63  ? 324  LEU A C   1 
ATOM   2469 O O   . LEU A 1 324 ? 19.915  -5.465  16.639  1.00 67.19  ? 324  LEU A O   1 
ATOM   2470 C CB  . LEU A 1 324 ? 22.966  -5.596  17.069  1.00 67.34  ? 324  LEU A CB  1 
ATOM   2471 C CG  . LEU A 1 324 ? 23.359  -4.122  17.123  1.00 64.94  ? 324  LEU A CG  1 
ATOM   2472 C CD1 . LEU A 1 324 ? 24.186  -3.837  18.367  1.00 64.05  ? 324  LEU A CD1 1 
ATOM   2473 C CD2 . LEU A 1 324 ? 24.102  -3.732  15.874  1.00 64.14  ? 324  LEU A CD2 1 
ATOM   2474 N N   . GLN A 1 325 ? 20.268  -4.228  18.479  1.00 63.85  ? 325  GLN A N   1 
ATOM   2475 C CA  . GLN A 1 325 ? 19.143  -3.362  18.190  1.00 62.17  ? 325  GLN A CA  1 
ATOM   2476 C C   . GLN A 1 325 ? 19.639  -1.946  18.003  1.00 59.04  ? 325  GLN A C   1 
ATOM   2477 O O   . GLN A 1 325 ? 20.246  -1.377  18.912  1.00 57.74  ? 325  GLN A O   1 
ATOM   2478 C CB  . GLN A 1 325 ? 18.093  -3.422  19.300  1.00 62.74  ? 325  GLN A CB  1 
ATOM   2479 C CG  . GLN A 1 325 ? 17.472  -4.782  19.503  1.00 64.48  ? 325  GLN A CG  1 
ATOM   2480 C CD  . GLN A 1 325 ? 17.899  -5.438  20.792  1.00 66.01  ? 325  GLN A CD  1 
ATOM   2481 O OE1 . GLN A 1 325 ? 18.302  -4.772  21.750  1.00 64.07  ? 325  GLN A OE1 1 
ATOM   2482 N NE2 . GLN A 1 325 ? 17.801  -6.766  20.834  1.00 69.67  ? 325  GLN A NE2 1 
ATOM   2483 N N   . VAL A 1 326 ? 19.403  -1.392  16.818  1.00 57.54  ? 326  VAL A N   1 
ATOM   2484 C CA  . VAL A 1 326 ? 19.794  -0.006  16.546  1.00 55.03  ? 326  VAL A CA  1 
ATOM   2485 C C   . VAL A 1 326 ? 18.645  0.813   16.019  1.00 54.23  ? 326  VAL A C   1 
ATOM   2486 O O   . VAL A 1 326 ? 17.803  0.328   15.256  1.00 55.53  ? 326  VAL A O   1 
ATOM   2487 C CB  . VAL A 1 326 ? 20.996  0.153   15.556  1.00 54.05  ? 326  VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 326 ? 22.234  -0.512  16.089  1.00 54.49  ? 326  VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 326 ? 20.663  -0.380  14.192  1.00 56.29  ? 326  VAL A CG2 1 
ATOM   2490 N N   . LEU A 1 327 ? 18.632  2.066   16.434  1.00 51.94  ? 327  LEU A N   1 
ATOM   2491 C CA  . LEU A 1 327 ? 17.740  3.041   15.896  1.00 51.20  ? 327  LEU A CA  1 
ATOM   2492 C C   . LEU A 1 327 ? 18.631  4.003   15.111  1.00 49.85  ? 327  LEU A C   1 
ATOM   2493 O O   . LEU A 1 327 ? 19.581  4.554   15.661  1.00 48.80  ? 327  LEU A O   1 
ATOM   2494 C CB  . LEU A 1 327 ? 16.979  3.714   17.050  1.00 50.90  ? 327  LEU A CB  1 
ATOM   2495 C CG  . LEU A 1 327 ? 16.437  5.136   16.927  1.00 51.08  ? 327  LEU A CG  1 
ATOM   2496 C CD1 . LEU A 1 327 ? 15.380  5.198   15.860  1.00 54.32  ? 327  LEU A CD1 1 
ATOM   2497 C CD2 . LEU A 1 327 ? 15.856  5.605   18.235  1.00 52.50  ? 327  LEU A CD2 1 
ATOM   2498 N N   . VAL A 1 328 ? 18.348  4.174   13.819  1.00 50.05  ? 328  VAL A N   1 
ATOM   2499 C CA  . VAL A 1 328 ? 19.152  5.046   12.919  1.00 48.61  ? 328  VAL A CA  1 
ATOM   2500 C C   . VAL A 1 328 ? 18.260  6.091   12.268  1.00 48.05  ? 328  VAL A C   1 
ATOM   2501 O O   . VAL A 1 328 ? 17.051  5.875   12.140  1.00 49.42  ? 328  VAL A O   1 
ATOM   2502 C CB  . VAL A 1 328 ? 19.817  4.226   11.762  1.00 49.13  ? 328  VAL A CB  1 
ATOM   2503 C CG1 . VAL A 1 328 ? 20.676  3.133   12.309  1.00 50.26  ? 328  VAL A CG1 1 
ATOM   2504 C CG2 . VAL A 1 328 ? 18.771  3.606   10.880  1.00 49.56  ? 328  VAL A CG2 1 
ATOM   2505 N N   . GLY A 1 329 ? 18.832  7.200   11.821  1.00 45.94  ? 329  GLY A N   1 
ATOM   2506 C CA  . GLY A 1 329 ? 18.016  8.180   11.145  1.00 45.45  ? 329  GLY A CA  1 
ATOM   2507 C C   . GLY A 1 329 ? 18.718  9.449   10.737  1.00 44.68  ? 329  GLY A C   1 
ATOM   2508 O O   . GLY A 1 329 ? 19.922  9.604   10.976  1.00 44.30  ? 329  GLY A O   1 
ATOM   2509 N N   . VAL A 1 330 ? 17.949  10.368  10.141  1.00 44.10  ? 330  VAL A N   1 
ATOM   2510 C CA  . VAL A 1 330 ? 18.466  11.574  9.538   1.00 42.72  ? 330  VAL A CA  1 
ATOM   2511 C C   . VAL A 1 330 ? 17.484  12.719  9.740   1.00 43.51  ? 330  VAL A C   1 
ATOM   2512 O O   . VAL A 1 330 ? 16.305  12.484  10.023  1.00 44.09  ? 330  VAL A O   1 
ATOM   2513 C CB  . VAL A 1 330 ? 18.693  11.388  8.010   1.00 43.65  ? 330  VAL A CB  1 
ATOM   2514 C CG1 . VAL A 1 330 ? 19.587  10.136  7.695   1.00 43.10  ? 330  VAL A CG1 1 
ATOM   2515 C CG2 . VAL A 1 330 ? 17.356  11.318  7.244   1.00 43.00  ? 330  VAL A CG2 1 
ATOM   2516 N N   . VAL A 1 331 ? 17.982  13.953  9.587   1.00 42.99  ? 331  VAL A N   1 
ATOM   2517 C CA  . VAL A 1 331 ? 17.163  15.163  9.575   1.00 43.63  ? 331  VAL A CA  1 
ATOM   2518 C C   . VAL A 1 331 ? 16.778  15.452  8.131   1.00 45.10  ? 331  VAL A C   1 
ATOM   2519 O O   . VAL A 1 331 ? 17.293  14.789  7.223   1.00 45.46  ? 331  VAL A O   1 
ATOM   2520 C CB  . VAL A 1 331 ? 17.903  16.397  10.178  1.00 42.76  ? 331  VAL A CB  1 
ATOM   2521 C CG1 . VAL A 1 331 ? 18.239  16.147  11.624  1.00 42.01  ? 331  VAL A CG1 1 
ATOM   2522 C CG2 . VAL A 1 331 ? 19.155  16.722  9.404   1.00 41.52  ? 331  VAL A CG2 1 
ATOM   2523 N N   . LYS A 1 332 ? 15.903  16.443  7.897   1.00 45.90  ? 332  LYS A N   1 
ATOM   2524 C CA  . LYS A 1 332 ? 15.397  16.686  6.534   1.00 46.78  ? 332  LYS A CA  1 
ATOM   2525 C C   . LYS A 1 332 ? 16.452  17.320  5.655   1.00 46.03  ? 332  LYS A C   1 
ATOM   2526 O O   . LYS A 1 332 ? 16.396  17.214  4.443   1.00 46.36  ? 332  LYS A O   1 
ATOM   2527 C CB  . LYS A 1 332 ? 14.141  17.560  6.546   1.00 48.31  ? 332  LYS A CB  1 
ATOM   2528 C CG  . LYS A 1 332 ? 13.268  17.461  5.285   1.00 50.37  ? 332  LYS A CG  1 
ATOM   2529 C CD  . LYS A 1 332 ? 11.982  18.293  5.429   1.00 54.48  ? 332  LYS A CD  1 
ATOM   2530 C CE  . LYS A 1 332 ? 12.065  19.645  4.674   1.00 59.56  ? 332  LYS A CE  1 
ATOM   2531 N NZ  . LYS A 1 332 ? 12.721  20.810  5.400   1.00 58.57  ? 332  LYS A NZ  1 
ATOM   2532 N N   . ASP A 1 333 ? 17.422  17.981  6.273   1.00 44.95  ? 333  ASP A N   1 
ATOM   2533 C CA  . ASP A 1 333 ? 18.346  18.830  5.517   1.00 44.14  ? 333  ASP A CA  1 
ATOM   2534 C C   . ASP A 1 333 ? 19.795  18.695  5.973   1.00 43.25  ? 333  ASP A C   1 
ATOM   2535 O O   . ASP A 1 333 ? 20.458  19.677  6.338   1.00 43.11  ? 333  ASP A O   1 
ATOM   2536 C CB  . ASP A 1 333 ? 17.848  20.264  5.537   1.00 44.02  ? 333  ASP A CB  1 
ATOM   2537 C CG  . ASP A 1 333 ? 16.520  20.401  4.834   1.00 44.81  ? 333  ASP A CG  1 
ATOM   2538 O OD1 . ASP A 1 333 ? 15.479  20.383  5.528   1.00 44.58  ? 333  ASP A OD1 1 
ATOM   2539 O OD2 . ASP A 1 333 ? 16.519  20.444  3.585   1.00 43.70  ? 333  ASP A OD2 1 
ATOM   2540 N N   . GLU A 1 334 ? 20.261  17.446  5.922   1.00 42.49  ? 334  GLU A N   1 
ATOM   2541 C CA  . GLU A 1 334 ? 21.584  17.073  6.299   1.00 41.35  ? 334  GLU A CA  1 
ATOM   2542 C C   . GLU A 1 334 ? 22.655  17.934  5.676   1.00 41.44  ? 334  GLU A C   1 
ATOM   2543 O O   . GLU A 1 334 ? 23.628  18.253  6.336   1.00 42.07  ? 334  GLU A O   1 
ATOM   2544 C CB  . GLU A 1 334 ? 21.846  15.626  5.898   1.00 41.64  ? 334  GLU A CB  1 
ATOM   2545 C CG  . GLU A 1 334 ? 21.091  14.565  6.678   1.00 42.83  ? 334  GLU A CG  1 
ATOM   2546 C CD  . GLU A 1 334 ? 21.375  14.578  8.170   1.00 44.76  ? 334  GLU A CD  1 
ATOM   2547 O OE1 . GLU A 1 334 ? 22.340  15.240  8.598   1.00 43.29  ? 334  GLU A OE1 1 
ATOM   2548 O OE2 . GLU A 1 334 ? 20.620  13.916  8.930   1.00 48.91  ? 334  GLU A OE2 1 
ATOM   2549 N N   . GLY A 1 335 ? 22.506  18.299  4.410   1.00 41.71  ? 335  GLY A N   1 
ATOM   2550 C CA  . GLY A 1 335 ? 23.570  18.977  3.714   1.00 41.13  ? 335  GLY A CA  1 
ATOM   2551 C C   . GLY A 1 335 ? 23.632  20.459  3.954   1.00 41.52  ? 335  GLY A C   1 
ATOM   2552 O O   . GLY A 1 335 ? 24.698  21.057  3.839   1.00 42.11  ? 335  GLY A O   1 
ATOM   2553 N N   . SER A 1 336 ? 22.497  21.065  4.279   1.00 42.21  ? 336  SER A N   1 
ATOM   2554 C CA  . SER A 1 336 ? 22.349  22.512  4.143   1.00 42.76  ? 336  SER A CA  1 
ATOM   2555 C C   . SER A 1 336 ? 23.414  23.320  4.874   1.00 42.94  ? 336  SER A C   1 
ATOM   2556 O O   . SER A 1 336 ? 24.078  24.115  4.240   1.00 44.18  ? 336  SER A O   1 
ATOM   2557 C CB  . SER A 1 336 ? 20.930  22.970  4.480   1.00 43.41  ? 336  SER A CB  1 
ATOM   2558 O OG  . SER A 1 336 ? 20.645  22.960  5.865   1.00 42.82  ? 336  SER A OG  1 
ATOM   2559 N N   . ALA A 1 337 ? 23.612  23.067  6.171   1.00 43.04  ? 337  ALA A N   1 
ATOM   2560 C CA  . ALA A 1 337 ? 24.631  23.729  7.018   1.00 43.07  ? 337  ALA A CA  1 
ATOM   2561 C C   . ALA A 1 337 ? 26.052  23.763  6.462   1.00 43.70  ? 337  ALA A C   1 
ATOM   2562 O O   . ALA A 1 337 ? 26.750  24.797  6.556   1.00 44.16  ? 337  ALA A O   1 
ATOM   2563 C CB  . ALA A 1 337 ? 24.648  23.121  8.421   1.00 42.22  ? 337  ALA A CB  1 
ATOM   2564 N N   . PHE A 1 338 ? 26.478  22.636  5.906   1.00 43.33  ? 338  PHE A N   1 
ATOM   2565 C CA  . PHE A 1 338 ? 27.811  22.506  5.348   1.00 43.58  ? 338  PHE A CA  1 
ATOM   2566 C C   . PHE A 1 338 ? 28.109  23.504  4.246   1.00 44.33  ? 338  PHE A C   1 
ATOM   2567 O O   . PHE A 1 338 ? 29.246  23.927  4.055   1.00 45.19  ? 338  PHE A O   1 
ATOM   2568 C CB  . PHE A 1 338 ? 28.025  21.061  4.872   1.00 43.30  ? 338  PHE A CB  1 
ATOM   2569 C CG  . PHE A 1 338 ? 28.073  20.102  6.005   1.00 42.73  ? 338  PHE A CG  1 
ATOM   2570 C CD1 . PHE A 1 338 ? 26.911  19.491  6.458   1.00 41.79  ? 338  PHE A CD1 1 
ATOM   2571 C CD2 . PHE A 1 338 ? 29.251  19.906  6.701   1.00 40.91  ? 338  PHE A CD2 1 
ATOM   2572 C CE1 . PHE A 1 338 ? 26.932  18.662  7.551   1.00 40.85  ? 338  PHE A CE1 1 
ATOM   2573 C CE2 . PHE A 1 338 ? 29.280  19.074  7.793   1.00 41.85  ? 338  PHE A CE2 1 
ATOM   2574 C CZ  . PHE A 1 338 ? 28.118  18.444  8.220   1.00 40.89  ? 338  PHE A CZ  1 
ATOM   2575 N N   . LEU A 1 339 ? 27.077  23.895  3.529   1.00 44.79  ? 339  LEU A N   1 
ATOM   2576 C CA  . LEU A 1 339 ? 27.273  24.754  2.402   1.00 45.62  ? 339  LEU A CA  1 
ATOM   2577 C C   . LEU A 1 339 ? 27.777  26.113  2.804   1.00 46.56  ? 339  LEU A C   1 
ATOM   2578 O O   . LEU A 1 339 ? 28.395  26.766  1.996   1.00 48.47  ? 339  LEU A O   1 
ATOM   2579 C CB  . LEU A 1 339 ? 25.979  24.904  1.606   1.00 46.05  ? 339  LEU A CB  1 
ATOM   2580 C CG  . LEU A 1 339 ? 25.310  23.624  1.137   1.00 44.16  ? 339  LEU A CG  1 
ATOM   2581 C CD1 . LEU A 1 339 ? 24.122  23.990  0.330   1.00 44.67  ? 339  LEU A CD1 1 
ATOM   2582 C CD2 . LEU A 1 339 ? 26.272  22.799  0.309   1.00 44.85  ? 339  LEU A CD2 1 
ATOM   2583 N N   . VAL A 1 340 ? 27.517  26.581  4.019   1.00 46.68  ? 340  VAL A N   1 
ATOM   2584 C CA  . VAL A 1 340 ? 28.017  27.925  4.357   1.00 47.60  ? 340  VAL A CA  1 
ATOM   2585 C C   . VAL A 1 340 ? 29.481  27.886  4.768   1.00 48.40  ? 340  VAL A C   1 
ATOM   2586 O O   . VAL A 1 340 ? 30.136  28.936  4.882   1.00 49.21  ? 340  VAL A O   1 
ATOM   2587 C CB  . VAL A 1 340 ? 27.177  28.699  5.398   1.00 47.47  ? 340  VAL A CB  1 
ATOM   2588 C CG1 . VAL A 1 340 ? 25.821  29.070  4.827   1.00 47.09  ? 340  VAL A CG1 1 
ATOM   2589 C CG2 . VAL A 1 340 ? 27.061  27.940  6.706   1.00 45.89  ? 340  VAL A CG2 1 
ATOM   2590 N N   . TYR A 1 341 ? 29.998  26.676  4.952   1.00 48.03  ? 341  TYR A N   1 
ATOM   2591 C CA  . TYR A 1 341 ? 31.375  26.524  5.369   1.00 49.03  ? 341  TYR A CA  1 
ATOM   2592 C C   . TYR A 1 341 ? 32.216  26.140  4.161   1.00 50.40  ? 341  TYR A C   1 
ATOM   2593 O O   . TYR A 1 341 ? 32.763  25.026  4.071   1.00 50.89  ? 341  TYR A O   1 
ATOM   2594 C CB  . TYR A 1 341 ? 31.508  25.454  6.456   1.00 47.87  ? 341  TYR A CB  1 
ATOM   2595 C CG  . TYR A 1 341 ? 30.930  25.787  7.818   1.00 46.41  ? 341  TYR A CG  1 
ATOM   2596 C CD1 . TYR A 1 341 ? 29.604  25.505  8.121   1.00 43.09  ? 341  TYR A CD1 1 
ATOM   2597 C CD2 . TYR A 1 341 ? 31.726  26.339  8.817   1.00 45.77  ? 341  TYR A CD2 1 
ATOM   2598 C CE1 . TYR A 1 341 ? 29.089  25.771  9.365   1.00 41.48  ? 341  TYR A CE1 1 
ATOM   2599 C CE2 . TYR A 1 341 ? 31.208  26.610  10.075  1.00 43.81  ? 341  TYR A CE2 1 
ATOM   2600 C CZ  . TYR A 1 341 ? 29.890  26.320  10.334  1.00 41.78  ? 341  TYR A CZ  1 
ATOM   2601 O OH  . TYR A 1 341 ? 29.367  26.571  11.573  1.00 41.84  ? 341  TYR A OH  1 
ATOM   2602 N N   . GLY A 1 342 ? 32.322  27.051  3.210   1.00 52.13  ? 342  GLY A N   1 
ATOM   2603 C CA  . GLY A 1 342 ? 33.187  26.774  2.069   1.00 53.29  ? 342  GLY A CA  1 
ATOM   2604 C C   . GLY A 1 342 ? 32.638  27.020  0.674   1.00 54.04  ? 342  GLY A C   1 
ATOM   2605 O O   . GLY A 1 342 ? 33.342  27.672  -0.129  1.00 55.88  ? 342  GLY A O   1 
ATOM   2606 N N   . VAL A 1 343 ? 31.417  26.527  0.383   1.00 52.17  ? 343  VAL A N   1 
ATOM   2607 C CA  . VAL A 1 343 ? 30.865  26.568  -0.984  1.00 51.91  ? 343  VAL A CA  1 
ATOM   2608 C C   . VAL A 1 343 ? 30.522  27.997  -1.464  1.00 52.30  ? 343  VAL A C   1 
ATOM   2609 O O   . VAL A 1 343 ? 29.678  28.676  -0.881  1.00 52.64  ? 343  VAL A O   1 
ATOM   2610 C CB  . VAL A 1 343 ? 29.648  25.627  -1.166  1.00 51.21  ? 343  VAL A CB  1 
ATOM   2611 C CG1 . VAL A 1 343 ? 29.322  25.454  -2.648  1.00 51.49  ? 343  VAL A CG1 1 
ATOM   2612 C CG2 . VAL A 1 343 ? 29.913  24.261  -0.533  1.00 51.43  ? 343  VAL A CG2 1 
ATOM   2613 N N   . PRO A 1 344 ? 31.176  28.466  -2.531  1.00 52.65  ? 344  PRO A N   1 
ATOM   2614 C CA  . PRO A 1 344 ? 30.855  29.847  -2.912  1.00 53.76  ? 344  PRO A CA  1 
ATOM   2615 C C   . PRO A 1 344 ? 29.401  29.988  -3.382  1.00 53.46  ? 344  PRO A C   1 
ATOM   2616 O O   . PRO A 1 344 ? 28.823  29.029  -3.923  1.00 52.74  ? 344  PRO A O   1 
ATOM   2617 C CB  . PRO A 1 344 ? 31.849  30.161  -4.052  1.00 54.63  ? 344  PRO A CB  1 
ATOM   2618 C CG  . PRO A 1 344 ? 32.909  29.087  -3.953  1.00 54.73  ? 344  PRO A CG  1 
ATOM   2619 C CD  . PRO A 1 344 ? 32.214  27.874  -3.386  1.00 53.02  ? 344  PRO A CD  1 
ATOM   2620 N N   . GLY A 1 345 ? 28.832  31.171  -3.142  1.00 53.24  ? 345  GLY A N   1 
ATOM   2621 C CA  . GLY A 1 345 ? 27.442  31.446  -3.424  1.00 52.67  ? 345  GLY A CA  1 
ATOM   2622 C C   . GLY A 1 345 ? 26.512  31.320  -2.233  1.00 51.82  ? 345  GLY A C   1 
ATOM   2623 O O   . GLY A 1 345 ? 25.455  31.935  -2.216  1.00 52.27  ? 345  GLY A O   1 
ATOM   2624 N N   . PHE A 1 346 ? 26.904  30.532  -1.234  1.00 51.10  ? 346  PHE A N   1 
ATOM   2625 C CA  . PHE A 1 346 ? 26.054  30.219  -0.079  1.00 50.09  ? 346  PHE A CA  1 
ATOM   2626 C C   . PHE A 1 346 ? 26.363  31.064  1.141   1.00 50.27  ? 346  PHE A C   1 
ATOM   2627 O O   . PHE A 1 346 ? 27.518  31.409  1.387   1.00 50.44  ? 346  PHE A O   1 
ATOM   2628 C CB  . PHE A 1 346 ? 26.197  28.754  0.278   1.00 48.91  ? 346  PHE A CB  1 
ATOM   2629 C CG  . PHE A 1 346 ? 25.605  27.833  -0.746  1.00 49.64  ? 346  PHE A CG  1 
ATOM   2630 C CD1 . PHE A 1 346 ? 26.366  27.388  -1.819  1.00 49.69  ? 346  PHE A CD1 1 
ATOM   2631 C CD2 . PHE A 1 346 ? 24.279  27.421  -0.641  1.00 48.91  ? 346  PHE A CD2 1 
ATOM   2632 C CE1 . PHE A 1 346 ? 25.831  26.536  -2.757  1.00 50.00  ? 346  PHE A CE1 1 
ATOM   2633 C CE2 . PHE A 1 346 ? 23.728  26.594  -1.578  1.00 49.18  ? 346  PHE A CE2 1 
ATOM   2634 C CZ  . PHE A 1 346 ? 24.504  26.143  -2.644  1.00 50.55  ? 346  PHE A CZ  1 
ATOM   2635 N N   . SER A 1 347 ? 25.314  31.397  1.892   1.00 50.55  ? 347  SER A N   1 
ATOM   2636 C CA  . SER A 1 347 ? 25.392  32.227  3.118   1.00 50.64  ? 347  SER A CA  1 
ATOM   2637 C C   . SER A 1 347 ? 24.145  32.019  4.016   1.00 50.48  ? 347  SER A C   1 
ATOM   2638 O O   . SER A 1 347 ? 23.079  31.616  3.526   1.00 51.13  ? 347  SER A O   1 
ATOM   2639 C CB  . SER A 1 347 ? 25.587  33.720  2.773   1.00 51.80  ? 347  SER A CB  1 
ATOM   2640 O OG  . SER A 1 347 ? 25.202  34.538  3.863   1.00 51.26  ? 347  SER A OG  1 
ATOM   2641 N N   . LYS A 1 348 ? 24.276  32.251  5.319   1.00 49.70  ? 348  LYS A N   1 
ATOM   2642 C CA  . LYS A 1 348 ? 23.097  32.347  6.175   1.00 50.05  ? 348  LYS A CA  1 
ATOM   2643 C C   . LYS A 1 348 ? 22.324  33.677  6.000   1.00 51.92  ? 348  LYS A C   1 
ATOM   2644 O O   . LYS A 1 348 ? 21.148  33.728  6.351   1.00 52.03  ? 348  LYS A O   1 
ATOM   2645 C CB  . LYS A 1 348 ? 23.460  32.177  7.655   1.00 49.45  ? 348  LYS A CB  1 
ATOM   2646 C CG  . LYS A 1 348 ? 23.947  33.465  8.352   1.00 51.02  ? 348  LYS A CG  1 
ATOM   2647 C CD  . LYS A 1 348 ? 24.016  33.278  9.862   1.00 51.24  ? 348  LYS A CD  1 
ATOM   2648 C CE  . LYS A 1 348 ? 24.493  34.552  10.565  1.00 54.35  ? 348  LYS A CE  1 
ATOM   2649 N NZ  . LYS A 1 348 ? 23.519  35.725  10.568  1.00 53.50  ? 348  LYS A NZ  1 
ATOM   2650 N N   . ASP A 1 349 ? 22.972  34.730  5.485   1.00 52.69  ? 349  ASP A N   1 
ATOM   2651 C CA  . ASP A 1 349 ? 22.359  36.088  5.494   1.00 55.35  ? 349  ASP A CA  1 
ATOM   2652 C C   . ASP A 1 349 ? 21.551  36.439  4.254   1.00 56.51  ? 349  ASP A C   1 
ATOM   2653 O O   . ASP A 1 349 ? 21.055  37.548  4.133   1.00 57.91  ? 349  ASP A O   1 
ATOM   2654 C CB  . ASP A 1 349 ? 23.400  37.192  5.736   1.00 55.94  ? 349  ASP A CB  1 
ATOM   2655 C CG  . ASP A 1 349 ? 24.064  37.072  7.082   1.00 56.26  ? 349  ASP A CG  1 
ATOM   2656 O OD1 . ASP A 1 349 ? 23.346  36.757  8.055   1.00 54.98  ? 349  ASP A OD1 1 
ATOM   2657 O OD2 . ASP A 1 349 ? 25.306  37.269  7.159   1.00 56.65  ? 349  ASP A OD2 1 
ATOM   2658 N N   . ASN A 1 350 ? 21.445  35.491  3.326   1.00 56.68  ? 350  ASN A N   1 
ATOM   2659 C CA  . ASN A 1 350 ? 20.590  35.640  2.151   1.00 57.45  ? 350  ASN A CA  1 
ATOM   2660 C C   . ASN A 1 350 ? 20.128  34.282  1.635   1.00 56.34  ? 350  ASN A C   1 
ATOM   2661 O O   . ASN A 1 350 ? 20.502  33.240  2.162   1.00 54.24  ? 350  ASN A O   1 
ATOM   2662 C CB  . ASN A 1 350 ? 21.268  36.477  1.049   1.00 58.40  ? 350  ASN A CB  1 
ATOM   2663 C CG  . ASN A 1 350 ? 22.371  35.726  0.325   1.00 58.72  ? 350  ASN A CG  1 
ATOM   2664 O OD1 . ASN A 1 350 ? 22.255  34.525  0.041   1.00 59.89  ? 350  ASN A OD1 1 
ATOM   2665 N ND2 . ASN A 1 350 ? 23.446  36.433  0.005   1.00 58.63  ? 350  ASN A ND2 1 
ATOM   2666 N N   . GLU A 1 351 ? 19.331  34.324  0.574   1.00 57.82  ? 351  GLU A N   1 
ATOM   2667 C CA  . GLU A 1 351 ? 18.563  33.173  0.085   1.00 57.52  ? 351  GLU A CA  1 
ATOM   2668 C C   . GLU A 1 351 ? 19.403  32.055  -0.549  1.00 55.47  ? 351  GLU A C   1 
ATOM   2669 O O   . GLU A 1 351 ? 18.894  30.951  -0.786  1.00 54.39  ? 351  GLU A O   1 
ATOM   2670 C CB  . GLU A 1 351 ? 17.492  33.670  -0.903  1.00 59.69  ? 351  GLU A CB  1 
ATOM   2671 C CG  . GLU A 1 351 ? 16.255  34.288  -0.259  1.00 63.75  ? 351  GLU A CG  1 
ATOM   2672 C CD  . GLU A 1 351 ? 15.811  33.516  0.974   1.00 68.62  ? 351  GLU A CD  1 
ATOM   2673 O OE1 . GLU A 1 351 ? 15.413  32.311  0.868   1.00 70.15  ? 351  GLU A OE1 1 
ATOM   2674 O OE2 . GLU A 1 351 ? 15.890  34.118  2.066   1.00 70.92  ? 351  GLU A OE2 1 
ATOM   2675 N N   . SER A 1 352 ? 20.676  32.369  -0.815  1.00 54.49  ? 352  SER A N   1 
ATOM   2676 C CA  . SER A 1 352 ? 21.629  31.472  -1.471  1.00 53.43  ? 352  SER A CA  1 
ATOM   2677 C C   . SER A 1 352 ? 21.127  30.899  -2.789  1.00 53.94  ? 352  SER A C   1 
ATOM   2678 O O   . SER A 1 352 ? 21.283  29.703  -3.054  1.00 53.16  ? 352  SER A O   1 
ATOM   2679 C CB  . SER A 1 352 ? 22.068  30.333  -0.542  1.00 51.84  ? 352  SER A CB  1 
ATOM   2680 O OG  . SER A 1 352 ? 22.676  30.852  0.626   1.00 51.84  ? 352  SER A OG  1 
ATOM   2681 N N   . LEU A 1 353 ? 20.529  31.745  -3.620  1.00 54.87  ? 353  LEU A N   1 
ATOM   2682 C CA  . LEU A 1 353 ? 20.129  31.308  -4.951  1.00 55.17  ? 353  LEU A CA  1 
ATOM   2683 C C   . LEU A 1 353 ? 21.368  31.255  -5.841  1.00 55.32  ? 353  LEU A C   1 
ATOM   2684 O O   . LEU A 1 353 ? 21.974  32.271  -6.139  1.00 56.55  ? 353  LEU A O   1 
ATOM   2685 C CB  . LEU A 1 353 ? 19.070  32.231  -5.510  1.00 56.39  ? 353  LEU A CB  1 
ATOM   2686 C CG  . LEU A 1 353 ? 17.850  32.373  -4.608  1.00 56.47  ? 353  LEU A CG  1 
ATOM   2687 C CD1 . LEU A 1 353 ? 17.086  33.625  -4.962  1.00 59.38  ? 353  LEU A CD1 1 
ATOM   2688 C CD2 . LEU A 1 353 ? 16.955  31.171  -4.695  1.00 55.54  ? 353  LEU A CD2 1 
ATOM   2689 N N   . ILE A 1 354 ? 21.769  30.054  -6.232  1.00 54.63  ? 354  ILE A N   1 
ATOM   2690 C CA  . ILE A 1 354 ? 23.004  29.884  -6.976  1.00 53.97  ? 354  ILE A CA  1 
ATOM   2691 C C   . ILE A 1 354 ? 22.800  29.655  -8.475  1.00 55.51  ? 354  ILE A C   1 
ATOM   2692 O O   . ILE A 1 354 ? 21.717  29.270  -8.925  1.00 55.99  ? 354  ILE A O   1 
ATOM   2693 C CB  . ILE A 1 354 ? 23.838  28.757  -6.384  1.00 52.72  ? 354  ILE A CB  1 
ATOM   2694 C CG1 . ILE A 1 354 ? 23.026  27.459  -6.309  1.00 50.79  ? 354  ILE A CG1 1 
ATOM   2695 C CG2 . ILE A 1 354 ? 24.353  29.159  -5.024  1.00 51.34  ? 354  ILE A CG2 1 
ATOM   2696 C CD1 . ILE A 1 354 ? 23.838  26.248  -6.544  1.00 49.03  ? 354  ILE A CD1 1 
ATOM   2697 N N   . SER A 1 355 ? 23.852  29.901  -9.246  1.00 56.53  ? 355  SER A N   1 
ATOM   2698 C CA  . SER A 1 355 ? 23.830  29.680  -10.681 1.00 58.15  ? 355  SER A CA  1 
ATOM   2699 C C   . SER A 1 355 ? 24.234  28.244  -10.966 1.00 57.78  ? 355  SER A C   1 
ATOM   2700 O O   . SER A 1 355 ? 24.785  27.546  -10.087 1.00 56.89  ? 355  SER A O   1 
ATOM   2701 C CB  . SER A 1 355 ? 24.812  30.619  -11.367 1.00 59.37  ? 355  SER A CB  1 
ATOM   2702 O OG  . SER A 1 355 ? 26.155  30.200  -11.125 1.00 60.18  ? 355  SER A OG  1 
ATOM   2703 N N   . ARG A 1 356 ? 23.982  27.806  -12.195 1.00 58.70  ? 356  ARG A N   1 
ATOM   2704 C CA  . ARG A 1 356 ? 24.386  26.473  -12.619 1.00 58.66  ? 356  ARG A CA  1 
ATOM   2705 C C   . ARG A 1 356 ? 25.907  26.280  -12.476 1.00 57.97  ? 356  ARG A C   1 
ATOM   2706 O O   . ARG A 1 356 ? 26.360  25.236  -12.009 1.00 56.87  ? 356  ARG A O   1 
ATOM   2707 C CB  . ARG A 1 356 ? 23.913  26.197  -14.045 1.00 60.37  ? 356  ARG A CB  1 
ATOM   2708 C CG  . ARG A 1 356 ? 24.380  24.871  -14.583 1.00 62.05  ? 356  ARG A CG  1 
ATOM   2709 C CD  . ARG A 1 356 ? 23.444  24.282  -15.613 1.00 64.51  ? 356  ARG A CD  1 
ATOM   2710 N NE  . ARG A 1 356 ? 23.686  22.843  -15.696 1.00 65.33  ? 356  ARG A NE  1 
ATOM   2711 C CZ  . ARG A 1 356 ? 23.025  21.922  -14.994 1.00 65.18  ? 356  ARG A CZ  1 
ATOM   2712 N NH1 . ARG A 1 356 ? 22.040  22.270  -14.162 1.00 63.57  ? 356  ARG A NH1 1 
ATOM   2713 N NH2 . ARG A 1 356 ? 23.331  20.638  -15.149 1.00 65.58  ? 356  ARG A NH2 1 
ATOM   2714 N N   . ALA A 1 357 ? 26.680  27.299  -12.854 1.00 58.32  ? 357  ALA A N   1 
ATOM   2715 C CA  . ALA A 1 357 ? 28.128  27.295  -12.641 1.00 57.56  ? 357  ALA A CA  1 
ATOM   2716 C C   . ALA A 1 357 ? 28.478  27.079  -11.158 1.00 55.66  ? 357  ALA A C   1 
ATOM   2717 O O   . ALA A 1 357 ? 29.302  26.231  -10.821 1.00 54.67  ? 357  ALA A O   1 
ATOM   2718 C CB  . ALA A 1 357 ? 28.752  28.582  -13.179 1.00 58.35  ? 357  ALA A CB  1 
ATOM   2719 N N   . GLN A 1 358 ? 27.830  27.830  -10.277 1.00 55.05  ? 358  GLN A N   1 
ATOM   2720 C CA  . GLN A 1 358 ? 28.073  27.686  -8.843  1.00 53.61  ? 358  GLN A CA  1 
ATOM   2721 C C   . GLN A 1 358 ? 27.732  26.286  -8.377  1.00 52.22  ? 358  GLN A C   1 
ATOM   2722 O O   . GLN A 1 358 ? 28.399  25.755  -7.520  1.00 51.46  ? 358  GLN A O   1 
ATOM   2723 C CB  . GLN A 1 358 ? 27.325  28.756  -8.032  1.00 53.50  ? 358  GLN A CB  1 
ATOM   2724 C CG  . GLN A 1 358 ? 27.917  30.158  -8.206  1.00 54.75  ? 358  GLN A CG  1 
ATOM   2725 C CD  . GLN A 1 358 ? 27.124  31.263  -7.510  1.00 56.74  ? 358  GLN A CD  1 
ATOM   2726 O OE1 . GLN A 1 358 ? 25.905  31.345  -7.621  1.00 57.91  ? 358  GLN A OE1 1 
ATOM   2727 N NE2 . GLN A 1 358 ? 27.829  32.136  -6.811  1.00 57.14  ? 358  GLN A NE2 1 
ATOM   2728 N N   . PHE A 1 359 ? 26.707  25.685  -8.973  1.00 52.44  ? 359  PHE A N   1 
ATOM   2729 C CA  . PHE A 1 359 ? 26.320  24.308  -8.681  1.00 51.10  ? 359  PHE A CA  1 
ATOM   2730 C C   . PHE A 1 359 ? 27.375  23.294  -9.128  1.00 51.36  ? 359  PHE A C   1 
ATOM   2731 O O   . PHE A 1 359 ? 27.784  22.484  -8.328  1.00 50.56  ? 359  PHE A O   1 
ATOM   2732 C CB  . PHE A 1 359 ? 24.935  24.002  -9.284  1.00 51.51  ? 359  PHE A CB  1 
ATOM   2733 C CG  . PHE A 1 359 ? 24.489  22.571  -9.132  1.00 49.71  ? 359  PHE A CG  1 
ATOM   2734 C CD1 . PHE A 1 359 ? 24.377  21.751  -10.236 1.00 49.91  ? 359  PHE A CD1 1 
ATOM   2735 C CD2 . PHE A 1 359 ? 24.164  22.051  -7.888  1.00 48.93  ? 359  PHE A CD2 1 
ATOM   2736 C CE1 . PHE A 1 359 ? 23.965  20.434  -10.109 1.00 49.36  ? 359  PHE A CE1 1 
ATOM   2737 C CE2 . PHE A 1 359 ? 23.759  20.722  -7.749  1.00 47.60  ? 359  PHE A CE2 1 
ATOM   2738 C CZ  . PHE A 1 359 ? 23.657  19.921  -8.862  1.00 48.62  ? 359  PHE A CZ  1 
ATOM   2739 N N   . LEU A 1 360 ? 27.811  23.329  -10.389 1.00 53.12  ? 360  LEU A N   1 
ATOM   2740 C CA  . LEU A 1 360 ? 28.860  22.420  -10.860 1.00 54.16  ? 360  LEU A CA  1 
ATOM   2741 C C   . LEU A 1 360 ? 30.095  22.548  -9.987  1.00 53.70  ? 360  LEU A C   1 
ATOM   2742 O O   . LEU A 1 360 ? 30.685  21.538  -9.614  1.00 53.46  ? 360  LEU A O   1 
ATOM   2743 C CB  . LEU A 1 360 ? 29.248  22.688  -12.317 1.00 56.04  ? 360  LEU A CB  1 
ATOM   2744 C CG  . LEU A 1 360 ? 28.186  22.633  -13.435 1.00 59.88  ? 360  LEU A CG  1 
ATOM   2745 C CD1 . LEU A 1 360 ? 28.745  23.032  -14.837 1.00 61.92  ? 360  LEU A CD1 1 
ATOM   2746 C CD2 . LEU A 1 360 ? 27.463  21.278  -13.505 1.00 60.35  ? 360  LEU A CD2 1 
ATOM   2747 N N   . ALA A 1 361 ? 30.489  23.791  -9.686  1.00 53.84  ? 361  ALA A N   1 
ATOM   2748 C CA  . ALA A 1 361 ? 31.590  24.080  -8.761  1.00 53.49  ? 361  ALA A CA  1 
ATOM   2749 C C   . ALA A 1 361 ? 31.356  23.456  -7.373  1.00 52.63  ? 361  ALA A C   1 
ATOM   2750 O O   . ALA A 1 361 ? 32.264  22.860  -6.795  1.00 53.09  ? 361  ALA A O   1 
ATOM   2751 C CB  . ALA A 1 361 ? 31.820  25.576  -8.644  1.00 53.02  ? 361  ALA A CB  1 
ATOM   2752 N N   . GLY A 1 362 ? 30.144  23.586  -6.850  1.00 51.93  ? 362  GLY A N   1 
ATOM   2753 C CA  . GLY A 1 362 ? 29.795  23.008  -5.580  1.00 50.97  ? 362  GLY A CA  1 
ATOM   2754 C C   . GLY A 1 362 ? 29.903  21.498  -5.562  1.00 51.37  ? 362  GLY A C   1 
ATOM   2755 O O   . GLY A 1 362 ? 30.318  20.930  -4.561  1.00 51.31  ? 362  GLY A O   1 
ATOM   2756 N N   . VAL A 1 363 ? 29.532  20.832  -6.651  1.00 52.41  ? 363  VAL A N   1 
ATOM   2757 C CA  . VAL A 1 363 ? 29.557  19.374  -6.689  1.00 52.60  ? 363  VAL A CA  1 
ATOM   2758 C C   . VAL A 1 363 ? 30.990  18.859  -6.603  1.00 53.62  ? 363  VAL A C   1 
ATOM   2759 O O   . VAL A 1 363 ? 31.246  17.811  -5.980  1.00 53.64  ? 363  VAL A O   1 
ATOM   2760 C CB  . VAL A 1 363 ? 28.844  18.830  -7.928  1.00 53.54  ? 363  VAL A CB  1 
ATOM   2761 C CG1 . VAL A 1 363 ? 29.050  17.324  -8.085  1.00 53.07  ? 363  VAL A CG1 1 
ATOM   2762 C CG2 . VAL A 1 363 ? 27.365  19.128  -7.828  1.00 53.27  ? 363  VAL A CG2 1 
ATOM   2763 N N   . ARG A 1 364 ? 31.916  19.612  -7.195  1.00 54.55  ? 364  ARG A N   1 
ATOM   2764 C CA  . ARG A 1 364 ? 33.337  19.296  -7.133  1.00 55.77  ? 364  ARG A CA  1 
ATOM   2765 C C   . ARG A 1 364 ? 33.888  19.317  -5.713  1.00 54.74  ? 364  ARG A C   1 
ATOM   2766 O O   . ARG A 1 364 ? 34.522  18.354  -5.284  1.00 54.73  ? 364  ARG A O   1 
ATOM   2767 C CB  . ARG A 1 364 ? 34.143  20.236  -8.027  1.00 57.48  ? 364  ARG A CB  1 
ATOM   2768 C CG  . ARG A 1 364 ? 34.034  19.924  -9.508  1.00 61.32  ? 364  ARG A CG  1 
ATOM   2769 C CD  . ARG A 1 364 ? 34.182  18.417  -9.781  1.00 65.96  ? 364  ARG A CD  1 
ATOM   2770 N NE  . ARG A 1 364 ? 34.871  18.194  -11.053 1.00 70.98  ? 364  ARG A NE  1 
ATOM   2771 C CZ  . ARG A 1 364 ? 35.782  17.241  -11.261 1.00 72.67  ? 364  ARG A CZ  1 
ATOM   2772 N NH1 . ARG A 1 364 ? 36.110  16.392  -10.279 1.00 70.53  ? 364  ARG A NH1 1 
ATOM   2773 N NH2 . ARG A 1 364 ? 36.368  17.140  -12.455 1.00 73.55  ? 364  ARG A NH2 1 
ATOM   2774 N N   . ILE A 1 365 ? 33.652  20.417  -5.003  1.00 54.00  ? 365  ILE A N   1 
ATOM   2775 C CA  . ILE A 1 365 ? 33.946  20.547  -3.581  1.00 52.86  ? 365  ILE A CA  1 
ATOM   2776 C C   . ILE A 1 365 ? 33.146  19.520  -2.747  1.00 52.19  ? 365  ILE A C   1 
ATOM   2777 O O   . ILE A 1 365 ? 33.621  19.021  -1.724  1.00 51.51  ? 365  ILE A O   1 
ATOM   2778 C CB  . ILE A 1 365 ? 33.568  21.962  -3.105  1.00 52.35  ? 365  ILE A CB  1 
ATOM   2779 C CG1 . ILE A 1 365 ? 34.353  23.012  -3.875  1.00 54.14  ? 365  ILE A CG1 1 
ATOM   2780 C CG2 . ILE A 1 365 ? 33.828  22.145  -1.633  1.00 51.52  ? 365  ILE A CG2 1 
ATOM   2781 C CD1 . ILE A 1 365 ? 33.968  24.412  -3.488  1.00 55.47  ? 365  ILE A CD1 1 
ATOM   2782 N N   . GLY A 1 366 ? 31.920  19.238  -3.167  1.00 52.26  ? 366  GLY A N   1 
ATOM   2783 C CA  . GLY A 1 366 ? 31.014  18.404  -2.375  1.00 52.09  ? 366  GLY A CA  1 
ATOM   2784 C C   . GLY A 1 366 ? 31.289  16.918  -2.529  1.00 52.50  ? 366  GLY A C   1 
ATOM   2785 O O   . GLY A 1 366 ? 30.995  16.116  -1.638  1.00 52.19  ? 366  GLY A O   1 
ATOM   2786 N N   . VAL A 1 367 ? 31.854  16.545  -3.667  1.00 53.38  ? 367  VAL A N   1 
ATOM   2787 C CA  . VAL A 1 367 ? 32.256  15.169  -3.891  1.00 53.99  ? 367  VAL A CA  1 
ATOM   2788 C C   . VAL A 1 367 ? 33.724  15.202  -4.346  1.00 54.87  ? 367  VAL A C   1 
ATOM   2789 O O   . VAL A 1 367 ? 34.022  14.902  -5.498  1.00 55.85  ? 367  VAL A O   1 
ATOM   2790 C CB  . VAL A 1 367 ? 31.338  14.489  -4.941  1.00 54.65  ? 367  VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 367 ? 31.402  13.003  -4.816  1.00 54.86  ? 367  VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 367 ? 29.902  14.932  -4.766  1.00 54.11  ? 367  VAL A CG2 1 
ATOM   2793 N N   . PRO A 1 368 ? 34.653  15.587  -3.440  1.00 54.82  ? 368  PRO A N   1 
ATOM   2794 C CA  . PRO A 1 368 ? 36.042  15.844  -3.847  1.00 55.79  ? 368  PRO A CA  1 
ATOM   2795 C C   . PRO A 1 368 ? 36.803  14.636  -4.369  1.00 57.50  ? 368  PRO A C   1 
ATOM   2796 O O   . PRO A 1 368 ? 37.750  14.790  -5.129  1.00 58.04  ? 368  PRO A O   1 
ATOM   2797 C CB  . PRO A 1 368 ? 36.688  16.381  -2.574  1.00 54.72  ? 368  PRO A CB  1 
ATOM   2798 C CG  . PRO A 1 368 ? 35.818  15.950  -1.480  1.00 53.44  ? 368  PRO A CG  1 
ATOM   2799 C CD  . PRO A 1 368 ? 34.439  15.938  -2.024  1.00 53.53  ? 368  PRO A CD  1 
ATOM   2800 N N   . GLN A 1 369 ? 36.368  13.442  -3.996  1.00 58.87  ? 369  GLN A N   1 
ATOM   2801 C CA  . GLN A 1 369 ? 37.083  12.215  -4.371  1.00 61.43  ? 369  GLN A CA  1 
ATOM   2802 C C   . GLN A 1 369 ? 36.732  11.725  -5.766  1.00 62.96  ? 369  GLN A C   1 
ATOM   2803 O O   . GLN A 1 369 ? 37.322  10.746  -6.247  1.00 64.54  ? 369  GLN A O   1 
ATOM   2804 C CB  . GLN A 1 369 ? 36.809  11.099  -3.352  1.00 61.62  ? 369  GLN A CB  1 
ATOM   2805 C CG  . GLN A 1 369 ? 35.431  10.432  -3.519  1.00 63.66  ? 369  GLN A CG  1 
ATOM   2806 C CD  . GLN A 1 369 ? 34.277  11.183  -2.839  1.00 64.51  ? 369  GLN A CD  1 
ATOM   2807 O OE1 . GLN A 1 369 ? 34.323  12.402  -2.589  1.00 63.12  ? 369  GLN A OE1 1 
ATOM   2808 N NE2 . GLN A 1 369 ? 33.225  10.437  -2.538  1.00 65.92  ? 369  GLN A NE2 1 
ATOM   2809 N N   . ALA A 1 370 ? 35.779  12.412  -6.399  1.00 63.18  ? 370  ALA A N   1 
ATOM   2810 C CA  . ALA A 1 370 ? 35.174  11.993  -7.667  1.00 64.54  ? 370  ALA A CA  1 
ATOM   2811 C C   . ALA A 1 370 ? 35.778  12.635  -8.921  1.00 65.85  ? 370  ALA A C   1 
ATOM   2812 O O   . ALA A 1 370 ? 35.958  13.857  -8.990  1.00 65.48  ? 370  ALA A O   1 
ATOM   2813 C CB  . ALA A 1 370 ? 33.667  12.235  -7.636  1.00 63.86  ? 370  ALA A CB  1 
ATOM   2814 N N   . SER A 1 371 ? 36.031  11.784  -9.916  1.00 67.48  ? 371  SER A N   1 
ATOM   2815 C CA  . SER A 1 371 ? 36.569  12.175  -11.213 1.00 69.29  ? 371  SER A CA  1 
ATOM   2816 C C   . SER A 1 371 ? 35.671  13.175  -11.928 1.00 69.30  ? 371  SER A C   1 
ATOM   2817 O O   . SER A 1 371 ? 34.610  13.536  -11.413 1.00 68.46  ? 371  SER A O   1 
ATOM   2818 C CB  . SER A 1 371 ? 36.709  10.929  -12.088 1.00 71.09  ? 371  SER A CB  1 
ATOM   2819 O OG  . SER A 1 371 ? 35.449  10.294  -12.248 1.00 71.78  ? 371  SER A OG  1 
ATOM   2820 N N   . ASP A 1 372 ? 36.082  13.602  -13.123 1.00 70.52  ? 372  ASP A N   1 
ATOM   2821 C CA  . ASP A 1 372 ? 35.234  14.459  -13.959 1.00 70.71  ? 372  ASP A CA  1 
ATOM   2822 C C   . ASP A 1 372 ? 33.935  13.775  -14.372 1.00 70.48  ? 372  ASP A C   1 
ATOM   2823 O O   . ASP A 1 372 ? 32.864  14.393  -14.338 1.00 69.93  ? 372  ASP A O   1 
ATOM   2824 C CB  . ASP A 1 372 ? 35.982  14.949  -15.196 1.00 72.61  ? 372  ASP A CB  1 
ATOM   2825 C CG  . ASP A 1 372 ? 37.057  15.942  -14.852 1.00 73.98  ? 372  ASP A CG  1 
ATOM   2826 O OD1 . ASP A 1 372 ? 38.059  15.513  -14.233 1.00 75.70  ? 372  ASP A OD1 1 
ATOM   2827 O OD2 . ASP A 1 372 ? 36.891  17.143  -15.179 1.00 74.95  ? 372  ASP A OD2 1 
ATOM   2828 N N   . LEU A 1 373 ? 34.046  12.505  -14.758 1.00 70.80  ? 373  LEU A N   1 
ATOM   2829 C CA  . LEU A 1 373 ? 32.901  11.725  -15.203 1.00 70.54  ? 373  LEU A CA  1 
ATOM   2830 C C   . LEU A 1 373 ? 31.881  11.599  -14.077 1.00 68.68  ? 373  LEU A C   1 
ATOM   2831 O O   . LEU A 1 373 ? 30.697  11.875  -14.267 1.00 68.68  ? 373  LEU A O   1 
ATOM   2832 C CB  . LEU A 1 373 ? 33.352  10.343  -15.694 1.00 71.84  ? 373  LEU A CB  1 
ATOM   2833 C CG  . LEU A 1 373 ? 32.303  9.435   -16.334 1.00 72.24  ? 373  LEU A CG  1 
ATOM   2834 C CD1 . LEU A 1 373 ? 31.592  10.118  -17.492 1.00 72.07  ? 373  LEU A CD1 1 
ATOM   2835 C CD2 . LEU A 1 373 ? 32.942  8.142   -16.791 1.00 73.53  ? 373  LEU A CD2 1 
ATOM   2836 N N   . ALA A 1 374 ? 32.360  11.212  -12.900 1.00 67.09  ? 374  ALA A N   1 
ATOM   2837 C CA  . ALA A 1 374 ? 31.502  10.990  -11.750 1.00 65.02  ? 374  ALA A CA  1 
ATOM   2838 C C   . ALA A 1 374 ? 30.813  12.262  -11.272 1.00 63.41  ? 374  ALA A C   1 
ATOM   2839 O O   . ALA A 1 374 ? 29.639  12.229  -10.925 1.00 62.72  ? 374  ALA A O   1 
ATOM   2840 C CB  . ALA A 1 374 ? 32.284  10.350  -10.647 1.00 64.25  ? 374  ALA A CB  1 
ATOM   2841 N N   . ALA A 1 375 ? 31.537  13.381  -11.266 1.00 62.96  ? 375  ALA A N   1 
ATOM   2842 C CA  . ALA A 1 375 ? 30.971  14.671  -10.861 1.00 61.88  ? 375  ALA A CA  1 
ATOM   2843 C C   . ALA A 1 375 ? 29.903  15.112  -11.844 1.00 62.89  ? 375  ALA A C   1 
ATOM   2844 O O   . ALA A 1 375 ? 28.931  15.767  -11.475 1.00 62.56  ? 375  ALA A O   1 
ATOM   2845 C CB  . ALA A 1 375 ? 32.054  15.723  -10.776 1.00 61.85  ? 375  ALA A CB  1 
ATOM   2846 N N   . GLU A 1 376 ? 30.098  14.758  -13.109 1.00 64.62  ? 376  GLU A N   1 
ATOM   2847 C CA  . GLU A 1 376 ? 29.115  15.044  -14.141 1.00 65.56  ? 376  GLU A CA  1 
ATOM   2848 C C   . GLU A 1 376 ? 27.924  14.100  -13.995 1.00 64.68  ? 376  GLU A C   1 
ATOM   2849 O O   . GLU A 1 376 ? 26.803  14.482  -14.304 1.00 64.95  ? 376  GLU A O   1 
ATOM   2850 C CB  . GLU A 1 376 ? 29.757  15.005  -15.538 1.00 67.57  ? 376  GLU A CB  1 
ATOM   2851 C CG  . GLU A 1 376 ? 28.940  15.660  -16.680 1.00 72.33  ? 376  GLU A CG  1 
ATOM   2852 C CD  . GLU A 1 376 ? 28.303  17.048  -16.353 1.00 75.73  ? 376  GLU A CD  1 
ATOM   2853 O OE1 . GLU A 1 376 ? 28.899  17.872  -15.608 1.00 75.20  ? 376  GLU A OE1 1 
ATOM   2854 O OE2 . GLU A 1 376 ? 27.190  17.319  -16.878 1.00 77.74  ? 376  GLU A OE2 1 
ATOM   2855 N N   . ALA A 1 377 ? 28.167  12.892  -13.483 1.00 63.67  ? 377  ALA A N   1 
ATOM   2856 C CA  . ALA A 1 377 ? 27.087  11.939  -13.189 1.00 63.07  ? 377  ALA A CA  1 
ATOM   2857 C C   . ALA A 1 377 ? 26.188  12.441  -12.067 1.00 61.29  ? 377  ALA A C   1 
ATOM   2858 O O   . ALA A 1 377 ? 24.968  12.309  -12.148 1.00 61.85  ? 377  ALA A O   1 
ATOM   2859 C CB  . ALA A 1 377 ? 27.633  10.561  -12.847 1.00 63.23  ? 377  ALA A CB  1 
ATOM   2860 N N   . VAL A 1 378 ? 26.796  13.014  -11.031 1.00 59.03  ? 378  VAL A N   1 
ATOM   2861 C CA  . VAL A 1 378 ? 26.052  13.572  -9.903  1.00 56.97  ? 378  VAL A CA  1 
ATOM   2862 C C   . VAL A 1 378 ? 25.185  14.724  -10.397 1.00 57.02  ? 378  VAL A C   1 
ATOM   2863 O O   . VAL A 1 378 ? 23.996  14.807  -10.081 1.00 57.05  ? 378  VAL A O   1 
ATOM   2864 C CB  . VAL A 1 378 ? 26.996  14.072  -8.771  1.00 55.38  ? 378  VAL A CB  1 
ATOM   2865 C CG1 . VAL A 1 378 ? 26.220  14.815  -7.725  1.00 53.51  ? 378  VAL A CG1 1 
ATOM   2866 C CG2 . VAL A 1 378 ? 27.749  12.908  -8.136  1.00 54.31  ? 378  VAL A CG2 1 
ATOM   2867 N N   . VAL A 1 379 ? 25.792  15.590  -11.197 1.00 57.23  ? 379  VAL A N   1 
ATOM   2868 C CA  . VAL A 1 379 ? 25.145  16.796  -11.695 1.00 57.13  ? 379  VAL A CA  1 
ATOM   2869 C C   . VAL A 1 379 ? 23.958  16.444  -12.589 1.00 58.49  ? 379  VAL A C   1 
ATOM   2870 O O   . VAL A 1 379 ? 22.896  17.078  -12.527 1.00 58.17  ? 379  VAL A O   1 
ATOM   2871 C CB  . VAL A 1 379 ? 26.160  17.676  -12.457 1.00 57.58  ? 379  VAL A CB  1 
ATOM   2872 C CG1 . VAL A 1 379 ? 25.447  18.648  -13.383 1.00 57.67  ? 379  VAL A CG1 1 
ATOM   2873 C CG2 . VAL A 1 379 ? 27.071  18.408  -11.464 1.00 55.41  ? 379  VAL A CG2 1 
ATOM   2874 N N   . LEU A 1 380 ? 24.136  15.411  -13.402 1.00 59.63  ? 380  LEU A N   1 
ATOM   2875 C CA  . LEU A 1 380 ? 23.057  14.950  -14.254 1.00 61.10  ? 380  LEU A CA  1 
ATOM   2876 C C   . LEU A 1 380 ? 21.934  14.345  -13.433 1.00 60.52  ? 380  LEU A C   1 
ATOM   2877 O O   . LEU A 1 380 ? 20.763  14.514  -13.762 1.00 61.73  ? 380  LEU A O   1 
ATOM   2878 C CB  . LEU A 1 380 ? 23.570  13.995  -15.332 1.00 62.76  ? 380  LEU A CB  1 
ATOM   2879 C CG  . LEU A 1 380 ? 24.617  14.619  -16.288 1.00 64.46  ? 380  LEU A CG  1 
ATOM   2880 C CD1 . LEU A 1 380 ? 24.972  13.670  -17.426 1.00 66.65  ? 380  LEU A CD1 1 
ATOM   2881 C CD2 . LEU A 1 380 ? 24.211  15.998  -16.856 1.00 64.73  ? 380  LEU A CD2 1 
ATOM   2882 N N   . HIS A 1 381 ? 22.289  13.680  -12.343 1.00 59.11  ? 381  HIS A N   1 
ATOM   2883 C CA  . HIS A 1 381 ? 21.288  13.062  -11.482 1.00 58.82  ? 381  HIS A CA  1 
ATOM   2884 C C   . HIS A 1 381 ? 20.464  14.074  -10.703 1.00 57.75  ? 381  HIS A C   1 
ATOM   2885 O O   . HIS A 1 381 ? 19.277  13.876  -10.503 1.00 57.83  ? 381  HIS A O   1 
ATOM   2886 C CB  . HIS A 1 381 ? 21.928  12.092  -10.502 1.00 58.02  ? 381  HIS A CB  1 
ATOM   2887 C CG  . HIS A 1 381 ? 20.936  11.356  -9.671  1.00 58.11  ? 381  HIS A CG  1 
ATOM   2888 N ND1 . HIS A 1 381 ? 20.406  10.147  -10.053 1.00 60.88  ? 381  HIS A ND1 1 
ATOM   2889 C CD2 . HIS A 1 381 ? 20.355  11.666  -8.489  1.00 58.52  ? 381  HIS A CD2 1 
ATOM   2890 C CE1 . HIS A 1 381 ? 19.553  9.730   -9.133  1.00 61.15  ? 381  HIS A CE1 1 
ATOM   2891 N NE2 . HIS A 1 381 ? 19.505  10.633  -8.170  1.00 59.31  ? 381  HIS A NE2 1 
ATOM   2892 N N   . TYR A 1 382 ? 21.110  15.147  -10.263 1.00 56.43  ? 382  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 382 ? 20.472  16.146  -9.426  1.00 55.16  ? 382  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 382 ? 19.918  17.326  -10.198 1.00 56.04  ? 382  TYR A C   1 
ATOM   2895 O O   . TYR A 1 382 ? 19.233  18.162  -9.620  1.00 56.06  ? 382  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 382 ? 21.447  16.620  -8.347  1.00 53.48  ? 382  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 382 ? 21.557  15.639  -7.199  1.00 52.13  ? 382  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 382 ? 22.371  14.512  -7.292  1.00 51.19  ? 382  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 382 ? 20.821  15.823  -6.029  1.00 50.52  ? 382  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 382 ? 22.452  13.603  -6.256  1.00 49.32  ? 382  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 382 ? 20.910  14.930  -4.992  1.00 49.31  ? 382  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 382 ? 21.724  13.823  -5.117  1.00 49.16  ? 382  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 382 ? 21.821  12.945  -4.085  1.00 48.94  ? 382  TYR A OH  1 
ATOM   2904 N N   . THR A 1 383 ? 20.207  17.417  -11.493 1.00 57.42  ? 383  THR A N   1 
ATOM   2905 C CA  . THR A 1 383 ? 19.599  18.467  -12.313 1.00 58.27  ? 383  THR A CA  1 
ATOM   2906 C C   . THR A 1 383 ? 18.112  18.177  -12.478 1.00 60.02  ? 383  THR A C   1 
ATOM   2907 O O   . THR A 1 383 ? 17.690  17.026  -12.642 1.00 61.19  ? 383  THR A O   1 
ATOM   2908 C CB  . THR A 1 383 ? 20.281  18.608  -13.696 1.00 59.00  ? 383  THR A CB  1 
ATOM   2909 O OG1 . THR A 1 383 ? 21.636  19.003  -13.519 1.00 57.88  ? 383  THR A OG1 1 
ATOM   2910 C CG2 . THR A 1 383 ? 19.615  19.668  -14.550 1.00 59.79  ? 383  THR A CG2 1 
ATOM   2911 N N   . ASP A 1 384 ? 17.307  19.222  -12.397 1.00 61.15  ? 384  ASP A N   1 
ATOM   2912 C CA  . ASP A 1 384 ? 15.913  19.115  -12.764 1.00 63.16  ? 384  ASP A CA  1 
ATOM   2913 C C   . ASP A 1 384 ? 15.850  19.556  -14.205 1.00 64.59  ? 384  ASP A C   1 
ATOM   2914 O O   . ASP A 1 384 ? 15.871  20.750  -14.487 1.00 65.04  ? 384  ASP A O   1 
ATOM   2915 C CB  . ASP A 1 384 ? 15.064  20.032  -11.891 1.00 63.32  ? 384  ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 384 ? 13.666  20.221  -12.434 1.00 67.62  ? 384  ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 384 ? 13.144  19.288  -13.094 1.00 70.60  ? 384  ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 384 ? 13.094  21.314  -12.206 1.00 70.76  ? 384  ASP A OD2 1 
ATOM   2919 N N   . TRP A 1 385 ? 15.777  18.595  -15.121 1.00 65.81  ? 385  TRP A N   1 
ATOM   2920 C CA  . TRP A 1 385 ? 15.877  18.898  -16.551 1.00 67.12  ? 385  TRP A CA  1 
ATOM   2921 C C   . TRP A 1 385 ? 14.697  19.691  -17.108 1.00 68.95  ? 385  TRP A C   1 
ATOM   2922 O O   . TRP A 1 385 ? 14.662  20.045  -18.281 1.00 70.60  ? 385  TRP A O   1 
ATOM   2923 C CB  . TRP A 1 385 ? 16.159  17.625  -17.333 1.00 67.68  ? 385  TRP A CB  1 
ATOM   2924 C CG  . TRP A 1 385 ? 17.492  17.117  -16.969 1.00 64.41  ? 385  TRP A CG  1 
ATOM   2925 C CD1 . TRP A 1 385 ? 17.776  16.087  -16.132 1.00 61.59  ? 385  TRP A CD1 1 
ATOM   2926 C CD2 . TRP A 1 385 ? 18.743  17.665  -17.377 1.00 62.57  ? 385  TRP A CD2 1 
ATOM   2927 N NE1 . TRP A 1 385 ? 19.137  15.932  -16.014 1.00 59.34  ? 385  TRP A NE1 1 
ATOM   2928 C CE2 . TRP A 1 385 ? 19.755  16.890  -16.768 1.00 60.42  ? 385  TRP A CE2 1 
ATOM   2929 C CE3 . TRP A 1 385 ? 19.109  18.734  -18.210 1.00 63.77  ? 385  TRP A CE3 1 
ATOM   2930 C CZ2 . TRP A 1 385 ? 21.116  17.149  -16.955 1.00 60.86  ? 385  TRP A CZ2 1 
ATOM   2931 C CZ3 . TRP A 1 385 ? 20.470  18.995  -18.408 1.00 64.18  ? 385  TRP A CZ3 1 
ATOM   2932 C CH2 . TRP A 1 385 ? 21.461  18.196  -17.776 1.00 63.20  ? 385  TRP A CH2 1 
ATOM   2933 N N   . LEU A 1 386 ? 13.748  19.983  -16.235 1.00 69.06  ? 386  LEU A N   1 
ATOM   2934 C CA  . LEU A 1 386 ? 12.606  20.790  -16.589 1.00 70.86  ? 386  LEU A CA  1 
ATOM   2935 C C   . LEU A 1 386 ? 12.887  22.276  -16.334 1.00 70.53  ? 386  LEU A C   1 
ATOM   2936 O O   . LEU A 1 386 ? 12.381  23.148  -17.043 1.00 71.96  ? 386  LEU A O   1 
ATOM   2937 C CB  . LEU A 1 386 ? 11.409  20.314  -15.773 1.00 71.18  ? 386  LEU A CB  1 
ATOM   2938 C CG  . LEU A 1 386 ? 10.017  20.502  -16.345 1.00 73.21  ? 386  LEU A CG  1 
ATOM   2939 C CD1 . LEU A 1 386 ? 10.036  20.418  -17.867 1.00 75.77  ? 386  LEU A CD1 1 
ATOM   2940 C CD2 . LEU A 1 386 ? 9.150   19.430  -15.732 1.00 74.87  ? 386  LEU A CD2 1 
ATOM   2941 N N   . HIS A 1 387 ? 13.665  22.546  -15.290 1.00 68.95  ? 387  HIS A N   1 
ATOM   2942 C CA  . HIS A 1 387 ? 14.158  23.887  -14.993 1.00 68.56  ? 387  HIS A CA  1 
ATOM   2943 C C   . HIS A 1 387 ? 15.638  23.783  -14.572 1.00 66.59  ? 387  HIS A C   1 
ATOM   2944 O O   . HIS A 1 387 ? 15.966  23.914  -13.392 1.00 65.13  ? 387  HIS A O   1 
ATOM   2945 C CB  . HIS A 1 387 ? 13.334  24.544  -13.884 1.00 68.38  ? 387  HIS A CB  1 
ATOM   2946 C CG  . HIS A 1 387 ? 11.857  24.334  -14.006 1.00 71.20  ? 387  HIS A CG  1 
ATOM   2947 N ND1 . HIS A 1 387 ? 11.164  23.442  -13.212 1.00 71.57  ? 387  HIS A ND1 1 
ATOM   2948 C CD2 . HIS A 1 387 ? 10.935  24.914  -14.812 1.00 74.41  ? 387  HIS A CD2 1 
ATOM   2949 C CE1 . HIS A 1 387 ? 9.880   23.481  -13.521 1.00 73.13  ? 387  HIS A CE1 1 
ATOM   2950 N NE2 . HIS A 1 387 ? 9.713   24.366  -14.490 1.00 75.56  ? 387  HIS A NE2 1 
ATOM   2951 N N   . PRO A 1 388 ? 16.535  23.548  -15.542 1.00 66.61  ? 388  PRO A N   1 
ATOM   2952 C CA  . PRO A 1 388 ? 17.929  23.233  -15.242 1.00 65.08  ? 388  PRO A CA  1 
ATOM   2953 C C   . PRO A 1 388 ? 18.771  24.444  -14.805 1.00 63.95  ? 388  PRO A C   1 
ATOM   2954 O O   . PRO A 1 388 ? 19.954  24.294  -14.474 1.00 62.89  ? 388  PRO A O   1 
ATOM   2955 C CB  . PRO A 1 388 ? 18.441  22.668  -16.571 1.00 66.18  ? 388  PRO A CB  1 
ATOM   2956 C CG  . PRO A 1 388 ? 17.649  23.382  -17.607 1.00 68.11  ? 388  PRO A CG  1 
ATOM   2957 C CD  . PRO A 1 388 ? 16.303  23.697  -16.994 1.00 68.60  ? 388  PRO A CD  1 
ATOM   2958 N N   . GLU A 1 389 ? 18.149  25.618  -14.794 1.00 64.33  ? 389  GLU A N   1 
ATOM   2959 C CA  . GLU A 1 389 ? 18.830  26.890  -14.545 1.00 63.92  ? 389  GLU A CA  1 
ATOM   2960 C C   . GLU A 1 389 ? 18.191  27.608  -13.362 1.00 62.54  ? 389  GLU A C   1 
ATOM   2961 O O   . GLU A 1 389 ? 18.537  28.749  -13.060 1.00 63.06  ? 389  GLU A O   1 
ATOM   2962 C CB  . GLU A 1 389 ? 18.762  27.797  -15.791 1.00 65.87  ? 389  GLU A CB  1 
ATOM   2963 C CG  . GLU A 1 389 ? 19.616  27.348  -16.999 1.00 68.55  ? 389  GLU A CG  1 
ATOM   2964 C CD  . GLU A 1 389 ? 21.075  27.833  -16.944 1.00 71.98  ? 389  GLU A CD  1 
ATOM   2965 O OE1 . GLU A 1 389 ? 21.730  27.813  -15.862 1.00 71.26  ? 389  GLU A OE1 1 
ATOM   2966 O OE2 . GLU A 1 389 ? 21.581  28.238  -18.010 1.00 74.66  ? 389  GLU A OE2 1 
ATOM   2967 N N   . ASP A 1 390 ? 17.250  26.943  -12.706 1.00 60.70  ? 390  ASP A N   1 
ATOM   2968 C CA  . ASP A 1 390 ? 16.471  27.574  -11.659 1.00 59.48  ? 390  ASP A CA  1 
ATOM   2969 C C   . ASP A 1 390 ? 17.258  27.657  -10.344 1.00 57.30  ? 390  ASP A C   1 
ATOM   2970 O O   . ASP A 1 390 ? 17.590  26.635  -9.753  1.00 55.64  ? 390  ASP A O   1 
ATOM   2971 C CB  . ASP A 1 390 ? 15.133  26.849  -11.470 1.00 59.78  ? 390  ASP A CB  1 
ATOM   2972 C CG  . ASP A 1 390 ? 14.372  27.348  -10.272 1.00 59.18  ? 390  ASP A CG  1 
ATOM   2973 O OD1 . ASP A 1 390 ? 13.795  28.438  -10.314 1.00 60.06  ? 390  ASP A OD1 1 
ATOM   2974 O OD2 . ASP A 1 390 ? 14.367  26.652  -9.261  1.00 59.68  ? 390  ASP A OD2 1 
ATOM   2975 N N   . PRO A 1 391 ? 17.534  28.887  -9.881  1.00 56.92  ? 391  PRO A N   1 
ATOM   2976 C CA  . PRO A 1 391 ? 18.419  29.158  -8.757  1.00 55.49  ? 391  PRO A CA  1 
ATOM   2977 C C   . PRO A 1 391 ? 18.006  28.430  -7.507  1.00 54.35  ? 391  PRO A C   1 
ATOM   2978 O O   . PRO A 1 391 ? 18.862  27.818  -6.856  1.00 53.64  ? 391  PRO A O   1 
ATOM   2979 C CB  . PRO A 1 391 ? 18.270  30.663  -8.556  1.00 56.05  ? 391  PRO A CB  1 
ATOM   2980 C CG  . PRO A 1 391 ? 17.882  31.164  -9.850  1.00 57.41  ? 391  PRO A CG  1 
ATOM   2981 C CD  . PRO A 1 391 ? 16.985  30.134  -10.431 1.00 58.11  ? 391  PRO A CD  1 
ATOM   2982 N N   . THR A 1 392 ? 16.711  28.486  -7.183  1.00 54.82  ? 392  THR A N   1 
ATOM   2983 C CA  . THR A 1 392 ? 16.144  27.756  -6.040  1.00 53.71  ? 392  THR A CA  1 
ATOM   2984 C C   . THR A 1 392 ? 16.360  26.247  -6.120  1.00 52.30  ? 392  THR A C   1 
ATOM   2985 O O   . THR A 1 392 ? 16.788  25.654  -5.137  1.00 51.57  ? 392  THR A O   1 
ATOM   2986 C CB  . THR A 1 392 ? 14.652  28.064  -5.820  1.00 54.89  ? 392  THR A CB  1 
ATOM   2987 O OG1 . THR A 1 392 ? 14.500  29.446  -5.490  1.00 56.87  ? 392  THR A OG1 1 
ATOM   2988 C CG2 . THR A 1 392 ? 14.085  27.241  -4.672  1.00 54.44  ? 392  THR A CG2 1 
ATOM   2989 N N   . HIS A 1 393 ? 16.071  25.607  -7.253  1.00 52.55  ? 393  HIS A N   1 
ATOM   2990 C CA  A HIS A 1 393 ? 16.312  24.170  -7.318  0.50 51.59  ? 393  HIS A CA  1 
ATOM   2991 C CA  B HIS A 1 393 ? 16.291  24.169  -7.385  0.50 52.07  ? 393  HIS A CA  1 
ATOM   2992 C C   . HIS A 1 393 ? 17.784  23.843  -7.234  1.00 50.60  ? 393  HIS A C   1 
ATOM   2993 O O   . HIS A 1 393 ? 18.158  22.905  -6.543  1.00 50.43  ? 393  HIS A O   1 
ATOM   2994 C CB  A HIS A 1 393 ? 15.722  23.477  -8.536  0.50 52.46  ? 393  HIS A CB  1 
ATOM   2995 C CB  B HIS A 1 393 ? 15.734  23.637  -8.718  0.50 53.43  ? 393  HIS A CB  1 
ATOM   2996 C CG  A HIS A 1 393 ? 16.077  22.021  -8.594  0.50 51.43  ? 393  HIS A CG  1 
ATOM   2997 C CG  B HIS A 1 393 ? 14.238  23.482  -8.750  0.50 55.54  ? 393  HIS A CG  1 
ATOM   2998 N ND1 A HIS A 1 393 ? 15.489  21.080  -7.774  0.50 50.35  ? 393  HIS A ND1 1 
ATOM   2999 N ND1 B HIS A 1 393 ? 13.524  22.868  -7.740  0.50 56.74  ? 393  HIS A ND1 1 
ATOM   3000 C CD2 A HIS A 1 393 ? 17.007  21.359  -9.322  0.50 50.34  ? 393  HIS A CD2 1 
ATOM   3001 C CD2 B HIS A 1 393 ? 13.327  23.828  -9.692  0.50 57.96  ? 393  HIS A CD2 1 
ATOM   3002 C CE1 A HIS A 1 393 ? 16.009  19.894  -8.030  0.50 50.74  ? 393  HIS A CE1 1 
ATOM   3003 C CE1 B HIS A 1 393 ? 12.239  22.859  -8.051  0.50 57.87  ? 393  HIS A CE1 1 
ATOM   3004 N NE2 A HIS A 1 393 ? 16.932  20.037  -8.966  0.50 50.16  ? 393  HIS A NE2 1 
ATOM   3005 N NE2 B HIS A 1 393 ? 12.093  23.437  -9.231  0.50 58.59  ? 393  HIS A NE2 1 
ATOM   3006 N N   . LEU A 1 394 ? 18.628  24.625  -7.897  1.00 50.43  ? 394  LEU A N   1 
ATOM   3007 C CA  . LEU A 1 394 ? 20.063  24.395  -7.842  1.00 49.29  ? 394  LEU A CA  1 
ATOM   3008 C C   . LEU A 1 394 ? 20.588  24.463  -6.405  1.00 48.14  ? 394  LEU A C   1 
ATOM   3009 O O   . LEU A 1 394 ? 21.304  23.562  -5.928  1.00 46.46  ? 394  LEU A O   1 
ATOM   3010 C CB  . LEU A 1 394 ? 20.798  25.382  -8.744  1.00 49.90  ? 394  LEU A CB  1 
ATOM   3011 C CG  . LEU A 1 394 ? 20.676  25.051  -10.230 1.00 51.13  ? 394  LEU A CG  1 
ATOM   3012 C CD1 . LEU A 1 394 ? 21.259  26.166  -11.056 1.00 52.36  ? 394  LEU A CD1 1 
ATOM   3013 C CD2 . LEU A 1 394 ? 21.328  23.708  -10.589 1.00 49.35  ? 394  LEU A CD2 1 
ATOM   3014 N N   . ARG A 1 395 ? 20.201  25.529  -5.717  1.00 48.20  ? 395  ARG A N   1 
ATOM   3015 C CA  . ARG A 1 395 ? 20.508  25.652  -4.316  1.00 47.51  ? 395  ARG A CA  1 
ATOM   3016 C C   . ARG A 1 395 ? 20.118  24.396  -3.557  1.00 47.24  ? 395  ARG A C   1 
ATOM   3017 O O   . ARG A 1 395 ? 20.970  23.800  -2.906  1.00 47.52  ? 395  ARG A O   1 
ATOM   3018 C CB  . ARG A 1 395 ? 19.849  26.893  -3.732  1.00 47.61  ? 395  ARG A CB  1 
ATOM   3019 C CG  . ARG A 1 395 ? 20.036  27.031  -2.266  1.00 45.04  ? 395  ARG A CG  1 
ATOM   3020 C CD  . ARG A 1 395 ? 18.713  26.890  -1.616  1.00 45.88  ? 395  ARG A CD  1 
ATOM   3021 N NE  . ARG A 1 395 ? 18.080  28.179  -1.394  1.00 46.36  ? 395  ARG A NE  1 
ATOM   3022 C CZ  . ARG A 1 395 ? 16.769  28.352  -1.261  1.00 47.04  ? 395  ARG A CZ  1 
ATOM   3023 N NH1 . ARG A 1 395 ? 15.934  27.327  -1.365  1.00 43.67  ? 395  ARG A NH1 1 
ATOM   3024 N NH2 . ARG A 1 395 ? 16.297  29.574  -1.054  1.00 50.51  ? 395  ARG A NH2 1 
ATOM   3025 N N   . ASP A 1 396 ? 18.863  23.972  -3.662  1.00 47.83  ? 396  ASP A N   1 
ATOM   3026 C CA  . ASP A 1 396 ? 18.387  22.822  -2.894  1.00 48.07  ? 396  ASP A CA  1 
ATOM   3027 C C   . ASP A 1 396 ? 19.038  21.508  -3.329  1.00 47.71  ? 396  ASP A C   1 
ATOM   3028 O O   . ASP A 1 396 ? 19.163  20.588  -2.532  1.00 47.09  ? 396  ASP A O   1 
ATOM   3029 C CB  . ASP A 1 396 ? 16.854  22.711  -2.931  1.00 49.27  ? 396  ASP A CB  1 
ATOM   3030 C CG  . ASP A 1 396 ? 16.156  23.930  -2.307  1.00 50.95  ? 396  ASP A CG  1 
ATOM   3031 O OD1 . ASP A 1 396 ? 16.789  24.615  -1.458  1.00 51.11  ? 396  ASP A OD1 1 
ATOM   3032 O OD2 . ASP A 1 396 ? 14.981  24.197  -2.666  1.00 50.68  ? 396  ASP A OD2 1 
ATOM   3033 N N   . ALA A 1 397 ? 19.459  21.433  -4.584  1.00 48.38  ? 397  ALA A N   1 
ATOM   3034 C CA  . ALA A 1 397 ? 20.144  20.244  -5.086  1.00 48.81  ? 397  ALA A CA  1 
ATOM   3035 C C   . ALA A 1 397 ? 21.555  20.119  -4.516  1.00 47.88  ? 397  ALA A C   1 
ATOM   3036 O O   . ALA A 1 397 ? 22.000  19.016  -4.191  1.00 47.23  ? 397  ALA A O   1 
ATOM   3037 C CB  . ALA A 1 397 ? 20.186  20.260  -6.588  1.00 50.22  ? 397  ALA A CB  1 
ATOM   3038 N N   . MET A 1 398 ? 22.240  21.260  -4.394  1.00 47.63  ? 398  MET A N   1 
ATOM   3039 C CA  . MET A 1 398 ? 23.534  21.332  -3.742  1.00 46.38  ? 398  MET A CA  1 
ATOM   3040 C C   . MET A 1 398 ? 23.391  20.815  -2.341  1.00 45.34  ? 398  MET A C   1 
ATOM   3041 O O   . MET A 1 398 ? 24.190  19.979  -1.900  1.00 45.12  ? 398  MET A O   1 
ATOM   3042 C CB  . MET A 1 398 ? 24.036  22.767  -3.676  1.00 46.94  ? 398  MET A CB  1 
ATOM   3043 C CG  . MET A 1 398 ? 25.540  22.897  -3.418  1.00 45.98  ? 398  MET A CG  1 
ATOM   3044 S SD  . MET A 1 398 ? 26.497  21.994  -4.650  1.00 46.78  ? 398  MET A SD  1 
ATOM   3045 C CE  . MET A 1 398 ? 27.073  20.584  -3.696  1.00 44.14  ? 398  MET A CE  1 
ATOM   3046 N N   . SER A 1 399 ? 22.369  21.302  -1.635  1.00 44.62  ? 399  SER A N   1 
ATOM   3047 C CA  . SER A 1 399 ? 22.117  20.805  -0.283  1.00 42.86  ? 399  SER A CA  1 
ATOM   3048 C C   . SER A 1 399 ? 21.847  19.297  -0.288  1.00 42.58  ? 399  SER A C   1 
ATOM   3049 O O   . SER A 1 399 ? 22.426  18.575  0.513   1.00 42.16  ? 399  SER A O   1 
ATOM   3050 C CB  . SER A 1 399 ? 21.016  21.578  0.394   1.00 42.53  ? 399  SER A CB  1 
ATOM   3051 O OG  . SER A 1 399 ? 20.618  20.963  1.597   1.00 41.94  ? 399  SER A OG  1 
ATOM   3052 N N   . ALA A 1 400 ? 21.030  18.813  -1.219  1.00 42.93  ? 400  ALA A N   1 
ATOM   3053 C CA  . ALA A 1 400 ? 20.714  17.387  -1.284  1.00 43.15  ? 400  ALA A CA  1 
ATOM   3054 C C   . ALA A 1 400 ? 21.943  16.504  -1.572  1.00 43.49  ? 400  ALA A C   1 
ATOM   3055 O O   . ALA A 1 400 ? 22.047  15.406  -1.053  1.00 43.50  ? 400  ALA A O   1 
ATOM   3056 C CB  . ALA A 1 400 ? 19.613  17.128  -2.280  1.00 44.05  ? 400  ALA A CB  1 
ATOM   3057 N N   . VAL A 1 401 ? 22.879  17.003  -2.380  1.00 44.44  ? 401  VAL A N   1 
ATOM   3058 C CA  . VAL A 1 401 ? 24.056  16.236  -2.800  1.00 44.00  ? 401  VAL A CA  1 
ATOM   3059 C C   . VAL A 1 401 ? 24.918  15.984  -1.589  1.00 43.31  ? 401  VAL A C   1 
ATOM   3060 O O   . VAL A 1 401 ? 25.239  14.831  -1.279  1.00 43.41  ? 401  VAL A O   1 
ATOM   3061 C CB  . VAL A 1 401 ? 24.887  16.993  -3.862  1.00 44.71  ? 401  VAL A CB  1 
ATOM   3062 C CG1 . VAL A 1 401 ? 26.259  16.348  -4.036  1.00 44.04  ? 401  VAL A CG1 1 
ATOM   3063 C CG2 . VAL A 1 401 ? 24.154  17.041  -5.190  1.00 44.53  ? 401  VAL A CG2 1 
ATOM   3064 N N   . VAL A 1 402 ? 25.269  17.067  -0.893  1.00 42.58  ? 402  VAL A N   1 
ATOM   3065 C CA  . VAL A 1 402 ? 26.086  16.987  0.315   1.00 41.61  ? 402  VAL A CA  1 
ATOM   3066 C C   . VAL A 1 402 ? 25.404  16.097  1.372   1.00 42.16  ? 402  VAL A C   1 
ATOM   3067 O O   . VAL A 1 402 ? 26.033  15.183  1.952   1.00 42.42  ? 402  VAL A O   1 
ATOM   3068 C CB  . VAL A 1 402 ? 26.368  18.382  0.894   1.00 41.09  ? 402  VAL A CB  1 
ATOM   3069 C CG1 . VAL A 1 402 ? 27.148  18.264  2.184   1.00 38.74  ? 402  VAL A CG1 1 
ATOM   3070 C CG2 . VAL A 1 402 ? 27.104  19.234  -0.125  1.00 39.51  ? 402  VAL A CG2 1 
ATOM   3071 N N   . GLY A 1 403 ? 24.114  16.344  1.586   1.00 42.16  ? 403  GLY A N   1 
ATOM   3072 C CA  . GLY A 1 403 ? 23.310  15.541  2.497   1.00 42.03  ? 403  GLY A CA  1 
ATOM   3073 C C   . GLY A 1 403 ? 23.240  14.081  2.113   1.00 43.02  ? 403  GLY A C   1 
ATOM   3074 O O   . GLY A 1 403 ? 23.477  13.221  2.949   1.00 42.89  ? 403  GLY A O   1 
ATOM   3075 N N   . ASP A 1 404 ? 22.925  13.793  0.852   1.00 44.08  ? 404  ASP A N   1 
ATOM   3076 C CA  . ASP A 1 404 ? 22.703  12.411  0.416   1.00 45.11  ? 404  ASP A CA  1 
ATOM   3077 C C   . ASP A 1 404 ? 23.991  11.599  0.429   1.00 45.38  ? 404  ASP A C   1 
ATOM   3078 O O   . ASP A 1 404 ? 24.007  10.433  0.834   1.00 45.44  ? 404  ASP A O   1 
ATOM   3079 C CB  . ASP A 1 404 ? 22.119  12.368  -0.988  1.00 45.91  ? 404  ASP A CB  1 
ATOM   3080 C CG  . ASP A 1 404 ? 20.719  12.890  -1.055  1.00 46.53  ? 404  ASP A CG  1 
ATOM   3081 O OD1 . ASP A 1 404 ? 20.037  12.917  -0.014  1.00 47.57  ? 404  ASP A OD1 1 
ATOM   3082 O OD2 . ASP A 1 404 ? 20.284  13.273  -2.164  1.00 48.21  ? 404  ASP A OD2 1 
ATOM   3083 N N   . HIS A 1 405 ? 25.063  12.250  -0.009  1.00 45.25  ? 405  HIS A N   1 
ATOM   3084 C CA  . HIS A 1 405 ? 26.361  11.625  -0.166  1.00 45.22  ? 405  HIS A CA  1 
ATOM   3085 C C   . HIS A 1 405 ? 27.016  11.296  1.162   1.00 44.86  ? 405  HIS A C   1 
ATOM   3086 O O   . HIS A 1 405 ? 27.522  10.194  1.319   1.00 45.58  ? 405  HIS A O   1 
ATOM   3087 C CB  . HIS A 1 405 ? 27.266  12.551  -0.974  1.00 45.13  ? 405  HIS A CB  1 
ATOM   3088 C CG  . HIS A 1 405 ? 28.672  12.079  -1.084  1.00 42.76  ? 405  HIS A CG  1 
ATOM   3089 N ND1 . HIS A 1 405 ? 28.992  10.771  -1.367  1.00 42.99  ? 405  HIS A ND1 1 
ATOM   3090 C CD2 . HIS A 1 405 ? 29.843  12.741  -0.971  1.00 40.71  ? 405  HIS A CD2 1 
ATOM   3091 C CE1 . HIS A 1 405 ? 30.303  10.646  -1.432  1.00 42.53  ? 405  HIS A CE1 1 
ATOM   3092 N NE2 . HIS A 1 405 ? 30.843  11.827  -1.193  1.00 42.82  ? 405  HIS A NE2 1 
ATOM   3093 N N   . ASN A 1 406 ? 27.004  12.249  2.098   1.00 43.90  ? 406  ASN A N   1 
ATOM   3094 C CA  . ASN A 1 406 ? 27.671  12.104  3.387   1.00 43.33  ? 406  ASN A CA  1 
ATOM   3095 C C   . ASN A 1 406 ? 26.829  11.508  4.509   1.00 43.46  ? 406  ASN A C   1 
ATOM   3096 O O   . ASN A 1 406 ? 27.377  10.901  5.456   1.00 44.12  ? 406  ASN A O   1 
ATOM   3097 C CB  . ASN A 1 406 ? 28.186  13.456  3.870   1.00 42.83  ? 406  ASN A CB  1 
ATOM   3098 C CG  . ASN A 1 406 ? 29.196  14.065  2.928   1.00 43.44  ? 406  ASN A CG  1 
ATOM   3099 O OD1 . ASN A 1 406 ? 30.342  13.628  2.856   1.00 44.16  ? 406  ASN A OD1 1 
ATOM   3100 N ND2 . ASN A 1 406 ? 28.782  15.103  2.223   1.00 43.33  ? 406  ASN A ND2 1 
ATOM   3101 N N   . VAL A 1 407 ? 25.511  11.686  4.451   1.00 43.27  ? 407  VAL A N   1 
ATOM   3102 C CA  . VAL A 1 407 ? 24.658  11.183  5.537   1.00 42.62  ? 407  VAL A CA  1 
ATOM   3103 C C   . VAL A 1 407 ? 23.581  10.182  5.094   1.00 43.73  ? 407  VAL A C   1 
ATOM   3104 O O   . VAL A 1 407 ? 23.617  9.019   5.519   1.00 44.73  ? 407  VAL A O   1 
ATOM   3105 C CB  . VAL A 1 407 ? 24.046  12.329  6.394   1.00 41.72  ? 407  VAL A CB  1 
ATOM   3106 C CG1 . VAL A 1 407 ? 23.233  11.763  7.563   1.00 40.94  ? 407  VAL A CG1 1 
ATOM   3107 C CG2 . VAL A 1 407 ? 25.133  13.254  6.926   1.00 39.97  ? 407  VAL A CG2 1 
ATOM   3108 N N   . VAL A 1 408 ? 22.643  10.607  4.247   1.00 43.68  ? 408  VAL A N   1 
ATOM   3109 C CA  . VAL A 1 408 ? 21.425  9.825   4.031   1.00 44.54  ? 408  VAL A CA  1 
ATOM   3110 C C   . VAL A 1 408 ? 21.709  8.429   3.421   1.00 46.39  ? 408  VAL A C   1 
ATOM   3111 O O   . VAL A 1 408 ? 21.091  7.420   3.812   1.00 46.79  ? 408  VAL A O   1 
ATOM   3112 C CB  . VAL A 1 408 ? 20.362  10.596  3.197   1.00 44.85  ? 408  VAL A CB  1 
ATOM   3113 C CG1 . VAL A 1 408 ? 19.072  9.811   3.116   1.00 45.28  ? 408  VAL A CG1 1 
ATOM   3114 C CG2 . VAL A 1 408 ? 20.088  11.987  3.777   1.00 43.34  ? 408  VAL A CG2 1 
ATOM   3115 N N   . CYS A 1 409 ? 22.646  8.374   2.476   1.00 46.41  ? 409  CYS A N   1 
ATOM   3116 C CA  . CYS A 1 409 ? 22.882  7.137   1.768   1.00 47.71  ? 409  CYS A CA  1 
ATOM   3117 C C   . CYS A 1 409 ? 23.809  6.191   2.535   1.00 48.10  ? 409  CYS A C   1 
ATOM   3118 O O   . CYS A 1 409 ? 23.628  4.955   2.479   1.00 49.31  ? 409  CYS A O   1 
ATOM   3119 C CB  . CYS A 1 409 ? 23.336  7.403   0.330   1.00 48.28  ? 409  CYS A CB  1 
ATOM   3120 S SG  . CYS A 1 409 ? 22.079  8.281   -0.655  1.00 48.22  ? 409  CYS A SG  1 
ATOM   3121 N N   . PRO A 1 410 ? 24.802  6.757   3.251   1.00 46.93  ? 410  PRO A N   1 
ATOM   3122 C CA  . PRO A 1 410 ? 25.516  5.975   4.257   1.00 46.61  ? 410  PRO A CA  1 
ATOM   3123 C C   . PRO A 1 410 ? 24.560  5.379   5.299   1.00 46.84  ? 410  PRO A C   1 
ATOM   3124 O O   . PRO A 1 410 ? 24.641  4.169   5.579   1.00 47.94  ? 410  PRO A O   1 
ATOM   3125 C CB  . PRO A 1 410 ? 26.435  7.006   4.906   1.00 45.63  ? 410  PRO A CB  1 
ATOM   3126 C CG  . PRO A 1 410 ? 26.699  8.004   3.832   1.00 45.07  ? 410  PRO A CG  1 
ATOM   3127 C CD  . PRO A 1 410 ? 25.485  8.034   2.957   1.00 45.95  ? 410  PRO A CD  1 
ATOM   3128 N N   . VAL A 1 411 ? 23.659  6.201   5.855   1.00 45.42  ? 411  VAL A N   1 
ATOM   3129 C CA  . VAL A 1 411 ? 22.609  5.692   6.747   1.00 45.44  ? 411  VAL A CA  1 
ATOM   3130 C C   . VAL A 1 411 ? 21.730  4.567   6.106   1.00 47.34  ? 411  VAL A C   1 
ATOM   3131 O O   . VAL A 1 411 ? 21.342  3.601   6.782   1.00 47.57  ? 411  VAL A O   1 
ATOM   3132 C CB  . VAL A 1 411 ? 21.749  6.843   7.285   1.00 44.53  ? 411  VAL A CB  1 
ATOM   3133 C CG1 . VAL A 1 411 ? 20.547  6.344   8.023   1.00 43.65  ? 411  VAL A CG1 1 
ATOM   3134 C CG2 . VAL A 1 411 ? 22.566  7.726   8.224   1.00 44.12  ? 411  VAL A CG2 1 
ATOM   3135 N N   . ALA A 1 412 ? 21.448  4.695   4.807   1.00 48.24  ? 412  ALA A N   1 
ATOM   3136 C CA  . ALA A 1 412 ? 20.612  3.752   4.091   1.00 50.35  ? 412  ALA A CA  1 
ATOM   3137 C C   . ALA A 1 412 ? 21.366  2.452   3.888   1.00 52.14  ? 412  ALA A C   1 
ATOM   3138 O O   . ALA A 1 412 ? 20.822  1.365   4.087   1.00 53.26  ? 412  ALA A O   1 
ATOM   3139 C CB  . ALA A 1 412 ? 20.211  4.310   2.779   1.00 50.69  ? 412  ALA A CB  1 
ATOM   3140 N N   . GLN A 1 413 ? 22.625  2.570   3.491   1.00 52.09  ? 413  GLN A N   1 
ATOM   3141 C CA  . GLN A 1 413 ? 23.432  1.399   3.342   1.00 53.78  ? 413  GLN A CA  1 
ATOM   3142 C C   . GLN A 1 413 ? 23.587  0.692   4.684   1.00 53.29  ? 413  GLN A C   1 
ATOM   3143 O O   . GLN A 1 413 ? 23.481  -0.566  4.743   1.00 54.32  ? 413  GLN A O   1 
ATOM   3144 C CB  . GLN A 1 413 ? 24.792  1.721   2.741   1.00 53.83  ? 413  GLN A CB  1 
ATOM   3145 C CG  . GLN A 1 413 ? 25.432  0.443   2.190   1.00 61.07  ? 413  GLN A CG  1 
ATOM   3146 C CD  . GLN A 1 413 ? 26.703  0.697   1.416   1.00 68.07  ? 413  GLN A CD  1 
ATOM   3147 O OE1 . GLN A 1 413 ? 27.588  1.458   1.861   1.00 69.22  ? 413  GLN A OE1 1 
ATOM   3148 N NE2 . GLN A 1 413 ? 26.813  0.056   0.246   1.00 71.01  ? 413  GLN A NE2 1 
ATOM   3149 N N   . LEU A 1 414 ? 23.819  1.488   5.746   1.00 50.73  ? 414  LEU A N   1 
ATOM   3150 C CA  . LEU A 1 414 ? 23.941  0.937   7.096   1.00 50.20  ? 414  LEU A CA  1 
ATOM   3151 C C   . LEU A 1 414 ? 22.696  0.138   7.495   1.00 51.43  ? 414  LEU A C   1 
ATOM   3152 O O   . LEU A 1 414 ? 22.814  -1.050  7.830   1.00 52.35  ? 414  LEU A O   1 
ATOM   3153 C CB  . LEU A 1 414 ? 24.257  2.002   8.150   1.00 48.52  ? 414  LEU A CB  1 
ATOM   3154 C CG  . LEU A 1 414 ? 24.549  1.479   9.571   1.00 47.03  ? 414  LEU A CG  1 
ATOM   3155 C CD1 . LEU A 1 414 ? 25.828  0.621   9.648   1.00 46.74  ? 414  LEU A CD1 1 
ATOM   3156 C CD2 . LEU A 1 414 ? 24.642  2.601   10.533  1.00 44.45  ? 414  LEU A CD2 1 
ATOM   3157 N N   . ALA A 1 415 ? 21.517  0.768   7.420   1.00 50.81  ? 415  ALA A N   1 
ATOM   3158 C CA  . ALA A 1 415 ? 20.285  0.098   7.824   1.00 52.01  ? 415  ALA A CA  1 
ATOM   3159 C C   . ALA A 1 415 ? 20.141  -1.235  7.069   1.00 54.89  ? 415  ALA A C   1 
ATOM   3160 O O   . ALA A 1 415 ? 19.886  -2.290  7.681   1.00 55.62  ? 415  ALA A O   1 
ATOM   3161 C CB  . ALA A 1 415 ? 19.078  0.978   7.602   1.00 50.71  ? 415  ALA A CB  1 
ATOM   3162 N N   . GLY A 1 416 ? 20.347  -1.160  5.748   1.00 55.84  ? 416  GLY A N   1 
ATOM   3163 C CA  . GLY A 1 416 ? 20.136  -2.255  4.835   1.00 58.59  ? 416  GLY A CA  1 
ATOM   3164 C C   . GLY A 1 416 ? 21.041  -3.438  5.130   1.00 60.23  ? 416  GLY A C   1 
ATOM   3165 O O   . GLY A 1 416 ? 20.609  -4.590  5.089   1.00 61.94  ? 416  GLY A O   1 
ATOM   3166 N N   . ARG A 1 417 ? 22.296  -3.148  5.443   1.00 59.49  ? 417  ARG A N   1 
ATOM   3167 C CA  . ARG A 1 417 ? 23.253  -4.200  5.663   1.00 60.58  ? 417  ARG A CA  1 
ATOM   3168 C C   . ARG A 1 417 ? 23.007  -4.833  7.026   1.00 60.65  ? 417  ARG A C   1 
ATOM   3169 O O   . ARG A 1 417 ? 22.879  -6.082  7.129   1.00 62.62  ? 417  ARG A O   1 
ATOM   3170 C CB  . ARG A 1 417 ? 24.675  -3.673  5.480   1.00 60.08  ? 417  ARG A CB  1 
ATOM   3171 C CG  . ARG A 1 417 ? 25.130  -3.721  4.016   1.00 62.82  ? 417  ARG A CG  1 
ATOM   3172 C CD  . ARG A 1 417 ? 25.487  -5.140  3.639   1.00 69.84  ? 417  ARG A CD  1 
ATOM   3173 N NE  . ARG A 1 417 ? 25.791  -5.290  2.218   1.00 76.50  ? 417  ARG A NE  1 
ATOM   3174 C CZ  . ARG A 1 417 ? 26.361  -6.373  1.678   1.00 80.61  ? 417  ARG A CZ  1 
ATOM   3175 N NH1 . ARG A 1 417 ? 26.700  -7.406  2.455   1.00 82.52  ? 417  ARG A NH1 1 
ATOM   3176 N NH2 . ARG A 1 417 ? 26.600  -6.427  0.364   1.00 80.72  ? 417  ARG A NH2 1 
ATOM   3177 N N   . LEU A 1 418 ? 22.878  -3.987  8.050   1.00 57.85  ? 418  LEU A N   1 
ATOM   3178 C CA  . LEU A 1 418 ? 22.487  -4.463  9.371   1.00 57.80  ? 418  LEU A CA  1 
ATOM   3179 C C   . LEU A 1 418 ? 21.232  -5.368  9.332   1.00 59.85  ? 418  LEU A C   1 
ATOM   3180 O O   . LEU A 1 418 ? 21.293  -6.530  9.741   1.00 61.41  ? 418  LEU A O   1 
ATOM   3181 C CB  . LEU A 1 418 ? 22.340  -3.305  10.355  1.00 55.41  ? 418  LEU A CB  1 
ATOM   3182 C CG  . LEU A 1 418 ? 23.649  -2.564  10.702  1.00 53.52  ? 418  LEU A CG  1 
ATOM   3183 C CD1 . LEU A 1 418 ? 23.366  -1.419  11.636  1.00 48.89  ? 418  LEU A CD1 1 
ATOM   3184 C CD2 . LEU A 1 418 ? 24.722  -3.490  11.302  1.00 52.53  ? 418  LEU A CD2 1 
ATOM   3185 N N   . ALA A 1 419 ? 20.129  -4.860  8.786   1.00 59.81  ? 419  ALA A N   1 
ATOM   3186 C CA  . ALA A 1 419 ? 18.876  -5.597  8.739   1.00 61.45  ? 419  ALA A CA  1 
ATOM   3187 C C   . ALA A 1 419 ? 19.022  -6.952  8.019   1.00 64.45  ? 419  ALA A C   1 
ATOM   3188 O O   . ALA A 1 419 ? 18.412  -7.957  8.409   1.00 65.28  ? 419  ALA A O   1 
ATOM   3189 C CB  . ALA A 1 419 ? 17.801  -4.762  8.082   1.00 60.46  ? 419  ALA A CB  1 
ATOM   3190 N N   . ALA A 1 420 ? 19.842  -6.958  6.971   1.00 65.24  ? 420  ALA A N   1 
ATOM   3191 C CA  . ALA A 1 420 ? 20.017  -8.136  6.139   1.00 68.28  ? 420  ALA A CA  1 
ATOM   3192 C C   . ALA A 1 420 ? 20.839  -9.191  6.876   1.00 69.83  ? 420  ALA A C   1 
ATOM   3193 O O   . ALA A 1 420 ? 20.892  -10.346 6.454   1.00 72.14  ? 420  ALA A O   1 
ATOM   3194 C CB  . ALA A 1 420 ? 20.676  -7.759  4.811   1.00 67.59  ? 420  ALA A CB  1 
ATOM   3195 N N   . GLN A 1 421 ? 21.441  -8.785  7.996   1.00 68.99  ? 421  GLN A N   1 
ATOM   3196 C CA  . GLN A 1 421 ? 22.394  -9.613  8.719   1.00 70.17  ? 421  GLN A CA  1 
ATOM   3197 C C   . GLN A 1 421 ? 22.101  -9.750  10.222  1.00 69.64  ? 421  GLN A C   1 
ATOM   3198 O O   . GLN A 1 421 ? 23.031  -9.722  11.047  1.00 68.73  ? 421  GLN A O   1 
ATOM   3199 C CB  . GLN A 1 421 ? 23.813  -9.101  8.459   1.00 69.35  ? 421  GLN A CB  1 
ATOM   3200 C CG  . GLN A 1 421 ? 24.386  -9.578  7.106   1.00 73.33  ? 421  GLN A CG  1 
ATOM   3201 C CD  . GLN A 1 421 ? 25.345  -8.570  6.501   1.00 75.20  ? 421  GLN A CD  1 
ATOM   3202 O OE1 . GLN A 1 421 ? 25.330  -8.308  5.285   1.00 76.79  ? 421  GLN A OE1 1 
ATOM   3203 N NE2 . GLN A 1 421 ? 26.182  -7.983  7.351   1.00 74.19  ? 421  GLN A NE2 1 
ATOM   3204 N N   . GLY A 1 422 ? 20.807  -9.906  10.553  1.00 70.06  ? 422  GLY A N   1 
ATOM   3205 C CA  . GLY A 1 422 ? 20.321  -10.191 11.918  1.00 69.25  ? 422  GLY A CA  1 
ATOM   3206 C C   . GLY A 1 422 ? 19.807  -9.040  12.787  1.00 66.53  ? 422  GLY A C   1 
ATOM   3207 O O   . GLY A 1 422 ? 19.054  -9.261  13.720  1.00 67.66  ? 422  GLY A O   1 
ATOM   3208 N N   . ALA A 1 423 ? 20.210  -7.809  12.514  1.00 63.43  ? 423  ALA A N   1 
ATOM   3209 C CA  . ALA A 1 423 ? 19.848  -6.688  13.399  1.00 60.65  ? 423  ALA A CA  1 
ATOM   3210 C C   . ALA A 1 423 ? 18.380  -6.258  13.347  1.00 59.96  ? 423  ALA A C   1 
ATOM   3211 O O   . ALA A 1 423 ? 17.719  -6.376  12.319  1.00 61.11  ? 423  ALA A O   1 
ATOM   3212 C CB  . ALA A 1 423 ? 20.747  -5.495  13.132  1.00 58.02  ? 423  ALA A CB  1 
ATOM   3213 N N   . ARG A 1 424 ? 17.878  -5.781  14.478  1.00 58.33  ? 424  ARG A N   1 
ATOM   3214 C CA  A ARG A 1 424 ? 16.581  -5.138  14.496  0.50 57.96  ? 424  ARG A CA  1 
ATOM   3215 C CA  B ARG A 1 424 ? 16.582  -5.129  14.547  0.50 57.83  ? 424  ARG A CA  1 
ATOM   3216 C C   . ARG A 1 424 ? 16.860  -3.652  14.344  1.00 55.52  ? 424  ARG A C   1 
ATOM   3217 O O   . ARG A 1 424 ? 17.478  -3.019  15.205  1.00 54.10  ? 424  ARG A O   1 
ATOM   3218 C CB  A ARG A 1 424 ? 15.803  -5.458  15.778  0.50 58.79  ? 424  ARG A CB  1 
ATOM   3219 C CB  B ARG A 1 424 ? 15.961  -5.362  15.926  0.50 58.34  ? 424  ARG A CB  1 
ATOM   3220 C CG  A ARG A 1 424 ? 14.272  -5.426  15.629  0.50 60.19  ? 424  ARG A CG  1 
ATOM   3221 C CG  B ARG A 1 424 ? 14.535  -4.851  16.129  0.50 58.32  ? 424  ARG A CG  1 
ATOM   3222 C CD  A ARG A 1 424 ? 13.598  -6.432  16.572  0.50 62.59  ? 424  ARG A CD  1 
ATOM   3223 C CD  B ARG A 1 424 ? 14.216  -4.806  17.621  0.50 58.13  ? 424  ARG A CD  1 
ATOM   3224 N NE  A ARG A 1 424 ? 12.167  -6.188  16.767  0.50 63.11  ? 424  ARG A NE  1 
ATOM   3225 N NE  B ARG A 1 424 ? 13.063  -5.626  17.989  0.50 60.15  ? 424  ARG A NE  1 
ATOM   3226 C CZ  A ARG A 1 424 ? 11.201  -7.003  16.352  0.50 65.45  ? 424  ARG A CZ  1 
ATOM   3227 C CZ  B ARG A 1 424 ? 12.682  -5.861  19.243  0.50 60.24  ? 424  ARG A CZ  1 
ATOM   3228 N NH1 A ARG A 1 424 ? 11.504  -8.124  15.712  0.50 66.96  ? 424  ARG A NH1 1 
ATOM   3229 N NH1 B ARG A 1 424 ? 13.356  -5.327  20.252  0.50 57.05  ? 424  ARG A NH1 1 
ATOM   3230 N NH2 A ARG A 1 424 ? 9.931   -6.699  16.577  0.50 65.67  ? 424  ARG A NH2 1 
ATOM   3231 N NH2 B ARG A 1 424 ? 11.618  -6.624  19.486  0.50 61.84  ? 424  ARG A NH2 1 
ATOM   3232 N N   . VAL A 1 425 ? 16.443  -3.105  13.209  1.00 54.91  ? 425  VAL A N   1 
ATOM   3233 C CA  . VAL A 1 425 ? 16.737  -1.713  12.922  1.00 52.45  ? 425  VAL A CA  1 
ATOM   3234 C C   . VAL A 1 425 ? 15.455  -0.895  12.938  1.00 52.30  ? 425  VAL A C   1 
ATOM   3235 O O   . VAL A 1 425 ? 14.429  -1.348  12.441  1.00 53.73  ? 425  VAL A O   1 
ATOM   3236 C CB  . VAL A 1 425 ? 17.448  -1.533  11.553  1.00 52.02  ? 425  VAL A CB  1 
ATOM   3237 C CG1 . VAL A 1 425 ? 17.991  -0.092  11.414  1.00 49.81  ? 425  VAL A CG1 1 
ATOM   3238 C CG2 . VAL A 1 425 ? 18.562  -2.543  11.383  1.00 51.56  ? 425  VAL A CG2 1 
ATOM   3239 N N   . TYR A 1 426 ? 15.523  0.299   13.515  1.00 50.07  ? 426  TYR A N   1 
ATOM   3240 C CA  . TYR A 1 426 ? 14.432  1.248   13.432  1.00 49.95  ? 426  TYR A CA  1 
ATOM   3241 C C   . TYR A 1 426 ? 14.985  2.491   12.808  1.00 48.49  ? 426  TYR A C   1 
ATOM   3242 O O   . TYR A 1 426 ? 16.022  2.997   13.236  1.00 47.45  ? 426  TYR A O   1 
ATOM   3243 C CB  . TYR A 1 426 ? 13.850  1.566   14.816  1.00 50.02  ? 426  TYR A CB  1 
ATOM   3244 C CG  . TYR A 1 426 ? 13.146  0.388   15.463  1.00 50.87  ? 426  TYR A CG  1 
ATOM   3245 C CD1 . TYR A 1 426 ? 13.835  -0.462  16.321  1.00 50.11  ? 426  TYR A CD1 1 
ATOM   3246 C CD2 . TYR A 1 426 ? 11.799  0.131   15.224  1.00 50.51  ? 426  TYR A CD2 1 
ATOM   3247 C CE1 . TYR A 1 426 ? 13.213  -1.541  16.919  1.00 51.63  ? 426  TYR A CE1 1 
ATOM   3248 C CE2 . TYR A 1 426 ? 11.160  -0.946  15.830  1.00 52.89  ? 426  TYR A CE2 1 
ATOM   3249 C CZ  . TYR A 1 426 ? 11.876  -1.793  16.671  1.00 53.27  ? 426  TYR A CZ  1 
ATOM   3250 O OH  . TYR A 1 426 ? 11.269  -2.889  17.276  1.00 54.56  ? 426  TYR A OH  1 
ATOM   3251 N N   . ALA A 1 427 ? 14.296  2.991   11.791  1.00 48.94  ? 427  ALA A N   1 
ATOM   3252 C CA  . ALA A 1 427 ? 14.836  4.048   10.950  1.00 47.46  ? 427  ALA A CA  1 
ATOM   3253 C C   . ALA A 1 427 ? 13.902  5.248   10.994  1.00 47.55  ? 427  ALA A C   1 
ATOM   3254 O O   . ALA A 1 427 ? 12.700  5.076   11.090  1.00 48.47  ? 427  ALA A O   1 
ATOM   3255 C CB  . ALA A 1 427 ? 15.004  3.531   9.525   1.00 47.64  ? 427  ALA A CB  1 
ATOM   3256 N N   . TYR A 1 428 ? 14.437  6.464   10.918  1.00 46.45  ? 428  TYR A N   1 
ATOM   3257 C CA  . TYR A 1 428 ? 13.572  7.644   10.977  1.00 46.86  ? 428  TYR A CA  1 
ATOM   3258 C C   . TYR A 1 428 ? 14.092  8.799   10.129  1.00 46.24  ? 428  TYR A C   1 
ATOM   3259 O O   . TYR A 1 428 ? 15.276  8.860   9.778   1.00 45.12  ? 428  TYR A O   1 
ATOM   3260 C CB  . TYR A 1 428 ? 13.394  8.123   12.431  1.00 46.36  ? 428  TYR A CB  1 
ATOM   3261 C CG  . TYR A 1 428 ? 14.658  8.735   12.995  1.00 45.54  ? 428  TYR A CG  1 
ATOM   3262 C CD1 . TYR A 1 428 ? 15.042  10.034  12.664  1.00 44.93  ? 428  TYR A CD1 1 
ATOM   3263 C CD2 . TYR A 1 428 ? 15.477  8.013   13.841  1.00 45.46  ? 428  TYR A CD2 1 
ATOM   3264 C CE1 . TYR A 1 428 ? 16.209  10.579  13.156  1.00 43.84  ? 428  TYR A CE1 1 
ATOM   3265 C CE2 . TYR A 1 428 ? 16.647  8.563   14.346  1.00 44.47  ? 428  TYR A CE2 1 
ATOM   3266 C CZ  . TYR A 1 428 ? 17.012  9.833   13.992  1.00 42.71  ? 428  TYR A CZ  1 
ATOM   3267 O OH  . TYR A 1 428 ? 18.170  10.374  14.499  1.00 40.99  ? 428  TYR A OH  1 
ATOM   3268 N N   . ILE A 1 429 ? 13.187  9.713   9.804   1.00 46.65  ? 429  ILE A N   1 
ATOM   3269 C CA  . ILE A 1 429 ? 13.570  10.980  9.258   1.00 46.09  ? 429  ILE A CA  1 
ATOM   3270 C C   . ILE A 1 429 ? 12.896  12.026  10.118  1.00 46.11  ? 429  ILE A C   1 
ATOM   3271 O O   . ILE A 1 429 ? 11.699  11.957  10.409  1.00 46.88  ? 429  ILE A O   1 
ATOM   3272 C CB  . ILE A 1 429 ? 13.272  11.115  7.744   1.00 46.76  ? 429  ILE A CB  1 
ATOM   3273 C CG1 . ILE A 1 429 ? 13.791  12.455  7.236   1.00 47.36  ? 429  ILE A CG1 1 
ATOM   3274 C CG2 . ILE A 1 429 ? 11.796  10.998  7.452   1.00 49.54  ? 429  ILE A CG2 1 
ATOM   3275 C CD1 . ILE A 1 429 ? 13.444  12.772  5.787   1.00 50.57  ? 429  ILE A CD1 1 
ATOM   3276 N N   . PHE A 1 430 ? 13.700  12.969  10.573  1.00 45.09  ? 430  PHE A N   1 
ATOM   3277 C CA  . PHE A 1 430 ? 13.244  13.970  11.507  1.00 45.17  ? 430  PHE A CA  1 
ATOM   3278 C C   . PHE A 1 430 ? 13.015  15.249  10.703  1.00 45.62  ? 430  PHE A C   1 
ATOM   3279 O O   . PHE A 1 430 ? 13.939  15.756  10.065  1.00 45.14  ? 430  PHE A O   1 
ATOM   3280 C CB  . PHE A 1 430 ? 14.309  14.149  12.595  1.00 43.93  ? 430  PHE A CB  1 
ATOM   3281 C CG  . PHE A 1 430 ? 13.956  15.158  13.631  1.00 43.42  ? 430  PHE A CG  1 
ATOM   3282 C CD1 . PHE A 1 430 ? 14.228  16.520  13.416  1.00 40.95  ? 430  PHE A CD1 1 
ATOM   3283 C CD2 . PHE A 1 430 ? 13.345  14.754  14.826  1.00 42.43  ? 430  PHE A CD2 1 
ATOM   3284 C CE1 . PHE A 1 430 ? 13.880  17.477  14.373  1.00 40.12  ? 430  PHE A CE1 1 
ATOM   3285 C CE2 . PHE A 1 430 ? 13.008  15.692  15.794  1.00 42.71  ? 430  PHE A CE2 1 
ATOM   3286 C CZ  . PHE A 1 430 ? 13.269  17.070  15.566  1.00 40.55  ? 430  PHE A CZ  1 
ATOM   3287 N N   . GLU A 1 431 ? 11.790  15.766  10.720  1.00 46.79  ? 431  GLU A N   1 
ATOM   3288 C CA  . GLU A 1 431 ? 11.419  16.830  9.786   1.00 47.52  ? 431  GLU A CA  1 
ATOM   3289 C C   . GLU A 1 431 ? 10.964  18.110  10.465  1.00 47.60  ? 431  GLU A C   1 
ATOM   3290 O O   . GLU A 1 431 ? 10.448  19.021  9.812   1.00 48.39  ? 431  GLU A O   1 
ATOM   3291 C CB  . GLU A 1 431 ? 10.314  16.355  8.834   1.00 49.02  ? 431  GLU A CB  1 
ATOM   3292 C CG  . GLU A 1 431 ? 10.643  15.125  8.014   1.00 50.58  ? 431  GLU A CG  1 
ATOM   3293 C CD  . GLU A 1 431 ? 9.456   14.638  7.195   1.00 53.68  ? 431  GLU A CD  1 
ATOM   3294 O OE1 . GLU A 1 431 ? 8.384   14.394  7.788   1.00 56.75  ? 431  GLU A OE1 1 
ATOM   3295 O OE2 . GLU A 1 431 ? 9.586   14.494  5.961   1.00 54.10  ? 431  GLU A OE2 1 
ATOM   3296 N N   . HIS A 1 432 ? 11.121  18.194  11.774  1.00 47.11  ? 432  HIS A N   1 
ATOM   3297 C CA  . HIS A 1 432 ? 10.665  19.400  12.433  1.00 47.53  ? 432  HIS A CA  1 
ATOM   3298 C C   . HIS A 1 432 ? 11.736  20.468  12.599  1.00 46.79  ? 432  HIS A C   1 
ATOM   3299 O O   . HIS A 1 432 ? 12.692  20.282  13.368  1.00 45.68  ? 432  HIS A O   1 
ATOM   3300 C CB  . HIS A 1 432 ? 10.027  19.096  13.780  1.00 48.25  ? 432  HIS A CB  1 
ATOM   3301 C CG  . HIS A 1 432 ? 9.557   20.324  14.481  1.00 49.11  ? 432  HIS A CG  1 
ATOM   3302 N ND1 . HIS A 1 432 ? 8.472   21.051  14.044  1.00 50.35  ? 432  HIS A ND1 1 
ATOM   3303 C CD2 . HIS A 1 432 ? 10.056  20.994  15.544  1.00 49.67  ? 432  HIS A CD2 1 
ATOM   3304 C CE1 . HIS A 1 432 ? 8.304   22.103  14.824  1.00 50.33  ? 432  HIS A CE1 1 
ATOM   3305 N NE2 . HIS A 1 432 ? 9.255   22.096  15.739  1.00 50.88  ? 432  HIS A NE2 1 
ATOM   3306 N N   . ARG A 1 433 ? 11.582  21.568  11.859  1.00 47.42  ? 433  ARG A N   1 
ATOM   3307 C CA  A ARG A 1 433 ? 12.383  22.771  12.088  0.50 47.45  ? 433  ARG A CA  1 
ATOM   3308 C CA  B ARG A 1 433 ? 12.368  22.768  12.075  0.50 46.90  ? 433  ARG A CA  1 
ATOM   3309 C C   . ARG A 1 433 ? 11.938  23.367  13.410  1.00 48.07  ? 433  ARG A C   1 
ATOM   3310 O O   . ARG A 1 433 ? 10.750  23.531  13.652  1.00 49.54  ? 433  ARG A O   1 
ATOM   3311 C CB  A ARG A 1 433 ? 12.190  23.811  10.974  0.50 48.33  ? 433  ARG A CB  1 
ATOM   3312 C CB  B ARG A 1 433 ? 12.090  23.764  10.951  0.50 47.41  ? 433  ARG A CB  1 
ATOM   3313 C CG  A ARG A 1 433 ? 13.067  25.076  11.147  0.50 49.29  ? 433  ARG A CG  1 
ATOM   3314 C CG  B ARG A 1 433 ? 13.174  24.805  10.766  0.50 45.60  ? 433  ARG A CG  1 
ATOM   3315 C CD  A ARG A 1 433 ? 12.748  26.173  10.147  0.50 50.82  ? 433  ARG A CD  1 
ATOM   3316 C CD  B ARG A 1 433 ? 12.830  25.784  9.675   0.50 42.25  ? 433  ARG A CD  1 
ATOM   3317 N NE  A ARG A 1 433 ? 13.184  27.506  10.579  0.50 51.65  ? 433  ARG A NE  1 
ATOM   3318 N NE  B ARG A 1 433 ? 13.395  27.096  9.960   0.50 38.37  ? 433  ARG A NE  1 
ATOM   3319 C CZ  A ARG A 1 433 ? 12.698  28.150  11.644  0.50 52.74  ? 433  ARG A CZ  1 
ATOM   3320 C CZ  B ARG A 1 433 ? 14.614  27.473  9.617   0.50 34.88  ? 433  ARG A CZ  1 
ATOM   3321 N NH1 A ARG A 1 433 ? 11.790  27.573  12.417  0.50 51.59  ? 433  ARG A NH1 1 
ATOM   3322 N NH1 B ARG A 1 433 ? 15.408  26.640  8.968   0.50 33.48  ? 433  ARG A NH1 1 
ATOM   3323 N NH2 A ARG A 1 433 ? 13.127  29.369  11.949  0.50 53.16  ? 433  ARG A NH2 1 
ATOM   3324 N NH2 B ARG A 1 433 ? 15.033  28.682  9.927   0.50 33.81  ? 433  ARG A NH2 1 
ATOM   3325 N N   . ALA A 1 434 ? 12.892  23.678  14.282  1.00 47.90  ? 434  ALA A N   1 
ATOM   3326 C CA  . ALA A 1 434 ? 12.562  24.285  15.575  1.00 49.34  ? 434  ALA A CA  1 
ATOM   3327 C C   . ALA A 1 434 ? 11.976  25.675  15.377  1.00 50.74  ? 434  ALA A C   1 
ATOM   3328 O O   . ALA A 1 434 ? 12.385  26.382  14.471  1.00 51.67  ? 434  ALA A O   1 
ATOM   3329 C CB  . ALA A 1 434 ? 13.802  24.362  16.447  1.00 48.47  ? 434  ALA A CB  1 
ATOM   3330 N N   . SER A 1 435 ? 11.020  26.074  16.206  1.00 52.28  ? 435  SER A N   1 
ATOM   3331 C CA  . SER A 1 435 ? 10.508  27.460  16.161  1.00 54.06  ? 435  SER A CA  1 
ATOM   3332 C C   . SER A 1 435 ? 11.595  28.480  16.536  1.00 54.17  ? 435  SER A C   1 
ATOM   3333 O O   . SER A 1 435 ? 11.498  29.656  16.209  1.00 54.80  ? 435  SER A O   1 
ATOM   3334 C CB  . SER A 1 435 ? 9.274   27.639  17.068  1.00 55.26  ? 435  SER A CB  1 
ATOM   3335 O OG  . SER A 1 435 ? 9.615   27.646  18.449  1.00 54.25  ? 435  SER A OG  1 
ATOM   3336 N N   . THR A 1 436 ? 12.628  28.008  17.226  1.00 54.00  ? 436  THR A N   1 
ATOM   3337 C CA  . THR A 1 436 ? 13.625  28.891  17.837  1.00 54.77  ? 436  THR A CA  1 
ATOM   3338 C C   . THR A 1 436 ? 14.901  28.982  17.016  1.00 53.84  ? 436  THR A C   1 
ATOM   3339 O O   . THR A 1 436 ? 15.861  29.617  17.457  1.00 54.08  ? 436  THR A O   1 
ATOM   3340 C CB  . THR A 1 436 ? 14.040  28.399  19.243  1.00 54.35  ? 436  THR A CB  1 
ATOM   3341 O OG1 . THR A 1 436 ? 14.540  27.051  19.151  1.00 55.06  ? 436  THR A OG1 1 
ATOM   3342 C CG2 . THR A 1 436 ? 12.879  28.451  20.214  1.00 55.16  ? 436  THR A CG2 1 
ATOM   3343 N N   . LEU A 1 437 ? 14.911  28.330  15.848  1.00 53.23  ? 437  LEU A N   1 
ATOM   3344 C CA  . LEU A 1 437 ? 16.091  28.242  14.999  1.00 52.01  ? 437  LEU A CA  1 
ATOM   3345 C C   . LEU A 1 437 ? 16.503  29.611  14.476  1.00 52.85  ? 437  LEU A C   1 
ATOM   3346 O O   . LEU A 1 437 ? 15.666  30.458  14.177  1.00 54.27  ? 437  LEU A O   1 
ATOM   3347 C CB  . LEU A 1 437 ? 15.835  27.290  13.849  1.00 51.31  ? 437  LEU A CB  1 
ATOM   3348 C CG  . LEU A 1 437 ? 17.047  26.518  13.338  1.00 50.77  ? 437  LEU A CG  1 
ATOM   3349 C CD1 . LEU A 1 437 ? 17.353  25.344  14.200  1.00 49.65  ? 437  LEU A CD1 1 
ATOM   3350 C CD2 . LEU A 1 437 ? 16.773  26.015  11.953  1.00 52.48  ? 437  LEU A CD2 1 
ATOM   3351 N N   . THR A 1 438 ? 17.803  29.829  14.373  1.00 52.37  ? 438  THR A N   1 
ATOM   3352 C CA  . THR A 1 438 ? 18.318  31.156  14.057  1.00 53.33  ? 438  THR A CA  1 
ATOM   3353 C C   . THR A 1 438 ? 18.863  31.180  12.635  1.00 52.73  ? 438  THR A C   1 
ATOM   3354 O O   . THR A 1 438 ? 19.054  32.271  12.047  1.00 53.79  ? 438  THR A O   1 
ATOM   3355 C CB  . THR A 1 438 ? 19.417  31.571  15.078  1.00 53.84  ? 438  THR A CB  1 
ATOM   3356 O OG1 . THR A 1 438 ? 20.089  30.386  15.556  1.00 52.84  ? 438  THR A OG1 1 
ATOM   3357 C CG2 . THR A 1 438 ? 18.801  32.307  16.271  1.00 53.87  ? 438  THR A CG2 1 
ATOM   3358 N N   . TRP A 1 439 ? 19.121  29.973  12.107  1.00 50.37  ? 439  TRP A N   1 
ATOM   3359 C CA  . TRP A 1 439 ? 19.493  29.746  10.711  1.00 49.00  ? 439  TRP A CA  1 
ATOM   3360 C C   . TRP A 1 439 ? 18.347  30.127  9.780   1.00 49.89  ? 439  TRP A C   1 
ATOM   3361 O O   . TRP A 1 439 ? 17.196  30.150  10.199  1.00 50.59  ? 439  TRP A O   1 
ATOM   3362 C CB  . TRP A 1 439 ? 19.824  28.279  10.498  1.00 47.61  ? 439  TRP A CB  1 
ATOM   3363 C CG  . TRP A 1 439 ? 21.046  27.875  11.192  1.00 45.75  ? 439  TRP A CG  1 
ATOM   3364 C CD1 . TRP A 1 439 ? 21.119  27.179  12.335  1.00 44.23  ? 439  TRP A CD1 1 
ATOM   3365 C CD2 . TRP A 1 439 ? 22.393  28.178  10.812  1.00 46.27  ? 439  TRP A CD2 1 
ATOM   3366 N NE1 . TRP A 1 439 ? 22.421  27.017  12.713  1.00 45.18  ? 439  TRP A NE1 1 
ATOM   3367 C CE2 . TRP A 1 439 ? 23.231  27.617  11.793  1.00 44.90  ? 439  TRP A CE2 1 
ATOM   3368 C CE3 . TRP A 1 439 ? 22.972  28.885  9.745   1.00 46.33  ? 439  TRP A CE3 1 
ATOM   3369 C CZ2 . TRP A 1 439 ? 24.623  27.714  11.739  1.00 43.63  ? 439  TRP A CZ2 1 
ATOM   3370 C CZ3 . TRP A 1 439 ? 24.354  28.974  9.684   1.00 45.09  ? 439  TRP A CZ3 1 
ATOM   3371 C CH2 . TRP A 1 439 ? 25.166  28.390  10.678  1.00 44.04  ? 439  TRP A CH2 1 
ATOM   3372 N N   . PRO A 1 440 ? 18.648  30.431  8.506   1.00 49.83  ? 440  PRO A N   1 
ATOM   3373 C CA  . PRO A 1 440 ? 17.535  30.917  7.726   1.00 50.80  ? 440  PRO A CA  1 
ATOM   3374 C C   . PRO A 1 440 ? 16.625  29.771  7.280   1.00 50.79  ? 440  PRO A C   1 
ATOM   3375 O O   . PRO A 1 440 ? 16.980  28.587  7.391   1.00 49.21  ? 440  PRO A O   1 
ATOM   3376 C CB  . PRO A 1 440 ? 18.223  31.588  6.539   1.00 51.11  ? 440  PRO A CB  1 
ATOM   3377 C CG  . PRO A 1 440 ? 19.512  30.856  6.387   1.00 49.55  ? 440  PRO A CG  1 
ATOM   3378 C CD  . PRO A 1 440 ? 19.866  30.250  7.688   1.00 49.11  ? 440  PRO A CD  1 
ATOM   3379 N N   . LEU A 1 441 ? 15.451  30.143  6.788   1.00 52.29  ? 441  LEU A N   1 
ATOM   3380 C CA  . LEU A 1 441 ? 14.452  29.188  6.335   1.00 52.63  ? 441  LEU A CA  1 
ATOM   3381 C C   . LEU A 1 441 ? 14.976  28.202  5.305   1.00 51.33  ? 441  LEU A C   1 
ATOM   3382 O O   . LEU A 1 441 ? 14.596  27.030  5.327   1.00 51.26  ? 441  LEU A O   1 
ATOM   3383 C CB  . LEU A 1 441 ? 13.250  29.930  5.760   1.00 54.31  ? 441  LEU A CB  1 
ATOM   3384 C CG  . LEU A 1 441 ? 12.187  30.221  6.813   1.00 57.26  ? 441  LEU A CG  1 
ATOM   3385 C CD1 . LEU A 1 441 ? 11.394  31.510  6.489   1.00 59.08  ? 441  LEU A CD1 1 
ATOM   3386 C CD2 . LEU A 1 441 ? 11.268  28.965  7.023   1.00 58.11  ? 441  LEU A CD2 1 
ATOM   3387 N N   . TRP A 1 442 ? 15.835  28.672  4.404   1.00 50.28  ? 442  TRP A N   1 
ATOM   3388 C CA  . TRP A 1 442 ? 16.204  27.865  3.259   1.00 49.48  ? 442  TRP A CA  1 
ATOM   3389 C C   . TRP A 1 442 ? 16.977  26.581  3.665   1.00 48.40  ? 442  TRP A C   1 
ATOM   3390 O O   . TRP A 1 442 ? 17.020  25.603  2.910   1.00 47.24  ? 442  TRP A O   1 
ATOM   3391 C CB  . TRP A 1 442 ? 16.918  28.704  2.185   1.00 49.10  ? 442  TRP A CB  1 
ATOM   3392 C CG  . TRP A 1 442 ? 18.336  29.162  2.506   1.00 47.98  ? 442  TRP A CG  1 
ATOM   3393 C CD1 . TRP A 1 442 ? 18.735  30.437  2.849   1.00 48.22  ? 442  TRP A CD1 1 
ATOM   3394 C CD2 . TRP A 1 442 ? 19.539  28.371  2.462   1.00 44.89  ? 442  TRP A CD2 1 
ATOM   3395 N NE1 . TRP A 1 442 ? 20.099  30.472  3.035   1.00 46.62  ? 442  TRP A NE1 1 
ATOM   3396 C CE2 . TRP A 1 442 ? 20.616  29.225  2.812   1.00 44.02  ? 442  TRP A CE2 1 
ATOM   3397 C CE3 . TRP A 1 442 ? 19.811  27.030  2.160   1.00 43.61  ? 442  TRP A CE3 1 
ATOM   3398 C CZ2 . TRP A 1 442 ? 21.931  28.779  2.887   1.00 42.43  ? 442  TRP A CZ2 1 
ATOM   3399 C CZ3 . TRP A 1 442 ? 21.137  26.582  2.231   1.00 41.83  ? 442  TRP A CZ3 1 
ATOM   3400 C CH2 . TRP A 1 442 ? 22.176  27.459  2.587   1.00 42.11  ? 442  TRP A CH2 1 
ATOM   3401 N N   . MET A 1 443 ? 17.548  26.596  4.873   1.00 47.98  ? 443  MET A N   1 
ATOM   3402 C CA  . MET A 1 443 ? 18.398  25.502  5.349   1.00 46.79  ? 443  MET A CA  1 
ATOM   3403 C C   . MET A 1 443 ? 17.599  24.340  5.892   1.00 46.67  ? 443  MET A C   1 
ATOM   3404 O O   . MET A 1 443 ? 18.165  23.262  6.139   1.00 45.59  ? 443  MET A O   1 
ATOM   3405 C CB  . MET A 1 443 ? 19.412  25.985  6.391   1.00 46.05  ? 443  MET A CB  1 
ATOM   3406 C CG  . MET A 1 443 ? 20.699  26.459  5.769   1.00 46.40  ? 443  MET A CG  1 
ATOM   3407 S SD  . MET A 1 443 ? 21.768  27.457  6.825   1.00 49.60  ? 443  MET A SD  1 
ATOM   3408 C CE  . MET A 1 443 ? 22.674  26.132  7.582   1.00 45.92  ? 443  MET A CE  1 
ATOM   3409 N N   . GLY A 1 444 ? 16.295  24.560  6.073   1.00 47.14  ? 444  GLY A N   1 
ATOM   3410 C CA  . GLY A 1 444 ? 15.395  23.522  6.548   1.00 47.47  ? 444  GLY A CA  1 
ATOM   3411 C C   . GLY A 1 444 ? 15.677  23.103  7.983   1.00 47.34  ? 444  GLY A C   1 
ATOM   3412 O O   . GLY A 1 444 ? 15.722  23.940  8.882   1.00 48.05  ? 444  GLY A O   1 
ATOM   3413 N N   . VAL A 1 445 ? 15.852  21.802  8.193   1.00 46.62  ? 445  VAL A N   1 
ATOM   3414 C CA  . VAL A 1 445 ? 16.131  21.233  9.491   1.00 45.64  ? 445  VAL A CA  1 
ATOM   3415 C C   . VAL A 1 445 ? 17.584  20.816  9.377   1.00 45.32  ? 445  VAL A C   1 
ATOM   3416 O O   . VAL A 1 445 ? 17.869  19.698  8.920   1.00 45.44  ? 445  VAL A O   1 
ATOM   3417 C CB  . VAL A 1 445 ? 15.290  19.941  9.741   1.00 46.02  ? 445  VAL A CB  1 
ATOM   3418 C CG1 . VAL A 1 445 ? 15.582  19.351  11.115  1.00 44.56  ? 445  VAL A CG1 1 
ATOM   3419 C CG2 . VAL A 1 445 ? 13.792  20.181  9.565   1.00 46.62  ? 445  VAL A CG2 1 
ATOM   3420 N N   . PRO A 1 446 ? 18.520  21.705  9.751   1.00 44.56  ? 446  PRO A N   1 
ATOM   3421 C CA  . PRO A 1 446 ? 19.926  21.392  9.502   1.00 43.65  ? 446  PRO A CA  1 
ATOM   3422 C C   . PRO A 1 446 ? 20.488  20.259  10.349  1.00 43.51  ? 446  PRO A C   1 
ATOM   3423 O O   . PRO A 1 446 ? 19.865  19.799  11.282  1.00 44.02  ? 446  PRO A O   1 
ATOM   3424 C CB  . PRO A 1 446 ? 20.636  22.703  9.826   1.00 43.50  ? 446  PRO A CB  1 
ATOM   3425 C CG  . PRO A 1 446 ? 19.555  23.758  9.725   1.00 44.05  ? 446  PRO A CG  1 
ATOM   3426 C CD  . PRO A 1 446 ? 18.335  23.086  10.213  1.00 44.61  ? 446  PRO A CD  1 
ATOM   3427 N N   . HIS A 1 447 ? 21.674  19.809  9.977   1.00 43.71  ? 447  HIS A N   1 
ATOM   3428 C CA  . HIS A 1 447 ? 22.469  18.815  10.694  1.00 42.64  ? 447  HIS A CA  1 
ATOM   3429 C C   . HIS A 1 447 ? 22.656  19.241  12.162  1.00 42.49  ? 447  HIS A C   1 
ATOM   3430 O O   . HIS A 1 447 ? 23.250  20.303  12.461  1.00 42.39  ? 447  HIS A O   1 
ATOM   3431 C CB  . HIS A 1 447 ? 23.829  18.742  9.974   1.00 42.37  ? 447  HIS A CB  1 
ATOM   3432 C CG  . HIS A 1 447 ? 24.676  17.569  10.340  1.00 41.37  ? 447  HIS A CG  1 
ATOM   3433 N ND1 . HIS A 1 447 ? 24.294  16.268  10.093  1.00 40.81  ? 447  HIS A ND1 1 
ATOM   3434 C CD2 . HIS A 1 447 ? 25.918  17.504  10.879  1.00 39.58  ? 447  HIS A CD2 1 
ATOM   3435 C CE1 . HIS A 1 447 ? 25.254  15.450  10.490  1.00 40.41  ? 447  HIS A CE1 1 
ATOM   3436 N NE2 . HIS A 1 447 ? 26.252  16.175  10.965  1.00 39.60  ? 447  HIS A NE2 1 
ATOM   3437 N N   . GLY A 1 448 ? 22.132  18.411  13.064  1.00 42.02  ? 448  GLY A N   1 
ATOM   3438 C CA  . GLY A 1 448 ? 22.258  18.624  14.493  1.00 40.96  ? 448  GLY A CA  1 
ATOM   3439 C C   . GLY A 1 448 ? 21.025  19.131  15.209  1.00 41.10  ? 448  GLY A C   1 
ATOM   3440 O O   . GLY A 1 448 ? 21.028  19.239  16.440  1.00 41.41  ? 448  GLY A O   1 
ATOM   3441 N N   . TYR A 1 449 ? 19.964  19.445  14.477  1.00 41.14  ? 449  TYR A N   1 
ATOM   3442 C CA  . TYR A 1 449 ? 18.865  20.178  15.111  1.00 41.55  ? 449  TYR A CA  1 
ATOM   3443 C C   . TYR A 1 449 ? 17.675  19.336  15.536  1.00 42.40  ? 449  TYR A C   1 
ATOM   3444 O O   . TYR A 1 449 ? 16.593  19.868  15.824  1.00 43.19  ? 449  TYR A O   1 
ATOM   3445 C CB  . TYR A 1 449 ? 18.474  21.415  14.316  1.00 41.22  ? 449  TYR A CB  1 
ATOM   3446 C CG  . TYR A 1 449 ? 19.535  22.452  14.434  1.00 41.10  ? 449  TYR A CG  1 
ATOM   3447 C CD1 . TYR A 1 449 ? 20.594  22.507  13.529  1.00 40.14  ? 449  TYR A CD1 1 
ATOM   3448 C CD2 . TYR A 1 449 ? 19.522  23.362  15.486  1.00 41.93  ? 449  TYR A CD2 1 
ATOM   3449 C CE1 . TYR A 1 449 ? 21.597  23.471  13.652  1.00 39.63  ? 449  TYR A CE1 1 
ATOM   3450 C CE2 . TYR A 1 449 ? 20.516  24.327  15.613  1.00 41.21  ? 449  TYR A CE2 1 
ATOM   3451 C CZ  . TYR A 1 449 ? 21.541  24.365  14.694  1.00 40.48  ? 449  TYR A CZ  1 
ATOM   3452 O OH  . TYR A 1 449 ? 22.521  25.285  14.859  1.00 41.28  ? 449  TYR A OH  1 
ATOM   3453 N N   . GLU A 1 450 ? 17.894  18.028  15.602  1.00 41.80  ? 450  GLU A N   1 
ATOM   3454 C CA  . GLU A 1 450 ? 16.990  17.176  16.316  1.00 42.55  ? 450  GLU A CA  1 
ATOM   3455 C C   . GLU A 1 450 ? 17.484  16.946  17.728  1.00 42.92  ? 450  GLU A C   1 
ATOM   3456 O O   . GLU A 1 450 ? 16.738  16.395  18.558  1.00 44.80  ? 450  GLU A O   1 
ATOM   3457 C CB  . GLU A 1 450 ? 16.874  15.834  15.636  1.00 42.47  ? 450  GLU A CB  1 
ATOM   3458 C CG  . GLU A 1 450 ? 17.882  14.842  16.094  1.00 42.12  ? 450  GLU A CG  1 
ATOM   3459 C CD  . GLU A 1 450 ? 19.205  14.957  15.384  1.00 43.42  ? 450  GLU A CD  1 
ATOM   3460 O OE1 . GLU A 1 450 ? 19.590  16.074  14.930  1.00 42.68  ? 450  GLU A OE1 1 
ATOM   3461 O OE2 . GLU A 1 450 ? 19.869  13.900  15.290  1.00 43.69  ? 450  GLU A OE2 1 
ATOM   3462 N N   . ILE A 1 451 ? 18.734  17.323  18.015  1.00 41.78  ? 451  ILE A N   1 
ATOM   3463 C CA  . ILE A 1 451 ? 19.351  16.916  19.271  1.00 40.89  ? 451  ILE A CA  1 
ATOM   3464 C C   . ILE A 1 451 ? 18.609  17.569  20.416  1.00 41.81  ? 451  ILE A C   1 
ATOM   3465 O O   . ILE A 1 451 ? 18.201  16.885  21.371  1.00 42.97  ? 451  ILE A O   1 
ATOM   3466 C CB  . ILE A 1 451 ? 20.830  17.239  19.353  1.00 39.91  ? 451  ILE A CB  1 
ATOM   3467 C CG1 . ILE A 1 451 ? 21.616  16.486  18.287  1.00 40.54  ? 451  ILE A CG1 1 
ATOM   3468 C CG2 . ILE A 1 451 ? 21.356  16.863  20.709  1.00 38.99  ? 451  ILE A CG2 1 
ATOM   3469 C CD1 . ILE A 1 451 ? 23.117  16.838  18.271  1.00 42.17  ? 451  ILE A CD1 1 
ATOM   3470 N N   . GLU A 1 452 ? 18.399  18.877  20.298  1.00 41.66  ? 452  GLU A N   1 
ATOM   3471 C CA  . GLU A 1 452 ? 17.688  19.629  21.313  1.00 42.57  ? 452  GLU A CA  1 
ATOM   3472 C C   . GLU A 1 452 ? 16.314  19.026  21.648  1.00 43.30  ? 452  GLU A C   1 
ATOM   3473 O O   . GLU A 1 452 ? 15.875  19.110  22.782  1.00 44.06  ? 452  GLU A O   1 
ATOM   3474 C CB  . GLU A 1 452 ? 17.594  21.120  20.949  1.00 42.94  ? 452  GLU A CB  1 
ATOM   3475 C CG  . GLU A 1 452 ? 16.658  21.488  19.800  1.00 44.37  ? 452  GLU A CG  1 
ATOM   3476 C CD  . GLU A 1 452 ? 17.043  22.832  19.182  1.00 47.22  ? 452  GLU A CD  1 
ATOM   3477 O OE1 . GLU A 1 452 ? 18.206  22.972  18.768  1.00 45.58  ? 452  GLU A OE1 1 
ATOM   3478 O OE2 . GLU A 1 452 ? 16.197  23.761  19.107  1.00 49.38  ? 452  GLU A OE2 1 
ATOM   3479 N N   . PHE A 1 453 ? 15.654  18.401  20.674  1.00 43.08  ? 453  PHE A N   1 
ATOM   3480 C CA  . PHE A 1 453 ? 14.400  17.704  20.946  1.00 43.68  ? 453  PHE A CA  1 
ATOM   3481 C C   . PHE A 1 453 ? 14.606  16.353  21.626  1.00 43.42  ? 453  PHE A C   1 
ATOM   3482 O O   . PHE A 1 453 ? 13.967  16.099  22.621  1.00 44.00  ? 453  PHE A O   1 
ATOM   3483 C CB  . PHE A 1 453 ? 13.535  17.581  19.692  1.00 44.36  ? 453  PHE A CB  1 
ATOM   3484 C CG  . PHE A 1 453 ? 13.058  18.905  19.173  1.00 44.42  ? 453  PHE A CG  1 
ATOM   3485 C CD1 . PHE A 1 453 ? 11.846  19.432  19.584  1.00 44.44  ? 453  PHE A CD1 1 
ATOM   3486 C CD2 . PHE A 1 453 ? 13.850  19.651  18.301  1.00 43.47  ? 453  PHE A CD2 1 
ATOM   3487 C CE1 . PHE A 1 453 ? 11.430  20.684  19.123  1.00 44.95  ? 453  PHE A CE1 1 
ATOM   3488 C CE2 . PHE A 1 453 ? 13.443  20.900  17.851  1.00 44.12  ? 453  PHE A CE2 1 
ATOM   3489 C CZ  . PHE A 1 453 ? 12.226  21.410  18.255  1.00 44.49  ? 453  PHE A CZ  1 
ATOM   3490 N N   . ILE A 1 454 ? 15.514  15.511  21.132  1.00 43.08  ? 454  ILE A N   1 
ATOM   3491 C CA  . ILE A 1 454 ? 15.779  14.213  21.778  1.00 43.19  ? 454  ILE A CA  1 
ATOM   3492 C C   . ILE A 1 454 ? 16.145  14.394  23.242  1.00 43.68  ? 454  ILE A C   1 
ATOM   3493 O O   . ILE A 1 454 ? 15.785  13.565  24.081  1.00 43.74  ? 454  ILE A O   1 
ATOM   3494 C CB  . ILE A 1 454 ? 16.915  13.423  21.091  1.00 42.79  ? 454  ILE A CB  1 
ATOM   3495 C CG1 . ILE A 1 454 ? 16.635  13.236  19.593  1.00 43.13  ? 454  ILE A CG1 1 
ATOM   3496 C CG2 . ILE A 1 454 ? 17.122  12.073  21.770  1.00 41.44  ? 454  ILE A CG2 1 
ATOM   3497 C CD1 . ILE A 1 454 ? 15.274  12.661  19.300  1.00 44.95  ? 454  ILE A CD1 1 
ATOM   3498 N N   . PHE A 1 455 ? 16.862  15.486  23.542  1.00 43.77  ? 455  PHE A N   1 
ATOM   3499 C CA  . PHE A 1 455 ? 17.360  15.745  24.905  1.00 43.71  ? 455  PHE A CA  1 
ATOM   3500 C C   . PHE A 1 455 ? 16.318  16.378  25.813  1.00 45.07  ? 455  PHE A C   1 
ATOM   3501 O O   . PHE A 1 455 ? 16.484  16.383  27.038  1.00 46.38  ? 455  PHE A O   1 
ATOM   3502 C CB  . PHE A 1 455 ? 18.675  16.540  24.897  1.00 42.41  ? 455  PHE A CB  1 
ATOM   3503 C CG  . PHE A 1 455 ? 19.898  15.664  24.860  1.00 41.83  ? 455  PHE A CG  1 
ATOM   3504 C CD1 . PHE A 1 455 ? 20.396  15.185  23.645  1.00 41.21  ? 455  PHE A CD1 1 
ATOM   3505 C CD2 . PHE A 1 455 ? 20.528  15.273  26.040  1.00 40.38  ? 455  PHE A CD2 1 
ATOM   3506 C CE1 . PHE A 1 455 ? 21.523  14.334  23.607  1.00 39.71  ? 455  PHE A CE1 1 
ATOM   3507 C CE2 . PHE A 1 455 ? 21.639  14.434  26.012  1.00 38.62  ? 455  PHE A CE2 1 
ATOM   3508 C CZ  . PHE A 1 455 ? 22.135  13.962  24.796  1.00 40.11  ? 455  PHE A CZ  1 
ATOM   3509 N N   . GLY A 1 456 ? 15.246  16.901  25.222  1.00 45.40  ? 456  GLY A N   1 
ATOM   3510 C CA  . GLY A 1 456 ? 14.134  17.446  25.987  1.00 46.17  ? 456  GLY A CA  1 
ATOM   3511 C C   . GLY A 1 456 ? 14.175  18.934  26.264  1.00 46.48  ? 456  GLY A C   1 
ATOM   3512 O O   . GLY A 1 456 ? 13.383  19.424  27.059  1.00 47.93  ? 456  GLY A O   1 
ATOM   3513 N N   . LEU A 1 457 ? 15.057  19.680  25.614  1.00 45.32  ? 457  LEU A N   1 
ATOM   3514 C CA  . LEU A 1 457 ? 15.186  21.107  25.966  1.00 46.15  ? 457  LEU A CA  1 
ATOM   3515 C C   . LEU A 1 457 ? 13.877  21.899  25.924  1.00 47.83  ? 457  LEU A C   1 
ATOM   3516 O O   . LEU A 1 457 ? 13.664  22.740  26.780  1.00 49.17  ? 457  LEU A O   1 
ATOM   3517 C CB  . LEU A 1 457 ? 16.301  21.822  25.192  1.00 44.77  ? 457  LEU A CB  1 
ATOM   3518 C CG  . LEU A 1 457 ? 17.718  21.626  25.744  1.00 44.35  ? 457  LEU A CG  1 
ATOM   3519 C CD1 . LEU A 1 457 ? 18.245  20.178  25.553  1.00 42.40  ? 457  LEU A CD1 1 
ATOM   3520 C CD2 . LEU A 1 457 ? 18.683  22.632  25.140  1.00 44.55  ? 457  LEU A CD2 1 
ATOM   3521 N N   . PRO A 1 458 ? 12.980  21.615  24.963  1.00 48.57  ? 458  PRO A N   1 
ATOM   3522 C CA  . PRO A 1 458 ? 11.726  22.373  24.938  1.00 50.35  ? 458  PRO A CA  1 
ATOM   3523 C C   . PRO A 1 458 ? 10.923  22.355  26.246  1.00 52.20  ? 458  PRO A C   1 
ATOM   3524 O O   . PRO A 1 458 ? 10.107  23.244  26.474  1.00 52.62  ? 458  PRO A O   1 
ATOM   3525 C CB  . PRO A 1 458 ? 10.951  21.701  23.801  1.00 50.42  ? 458  PRO A CB  1 
ATOM   3526 C CG  . PRO A 1 458 ? 12.015  21.257  22.878  1.00 48.36  ? 458  PRO A CG  1 
ATOM   3527 C CD  . PRO A 1 458 ? 13.062  20.707  23.804  1.00 47.99  ? 458  PRO A CD  1 
ATOM   3528 N N   . LEU A 1 459 ? 11.181  21.365  27.100  1.00 52.74  ? 459  LEU A N   1 
ATOM   3529 C CA  . LEU A 1 459 ? 10.507  21.270  28.387  1.00 54.93  ? 459  LEU A CA  1 
ATOM   3530 C C   . LEU A 1 459 ? 10.887  22.388  29.332  1.00 56.12  ? 459  LEU A C   1 
ATOM   3531 O O   . LEU A 1 459 ? 10.145  22.684  30.260  1.00 57.65  ? 459  LEU A O   1 
ATOM   3532 C CB  . LEU A 1 459 ? 10.775  19.923  29.050  1.00 54.49  ? 459  LEU A CB  1 
ATOM   3533 C CG  . LEU A 1 459 ? 9.866   18.769  28.655  1.00 55.41  ? 459  LEU A CG  1 
ATOM   3534 C CD1 . LEU A 1 459 ? 10.188  18.249  27.278  1.00 56.32  ? 459  LEU A CD1 1 
ATOM   3535 C CD2 . LEU A 1 459 ? 10.079  17.679  29.621  1.00 56.84  ? 459  LEU A CD2 1 
ATOM   3536 N N   . ASP A 1 460 ? 12.051  22.987  29.115  1.00 56.32  ? 460  ASP A N   1 
ATOM   3537 C CA  . ASP A 1 460 ? 12.452  24.185  29.853  1.00 58.18  ? 460  ASP A CA  1 
ATOM   3538 C C   . ASP A 1 460 ? 11.624  25.382  29.388  1.00 59.63  ? 460  ASP A C   1 
ATOM   3539 O O   . ASP A 1 460 ? 11.837  25.899  28.309  1.00 59.18  ? 460  ASP A O   1 
ATOM   3540 C CB  . ASP A 1 460 ? 13.941  24.456  29.631  1.00 57.08  ? 460  ASP A CB  1 
ATOM   3541 C CG  . ASP A 1 460 ? 14.497  25.552  30.546  1.00 58.97  ? 460  ASP A CG  1 
ATOM   3542 O OD1 . ASP A 1 460 ? 13.764  26.477  30.972  1.00 60.00  ? 460  ASP A OD1 1 
ATOM   3543 O OD2 . ASP A 1 460 ? 15.705  25.474  30.833  1.00 59.88  ? 460  ASP A OD2 1 
ATOM   3544 N N   . PRO A 1 461 ? 10.682  25.842  30.208  1.00 62.26  ? 461  PRO A N   1 
ATOM   3545 C CA  . PRO A 1 461 ? 9.798   26.907  29.688  1.00 64.57  ? 461  PRO A CA  1 
ATOM   3546 C C   . PRO A 1 461 ? 10.526  28.238  29.391  1.00 65.00  ? 461  PRO A C   1 
ATOM   3547 O O   . PRO A 1 461 ? 10.067  29.019  28.550  1.00 65.89  ? 461  PRO A O   1 
ATOM   3548 C CB  . PRO A 1 461 ? 8.750   27.076  30.796  1.00 66.32  ? 461  PRO A CB  1 
ATOM   3549 C CG  . PRO A 1 461 ? 9.468   26.669  32.056  1.00 65.79  ? 461  PRO A CG  1 
ATOM   3550 C CD  . PRO A 1 461 ? 10.539  25.653  31.662  1.00 63.57  ? 461  PRO A CD  1 
ATOM   3551 N N   . SER A 1 462 ? 11.660  28.466  30.052  1.00 64.63  ? 462  SER A N   1 
ATOM   3552 C CA  . SER A 1 462 ? 12.488  29.642  29.789  1.00 64.89  ? 462  SER A CA  1 
ATOM   3553 C C   . SER A 1 462 ? 13.144  29.637  28.391  1.00 63.56  ? 462  SER A C   1 
ATOM   3554 O O   . SER A 1 462 ? 13.702  30.666  27.973  1.00 64.05  ? 462  SER A O   1 
ATOM   3555 C CB  . SER A 1 462 ? 13.569  29.784  30.863  1.00 64.58  ? 462  SER A CB  1 
ATOM   3556 O OG  . SER A 1 462 ? 14.752  29.106  30.471  1.00 63.39  ? 462  SER A OG  1 
ATOM   3557 N N   . LEU A 1 463 ? 13.090  28.497  27.683  1.00 61.89  ? 463  LEU A N   1 
ATOM   3558 C CA  . LEU A 1 463 ? 13.624  28.402  26.302  1.00 60.10  ? 463  LEU A CA  1 
ATOM   3559 C C   . LEU A 1 463 ? 12.656  28.763  25.139  1.00 60.79  ? 463  LEU A C   1 
ATOM   3560 O O   . LEU A 1 463 ? 13.045  28.707  23.975  1.00 60.37  ? 463  LEU A O   1 
ATOM   3561 C CB  . LEU A 1 463 ? 14.284  27.051  26.049  1.00 57.82  ? 463  LEU A CB  1 
ATOM   3562 C CG  . LEU A 1 463 ? 15.572  26.752  26.811  1.00 56.39  ? 463  LEU A CG  1 
ATOM   3563 C CD1 . LEU A 1 463 ? 15.990  25.298  26.544  1.00 53.98  ? 463  LEU A CD1 1 
ATOM   3564 C CD2 . LEU A 1 463 ? 16.694  27.723  26.479  1.00 53.23  ? 463  LEU A CD2 1 
ATOM   3565 N N   . ASN A 1 464 ? 11.409  29.115  25.443  1.00 62.16  ? 464  ASN A N   1 
ATOM   3566 C CA  . ASN A 1 464 ? 10.503  29.692  24.426  1.00 63.18  ? 464  ASN A CA  1 
ATOM   3567 C C   . ASN A 1 464 ? 10.011  28.780  23.297  1.00 61.83  ? 464  ASN A C   1 
ATOM   3568 O O   . ASN A 1 464 ? 9.455   29.284  22.313  1.00 62.72  ? 464  ASN A O   1 
ATOM   3569 C CB  . ASN A 1 464 ? 11.102  30.969  23.803  1.00 63.52  ? 464  ASN A CB  1 
ATOM   3570 C CG  . ASN A 1 464 ? 11.039  32.168  24.739  1.00 66.10  ? 464  ASN A CG  1 
ATOM   3571 O OD1 . ASN A 1 464 ? 10.734  32.042  25.933  1.00 65.72  ? 464  ASN A OD1 1 
ATOM   3572 N ND2 . ASN A 1 464 ? 11.341  33.346  24.194  1.00 68.46  ? 464  ASN A ND2 1 
ATOM   3573 N N   . TYR A 1 465 ? 10.200  27.468  23.428  1.00 59.35  ? 465  TYR A N   1 
ATOM   3574 C CA  . TYR A 1 465 ? 9.591   26.523  22.493  1.00 58.14  ? 465  TYR A CA  1 
ATOM   3575 C C   . TYR A 1 465 ? 8.067   26.531  22.614  1.00 59.73  ? 465  TYR A C   1 
ATOM   3576 O O   . TYR A 1 465 ? 7.541   26.883  23.662  1.00 60.87  ? 465  TYR A O   1 
ATOM   3577 C CB  . TYR A 1 465 ? 10.101  25.125  22.785  1.00 56.57  ? 465  TYR A CB  1 
ATOM   3578 C CG  . TYR A 1 465 ? 11.554  24.932  22.481  1.00 53.40  ? 465  TYR A CG  1 
ATOM   3579 C CD1 . TYR A 1 465 ? 11.969  24.540  21.217  1.00 52.07  ? 465  TYR A CD1 1 
ATOM   3580 C CD2 . TYR A 1 465 ? 12.518  25.131  23.456  1.00 52.81  ? 465  TYR A CD2 1 
ATOM   3581 C CE1 . TYR A 1 465 ? 13.310  24.354  20.926  1.00 51.15  ? 465  TYR A CE1 1 
ATOM   3582 C CE2 . TYR A 1 465 ? 13.864  24.936  23.182  1.00 51.33  ? 465  TYR A CE2 1 
ATOM   3583 C CZ  . TYR A 1 465 ? 14.255  24.550  21.911  1.00 50.91  ? 465  TYR A CZ  1 
ATOM   3584 O OH  . TYR A 1 465 ? 15.593  24.343  21.626  1.00 49.63  ? 465  TYR A OH  1 
ATOM   3585 N N   . THR A 1 466 ? 7.353   26.136  21.563  1.00 59.85  ? 466  THR A N   1 
ATOM   3586 C CA  . THR A 1 466 ? 5.883   26.100  21.627  1.00 61.49  ? 466  THR A CA  1 
ATOM   3587 C C   . THR A 1 466 ? 5.402   24.896  22.428  1.00 62.03  ? 466  THR A C   1 
ATOM   3588 O O   . THR A 1 466 ? 6.146   23.930  22.619  1.00 61.18  ? 466  THR A O   1 
ATOM   3589 C CB  . THR A 1 466 ? 5.226   26.007  20.235  1.00 61.97  ? 466  THR A CB  1 
ATOM   3590 O OG1 . THR A 1 466 ? 5.439   24.697  19.696  1.00 60.94  ? 466  THR A OG1 1 
ATOM   3591 C CG2 . THR A 1 466 ? 5.765   27.069  19.275  1.00 60.22  ? 466  THR A CG2 1 
ATOM   3592 N N   . THR A 1 467 ? 4.151   24.943  22.877  1.00 64.07  ? 467  THR A N   1 
ATOM   3593 C CA  . THR A 1 467 ? 3.522   23.807  23.555  1.00 64.56  ? 467  THR A CA  1 
ATOM   3594 C C   . THR A 1 467 ? 3.585   22.523  22.713  1.00 63.81  ? 467  THR A C   1 
ATOM   3595 O O   . THR A 1 467 ? 3.821   21.429  23.236  1.00 63.05  ? 467  THR A O   1 
ATOM   3596 C CB  . THR A 1 467 ? 2.067   24.140  23.916  1.00 67.13  ? 467  THR A CB  1 
ATOM   3597 O OG1 . THR A 1 467 ? 2.048   25.287  24.777  1.00 67.89  ? 467  THR A OG1 1 
ATOM   3598 C CG2 . THR A 1 467 ? 1.401   22.975  24.632  1.00 67.70  ? 467  THR A CG2 1 
ATOM   3599 N N   . GLU A 1 468 ? 3.391   22.675  21.402  1.00 63.84  ? 468  GLU A N   1 
ATOM   3600 C CA  . GLU A 1 468 ? 3.413   21.554  20.470  1.00 63.18  ? 468  GLU A CA  1 
ATOM   3601 C C   . GLU A 1 468 ? 4.781   20.872  20.531  1.00 60.82  ? 468  GLU A C   1 
ATOM   3602 O O   . GLU A 1 468 ? 4.879   19.643  20.576  1.00 60.34  ? 468  GLU A O   1 
ATOM   3603 C CB  . GLU A 1 468 ? 3.081   22.037  19.053  1.00 63.46  ? 468  GLU A CB  1 
ATOM   3604 C CG  . GLU A 1 468 ? 1.605   22.431  18.809  1.00 68.80  ? 468  GLU A CG  1 
ATOM   3605 C CD  . GLU A 1 468 ? 1.165   23.783  19.470  1.00 75.13  ? 468  GLU A CD  1 
ATOM   3606 O OE1 . GLU A 1 468 ? 0.039   23.823  20.050  1.00 76.72  ? 468  GLU A OE1 1 
ATOM   3607 O OE2 . GLU A 1 468 ? 1.928   24.799  19.414  1.00 75.21  ? 468  GLU A OE2 1 
ATOM   3608 N N   . GLU A 1 469 ? 5.826   21.697  20.565  1.00 59.33  ? 469  GLU A N   1 
ATOM   3609 C CA  . GLU A 1 469 ? 7.201   21.242  20.581  1.00 57.08  ? 469  GLU A CA  1 
ATOM   3610 C C   . GLU A 1 469 ? 7.544   20.533  21.881  1.00 56.92  ? 469  GLU A C   1 
ATOM   3611 O O   . GLU A 1 469 ? 8.322   19.589  21.885  1.00 56.18  ? 469  GLU A O   1 
ATOM   3612 C CB  . GLU A 1 469 ? 8.138   22.423  20.342  1.00 56.02  ? 469  GLU A CB  1 
ATOM   3613 C CG  . GLU A 1 469 ? 8.280   22.782  18.864  1.00 54.95  ? 469  GLU A CG  1 
ATOM   3614 C CD  . GLU A 1 469 ? 9.011   24.099  18.601  1.00 53.61  ? 469  GLU A CD  1 
ATOM   3615 O OE1 . GLU A 1 469 ? 8.865   25.050  19.391  1.00 55.60  ? 469  GLU A OE1 1 
ATOM   3616 O OE2 . GLU A 1 469 ? 9.705   24.204  17.576  1.00 51.44  ? 469  GLU A OE2 1 
ATOM   3617 N N   . ARG A 1 470 ? 6.940   20.985  22.977  1.00 58.07  ? 470  ARG A N   1 
ATOM   3618 C CA  . ARG A 1 470 ? 7.118   20.386  24.289  1.00 57.87  ? 470  ARG A CA  1 
ATOM   3619 C C   . ARG A 1 470 ? 6.502   18.983  24.319  1.00 58.21  ? 470  ARG A C   1 
ATOM   3620 O O   . ARG A 1 470 ? 7.072   18.062  24.908  1.00 57.55  ? 470  ARG A O   1 
ATOM   3621 C CB  . ARG A 1 470 ? 6.480   21.283  25.344  1.00 59.49  ? 470  ARG A CB  1 
ATOM   3622 C CG  . ARG A 1 470 ? 6.886   20.979  26.771  1.00 62.85  ? 470  ARG A CG  1 
ATOM   3623 C CD  . ARG A 1 470 ? 5.852   21.486  27.825  1.00 69.82  ? 470  ARG A CD  1 
ATOM   3624 N NE  . ARG A 1 470 ? 4.914   20.435  28.247  1.00 74.19  ? 470  ARG A NE  1 
ATOM   3625 C CZ  . ARG A 1 470 ? 3.607   20.413  27.968  1.00 78.77  ? 470  ARG A CZ  1 
ATOM   3626 N NH1 . ARG A 1 470 ? 2.851   19.408  28.396  1.00 80.68  ? 470  ARG A NH1 1 
ATOM   3627 N NH2 . ARG A 1 470 ? 3.039   21.399  27.273  1.00 81.55  ? 470  ARG A NH2 1 
ATOM   3628 N N   . ILE A 1 471 ? 5.340   18.830  23.679  1.00 59.15  ? 471  ILE A N   1 
ATOM   3629 C CA  . ILE A 1 471 ? 4.643   17.545  23.577  1.00 59.47  ? 471  ILE A CA  1 
ATOM   3630 C C   . ILE A 1 471 ? 5.434   16.596  22.667  1.00 57.99  ? 471  ILE A C   1 
ATOM   3631 O O   . ILE A 1 471 ? 5.504   15.374  22.900  1.00 57.88  ? 471  ILE A O   1 
ATOM   3632 C CB  . ILE A 1 471 ? 3.186   17.755  23.074  1.00 61.47  ? 471  ILE A CB  1 
ATOM   3633 C CG1 . ILE A 1 471 ? 2.362   18.444  24.167  1.00 63.49  ? 471  ILE A CG1 1 
ATOM   3634 C CG2 . ILE A 1 471 ? 2.524   16.431  22.675  1.00 61.85  ? 471  ILE A CG2 1 
ATOM   3635 C CD1 . ILE A 1 471 ? 1.095   19.109  23.686  1.00 66.23  ? 471  ILE A CD1 1 
ATOM   3636 N N   . PHE A 1 472 ? 6.045   17.193  21.648  1.00 56.51  ? 472  PHE A N   1 
ATOM   3637 C CA  . PHE A 1 472 ? 6.846   16.487  20.659  1.00 55.03  ? 472  PHE A CA  1 
ATOM   3638 C C   . PHE A 1 472 ? 8.134   15.988  21.314  1.00 53.74  ? 472  PHE A C   1 
ATOM   3639 O O   . PHE A 1 472 ? 8.443   14.788  21.280  1.00 53.46  ? 472  PHE A O   1 
ATOM   3640 C CB  . PHE A 1 472 ? 7.115   17.438  19.495  1.00 54.20  ? 472  PHE A CB  1 
ATOM   3641 C CG  . PHE A 1 472 ? 7.952   16.863  18.406  1.00 51.93  ? 472  PHE A CG  1 
ATOM   3642 C CD1 . PHE A 1 472 ? 7.669   15.609  17.875  1.00 51.69  ? 472  PHE A CD1 1 
ATOM   3643 C CD2 . PHE A 1 472 ? 9.013   17.603  17.877  1.00 49.37  ? 472  PHE A CD2 1 
ATOM   3644 C CE1 . PHE A 1 472 ? 8.456   15.077  16.851  1.00 50.76  ? 472  PHE A CE1 1 
ATOM   3645 C CE2 . PHE A 1 472 ? 9.792   17.095  16.855  1.00 48.14  ? 472  PHE A CE2 1 
ATOM   3646 C CZ  . PHE A 1 472 ? 9.515   15.825  16.336  1.00 49.10  ? 472  PHE A CZ  1 
ATOM   3647 N N   . ALA A 1 473 ? 8.852   16.909  21.951  1.00 52.88  ? 473  ALA A N   1 
ATOM   3648 C CA  . ALA A 1 473 ? 10.017  16.574  22.761  1.00 51.83  ? 473  ALA A CA  1 
ATOM   3649 C C   . ALA A 1 473 ? 9.732   15.396  23.707  1.00 52.60  ? 473  ALA A C   1 
ATOM   3650 O O   . ALA A 1 473 ? 10.520  14.479  23.805  1.00 51.90  ? 473  ALA A O   1 
ATOM   3651 C CB  . ALA A 1 473 ? 10.494  17.809  23.527  1.00 50.93  ? 473  ALA A CB  1 
ATOM   3652 N N   . GLN A 1 474 ? 8.590   15.424  24.384  1.00 54.70  ? 474  GLN A N   1 
ATOM   3653 C CA  . GLN A 1 474 ? 8.193   14.353  25.293  1.00 56.02  ? 474  GLN A CA  1 
ATOM   3654 C C   . GLN A 1 474 ? 8.011   13.012  24.559  1.00 56.44  ? 474  GLN A C   1 
ATOM   3655 O O   . GLN A 1 474 ? 8.457   11.965  25.043  1.00 56.34  ? 474  GLN A O   1 
ATOM   3656 C CB  . GLN A 1 474 ? 6.925   14.749  26.062  1.00 57.92  ? 474  GLN A CB  1 
ATOM   3657 C CG  . GLN A 1 474 ? 7.138   15.889  27.094  1.00 59.98  ? 474  GLN A CG  1 
ATOM   3658 C CD  . GLN A 1 474 ? 5.860   16.283  27.868  1.00 64.78  ? 474  GLN A CD  1 
ATOM   3659 O OE1 . GLN A 1 474 ? 4.954   16.957  27.346  1.00 66.22  ? 474  GLN A OE1 1 
ATOM   3660 N NE2 . GLN A 1 474 ? 5.806   15.882  29.126  1.00 66.03  ? 474  GLN A NE2 1 
ATOM   3661 N N   . ARG A 1 475 ? 7.367   13.056  23.393  1.00 57.15  ? 475  ARG A N   1 
ATOM   3662 C CA  . ARG A 1 475 ? 7.200   11.880  22.532  1.00 57.54  ? 475  ARG A CA  1 
ATOM   3663 C C   . ARG A 1 475 ? 8.549   11.257  22.174  1.00 56.03  ? 475  ARG A C   1 
ATOM   3664 O O   . ARG A 1 475 ? 8.740   10.025  22.287  1.00 56.52  ? 475  ARG A O   1 
ATOM   3665 C CB  . ARG A 1 475 ? 6.497   12.282  21.237  1.00 58.23  ? 475  ARG A CB  1 
ATOM   3666 C CG  . ARG A 1 475 ? 5.080   11.777  21.076  1.00 61.08  ? 475  ARG A CG  1 
ATOM   3667 C CD  . ARG A 1 475 ? 4.465   12.330  19.776  1.00 61.44  ? 475  ARG A CD  1 
ATOM   3668 N NE  . ARG A 1 475 ? 4.955   11.622  18.596  1.00 59.38  ? 475  ARG A NE  1 
ATOM   3669 C CZ  . ARG A 1 475 ? 5.063   12.159  17.387  1.00 58.13  ? 475  ARG A CZ  1 
ATOM   3670 N NH1 . ARG A 1 475 ? 4.716   13.427  17.177  1.00 56.71  ? 475  ARG A NH1 1 
ATOM   3671 N NH2 . ARG A 1 475 ? 5.521   11.420  16.382  1.00 57.37  ? 475  ARG A NH2 1 
ATOM   3672 N N   . LEU A 1 476 ? 9.468   12.118  21.733  1.00 53.54  ? 476  LEU A N   1 
ATOM   3673 C CA  . LEU A 1 476 ? 10.796  11.700  21.296  1.00 51.39  ? 476  LEU A CA  1 
ATOM   3674 C C   . LEU A 1 476 ? 11.594  11.015  22.382  1.00 50.56  ? 476  LEU A C   1 
ATOM   3675 O O   . LEU A 1 476 ? 12.191  9.974   22.129  1.00 50.49  ? 476  LEU A O   1 
ATOM   3676 C CB  . LEU A 1 476 ? 11.575  12.886  20.716  1.00 49.96  ? 476  LEU A CB  1 
ATOM   3677 C CG  . LEU A 1 476 ? 11.023  13.343  19.364  1.00 49.75  ? 476  LEU A CG  1 
ATOM   3678 C CD1 . LEU A 1 476 ? 11.826  14.467  18.793  1.00 47.56  ? 476  LEU A CD1 1 
ATOM   3679 C CD2 . LEU A 1 476 ? 10.981  12.170  18.398  1.00 50.82  ? 476  LEU A CD2 1 
ATOM   3680 N N   . MET A 1 477 ? 11.580  11.592  23.588  1.00 50.39  ? 477  MET A N   1 
ATOM   3681 C CA  . MET A 1 477 ? 12.296  11.053  24.743  1.00 49.63  ? 477  MET A CA  1 
ATOM   3682 C C   . MET A 1 477 ? 11.724  9.689   25.128  1.00 50.98  ? 477  MET A C   1 
ATOM   3683 O O   . MET A 1 477 ? 12.447  8.806   25.605  1.00 50.43  ? 477  MET A O   1 
ATOM   3684 C CB  . MET A 1 477 ? 12.155  11.993  25.917  1.00 49.68  ? 477  MET A CB  1 
ATOM   3685 C CG  . MET A 1 477 ? 12.924  13.279  25.779  1.00 50.42  ? 477  MET A CG  1 
ATOM   3686 S SD  . MET A 1 477 ? 12.171  14.550  26.818  1.00 55.22  ? 477  MET A SD  1 
ATOM   3687 C CE  . MET A 1 477 ? 12.939  14.197  28.390  1.00 53.90  ? 477  MET A CE  1 
ATOM   3688 N N   . LYS A 1 478 ? 10.418  9.527   24.916  1.00 52.16  ? 478  LYS A N   1 
ATOM   3689 C CA  . LYS A 1 478 ? 9.783   8.255   25.138  1.00 53.75  ? 478  LYS A CA  1 
ATOM   3690 C C   . LYS A 1 478 ? 10.240  7.181   24.143  1.00 52.98  ? 478  LYS A C   1 
ATOM   3691 O O   . LYS A 1 478 ? 10.430  6.029   24.546  1.00 53.00  ? 478  LYS A O   1 
ATOM   3692 C CB  . LYS A 1 478 ? 8.266   8.388   25.181  1.00 55.87  ? 478  LYS A CB  1 
ATOM   3693 C CG  . LYS A 1 478 ? 7.773   8.874   26.525  1.00 58.95  ? 478  LYS A CG  1 
ATOM   3694 C CD  . LYS A 1 478 ? 6.381   8.336   26.887  1.00 64.09  ? 478  LYS A CD  1 
ATOM   3695 C CE  . LYS A 1 478 ? 6.187   8.301   28.410  1.00 66.15  ? 478  LYS A CE  1 
ATOM   3696 N NZ  . LYS A 1 478 ? 7.105   7.317   29.097  1.00 65.77  ? 478  LYS A NZ  1 
ATOM   3697 N N   . TYR A 1 479 ? 10.434  7.563   22.874  1.00 51.59  ? 479  TYR A N   1 
ATOM   3698 C CA  . TYR A 1 479 ? 10.908  6.619   21.856  1.00 51.04  ? 479  TYR A CA  1 
ATOM   3699 C C   . TYR A 1 479 ? 12.313  6.192   22.236  1.00 49.92  ? 479  TYR A C   1 
ATOM   3700 O O   . TYR A 1 479 ? 12.585  4.978   22.406  1.00 49.82  ? 479  TYR A O   1 
ATOM   3701 C CB  . TYR A 1 479 ? 10.958  7.245   20.456  1.00 50.55  ? 479  TYR A CB  1 
ATOM   3702 C CG  . TYR A 1 479 ? 9.627   7.600   19.828  1.00 50.96  ? 479  TYR A CG  1 
ATOM   3703 C CD1 . TYR A 1 479 ? 8.524   6.747   19.934  1.00 52.81  ? 479  TYR A CD1 1 
ATOM   3704 C CD2 . TYR A 1 479 ? 9.484   8.776   19.102  1.00 48.75  ? 479  TYR A CD2 1 
ATOM   3705 C CE1 . TYR A 1 479 ? 7.295   7.078   19.344  1.00 53.83  ? 479  TYR A CE1 1 
ATOM   3706 C CE2 . TYR A 1 479 ? 8.274   9.120   18.511  1.00 51.23  ? 479  TYR A CE2 1 
ATOM   3707 C CZ  . TYR A 1 479 ? 7.177   8.270   18.627  1.00 53.50  ? 479  TYR A CZ  1 
ATOM   3708 O OH  . TYR A 1 479 ? 5.971   8.621   18.031  1.00 54.62  ? 479  TYR A OH  1 
ATOM   3709 N N   . TRP A 1 480 ? 13.184  7.203   22.395  1.00 47.70  ? 480  TRP A N   1 
ATOM   3710 C CA  . TRP A 1 480 ? 14.582  6.980   22.752  1.00 46.83  ? 480  TRP A CA  1 
ATOM   3711 C C   . TRP A 1 480 ? 14.786  6.057   23.972  1.00 47.36  ? 480  TRP A C   1 
ATOM   3712 O O   . TRP A 1 480 ? 15.492  5.052   23.879  1.00 46.87  ? 480  TRP A O   1 
ATOM   3713 C CB  . TRP A 1 480 ? 15.326  8.305   22.899  1.00 45.27  ? 480  TRP A CB  1 
ATOM   3714 C CG  . TRP A 1 480 ? 16.114  8.696   21.637  1.00 45.49  ? 480  TRP A CG  1 
ATOM   3715 C CD1 . TRP A 1 480 ? 17.465  8.890   21.544  1.00 44.71  ? 480  TRP A CD1 1 
ATOM   3716 C CD2 . TRP A 1 480 ? 15.592  8.924   20.307  1.00 45.55  ? 480  TRP A CD2 1 
ATOM   3717 N NE1 . TRP A 1 480 ? 17.812  9.226   20.250  1.00 43.87  ? 480  TRP A NE1 1 
ATOM   3718 C CE2 . TRP A 1 480 ? 16.680  9.266   19.483  1.00 44.37  ? 480  TRP A CE2 1 
ATOM   3719 C CE3 . TRP A 1 480 ? 14.312  8.876   19.742  1.00 46.59  ? 480  TRP A CE3 1 
ATOM   3720 C CZ2 . TRP A 1 480 ? 16.526  9.537   18.129  1.00 45.25  ? 480  TRP A CZ2 1 
ATOM   3721 C CZ3 . TRP A 1 480 ? 14.160  9.155   18.403  1.00 45.35  ? 480  TRP A CZ3 1 
ATOM   3722 C CH2 . TRP A 1 480 ? 15.256  9.477   17.609  1.00 46.51  ? 480  TRP A CH2 1 
ATOM   3723 N N   . THR A 1 481 ? 14.119  6.370   25.084  1.00 48.04  ? 481  THR A N   1 
ATOM   3724 C CA  . THR A 1 481 ? 14.277  5.608   26.327  1.00 48.48  ? 481  THR A CA  1 
ATOM   3725 C C   . THR A 1 481 ? 13.498  4.286   26.329  1.00 50.08  ? 481  THR A C   1 
ATOM   3726 O O   . THR A 1 481 ? 13.849  3.376   27.068  1.00 50.41  ? 481  THR A O   1 
ATOM   3727 C CB  . THR A 1 481 ? 13.863  6.438   27.542  1.00 48.50  ? 481  THR A CB  1 
ATOM   3728 O OG1 . THR A 1 481 ? 12.495  6.803   27.386  1.00 51.64  ? 481  THR A OG1 1 
ATOM   3729 C CG2 . THR A 1 481 ? 14.667  7.714   27.636  1.00 46.87  ? 481  THR A CG2 1 
ATOM   3730 N N   . ASN A 1 482 ? 12.434  4.182   25.533  1.00 51.18  ? 482  ASN A N   1 
ATOM   3731 C CA  . ASN A 1 482 ? 11.766  2.882   25.358  1.00 53.21  ? 482  ASN A CA  1 
ATOM   3732 C C   . ASN A 1 482 ? 12.725  1.958   24.629  1.00 53.34  ? 482  ASN A C   1 
ATOM   3733 O O   . ASN A 1 482 ? 12.857  0.760   24.947  1.00 53.54  ? 482  ASN A O   1 
ATOM   3734 C CB  . ASN A 1 482 ? 10.507  2.988   24.501  1.00 54.02  ? 482  ASN A CB  1 
ATOM   3735 C CG  . ASN A 1 482 ? 9.285   3.435   25.268  1.00 55.25  ? 482  ASN A CG  1 
ATOM   3736 O OD1 . ASN A 1 482 ? 9.267   3.511   26.494  1.00 56.22  ? 482  ASN A OD1 1 
ATOM   3737 N ND2 . ASN A 1 482 ? 8.233   3.727   24.525  1.00 57.78  ? 482  ASN A ND2 1 
ATOM   3738 N N   . PHE A 1 483 ? 13.385  2.541   23.627  1.00 52.27  ? 483  PHE A N   1 
ATOM   3739 C CA  . PHE A 1 483 ? 14.330  1.798   22.857  1.00 52.13  ? 483  PHE A CA  1 
ATOM   3740 C C   . PHE A 1 483 ? 15.474  1.327   23.753  1.00 52.63  ? 483  PHE A C   1 
ATOM   3741 O O   . PHE A 1 483 ? 15.815  0.121   23.759  1.00 53.22  ? 483  PHE A O   1 
ATOM   3742 C CB  . PHE A 1 483 ? 14.876  2.612   21.711  1.00 50.56  ? 483  PHE A CB  1 
ATOM   3743 C CG  . PHE A 1 483 ? 15.884  1.871   20.938  1.00 49.54  ? 483  PHE A CG  1 
ATOM   3744 C CD1 . PHE A 1 483 ? 15.494  0.806   20.141  1.00 47.03  ? 483  PHE A CD1 1 
ATOM   3745 C CD2 . PHE A 1 483 ? 17.231  2.171   21.063  1.00 47.43  ? 483  PHE A CD2 1 
ATOM   3746 C CE1 . PHE A 1 483 ? 16.412  0.075   19.449  1.00 46.90  ? 483  PHE A CE1 1 
ATOM   3747 C CE2 . PHE A 1 483 ? 18.161  1.432   20.372  1.00 47.85  ? 483  PHE A CE2 1 
ATOM   3748 C CZ  . PHE A 1 483 ? 17.743  0.374   19.557  1.00 47.52  ? 483  PHE A CZ  1 
ATOM   3749 N N   . ALA A 1 484 ? 16.062  2.271   24.505  1.00 51.47  ? 484  ALA A N   1 
ATOM   3750 C CA  . ALA A 1 484 ? 17.039  1.921   25.542  1.00 51.65  ? 484  ALA A CA  1 
ATOM   3751 C C   . ALA A 1 484 ? 16.535  0.781   26.428  1.00 53.90  ? 484  ALA A C   1 
ATOM   3752 O O   . ALA A 1 484 ? 17.247  -0.189  26.638  1.00 54.95  ? 484  ALA A O   1 
ATOM   3753 C CB  . ALA A 1 484 ? 17.358  3.094   26.386  1.00 50.37  ? 484  ALA A CB  1 
ATOM   3754 N N   . ARG A 1 485 ? 15.315  0.892   26.939  1.00 55.18  ? 485  ARG A N   1 
ATOM   3755 C CA  . ARG A 1 485 ? 14.791  -0.103  27.867  1.00 57.80  ? 485  ARG A CA  1 
ATOM   3756 C C   . ARG A 1 485 ? 14.599  -1.483  27.237  1.00 58.66  ? 485  ARG A C   1 
ATOM   3757 O O   . ARG A 1 485 ? 14.960  -2.487  27.833  1.00 58.93  ? 485  ARG A O   1 
ATOM   3758 C CB  . ARG A 1 485 ? 13.437  0.346   28.423  1.00 59.57  ? 485  ARG A CB  1 
ATOM   3759 C CG  . ARG A 1 485 ? 13.451  1.051   29.768  1.00 62.94  ? 485  ARG A CG  1 
ATOM   3760 C CD  . ARG A 1 485 ? 12.000  1.332   30.220  1.00 70.43  ? 485  ARG A CD  1 
ATOM   3761 N NE  . ARG A 1 485 ? 11.397  2.453   29.468  1.00 72.54  ? 485  ARG A NE  1 
ATOM   3762 C CZ  . ARG A 1 485 ? 11.571  3.747   29.756  1.00 71.52  ? 485  ARG A CZ  1 
ATOM   3763 N NH1 . ARG A 1 485 ? 12.325  4.117   30.795  1.00 70.06  ? 485  ARG A NH1 1 
ATOM   3764 N NH2 . ARG A 1 485 ? 10.980  4.678   29.003  1.00 71.25  ? 485  ARG A NH2 1 
ATOM   3765 N N   . THR A 1 486 ? 14.030  -1.505  26.032  1.00 58.76  ? 486  THR A N   1 
ATOM   3766 C CA  . THR A 1 486 ? 13.383  -2.701  25.496  1.00 60.35  ? 486  THR A CA  1 
ATOM   3767 C C   . THR A 1 486 ? 13.896  -3.156  24.125  1.00 60.34  ? 486  THR A C   1 
ATOM   3768 O O   . THR A 1 486 ? 13.662  -4.293  23.711  1.00 62.38  ? 486  THR A O   1 
ATOM   3769 C CB  . THR A 1 486 ? 11.829  -2.527  25.431  1.00 61.65  ? 486  THR A CB  1 
ATOM   3770 O OG1 . THR A 1 486 ? 11.468  -1.645  24.361  1.00 60.65  ? 486  THR A OG1 1 
ATOM   3771 C CG2 . THR A 1 486 ? 11.269  -1.982  26.738  1.00 60.40  ? 486  THR A CG2 1 
ATOM   3772 N N   . GLY A 1 487 ? 14.595  -2.271  23.432  1.00 58.81  ? 487  GLY A N   1 
ATOM   3773 C CA  . GLY A 1 487 ? 15.025  -2.516  22.065  1.00 58.77  ? 487  GLY A CA  1 
ATOM   3774 C C   . GLY A 1 487 ? 13.976  -2.087  21.059  1.00 59.36  ? 487  GLY A C   1 
ATOM   3775 O O   . GLY A 1 487 ? 14.179  -2.234  19.861  1.00 59.09  ? 487  GLY A O   1 
ATOM   3776 N N   . ASP A 1 488 ? 12.871  -1.530  21.554  1.00 60.23  ? 488  ASP A N   1 
ATOM   3777 C CA  . ASP A 1 488 ? 11.684  -1.228  20.757  1.00 62.09  ? 488  ASP A CA  1 
ATOM   3778 C C   . ASP A 1 488 ? 11.242  0.174   21.169  1.00 61.76  ? 488  ASP A C   1 
ATOM   3779 O O   . ASP A 1 488 ? 11.098  0.425   22.355  1.00 62.22  ? 488  ASP A O   1 
ATOM   3780 C CB  . ASP A 1 488 ? 10.612  -2.286  21.089  1.00 64.34  ? 488  ASP A CB  1 
ATOM   3781 C CG  . ASP A 1 488 ? 9.326   -2.146  20.284  1.00 65.26  ? 488  ASP A CG  1 
ATOM   3782 O OD1 . ASP A 1 488 ? 9.008   -1.063  19.764  1.00 63.64  ? 488  ASP A OD1 1 
ATOM   3783 O OD2 . ASP A 1 488 ? 8.588   -3.156  20.208  1.00 68.66  ? 488  ASP A OD2 1 
ATOM   3784 N N   . PRO A 1 489 ? 11.056  1.103   20.208  1.00 61.87  ? 489  PRO A N   1 
ATOM   3785 C CA  . PRO A 1 489 ? 10.701  2.470   20.618  1.00 61.98  ? 489  PRO A CA  1 
ATOM   3786 C C   . PRO A 1 489 ? 9.216   2.641   20.900  1.00 64.97  ? 489  PRO A C   1 
ATOM   3787 O O   . PRO A 1 489 ? 8.807   3.685   21.408  1.00 64.75  ? 489  PRO A O   1 
ATOM   3788 C CB  . PRO A 1 489 ? 11.116  3.328   19.420  1.00 60.22  ? 489  PRO A CB  1 
ATOM   3789 C CG  . PRO A 1 489 ? 11.077  2.413   18.267  1.00 60.98  ? 489  PRO A CG  1 
ATOM   3790 C CD  . PRO A 1 489 ? 11.250  0.994   18.752  1.00 61.64  ? 489  PRO A CD  1 
ATOM   3791 N N   . ASN A 1 490 ? 8.425   1.621   20.570  1.00 68.79  ? 490  ASN A N   1 
ATOM   3792 C CA  . ASN A 1 490 ? 6.981   1.634   20.803  1.00 72.52  ? 490  ASN A CA  1 
ATOM   3793 C C   . ASN A 1 490 ? 6.678   1.465   22.278  1.00 75.47  ? 490  ASN A C   1 
ATOM   3794 O O   . ASN A 1 490 ? 7.460   0.857   23.018  1.00 75.21  ? 490  ASN A O   1 
ATOM   3795 C CB  . ASN A 1 490 ? 6.279   0.491   20.039  1.00 73.84  ? 490  ASN A CB  1 
ATOM   3796 C CG  . ASN A 1 490 ? 6.279   0.688   18.537  1.00 72.13  ? 490  ASN A CG  1 
ATOM   3797 O OD1 . ASN A 1 490 ? 5.550   1.529   18.003  1.00 70.61  ? 490  ASN A OD1 1 
ATOM   3798 N ND2 . ASN A 1 490 ? 7.090   -0.100  17.840  1.00 70.13  ? 490  ASN A ND2 1 
ATOM   3799 N N   . ASP A 1 491 ? 5.537   2.000   22.704  1.00 79.66  ? 491  ASP A N   1 
ATOM   3800 C CA  . ASP A 1 491 ? 5.003   1.674   24.019  1.00 83.95  ? 491  ASP A CA  1 
ATOM   3801 C C   . ASP A 1 491 ? 4.148   0.397   23.925  1.00 88.18  ? 491  ASP A C   1 
ATOM   3802 O O   . ASP A 1 491 ? 3.223   0.317   23.098  1.00 89.39  ? 491  ASP A O   1 
ATOM   3803 C CB  . ASP A 1 491 ? 4.207   2.845   24.619  1.00 84.52  ? 491  ASP A CB  1 
ATOM   3804 C CG  . ASP A 1 491 ? 3.689   2.540   26.034  1.00 88.04  ? 491  ASP A CG  1 
ATOM   3805 O OD1 . ASP A 1 491 ? 4.527   2.294   26.940  1.00 89.12  ? 491  ASP A OD1 1 
ATOM   3806 O OD2 . ASP A 1 491 ? 2.444   2.537   26.240  1.00 91.48  ? 491  ASP A OD2 1 
ATOM   3807 N N   . PRO A 1 492 ? 4.467   -0.608  24.769  1.00 90.78  ? 492  PRO A N   1 
ATOM   3808 C CA  . PRO A 1 492 ? 3.764   -1.899  24.810  1.00 94.84  ? 492  PRO A CA  1 
ATOM   3809 C C   . PRO A 1 492 ? 2.287   -1.788  25.215  1.00 98.46  ? 492  PRO A C   1 
ATOM   3810 O O   . PRO A 1 492 ? 1.521   -2.750  25.037  1.00 100.82 ? 492  PRO A O   1 
ATOM   3811 C CB  . PRO A 1 492 ? 4.543   -2.690  25.877  1.00 95.07  ? 492  PRO A CB  1 
ATOM   3812 C CG  . PRO A 1 492 ? 5.886   -1.992  25.983  1.00 91.64  ? 492  PRO A CG  1 
ATOM   3813 C CD  . PRO A 1 492 ? 5.570   -0.554  25.748  1.00 89.49  ? 492  PRO A CD  1 
ATOM   3814 N N   . ARG A 1 493 ? 1.899   -0.628  25.751  1.00 99.37  ? 493  ARG A N   1 
ATOM   3815 C CA  . ARG A 1 493 ? 0.531   -0.404  26.240  1.00 102.99 ? 493  ARG A CA  1 
ATOM   3816 C C   . ARG A 1 493 ? -0.309  0.421   25.254  1.00 103.75 ? 493  ARG A C   1 
ATOM   3817 O O   . ARG A 1 493 ? -1.465  0.075   24.964  1.00 106.04 ? 493  ARG A O   1 
ATOM   3818 C CB  . ARG A 1 493 ? 0.545   0.255   27.633  1.00 102.94 ? 493  ARG A CB  1 
ATOM   3819 C CG  . ARG A 1 493 ? 1.356   -0.513  28.709  1.00 104.59 ? 493  ARG A CG  1 
ATOM   3820 C CD  . ARG A 1 493 ? 1.575   0.315   29.993  1.00 106.71 ? 493  ARG A CD  1 
ATOM   3821 N NE  . ARG A 1 493 ? 2.342   1.554   29.767  1.00 105.91 ? 493  ARG A NE  1 
ATOM   3822 C CZ  . ARG A 1 493 ? 3.453   1.903   30.421  1.00 104.87 ? 493  ARG A CZ  1 
ATOM   3823 N NH1 . ARG A 1 493 ? 3.963   1.124   31.372  1.00 104.99 ? 493  ARG A NH1 1 
ATOM   3824 N NH2 . ARG A 1 493 ? 4.054   3.050   30.127  1.00 103.34 ? 493  ARG A NH2 1 
ATOM   3825 N N   . ASP A 1 494 ? 0.290   1.493   24.730  1.00 102.27 ? 494  ASP A N   1 
ATOM   3826 C CA  . ASP A 1 494 ? -0.404  2.439   23.844  1.00 102.84 ? 494  ASP A CA  1 
ATOM   3827 C C   . ASP A 1 494 ? -0.638  1.907   22.419  1.00 103.52 ? 494  ASP A C   1 
ATOM   3828 O O   . ASP A 1 494 ? 0.153   2.164   21.501  1.00 102.06 ? 494  ASP A O   1 
ATOM   3829 C CB  . ASP A 1 494 ? 0.335   3.781   23.807  1.00 100.61 ? 494  ASP A CB  1 
ATOM   3830 C CG  . ASP A 1 494 ? -0.574  4.932   23.415  1.00 101.99 ? 494  ASP A CG  1 
ATOM   3831 O OD1 . ASP A 1 494 ? -1.717  4.987   23.928  1.00 104.19 ? 494  ASP A OD1 1 
ATOM   3832 O OD2 . ASP A 1 494 ? -0.146  5.781   22.600  1.00 100.79 ? 494  ASP A OD2 1 
ATOM   3833 N N   . SER A 1 495 ? -1.747  1.184   22.254  1.00 105.98 ? 495  SER A N   1 
ATOM   3834 C CA  . SER A 1 495 ? -2.105  0.515   20.996  1.00 107.05 ? 495  SER A CA  1 
ATOM   3835 C C   . SER A 1 495 ? -2.715  1.464   19.957  1.00 106.50 ? 495  SER A C   1 
ATOM   3836 O O   . SER A 1 495 ? -2.703  1.167   18.757  1.00 106.76 ? 495  SER A O   1 
ATOM   3837 C CB  . SER A 1 495 ? -3.079  -0.651  21.268  1.00 110.43 ? 495  SER A CB  1 
ATOM   3838 N N   . LYS A 1 496 ? -3.256  2.591   20.430  1.00 105.60 ? 496  LYS A N   1 
ATOM   3839 C CA  . LYS A 1 496 ? -3.939  3.580   19.570  1.00 104.76 ? 496  LYS A CA  1 
ATOM   3840 C C   . LYS A 1 496 ? -2.969  4.435   18.713  1.00 101.01 ? 496  LYS A C   1 
ATOM   3841 O O   . LYS A 1 496 ? -3.206  4.636   17.510  1.00 100.99 ? 496  LYS A O   1 
ATOM   3842 C CB  . LYS A 1 496 ? -4.902  4.468   20.410  1.00 105.87 ? 496  LYS A CB  1 
ATOM   3843 N N   . SER A 1 497 ? -1.888  4.924   19.329  1.00 97.09  ? 497  SER A N   1 
ATOM   3844 C CA  . SER A 1 497 ? -0.789  5.551   18.583  1.00 93.28  ? 497  SER A CA  1 
ATOM   3845 C C   . SER A 1 497 ? -0.331  4.599   17.475  1.00 91.92  ? 497  SER A C   1 
ATOM   3846 O O   . SER A 1 497 ? -0.374  3.372   17.661  1.00 93.13  ? 497  SER A O   1 
ATOM   3847 C CB  . SER A 1 497 ? 0.401   5.856   19.500  1.00 91.26  ? 497  SER A CB  1 
ATOM   3848 O OG  . SER A 1 497 ? 0.137   6.936   20.379  1.00 91.28  ? 497  SER A OG  1 
ATOM   3849 N N   . PRO A 1 498 ? 0.105   5.149   16.318  1.00 89.16  ? 498  PRO A N   1 
ATOM   3850 C CA  . PRO A 1 498 ? 0.523   4.245   15.238  1.00 87.60  ? 498  PRO A CA  1 
ATOM   3851 C C   . PRO A 1 498 ? 1.862   3.604   15.586  1.00 83.66  ? 498  PRO A C   1 
ATOM   3852 O O   . PRO A 1 498 ? 2.712   4.262   16.181  1.00 81.39  ? 498  PRO A O   1 
ATOM   3853 C CB  . PRO A 1 498 ? 0.638   5.170   14.007  1.00 87.32  ? 498  PRO A CB  1 
ATOM   3854 C CG  . PRO A 1 498 ? 0.067   6.528   14.446  1.00 87.87  ? 498  PRO A CG  1 
ATOM   3855 C CD  . PRO A 1 498 ? 0.259   6.566   15.938  1.00 87.83  ? 498  PRO A CD  1 
ATOM   3856 N N   . GLN A 1 499 ? 2.016   2.325   15.242  1.00 82.87  ? 499  GLN A N   1 
ATOM   3857 C CA  A GLN A 1 499 ? 3.224   1.576   15.573  0.50 80.37  ? 499  GLN A CA  1 
ATOM   3858 C CA  B GLN A 1 499 ? 3.226   1.554   15.556  0.50 80.65  ? 499  GLN A CA  1 
ATOM   3859 C C   . GLN A 1 499 ? 4.374   1.938   14.612  1.00 77.66  ? 499  GLN A C   1 
ATOM   3860 O O   . GLN A 1 499 ? 4.155   2.249   13.436  1.00 77.63  ? 499  GLN A O   1 
ATOM   3861 C CB  A GLN A 1 499 ? 2.955   0.059   15.562  0.50 82.39  ? 499  GLN A CB  1 
ATOM   3862 C CB  B GLN A 1 499 ? 2.922   0.037   15.506  0.50 82.89  ? 499  GLN A CB  1 
ATOM   3863 C CG  A GLN A 1 499 ? 1.557   -0.458  16.386  0.50 84.20  ? 499  GLN A CG  1 
ATOM   3864 C CG  B GLN A 1 499 ? 4.094   -0.943  15.795  0.50 82.84  ? 499  GLN A CG  1 
ATOM   3865 C CD  A GLN A 1 499 ? 1.937   0.083   18.011  0.50 82.37  ? 499  GLN A CD  1 
ATOM   3866 C CD  B GLN A 1 499 ? 3.997   -1.552  17.324  0.50 84.38  ? 499  GLN A CD  1 
ATOM   3867 O OE1 A GLN A 1 499 ? 2.552   -0.459  19.007  0.50 81.46  ? 499  GLN A OE1 1 
ATOM   3868 O OE1 B GLN A 1 499 ? 4.682   -2.535  17.585  0.50 83.76  ? 499  GLN A OE1 1 
ATOM   3869 N NE2 A GLN A 1 499 ? 1.301   1.313   18.125  0.50 81.68  ? 499  GLN A NE2 1 
ATOM   3870 N NE2 B GLN A 1 499 ? 3.160   -0.935  18.185  0.50 85.14  ? 499  GLN A NE2 1 
ATOM   3871 N N   . TRP A 1 500 ? 5.592   1.923   15.145  1.00 74.20  ? 500  TRP A N   1 
ATOM   3872 C CA  . TRP A 1 500 ? 6.820   2.181   14.407  1.00 70.25  ? 500  TRP A CA  1 
ATOM   3873 C C   . TRP A 1 500 ? 7.396   0.815   14.038  1.00 70.25  ? 500  TRP A C   1 
ATOM   3874 O O   . TRP A 1 500 ? 7.905   0.103   14.901  1.00 69.86  ? 500  TRP A O   1 
ATOM   3875 C CB  . TRP A 1 500 ? 7.784   2.942   15.317  1.00 67.51  ? 500  TRP A CB  1 
ATOM   3876 C CG  . TRP A 1 500 ? 9.107   3.352   14.734  1.00 63.36  ? 500  TRP A CG  1 
ATOM   3877 C CD1 . TRP A 1 500 ? 9.720   2.848   13.624  1.00 62.75  ? 500  TRP A CD1 1 
ATOM   3878 C CD2 . TRP A 1 500 ? 10.001  4.330   15.274  1.00 58.22  ? 500  TRP A CD2 1 
ATOM   3879 N NE1 . TRP A 1 500 ? 10.931  3.460   13.433  1.00 58.29  ? 500  TRP A NE1 1 
ATOM   3880 C CE2 . TRP A 1 500 ? 11.125  4.380   14.426  1.00 56.28  ? 500  TRP A CE2 1 
ATOM   3881 C CE3 . TRP A 1 500 ? 9.948   5.187   16.378  1.00 56.20  ? 500  TRP A CE3 1 
ATOM   3882 C CZ2 . TRP A 1 500 ? 12.189  5.252   14.645  1.00 53.28  ? 500  TRP A CZ2 1 
ATOM   3883 C CZ3 . TRP A 1 500 ? 11.002  6.049   16.597  1.00 53.63  ? 500  TRP A CZ3 1 
ATOM   3884 C CH2 . TRP A 1 500 ? 12.112  6.070   15.737  1.00 52.18  ? 500  TRP A CH2 1 
ATOM   3885 N N   . PRO A 1 501 ? 7.306   0.433   12.752  1.00 70.48  ? 501  PRO A N   1 
ATOM   3886 C CA  . PRO A 1 501 ? 7.758   -0.908  12.398  1.00 71.00  ? 501  PRO A CA  1 
ATOM   3887 C C   . PRO A 1 501 ? 9.271   -0.917  12.159  1.00 68.84  ? 501  PRO A C   1 
ATOM   3888 O O   . PRO A 1 501 ? 9.853   0.131   11.831  1.00 66.44  ? 501  PRO A O   1 
ATOM   3889 C CB  . PRO A 1 501 ? 7.009   -1.189  11.092  1.00 72.55  ? 501  PRO A CB  1 
ATOM   3890 C CG  . PRO A 1 501 ? 6.797   0.178   10.470  1.00 71.59  ? 501  PRO A CG  1 
ATOM   3891 C CD  . PRO A 1 501 ? 6.970   1.228   11.554  1.00 70.14  ? 501  PRO A CD  1 
ATOM   3892 N N   . PRO A 1 502 ? 9.909   -2.093  12.334  1.00 68.85  ? 502  PRO A N   1 
ATOM   3893 C CA  . PRO A 1 502 ? 11.331  -2.219  12.030  1.00 66.86  ? 502  PRO A CA  1 
ATOM   3894 C C   . PRO A 1 502 ? 11.617  -1.924  10.557  1.00 66.31  ? 502  PRO A C   1 
ATOM   3895 O O   . PRO A 1 502 ? 10.737  -2.073  9.704   1.00 67.94  ? 502  PRO A O   1 
ATOM   3896 C CB  . PRO A 1 502 ? 11.625  -3.690  12.330  1.00 68.02  ? 502  PRO A CB  1 
ATOM   3897 C CG  . PRO A 1 502 ? 10.582  -4.100  13.258  1.00 69.98  ? 502  PRO A CG  1 
ATOM   3898 C CD  . PRO A 1 502 ? 9.357   -3.335  12.893  1.00 70.52  ? 502  PRO A CD  1 
ATOM   3899 N N   . TYR A 1 503 ? 12.843  -1.507  10.269  1.00 63.93  ? 503  TYR A N   1 
ATOM   3900 C CA  . TYR A 1 503 ? 13.304  -1.372  8.908   1.00 63.45  ? 503  TYR A CA  1 
ATOM   3901 C C   . TYR A 1 503 ? 13.773  -2.744  8.415   1.00 64.83  ? 503  TYR A C   1 
ATOM   3902 O O   . TYR A 1 503 ? 14.470  -3.461  9.135   1.00 64.73  ? 503  TYR A O   1 
ATOM   3903 C CB  . TYR A 1 503 ? 14.440  -0.351  8.872   1.00 61.08  ? 503  TYR A CB  1 
ATOM   3904 C CG  . TYR A 1 503 ? 15.046  -0.132  7.512   1.00 61.32  ? 503  TYR A CG  1 
ATOM   3905 C CD1 . TYR A 1 503 ? 16.064  -0.957  7.034   1.00 62.44  ? 503  TYR A CD1 1 
ATOM   3906 C CD2 . TYR A 1 503 ? 14.615  0.909   6.703   1.00 61.70  ? 503  TYR A CD2 1 
ATOM   3907 C CE1 . TYR A 1 503 ? 16.619  -0.752  5.777   1.00 63.14  ? 503  TYR A CE1 1 
ATOM   3908 C CE2 . TYR A 1 503 ? 15.179  1.127   5.461   1.00 62.21  ? 503  TYR A CE2 1 
ATOM   3909 C CZ  . TYR A 1 503 ? 16.173  0.296   5.002   1.00 61.58  ? 503  TYR A CZ  1 
ATOM   3910 O OH  . TYR A 1 503 ? 16.715  0.518   3.763   1.00 61.62  ? 503  TYR A OH  1 
ATOM   3911 N N   . THR A 1 504 ? 13.375  -3.114  7.202   1.00 66.25  ? 504  THR A N   1 
ATOM   3912 C CA  . THR A 1 504 ? 13.755  -4.400  6.619   1.00 68.45  ? 504  THR A CA  1 
ATOM   3913 C C   . THR A 1 504 ? 14.101  -4.204  5.161   1.00 68.68  ? 504  THR A C   1 
ATOM   3914 O O   . THR A 1 504 ? 13.640  -3.247  4.552   1.00 68.08  ? 504  THR A O   1 
ATOM   3915 C CB  . THR A 1 504 ? 12.600  -5.409  6.646   1.00 71.20  ? 504  THR A CB  1 
ATOM   3916 O OG1 . THR A 1 504 ? 11.439  -4.805  6.063   1.00 72.72  ? 504  THR A OG1 1 
ATOM   3917 C CG2 . THR A 1 504 ? 12.292  -5.880  8.064   1.00 71.55  ? 504  THR A CG2 1 
ATOM   3918 N N   . THR A 1 505 ? 14.888  -5.120  4.593   1.00 69.91  ? 505  THR A N   1 
ATOM   3919 C CA  . THR A 1 505 ? 15.248  -5.040  3.173   1.00 70.62  ? 505  THR A CA  1 
ATOM   3920 C C   . THR A 1 505 ? 14.023  -5.261  2.286   1.00 72.63  ? 505  THR A C   1 
ATOM   3921 O O   . THR A 1 505 ? 13.880  -4.625  1.239   1.00 73.03  ? 505  THR A O   1 
ATOM   3922 C CB  . THR A 1 505 ? 16.404  -6.006  2.775   1.00 71.71  ? 505  THR A CB  1 
ATOM   3923 O OG1 . THR A 1 505 ? 15.998  -7.370  2.938   1.00 73.65  ? 505  THR A OG1 1 
ATOM   3924 C CG2 . THR A 1 505 ? 17.667  -5.723  3.605   1.00 70.09  ? 505  THR A CG2 1 
ATOM   3925 N N   . ALA A 1 506 ? 13.134  -6.142  2.735   1.00 74.10  ? 506  ALA A N   1 
ATOM   3926 C CA  . ALA A 1 506 ? 11.895  -6.450  2.026   1.00 75.84  ? 506  ALA A CA  1 
ATOM   3927 C C   . ALA A 1 506 ? 10.900  -5.282  1.904   1.00 74.63  ? 506  ALA A C   1 
ATOM   3928 O O   . ALA A 1 506 ? 10.038  -5.312  1.023   1.00 76.33  ? 506  ALA A O   1 
ATOM   3929 C CB  . ALA A 1 506 ? 11.196  -7.668  2.682   1.00 78.38  ? 506  ALA A CB  1 
ATOM   3930 N N   . ALA A 1 507 ? 10.994  -4.278  2.782   1.00 71.56  ? 507  ALA A N   1 
ATOM   3931 C CA  . ALA A 1 507 ? 9.968   -3.227  2.852   1.00 70.12  ? 507  ALA A CA  1 
ATOM   3932 C C   . ALA A 1 507 ? 10.512  -1.844  3.185   1.00 66.86  ? 507  ALA A C   1 
ATOM   3933 O O   . ALA A 1 507 ? 9.805   -0.851  3.081   1.00 66.32  ? 507  ALA A O   1 
ATOM   3934 C CB  . ALA A 1 507 ? 8.887   -3.620  3.842   1.00 71.03  ? 507  ALA A CB  1 
ATOM   3935 N N   . GLN A 1 508 ? 11.763  -1.788  3.614   1.00 64.98  ? 508  GLN A N   1 
ATOM   3936 C CA  . GLN A 1 508 ? 12.470  -0.517  3.827   1.00 62.61  ? 508  GLN A CA  1 
ATOM   3937 C C   . GLN A 1 508 ? 11.634  0.558   4.541   1.00 61.43  ? 508  GLN A C   1 
ATOM   3938 O O   . GLN A 1 508 ? 11.707  1.744   4.202   1.00 60.33  ? 508  GLN A O   1 
ATOM   3939 C CB  . GLN A 1 508 ? 13.012  0.010   2.493   1.00 62.16  ? 508  GLN A CB  1 
ATOM   3940 C CG  . GLN A 1 508 ? 13.584  -1.082  1.587   1.00 64.53  ? 508  GLN A CG  1 
ATOM   3941 C CD  . GLN A 1 508 ? 14.151  -0.531  0.303   1.00 65.59  ? 508  GLN A CD  1 
ATOM   3942 O OE1 . GLN A 1 508 ? 14.832  0.500   0.308   1.00 65.33  ? 508  GLN A OE1 1 
ATOM   3943 N NE2 . GLN A 1 508 ? 13.882  -1.213  -0.811  1.00 67.58  ? 508  GLN A NE2 1 
ATOM   3944 N N   . GLN A 1 509 ? 10.856  0.135   5.538   1.00 61.54  ? 509  GLN A N   1 
ATOM   3945 C CA  . GLN A 1 509 ? 10.021  1.052   6.331   1.00 60.19  ? 509  GLN A CA  1 
ATOM   3946 C C   . GLN A 1 509 ? 10.767  1.953   7.321   1.00 57.13  ? 509  GLN A C   1 
ATOM   3947 O O   . GLN A 1 509 ? 11.693  1.523   7.989   1.00 56.26  ? 509  GLN A O   1 
ATOM   3948 C CB  . GLN A 1 509 ? 8.976   0.257   7.098   1.00 61.75  ? 509  GLN A CB  1 
ATOM   3949 C CG  . GLN A 1 509 ? 7.842   -0.204  6.254   1.00 63.92  ? 509  GLN A CG  1 
ATOM   3950 C CD  . GLN A 1 509 ? 7.058   -1.297  6.919   1.00 65.64  ? 509  GLN A CD  1 
ATOM   3951 O OE1 . GLN A 1 509 ? 7.591   -2.373  7.192   1.00 66.25  ? 509  GLN A OE1 1 
ATOM   3952 N NE2 . GLN A 1 509 ? 5.777   -1.039  7.176   1.00 67.07  ? 509  GLN A NE2 1 
ATOM   3953 N N   . TYR A 1 510 ? 10.318  3.195   7.427   1.00 55.98  ? 510  TYR A N   1 
ATOM   3954 C CA  . TYR A 1 510 ? 10.883  4.186   8.355   1.00 53.96  ? 510  TYR A CA  1 
ATOM   3955 C C   . TYR A 1 510 ? 9.796   5.194   8.683   1.00 54.38  ? 510  TYR A C   1 
ATOM   3956 O O   . TYR A 1 510 ? 8.773   5.208   8.009   1.00 56.53  ? 510  TYR A O   1 
ATOM   3957 C CB  . TYR A 1 510 ? 12.093  4.874   7.746   1.00 51.56  ? 510  TYR A CB  1 
ATOM   3958 C CG  . TYR A 1 510 ? 11.824  5.803   6.571   1.00 51.92  ? 510  TYR A CG  1 
ATOM   3959 C CD1 . TYR A 1 510 ? 11.562  5.306   5.278   1.00 53.17  ? 510  TYR A CD1 1 
ATOM   3960 C CD2 . TYR A 1 510 ? 11.897  7.185   6.739   1.00 51.45  ? 510  TYR A CD2 1 
ATOM   3961 C CE1 . TYR A 1 510 ? 11.340  6.170   4.195   1.00 54.23  ? 510  TYR A CE1 1 
ATOM   3962 C CE2 . TYR A 1 510 ? 11.687  8.064   5.668   1.00 52.73  ? 510  TYR A CE2 1 
ATOM   3963 C CZ  . TYR A 1 510 ? 11.408  7.560   4.397   1.00 55.49  ? 510  TYR A CZ  1 
ATOM   3964 O OH  . TYR A 1 510 ? 11.196  8.470   3.360   1.00 55.95  ? 510  TYR A OH  1 
ATOM   3965 N N   . VAL A 1 511 ? 9.976   6.019   9.712   1.00 53.12  ? 511  VAL A N   1 
ATOM   3966 C CA  . VAL A 1 511 ? 8.897   6.928   10.108  1.00 53.40  ? 511  VAL A CA  1 
ATOM   3967 C C   . VAL A 1 511 ? 9.280   8.396   10.050  1.00 52.58  ? 511  VAL A C   1 
ATOM   3968 O O   . VAL A 1 511 ? 10.452  8.745   10.157  1.00 51.43  ? 511  VAL A O   1 
ATOM   3969 C CB  . VAL A 1 511 ? 8.341   6.613   11.513  1.00 53.68  ? 511  VAL A CB  1 
ATOM   3970 C CG1 . VAL A 1 511 ? 7.561   5.316   11.507  1.00 55.69  ? 511  VAL A CG1 1 
ATOM   3971 C CG2 . VAL A 1 511 ? 9.450   6.585   12.545  1.00 51.29  ? 511  VAL A CG2 1 
ATOM   3972 N N   . SER A 1 512 ? 8.288   9.257   9.882   1.00 53.57  ? 512  SER A N   1 
ATOM   3973 C CA  . SER A 1 512 ? 8.527   10.685  9.998   1.00 53.53  ? 512  SER A CA  1 
ATOM   3974 C C   . SER A 1 512 ? 8.428   11.075  11.462  1.00 53.50  ? 512  SER A C   1 
ATOM   3975 O O   . SER A 1 512 ? 7.528   10.628  12.173  1.00 55.28  ? 512  SER A O   1 
ATOM   3976 C CB  . SER A 1 512 ? 7.501   11.467  9.191   1.00 54.35  ? 512  SER A CB  1 
ATOM   3977 O OG  . SER A 1 512 ? 6.186   10.996  9.488   1.00 59.37  ? 512  SER A OG  1 
ATOM   3978 N N   . LEU A 1 513 ? 9.373   11.883  11.927  1.00 52.39  ? 513  LEU A N   1 
ATOM   3979 C CA  . LEU A 1 513 ? 9.214   12.552  13.205  1.00 51.74  ? 513  LEU A CA  1 
ATOM   3980 C C   . LEU A 1 513 ? 8.951   14.031  12.940  1.00 51.70  ? 513  LEU A C   1 
ATOM   3981 O O   . LEU A 1 513 ? 9.831   14.777  12.496  1.00 50.09  ? 513  LEU A O   1 
ATOM   3982 C CB  . LEU A 1 513 ? 10.435  12.331  14.090  1.00 50.65  ? 513  LEU A CB  1 
ATOM   3983 C CG  . LEU A 1 513 ? 10.924  10.905  14.322  1.00 49.82  ? 513  LEU A CG  1 
ATOM   3984 C CD1 . LEU A 1 513 ? 12.135  10.970  15.183  1.00 47.90  ? 513  LEU A CD1 1 
ATOM   3985 C CD2 . LEU A 1 513 ? 9.871   10.037  14.981  1.00 51.86  ? 513  LEU A CD2 1 
ATOM   3986 N N   . ASN A 1 514 ? 7.698   14.415  13.150  1.00 53.38  ? 514  ASN A N   1 
ATOM   3987 C CA  . ASN A 1 514 ? 7.250   15.806  13.058  1.00 54.28  ? 514  ASN A CA  1 
ATOM   3988 C C   . ASN A 1 514 ? 6.153   16.018  14.083  1.00 55.48  ? 514  ASN A C   1 
ATOM   3989 O O   . ASN A 1 514 ? 5.976   15.181  14.960  1.00 56.06  ? 514  ASN A O   1 
ATOM   3990 C CB  . ASN A 1 514 ? 6.779   16.176  11.640  1.00 55.08  ? 514  ASN A CB  1 
ATOM   3991 C CG  . ASN A 1 514 ? 6.003   15.064  10.967  1.00 57.17  ? 514  ASN A CG  1 
ATOM   3992 O OD1 . ASN A 1 514 ? 4.986   14.586  11.486  1.00 60.11  ? 514  ASN A OD1 1 
ATOM   3993 N ND2 . ASN A 1 514 ? 6.474   14.646  9.794   1.00 56.20  ? 514  ASN A ND2 1 
ATOM   3994 N N   . LEU A 1 515 ? 5.420   17.122  13.979  1.00 56.58  ? 515  LEU A N   1 
ATOM   3995 C CA  . LEU A 1 515 ? 4.411   17.476  14.981  1.00 57.84  ? 515  LEU A CA  1 
ATOM   3996 C C   . LEU A 1 515 ? 3.149   16.622  14.874  1.00 60.06  ? 515  LEU A C   1 
ATOM   3997 O O   . LEU A 1 515 ? 2.344   16.557  15.798  1.00 61.00  ? 515  LEU A O   1 
ATOM   3998 C CB  . LEU A 1 515 ? 4.064   18.963  14.870  1.00 58.12  ? 515  LEU A CB  1 
ATOM   3999 C CG  . LEU A 1 515 ? 5.189   19.937  15.192  1.00 56.08  ? 515  LEU A CG  1 
ATOM   4000 C CD1 . LEU A 1 515 ? 4.687   21.362  15.183  1.00 55.53  ? 515  LEU A CD1 1 
ATOM   4001 C CD2 . LEU A 1 515 ? 5.833   19.593  16.540  1.00 54.65  ? 515  LEU A CD2 1 
ATOM   4002 N N   . LYS A 1 516 ? 2.994   15.979  13.723  1.00 61.15  ? 516  LYS A N   1 
ATOM   4003 C CA  . LYS A 1 516 ? 1.884   15.088  13.440  1.00 63.48  ? 516  LYS A CA  1 
ATOM   4004 C C   . LYS A 1 516 ? 2.252   13.706  13.986  1.00 62.81  ? 516  LYS A C   1 
ATOM   4005 O O   . LYS A 1 516 ? 3.428   13.438  14.222  1.00 60.93  ? 516  LYS A O   1 
ATOM   4006 C CB  . LYS A 1 516 ? 1.620   15.051  11.918  1.00 64.46  ? 516  LYS A CB  1 
ATOM   4007 C CG  . LYS A 1 516 ? 1.206   16.419  11.301  1.00 67.70  ? 516  LYS A CG  1 
ATOM   4008 C CD  . LYS A 1 516 ? 0.732   16.320  9.813   1.00 73.40  ? 516  LYS A CD  1 
ATOM   4009 C CE  . LYS A 1 516 ? 1.889   16.513  8.771   1.00 73.43  ? 516  LYS A CE  1 
ATOM   4010 N NZ  . LYS A 1 516 ? 1.389   16.703  7.347   1.00 73.98  ? 516  LYS A NZ  1 
ATOM   4011 N N   . PRO A 1 517 ? 1.251   12.829  14.210  1.00 64.41  ? 517  PRO A N   1 
ATOM   4012 C CA  . PRO A 1 517 ? 1.576   11.476  14.664  1.00 64.00  ? 517  PRO A CA  1 
ATOM   4013 C C   . PRO A 1 517 ? 2.446   10.759  13.638  1.00 63.09  ? 517  PRO A C   1 
ATOM   4014 O O   . PRO A 1 517 ? 2.546   11.215  12.493  1.00 62.81  ? 517  PRO A O   1 
ATOM   4015 C CB  . PRO A 1 517 ? 0.199   10.802  14.765  1.00 66.64  ? 517  PRO A CB  1 
ATOM   4016 C CG  . PRO A 1 517 ? -0.774  11.934  14.953  1.00 67.49  ? 517  PRO A CG  1 
ATOM   4017 C CD  . PRO A 1 517 ? -0.211  13.039  14.106  1.00 66.51  ? 517  PRO A CD  1 
ATOM   4018 N N   . LEU A 1 518 ? 3.071   9.655   14.050  1.00 62.63  ? 518  LEU A N   1 
ATOM   4019 C CA  . LEU A 1 518 ? 3.950   8.859   13.183  1.00 61.96  ? 518  LEU A CA  1 
ATOM   4020 C C   . LEU A 1 518 ? 3.315   8.461   11.858  1.00 63.53  ? 518  LEU A C   1 
ATOM   4021 O O   . LEU A 1 518 ? 2.250   7.872   11.840  1.00 65.94  ? 518  LEU A O   1 
ATOM   4022 C CB  . LEU A 1 518 ? 4.381   7.573   13.893  1.00 61.84  ? 518  LEU A CB  1 
ATOM   4023 C CG  . LEU A 1 518 ? 5.418   7.556   15.003  1.00 59.52  ? 518  LEU A CG  1 
ATOM   4024 C CD1 . LEU A 1 518 ? 5.731   6.127   15.317  1.00 60.19  ? 518  LEU A CD1 1 
ATOM   4025 C CD2 . LEU A 1 518 ? 6.677   8.258   14.605  1.00 57.95  ? 518  LEU A CD2 1 
ATOM   4026 N N   . GLU A 1 519 ? 3.993   8.765   10.759  1.00 63.20  ? 519  GLU A N   1 
ATOM   4027 C CA  . GLU A 1 519 ? 3.584   8.341   9.423   1.00 65.12  ? 519  GLU A CA  1 
ATOM   4028 C C   . GLU A 1 519 ? 4.656   7.366   8.930   1.00 63.90  ? 519  GLU A C   1 
ATOM   4029 O O   . GLU A 1 519 ? 5.850   7.668   8.986   1.00 62.47  ? 519  GLU A O   1 
ATOM   4030 C CB  . GLU A 1 519 ? 3.430   9.569   8.485   1.00 65.24  ? 519  GLU A CB  1 
ATOM   4031 C CG  . GLU A 1 519 ? 3.135   9.262   6.994   1.00 69.37  ? 519  GLU A CG  1 
ATOM   4032 C CD  . GLU A 1 519 ? 3.180   10.513  6.067   1.00 72.45  ? 519  GLU A CD  1 
ATOM   4033 O OE1 . GLU A 1 519 ? 2.129   11.168  5.900   1.00 75.71  ? 519  GLU A OE1 1 
ATOM   4034 O OE2 . GLU A 1 519 ? 4.246   10.831  5.479   1.00 70.43  ? 519  GLU A OE2 1 
ATOM   4035 N N   . VAL A 1 520 ? 4.232   6.187   8.485   1.00 64.94  ? 520  VAL A N   1 
ATOM   4036 C CA  . VAL A 1 520 ? 5.153   5.176   7.973   1.00 63.88  ? 520  VAL A CA  1 
ATOM   4037 C C   . VAL A 1 520 ? 5.411   5.456   6.507   1.00 63.73  ? 520  VAL A C   1 
ATOM   4038 O O   . VAL A 1 520 ? 4.498   5.796   5.758   1.00 65.04  ? 520  VAL A O   1 
ATOM   4039 C CB  . VAL A 1 520 ? 4.595   3.739   8.155   1.00 65.87  ? 520  VAL A CB  1 
ATOM   4040 C CG1 . VAL A 1 520 ? 5.460   2.694   7.436   1.00 65.18  ? 520  VAL A CG1 1 
ATOM   4041 C CG2 . VAL A 1 520 ? 4.488   3.409   9.630   1.00 65.17  ? 520  VAL A CG2 1 
ATOM   4042 N N   . ARG A 1 521 ? 6.670   5.322   6.114   1.00 62.07  ? 521  ARG A N   1 
ATOM   4043 C CA  . ARG A 1 521 ? 7.103   5.563   4.750   1.00 61.49  ? 521  ARG A CA  1 
ATOM   4044 C C   . ARG A 1 521 ? 7.995   4.420   4.307   1.00 61.89  ? 521  ARG A C   1 
ATOM   4045 O O   . ARG A 1 521 ? 8.574   3.720   5.140   1.00 61.51  ? 521  ARG A O   1 
ATOM   4046 C CB  . ARG A 1 521 ? 7.855   6.890   4.660   1.00 59.18  ? 521  ARG A CB  1 
ATOM   4047 C CG  . ARG A 1 521 ? 6.981   8.085   4.922   1.00 58.26  ? 521  ARG A CG  1 
ATOM   4048 C CD  . ARG A 1 521 ? 7.719   9.348   4.630   1.00 55.68  ? 521  ARG A CD  1 
ATOM   4049 N NE  . ARG A 1 521 ? 7.061   10.473  5.274   1.00 55.97  ? 521  ARG A NE  1 
ATOM   4050 C CZ  . ARG A 1 521 ? 7.618   11.668  5.461   1.00 55.28  ? 521  ARG A CZ  1 
ATOM   4051 N NH1 . ARG A 1 521 ? 8.869   11.914  5.056   1.00 54.28  ? 521  ARG A NH1 1 
ATOM   4052 N NH2 . ARG A 1 521 ? 6.926   12.618  6.071   1.00 54.16  ? 521  ARG A NH2 1 
ATOM   4053 N N   . ARG A 1 522 ? 8.110   4.237   2.996   1.00 62.80  ? 522  ARG A N   1 
ATOM   4054 C CA  . ARG A 1 522 ? 8.866   3.120   2.443   1.00 63.80  ? 522  ARG A CA  1 
ATOM   4055 C C   . ARG A 1 522 ? 9.975   3.619   1.534   1.00 62.53  ? 522  ARG A C   1 
ATOM   4056 O O   . ARG A 1 522 ? 9.745   4.457   0.659   1.00 62.65  ? 522  ARG A O   1 
ATOM   4057 C CB  . ARG A 1 522 ? 7.930   2.145   1.693   1.00 66.36  ? 522  ARG A CB  1 
ATOM   4058 C CG  . ARG A 1 522 ? 6.826   1.519   2.578   1.00 69.74  ? 522  ARG A CG  1 
ATOM   4059 C CD  . ARG A 1 522 ? 5.931   0.551   1.825   1.00 75.40  ? 522  ARG A CD  1 
ATOM   4060 N NE  . ARG A 1 522 ? 6.711   -0.336  0.948   1.00 79.75  ? 522  ARG A NE  1 
ATOM   4061 C CZ  . ARG A 1 522 ? 6.231   -1.407  0.303   1.00 83.88  ? 522  ARG A CZ  1 
ATOM   4062 N NH1 . ARG A 1 522 ? 4.950   -1.769  0.429   1.00 85.44  ? 522  ARG A NH1 1 
ATOM   4063 N NH2 . ARG A 1 522 ? 7.045   -2.128  -0.470  1.00 85.10  ? 522  ARG A NH2 1 
ATOM   4064 N N   . GLY A 1 523 ? 11.175  3.091   1.738   1.00 61.96  ? 523  GLY A N   1 
ATOM   4065 C CA  . GLY A 1 523 ? 12.322  3.415   0.896   1.00 61.64  ? 523  GLY A CA  1 
ATOM   4066 C C   . GLY A 1 523 ? 12.958  4.744   1.248   1.00 60.16  ? 523  GLY A C   1 
ATOM   4067 O O   . GLY A 1 523 ? 12.409  5.809   0.968   1.00 59.87  ? 523  GLY A O   1 
ATOM   4068 N N   . LEU A 1 524 ? 14.132  4.682   1.855   1.00 59.50  ? 524  LEU A N   1 
ATOM   4069 C CA  . LEU A 1 524 ? 14.814  5.888   2.296   1.00 58.54  ? 524  LEU A CA  1 
ATOM   4070 C C   . LEU A 1 524 ? 15.647  6.415   1.152   1.00 58.51  ? 524  LEU A C   1 
ATOM   4071 O O   . LEU A 1 524 ? 16.722  5.862   0.859   1.00 59.00  ? 524  LEU A O   1 
ATOM   4072 C CB  . LEU A 1 524 ? 15.707  5.546   3.486   1.00 57.73  ? 524  LEU A CB  1 
ATOM   4073 C CG  . LEU A 1 524 ? 16.344  6.621   4.357   1.00 56.89  ? 524  LEU A CG  1 
ATOM   4074 C CD1 . LEU A 1 524 ? 15.629  8.003   4.329   1.00 57.30  ? 524  LEU A CD1 1 
ATOM   4075 C CD2 . LEU A 1 524 ? 16.390  6.042   5.753   1.00 57.69  ? 524  LEU A CD2 1 
ATOM   4076 N N   . ARG A 1 525 ? 15.157  7.469   0.500   1.00 58.61  ? 525  ARG A N   1 
ATOM   4077 C CA  . ARG A 1 525 ? 15.728  7.926   -0.770  1.00 58.89  ? 525  ARG A CA  1 
ATOM   4078 C C   . ARG A 1 525 ? 16.178  6.758   -1.657  1.00 59.82  ? 525  ARG A C   1 
ATOM   4079 O O   . ARG A 1 525 ? 17.261  6.829   -2.240  1.00 59.85  ? 525  ARG A O   1 
ATOM   4080 C CB  . ARG A 1 525 ? 16.941  8.818   -0.514  1.00 57.62  ? 525  ARG A CB  1 
ATOM   4081 C CG  . ARG A 1 525 ? 16.663  10.038  0.315   1.00 58.16  ? 525  ARG A CG  1 
ATOM   4082 C CD  . ARG A 1 525 ? 16.222  11.221  -0.536  1.00 60.62  ? 525  ARG A CD  1 
ATOM   4083 N NE  . ARG A 1 525 ? 16.895  12.449  -0.109  1.00 60.66  ? 525  ARG A NE  1 
ATOM   4084 C CZ  . ARG A 1 525 ? 16.555  13.188  0.950   1.00 60.87  ? 525  ARG A CZ  1 
ATOM   4085 N NH1 . ARG A 1 525 ? 15.532  12.853  1.740   1.00 62.12  ? 525  ARG A NH1 1 
ATOM   4086 N NH2 . ARG A 1 525 ? 17.250  14.280  1.219   1.00 60.20  ? 525  ARG A NH2 1 
ATOM   4087 N N   . ALA A 1 526 ? 15.374  5.693   -1.753  1.00 60.64  ? 526  ALA A N   1 
ATOM   4088 C CA  . ALA A 1 526 ? 15.810  4.462   -2.419  1.00 61.39  ? 526  ALA A CA  1 
ATOM   4089 C C   . ALA A 1 526 ? 16.498  4.684   -3.763  1.00 61.42  ? 526  ALA A C   1 
ATOM   4090 O O   . ALA A 1 526 ? 17.600  4.185   -3.968  1.00 61.59  ? 526  ALA A O   1 
ATOM   4091 C CB  . ALA A 1 526 ? 14.653  3.462   -2.566  1.00 63.66  ? 526  ALA A CB  1 
ATOM   4092 N N   . GLN A 1 527 ? 15.865  5.441   -4.659  1.00 61.22  ? 527  GLN A N   1 
ATOM   4093 C CA  . GLN A 1 527 ? 16.385  5.606   -6.022  1.00 61.75  ? 527  GLN A CA  1 
ATOM   4094 C C   . GLN A 1 527 ? 17.734  6.349   -6.082  1.00 60.21  ? 527  GLN A C   1 
ATOM   4095 O O   . GLN A 1 527 ? 18.705  5.826   -6.635  1.00 61.01  ? 527  GLN A O   1 
ATOM   4096 C CB  . GLN A 1 527 ? 15.336  6.264   -6.923  1.00 62.45  ? 527  GLN A CB  1 
ATOM   4097 C CG  . GLN A 1 527 ? 15.364  5.792   -8.363  1.00 64.80  ? 527  GLN A CG  1 
ATOM   4098 C CD  . GLN A 1 527 ? 15.057  4.283   -8.572  1.00 67.74  ? 527  GLN A CD  1 
ATOM   4099 O OE1 . GLN A 1 527 ? 14.526  3.590   -7.689  1.00 67.20  ? 527  GLN A OE1 1 
ATOM   4100 N NE2 . GLN A 1 527 ? 15.383  3.786   -9.772  1.00 68.56  ? 527  GLN A NE2 1 
ATOM   4101 N N   . THR A 1 528 ? 17.788  7.552   -5.508  1.00 57.87  ? 528  THR A N   1 
ATOM   4102 C CA  . THR A 1 528 ? 19.018  8.322   -5.409  1.00 56.12  ? 528  THR A CA  1 
ATOM   4103 C C   . THR A 1 528 ? 20.146  7.586   -4.650  1.00 55.72  ? 528  THR A C   1 
ATOM   4104 O O   . THR A 1 528 ? 21.308  7.646   -5.041  1.00 55.63  ? 528  THR A O   1 
ATOM   4105 C CB  . THR A 1 528 ? 18.748  9.711   -4.773  1.00 54.77  ? 528  THR A CB  1 
ATOM   4106 O OG1 . THR A 1 528 ? 18.131  10.558  -5.744  1.00 54.45  ? 528  THR A OG1 1 
ATOM   4107 C CG2 . THR A 1 528 ? 20.037  10.376  -4.302  1.00 52.18  ? 528  THR A CG2 1 
ATOM   4108 N N   . CYS A 1 529 ? 19.826  6.897   -3.564  1.00 55.51  ? 529  CYS A N   1 
ATOM   4109 C CA  . CYS A 1 529 ? 20.870  6.134   -2.881  1.00 54.98  ? 529  CYS A CA  1 
ATOM   4110 C C   . CYS A 1 529 ? 21.334  4.912   -3.680  1.00 56.30  ? 529  CYS A C   1 
ATOM   4111 O O   . CYS A 1 529 ? 22.431  4.415   -3.452  1.00 56.42  ? 529  CYS A O   1 
ATOM   4112 C CB  . CYS A 1 529 ? 20.489  5.771   -1.445  1.00 54.18  ? 529  CYS A CB  1 
ATOM   4113 S SG  . CYS A 1 529 ? 20.332  7.225   -0.401  1.00 52.52  ? 529  CYS A SG  1 
ATOM   4114 N N   . ALA A 1 530 ? 20.534  4.444   -4.633  1.00 57.57  ? 530  ALA A N   1 
ATOM   4115 C CA  . ALA A 1 530 ? 21.050  3.430   -5.557  1.00 59.06  ? 530  ALA A CA  1 
ATOM   4116 C C   . ALA A 1 530 ? 22.193  4.049   -6.350  1.00 58.50  ? 530  ALA A C   1 
ATOM   4117 O O   . ALA A 1 530 ? 23.222  3.407   -6.573  1.00 59.47  ? 530  ALA A O   1 
ATOM   4118 C CB  . ALA A 1 530 ? 19.988  2.937   -6.476  1.00 60.64  ? 530  ALA A CB  1 
ATOM   4119 N N   . PHE A 1 531 ? 22.012  5.301   -6.753  1.00 57.00  ? 531  PHE A N   1 
ATOM   4120 C CA  . PHE A 1 531 ? 23.055  6.036   -7.434  1.00 56.48  ? 531  PHE A CA  1 
ATOM   4121 C C   . PHE A 1 531 ? 24.354  6.057   -6.629  1.00 55.76  ? 531  PHE A C   1 
ATOM   4122 O O   . PHE A 1 531 ? 25.386  5.579   -7.109  1.00 56.59  ? 531  PHE A O   1 
ATOM   4123 C CB  . PHE A 1 531 ? 22.604  7.469   -7.744  1.00 55.55  ? 531  PHE A CB  1 
ATOM   4124 C CG  . PHE A 1 531 ? 23.673  8.310   -8.320  1.00 53.71  ? 531  PHE A CG  1 
ATOM   4125 C CD1 . PHE A 1 531 ? 24.064  8.144   -9.642  1.00 55.08  ? 531  PHE A CD1 1 
ATOM   4126 C CD2 . PHE A 1 531 ? 24.306  9.258   -7.543  1.00 52.65  ? 531  PHE A CD2 1 
ATOM   4127 C CE1 . PHE A 1 531 ? 25.079  8.905   -10.182 1.00 55.89  ? 531  PHE A CE1 1 
ATOM   4128 C CE2 . PHE A 1 531 ? 25.324  10.055  -8.075  1.00 53.27  ? 531  PHE A CE2 1 
ATOM   4129 C CZ  . PHE A 1 531 ? 25.717  9.872   -9.392  1.00 54.23  ? 531  PHE A CZ  1 
ATOM   4130 N N   . TRP A 1 532 ? 24.298  6.592   -5.404  1.00 54.29  ? 532  TRP A N   1 
ATOM   4131 C CA  . TRP A 1 532 ? 25.503  6.761   -4.585  1.00 52.82  ? 532  TRP A CA  1 
ATOM   4132 C C   . TRP A 1 532 ? 26.118  5.453   -4.088  1.00 54.05  ? 532  TRP A C   1 
ATOM   4133 O O   . TRP A 1 532 ? 27.337  5.335   -4.029  1.00 53.94  ? 532  TRP A O   1 
ATOM   4134 C CB  . TRP A 1 532 ? 25.235  7.643   -3.395  1.00 50.06  ? 532  TRP A CB  1 
ATOM   4135 C CG  . TRP A 1 532 ? 24.926  9.027   -3.710  1.00 48.55  ? 532  TRP A CG  1 
ATOM   4136 C CD1 . TRP A 1 532 ? 23.685  9.619   -3.690  1.00 48.48  ? 532  TRP A CD1 1 
ATOM   4137 C CD2 . TRP A 1 532 ? 25.857  10.061  -4.039  1.00 47.16  ? 532  TRP A CD2 1 
ATOM   4138 N NE1 . TRP A 1 532 ? 23.795  10.957  -3.993  1.00 47.64  ? 532  TRP A NE1 1 
ATOM   4139 C CE2 . TRP A 1 532 ? 25.116  11.253  -4.211  1.00 46.60  ? 532  TRP A CE2 1 
ATOM   4140 C CE3 . TRP A 1 532 ? 27.246  10.101  -4.199  1.00 47.41  ? 532  TRP A CE3 1 
ATOM   4141 C CZ2 . TRP A 1 532 ? 25.717  12.464  -4.543  1.00 46.19  ? 532  TRP A CZ2 1 
ATOM   4142 C CZ3 . TRP A 1 532 ? 27.850  11.316  -4.539  1.00 45.98  ? 532  TRP A CZ3 1 
ATOM   4143 C CH2 . TRP A 1 532 ? 27.082  12.476  -4.706  1.00 46.51  ? 532  TRP A CH2 1 
ATOM   4144 N N   . ASN A 1 533 ? 25.279  4.486   -3.737  1.00 55.33  ? 533  ASN A N   1 
ATOM   4145 C CA  . ASN A 1 533 ? 25.743  3.264   -3.088  1.00 56.89  ? 533  ASN A CA  1 
ATOM   4146 C C   . ASN A 1 533 ? 26.115  2.145   -4.041  1.00 59.27  ? 533  ASN A C   1 
ATOM   4147 O O   . ASN A 1 533 ? 26.977  1.342   -3.746  1.00 59.30  ? 533  ASN A O   1 
ATOM   4148 C CB  . ASN A 1 533 ? 24.696  2.747   -2.101  1.00 56.65  ? 533  ASN A CB  1 
ATOM   4149 C CG  . ASN A 1 533 ? 24.452  3.703   -0.963  1.00 56.36  ? 533  ASN A CG  1 
ATOM   4150 O OD1 . ASN A 1 533 ? 25.204  4.665   -0.763  1.00 56.01  ? 533  ASN A OD1 1 
ATOM   4151 N ND2 . ASN A 1 533 ? 23.402  3.444   -0.196  1.00 57.34  ? 533  ASN A ND2 1 
ATOM   4152 N N   . ARG A 1 534 ? 25.448  2.085   -5.181  1.00 61.81  ? 534  ARG A N   1 
ATOM   4153 C CA  . ARG A 1 534 ? 25.663  0.983   -6.102  1.00 64.98  ? 534  ARG A CA  1 
ATOM   4154 C C   . ARG A 1 534 ? 26.365  1.417   -7.376  1.00 66.36  ? 534  ARG A C   1 
ATOM   4155 O O   . ARG A 1 534 ? 27.219  0.697   -7.888  1.00 67.86  ? 534  ARG A O   1 
ATOM   4156 C CB  . ARG A 1 534 ? 24.341  0.298   -6.443  1.00 66.31  ? 534  ARG A CB  1 
ATOM   4157 C CG  . ARG A 1 534 ? 23.748  -0.485  -5.312  1.00 66.85  ? 534  ARG A CG  1 
ATOM   4158 C CD  . ARG A 1 534 ? 22.412  -1.053  -5.715  1.00 68.94  ? 534  ARG A CD  1 
ATOM   4159 N NE  . ARG A 1 534 ? 21.566  -1.334  -4.553  1.00 69.58  ? 534  ARG A NE  1 
ATOM   4160 C CZ  . ARG A 1 534 ? 21.255  -2.555  -4.116  1.00 69.99  ? 534  ARG A CZ  1 
ATOM   4161 N NH1 . ARG A 1 534 ? 21.711  -3.639  -4.747  1.00 69.69  ? 534  ARG A NH1 1 
ATOM   4162 N NH2 . ARG A 1 534 ? 20.471  -2.684  -3.053  1.00 68.18  ? 534  ARG A NH2 1 
ATOM   4163 N N   . PHE A 1 535 ? 26.000  2.581   -7.901  1.00 66.48  ? 535  PHE A N   1 
ATOM   4164 C CA  . PHE A 1 535 ? 26.553  2.977   -9.168  1.00 68.07  ? 535  PHE A CA  1 
ATOM   4165 C C   . PHE A 1 535 ? 27.859  3.694   -8.973  1.00 68.33  ? 535  PHE A C   1 
ATOM   4166 O O   . PHE A 1 535 ? 28.890  3.223   -9.425  1.00 69.47  ? 535  PHE A O   1 
ATOM   4167 C CB  . PHE A 1 535 ? 25.580  3.810   -10.006 1.00 67.81  ? 535  PHE A CB  1 
ATOM   4168 C CG  . PHE A 1 535 ? 26.168  4.265   -11.308 1.00 66.90  ? 535  PHE A CG  1 
ATOM   4169 C CD1 . PHE A 1 535 ? 26.465  3.340   -12.308 1.00 67.20  ? 535  PHE A CD1 1 
ATOM   4170 C CD2 . PHE A 1 535 ? 26.466  5.609   -11.520 1.00 64.61  ? 535  PHE A CD2 1 
ATOM   4171 C CE1 . PHE A 1 535 ? 27.037  3.739   -13.504 1.00 67.62  ? 535  PHE A CE1 1 
ATOM   4172 C CE2 . PHE A 1 535 ? 27.047  6.027   -12.716 1.00 65.01  ? 535  PHE A CE2 1 
ATOM   4173 C CZ  . PHE A 1 535 ? 27.331  5.088   -13.711 1.00 67.24  ? 535  PHE A CZ  1 
ATOM   4174 N N   . LEU A 1 536 ? 27.816  4.833   -8.297  1.00 68.40  ? 536  LEU A N   1 
ATOM   4175 C CA  . LEU A 1 536 ? 28.979  5.707   -8.195  1.00 69.60  ? 536  LEU A CA  1 
ATOM   4176 C C   . LEU A 1 536 ? 30.299  5.018   -7.818  1.00 71.72  ? 536  LEU A C   1 
ATOM   4177 O O   . LEU A 1 536 ? 31.350  5.411   -8.342  1.00 72.01  ? 536  LEU A O   1 
ATOM   4178 C CB  . LEU A 1 536 ? 28.709  6.858   -7.250  1.00 67.73  ? 536  LEU A CB  1 
ATOM   4179 C CG  . LEU A 1 536 ? 29.789  7.921   -7.352  1.00 68.02  ? 536  LEU A CG  1 
ATOM   4180 C CD1 . LEU A 1 536 ? 29.587  8.781   -8.594  1.00 69.70  ? 536  LEU A CD1 1 
ATOM   4181 C CD2 . LEU A 1 536 ? 29.813  8.757   -6.088  1.00 67.39  ? 536  LEU A CD2 1 
ATOM   4182 N N   . PRO A 1 537 ? 30.260  4.000   -6.914  1.00 73.58  ? 537  PRO A N   1 
ATOM   4183 C CA  . PRO A 1 537 ? 31.449  3.172   -6.744  1.00 75.59  ? 537  PRO A CA  1 
ATOM   4184 C C   . PRO A 1 537 ? 31.993  2.710   -8.085  1.00 78.74  ? 537  PRO A C   1 
ATOM   4185 O O   . PRO A 1 537 ? 33.125  3.058   -8.421  1.00 79.31  ? 537  PRO A O   1 
ATOM   4186 C CB  . PRO A 1 537 ? 30.931  1.979   -5.943  1.00 75.96  ? 537  PRO A CB  1 
ATOM   4187 C CG  . PRO A 1 537 ? 29.888  2.561   -5.099  1.00 73.95  ? 537  PRO A CG  1 
ATOM   4188 C CD  . PRO A 1 537 ? 29.239  3.658   -5.905  1.00 73.13  ? 537  PRO A CD  1 
ATOM   4189 N N   . LYS A 1 538 ? 31.175  1.986   -8.853  1.00 81.64  ? 538  LYS A N   1 
ATOM   4190 C CA  . LYS A 1 538 ? 31.592  1.351   -10.127 1.00 85.21  ? 538  LYS A CA  1 
ATOM   4191 C C   . LYS A 1 538 ? 32.265  2.294   -11.141 1.00 86.25  ? 538  LYS A C   1 
ATOM   4192 O O   . LYS A 1 538 ? 33.018  1.847   -12.000 1.00 87.97  ? 538  LYS A O   1 
ATOM   4193 C CB  . LYS A 1 538 ? 30.449  0.542   -10.759 1.00 86.37  ? 538  LYS A CB  1 
ATOM   4194 C CG  . LYS A 1 538 ? 29.877  -0.510  -9.825  1.00 87.23  ? 538  LYS A CG  1 
ATOM   4195 C CD  . LYS A 1 538 ? 29.121  -1.595  -10.569 1.00 91.74  ? 538  LYS A CD  1 
ATOM   4196 C CE  . LYS A 1 538 ? 28.785  -2.778  -9.659  1.00 92.65  ? 538  LYS A CE  1 
ATOM   4197 N NZ  . LYS A 1 538 ? 28.014  -3.809  -10.408 1.00 95.98  ? 538  LYS A NZ  1 
ATOM   4198 N N   . LEU A 1 539 ? 32.016  3.592   -11.025 1.00 86.17  ? 539  LEU A N   1 
ATOM   4199 C CA  . LEU A 1 539 ? 32.916  4.578   -11.615 1.00 87.66  ? 539  LEU A CA  1 
ATOM   4200 C C   . LEU A 1 539 ? 34.216  4.609   -10.787 1.00 88.69  ? 539  LEU A C   1 
ATOM   4201 O O   . LEU A 1 539 ? 34.609  5.655   -10.217 1.00 87.17  ? 539  LEU A O   1 
ATOM   4202 C CB  . LEU A 1 539 ? 32.250  5.953   -11.673 1.00 86.04  ? 539  LEU A CB  1 
ATOM   4203 C CG  . LEU A 1 539 ? 31.674  6.437   -13.007 1.00 86.37  ? 539  LEU A CG  1 
ATOM   4204 C CD1 . LEU A 1 539 ? 31.065  5.317   -13.840 1.00 87.53  ? 539  LEU A CD1 1 
ATOM   4205 C CD2 . LEU A 1 539 ? 30.671  7.559   -12.771 1.00 83.82  ? 539  LEU A CD2 1 
ATOM   4206 N N   . LEU A 1 540 ? 34.837  3.419   -10.705 1.00 91.78  ? 540  LEU A N   1 
ATOM   4207 C CA  . LEU A 1 540 ? 36.136  3.169   -10.044 1.00 93.12  ? 540  LEU A CA  1 
ATOM   4208 C C   . LEU A 1 540 ? 37.306  3.362   -11.022 1.00 95.43  ? 540  LEU A C   1 
ATOM   4209 O O   . LEU A 1 540 ? 38.403  3.758   -10.610 1.00 95.61  ? 540  LEU A O   1 
ATOM   4210 C CB  . LEU A 1 540 ? 36.193  1.760   -9.401  1.00 94.06  ? 540  LEU A CB  1 
ATOM   4211 C CG  . LEU A 1 540 ? 35.650  0.454   -10.039 1.00 96.53  ? 540  LEU A CG  1 
ATOM   4212 C CD1 . LEU A 1 540 ? 36.439  -0.042  -11.262 1.00 98.32  ? 540  LEU A CD1 1 
ATOM   4213 C CD2 . LEU A 1 540 ? 35.530  -0.675  -8.991  1.00 96.57  ? 540  LEU A CD2 1 
ATOM   4214 N N   . SER A 1 541 ? 37.059  3.070   -12.307 1.00 97.75  ? 541  SER A N   1 
ATOM   4215 C CA  . SER A 1 541 ? 37.992  3.377   -13.404 1.00 99.45  ? 541  SER A CA  1 
ATOM   4216 C C   . SER A 1 541 ? 37.777  4.818   -13.894 1.00 98.49  ? 541  SER A C   1 
ATOM   4217 O O   . SER A 1 541 ? 38.557  5.729   -13.598 1.00 97.68  ? 541  SER A O   1 
ATOM   4218 C CB  . SER A 1 541 ? 37.797  2.401   -14.570 1.00 101.86 ? 541  SER A CB  1 
ATOM   4219 O OG  . SER A 1 541 ? 37.299  1.156   -14.117 1.00 103.04 ? 541  SER A OG  1 
ATOM   4220 N N   . ALA A 1 542 ? 36.805  5.112   -14.595 1.00 98.54  ? 542  ALA A N   1 
ATOM   4221 N N   . GLU B 1 4   ? -17.391 4.561   -68.882 1.00 97.42  ? 4    GLU B N   1 
ATOM   4222 C CA  . GLU B 1 4   ? -16.201 5.296   -68.360 1.00 95.05  ? 4    GLU B CA  1 
ATOM   4223 C C   . GLU B 1 4   ? -16.619 6.500   -67.506 1.00 94.42  ? 4    GLU B C   1 
ATOM   4224 O O   . GLU B 1 4   ? -17.431 7.328   -67.927 1.00 96.26  ? 4    GLU B O   1 
ATOM   4225 C CB  . GLU B 1 4   ? -15.300 5.750   -69.517 1.00 95.16  ? 4    GLU B CB  1 
ATOM   4226 C CG  . GLU B 1 4   ? -13.851 6.085   -69.112 1.00 94.48  ? 4    GLU B CG  1 
ATOM   4227 C CD  . GLU B 1 4   ? -12.898 4.873   -69.141 1.00 95.50  ? 4    GLU B CD  1 
ATOM   4228 O OE1 . GLU B 1 4   ? -13.236 3.851   -69.785 1.00 97.14  ? 4    GLU B OE1 1 
ATOM   4229 O OE2 . GLU B 1 4   ? -11.803 4.949   -68.525 1.00 94.05  ? 4    GLU B OE2 1 
ATOM   4230 N N   . ASP B 1 5   ? -16.052 6.583   -66.306 1.00 91.81  ? 5    ASP B N   1 
ATOM   4231 C CA  . ASP B 1 5   ? -16.307 7.685   -65.380 1.00 90.73  ? 5    ASP B CA  1 
ATOM   4232 C C   . ASP B 1 5   ? -15.150 8.688   -65.478 1.00 88.99  ? 5    ASP B C   1 
ATOM   4233 O O   . ASP B 1 5   ? -14.037 8.380   -65.053 1.00 87.01  ? 5    ASP B O   1 
ATOM   4234 C CB  . ASP B 1 5   ? -16.441 7.134   -63.950 1.00 89.31  ? 5    ASP B CB  1 
ATOM   4235 C CG  . ASP B 1 5   ? -16.858 8.187   -62.934 1.00 88.27  ? 5    ASP B CG  1 
ATOM   4236 O OD1 . ASP B 1 5   ? -16.922 9.391   -63.274 1.00 88.05  ? 5    ASP B OD1 1 
ATOM   4237 O OD2 . ASP B 1 5   ? -17.122 7.796   -61.777 1.00 85.81  ? 5    ASP B OD2 1 
ATOM   4238 N N   . PRO B 1 6   ? -15.404 9.885   -66.058 1.00 89.86  ? 6    PRO B N   1 
ATOM   4239 C CA  . PRO B 1 6   ? -14.371 10.926  -66.232 1.00 88.32  ? 6    PRO B CA  1 
ATOM   4240 C C   . PRO B 1 6   ? -13.594 11.224  -64.955 1.00 85.58  ? 6    PRO B C   1 
ATOM   4241 O O   . PRO B 1 6   ? -12.389 11.465  -65.014 1.00 84.22  ? 6    PRO B O   1 
ATOM   4242 C CB  . PRO B 1 6   ? -15.169 12.167  -66.665 1.00 90.64  ? 6    PRO B CB  1 
ATOM   4243 C CG  . PRO B 1 6   ? -16.635 11.781  -66.567 1.00 92.98  ? 6    PRO B CG  1 
ATOM   4244 C CD  . PRO B 1 6   ? -16.681 10.288  -66.672 1.00 92.46  ? 6    PRO B CD  1 
ATOM   4245 N N   . GLN B 1 7   ? -14.286 11.188  -63.816 1.00 84.74  ? 7    GLN B N   1 
ATOM   4246 C CA  . GLN B 1 7   ? -13.668 11.379  -62.502 1.00 81.90  ? 7    GLN B CA  1 
ATOM   4247 C C   . GLN B 1 7   ? -12.564 10.377  -62.210 1.00 79.04  ? 7    GLN B C   1 
ATOM   4248 O O   . GLN B 1 7   ? -11.637 10.690  -61.474 1.00 77.54  ? 7    GLN B O   1 
ATOM   4249 C CB  . GLN B 1 7   ? -14.720 11.313  -61.391 1.00 82.58  ? 7    GLN B CB  1 
ATOM   4250 C CG  . GLN B 1 7   ? -15.619 12.560  -61.285 1.00 85.01  ? 7    GLN B CG  1 
ATOM   4251 C CD  . GLN B 1 7   ? -14.881 13.792  -60.782 1.00 83.87  ? 7    GLN B CD  1 
ATOM   4252 O OE1 . GLN B 1 7   ? -14.113 13.722  -59.827 1.00 81.25  ? 7    GLN B OE1 1 
ATOM   4253 N NE2 . GLN B 1 7   ? -15.120 14.927  -61.423 1.00 85.89  ? 7    GLN B NE2 1 
ATOM   4254 N N   . LEU B 1 8   ? -12.666 9.179   -62.782 1.00 78.23  ? 8    LEU B N   1 
ATOM   4255 C CA  . LEU B 1 8   ? -11.682 8.126   -62.546 1.00 75.59  ? 8    LEU B CA  1 
ATOM   4256 C C   . LEU B 1 8   ? -10.669 8.035   -63.677 1.00 74.94  ? 8    LEU B C   1 
ATOM   4257 O O   . LEU B 1 8   ? -10.007 7.011   -63.834 1.00 74.46  ? 8    LEU B O   1 
ATOM   4258 C CB  . LEU B 1 8   ? -12.361 6.765   -62.360 1.00 75.84  ? 8    LEU B CB  1 
ATOM   4259 C CG  . LEU B 1 8   ? -13.430 6.597   -61.275 1.00 76.36  ? 8    LEU B CG  1 
ATOM   4260 C CD1 . LEU B 1 8   ? -14.118 5.237   -61.387 1.00 76.84  ? 8    LEU B CD1 1 
ATOM   4261 C CD2 . LEU B 1 8   ? -12.845 6.799   -59.882 1.00 74.25  ? 8    LEU B CD2 1 
ATOM   4262 N N   . LEU B 1 9   ? -10.542 9.104   -64.457 1.00 75.07  ? 9    LEU B N   1 
ATOM   4263 C CA  . LEU B 1 9   ? -9.620  9.138   -65.584 1.00 74.53  ? 9    LEU B CA  1 
ATOM   4264 C C   . LEU B 1 9   ? -8.696  10.364  -65.488 1.00 73.51  ? 9    LEU B C   1 
ATOM   4265 O O   . LEU B 1 9   ? -9.165  11.505  -65.600 1.00 74.83  ? 9    LEU B O   1 
ATOM   4266 C CB  . LEU B 1 9   ? -10.425 9.186   -66.884 1.00 76.82  ? 9    LEU B CB  1 
ATOM   4267 C CG  . LEU B 1 9   ? -10.000 8.425   -68.144 1.00 78.06  ? 9    LEU B CG  1 
ATOM   4268 C CD1 . LEU B 1 9   ? -11.048 8.619   -69.250 1.00 80.62  ? 9    LEU B CD1 1 
ATOM   4269 C CD2 . LEU B 1 9   ? -8.602  8.824   -68.636 1.00 78.10  ? 9    LEU B CD2 1 
ATOM   4270 N N   . VAL B 1 10  ? -7.398  10.133  -65.276 1.00 70.92  ? 10   VAL B N   1 
ATOM   4271 C CA  . VAL B 1 10  ? -6.426  11.217  -65.157 1.00 69.69  ? 10   VAL B CA  1 
ATOM   4272 C C   . VAL B 1 10  ? -5.277  11.025  -66.132 1.00 69.48  ? 10   VAL B C   1 
ATOM   4273 O O   . VAL B 1 10  ? -4.804  9.905   -66.323 1.00 68.78  ? 10   VAL B O   1 
ATOM   4274 C CB  . VAL B 1 10  ? -5.800  11.284  -63.737 1.00 68.06  ? 10   VAL B CB  1 
ATOM   4275 C CG1 . VAL B 1 10  ? -5.073  12.612  -63.520 1.00 67.31  ? 10   VAL B CG1 1 
ATOM   4276 C CG2 . VAL B 1 10  ? -6.843  11.105  -62.674 1.00 68.04  ? 10   VAL B CG2 1 
ATOM   4277 N N   . ARG B 1 11  ? -4.827  12.124  -66.736 1.00 70.05  ? 11   ARG B N   1 
ATOM   4278 C CA  . ARG B 1 11  ? -3.599  12.141  -67.524 1.00 69.78  ? 11   ARG B CA  1 
ATOM   4279 C C   . ARG B 1 11  ? -2.457  12.708  -66.694 1.00 68.34  ? 11   ARG B C   1 
ATOM   4280 O O   . ARG B 1 11  ? -2.458  13.900  -66.331 1.00 68.52  ? 11   ARG B O   1 
ATOM   4281 C CB  . ARG B 1 11  ? -3.767  12.951  -68.816 1.00 71.84  ? 11   ARG B CB  1 
ATOM   4282 C CG  . ARG B 1 11  ? -2.445  13.251  -69.546 1.00 73.69  ? 11   ARG B CG  1 
ATOM   4283 C CD  . ARG B 1 11  ? -2.632  13.907  -70.938 1.00 78.77  ? 11   ARG B CD  1 
ATOM   4284 N NE  . ARG B 1 11  ? -3.141  12.961  -71.937 1.00 81.73  ? 11   ARG B NE  1 
ATOM   4285 C CZ  . ARG B 1 11  ? -2.456  11.919  -72.425 1.00 81.87  ? 11   ARG B CZ  1 
ATOM   4286 N NH1 . ARG B 1 11  ? -1.209  11.668  -72.015 1.00 79.41  ? 11   ARG B NH1 1 
ATOM   4287 N NH2 . ARG B 1 11  ? -3.025  11.118  -73.326 1.00 82.90  ? 11   ARG B NH2 1 
ATOM   4288 N N   . VAL B 1 12  ? -1.488  11.845  -66.393 1.00 66.55  ? 12   VAL B N   1 
ATOM   4289 C CA  . VAL B 1 12  ? -0.240  12.273  -65.761 1.00 64.93  ? 12   VAL B CA  1 
ATOM   4290 C C   . VAL B 1 12  ? 0.851   12.380  -66.830 1.00 65.66  ? 12   VAL B C   1 
ATOM   4291 O O   . VAL B 1 12  ? 0.589   12.079  -68.003 1.00 66.77  ? 12   VAL B O   1 
ATOM   4292 C CB  . VAL B 1 12  ? 0.154   11.351  -64.589 1.00 63.03  ? 12   VAL B CB  1 
ATOM   4293 C CG1 . VAL B 1 12  ? -0.938  11.394  -63.528 1.00 61.73  ? 12   VAL B CG1 1 
ATOM   4294 C CG2 . VAL B 1 12  ? 0.395   9.917   -65.062 1.00 62.46  ? 12   VAL B CG2 1 
ATOM   4295 N N   . ARG B 1 13  ? 2.052   12.820  -66.448 1.00 64.88  ? 13   ARG B N   1 
ATOM   4296 C CA  . ARG B 1 13  ? 3.128   13.021  -67.428 1.00 65.98  ? 13   ARG B CA  1 
ATOM   4297 C C   . ARG B 1 13  ? 3.485   11.768  -68.235 1.00 65.17  ? 13   ARG B C   1 
ATOM   4298 O O   . ARG B 1 13  ? 3.754   11.863  -69.423 1.00 66.46  ? 13   ARG B O   1 
ATOM   4299 C CB  . ARG B 1 13  ? 4.384   13.620  -66.789 1.00 66.15  ? 13   ARG B CB  1 
ATOM   4300 C CG  . ARG B 1 13  ? 4.373   15.144  -66.710 1.00 70.47  ? 13   ARG B CG  1 
ATOM   4301 C CD  . ARG B 1 13  ? 5.791   15.672  -66.586 1.00 77.37  ? 13   ARG B CD  1 
ATOM   4302 N NE  . ARG B 1 13  ? 5.878   16.961  -65.883 1.00 83.71  ? 13   ARG B NE  1 
ATOM   4303 C CZ  . ARG B 1 13  ? 7.001   17.450  -65.340 1.00 86.10  ? 13   ARG B CZ  1 
ATOM   4304 N NH1 . ARG B 1 13  ? 8.135   16.753  -65.420 1.00 87.14  ? 13   ARG B NH1 1 
ATOM   4305 N NH2 . ARG B 1 13  ? 7.000   18.628  -64.709 1.00 85.84  ? 13   ARG B NH2 1 
ATOM   4306 N N   . GLY B 1 14  ? 3.469   10.602  -67.600 1.00 62.85  ? 14   GLY B N   1 
ATOM   4307 C CA  . GLY B 1 14  ? 3.780   9.371   -68.298 1.00 62.03  ? 14   GLY B CA  1 
ATOM   4308 C C   . GLY B 1 14  ? 2.645   8.793   -69.121 1.00 62.21  ? 14   GLY B C   1 
ATOM   4309 O O   . GLY B 1 14  ? 2.845   7.843   -69.872 1.00 62.54  ? 14   GLY B O   1 
ATOM   4310 N N   . GLY B 1 15  ? 1.449   9.345   -68.970 1.00 62.25  ? 15   GLY B N   1 
ATOM   4311 C CA  . GLY B 1 15  ? 0.285   8.858   -69.714 1.00 63.31  ? 15   GLY B CA  1 
ATOM   4312 C C   . GLY B 1 15  ? -1.046  8.855   -68.973 1.00 63.06  ? 15   GLY B C   1 
ATOM   4313 O O   . GLY B 1 15  ? -1.221  9.535   -67.956 1.00 62.17  ? 15   GLY B O   1 
ATOM   4314 N N   . GLN B 1 16  ? -1.992  8.081   -69.487 1.00 63.93  ? 16   GLN B N   1 
ATOM   4315 C CA  . GLN B 1 16  ? -3.328  8.071   -68.922 1.00 64.38  ? 16   GLN B CA  1 
ATOM   4316 C C   . GLN B 1 16  ? -3.546  6.934   -67.937 1.00 62.72  ? 16   GLN B C   1 
ATOM   4317 O O   . GLN B 1 16  ? -3.071  5.821   -68.149 1.00 62.47  ? 16   GLN B O   1 
ATOM   4318 C CB  . GLN B 1 16  ? -4.386  8.095   -70.031 1.00 66.78  ? 16   GLN B CB  1 
ATOM   4319 C CG  . GLN B 1 16  ? -4.523  9.488   -70.645 1.00 69.88  ? 16   GLN B CG  1 
ATOM   4320 C CD  . GLN B 1 16  ? -5.858  9.725   -71.347 1.00 75.63  ? 16   GLN B CD  1 
ATOM   4321 O OE1 . GLN B 1 16  ? -6.203  9.037   -72.325 1.00 76.61  ? 16   GLN B OE1 1 
ATOM   4322 N NE2 . GLN B 1 16  ? -6.608  10.728  -70.863 1.00 76.71  ? 16   GLN B NE2 1 
ATOM   4323 N N   . LEU B 1 17  ? -4.273  7.249   -66.866 1.00 61.76  ? 17   LEU B N   1 
ATOM   4324 C CA  . LEU B 1 17  ? -4.509  6.362   -65.732 1.00 60.53  ? 17   LEU B CA  1 
ATOM   4325 C C   . LEU B 1 17  ? -5.990  6.164   -65.493 1.00 61.61  ? 17   LEU B C   1 
ATOM   4326 O O   . LEU B 1 17  ? -6.750  7.126   -65.536 1.00 62.70  ? 17   LEU B O   1 
ATOM   4327 C CB  . LEU B 1 17  ? -3.931  7.007   -64.463 1.00 59.05  ? 17   LEU B CB  1 
ATOM   4328 C CG  . LEU B 1 17  ? -2.417  7.132   -64.332 1.00 56.94  ? 17   LEU B CG  1 
ATOM   4329 C CD1 . LEU B 1 17  ? -2.085  8.025   -63.217 1.00 53.50  ? 17   LEU B CD1 1 
ATOM   4330 C CD2 . LEU B 1 17  ? -1.805  5.742   -64.113 1.00 56.69  ? 17   LEU B CD2 1 
ATOM   4331 N N   . ARG B 1 18  ? -6.406  4.935   -65.208 1.00 61.84  ? 18   ARG B N   1 
ATOM   4332 C CA  . ARG B 1 18  ? -7.791  4.699   -64.818 1.00 63.25  ? 18   ARG B CA  1 
ATOM   4333 C C   . ARG B 1 18  ? -7.870  4.266   -63.373 1.00 62.28  ? 18   ARG B C   1 
ATOM   4334 O O   . ARG B 1 18  ? -7.303  3.237   -62.992 1.00 61.34  ? 18   ARG B O   1 
ATOM   4335 C CB  . ARG B 1 18  ? -8.482  3.661   -65.698 1.00 65.17  ? 18   ARG B CB  1 
ATOM   4336 C CG  . ARG B 1 18  ? -9.960  3.416   -65.319 1.00 68.56  ? 18   ARG B CG  1 
ATOM   4337 C CD  . ARG B 1 18  ? -10.571 2.218   -66.072 1.00 73.87  ? 18   ARG B CD  1 
ATOM   4338 N NE  . ARG B 1 18  ? -10.834 2.550   -67.477 1.00 78.64  ? 18   ARG B NE  1 
ATOM   4339 C CZ  . ARG B 1 18  ? -10.089 2.150   -68.511 1.00 80.02  ? 18   ARG B CZ  1 
ATOM   4340 N NH1 . ARG B 1 18  ? -9.021  1.370   -68.327 1.00 79.73  ? 18   ARG B NH1 1 
ATOM   4341 N NH2 . ARG B 1 18  ? -10.418 2.532   -69.738 1.00 81.88  ? 18   ARG B NH2 1 
ATOM   4342 N N   . GLY B 1 19  ? -8.594  5.065   -62.587 1.00 62.44  ? 19   GLY B N   1 
ATOM   4343 C CA  . GLY B 1 19  ? -8.860  4.773   -61.191 1.00 61.84  ? 19   GLY B CA  1 
ATOM   4344 C C   . GLY B 1 19  ? -10.061 3.882   -60.936 1.00 63.25  ? 19   GLY B C   1 
ATOM   4345 O O   . GLY B 1 19  ? -10.684 3.350   -61.866 1.00 64.93  ? 19   GLY B O   1 
ATOM   4346 N N   . ILE B 1 20  ? -10.368 3.729   -59.653 1.00 62.89  ? 20   ILE B N   1 
ATOM   4347 C CA  . ILE B 1 20  ? -11.503 2.967   -59.170 1.00 64.40  ? 20   ILE B CA  1 
ATOM   4348 C C   . ILE B 1 20  ? -12.200 3.827   -58.134 1.00 65.24  ? 20   ILE B C   1 
ATOM   4349 O O   . ILE B 1 20  ? -11.544 4.504   -57.341 1.00 64.57  ? 20   ILE B O   1 
ATOM   4350 C CB  . ILE B 1 20  ? -11.059 1.612   -58.546 1.00 63.81  ? 20   ILE B CB  1 
ATOM   4351 C CG1 . ILE B 1 20  ? -12.274 0.726   -58.230 1.00 65.59  ? 20   ILE B CG1 1 
ATOM   4352 C CG2 . ILE B 1 20  ? -10.159 1.820   -57.329 1.00 60.86  ? 20   ILE B CG2 1 
ATOM   4353 C CD1 . ILE B 1 20  ? -11.932 -0.715  -57.864 1.00 66.09  ? 20   ILE B CD1 1 
ATOM   4354 N N   . ARG B 1 21  ? -13.525 3.834   -58.159 1.00 67.73  ? 21   ARG B N   1 
ATOM   4355 C CA  . ARG B 1 21  ? -14.300 4.565   -57.164 1.00 68.70  ? 21   ARG B CA  1 
ATOM   4356 C C   . ARG B 1 21  ? -14.531 3.628   -56.001 1.00 68.59  ? 21   ARG B C   1 
ATOM   4357 O O   . ARG B 1 21  ? -15.109 2.544   -56.172 1.00 69.83  ? 21   ARG B O   1 
ATOM   4358 C CB  . ARG B 1 21  ? -15.633 5.051   -57.735 1.00 71.01  ? 21   ARG B CB  1 
ATOM   4359 C CG  . ARG B 1 21  ? -16.573 5.594   -56.677 1.00 73.89  ? 21   ARG B CG  1 
ATOM   4360 C CD  . ARG B 1 21  ? -17.709 6.397   -57.263 1.00 79.64  ? 21   ARG B CD  1 
ATOM   4361 N NE  . ARG B 1 21  ? -18.818 5.557   -57.701 1.00 85.46  ? 21   ARG B NE  1 
ATOM   4362 C CZ  . ARG B 1 21  ? -19.850 5.202   -56.935 1.00 89.16  ? 21   ARG B CZ  1 
ATOM   4363 N NH1 . ARG B 1 21  ? -19.923 5.596   -55.664 1.00 88.81  ? 21   ARG B NH1 1 
ATOM   4364 N NH2 . ARG B 1 21  ? -20.815 4.439   -57.448 1.00 92.04  ? 21   ARG B NH2 1 
ATOM   4365 N N   . LEU B 1 22  ? -14.072 4.056   -54.830 1.00 67.24  ? 22   LEU B N   1 
ATOM   4366 C CA  . LEU B 1 22  ? -14.150 3.255   -53.631 1.00 67.65  ? 22   LEU B CA  1 
ATOM   4367 C C   . LEU B 1 22  ? -15.167 3.802   -52.644 1.00 69.30  ? 22   LEU B C   1 
ATOM   4368 O O   . LEU B 1 22  ? -15.415 5.014   -52.584 1.00 69.43  ? 22   LEU B O   1 
ATOM   4369 C CB  . LEU B 1 22  ? -12.778 3.173   -52.965 1.00 65.49  ? 22   LEU B CB  1 
ATOM   4370 C CG  . LEU B 1 22  ? -11.663 2.412   -53.695 1.00 65.05  ? 22   LEU B CG  1 
ATOM   4371 C CD1 . LEU B 1 22  ? -10.361 2.531   -52.910 1.00 63.55  ? 22   LEU B CD1 1 
ATOM   4372 C CD2 . LEU B 1 22  ? -12.012 0.936   -53.938 1.00 65.59  ? 22   LEU B CD2 1 
ATOM   4373 N N   . LYS B 1 23  ? -15.740 2.890   -51.863 1.00 70.90  ? 23   LYS B N   1 
ATOM   4374 C CA  . LYS B 1 23  ? -16.771 3.219   -50.880 1.00 72.98  ? 23   LYS B CA  1 
ATOM   4375 C C   . LYS B 1 23  ? -16.147 3.543   -49.535 1.00 71.48  ? 23   LYS B C   1 
ATOM   4376 O O   . LYS B 1 23  ? -15.515 2.687   -48.907 1.00 71.07  ? 23   LYS B O   1 
ATOM   4377 C CB  . LYS B 1 23  ? -17.742 2.043   -50.738 1.00 75.54  ? 23   LYS B CB  1 
ATOM   4378 C CG  . LYS B 1 23  ? -18.739 2.115   -49.573 1.00 79.53  ? 23   LYS B CG  1 
ATOM   4379 C CD  . LYS B 1 23  ? -19.581 0.806   -49.513 1.00 85.00  ? 23   LYS B CD  1 
ATOM   4380 C CE  . LYS B 1 23  ? -20.955 0.997   -48.835 1.00 88.18  ? 23   LYS B CE  1 
ATOM   4381 N NZ  . LYS B 1 23  ? -20.844 1.415   -47.405 1.00 87.59  ? 23   LYS B NZ  1 
ATOM   4382 N N   . ALA B 1 24  ? -16.305 4.791   -49.108 1.00 71.02  ? 24   ALA B N   1 
ATOM   4383 C CA  . ALA B 1 24  ? -15.979 5.179   -47.746 1.00 69.48  ? 24   ALA B CA  1 
ATOM   4384 C C   . ALA B 1 24  ? -17.301 5.484   -47.026 1.00 71.45  ? 24   ALA B C   1 
ATOM   4385 O O   . ALA B 1 24  ? -18.270 5.883   -47.676 1.00 73.17  ? 24   ALA B O   1 
ATOM   4386 C CB  . ALA B 1 24  ? -15.064 6.382   -47.756 1.00 67.66  ? 24   ALA B CB  1 
ATOM   4387 N N   . PRO B 1 25  ? -17.355 5.289   -45.688 1.00 71.25  ? 25   PRO B N   1 
ATOM   4388 C CA  . PRO B 1 25  ? -18.546 5.529   -44.870 1.00 72.73  ? 25   PRO B CA  1 
ATOM   4389 C C   . PRO B 1 25  ? -19.410 6.703   -45.325 1.00 73.63  ? 25   PRO B C   1 
ATOM   4390 O O   . PRO B 1 25  ? -20.600 6.521   -45.585 1.00 76.17  ? 25   PRO B O   1 
ATOM   4391 C CB  . PRO B 1 25  ? -17.954 5.850   -43.494 1.00 71.78  ? 25   PRO B CB  1 
ATOM   4392 C CG  . PRO B 1 25  ? -16.701 5.082   -43.428 1.00 70.01  ? 25   PRO B CG  1 
ATOM   4393 C CD  . PRO B 1 25  ? -16.229 4.820   -44.855 1.00 69.60  ? 25   PRO B CD  1 
ATOM   4394 N N   . GLY B 1 26  ? -18.813 7.887   -45.431 1.00 71.92  ? 26   GLY B N   1 
ATOM   4395 C CA  . GLY B 1 26  ? -19.565 9.123   -45.673 1.00 72.86  ? 26   GLY B CA  1 
ATOM   4396 C C   . GLY B 1 26  ? -19.814 9.458   -47.135 1.00 73.40  ? 26   GLY B C   1 
ATOM   4397 O O   . GLY B 1 26  ? -20.619 10.346  -47.454 1.00 74.91  ? 26   GLY B O   1 
ATOM   4398 N N   . GLY B 1 27  ? -19.114 8.753   -48.023 1.00 72.04  ? 27   GLY B N   1 
ATOM   4399 C CA  . GLY B 1 27  ? -19.310 8.895   -49.461 1.00 72.30  ? 27   GLY B CA  1 
ATOM   4400 C C   . GLY B 1 27  ? -18.206 8.245   -50.272 1.00 70.34  ? 27   GLY B C   1 
ATOM   4401 O O   . GLY B 1 27  ? -17.286 7.649   -49.705 1.00 68.62  ? 27   GLY B O   1 
ATOM   4402 N N   . PRO B 1 28  ? -18.284 8.366   -51.611 1.00 70.60  ? 28   PRO B N   1 
ATOM   4403 C CA  . PRO B 1 28  ? -17.307 7.785   -52.538 1.00 68.80  ? 28   PRO B CA  1 
ATOM   4404 C C   . PRO B 1 28  ? -15.975 8.536   -52.572 1.00 66.60  ? 28   PRO B C   1 
ATOM   4405 O O   . PRO B 1 28  ? -15.945 9.752   -52.349 1.00 66.46  ? 28   PRO B O   1 
ATOM   4406 C CB  . PRO B 1 28  ? -18.004 7.903   -53.886 1.00 70.59  ? 28   PRO B CB  1 
ATOM   4407 C CG  . PRO B 1 28  ? -18.940 9.046   -53.737 1.00 72.29  ? 28   PRO B CG  1 
ATOM   4408 C CD  . PRO B 1 28  ? -19.341 9.121   -52.309 1.00 72.49  ? 28   PRO B CD  1 
ATOM   4409 N N   . VAL B 1 29  ? -14.885 7.803   -52.825 1.00 64.74  ? 29   VAL B N   1 
ATOM   4410 C CA  . VAL B 1 29  ? -13.555 8.397   -53.040 1.00 62.63  ? 29   VAL B CA  1 
ATOM   4411 C C   . VAL B 1 29  ? -12.976 7.828   -54.325 1.00 62.11  ? 29   VAL B C   1 
ATOM   4412 O O   . VAL B 1 29  ? -13.396 6.753   -54.767 1.00 63.28  ? 29   VAL B O   1 
ATOM   4413 C CB  . VAL B 1 29  ? -12.547 8.143   -51.868 1.00 60.98  ? 29   VAL B CB  1 
ATOM   4414 C CG1 . VAL B 1 29  ? -13.115 8.585   -50.541 1.00 61.63  ? 29   VAL B CG1 1 
ATOM   4415 C CG2 . VAL B 1 29  ? -12.124 6.671   -51.789 1.00 61.01  ? 29   VAL B CG2 1 
ATOM   4416 N N   . SER B 1 30  ? -12.022 8.544   -54.924 1.00 60.48  ? 30   SER B N   1 
ATOM   4417 C CA  . SER B 1 30  ? -11.339 8.068   -56.120 1.00 59.31  ? 30   SER B CA  1 
ATOM   4418 C C   . SER B 1 30  ? -9.977  7.523   -55.724 1.00 57.06  ? 30   SER B C   1 
ATOM   4419 O O   . SER B 1 30  ? -9.230  8.172   -55.012 1.00 56.41  ? 30   SER B O   1 
ATOM   4420 C CB  . SER B 1 30  ? -11.180 9.198   -57.130 1.00 59.99  ? 30   SER B CB  1 
ATOM   4421 O OG  . SER B 1 30  ? -12.396 9.898   -57.340 1.00 61.92  ? 30   SER B OG  1 
ATOM   4422 N N   . ALA B 1 31  ? -9.656  6.312   -56.156 1.00 56.50  ? 31   ALA B N   1 
ATOM   4423 C CA  . ALA B 1 31  ? -8.367  5.730   -55.836 1.00 53.90  ? 31   ALA B CA  1 
ATOM   4424 C C   . ALA B 1 31  ? -7.600  5.465   -57.105 1.00 53.40  ? 31   ALA B C   1 
ATOM   4425 O O   . ALA B 1 31  ? -8.156  5.003   -58.083 1.00 55.16  ? 31   ALA B O   1 
ATOM   4426 C CB  . ALA B 1 31  ? -8.551  4.463   -55.066 1.00 53.89  ? 31   ALA B CB  1 
ATOM   4427 N N   . PHE B 1 32  ? -6.318  5.768   -57.095 1.00 51.49  ? 32   PHE B N   1 
ATOM   4428 C CA  . PHE B 1 32  ? -5.453  5.435   -58.215 1.00 50.67  ? 32   PHE B CA  1 
ATOM   4429 C C   . PHE B 1 32  ? -4.334  4.577   -57.646 1.00 49.31  ? 32   PHE B C   1 
ATOM   4430 O O   . PHE B 1 32  ? -3.362  5.088   -57.119 1.00 48.62  ? 32   PHE B O   1 
ATOM   4431 C CB  . PHE B 1 32  ? -4.948  6.724   -58.873 1.00 50.40  ? 32   PHE B CB  1 
ATOM   4432 C CG  . PHE B 1 32  ? -6.058  7.583   -59.374 1.00 50.20  ? 32   PHE B CG  1 
ATOM   4433 C CD1 . PHE B 1 32  ? -6.692  8.473   -58.534 1.00 49.59  ? 32   PHE B CD1 1 
ATOM   4434 C CD2 . PHE B 1 32  ? -6.529  7.430   -60.663 1.00 51.07  ? 32   PHE B CD2 1 
ATOM   4435 C CE1 . PHE B 1 32  ? -7.743  9.220   -58.980 1.00 51.22  ? 32   PHE B CE1 1 
ATOM   4436 C CE2 . PHE B 1 32  ? -7.576  8.168   -61.129 1.00 51.68  ? 32   PHE B CE2 1 
ATOM   4437 C CZ  . PHE B 1 32  ? -8.187  9.075   -60.287 1.00 52.76  ? 32   PHE B CZ  1 
ATOM   4438 N N   . LEU B 1 33  ? -4.508  3.265   -57.702 1.00 49.26  ? 33   LEU B N   1 
ATOM   4439 C CA  . LEU B 1 33  ? -3.606  2.367   -57.011 1.00 48.25  ? 33   LEU B CA  1 
ATOM   4440 C C   . LEU B 1 33  ? -2.624  1.729   -57.972 1.00 48.38  ? 33   LEU B C   1 
ATOM   4441 O O   . LEU B 1 33  ? -2.986  1.425   -59.102 1.00 49.54  ? 33   LEU B O   1 
ATOM   4442 C CB  . LEU B 1 33  ? -4.395  1.315   -56.250 1.00 48.19  ? 33   LEU B CB  1 
ATOM   4443 C CG  . LEU B 1 33  ? -5.570  1.877   -55.450 1.00 49.43  ? 33   LEU B CG  1 
ATOM   4444 C CD1 . LEU B 1 33  ? -6.437  0.745   -54.955 1.00 51.67  ? 33   LEU B CD1 1 
ATOM   4445 C CD2 . LEU B 1 33  ? -5.081  2.701   -54.282 1.00 47.24  ? 33   LEU B CD2 1 
ATOM   4446 N N   . GLY B 1 34  ? -1.381  1.544   -57.527 1.00 47.56  ? 34   GLY B N   1 
ATOM   4447 C CA  . GLY B 1 34  ? -0.358  0.870   -58.333 1.00 47.66  ? 34   GLY B CA  1 
ATOM   4448 C C   . GLY B 1 34  ? 0.142   1.677   -59.519 1.00 47.87  ? 34   GLY B C   1 
ATOM   4449 O O   . GLY B 1 34  ? 0.468   1.102   -60.554 1.00 49.20  ? 34   GLY B O   1 
ATOM   4450 N N   . ILE B 1 35  ? 0.179   3.005   -59.378 1.00 47.14  ? 35   ILE B N   1 
ATOM   4451 C CA  . ILE B 1 35  ? 0.794   3.878   -60.381 1.00 46.95  ? 35   ILE B CA  1 
ATOM   4452 C C   . ILE B 1 35  ? 2.300   3.654   -60.354 1.00 46.73  ? 35   ILE B C   1 
ATOM   4453 O O   . ILE B 1 35  ? 2.909   3.719   -59.297 1.00 46.77  ? 35   ILE B O   1 
ATOM   4454 C CB  . ILE B 1 35  ? 0.518   5.391   -60.107 1.00 46.32  ? 35   ILE B CB  1 
ATOM   4455 C CG1 . ILE B 1 35  ? -0.981  5.643   -59.954 1.00 45.80  ? 35   ILE B CG1 1 
ATOM   4456 C CG2 . ILE B 1 35  ? 1.159   6.277   -61.203 1.00 45.27  ? 35   ILE B CG2 1 
ATOM   4457 C CD1 . ILE B 1 35  ? -1.377  7.065   -59.524 1.00 43.41  ? 35   ILE B CD1 1 
ATOM   4458 N N   . PRO B 1 36  ? 2.908   3.364   -61.504 1.00 47.52  ? 36   PRO B N   1 
ATOM   4459 C CA  . PRO B 1 36  ? 4.364   3.191   -61.501 1.00 47.14  ? 36   PRO B CA  1 
ATOM   4460 C C   . PRO B 1 36  ? 5.084   4.528   -61.528 1.00 46.91  ? 36   PRO B C   1 
ATOM   4461 O O   . PRO B 1 36  ? 4.756   5.385   -62.333 1.00 47.31  ? 36   PRO B O   1 
ATOM   4462 C CB  . PRO B 1 36  ? 4.628   2.450   -62.802 1.00 47.93  ? 36   PRO B CB  1 
ATOM   4463 C CG  . PRO B 1 36  ? 3.501   2.900   -63.713 1.00 49.38  ? 36   PRO B CG  1 
ATOM   4464 C CD  . PRO B 1 36  ? 2.311   3.162   -62.837 1.00 48.61  ? 36   PRO B CD  1 
ATOM   4465 N N   . PHE B 1 37  ? 6.074   4.687   -60.665 1.00 46.56  ? 37   PHE B N   1 
ATOM   4466 C CA  . PHE B 1 37  ? 6.837   5.922   -60.628 1.00 47.07  ? 37   PHE B CA  1 
ATOM   4467 C C   . PHE B 1 37  ? 8.300   5.740   -61.008 1.00 47.68  ? 37   PHE B C   1 
ATOM   4468 O O   . PHE B 1 37  ? 9.050   6.712   -61.091 1.00 47.29  ? 37   PHE B O   1 
ATOM   4469 C CB  . PHE B 1 37  ? 6.691   6.613   -59.260 1.00 46.72  ? 37   PHE B CB  1 
ATOM   4470 C CG  . PHE B 1 37  ? 7.335   5.879   -58.112 1.00 45.70  ? 37   PHE B CG  1 
ATOM   4471 C CD1 . PHE B 1 37  ? 8.661   6.121   -57.770 1.00 45.89  ? 37   PHE B CD1 1 
ATOM   4472 C CD2 . PHE B 1 37  ? 6.590   5.006   -57.325 1.00 45.81  ? 37   PHE B CD2 1 
ATOM   4473 C CE1 . PHE B 1 37  ? 9.239   5.481   -56.686 1.00 46.09  ? 37   PHE B CE1 1 
ATOM   4474 C CE2 . PHE B 1 37  ? 7.164   4.352   -56.240 1.00 45.06  ? 37   PHE B CE2 1 
ATOM   4475 C CZ  . PHE B 1 37  ? 8.499   4.591   -55.920 1.00 44.74  ? 37   PHE B CZ  1 
ATOM   4476 N N   . ALA B 1 38  ? 8.702   4.486   -61.227 1.00 48.38  ? 38   ALA B N   1 
ATOM   4477 C CA  . ALA B 1 38  ? 10.078  4.184   -61.588 1.00 49.14  ? 38   ALA B CA  1 
ATOM   4478 C C   . ALA B 1 38  ? 10.135  3.011   -62.533 1.00 50.78  ? 38   ALA B C   1 
ATOM   4479 O O   . ALA B 1 38  ? 9.230   2.154   -62.561 1.00 51.56  ? 38   ALA B O   1 
ATOM   4480 C CB  . ALA B 1 38  ? 10.891  3.896   -60.369 1.00 48.00  ? 38   ALA B CB  1 
ATOM   4481 N N   . GLU B 1 39  ? 11.206  2.970   -63.314 1.00 51.58  ? 39   GLU B N   1 
ATOM   4482 C CA  . GLU B 1 39  ? 11.535  1.766   -64.045 1.00 52.18  ? 39   GLU B CA  1 
ATOM   4483 C C   . GLU B 1 39  ? 11.716  0.684   -63.000 1.00 51.60  ? 39   GLU B C   1 
ATOM   4484 O O   . GLU B 1 39  ? 12.374  0.920   -62.002 1.00 51.23  ? 39   GLU B O   1 
ATOM   4485 C CB  . GLU B 1 39  ? 12.796  1.981   -64.879 1.00 52.80  ? 39   GLU B CB  1 
ATOM   4486 C CG  . GLU B 1 39  ? 12.556  2.866   -66.090 1.00 53.42  ? 39   GLU B CG  1 
ATOM   4487 C CD  . GLU B 1 39  ? 11.594  2.237   -67.069 1.00 54.53  ? 39   GLU B CD  1 
ATOM   4488 O OE1 . GLU B 1 39  ? 12.030  1.398   -67.878 1.00 59.16  ? 39   GLU B OE1 1 
ATOM   4489 O OE2 . GLU B 1 39  ? 10.401  2.563   -67.031 1.00 53.67  ? 39   GLU B OE2 1 
ATOM   4490 N N   . PRO B 1 40  ? 11.096  -0.489  -63.199 1.00 52.21  ? 40   PRO B N   1 
ATOM   4491 C CA  . PRO B 1 40  ? 11.232  -1.564  -62.219 1.00 52.31  ? 40   PRO B CA  1 
ATOM   4492 C C   . PRO B 1 40  ? 12.704  -1.841  -61.929 1.00 53.08  ? 40   PRO B C   1 
ATOM   4493 O O   . PRO B 1 40  ? 13.448  -2.188  -62.848 1.00 55.45  ? 40   PRO B O   1 
ATOM   4494 C CB  . PRO B 1 40  ? 10.613  -2.763  -62.942 1.00 52.98  ? 40   PRO B CB  1 
ATOM   4495 C CG  . PRO B 1 40  ? 9.673   -2.173  -63.866 1.00 52.31  ? 40   PRO B CG  1 
ATOM   4496 C CD  . PRO B 1 40  ? 10.340  -0.939  -64.375 1.00 52.78  ? 40   PRO B CD  1 
ATOM   4497 N N   . PRO B 1 41  ? 13.132  -1.707  -60.665 1.00 52.18  ? 41   PRO B N   1 
ATOM   4498 C CA  . PRO B 1 41  ? 14.560  -1.753  -60.423 1.00 52.56  ? 41   PRO B CA  1 
ATOM   4499 C C   . PRO B 1 41  ? 15.074  -3.190  -60.373 1.00 53.43  ? 41   PRO B C   1 
ATOM   4500 O O   . PRO B 1 41  ? 15.520  -3.640  -59.315 1.00 53.36  ? 41   PRO B O   1 
ATOM   4501 C CB  . PRO B 1 41  ? 14.677  -1.104  -59.050 1.00 51.09  ? 41   PRO B CB  1 
ATOM   4502 C CG  . PRO B 1 41  ? 13.451  -1.562  -58.352 1.00 50.76  ? 41   PRO B CG  1 
ATOM   4503 C CD  . PRO B 1 41  ? 12.376  -1.736  -59.402 1.00 51.12  ? 41   PRO B CD  1 
ATOM   4504 N N   . VAL B 1 42  ? 15.025  -3.889  -61.507 1.00 54.47  ? 42   VAL B N   1 
ATOM   4505 C CA  . VAL B 1 42  ? 15.350  -5.331  -61.558 1.00 55.74  ? 42   VAL B CA  1 
ATOM   4506 C C   . VAL B 1 42  ? 16.593  -5.627  -62.415 1.00 57.41  ? 42   VAL B C   1 
ATOM   4507 O O   . VAL B 1 42  ? 17.140  -4.724  -63.050 1.00 58.31  ? 42   VAL B O   1 
ATOM   4508 C CB  . VAL B 1 42  ? 14.141  -6.183  -62.060 1.00 56.21  ? 42   VAL B CB  1 
ATOM   4509 C CG1 . VAL B 1 42  ? 12.988  -6.147  -61.049 1.00 54.66  ? 42   VAL B CG1 1 
ATOM   4510 C CG2 . VAL B 1 42  ? 13.686  -5.743  -63.445 1.00 54.99  ? 42   VAL B CG2 1 
ATOM   4511 N N   . GLY B 1 43  ? 17.040  -6.876  -62.434 1.00 58.16  ? 43   GLY B N   1 
ATOM   4512 C CA  . GLY B 1 43  ? 18.244  -7.237  -63.181 1.00 60.10  ? 43   GLY B CA  1 
ATOM   4513 C C   . GLY B 1 43  ? 19.449  -6.376  -62.839 1.00 60.45  ? 43   GLY B C   1 
ATOM   4514 O O   . GLY B 1 43  ? 19.832  -6.258  -61.683 1.00 59.84  ? 43   GLY B O   1 
ATOM   4515 N N   . SER B 1 44  ? 20.049  -5.760  -63.847 1.00 62.04  ? 44   SER B N   1 
ATOM   4516 C CA  . SER B 1 44  ? 21.189  -4.866  -63.615 1.00 62.80  ? 44   SER B CA  1 
ATOM   4517 C C   . SER B 1 44  ? 20.872  -3.644  -62.740 1.00 61.28  ? 44   SER B C   1 
ATOM   4518 O O   . SER B 1 44  ? 21.795  -2.958  -62.304 1.00 61.90  ? 44   SER B O   1 
ATOM   4519 C CB  . SER B 1 44  ? 21.752  -4.365  -64.949 1.00 64.33  ? 44   SER B CB  1 
ATOM   4520 O OG  . SER B 1 44  ? 21.215  -3.079  -65.257 1.00 62.72  ? 44   SER B OG  1 
ATOM   4521 N N   . ARG B 1 45  ? 19.590  -3.334  -62.523 1.00 59.92  ? 45   ARG B N   1 
ATOM   4522 C CA  . ARG B 1 45  ? 19.219  -2.127  -61.761 1.00 58.47  ? 45   ARG B CA  1 
ATOM   4523 C C   . ARG B 1 45  ? 19.081  -2.396  -60.263 1.00 56.98  ? 45   ARG B C   1 
ATOM   4524 O O   . ARG B 1 45  ? 18.833  -1.477  -59.488 1.00 56.39  ? 45   ARG B O   1 
ATOM   4525 C CB  . ARG B 1 45  ? 17.925  -1.518  -62.273 1.00 57.85  ? 45   ARG B CB  1 
ATOM   4526 C CG  . ARG B 1 45  ? 17.989  -0.820  -63.611 1.00 60.74  ? 45   ARG B CG  1 
ATOM   4527 C CD  . ARG B 1 45  ? 16.560  -0.697  -64.135 1.00 65.24  ? 45   ARG B CD  1 
ATOM   4528 N NE  . ARG B 1 45  ? 16.437  -0.359  -65.560 1.00 71.93  ? 45   ARG B NE  1 
ATOM   4529 C CZ  . ARG B 1 45  ? 16.475  0.885   -66.061 1.00 74.12  ? 45   ARG B CZ  1 
ATOM   4530 N NH1 . ARG B 1 45  ? 16.334  1.061   -67.374 1.00 75.24  ? 45   ARG B NH1 1 
ATOM   4531 N NH2 . ARG B 1 45  ? 16.660  1.951   -65.266 1.00 71.92  ? 45   ARG B NH2 1 
ATOM   4532 N N   . ARG B 1 46  ? 19.221  -3.655  -59.857 1.00 56.81  ? 46   ARG B N   1 
ATOM   4533 C CA  . ARG B 1 46  ? 19.246  -4.006  -58.436 1.00 55.22  ? 46   ARG B CA  1 
ATOM   4534 C C   . ARG B 1 46  ? 20.359  -3.246  -57.736 1.00 55.45  ? 46   ARG B C   1 
ATOM   4535 O O   . ARG B 1 46  ? 21.468  -3.122  -58.279 1.00 57.39  ? 46   ARG B O   1 
ATOM   4536 C CB  . ARG B 1 46  ? 19.472  -5.499  -58.241 1.00 55.22  ? 46   ARG B CB  1 
ATOM   4537 C CG  . ARG B 1 46  ? 19.263  -5.933  -56.837 1.00 52.79  ? 46   ARG B CG  1 
ATOM   4538 C CD  . ARG B 1 46  ? 19.690  -7.343  -56.668 1.00 54.31  ? 46   ARG B CD  1 
ATOM   4539 N NE  . ARG B 1 46  ? 18.585  -8.289  -56.727 1.00 52.74  ? 46   ARG B NE  1 
ATOM   4540 C CZ  . ARG B 1 46  ? 18.750  -9.602  -56.693 1.00 52.94  ? 46   ARG B CZ  1 
ATOM   4541 N NH1 . ARG B 1 46  ? 19.960  -10.106 -56.611 1.00 54.84  ? 46   ARG B NH1 1 
ATOM   4542 N NH2 . ARG B 1 46  ? 17.707  -10.409 -56.742 1.00 53.53  ? 46   ARG B NH2 1 
ATOM   4543 N N   . PHE B 1 47  ? 20.067  -2.771  -56.529 1.00 53.78  ? 47   PHE B N   1 
ATOM   4544 C CA  . PHE B 1 47  ? 20.998  -1.952  -55.732 1.00 53.39  ? 47   PHE B CA  1 
ATOM   4545 C C   . PHE B 1 47  ? 21.208  -0.536  -56.279 1.00 53.67  ? 47   PHE B C   1 
ATOM   4546 O O   . PHE B 1 47  ? 21.906  0.261   -55.657 1.00 53.70  ? 47   PHE B O   1 
ATOM   4547 C CB  . PHE B 1 47  ? 22.365  -2.633  -55.532 1.00 54.27  ? 47   PHE B CB  1 
ATOM   4548 C CG  . PHE B 1 47  ? 22.282  -4.051  -55.099 1.00 53.11  ? 47   PHE B CG  1 
ATOM   4549 C CD1 . PHE B 1 47  ? 21.563  -4.412  -53.968 1.00 52.10  ? 47   PHE B CD1 1 
ATOM   4550 C CD2 . PHE B 1 47  ? 22.942  -5.033  -55.805 1.00 53.58  ? 47   PHE B CD2 1 
ATOM   4551 C CE1 . PHE B 1 47  ? 21.481  -5.738  -53.566 1.00 50.49  ? 47   PHE B CE1 1 
ATOM   4552 C CE2 . PHE B 1 47  ? 22.876  -6.344  -55.403 1.00 53.48  ? 47   PHE B CE2 1 
ATOM   4553 C CZ  . PHE B 1 47  ? 22.131  -6.693  -54.278 1.00 52.24  ? 47   PHE B CZ  1 
ATOM   4554 N N   . MET B 1 48  ? 20.608  -0.220  -57.425 1.00 54.27  ? 48   MET B N   1 
ATOM   4555 C CA  . MET B 1 48  ? 20.873  1.061   -58.071 1.00 55.80  ? 48   MET B CA  1 
ATOM   4556 C C   . MET B 1 48  ? 19.802  2.097   -57.799 1.00 54.56  ? 48   MET B C   1 
ATOM   4557 O O   . MET B 1 48  ? 18.665  1.753   -57.443 1.00 53.80  ? 48   MET B O   1 
ATOM   4558 C CB  . MET B 1 48  ? 21.045  0.894   -59.573 1.00 57.50  ? 48   MET B CB  1 
ATOM   4559 C CG  . MET B 1 48  ? 22.137  -0.063  -59.967 1.00 62.35  ? 48   MET B CG  1 
ATOM   4560 S SD  . MET B 1 48  ? 22.956  0.486   -61.465 1.00 71.50  ? 48   MET B SD  1 
ATOM   4561 C CE  . MET B 1 48  ? 23.892  1.877   -60.785 1.00 68.69  ? 48   MET B CE  1 
ATOM   4562 N N   . PRO B 1 49  ? 20.156  3.382   -57.944 1.00 54.89  ? 49   PRO B N   1 
ATOM   4563 C CA  . PRO B 1 49  ? 19.127  4.414   -57.824 1.00 53.87  ? 49   PRO B CA  1 
ATOM   4564 C C   . PRO B 1 49  ? 17.939  4.149   -58.778 1.00 53.88  ? 49   PRO B C   1 
ATOM   4565 O O   . PRO B 1 49  ? 18.110  3.497   -59.806 1.00 54.55  ? 49   PRO B O   1 
ATOM   4566 C CB  . PRO B 1 49  ? 19.870  5.688   -58.232 1.00 54.65  ? 49   PRO B CB  1 
ATOM   4567 C CG  . PRO B 1 49  ? 21.280  5.430   -57.848 1.00 55.82  ? 49   PRO B CG  1 
ATOM   4568 C CD  . PRO B 1 49  ? 21.513  3.951   -58.032 1.00 55.95  ? 49   PRO B CD  1 
ATOM   4569 N N   . PRO B 1 50  ? 16.737  4.633   -58.426 1.00 52.83  ? 50   PRO B N   1 
ATOM   4570 C CA  . PRO B 1 50  ? 15.634  4.494   -59.331 1.00 52.94  ? 50   PRO B CA  1 
ATOM   4571 C C   . PRO B 1 50  ? 15.783  5.427   -60.515 1.00 54.83  ? 50   PRO B C   1 
ATOM   4572 O O   . PRO B 1 50  ? 16.220  6.570   -60.346 1.00 55.20  ? 50   PRO B O   1 
ATOM   4573 C CB  . PRO B 1 50  ? 14.442  4.945   -58.489 1.00 51.63  ? 50   PRO B CB  1 
ATOM   4574 C CG  . PRO B 1 50  ? 15.001  5.808   -57.470 1.00 50.86  ? 50   PRO B CG  1 
ATOM   4575 C CD  . PRO B 1 50  ? 16.318  5.229   -57.148 1.00 51.51  ? 50   PRO B CD  1 
ATOM   4576 N N   . GLU B 1 51  ? 15.431  4.925   -61.700 1.00 56.14  ? 51   GLU B N   1 
ATOM   4577 C CA  . GLU B 1 51  ? 15.259  5.753   -62.876 1.00 58.03  ? 51   GLU B CA  1 
ATOM   4578 C C   . GLU B 1 51  ? 13.763  6.076   -63.017 1.00 56.73  ? 51   GLU B C   1 
ATOM   4579 O O   . GLU B 1 51  ? 12.928  5.273   -62.620 1.00 56.27  ? 51   GLU B O   1 
ATOM   4580 C CB  . GLU B 1 51  ? 15.786  5.013   -64.115 1.00 60.10  ? 51   GLU B CB  1 
ATOM   4581 C CG  . GLU B 1 51  ? 17.327  4.855   -64.193 1.00 65.70  ? 51   GLU B CG  1 
ATOM   4582 C CD  . GLU B 1 51  ? 18.080  6.201   -64.255 1.00 73.07  ? 51   GLU B CD  1 
ATOM   4583 O OE1 . GLU B 1 51  ? 17.549  7.177   -64.850 1.00 76.28  ? 51   GLU B OE1 1 
ATOM   4584 O OE2 . GLU B 1 51  ? 19.208  6.288   -63.707 1.00 74.82  ? 51   GLU B OE2 1 
ATOM   4585 N N   . PRO B 1 52  ? 13.411  7.252   -63.562 1.00 56.91  ? 52   PRO B N   1 
ATOM   4586 C CA  . PRO B 1 52  ? 11.976  7.559   -63.748 1.00 56.53  ? 52   PRO B CA  1 
ATOM   4587 C C   . PRO B 1 52  ? 11.244  6.598   -64.702 1.00 56.90  ? 52   PRO B C   1 
ATOM   4588 O O   . PRO B 1 52  ? 11.838  6.091   -65.662 1.00 57.60  ? 52   PRO B O   1 
ATOM   4589 C CB  . PRO B 1 52  ? 11.977  8.983   -64.332 1.00 57.54  ? 52   PRO B CB  1 
ATOM   4590 C CG  . PRO B 1 52  ? 13.340  9.545   -64.032 1.00 57.98  ? 52   PRO B CG  1 
ATOM   4591 C CD  . PRO B 1 52  ? 14.286  8.396   -63.886 1.00 58.09  ? 52   PRO B CD  1 
ATOM   4592 N N   . LYS B 1 53  ? 9.958   6.371   -64.438 1.00 56.12  ? 53   LYS B N   1 
ATOM   4593 C CA  . LYS B 1 53  ? 9.136   5.513   -65.286 1.00 56.36  ? 53   LYS B CA  1 
ATOM   4594 C C   . LYS B 1 53  ? 9.029   6.093   -66.683 1.00 57.92  ? 53   LYS B C   1 
ATOM   4595 O O   . LYS B 1 53  ? 8.662   7.264   -66.852 1.00 58.12  ? 53   LYS B O   1 
ATOM   4596 C CB  . LYS B 1 53  ? 7.722   5.347   -64.706 1.00 55.52  ? 53   LYS B CB  1 
ATOM   4597 C CG  . LYS B 1 53  ? 6.760   4.482   -65.559 1.00 55.48  ? 53   LYS B CG  1 
ATOM   4598 C CD  . LYS B 1 53  ? 7.243   3.030   -65.648 1.00 55.43  ? 53   LYS B CD  1 
ATOM   4599 C CE  . LYS B 1 53  ? 6.214   2.107   -66.301 1.00 55.21  ? 53   LYS B CE  1 
ATOM   4600 N NZ  . LYS B 1 53  ? 6.240   2.174   -67.789 1.00 53.27  ? 53   LYS B NZ  1 
ATOM   4601 N N   . ARG B 1 54  ? 9.344   5.268   -67.684 1.00 58.87  ? 54   ARG B N   1 
ATOM   4602 C CA  . ARG B 1 54  ? 9.105   5.636   -69.078 1.00 60.14  ? 54   ARG B CA  1 
ATOM   4603 C C   . ARG B 1 54  ? 7.606   5.780   -69.320 1.00 59.89  ? 54   ARG B C   1 
ATOM   4604 O O   . ARG B 1 54  ? 6.810   5.022   -68.755 1.00 58.84  ? 54   ARG B O   1 
ATOM   4605 C CB  . ARG B 1 54  ? 9.676   4.589   -70.039 1.00 61.21  ? 54   ARG B CB  1 
ATOM   4606 C CG  . ARG B 1 54  ? 11.199  4.509   -70.079 1.00 62.12  ? 54   ARG B CG  1 
ATOM   4607 C CD  . ARG B 1 54  ? 11.670  3.273   -70.832 1.00 64.50  ? 54   ARG B CD  1 
ATOM   4608 N NE  . ARG B 1 54  ? 10.984  2.064   -70.376 1.00 64.65  ? 54   ARG B NE  1 
ATOM   4609 C CZ  . ARG B 1 54  ? 10.204  1.297   -71.133 1.00 65.95  ? 54   ARG B CZ  1 
ATOM   4610 N NH1 . ARG B 1 54  ? 9.629   0.235   -70.606 1.00 65.73  ? 54   ARG B NH1 1 
ATOM   4611 N NH2 . ARG B 1 54  ? 10.000  1.578   -72.407 1.00 66.42  ? 54   ARG B NH2 1 
ATOM   4612 N N   . PRO B 1 55  ? 7.225   6.755   -70.165 1.00 60.68  ? 55   PRO B N   1 
ATOM   4613 C CA  . PRO B 1 55  ? 5.871   6.974   -70.654 1.00 60.78  ? 55   PRO B CA  1 
ATOM   4614 C C   . PRO B 1 55  ? 5.245   5.694   -71.181 1.00 60.67  ? 55   PRO B C   1 
ATOM   4615 O O   . PRO B 1 55  ? 5.949   4.819   -71.663 1.00 61.06  ? 55   PRO B O   1 
ATOM   4616 C CB  . PRO B 1 55  ? 6.091   7.931   -71.818 1.00 62.37  ? 55   PRO B CB  1 
ATOM   4617 C CG  . PRO B 1 55  ? 7.255   8.723   -71.412 1.00 62.71  ? 55   PRO B CG  1 
ATOM   4618 C CD  . PRO B 1 55  ? 8.159   7.741   -70.739 1.00 61.93  ? 55   PRO B CD  1 
ATOM   4619 N N   . TRP B 1 56  ? 3.925   5.596   -71.092 1.00 60.20  ? 56   TRP B N   1 
ATOM   4620 C CA  . TRP B 1 56  ? 3.212   4.426   -71.567 1.00 59.82  ? 56   TRP B CA  1 
ATOM   4621 C C   . TRP B 1 56  ? 2.089   4.783   -72.555 1.00 61.06  ? 56   TRP B C   1 
ATOM   4622 O O   . TRP B 1 56  ? 1.637   5.936   -72.630 1.00 61.47  ? 56   TRP B O   1 
ATOM   4623 C CB  . TRP B 1 56  ? 2.674   3.641   -70.377 1.00 58.41  ? 56   TRP B CB  1 
ATOM   4624 C CG  . TRP B 1 56  ? 1.758   4.417   -69.512 1.00 58.53  ? 56   TRP B CG  1 
ATOM   4625 C CD1 . TRP B 1 56  ? 0.412   4.595   -69.690 1.00 60.02  ? 56   TRP B CD1 1 
ATOM   4626 C CD2 . TRP B 1 56  ? 2.100   5.131   -68.309 1.00 57.77  ? 56   TRP B CD2 1 
ATOM   4627 N NE1 . TRP B 1 56  ? -0.102  5.386   -68.679 1.00 58.87  ? 56   TRP B NE1 1 
ATOM   4628 C CE2 . TRP B 1 56  ? 0.913   5.721   -67.818 1.00 57.35  ? 56   TRP B CE2 1 
ATOM   4629 C CE3 . TRP B 1 56  ? 3.291   5.328   -67.601 1.00 55.76  ? 56   TRP B CE3 1 
ATOM   4630 C CZ2 . TRP B 1 56  ? 0.889   6.481   -66.648 1.00 55.36  ? 56   TRP B CZ2 1 
ATOM   4631 C CZ3 . TRP B 1 56  ? 3.262   6.098   -66.463 1.00 53.95  ? 56   TRP B CZ3 1 
ATOM   4632 C CH2 . TRP B 1 56  ? 2.069   6.657   -65.989 1.00 53.54  ? 56   TRP B CH2 1 
ATOM   4633 N N   . SER B 1 57  ? 1.660   3.779   -73.314 1.00 61.42  ? 57   SER B N   1 
ATOM   4634 C CA  . SER B 1 57  ? 0.604   3.915   -74.298 1.00 62.31  ? 57   SER B CA  1 
ATOM   4635 C C   . SER B 1 57  ? -0.758  3.669   -73.655 1.00 62.04  ? 57   SER B C   1 
ATOM   4636 O O   . SER B 1 57  ? -0.856  2.948   -72.642 1.00 60.60  ? 57   SER B O   1 
ATOM   4637 C CB  . SER B 1 57  ? 0.821   2.909   -75.440 1.00 63.79  ? 57   SER B CB  1 
ATOM   4638 O OG  . SER B 1 57  ? 0.319   1.611   -75.121 1.00 62.11  ? 57   SER B OG  1 
ATOM   4639 N N   . GLY B 1 58  ? -1.797  4.264   -74.250 1.00 62.75  ? 58   GLY B N   1 
ATOM   4640 C CA  . GLY B 1 58  ? -3.184  3.974   -73.894 1.00 63.28  ? 58   GLY B CA  1 
ATOM   4641 C C   . GLY B 1 58  ? -3.521  4.277   -72.449 1.00 62.09  ? 58   GLY B C   1 
ATOM   4642 O O   . GLY B 1 58  ? -2.880  5.117   -71.821 1.00 60.98  ? 58   GLY B O   1 
ATOM   4643 N N   . VAL B 1 59  ? -4.522  3.583   -71.914 1.00 62.61  ? 59   VAL B N   1 
ATOM   4644 C CA  . VAL B 1 59  ? -4.938  3.790   -70.522 1.00 61.76  ? 59   VAL B CA  1 
ATOM   4645 C C   . VAL B 1 59  ? -4.442  2.700   -69.578 1.00 60.91  ? 59   VAL B C   1 
ATOM   4646 O O   . VAL B 1 59  ? -4.877  1.541   -69.661 1.00 61.06  ? 59   VAL B O   1 
ATOM   4647 C CB  . VAL B 1 59  ? -6.471  3.911   -70.376 1.00 63.01  ? 59   VAL B CB  1 
ATOM   4648 C CG1 . VAL B 1 59  ? -6.834  4.371   -68.954 1.00 61.79  ? 59   VAL B CG1 1 
ATOM   4649 C CG2 . VAL B 1 59  ? -7.050  4.875   -71.410 1.00 64.65  ? 59   VAL B CG2 1 
ATOM   4650 N N   . LEU B 1 60  ? -3.547  3.106   -68.672 1.00 60.26  ? 60   LEU B N   1 
ATOM   4651 C CA  . LEU B 1 60  ? -2.992  2.249   -67.607 1.00 59.49  ? 60   LEU B CA  1 
ATOM   4652 C C   . LEU B 1 60  ? -3.971  1.976   -66.450 1.00 59.62  ? 60   LEU B C   1 
ATOM   4653 O O   . LEU B 1 60  ? -4.489  2.890   -65.814 1.00 59.27  ? 60   LEU B O   1 
ATOM   4654 C CB  . LEU B 1 60  ? -1.681  2.840   -67.067 1.00 57.81  ? 60   LEU B CB  1 
ATOM   4655 C CG  . LEU B 1 60  ? -0.866  1.979   -66.084 1.00 56.97  ? 60   LEU B CG  1 
ATOM   4656 C CD1 . LEU B 1 60  ? -0.471  0.591   -66.672 1.00 58.32  ? 60   LEU B CD1 1 
ATOM   4657 C CD2 . LEU B 1 60  ? 0.357   2.726   -65.641 1.00 54.05  ? 60   LEU B CD2 1 
ATOM   4658 N N   . ASP B 1 61  ? -4.193  0.698   -66.186 1.00 60.89  ? 61   ASP B N   1 
ATOM   4659 C CA  . ASP B 1 61  ? -5.114  0.243   -65.160 1.00 61.95  ? 61   ASP B CA  1 
ATOM   4660 C C   . ASP B 1 61  ? -4.568  0.464   -63.742 1.00 60.44  ? 61   ASP B C   1 
ATOM   4661 O O   . ASP B 1 61  ? -3.699  -0.276  -63.272 1.00 59.85  ? 61   ASP B O   1 
ATOM   4662 C CB  . ASP B 1 61  ? -5.422  -1.241  -65.383 1.00 63.38  ? 61   ASP B CB  1 
ATOM   4663 C CG  . ASP B 1 61  ? -6.025  -1.900  -64.159 1.00 65.55  ? 61   ASP B CG  1 
ATOM   4664 O OD1 . ASP B 1 61  ? -7.071  -1.413  -63.687 1.00 69.57  ? 61   ASP B OD1 1 
ATOM   4665 O OD2 . ASP B 1 61  ? -5.449  -2.887  -63.654 1.00 67.03  ? 61   ASP B OD2 1 
ATOM   4666 N N   . ALA B 1 62  ? -5.087  1.479   -63.060 1.00 60.12  ? 62   ALA B N   1 
ATOM   4667 C CA  . ALA B 1 62  ? -4.632  1.800   -61.705 1.00 58.44  ? 62   ALA B CA  1 
ATOM   4668 C C   . ALA B 1 62  ? -5.755  1.562   -60.685 1.00 58.68  ? 62   ALA B C   1 
ATOM   4669 O O   . ALA B 1 62  ? -6.105  2.444   -59.896 1.00 58.36  ? 62   ALA B O   1 
ATOM   4670 C CB  . ALA B 1 62  ? -4.123  3.236   -61.643 1.00 57.48  ? 62   ALA B CB  1 
ATOM   4671 N N   . THR B 1 63  ? -6.322  0.362   -60.719 1.00 59.35  ? 63   THR B N   1 
ATOM   4672 C CA  . THR B 1 63  ? -7.461  0.048   -59.883 1.00 59.89  ? 63   THR B CA  1 
ATOM   4673 C C   . THR B 1 63  ? -7.086  -0.857  -58.731 1.00 59.41  ? 63   THR B C   1 
ATOM   4674 O O   . THR B 1 63  ? -7.911  -1.062  -57.825 1.00 60.51  ? 63   THR B O   1 
ATOM   4675 C CB  . THR B 1 63  ? -8.596  -0.637  -60.677 1.00 62.13  ? 63   THR B CB  1 
ATOM   4676 O OG1 . THR B 1 63  ? -8.076  -1.784  -61.358 1.00 62.03  ? 63   THR B OG1 1 
ATOM   4677 C CG2 . THR B 1 63  ? -9.224  0.314   -61.682 1.00 62.65  ? 63   THR B CG2 1 
ATOM   4678 N N   . THR B 1 64  ? -5.876  -1.424  -58.765 1.00 58.05  ? 64   THR B N   1 
ATOM   4679 C CA  . THR B 1 64  ? -5.406  -2.258  -57.665 1.00 57.14  ? 64   THR B CA  1 
ATOM   4680 C C   . THR B 1 64  ? -3.981  -1.924  -57.240 1.00 55.44  ? 64   THR B C   1 
ATOM   4681 O O   . THR B 1 64  ? -3.174  -1.441  -58.029 1.00 54.31  ? 64   THR B O   1 
ATOM   4682 C CB  . THR B 1 64  ? -5.485  -3.777  -57.974 1.00 58.50  ? 64   THR B CB  1 
ATOM   4683 O OG1 . THR B 1 64  ? -4.560  -4.111  -59.018 1.00 59.32  ? 64   THR B OG1 1 
ATOM   4684 C CG2 . THR B 1 64  ? -6.891  -4.202  -58.401 1.00 61.16  ? 64   THR B CG2 1 
ATOM   4685 N N   . PHE B 1 65  ? -3.708  -2.173  -55.962 1.00 54.93  ? 65   PHE B N   1 
ATOM   4686 C CA  . PHE B 1 65  ? -2.367  -2.222  -55.415 1.00 53.84  ? 65   PHE B CA  1 
ATOM   4687 C C   . PHE B 1 65  ? -1.440  -3.125  -56.195 1.00 54.64  ? 65   PHE B C   1 
ATOM   4688 O O   . PHE B 1 65  ? -1.823  -4.209  -56.668 1.00 55.88  ? 65   PHE B O   1 
ATOM   4689 C CB  . PHE B 1 65  ? -2.405  -2.722  -53.974 1.00 53.34  ? 65   PHE B CB  1 
ATOM   4690 C CG  . PHE B 1 65  ? -2.974  -1.734  -53.020 1.00 52.64  ? 65   PHE B CG  1 
ATOM   4691 C CD1 . PHE B 1 65  ? -2.449  -0.438  -52.949 1.00 49.00  ? 65   PHE B CD1 1 
ATOM   4692 C CD2 . PHE B 1 65  ? -4.054  -2.090  -52.194 1.00 52.22  ? 65   PHE B CD2 1 
ATOM   4693 C CE1 . PHE B 1 65  ? -2.987  0.492   -52.074 1.00 49.31  ? 65   PHE B CE1 1 
ATOM   4694 C CE2 . PHE B 1 65  ? -4.600  -1.168  -51.308 1.00 51.41  ? 65   PHE B CE2 1 
ATOM   4695 C CZ  . PHE B 1 65  ? -4.054  0.132   -51.240 1.00 49.78  ? 65   PHE B CZ  1 
ATOM   4696 N N   . GLN B 1 66  ? -0.199  -2.678  -56.294 1.00 54.04  ? 66   GLN B N   1 
ATOM   4697 C CA  . GLN B 1 66  ? 0.788   -3.397  -57.053 1.00 54.93  ? 66   GLN B CA  1 
ATOM   4698 C C   . GLN B 1 66  ? 1.626   -4.264  -56.093 1.00 54.42  ? 66   GLN B C   1 
ATOM   4699 O O   . GLN B 1 66  ? 1.337   -4.323  -54.897 1.00 53.75  ? 66   GLN B O   1 
ATOM   4700 C CB  . GLN B 1 66  ? 1.622   -2.405  -57.859 1.00 54.34  ? 66   GLN B CB  1 
ATOM   4701 C CG  . GLN B 1 66  ? 2.424   -3.049  -58.953 1.00 57.89  ? 66   GLN B CG  1 
ATOM   4702 C CD  . GLN B 1 66  ? 1.589   -3.610  -60.057 1.00 61.67  ? 66   GLN B CD  1 
ATOM   4703 O OE1 . GLN B 1 66  ? 0.645   -2.973  -60.520 1.00 63.56  ? 66   GLN B OE1 1 
ATOM   4704 N NE2 . GLN B 1 66  ? 1.931   -4.812  -60.499 1.00 63.70  ? 66   GLN B NE2 1 
ATOM   4705 N N   . ASN B 1 67  ? 2.629   -4.969  -56.613 1.00 54.31  ? 67   ASN B N   1 
ATOM   4706 C CA  . ASN B 1 67  ? 3.407   -5.845  -55.769 1.00 53.84  ? 67   ASN B CA  1 
ATOM   4707 C C   . ASN B 1 67  ? 4.100   -5.159  -54.596 1.00 52.44  ? 67   ASN B C   1 
ATOM   4708 O O   . ASN B 1 67  ? 4.425   -3.960  -54.632 1.00 51.80  ? 67   ASN B O   1 
ATOM   4709 C CB  . ASN B 1 67  ? 4.393   -6.667  -56.602 1.00 54.98  ? 67   ASN B CB  1 
ATOM   4710 C CG  . ASN B 1 67  ? 3.688   -7.695  -57.497 1.00 56.66  ? 67   ASN B CG  1 
ATOM   4711 O OD1 . ASN B 1 67  ? 2.588   -8.149  -57.177 1.00 55.25  ? 67   ASN B OD1 1 
ATOM   4712 N ND2 . ASN B 1 67  ? 4.315   -8.043  -58.632 1.00 57.30  ? 67   ASN B ND2 1 
ATOM   4713 N N   . VAL B 1 68  ? 4.290   -5.941  -53.542 1.00 52.07  ? 68   VAL B N   1 
ATOM   4714 C CA  . VAL B 1 68  ? 5.031   -5.541  -52.370 1.00 50.57  ? 68   VAL B CA  1 
ATOM   4715 C C   . VAL B 1 68  ? 6.510   -5.787  -52.658 1.00 50.67  ? 68   VAL B C   1 
ATOM   4716 O O   . VAL B 1 68  ? 6.860   -6.852  -53.191 1.00 51.29  ? 68   VAL B O   1 
ATOM   4717 C CB  . VAL B 1 68  ? 4.554   -6.380  -51.157 1.00 51.02  ? 68   VAL B CB  1 
ATOM   4718 C CG1 . VAL B 1 68  ? 5.485   -6.267  -49.982 1.00 50.03  ? 68   VAL B CG1 1 
ATOM   4719 C CG2 . VAL B 1 68  ? 3.130   -5.992  -50.762 1.00 50.28  ? 68   VAL B CG2 1 
ATOM   4720 N N   . CYS B 1 69  ? 7.361   -4.804  -52.328 1.00 49.57  ? 69   CYS B N   1 
ATOM   4721 C CA  . CYS B 1 69  ? 8.809   -4.948  -52.472 1.00 49.89  ? 69   CYS B CA  1 
ATOM   4722 C C   . CYS B 1 69  ? 9.295   -6.154  -51.719 1.00 50.57  ? 69   CYS B C   1 
ATOM   4723 O O   . CYS B 1 69  ? 8.785   -6.464  -50.645 1.00 49.89  ? 69   CYS B O   1 
ATOM   4724 C CB  . CYS B 1 69  ? 9.549   -3.725  -51.970 1.00 48.93  ? 69   CYS B CB  1 
ATOM   4725 S SG  . CYS B 1 69  ? 9.365   -2.290  -52.998 1.00 50.99  ? 69   CYS B SG  1 
ATOM   4726 N N   . TYR B 1 70  ? 10.289  -6.828  -52.291 1.00 52.02  ? 70   TYR B N   1 
ATOM   4727 C CA  . TYR B 1 70  ? 10.697  -8.124  -51.794 1.00 53.34  ? 70   TYR B CA  1 
ATOM   4728 C C   . TYR B 1 70  ? 11.215  -8.022  -50.371 1.00 53.65  ? 70   TYR B C   1 
ATOM   4729 O O   . TYR B 1 70  ? 12.060  -7.164  -50.067 1.00 53.32  ? 70   TYR B O   1 
ATOM   4730 C CB  . TYR B 1 70  ? 11.723  -8.777  -52.708 1.00 54.34  ? 70   TYR B CB  1 
ATOM   4731 C CG  . TYR B 1 70  ? 11.595  -10.273 -52.620 1.00 55.79  ? 70   TYR B CG  1 
ATOM   4732 C CD1 . TYR B 1 70  ? 10.796  -10.969 -53.492 1.00 54.54  ? 70   TYR B CD1 1 
ATOM   4733 C CD2 . TYR B 1 70  ? 12.209  -10.966 -51.605 1.00 57.36  ? 70   TYR B CD2 1 
ATOM   4734 C CE1 . TYR B 1 70  ? 10.636  -12.305 -53.374 1.00 58.85  ? 70   TYR B CE1 1 
ATOM   4735 C CE2 . TYR B 1 70  ? 12.064  -12.313 -51.485 1.00 60.02  ? 70   TYR B CE2 1 
ATOM   4736 C CZ  . TYR B 1 70  ? 11.279  -12.984 -52.367 1.00 60.13  ? 70   TYR B CZ  1 
ATOM   4737 O OH  . TYR B 1 70  ? 11.150  -14.346 -52.225 1.00 61.71  ? 70   TYR B OH  1 
ATOM   4738 N N   . GLN B 1 71  ? 10.685  -8.871  -49.492 1.00 54.59  ? 71   GLN B N   1 
ATOM   4739 C CA  . GLN B 1 71  ? 10.933  -8.684  -48.060 1.00 54.91  ? 71   GLN B CA  1 
ATOM   4740 C C   . GLN B 1 71  ? 10.814  -9.941  -47.211 1.00 57.01  ? 71   GLN B C   1 
ATOM   4741 O O   . GLN B 1 71  ? 10.293  -10.978 -47.661 1.00 58.45  ? 71   GLN B O   1 
ATOM   4742 C CB  . GLN B 1 71  ? 10.046  -7.536  -47.524 1.00 53.68  ? 71   GLN B CB  1 
ATOM   4743 C CG  . GLN B 1 71  ? 8.598   -7.928  -47.051 1.00 53.61  ? 71   GLN B CG  1 
ATOM   4744 C CD  . GLN B 1 71  ? 7.778   -6.626  -46.880 1.00 53.99  ? 71   GLN B CD  1 
ATOM   4745 O OE1 . GLN B 1 71  ? 7.054   -6.426  -45.883 1.00 56.10  ? 71   GLN B OE1 1 
ATOM   4746 N NE2 . GLN B 1 71  ? 7.919   -5.725  -47.846 1.00 48.99  ? 71   GLN B NE2 1 
ATOM   4747 N N   . TYR B 1 72  ? 11.326  -9.859  -45.988 1.00 57.70  ? 72   TYR B N   1 
ATOM   4748 C CA  . TYR B 1 72  ? 11.207  -10.963 -45.057 1.00 59.70  ? 72   TYR B CA  1 
ATOM   4749 C C   . TYR B 1 72  ? 9.815   -10.975 -44.491 1.00 59.41  ? 72   TYR B C   1 
ATOM   4750 O O   . TYR B 1 72  ? 9.343   -9.963  -43.985 1.00 59.21  ? 72   TYR B O   1 
ATOM   4751 C CB  . TYR B 1 72  ? 12.231  -10.849 -43.933 1.00 60.47  ? 72   TYR B CB  1 
ATOM   4752 C CG  . TYR B 1 72  ? 12.115  -11.953 -42.901 1.00 63.74  ? 72   TYR B CG  1 
ATOM   4753 C CD1 . TYR B 1 72  ? 11.567  -11.690 -41.625 1.00 65.10  ? 72   TYR B CD1 1 
ATOM   4754 C CD2 . TYR B 1 72  ? 12.550  -13.255 -43.192 1.00 66.22  ? 72   TYR B CD2 1 
ATOM   4755 C CE1 . TYR B 1 72  ? 11.450  -12.699 -40.662 1.00 68.05  ? 72   TYR B CE1 1 
ATOM   4756 C CE2 . TYR B 1 72  ? 12.439  -14.282 -42.244 1.00 69.62  ? 72   TYR B CE2 1 
ATOM   4757 C CZ  . TYR B 1 72  ? 11.882  -14.000 -40.979 1.00 72.11  ? 72   TYR B CZ  1 
ATOM   4758 O OH  . TYR B 1 72  ? 11.780  -15.005 -40.023 1.00 75.56  ? 72   TYR B OH  1 
ATOM   4759 N N   . VAL B 1 73  ? 9.159   -12.123 -44.601 1.00 60.96  ? 73   VAL B N   1 
ATOM   4760 C CA  . VAL B 1 73  ? 7.799   -12.312 -44.113 1.00 61.00  ? 73   VAL B CA  1 
ATOM   4761 C C   . VAL B 1 73  ? 7.866   -12.909 -42.719 1.00 62.02  ? 73   VAL B C   1 
ATOM   4762 O O   . VAL B 1 73  ? 8.491   -13.955 -42.510 1.00 63.64  ? 73   VAL B O   1 
ATOM   4763 C CB  . VAL B 1 73  ? 6.973   -13.218 -45.070 1.00 62.12  ? 73   VAL B CB  1 
ATOM   4764 C CG1 . VAL B 1 73  ? 5.562   -13.424 -44.549 1.00 62.35  ? 73   VAL B CG1 1 
ATOM   4765 C CG2 . VAL B 1 73  ? 6.918   -12.599 -46.456 1.00 60.59  ? 73   VAL B CG2 1 
ATOM   4766 N N   . ASP B 1 74  ? 7.222   -12.225 -41.778 1.00 61.37  ? 74   ASP B N   1 
ATOM   4767 C CA  . ASP B 1 74  ? 7.263   -12.560 -40.351 1.00 62.10  ? 74   ASP B CA  1 
ATOM   4768 C C   . ASP B 1 74  ? 6.542   -13.875 -40.021 1.00 63.77  ? 74   ASP B C   1 
ATOM   4769 O O   . ASP B 1 74  ? 5.351   -14.020 -40.283 1.00 64.05  ? 74   ASP B O   1 
ATOM   4770 C CB  . ASP B 1 74  ? 6.649   -11.408 -39.561 1.00 60.69  ? 74   ASP B CB  1 
ATOM   4771 C CG  . ASP B 1 74  ? 6.827   -11.550 -38.069 1.00 62.65  ? 74   ASP B CG  1 
ATOM   4772 O OD1 . ASP B 1 74  ? 7.611   -12.419 -37.615 1.00 65.56  ? 74   ASP B OD1 1 
ATOM   4773 O OD2 . ASP B 1 74  ? 6.174   -10.771 -37.340 1.00 64.11  ? 74   ASP B OD2 1 
ATOM   4774 N N   . THR B 1 75  ? 7.260   -14.830 -39.443 1.00 65.02  ? 75   THR B N   1 
ATOM   4775 C CA  . THR B 1 75  ? 6.642   -16.129 -39.125 1.00 67.34  ? 75   THR B CA  1 
ATOM   4776 C C   . THR B 1 75  ? 6.685   -16.432 -37.623 1.00 68.93  ? 75   THR B C   1 
ATOM   4777 O O   . THR B 1 75  ? 6.798   -17.592 -37.206 1.00 70.38  ? 75   THR B O   1 
ATOM   4778 C CB  . THR B 1 75  ? 7.207   -17.301 -39.989 1.00 68.44  ? 75   THR B CB  1 
ATOM   4779 O OG1 . THR B 1 75  ? 8.622   -17.412 -39.813 1.00 67.44  ? 75   THR B OG1 1 
ATOM   4780 C CG2 . THR B 1 75  ? 6.893   -17.091 -41.483 1.00 67.03  ? 75   THR B CG2 1 
ATOM   4781 N N   . LEU B 1 76  ? 6.566   -15.366 -36.823 1.00 68.25  ? 76   LEU B N   1 
ATOM   4782 C CA  . LEU B 1 76  ? 6.671   -15.475 -35.366 1.00 69.54  ? 76   LEU B CA  1 
ATOM   4783 C C   . LEU B 1 76  ? 5.458   -16.180 -34.796 1.00 71.65  ? 76   LEU B C   1 
ATOM   4784 O O   . LEU B 1 76  ? 5.592   -17.190 -34.091 1.00 73.92  ? 76   LEU B O   1 
ATOM   4785 C CB  . LEU B 1 76  ? 6.850   -14.098 -34.709 1.00 67.60  ? 76   LEU B CB  1 
ATOM   4786 C CG  . LEU B 1 76  ? 7.121   -14.073 -33.193 1.00 67.71  ? 76   LEU B CG  1 
ATOM   4787 C CD1 . LEU B 1 76  ? 8.453   -14.721 -32.811 1.00 67.72  ? 76   LEU B CD1 1 
ATOM   4788 C CD2 . LEU B 1 76  ? 7.055   -12.657 -32.671 1.00 66.72  ? 76   LEU B CD2 1 
ATOM   4789 N N   . TYR B 1 77  ? 4.283   -15.632 -35.102 1.00 71.28  ? 77   TYR B N   1 
ATOM   4790 C CA  . TYR B 1 77  ? 3.015   -16.252 -34.744 1.00 73.21  ? 77   TYR B CA  1 
ATOM   4791 C C   . TYR B 1 77  ? 2.166   -16.406 -35.998 1.00 73.35  ? 77   TYR B C   1 
ATOM   4792 O O   . TYR B 1 77  ? 1.465   -15.473 -36.395 1.00 72.15  ? 77   TYR B O   1 
ATOM   4793 C CB  . TYR B 1 77  ? 2.262   -15.420 -33.703 1.00 72.65  ? 77   TYR B CB  1 
ATOM   4794 C CG  . TYR B 1 77  ? 3.035   -15.121 -32.438 1.00 73.06  ? 77   TYR B CG  1 
ATOM   4795 C CD1 . TYR B 1 77  ? 3.366   -16.137 -31.538 1.00 75.46  ? 77   TYR B CD1 1 
ATOM   4796 C CD2 . TYR B 1 77  ? 3.418   -13.810 -32.130 1.00 70.73  ? 77   TYR B CD2 1 
ATOM   4797 C CE1 . TYR B 1 77  ? 4.075   -15.853 -30.369 1.00 76.06  ? 77   TYR B CE1 1 
ATOM   4798 C CE2 . TYR B 1 77  ? 4.115   -13.522 -30.977 1.00 70.70  ? 77   TYR B CE2 1 
ATOM   4799 C CZ  . TYR B 1 77  ? 4.443   -14.540 -30.102 1.00 73.18  ? 77   TYR B CZ  1 
ATOM   4800 O OH  . TYR B 1 77  ? 5.137   -14.238 -28.957 1.00 74.11  ? 77   TYR B OH  1 
ATOM   4801 N N   . PRO B 1 78  ? 2.210   -17.595 -36.621 1.00 75.24  ? 78   PRO B N   1 
ATOM   4802 C CA  . PRO B 1 78  ? 1.529   -17.768 -37.913 1.00 75.23  ? 78   PRO B CA  1 
ATOM   4803 C C   . PRO B 1 78  ? -0.001  -17.556 -37.846 1.00 75.71  ? 78   PRO B C   1 
ATOM   4804 O O   . PRO B 1 78  ? -0.700  -18.205 -37.047 1.00 76.73  ? 78   PRO B O   1 
ATOM   4805 C CB  . PRO B 1 78  ? 1.898   -19.207 -38.322 1.00 77.49  ? 78   PRO B CB  1 
ATOM   4806 C CG  . PRO B 1 78  ? 3.110   -19.581 -37.438 1.00 77.72  ? 78   PRO B CG  1 
ATOM   4807 C CD  . PRO B 1 78  ? 2.847   -18.847 -36.154 1.00 77.56  ? 78   PRO B CD  1 
ATOM   4808 N N   . GLY B 1 79  ? -0.490  -16.619 -38.662 1.00 74.01  ? 79   GLY B N   1 
ATOM   4809 C CA  . GLY B 1 79  ? -1.922  -16.370 -38.783 1.00 74.71  ? 79   GLY B CA  1 
ATOM   4810 C C   . GLY B 1 79  ? -2.501  -15.575 -37.623 1.00 74.54  ? 79   GLY B C   1 
ATOM   4811 O O   . GLY B 1 79  ? -3.713  -15.334 -37.566 1.00 75.22  ? 79   GLY B O   1 
ATOM   4812 N N   . PHE B 1 80  ? -1.640  -15.174 -36.690 1.00 73.39  ? 80   PHE B N   1 
ATOM   4813 C CA  . PHE B 1 80  ? -2.050  -14.297 -35.612 1.00 72.96  ? 80   PHE B CA  1 
ATOM   4814 C C   . PHE B 1 80  ? -2.228  -12.870 -36.166 1.00 70.85  ? 80   PHE B C   1 
ATOM   4815 O O   . PHE B 1 80  ? -1.285  -12.282 -36.703 1.00 68.67  ? 80   PHE B O   1 
ATOM   4816 C CB  . PHE B 1 80  ? -1.025  -14.350 -34.469 1.00 72.75  ? 80   PHE B CB  1 
ATOM   4817 C CG  . PHE B 1 80  ? -1.165  -13.231 -33.462 1.00 71.80  ? 80   PHE B CG  1 
ATOM   4818 C CD1 . PHE B 1 80  ? -2.288  -13.144 -32.639 1.00 73.16  ? 80   PHE B CD1 1 
ATOM   4819 C CD2 . PHE B 1 80  ? -0.172  -12.276 -33.330 1.00 68.98  ? 80   PHE B CD2 1 
ATOM   4820 C CE1 . PHE B 1 80  ? -2.417  -12.114 -31.714 1.00 71.61  ? 80   PHE B CE1 1 
ATOM   4821 C CE2 . PHE B 1 80  ? -0.293  -11.259 -32.403 1.00 68.44  ? 80   PHE B CE2 1 
ATOM   4822 C CZ  . PHE B 1 80  ? -1.420  -11.173 -31.602 1.00 69.75  ? 80   PHE B CZ  1 
ATOM   4823 N N   . GLU B 1 81  ? -3.448  -12.345 -36.050 1.00 71.28  ? 81   GLU B N   1 
ATOM   4824 C CA  . GLU B 1 81  ? -3.792  -11.013 -36.544 1.00 70.25  ? 81   GLU B CA  1 
ATOM   4825 C C   . GLU B 1 81  ? -2.711  -9.975  -36.232 1.00 67.32  ? 81   GLU B C   1 
ATOM   4826 O O   . GLU B 1 81  ? -2.232  -9.289  -37.125 1.00 65.81  ? 81   GLU B O   1 
ATOM   4827 C CB  . GLU B 1 81  ? -5.144  -10.562 -35.970 1.00 72.00  ? 81   GLU B CB  1 
ATOM   4828 C CG  . GLU B 1 81  ? -5.629  -9.182  -36.443 1.00 75.00  ? 81   GLU B CG  1 
ATOM   4829 C CD  . GLU B 1 81  ? -6.400  -9.253  -37.765 1.00 81.54  ? 81   GLU B CD  1 
ATOM   4830 O OE1 . GLU B 1 81  ? -5.822  -8.903  -38.831 1.00 81.96  ? 81   GLU B OE1 1 
ATOM   4831 O OE2 . GLU B 1 81  ? -7.583  -9.681  -37.738 1.00 86.22  ? 81   GLU B OE2 1 
ATOM   4832 N N   . GLY B 1 82  ? -2.316  -9.886  -34.967 1.00 66.53  ? 82   GLY B N   1 
ATOM   4833 C CA  . GLY B 1 82  ? -1.349  -8.892  -34.530 1.00 63.87  ? 82   GLY B CA  1 
ATOM   4834 C C   . GLY B 1 82  ? -0.067  -8.822  -35.332 1.00 61.85  ? 82   GLY B C   1 
ATOM   4835 O O   . GLY B 1 82  ? 0.520   -7.744  -35.478 1.00 60.09  ? 82   GLY B O   1 
ATOM   4836 N N   . THR B 1 83  ? 0.380   -9.968  -35.838 1.00 62.37  ? 83   THR B N   1 
ATOM   4837 C CA  . THR B 1 83  ? 1.572   -10.004 -36.681 1.00 60.90  ? 83   THR B CA  1 
ATOM   4838 C C   . THR B 1 83  ? 1.260   -9.982  -38.167 1.00 60.66  ? 83   THR B C   1 
ATOM   4839 O O   . THR B 1 83  ? 1.975   -9.332  -38.933 1.00 59.95  ? 83   THR B O   1 
ATOM   4840 C CB  . THR B 1 83  ? 2.564   -11.149 -36.348 1.00 62.13  ? 83   THR B CB  1 
ATOM   4841 O OG1 . THR B 1 83  ? 1.895   -12.426 -36.279 1.00 62.82  ? 83   THR B OG1 1 
ATOM   4842 C CG2 . THR B 1 83  ? 3.295   -10.839 -35.057 1.00 61.38  ? 83   THR B CG2 1 
ATOM   4843 N N   . GLU B 1 84  ? 0.196   -10.660 -38.576 1.00 61.78  ? 84   GLU B N   1 
ATOM   4844 C CA  . GLU B 1 84  ? -0.077  -10.815 -40.004 1.00 61.92  ? 84   GLU B CA  1 
ATOM   4845 C C   . GLU B 1 84  ? -0.453  -9.502  -40.646 1.00 60.04  ? 84   GLU B C   1 
ATOM   4846 O O   . GLU B 1 84  ? -0.220  -9.306  -41.841 1.00 59.84  ? 84   GLU B O   1 
ATOM   4847 C CB  . GLU B 1 84  ? -1.142  -11.881 -40.277 1.00 63.95  ? 84   GLU B CB  1 
ATOM   4848 C CG  . GLU B 1 84  ? -0.706  -13.285 -39.910 1.00 67.22  ? 84   GLU B CG  1 
ATOM   4849 C CD  . GLU B 1 84  ? 0.388   -13.856 -40.819 1.00 69.99  ? 84   GLU B CD  1 
ATOM   4850 O OE1 . GLU B 1 84  ? 0.741   -13.183 -41.814 1.00 69.42  ? 84   GLU B OE1 1 
ATOM   4851 O OE2 . GLU B 1 84  ? 0.884   -14.987 -40.547 1.00 71.24  ? 84   GLU B OE2 1 
ATOM   4852 N N   . MET B 1 85  ? -0.980  -8.584  -39.835 1.00 58.85  ? 85   MET B N   1 
ATOM   4853 C CA  . MET B 1 85  ? -1.506  -7.319  -40.332 1.00 56.80  ? 85   MET B CA  1 
ATOM   4854 C C   . MET B 1 85  ? -0.362  -6.454  -40.810 1.00 54.87  ? 85   MET B C   1 
ATOM   4855 O O   . MET B 1 85  ? -0.571  -5.392  -41.407 1.00 53.81  ? 85   MET B O   1 
ATOM   4856 C CB  . MET B 1 85  ? -2.297  -6.604  -39.240 1.00 56.94  ? 85   MET B CB  1 
ATOM   4857 C CG  . MET B 1 85  ? -1.451  -6.249  -38.038 1.00 56.81  ? 85   MET B CG  1 
ATOM   4858 S SD  . MET B 1 85  ? -2.224  -5.128  -36.887 1.00 56.74  ? 85   MET B SD  1 
ATOM   4859 C CE  . MET B 1 85  ? -2.219  -3.593  -37.798 1.00 54.75  ? 85   MET B CE  1 
ATOM   4860 N N   . TRP B 1 86  ? 0.856   -6.904  -40.533 1.00 54.12  ? 86   TRP B N   1 
ATOM   4861 C CA  . TRP B 1 86  ? 2.033   -6.171  -40.982 1.00 52.69  ? 86   TRP B CA  1 
ATOM   4862 C C   . TRP B 1 86  ? 2.708   -6.845  -42.182 1.00 52.92  ? 86   TRP B C   1 
ATOM   4863 O O   . TRP B 1 86  ? 3.424   -6.172  -42.936 1.00 51.53  ? 86   TRP B O   1 
ATOM   4864 C CB  . TRP B 1 86  ? 3.023   -5.954  -39.829 1.00 52.17  ? 86   TRP B CB  1 
ATOM   4865 C CG  . TRP B 1 86  ? 2.434   -5.249  -38.611 1.00 51.43  ? 86   TRP B CG  1 
ATOM   4866 C CD1 . TRP B 1 86  ? 2.156   -5.810  -37.395 1.00 52.38  ? 86   TRP B CD1 1 
ATOM   4867 C CD2 . TRP B 1 86  ? 2.060   -3.873  -38.507 1.00 48.62  ? 86   TRP B CD2 1 
ATOM   4868 N NE1 . TRP B 1 86  ? 1.646   -4.861  -36.538 1.00 50.06  ? 86   TRP B NE1 1 
ATOM   4869 C CE2 . TRP B 1 86  ? 1.580   -3.664  -37.193 1.00 49.15  ? 86   TRP B CE2 1 
ATOM   4870 C CE3 . TRP B 1 86  ? 2.094   -2.788  -39.390 1.00 47.27  ? 86   TRP B CE3 1 
ATOM   4871 C CZ2 . TRP B 1 86  ? 1.127   -2.403  -36.739 1.00 47.97  ? 86   TRP B CZ2 1 
ATOM   4872 C CZ3 . TRP B 1 86  ? 1.641   -1.533  -38.935 1.00 45.41  ? 86   TRP B CZ3 1 
ATOM   4873 C CH2 . TRP B 1 86  ? 1.163   -1.361  -37.626 1.00 45.15  ? 86   TRP B CH2 1 
ATOM   4874 N N   . ASN B 1 87  ? 2.456   -8.155  -42.345 1.00 53.98  ? 87   ASN B N   1 
ATOM   4875 C CA  . ASN B 1 87  ? 2.995   -8.964  -43.429 1.00 54.50  ? 87   ASN B CA  1 
ATOM   4876 C C   . ASN B 1 87  ? 2.479   -8.533  -44.806 1.00 54.28  ? 87   ASN B C   1 
ATOM   4877 O O   . ASN B 1 87  ? 1.422   -7.907  -44.891 1.00 54.21  ? 87   ASN B O   1 
ATOM   4878 C CB  . ASN B 1 87  ? 2.652   -10.444 -43.201 1.00 56.35  ? 87   ASN B CB  1 
ATOM   4879 C CG  . ASN B 1 87  ? 3.656   -11.150 -42.299 1.00 57.36  ? 87   ASN B CG  1 
ATOM   4880 O OD1 . ASN B 1 87  ? 4.856   -10.843 -42.299 1.00 56.50  ? 87   ASN B OD1 1 
ATOM   4881 N ND2 . ASN B 1 87  ? 3.166   -12.097 -41.519 1.00 57.03  ? 87   ASN B ND2 1 
ATOM   4882 N N   . PRO B 1 88  ? 3.216   -8.883  -45.892 1.00 54.28  ? 88   PRO B N   1 
ATOM   4883 C CA  . PRO B 1 88  ? 2.796   -8.522  -47.248 1.00 54.00  ? 88   PRO B CA  1 
ATOM   4884 C C   . PRO B 1 88  ? 1.398   -9.030  -47.598 1.00 55.16  ? 88   PRO B C   1 
ATOM   4885 O O   . PRO B 1 88  ? 1.119   -10.223 -47.445 1.00 56.83  ? 88   PRO B O   1 
ATOM   4886 C CB  . PRO B 1 88  ? 3.844   -9.208  -48.129 1.00 54.01  ? 88   PRO B CB  1 
ATOM   4887 C CG  . PRO B 1 88  ? 5.024   -9.305  -47.281 1.00 53.37  ? 88   PRO B CG  1 
ATOM   4888 C CD  . PRO B 1 88  ? 4.525   -9.570  -45.910 1.00 54.31  ? 88   PRO B CD  1 
ATOM   4889 N N   . ASN B 1 89  ? 0.539   -8.115  -48.050 1.00 54.50  ? 89   ASN B N   1 
ATOM   4890 C CA  . ASN B 1 89  ? -0.795  -8.457  -48.512 1.00 55.26  ? 89   ASN B CA  1 
ATOM   4891 C C   . ASN B 1 89  ? -0.917  -8.441  -50.025 1.00 55.80  ? 89   ASN B C   1 
ATOM   4892 O O   . ASN B 1 89  ? -2.012  -8.551  -50.559 1.00 57.53  ? 89   ASN B O   1 
ATOM   4893 C CB  . ASN B 1 89  ? -1.884  -7.596  -47.852 1.00 54.95  ? 89   ASN B CB  1 
ATOM   4894 C CG  . ASN B 1 89  ? -1.873  -6.133  -48.308 1.00 53.62  ? 89   ASN B CG  1 
ATOM   4895 O OD1 . ASN B 1 89  ? -0.897  -5.623  -48.878 1.00 53.24  ? 89   ASN B OD1 1 
ATOM   4896 N ND2 . ASN B 1 89  ? -2.968  -5.446  -48.028 1.00 51.75  ? 89   ASN B ND2 1 
ATOM   4897 N N   . ARG B 1 90  ? 0.196   -8.301  -50.725 1.00 55.01  ? 90   ARG B N   1 
ATOM   4898 C CA  . ARG B 1 90  ? 0.203   -8.666  -52.134 1.00 56.10  ? 90   ARG B CA  1 
ATOM   4899 C C   . ARG B 1 90  ? 1.405   -9.563  -52.471 1.00 56.84  ? 90   ARG B C   1 
ATOM   4900 O O   . ARG B 1 90  ? 2.253   -9.842  -51.620 1.00 56.95  ? 90   ARG B O   1 
ATOM   4901 C CB  . ARG B 1 90  ? 0.110   -7.444  -53.051 1.00 55.22  ? 90   ARG B CB  1 
ATOM   4902 C CG  . ARG B 1 90  ? -1.206  -6.638  -52.959 1.00 56.10  ? 90   ARG B CG  1 
ATOM   4903 C CD  . ARG B 1 90  ? -2.449  -7.442  -53.431 1.00 59.69  ? 90   ARG B CD  1 
ATOM   4904 N NE  . ARG B 1 90  ? -3.635  -6.582  -53.511 1.00 62.19  ? 90   ARG B NE  1 
ATOM   4905 C CZ  . ARG B 1 90  ? -4.434  -6.265  -52.485 1.00 62.87  ? 90   ARG B CZ  1 
ATOM   4906 N NH1 . ARG B 1 90  ? -4.226  -6.744  -51.268 1.00 62.59  ? 90   ARG B NH1 1 
ATOM   4907 N NH2 . ARG B 1 90  ? -5.455  -5.455  -52.679 1.00 62.77  ? 90   ARG B NH2 1 
ATOM   4908 N N   . GLU B 1 91  ? 1.439   -10.053 -53.702 1.00 57.91  ? 91   GLU B N   1 
ATOM   4909 C CA  . GLU B 1 91  ? 2.568   -10.802 -54.215 1.00 58.45  ? 91   GLU B CA  1 
ATOM   4910 C C   . GLU B 1 91  ? 3.860   -9.989  -53.998 1.00 56.83  ? 91   GLU B C   1 
ATOM   4911 O O   . GLU B 1 91  ? 3.865   -8.737  -54.100 1.00 55.20  ? 91   GLU B O   1 
ATOM   4912 C CB  . GLU B 1 91  ? 2.326   -11.092 -55.698 1.00 59.82  ? 91   GLU B CB  1 
ATOM   4913 C CG  . GLU B 1 91  ? 2.735   -12.478 -56.180 1.00 64.26  ? 91   GLU B CG  1 
ATOM   4914 C CD  . GLU B 1 91  ? 1.913   -13.611 -55.554 1.00 68.65  ? 91   GLU B CD  1 
ATOM   4915 O OE1 . GLU B 1 91  ? 1.537   -13.532 -54.355 1.00 67.13  ? 91   GLU B OE1 1 
ATOM   4916 O OE2 . GLU B 1 91  ? 1.657   -14.609 -56.275 1.00 73.17  ? 91   GLU B OE2 1 
ATOM   4917 N N   . LEU B 1 92  ? 4.928   -10.701 -53.640 1.00 56.46  ? 92   LEU B N   1 
ATOM   4918 C CA  . LEU B 1 92  ? 6.247   -10.097 -53.469 1.00 54.63  ? 92   LEU B CA  1 
ATOM   4919 C C   . LEU B 1 92  ? 6.940   -10.012 -54.820 1.00 54.70  ? 92   LEU B C   1 
ATOM   4920 O O   . LEU B 1 92  ? 6.783   -10.889 -55.664 1.00 55.82  ? 92   LEU B O   1 
ATOM   4921 C CB  . LEU B 1 92  ? 7.112   -10.961 -52.545 1.00 55.28  ? 92   LEU B CB  1 
ATOM   4922 C CG  . LEU B 1 92  ? 6.894   -11.104 -51.041 1.00 53.83  ? 92   LEU B CG  1 
ATOM   4923 C CD1 . LEU B 1 92  ? 7.888   -12.122 -50.502 1.00 53.20  ? 92   LEU B CD1 1 
ATOM   4924 C CD2 . LEU B 1 92  ? 7.071   -9.762  -50.379 1.00 50.76  ? 92   LEU B CD2 1 
ATOM   4925 N N   . SER B 1 93  ? 7.741   -8.978  -55.017 1.00 53.44  ? 93   SER B N   1 
ATOM   4926 C CA  . SER B 1 93  ? 8.437   -8.814  -56.280 1.00 53.76  ? 93   SER B CA  1 
ATOM   4927 C C   . SER B 1 93  ? 9.427   -7.683  -56.173 1.00 52.65  ? 93   SER B C   1 
ATOM   4928 O O   . SER B 1 93  ? 9.146   -6.675  -55.496 1.00 51.59  ? 93   SER B O   1 
ATOM   4929 C CB  . SER B 1 93  ? 7.440   -8.491  -57.392 1.00 54.06  ? 93   SER B CB  1 
ATOM   4930 O OG  . SER B 1 93  ? 8.109   -8.034  -58.547 1.00 54.70  ? 93   SER B OG  1 
ATOM   4931 N N   . GLU B 1 94  ? 10.570  -7.831  -56.853 1.00 52.77  ? 94   GLU B N   1 
ATOM   4932 C CA  . GLU B 1 94  ? 11.546  -6.737  -56.939 1.00 51.67  ? 94   GLU B CA  1 
ATOM   4933 C C   . GLU B 1 94  ? 10.958  -5.583  -57.759 1.00 50.66  ? 94   GLU B C   1 
ATOM   4934 O O   . GLU B 1 94  ? 11.399  -4.447  -57.668 1.00 49.21  ? 94   GLU B O   1 
ATOM   4935 C CB  . GLU B 1 94  ? 12.871  -7.216  -57.530 1.00 52.71  ? 94   GLU B CB  1 
ATOM   4936 C CG  . GLU B 1 94  ? 13.742  -8.024  -56.580 1.00 53.04  ? 94   GLU B CG  1 
ATOM   4937 C CD  . GLU B 1 94  ? 15.157  -8.210  -57.108 1.00 55.39  ? 94   GLU B CD  1 
ATOM   4938 O OE1 . GLU B 1 94  ? 15.968  -7.261  -56.933 1.00 56.04  ? 94   GLU B OE1 1 
ATOM   4939 O OE2 . GLU B 1 94  ? 15.457  -9.285  -57.699 1.00 55.15  ? 94   GLU B OE2 1 
ATOM   4940 N N   . ASP B 1 95  ? 9.948   -5.908  -58.552 1.00 51.17  ? 95   ASP B N   1 
ATOM   4941 C CA  . ASP B 1 95  ? 9.222   -4.939  -59.341 1.00 51.01  ? 95   ASP B CA  1 
ATOM   4942 C C   . ASP B 1 95  ? 8.074   -4.432  -58.471 1.00 50.31  ? 95   ASP B C   1 
ATOM   4943 O O   . ASP B 1 95  ? 7.004   -5.045  -58.411 1.00 51.01  ? 95   ASP B O   1 
ATOM   4944 C CB  . ASP B 1 95  ? 8.731   -5.624  -60.614 1.00 52.09  ? 95   ASP B CB  1 
ATOM   4945 C CG  . ASP B 1 95  ? 7.930   -4.717  -61.514 1.00 52.99  ? 95   ASP B CG  1 
ATOM   4946 O OD1 . ASP B 1 95  ? 7.775   -3.508  -61.207 1.00 53.79  ? 95   ASP B OD1 1 
ATOM   4947 O OD2 . ASP B 1 95  ? 7.452   -5.234  -62.549 1.00 53.65  ? 95   ASP B OD2 1 
ATOM   4948 N N   . CYS B 1 96  ? 8.305   -3.302  -57.803 1.00 49.26  ? 96   CYS B N   1 
ATOM   4949 C CA  . CYS B 1 96  ? 7.422   -2.825  -56.747 1.00 47.95  ? 96   CYS B CA  1 
ATOM   4950 C C   . CYS B 1 96  ? 7.386   -1.292  -56.622 1.00 46.96  ? 96   CYS B C   1 
ATOM   4951 O O   . CYS B 1 96  ? 6.772   -0.743  -55.705 1.00 46.62  ? 96   CYS B O   1 
ATOM   4952 C CB  . CYS B 1 96  ? 7.866   -3.438  -55.420 1.00 47.69  ? 96   CYS B CB  1 
ATOM   4953 S SG  . CYS B 1 96  ? 9.540   -2.956  -54.933 1.00 47.83  ? 96   CYS B SG  1 
ATOM   4954 N N   . LEU B 1 97  ? 8.028   -0.585  -57.538 1.00 46.79  ? 97   LEU B N   1 
ATOM   4955 C CA  . LEU B 1 97  ? 8.087   0.865   -57.406 1.00 45.68  ? 97   LEU B CA  1 
ATOM   4956 C C   . LEU B 1 97  ? 6.799   1.524   -57.901 1.00 45.99  ? 97   LEU B C   1 
ATOM   4957 O O   . LEU B 1 97  ? 6.728   2.098   -58.984 1.00 47.25  ? 97   LEU B O   1 
ATOM   4958 C CB  . LEU B 1 97  ? 9.361   1.428   -58.031 1.00 45.41  ? 97   LEU B CB  1 
ATOM   4959 C CG  . LEU B 1 97  ? 10.643  0.889   -57.355 1.00 46.25  ? 97   LEU B CG  1 
ATOM   4960 C CD1 . LEU B 1 97  ? 11.878  1.690   -57.734 1.00 46.58  ? 97   LEU B CD1 1 
ATOM   4961 C CD2 . LEU B 1 97  ? 10.547  0.789   -55.824 1.00 44.37  ? 97   LEU B CD2 1 
ATOM   4962 N N   . TYR B 1 98  ? 5.766   1.429   -57.080 1.00 45.70  ? 98   TYR B N   1 
ATOM   4963 C CA  . TYR B 1 98  ? 4.453   1.935   -57.448 1.00 45.92  ? 98   TYR B CA  1 
ATOM   4964 C C   . TYR B 1 98  ? 3.898   2.749   -56.302 1.00 45.28  ? 98   TYR B C   1 
ATOM   4965 O O   . TYR B 1 98  ? 4.093   2.403   -55.134 1.00 45.24  ? 98   TYR B O   1 
ATOM   4966 C CB  . TYR B 1 98  ? 3.507   0.778   -57.764 1.00 46.43  ? 98   TYR B CB  1 
ATOM   4967 C CG  . TYR B 1 98  ? 4.008   -0.100  -58.891 1.00 48.09  ? 98   TYR B CG  1 
ATOM   4968 C CD1 . TYR B 1 98  ? 3.585   0.106   -60.217 1.00 48.01  ? 98   TYR B CD1 1 
ATOM   4969 C CD2 . TYR B 1 98  ? 4.927   -1.133  -58.638 1.00 47.04  ? 98   TYR B CD2 1 
ATOM   4970 C CE1 . TYR B 1 98  ? 4.069   -0.699  -61.243 1.00 48.81  ? 98   TYR B CE1 1 
ATOM   4971 C CE2 . TYR B 1 98  ? 5.412   -1.942  -59.658 1.00 47.42  ? 98   TYR B CE2 1 
ATOM   4972 C CZ  . TYR B 1 98  ? 4.983   -1.726  -60.951 1.00 48.58  ? 98   TYR B CZ  1 
ATOM   4973 O OH  . TYR B 1 98  ? 5.473   -2.535  -61.943 1.00 48.95  ? 98   TYR B OH  1 
ATOM   4974 N N   . LEU B 1 99  ? 3.207   3.832   -56.622 1.00 44.79  ? 99   LEU B N   1 
ATOM   4975 C CA  . LEU B 1 99  ? 2.553   4.604   -55.586 1.00 43.80  ? 99   LEU B CA  1 
ATOM   4976 C C   . LEU B 1 99  ? 1.026   4.573   -55.704 1.00 44.43  ? 99   LEU B C   1 
ATOM   4977 O O   . LEU B 1 99  ? 0.476   4.127   -56.710 1.00 46.14  ? 99   LEU B O   1 
ATOM   4978 C CB  . LEU B 1 99  ? 3.100   6.036   -55.562 1.00 43.29  ? 99   LEU B CB  1 
ATOM   4979 C CG  . LEU B 1 99  ? 3.106   6.895   -56.819 1.00 42.76  ? 99   LEU B CG  1 
ATOM   4980 C CD1 . LEU B 1 99  ? 1.713   7.404   -57.149 1.00 41.19  ? 99   LEU B CD1 1 
ATOM   4981 C CD2 . LEU B 1 99  ? 4.064   8.040   -56.584 1.00 40.59  ? 99   LEU B CD2 1 
ATOM   4982 N N   . ASN B 1 100 ? 0.342   5.050   -54.676 1.00 44.06  ? 100  ASN B N   1 
ATOM   4983 C CA  . ASN B 1 100 ? -1.116  5.154   -54.690 1.00 44.65  ? 100  ASN B CA  1 
ATOM   4984 C C   . ASN B 1 100 ? -1.570  6.560   -54.320 1.00 45.04  ? 100  ASN B C   1 
ATOM   4985 O O   . ASN B 1 100 ? -0.900  7.252   -53.537 1.00 44.52  ? 100  ASN B O   1 
ATOM   4986 C CB  . ASN B 1 100 ? -1.674  4.145   -53.713 1.00 44.30  ? 100  ASN B CB  1 
ATOM   4987 C CG  . ASN B 1 100 ? -0.886  2.867   -53.729 1.00 43.28  ? 100  ASN B CG  1 
ATOM   4988 O OD1 . ASN B 1 100 ? -0.912  2.147   -54.719 1.00 46.48  ? 100  ASN B OD1 1 
ATOM   4989 N ND2 . ASN B 1 100 ? -0.142  2.597   -52.666 1.00 39.94  ? 100  ASN B ND2 1 
ATOM   4990 N N   . VAL B 1 101 ? -2.688  6.990   -54.899 1.00 46.14  ? 101  VAL B N   1 
ATOM   4991 C CA  . VAL B 1 101 ? -3.290  8.281   -54.564 1.00 46.54  ? 101  VAL B CA  1 
ATOM   4992 C C   . VAL B 1 101 ? -4.751  8.048   -54.232 1.00 47.69  ? 101  VAL B C   1 
ATOM   4993 O O   . VAL B 1 101 ? -5.456  7.430   -55.023 1.00 48.94  ? 101  VAL B O   1 
ATOM   4994 C CB  . VAL B 1 101 ? -3.237  9.266   -55.756 1.00 47.09  ? 101  VAL B CB  1 
ATOM   4995 C CG1 . VAL B 1 101 ? -3.851  10.586  -55.372 1.00 47.74  ? 101  VAL B CG1 1 
ATOM   4996 C CG2 . VAL B 1 101 ? -1.822  9.480   -56.234 1.00 46.41  ? 101  VAL B CG2 1 
ATOM   4997 N N   . TRP B 1 102 ? -5.193  8.501   -53.061 1.00 47.85  ? 102  TRP B N   1 
ATOM   4998 C CA  . TRP B 1 102 ? -6.626  8.628   -52.763 1.00 49.60  ? 102  TRP B CA  1 
ATOM   4999 C C   . TRP B 1 102 ? -7.019  10.089  -52.843 1.00 51.41  ? 102  TRP B C   1 
ATOM   5000 O O   . TRP B 1 102 ? -6.356  10.962  -52.265 1.00 50.67  ? 102  TRP B O   1 
ATOM   5001 C CB  . TRP B 1 102 ? -6.959  8.130   -51.368 1.00 48.72  ? 102  TRP B CB  1 
ATOM   5002 C CG  . TRP B 1 102 ? -6.841  6.676   -51.216 1.00 48.36  ? 102  TRP B CG  1 
ATOM   5003 C CD1 . TRP B 1 102 ? -7.834  5.770   -51.358 1.00 49.66  ? 102  TRP B CD1 1 
ATOM   5004 C CD2 . TRP B 1 102 ? -5.657  5.936   -50.891 1.00 45.98  ? 102  TRP B CD2 1 
ATOM   5005 N NE1 . TRP B 1 102 ? -7.357  4.499   -51.146 1.00 49.95  ? 102  TRP B NE1 1 
ATOM   5006 C CE2 . TRP B 1 102 ? -6.020  4.571   -50.853 1.00 46.99  ? 102  TRP B CE2 1 
ATOM   5007 C CE3 . TRP B 1 102 ? -4.329  6.294   -50.628 1.00 44.52  ? 102  TRP B CE3 1 
ATOM   5008 C CZ2 . TRP B 1 102 ? -5.105  3.550   -50.555 1.00 45.28  ? 102  TRP B CZ2 1 
ATOM   5009 C CZ3 . TRP B 1 102 ? -3.414  5.284   -50.330 1.00 44.94  ? 102  TRP B CZ3 1 
ATOM   5010 C CH2 . TRP B 1 102 ? -3.810  3.924   -50.297 1.00 45.40  ? 102  TRP B CH2 1 
ATOM   5011 N N   . THR B 1 103 ? -8.096  10.361  -53.557 1.00 53.97  ? 103  THR B N   1 
ATOM   5012 C CA  . THR B 1 103 ? -8.570  11.717  -53.695 1.00 56.78  ? 103  THR B CA  1 
ATOM   5013 C C   . THR B 1 103 ? -10.085 11.729  -53.498 1.00 59.21  ? 103  THR B C   1 
ATOM   5014 O O   . THR B 1 103 ? -10.732 10.684  -53.646 1.00 60.00  ? 103  THR B O   1 
ATOM   5015 C CB  . THR B 1 103 ? -8.158  12.321  -55.066 1.00 57.70  ? 103  THR B CB  1 
ATOM   5016 O OG1 . THR B 1 103 ? -8.565  13.695  -55.136 1.00 60.13  ? 103  THR B OG1 1 
ATOM   5017 C CG2 . THR B 1 103 ? -8.806  11.555  -56.232 1.00 58.75  ? 103  THR B CG2 1 
ATOM   5018 N N   . PRO B 1 104 ? -10.650 12.890  -53.110 1.00 60.85  ? 104  PRO B N   1 
ATOM   5019 C CA  . PRO B 1 104 ? -12.098 13.038  -53.064 1.00 63.42  ? 104  PRO B CA  1 
ATOM   5020 C C   . PRO B 1 104 ? -12.811 12.741  -54.391 1.00 66.03  ? 104  PRO B C   1 
ATOM   5021 O O   . PRO B 1 104 ? -12.260 12.964  -55.479 1.00 66.55  ? 104  PRO B O   1 
ATOM   5022 C CB  . PRO B 1 104 ? -12.280 14.509  -52.699 1.00 63.86  ? 104  PRO B CB  1 
ATOM   5023 C CG  . PRO B 1 104 ? -11.119 14.821  -51.853 1.00 62.01  ? 104  PRO B CG  1 
ATOM   5024 C CD  . PRO B 1 104 ? -9.977  13.962  -52.352 1.00 60.40  ? 104  PRO B CD  1 
ATOM   5025 N N   . TYR B 1 105 ? -14.030 12.220  -54.272 1.00 68.21  ? 105  TYR B N   1 
ATOM   5026 C CA  . TYR B 1 105 ? -14.961 12.101  -55.374 1.00 70.28  ? 105  TYR B CA  1 
ATOM   5027 C C   . TYR B 1 105 ? -16.129 13.036  -55.040 1.00 73.13  ? 105  TYR B C   1 
ATOM   5028 O O   . TYR B 1 105 ? -16.783 12.879  -53.995 1.00 73.90  ? 105  TYR B O   1 
ATOM   5029 C CB  . TYR B 1 105 ? -15.437 10.655  -55.485 1.00 70.28  ? 105  TYR B CB  1 
ATOM   5030 C CG  . TYR B 1 105 ? -16.250 10.331  -56.719 1.00 71.48  ? 105  TYR B CG  1 
ATOM   5031 C CD1 . TYR B 1 105 ? -15.732 9.530   -57.730 1.00 69.29  ? 105  TYR B CD1 1 
ATOM   5032 C CD2 . TYR B 1 105 ? -17.553 10.818  -56.865 1.00 74.20  ? 105  TYR B CD2 1 
ATOM   5033 C CE1 . TYR B 1 105 ? -16.481 9.228   -58.853 1.00 71.57  ? 105  TYR B CE1 1 
ATOM   5034 C CE2 . TYR B 1 105 ? -18.314 10.524  -57.989 1.00 75.57  ? 105  TYR B CE2 1 
ATOM   5035 C CZ  . TYR B 1 105 ? -17.776 9.726   -58.975 1.00 74.68  ? 105  TYR B CZ  1 
ATOM   5036 O OH  . TYR B 1 105 ? -18.549 9.450   -60.076 1.00 76.36  ? 105  TYR B OH  1 
ATOM   5037 N N   . PRO B 1 106 ? -16.379 14.043  -55.893 1.00 75.07  ? 106  PRO B N   1 
ATOM   5038 C CA  . PRO B 1 106 ? -15.593 14.423  -57.053 1.00 75.20  ? 106  PRO B CA  1 
ATOM   5039 C C   . PRO B 1 106 ? -14.244 15.028  -56.681 1.00 73.92  ? 106  PRO B C   1 
ATOM   5040 O O   . PRO B 1 106 ? -14.041 15.451  -55.538 1.00 73.03  ? 106  PRO B O   1 
ATOM   5041 C CB  . PRO B 1 106 ? -16.465 15.496  -57.725 1.00 77.68  ? 106  PRO B CB  1 
ATOM   5042 C CG  . PRO B 1 106 ? -17.262 16.076  -56.628 1.00 78.07  ? 106  PRO B CG  1 
ATOM   5043 C CD  . PRO B 1 106 ? -17.578 14.894  -55.753 1.00 77.53  ? 106  PRO B CD  1 
ATOM   5044 N N   . ARG B 1 107 ? -13.341 15.031  -57.664 1.00 74.20  ? 107  ARG B N   1 
ATOM   5045 C CA  . ARG B 1 107 ? -12.060 15.743  -57.646 1.00 73.75  ? 107  ARG B CA  1 
ATOM   5046 C C   . ARG B 1 107 ? -12.220 17.102  -56.989 1.00 74.50  ? 107  ARG B C   1 
ATOM   5047 O O   . ARG B 1 107 ? -13.160 17.827  -57.312 1.00 76.75  ? 107  ARG B O   1 
ATOM   5048 C CB  . ARG B 1 107 ? -11.590 15.938  -59.092 1.00 74.73  ? 107  ARG B CB  1 
ATOM   5049 C CG  . ARG B 1 107 ? -10.158 16.430  -59.291 1.00 75.19  ? 107  ARG B CG  1 
ATOM   5050 C CD  . ARG B 1 107 ? -9.599  15.875  -60.594 1.00 77.92  ? 107  ARG B CD  1 
ATOM   5051 N NE  . ARG B 1 107 ? -9.657  14.408  -60.597 1.00 79.08  ? 107  ARG B NE  1 
ATOM   5052 C CZ  . ARG B 1 107 ? -9.676  13.645  -61.693 1.00 81.43  ? 107  ARG B CZ  1 
ATOM   5053 N NH1 . ARG B 1 107 ? -9.633  14.178  -62.919 1.00 82.33  ? 107  ARG B NH1 1 
ATOM   5054 N NH2 . ARG B 1 107 ? -9.746  12.329  -61.561 1.00 81.44  ? 107  ARG B NH2 1 
ATOM   5055 N N   . PRO B 1 108 ? -11.309 17.454  -56.068 1.00 73.08  ? 108  PRO B N   1 
ATOM   5056 C CA  . PRO B 1 108 ? -11.419 18.729  -55.359 1.00 73.93  ? 108  PRO B CA  1 
ATOM   5057 C C   . PRO B 1 108 ? -11.404 19.907  -56.329 1.00 75.73  ? 108  PRO B C   1 
ATOM   5058 O O   . PRO B 1 108 ? -10.619 19.906  -57.288 1.00 75.19  ? 108  PRO B O   1 
ATOM   5059 C CB  . PRO B 1 108 ? -10.173 18.746  -54.477 1.00 71.95  ? 108  PRO B CB  1 
ATOM   5060 C CG  . PRO B 1 108 ? -9.813  17.288  -54.305 1.00 70.42  ? 108  PRO B CG  1 
ATOM   5061 C CD  . PRO B 1 108 ? -10.145 16.671  -55.621 1.00 70.88  ? 108  PRO B CD  1 
ATOM   5062 N N   . ALA B 1 109 ? -12.282 20.882  -56.077 1.00 77.79  ? 109  ALA B N   1 
ATOM   5063 C CA  . ALA B 1 109 ? -12.458 22.046  -56.959 1.00 80.00  ? 109  ALA B CA  1 
ATOM   5064 C C   . ALA B 1 109 ? -11.198 22.903  -57.010 1.00 79.45  ? 109  ALA B C   1 
ATOM   5065 O O   . ALA B 1 109 ? -10.813 23.391  -58.078 1.00 80.24  ? 109  ALA B O   1 
ATOM   5066 C CB  . ALA B 1 109 ? -13.664 22.894  -56.513 1.00 82.29  ? 109  ALA B CB  1 
ATOM   5067 N N   . SER B 1 110 ? -10.568 23.073  -55.847 1.00 77.94  ? 110  SER B N   1 
ATOM   5068 C CA  . SER B 1 110 ? -9.331  23.844  -55.732 1.00 77.37  ? 110  SER B CA  1 
ATOM   5069 C C   . SER B 1 110 ? -8.181  22.987  -55.151 1.00 74.64  ? 110  SER B C   1 
ATOM   5070 O O   . SER B 1 110 ? -8.436  21.933  -54.551 1.00 73.65  ? 110  SER B O   1 
ATOM   5071 C CB  . SER B 1 110 ? -9.569  25.129  -54.919 1.00 78.62  ? 110  SER B CB  1 
ATOM   5072 O OG  . SER B 1 110 ? -10.110 24.828  -53.652 1.00 77.86  ? 110  SER B OG  1 
ATOM   5073 N N   . PRO B 1 111 ? -6.912  23.416  -55.364 1.00 73.61  ? 111  PRO B N   1 
ATOM   5074 C CA  . PRO B 1 111 ? -5.723  22.711  -54.850 1.00 70.74  ? 111  PRO B CA  1 
ATOM   5075 C C   . PRO B 1 111 ? -5.817  22.355  -53.357 1.00 68.89  ? 111  PRO B C   1 
ATOM   5076 O O   . PRO B 1 111 ? -6.001  23.241  -52.517 1.00 69.26  ? 111  PRO B O   1 
ATOM   5077 C CB  . PRO B 1 111 ? -4.601  23.727  -55.072 1.00 71.45  ? 111  PRO B CB  1 
ATOM   5078 C CG  . PRO B 1 111 ? -5.055  24.566  -56.241 1.00 73.53  ? 111  PRO B CG  1 
ATOM   5079 C CD  . PRO B 1 111 ? -6.550  24.557  -56.237 1.00 75.05  ? 111  PRO B CD  1 
ATOM   5080 N N   . THR B 1 112 ? -5.665  21.064  -53.050 1.00 66.59  ? 112  THR B N   1 
ATOM   5081 C CA  . THR B 1 112 ? -5.828  20.522  -51.694 1.00 64.82  ? 112  THR B CA  1 
ATOM   5082 C C   . THR B 1 112 ? -4.492  20.171  -51.065 1.00 62.25  ? 112  THR B C   1 
ATOM   5083 O O   . THR B 1 112 ? -3.593  19.710  -51.757 1.00 61.78  ? 112  THR B O   1 
ATOM   5084 C CB  . THR B 1 112 ? -6.650  19.226  -51.712 1.00 64.69  ? 112  THR B CB  1 
ATOM   5085 O OG1 . THR B 1 112 ? -7.604  19.286  -52.775 1.00 67.70  ? 112  THR B OG1 1 
ATOM   5086 C CG2 . THR B 1 112 ? -7.377  19.020  -50.387 1.00 64.49  ? 112  THR B CG2 1 
ATOM   5087 N N   . PRO B 1 113 ? -4.353  20.369  -49.746 1.00 60.79  ? 113  PRO B N   1 
ATOM   5088 C CA  . PRO B 1 113 ? -3.118  19.929  -49.154 1.00 58.79  ? 113  PRO B CA  1 
ATOM   5089 C C   . PRO B 1 113 ? -2.880  18.433  -49.397 1.00 56.80  ? 113  PRO B C   1 
ATOM   5090 O O   . PRO B 1 113 ? -3.822  17.639  -49.363 1.00 56.84  ? 113  PRO B O   1 
ATOM   5091 C CB  . PRO B 1 113 ? -3.335  20.239  -47.673 1.00 58.76  ? 113  PRO B CB  1 
ATOM   5092 C CG  . PRO B 1 113 ? -4.160  21.425  -47.685 1.00 60.32  ? 113  PRO B CG  1 
ATOM   5093 C CD  . PRO B 1 113 ? -5.139  21.167  -48.792 1.00 62.03  ? 113  PRO B CD  1 
ATOM   5094 N N   . VAL B 1 114 ? -1.627  18.075  -49.665 1.00 54.84  ? 114  VAL B N   1 
ATOM   5095 C CA  . VAL B 1 114 ? -1.258  16.701  -50.010 1.00 53.08  ? 114  VAL B CA  1 
ATOM   5096 C C   . VAL B 1 114 ? -0.499  16.071  -48.866 1.00 51.48  ? 114  VAL B C   1 
ATOM   5097 O O   . VAL B 1 114 ? 0.445   16.621  -48.344 1.00 51.59  ? 114  VAL B O   1 
ATOM   5098 C CB  . VAL B 1 114 ? -0.354  16.655  -51.244 1.00 52.68  ? 114  VAL B CB  1 
ATOM   5099 C CG1 . VAL B 1 114 ? -0.031  15.247  -51.594 1.00 52.22  ? 114  VAL B CG1 1 
ATOM   5100 C CG2 . VAL B 1 114 ? -1.015  17.328  -52.401 1.00 54.27  ? 114  VAL B CG2 1 
ATOM   5101 N N   . LEU B 1 115 ? -0.880  14.879  -48.500 1.00 50.85  ? 115  LEU B N   1 
ATOM   5102 C CA  . LEU B 1 115 ? -0.278  14.249  -47.358 1.00 49.82  ? 115  LEU B CA  1 
ATOM   5103 C C   . LEU B 1 115 ? 0.368   12.958  -47.894 1.00 48.32  ? 115  LEU B C   1 
ATOM   5104 O O   . LEU B 1 115 ? -0.310  12.157  -48.528 1.00 48.55  ? 115  LEU B O   1 
ATOM   5105 C CB  . LEU B 1 115 ? -1.434  14.001  -46.383 1.00 50.99  ? 115  LEU B CB  1 
ATOM   5106 C CG  . LEU B 1 115 ? -1.635  13.933  -44.862 1.00 50.99  ? 115  LEU B CG  1 
ATOM   5107 C CD1 . LEU B 1 115 ? -0.610  14.634  -44.060 1.00 50.80  ? 115  LEU B CD1 1 
ATOM   5108 C CD2 . LEU B 1 115 ? -2.967  14.572  -44.611 1.00 50.72  ? 115  LEU B CD2 1 
ATOM   5109 N N   . ILE B 1 116 ? 1.681   12.789  -47.711 1.00 46.55  ? 116  ILE B N   1 
ATOM   5110 C CA  . ILE B 1 116 ? 2.363   11.580  -48.208 1.00 45.08  ? 116  ILE B CA  1 
ATOM   5111 C C   . ILE B 1 116 ? 2.819   10.630  -47.107 1.00 43.69  ? 116  ILE B C   1 
ATOM   5112 O O   . ILE B 1 116 ? 3.623   10.993  -46.249 1.00 43.75  ? 116  ILE B O   1 
ATOM   5113 C CB  . ILE B 1 116 ? 3.581   11.903  -49.103 1.00 45.34  ? 116  ILE B CB  1 
ATOM   5114 C CG1 . ILE B 1 116 ? 3.241   12.944  -50.172 1.00 46.20  ? 116  ILE B CG1 1 
ATOM   5115 C CG2 . ILE B 1 116 ? 4.093   10.641  -49.789 1.00 44.06  ? 116  ILE B CG2 1 
ATOM   5116 C CD1 . ILE B 1 116 ? 4.397   13.209  -51.110 1.00 46.19  ? 116  ILE B CD1 1 
ATOM   5117 N N   . TRP B 1 117 ? 2.311   9.411   -47.139 1.00 42.62  ? 117  TRP B N   1 
ATOM   5118 C CA  . TRP B 1 117 ? 2.688   8.386   -46.161 1.00 41.68  ? 117  TRP B CA  1 
ATOM   5119 C C   . TRP B 1 117 ? 3.905   7.581   -46.590 1.00 40.71  ? 117  TRP B C   1 
ATOM   5120 O O   . TRP B 1 117 ? 4.008   7.175   -47.745 1.00 39.82  ? 117  TRP B O   1 
ATOM   5121 C CB  . TRP B 1 117 ? 1.528   7.424   -45.947 1.00 42.23  ? 117  TRP B CB  1 
ATOM   5122 C CG  . TRP B 1 117 ? 1.816   6.311   -45.028 1.00 42.85  ? 117  TRP B CG  1 
ATOM   5123 C CD1 . TRP B 1 117 ? 2.001   4.980   -45.354 1.00 44.30  ? 117  TRP B CD1 1 
ATOM   5124 C CD2 . TRP B 1 117 ? 1.922   6.394   -43.611 1.00 43.23  ? 117  TRP B CD2 1 
ATOM   5125 N NE1 . TRP B 1 117 ? 2.222   4.237   -44.210 1.00 44.60  ? 117  TRP B NE1 1 
ATOM   5126 C CE2 . TRP B 1 117 ? 2.172   5.078   -43.128 1.00 44.64  ? 117  TRP B CE2 1 
ATOM   5127 C CE3 . TRP B 1 117 ? 1.827   7.449   -42.693 1.00 41.61  ? 117  TRP B CE3 1 
ATOM   5128 C CZ2 . TRP B 1 117 ? 2.332   4.807   -41.769 1.00 44.77  ? 117  TRP B CZ2 1 
ATOM   5129 C CZ3 . TRP B 1 117 ? 1.981   7.183   -41.362 1.00 41.52  ? 117  TRP B CZ3 1 
ATOM   5130 C CH2 . TRP B 1 117 ? 2.249   5.880   -40.903 1.00 43.70  ? 117  TRP B CH2 1 
ATOM   5131 N N   . ILE B 1 118 ? 4.818   7.346   -45.643 1.00 40.12  ? 118  ILE B N   1 
ATOM   5132 C CA  . ILE B 1 118 ? 5.955   6.448   -45.863 1.00 38.93  ? 118  ILE B CA  1 
ATOM   5133 C C   . ILE B 1 118 ? 5.901   5.369   -44.800 1.00 39.94  ? 118  ILE B C   1 
ATOM   5134 O O   . ILE B 1 118 ? 6.149   5.659   -43.626 1.00 39.69  ? 118  ILE B O   1 
ATOM   5135 C CB  . ILE B 1 118 ? 7.309   7.168   -45.696 1.00 38.68  ? 118  ILE B CB  1 
ATOM   5136 C CG1 . ILE B 1 118 ? 7.336   8.529   -46.424 1.00 35.06  ? 118  ILE B CG1 1 
ATOM   5137 C CG2 . ILE B 1 118 ? 8.466   6.234   -46.100 1.00 37.25  ? 118  ILE B CG2 1 
ATOM   5138 C CD1 . ILE B 1 118 ? 8.680   8.980   -46.685 1.00 29.75  ? 118  ILE B CD1 1 
ATOM   5139 N N   . TYR B 1 119 ? 5.582   4.127   -45.171 1.00 40.28  ? 119  TYR B N   1 
ATOM   5140 C CA  . TYR B 1 119 ? 5.466   3.092   -44.121 1.00 40.72  ? 119  TYR B CA  1 
ATOM   5141 C C   . TYR B 1 119 ? 6.801   2.879   -43.415 1.00 40.80  ? 119  TYR B C   1 
ATOM   5142 O O   . TYR B 1 119 ? 7.849   3.276   -43.929 1.00 40.85  ? 119  TYR B O   1 
ATOM   5143 C CB  . TYR B 1 119 ? 4.925   1.756   -44.654 1.00 40.44  ? 119  TYR B CB  1 
ATOM   5144 C CG  . TYR B 1 119 ? 5.713   1.217   -45.832 1.00 40.24  ? 119  TYR B CG  1 
ATOM   5145 C CD1 . TYR B 1 119 ? 6.934   0.526   -45.638 1.00 38.53  ? 119  TYR B CD1 1 
ATOM   5146 C CD2 . TYR B 1 119 ? 5.244   1.394   -47.141 1.00 38.74  ? 119  TYR B CD2 1 
ATOM   5147 C CE1 . TYR B 1 119 ? 7.673   0.038   -46.722 1.00 37.72  ? 119  TYR B CE1 1 
ATOM   5148 C CE2 . TYR B 1 119 ? 5.972   0.924   -48.229 1.00 39.51  ? 119  TYR B CE2 1 
ATOM   5149 C CZ  . TYR B 1 119 ? 7.177   0.234   -48.015 1.00 39.03  ? 119  TYR B CZ  1 
ATOM   5150 O OH  . TYR B 1 119 ? 7.878   -0.223  -49.105 1.00 39.38  ? 119  TYR B OH  1 
ATOM   5151 N N   . GLY B 1 120 ? 6.740   2.274   -42.232 1.00 41.32  ? 120  GLY B N   1 
ATOM   5152 C CA  . GLY B 1 120 ? 7.909   1.719   -41.571 1.00 41.74  ? 120  GLY B CA  1 
ATOM   5153 C C   . GLY B 1 120 ? 7.923   0.226   -41.793 1.00 43.01  ? 120  GLY B C   1 
ATOM   5154 O O   . GLY B 1 120 ? 7.250   -0.270  -42.706 1.00 44.20  ? 120  GLY B O   1 
ATOM   5155 N N   . GLY B 1 121 ? 8.664   -0.494  -40.957 1.00 43.76  ? 121  GLY B N   1 
ATOM   5156 C CA  . GLY B 1 121 ? 8.940   -1.913  -41.170 1.00 44.94  ? 121  GLY B CA  1 
ATOM   5157 C C   . GLY B 1 121 ? 10.430  -2.187  -41.004 1.00 46.47  ? 121  GLY B C   1 
ATOM   5158 O O   . GLY B 1 121 ? 10.950  -3.192  -41.527 1.00 47.44  ? 121  GLY B O   1 
ATOM   5159 N N   . GLY B 1 122 ? 11.121  -1.297  -40.275 1.00 46.05  ? 122  GLY B N   1 
ATOM   5160 C CA  . GLY B 1 122 ? 12.552  -1.430  -39.998 1.00 46.74  ? 122  GLY B CA  1 
ATOM   5161 C C   . GLY B 1 122 ? 13.458  -1.435  -41.222 1.00 47.62  ? 122  GLY B C   1 
ATOM   5162 O O   . GLY B 1 122 ? 14.539  -2.059  -41.209 1.00 49.52  ? 122  GLY B O   1 
ATOM   5163 N N   . PHE B 1 123 ? 13.012  -0.760  -42.283 1.00 46.97  ? 123  PHE B N   1 
ATOM   5164 C CA  . PHE B 1 123 ? 13.733  -0.648  -43.566 1.00 46.45  ? 123  PHE B CA  1 
ATOM   5165 C C   . PHE B 1 123 ? 13.991  -1.995  -44.176 1.00 47.12  ? 123  PHE B C   1 
ATOM   5166 O O   . PHE B 1 123 ? 14.797  -2.101  -45.090 1.00 47.63  ? 123  PHE B O   1 
ATOM   5167 C CB  . PHE B 1 123 ? 15.069  0.103   -43.438 1.00 46.50  ? 123  PHE B CB  1 
ATOM   5168 C CG  . PHE B 1 123 ? 14.941  1.550   -43.017 1.00 45.87  ? 123  PHE B CG  1 
ATOM   5169 C CD1 . PHE B 1 123 ? 14.462  2.517   -43.900 1.00 45.09  ? 123  PHE B CD1 1 
ATOM   5170 C CD2 . PHE B 1 123 ? 15.344  1.950   -41.759 1.00 45.19  ? 123  PHE B CD2 1 
ATOM   5171 C CE1 . PHE B 1 123 ? 14.356  3.834   -43.512 1.00 43.33  ? 123  PHE B CE1 1 
ATOM   5172 C CE2 . PHE B 1 123 ? 15.258  3.278   -41.373 1.00 43.18  ? 123  PHE B CE2 1 
ATOM   5173 C CZ  . PHE B 1 123 ? 14.760  4.213   -42.242 1.00 43.59  ? 123  PHE B CZ  1 
ATOM   5174 N N   . TYR B 1 124 ? 13.316  -3.027  -43.668 1.00 47.61  ? 124  TYR B N   1 
ATOM   5175 C CA  . TYR B 1 124 ? 13.444  -4.377  -44.224 1.00 48.49  ? 124  TYR B CA  1 
ATOM   5176 C C   . TYR B 1 124 ? 12.078  -4.950  -44.616 1.00 49.04  ? 124  TYR B C   1 
ATOM   5177 O O   . TYR B 1 124 ? 12.000  -6.059  -45.189 1.00 50.67  ? 124  TYR B O   1 
ATOM   5178 C CB  . TYR B 1 124 ? 14.176  -5.307  -43.240 1.00 49.39  ? 124  TYR B CB  1 
ATOM   5179 C CG  . TYR B 1 124 ? 13.289  -5.849  -42.148 1.00 48.66  ? 124  TYR B CG  1 
ATOM   5180 C CD1 . TYR B 1 124 ? 12.580  -7.031  -42.346 1.00 49.78  ? 124  TYR B CD1 1 
ATOM   5181 C CD2 . TYR B 1 124 ? 13.135  -5.178  -40.931 1.00 47.46  ? 124  TYR B CD2 1 
ATOM   5182 C CE1 . TYR B 1 124 ? 11.744  -7.543  -41.382 1.00 49.91  ? 124  TYR B CE1 1 
ATOM   5183 C CE2 . TYR B 1 124 ? 12.295  -5.695  -39.933 1.00 48.00  ? 124  TYR B CE2 1 
ATOM   5184 C CZ  . TYR B 1 124 ? 11.597  -6.885  -40.183 1.00 49.11  ? 124  TYR B CZ  1 
ATOM   5185 O OH  . TYR B 1 124 ? 10.743  -7.447  -39.264 1.00 49.23  ? 124  TYR B OH  1 
ATOM   5186 N N   . SER B 1 125 ? 11.005  -4.217  -44.302 1.00 47.60  ? 125  SER B N   1 
ATOM   5187 C CA  . SER B 1 125 ? 9.649   -4.667  -44.634 1.00 47.55  ? 125  SER B CA  1 
ATOM   5188 C C   . SER B 1 125 ? 8.665   -3.503  -44.741 1.00 46.77  ? 125  SER B C   1 
ATOM   5189 O O   . SER B 1 125 ? 9.044   -2.350  -44.585 1.00 45.35  ? 125  SER B O   1 
ATOM   5190 C CB  . SER B 1 125 ? 9.139   -5.762  -43.682 1.00 48.10  ? 125  SER B CB  1 
ATOM   5191 O OG  . SER B 1 125 ? 9.029   -5.328  -42.333 1.00 47.76  ? 125  SER B OG  1 
ATOM   5192 N N   . GLY B 1 126 ? 7.409   -3.828  -45.045 1.00 47.27  ? 126  GLY B N   1 
ATOM   5193 C CA  . GLY B 1 126 ? 6.361   -2.836  -45.217 1.00 46.33  ? 126  GLY B CA  1 
ATOM   5194 C C   . GLY B 1 126 ? 5.876   -2.736  -46.653 1.00 46.76  ? 126  GLY B C   1 
ATOM   5195 O O   . GLY B 1 126 ? 6.462   -3.328  -47.576 1.00 47.52  ? 126  GLY B O   1 
ATOM   5196 N N   . ALA B 1 127 ? 4.812   -1.955  -46.835 1.00 46.08  ? 127  ALA B N   1 
ATOM   5197 C CA  . ALA B 1 127 ? 4.045   -1.890  -48.085 1.00 46.35  ? 127  ALA B CA  1 
ATOM   5198 C C   . ALA B 1 127 ? 2.983   -0.836  -47.888 1.00 46.00  ? 127  ALA B C   1 
ATOM   5199 O O   . ALA B 1 127 ? 2.450   -0.705  -46.783 1.00 46.09  ? 127  ALA B O   1 
ATOM   5200 C CB  . ALA B 1 127 ? 3.389   -3.251  -48.419 1.00 46.90  ? 127  ALA B CB  1 
ATOM   5201 N N   . ALA B 1 128 ? 2.684   -0.078  -48.940 1.00 45.68  ? 128  ALA B N   1 
ATOM   5202 C CA  . ALA B 1 128 ? 1.687   0.986   -48.836 1.00 45.63  ? 128  ALA B CA  1 
ATOM   5203 C C   . ALA B 1 128 ? 0.288   0.395   -48.971 1.00 46.31  ? 128  ALA B C   1 
ATOM   5204 O O   . ALA B 1 128 ? -0.713  1.096   -48.798 1.00 47.15  ? 128  ALA B O   1 
ATOM   5205 C CB  . ALA B 1 128 ? 1.928   2.088   -49.898 1.00 45.20  ? 128  ALA B CB  1 
ATOM   5206 N N   . SER B 1 129 ? 0.222   -0.904  -49.238 1.00 46.46  ? 129  SER B N   1 
ATOM   5207 C CA  . SER B 1 129 ? -1.052  -1.564  -49.527 1.00 47.36  ? 129  SER B CA  1 
ATOM   5208 C C   . SER B 1 129 ? -1.735  -2.142  -48.313 1.00 47.92  ? 129  SER B C   1 
ATOM   5209 O O   . SER B 1 129 ? -2.831  -2.664  -48.434 1.00 49.38  ? 129  SER B O   1 
ATOM   5210 C CB  . SER B 1 129 ? -0.840  -2.653  -50.559 1.00 47.54  ? 129  SER B CB  1 
ATOM   5211 O OG  . SER B 1 129 ? 0.319   -3.387  -50.248 1.00 47.38  ? 129  SER B OG  1 
ATOM   5212 N N   . LEU B 1 130 ? -1.083  -2.046  -47.154 1.00 47.74  ? 130  LEU B N   1 
ATOM   5213 C CA  . LEU B 1 130 ? -1.589  -2.581  -45.886 1.00 48.96  ? 130  LEU B CA  1 
ATOM   5214 C C   . LEU B 1 130 ? -2.859  -1.877  -45.441 1.00 50.13  ? 130  LEU B C   1 
ATOM   5215 O O   . LEU B 1 130 ? -2.981  -0.642  -45.559 1.00 49.79  ? 130  LEU B O   1 
ATOM   5216 C CB  . LEU B 1 130 ? -0.547  -2.438  -44.772 1.00 48.20  ? 130  LEU B CB  1 
ATOM   5217 C CG  . LEU B 1 130 ? 0.785   -3.214  -44.792 1.00 49.08  ? 130  LEU B CG  1 
ATOM   5218 C CD1 . LEU B 1 130 ? 1.558   -2.891  -43.510 1.00 48.87  ? 130  LEU B CD1 1 
ATOM   5219 C CD2 . LEU B 1 130 ? 0.609   -4.752  -44.960 1.00 48.20  ? 130  LEU B CD2 1 
ATOM   5220 N N   . ASP B 1 131 ? -3.797  -2.662  -44.906 1.00 51.86  ? 131  ASP B N   1 
ATOM   5221 C CA  . ASP B 1 131 ? -5.082  -2.133  -44.447 1.00 52.74  ? 131  ASP B CA  1 
ATOM   5222 C C   . ASP B 1 131 ? -4.999  -0.865  -43.581 1.00 51.90  ? 131  ASP B C   1 
ATOM   5223 O O   . ASP B 1 131 ? -5.845  0.027   -43.727 1.00 52.41  ? 131  ASP B O   1 
ATOM   5224 C CB  . ASP B 1 131 ? -5.844  -3.212  -43.703 1.00 54.37  ? 131  ASP B CB  1 
ATOM   5225 C CG  . ASP B 1 131 ? -6.465  -4.229  -44.627 1.00 57.28  ? 131  ASP B CG  1 
ATOM   5226 O OD1 . ASP B 1 131 ? -6.317  -4.122  -45.872 1.00 57.13  ? 131  ASP B OD1 1 
ATOM   5227 O OD2 . ASP B 1 131 ? -7.113  -5.149  -44.090 1.00 61.26  ? 131  ASP B OD2 1 
ATOM   5228 N N   . VAL B 1 132 ? -3.990  -0.784  -42.701 1.00 50.42  ? 132  VAL B N   1 
ATOM   5229 C CA  . VAL B 1 132 ? -3.859  0.358   -41.775 1.00 49.43  ? 132  VAL B CA  1 
ATOM   5230 C C   . VAL B 1 132 ? -3.397  1.682   -42.415 1.00 48.83  ? 132  VAL B C   1 
ATOM   5231 O O   . VAL B 1 132 ? -3.396  2.720   -41.763 1.00 47.94  ? 132  VAL B O   1 
ATOM   5232 C CB  . VAL B 1 132 ? -2.976  0.039   -40.536 1.00 48.64  ? 132  VAL B CB  1 
ATOM   5233 C CG1 . VAL B 1 132 ? -3.726  -0.839  -39.575 1.00 49.08  ? 132  VAL B CG1 1 
ATOM   5234 C CG2 . VAL B 1 132 ? -1.677  -0.616  -40.942 1.00 48.01  ? 132  VAL B CG2 1 
ATOM   5235 N N   . TYR B 1 133 ? -3.010  1.642   -43.685 1.00 48.74  ? 133  TYR B N   1 
ATOM   5236 C CA  . TYR B 1 133 ? -2.591  2.843   -44.372 1.00 47.82  ? 133  TYR B CA  1 
ATOM   5237 C C   . TYR B 1 133 ? -3.562  3.182   -45.463 1.00 48.56  ? 133  TYR B C   1 
ATOM   5238 O O   . TYR B 1 133 ? -3.157  3.667   -46.518 1.00 48.31  ? 133  TYR B O   1 
ATOM   5239 C CB  . TYR B 1 133 ? -1.228  2.659   -45.020 1.00 47.34  ? 133  TYR B CB  1 
ATOM   5240 C CG  . TYR B 1 133 ? -0.199  1.981   -44.188 1.00 47.03  ? 133  TYR B CG  1 
ATOM   5241 C CD1 . TYR B 1 133 ? -0.021  2.314   -42.852 1.00 48.10  ? 133  TYR B CD1 1 
ATOM   5242 C CD2 . TYR B 1 133 ? 0.627   1.022   -44.741 1.00 46.50  ? 133  TYR B CD2 1 
ATOM   5243 C CE1 . TYR B 1 133 ? 0.949   1.679   -42.085 1.00 47.69  ? 133  TYR B CE1 1 
ATOM   5244 C CE2 . TYR B 1 133 ? 1.599   0.402   -43.984 1.00 46.87  ? 133  TYR B CE2 1 
ATOM   5245 C CZ  . TYR B 1 133 ? 1.754   0.733   -42.658 1.00 46.20  ? 133  TYR B CZ  1 
ATOM   5246 O OH  . TYR B 1 133 ? 2.719   0.114   -41.901 1.00 48.12  ? 133  TYR B OH  1 
ATOM   5247 N N   . ASP B 1 134 ? -4.834  2.904   -45.218 1.00 49.82  ? 134  ASP B N   1 
ATOM   5248 C CA  . ASP B 1 134 ? -5.897  3.149   -46.187 1.00 51.17  ? 134  ASP B CA  1 
ATOM   5249 C C   . ASP B 1 134 ? -6.219  4.644   -46.230 1.00 51.29  ? 134  ASP B C   1 
ATOM   5250 O O   . ASP B 1 134 ? -6.673  5.223   -45.233 1.00 51.82  ? 134  ASP B O   1 
ATOM   5251 C CB  . ASP B 1 134 ? -7.121  2.318   -45.794 1.00 52.69  ? 134  ASP B CB  1 
ATOM   5252 C CG  . ASP B 1 134 ? -8.196  2.292   -46.866 1.00 55.49  ? 134  ASP B CG  1 
ATOM   5253 O OD1 . ASP B 1 134 ? -8.155  3.116   -47.801 1.00 56.16  ? 134  ASP B OD1 1 
ATOM   5254 O OD2 . ASP B 1 134 ? -9.108  1.441   -46.764 1.00 57.74  ? 134  ASP B OD2 1 
ATOM   5255 N N   . GLY B 1 135 ? -5.973  5.273   -47.382 1.00 51.20  ? 135  GLY B N   1 
ATOM   5256 C CA  . GLY B 1 135 ? -6.111  6.732   -47.525 1.00 51.09  ? 135  GLY B CA  1 
ATOM   5257 C C   . GLY B 1 135 ? -7.552  7.204   -47.665 1.00 52.45  ? 135  GLY B C   1 
ATOM   5258 O O   . GLY B 1 135 ? -7.843  8.407   -47.584 1.00 53.05  ? 135  GLY B O   1 
ATOM   5259 N N   . ARG B 1 136 ? -8.429  6.230   -47.868 1.00 52.53  ? 136  ARG B N   1 
ATOM   5260 C CA  . ARG B 1 136 ? -9.860  6.383   -48.075 1.00 54.36  ? 136  ARG B CA  1 
ATOM   5261 C C   . ARG B 1 136 ? -10.537 7.370   -47.109 1.00 54.41  ? 136  ARG B C   1 
ATOM   5262 O O   . ARG B 1 136 ? -11.214 8.306   -47.531 1.00 55.48  ? 136  ARG B O   1 
ATOM   5263 C CB  . ARG B 1 136 ? -10.460 4.966   -47.952 1.00 55.47  ? 136  ARG B CB  1 
ATOM   5264 C CG  . ARG B 1 136 ? -11.916 4.769   -48.203 1.00 58.93  ? 136  ARG B CG  1 
ATOM   5265 C CD  . ARG B 1 136 ? -12.359 3.404   -47.646 1.00 63.78  ? 136  ARG B CD  1 
ATOM   5266 N NE  . ARG B 1 136 ? -11.446 2.336   -48.057 1.00 66.56  ? 136  ARG B NE  1 
ATOM   5267 C CZ  . ARG B 1 136 ? -11.754 1.351   -48.908 1.00 69.96  ? 136  ARG B CZ  1 
ATOM   5268 N NH1 . ARG B 1 136 ? -12.969 1.268   -49.448 1.00 72.06  ? 136  ARG B NH1 1 
ATOM   5269 N NH2 . ARG B 1 136 ? -10.843 0.435   -49.224 1.00 69.52  ? 136  ARG B NH2 1 
ATOM   5270 N N   . PHE B 1 137 ? -10.337 7.159   -45.816 1.00 53.49  ? 137  PHE B N   1 
ATOM   5271 C CA  . PHE B 1 137 ? -11.016 7.927   -44.792 1.00 54.00  ? 137  PHE B CA  1 
ATOM   5272 C C   . PHE B 1 137 ? -10.557 9.390   -44.751 1.00 53.75  ? 137  PHE B C   1 
ATOM   5273 O O   . PHE B 1 137 ? -11.383 10.291  -44.651 1.00 54.53  ? 137  PHE B O   1 
ATOM   5274 C CB  . PHE B 1 137 ? -10.846 7.255   -43.431 1.00 53.37  ? 137  PHE B CB  1 
ATOM   5275 C CG  . PHE B 1 137 ? -11.195 5.813   -43.435 1.00 54.24  ? 137  PHE B CG  1 
ATOM   5276 C CD1 . PHE B 1 137 ? -12.518 5.406   -43.276 1.00 56.91  ? 137  PHE B CD1 1 
ATOM   5277 C CD2 . PHE B 1 137 ? -10.214 4.849   -43.622 1.00 53.05  ? 137  PHE B CD2 1 
ATOM   5278 C CE1 . PHE B 1 137 ? -12.862 4.046   -43.305 1.00 57.04  ? 137  PHE B CE1 1 
ATOM   5279 C CE2 . PHE B 1 137 ? -10.540 3.497   -43.654 1.00 54.71  ? 137  PHE B CE2 1 
ATOM   5280 C CZ  . PHE B 1 137 ? -11.870 3.092   -43.495 1.00 56.84  ? 137  PHE B CZ  1 
ATOM   5281 N N   . LEU B 1 138 ? -9.245  9.627   -44.824 1.00 52.79  ? 138  LEU B N   1 
ATOM   5282 C CA  . LEU B 1 138 ? -8.727  11.005  -44.830 1.00 52.59  ? 138  LEU B CA  1 
ATOM   5283 C C   . LEU B 1 138 ? -9.123  11.746  -46.098 1.00 54.02  ? 138  LEU B C   1 
ATOM   5284 O O   . LEU B 1 138 ? -9.427  12.949  -46.055 1.00 55.04  ? 138  LEU B O   1 
ATOM   5285 C CB  . LEU B 1 138 ? -7.213  11.050  -44.632 1.00 50.74  ? 138  LEU B CB  1 
ATOM   5286 C CG  . LEU B 1 138 ? -6.671  10.873  -43.216 1.00 49.00  ? 138  LEU B CG  1 
ATOM   5287 C CD1 . LEU B 1 138 ? -5.237  10.489  -43.293 1.00 47.15  ? 138  LEU B CD1 1 
ATOM   5288 C CD2 . LEU B 1 138 ? -6.816  12.127  -42.410 1.00 49.81  ? 138  LEU B CD2 1 
ATOM   5289 N N   . ALA B 1 139 ? -9.142  11.022  -47.215 1.00 54.31  ? 139  ALA B N   1 
ATOM   5290 C CA  . ALA B 1 139 ? -9.628  11.574  -48.466 1.00 55.64  ? 139  ALA B CA  1 
ATOM   5291 C C   . ALA B 1 139 ? -11.073 12.070  -48.297 1.00 58.18  ? 139  ALA B C   1 
ATOM   5292 O O   . ALA B 1 139 ? -11.350 13.278  -48.388 1.00 59.13  ? 139  ALA B O   1 
ATOM   5293 C CB  . ALA B 1 139 ? -9.539  10.543  -49.553 1.00 55.19  ? 139  ALA B CB  1 
ATOM   5294 N N   . GLN B 1 140 ? -11.972 11.133  -48.004 1.00 59.12  ? 140  GLN B N   1 
ATOM   5295 C CA  . GLN B 1 140 ? -13.387 11.410  -47.914 1.00 61.23  ? 140  GLN B CA  1 
ATOM   5296 C C   . GLN B 1 140 ? -13.741 12.488  -46.869 1.00 62.39  ? 140  GLN B C   1 
ATOM   5297 O O   . GLN B 1 140 ? -14.488 13.440  -47.170 1.00 63.99  ? 140  GLN B O   1 
ATOM   5298 C CB  . GLN B 1 140 ? -14.117 10.108  -47.580 1.00 62.02  ? 140  GLN B CB  1 
ATOM   5299 C CG  . GLN B 1 140 ? -15.578 10.054  -48.022 1.00 63.99  ? 140  GLN B CG  1 
ATOM   5300 C CD  . GLN B 1 140 ? -16.486 10.894  -47.159 1.00 64.85  ? 140  GLN B CD  1 
ATOM   5301 O OE1 . GLN B 1 140 ? -16.388 10.892  -45.927 1.00 64.99  ? 140  GLN B OE1 1 
ATOM   5302 N NE2 . GLN B 1 140 ? -17.377 11.623  -47.800 1.00 66.54  ? 140  GLN B NE2 1 
ATOM   5303 N N   . VAL B 1 141 ? -13.217 12.331  -45.652 1.00 61.46  ? 141  VAL B N   1 
ATOM   5304 C CA  . VAL B 1 141 ? -13.709 13.084  -44.501 1.00 62.15  ? 141  VAL B CA  1 
ATOM   5305 C C   . VAL B 1 141 ? -13.069 14.466  -44.412 1.00 62.14  ? 141  VAL B C   1 
ATOM   5306 O O   . VAL B 1 141 ? -13.748 15.464  -44.149 1.00 63.32  ? 141  VAL B O   1 
ATOM   5307 C CB  . VAL B 1 141 ? -13.501 12.307  -43.182 1.00 61.46  ? 141  VAL B CB  1 
ATOM   5308 C CG1 . VAL B 1 141 ? -13.977 13.127  -41.986 1.00 62.19  ? 141  VAL B CG1 1 
ATOM   5309 C CG2 . VAL B 1 141 ? -14.231 10.971  -43.230 1.00 61.36  ? 141  VAL B CG2 1 
ATOM   5310 N N   . GLU B 1 142 ? -11.768 14.521  -44.654 1.00 60.84  ? 142  GLU B N   1 
ATOM   5311 C CA  . GLU B 1 142 ? -11.026 15.763  -44.505 1.00 60.80  ? 142  GLU B CA  1 
ATOM   5312 C C   . GLU B 1 142 ? -10.742 16.448  -45.825 1.00 61.33  ? 142  GLU B C   1 
ATOM   5313 O O   . GLU B 1 142 ? -10.223 17.577  -45.847 1.00 61.81  ? 142  GLU B O   1 
ATOM   5314 C CB  . GLU B 1 142 ? -9.725  15.507  -43.757 1.00 58.93  ? 142  GLU B CB  1 
ATOM   5315 C CG  . GLU B 1 142 ? -9.946  15.139  -42.300 1.00 59.97  ? 142  GLU B CG  1 
ATOM   5316 C CD  . GLU B 1 142 ? -10.628 16.238  -41.526 1.00 62.49  ? 142  GLU B CD  1 
ATOM   5317 O OE1 . GLU B 1 142 ? -10.507 17.409  -41.952 1.00 65.10  ? 142  GLU B OE1 1 
ATOM   5318 O OE2 . GLU B 1 142 ? -11.272 15.939  -40.495 1.00 63.74  ? 142  GLU B OE2 1 
ATOM   5319 N N   . GLY B 1 143 ? -11.083 15.772  -46.920 1.00 61.64  ? 143  GLY B N   1 
ATOM   5320 C CA  . GLY B 1 143 ? -10.900 16.328  -48.254 1.00 62.41  ? 143  GLY B CA  1 
ATOM   5321 C C   . GLY B 1 143 ? -9.459  16.281  -48.737 1.00 61.30  ? 143  GLY B C   1 
ATOM   5322 O O   . GLY B 1 143 ? -9.106  16.933  -49.724 1.00 62.42  ? 143  GLY B O   1 
ATOM   5323 N N   . ALA B 1 144 ? -8.615  15.507  -48.063 1.00 59.22  ? 144  ALA B N   1 
ATOM   5324 C CA  . ALA B 1 144 ? -7.200  15.515  -48.394 1.00 57.26  ? 144  ALA B CA  1 
ATOM   5325 C C   . ALA B 1 144 ? -6.908  14.589  -49.573 1.00 56.51  ? 144  ALA B C   1 
ATOM   5326 O O   . ALA B 1 144 ? -7.622  13.609  -49.783 1.00 56.82  ? 144  ALA B O   1 
ATOM   5327 C CB  . ALA B 1 144 ? -6.364  15.133  -47.170 1.00 55.70  ? 144  ALA B CB  1 
ATOM   5328 N N   . VAL B 1 145 ? -5.883  14.932  -50.353 1.00 55.43  ? 145  VAL B N   1 
ATOM   5329 C CA  . VAL B 1 145 ? -5.313  14.020  -51.331 1.00 54.36  ? 145  VAL B CA  1 
ATOM   5330 C C   . VAL B 1 145 ? -4.200  13.313  -50.589 1.00 53.17  ? 145  VAL B C   1 
ATOM   5331 O O   . VAL B 1 145 ? -3.250  13.957  -50.119 1.00 52.64  ? 145  VAL B O   1 
ATOM   5332 C CB  . VAL B 1 145 ? -4.699  14.742  -52.545 1.00 54.58  ? 145  VAL B CB  1 
ATOM   5333 C CG1 . VAL B 1 145 ? -4.031  13.758  -53.458 1.00 53.14  ? 145  VAL B CG1 1 
ATOM   5334 C CG2 . VAL B 1 145 ? -5.739  15.543  -53.299 1.00 56.01  ? 145  VAL B CG2 1 
ATOM   5335 N N   . LEU B 1 146 ? -4.329  11.994  -50.474 1.00 52.45  ? 146  LEU B N   1 
ATOM   5336 C CA  . LEU B 1 146 ? -3.374  11.198  -49.740 1.00 51.07  ? 146  LEU B CA  1 
ATOM   5337 C C   . LEU B 1 146 ? -2.575  10.323  -50.704 1.00 50.68  ? 146  LEU B C   1 
ATOM   5338 O O   . LEU B 1 146 ? -3.135  9.757   -51.637 1.00 52.46  ? 146  LEU B O   1 
ATOM   5339 C CB  . LEU B 1 146 ? -4.079  10.365  -48.667 1.00 50.86  ? 146  LEU B CB  1 
ATOM   5340 C CG  . LEU B 1 146 ? -3.096  9.825   -47.618 1.00 49.99  ? 146  LEU B CG  1 
ATOM   5341 C CD1 . LEU B 1 146 ? -3.668  9.895   -46.232 1.00 50.25  ? 146  LEU B CD1 1 
ATOM   5342 C CD2 . LEU B 1 146 ? -2.639  8.388   -47.943 1.00 50.64  ? 146  LEU B CD2 1 
ATOM   5343 N N   . VAL B 1 147 ? -1.267  10.219  -50.485 1.00 49.15  ? 147  VAL B N   1 
ATOM   5344 C CA  . VAL B 1 147 ? -0.388  9.506   -51.397 1.00 48.35  ? 147  VAL B CA  1 
ATOM   5345 C C   . VAL B 1 147 ? 0.509   8.550   -50.599 1.00 47.34  ? 147  VAL B C   1 
ATOM   5346 O O   . VAL B 1 147 ? 1.077   8.947   -49.587 1.00 47.31  ? 147  VAL B O   1 
ATOM   5347 C CB  . VAL B 1 147 ? 0.513   10.501  -52.173 1.00 48.18  ? 147  VAL B CB  1 
ATOM   5348 C CG1 . VAL B 1 147 ? 1.294   9.801   -53.242 1.00 48.24  ? 147  VAL B CG1 1 
ATOM   5349 C CG2 . VAL B 1 147 ? -0.294  11.639  -52.765 1.00 48.97  ? 147  VAL B CG2 1 
ATOM   5350 N N   . SER B 1 148 ? 0.626   7.300   -51.028 1.00 46.53  ? 148  SER B N   1 
ATOM   5351 C CA  . SER B 1 148 ? 1.642   6.428   -50.460 1.00 45.41  ? 148  SER B CA  1 
ATOM   5352 C C   . SER B 1 148 ? 2.404   5.684   -51.556 1.00 45.41  ? 148  SER B C   1 
ATOM   5353 O O   . SER B 1 148 ? 1.845   5.421   -52.607 1.00 46.60  ? 148  SER B O   1 
ATOM   5354 C CB  . SER B 1 148 ? 1.055   5.482   -49.419 1.00 45.21  ? 148  SER B CB  1 
ATOM   5355 O OG  . SER B 1 148 ? 0.089   4.611   -49.960 1.00 46.05  ? 148  SER B OG  1 
ATOM   5356 N N   . MET B 1 149 ? 3.678   5.383   -51.310 1.00 44.40  ? 149  MET B N   1 
ATOM   5357 C CA  . MET B 1 149 ? 4.571   4.710   -52.266 1.00 44.82  ? 149  MET B CA  1 
ATOM   5358 C C   . MET B 1 149 ? 5.037   3.361   -51.697 1.00 44.32  ? 149  MET B C   1 
ATOM   5359 O O   . MET B 1 149 ? 5.058   3.155   -50.473 1.00 45.08  ? 149  MET B O   1 
ATOM   5360 C CB  . MET B 1 149 ? 5.838   5.537   -52.383 1.00 44.53  ? 149  MET B CB  1 
ATOM   5361 C CG  . MET B 1 149 ? 6.541   5.422   -51.054 1.00 45.50  ? 149  MET B CG  1 
ATOM   5362 S SD  . MET B 1 149 ? 7.074   6.888   -50.242 1.00 52.77  ? 149  MET B SD  1 
ATOM   5363 C CE  . MET B 1 149 ? 6.085   8.247   -50.892 1.00 49.45  ? 149  MET B CE  1 
ATOM   5364 N N   . ASN B 1 150 ? 5.476   2.461   -52.549 1.00 43.74  ? 150  ASN B N   1 
ATOM   5365 C CA  . ASN B 1 150 ? 6.349   1.435   -52.060 1.00 43.65  ? 150  ASN B CA  1 
ATOM   5366 C C   . ASN B 1 150 ? 7.748   1.959   -52.282 1.00 43.84  ? 150  ASN B C   1 
ATOM   5367 O O   . ASN B 1 150 ? 8.000   2.711   -53.221 1.00 44.49  ? 150  ASN B O   1 
ATOM   5368 C CB  . ASN B 1 150 ? 6.161   0.115   -52.812 1.00 44.41  ? 150  ASN B CB  1 
ATOM   5369 C CG  . ASN B 1 150 ? 4.848   -0.528  -52.521 1.00 45.21  ? 150  ASN B CG  1 
ATOM   5370 O OD1 . ASN B 1 150 ? 4.214   -0.230  -51.500 1.00 46.16  ? 150  ASN B OD1 1 
ATOM   5371 N ND2 . ASN B 1 150 ? 4.412   -1.418  -53.409 1.00 46.44  ? 150  ASN B ND2 1 
ATOM   5372 N N   . TYR B 1 151 ? 8.663   1.566   -51.412 1.00 43.50  ? 151  TYR B N   1 
ATOM   5373 C CA  . TYR B 1 151 ? 10.051  1.857   -51.609 1.00 43.34  ? 151  TYR B CA  1 
ATOM   5374 C C   . TYR B 1 151 ? 10.778  0.564   -51.268 1.00 43.74  ? 151  TYR B C   1 
ATOM   5375 O O   . TYR B 1 151 ? 10.256  -0.238  -50.496 1.00 43.88  ? 151  TYR B O   1 
ATOM   5376 C CB  . TYR B 1 151 ? 10.482  3.048   -50.732 1.00 42.26  ? 151  TYR B CB  1 
ATOM   5377 C CG  . TYR B 1 151 ? 10.392  2.809   -49.241 1.00 40.84  ? 151  TYR B CG  1 
ATOM   5378 C CD1 . TYR B 1 151 ? 9.268   3.213   -48.512 1.00 40.10  ? 151  TYR B CD1 1 
ATOM   5379 C CD2 . TYR B 1 151 ? 11.436  2.185   -48.547 1.00 40.17  ? 151  TYR B CD2 1 
ATOM   5380 C CE1 . TYR B 1 151 ? 9.185   3.004   -47.118 1.00 38.39  ? 151  TYR B CE1 1 
ATOM   5381 C CE2 . TYR B 1 151 ? 11.367  1.971   -47.156 1.00 38.26  ? 151  TYR B CE2 1 
ATOM   5382 C CZ  . TYR B 1 151 ? 10.245  2.392   -46.456 1.00 38.29  ? 151  TYR B CZ  1 
ATOM   5383 O OH  . TYR B 1 151 ? 10.169  2.177   -45.103 1.00 38.94  ? 151  TYR B OH  1 
ATOM   5384 N N   . ARG B 1 152 ? 11.959  0.361   -51.849 1.00 43.95  ? 152  ARG B N   1 
ATOM   5385 C CA  . ARG B 1 152 ? 12.726  -0.866  -51.650 1.00 44.34  ? 152  ARG B CA  1 
ATOM   5386 C C   . ARG B 1 152 ? 13.255  -1.015  -50.233 1.00 44.25  ? 152  ARG B C   1 
ATOM   5387 O O   . ARG B 1 152 ? 13.664  -0.054  -49.618 1.00 44.56  ? 152  ARG B O   1 
ATOM   5388 C CB  . ARG B 1 152 ? 13.878  -0.918  -52.641 1.00 44.78  ? 152  ARG B CB  1 
ATOM   5389 C CG  . ARG B 1 152 ? 13.464  -1.317  -54.018 1.00 44.53  ? 152  ARG B CG  1 
ATOM   5390 C CD  . ARG B 1 152 ? 14.598  -1.194  -54.983 1.00 44.64  ? 152  ARG B CD  1 
ATOM   5391 N NE  . ARG B 1 152 ? 14.855  0.195   -55.350 1.00 41.99  ? 152  ARG B NE  1 
ATOM   5392 C CZ  . ARG B 1 152 ? 15.900  0.595   -56.073 1.00 44.26  ? 152  ARG B CZ  1 
ATOM   5393 N NH1 . ARG B 1 152 ? 16.812  -0.292  -56.507 1.00 43.38  ? 152  ARG B NH1 1 
ATOM   5394 N NH2 . ARG B 1 152 ? 16.039  1.890   -56.363 1.00 43.28  ? 152  ARG B NH2 1 
ATOM   5395 N N   . VAL B 1 153 ? 13.243  -2.232  -49.719 1.00 45.14  ? 153  VAL B N   1 
ATOM   5396 C CA  . VAL B 1 153 ? 13.675  -2.487  -48.358 1.00 45.22  ? 153  VAL B CA  1 
ATOM   5397 C C   . VAL B 1 153 ? 14.687  -3.629  -48.322 1.00 46.80  ? 153  VAL B C   1 
ATOM   5398 O O   . VAL B 1 153 ? 14.866  -4.342  -49.319 1.00 48.07  ? 153  VAL B O   1 
ATOM   5399 C CB  . VAL B 1 153 ? 12.488  -2.866  -47.460 1.00 44.93  ? 153  VAL B CB  1 
ATOM   5400 C CG1 . VAL B 1 153 ? 11.502  -1.732  -47.376 1.00 44.01  ? 153  VAL B CG1 1 
ATOM   5401 C CG2 . VAL B 1 153 ? 11.807  -4.136  -47.960 1.00 45.79  ? 153  VAL B CG2 1 
ATOM   5402 N N   . GLY B 1 154 ? 15.335  -3.813  -47.167 1.00 47.08  ? 154  GLY B N   1 
ATOM   5403 C CA  . GLY B 1 154 ? 16.302  -4.899  -46.990 1.00 47.96  ? 154  GLY B CA  1 
ATOM   5404 C C   . GLY B 1 154 ? 17.486  -4.687  -47.897 1.00 48.64  ? 154  GLY B C   1 
ATOM   5405 O O   . GLY B 1 154 ? 17.823  -3.532  -48.215 1.00 48.68  ? 154  GLY B O   1 
ATOM   5406 N N   . THR B 1 155 ? 18.111  -5.777  -48.337 1.00 49.57  ? 155  THR B N   1 
ATOM   5407 C CA  . THR B 1 155 ? 19.298  -5.655  -49.181 1.00 50.36  ? 155  THR B CA  1 
ATOM   5408 C C   . THR B 1 155 ? 18.977  -4.780  -50.376 1.00 49.79  ? 155  THR B C   1 
ATOM   5409 O O   . THR B 1 155 ? 19.701  -3.823  -50.651 1.00 50.87  ? 155  THR B O   1 
ATOM   5410 C CB  . THR B 1 155 ? 19.831  -6.997  -49.673 1.00 51.70  ? 155  THR B CB  1 
ATOM   5411 O OG1 . THR B 1 155 ? 18.758  -7.743  -50.235 1.00 51.34  ? 155  THR B OG1 1 
ATOM   5412 C CG2 . THR B 1 155 ? 20.431  -7.782  -48.533 1.00 52.97  ? 155  THR B CG2 1 
ATOM   5413 N N   . PHE B 1 156 ? 17.861  -5.067  -51.034 1.00 48.57  ? 156  PHE B N   1 
ATOM   5414 C CA  . PHE B 1 156 ? 17.489  -4.383  -52.266 1.00 48.37  ? 156  PHE B CA  1 
ATOM   5415 C C   . PHE B 1 156 ? 17.439  -2.856  -52.128 1.00 48.00  ? 156  PHE B C   1 
ATOM   5416 O O   . PHE B 1 156 ? 17.719  -2.133  -53.083 1.00 48.63  ? 156  PHE B O   1 
ATOM   5417 C CB  . PHE B 1 156 ? 16.149  -4.925  -52.802 1.00 47.77  ? 156  PHE B CB  1 
ATOM   5418 C CG  . PHE B 1 156 ? 16.019  -6.423  -52.701 1.00 47.47  ? 156  PHE B CG  1 
ATOM   5419 C CD1 . PHE B 1 156 ? 16.558  -7.250  -53.672 1.00 47.65  ? 156  PHE B CD1 1 
ATOM   5420 C CD2 . PHE B 1 156 ? 15.391  -7.007  -51.610 1.00 46.77  ? 156  PHE B CD2 1 
ATOM   5421 C CE1 . PHE B 1 156 ? 16.458  -8.648  -53.568 1.00 49.26  ? 156  PHE B CE1 1 
ATOM   5422 C CE2 . PHE B 1 156 ? 15.296  -8.411  -51.499 1.00 49.00  ? 156  PHE B CE2 1 
ATOM   5423 C CZ  . PHE B 1 156 ? 15.828  -9.225  -52.480 1.00 48.25  ? 156  PHE B CZ  1 
ATOM   5424 N N   . GLY B 1 157 ? 17.095  -2.362  -50.944 1.00 47.32  ? 157  GLY B N   1 
ATOM   5425 C CA  . GLY B 1 157 ? 16.897  -0.933  -50.773 1.00 46.76  ? 157  GLY B CA  1 
ATOM   5426 C C   . GLY B 1 157 ? 18.091  -0.279  -50.119 1.00 47.38  ? 157  GLY B C   1 
ATOM   5427 O O   . GLY B 1 157 ? 18.318  0.925   -50.280 1.00 47.52  ? 157  GLY B O   1 
ATOM   5428 N N   . PHE B 1 158 ? 18.869  -1.068  -49.381 1.00 47.80  ? 158  PHE B N   1 
ATOM   5429 C CA  . PHE B 1 158 ? 19.859  -0.470  -48.497 1.00 47.64  ? 158  PHE B CA  1 
ATOM   5430 C C   . PHE B 1 158 ? 21.184  -1.199  -48.407 1.00 49.49  ? 158  PHE B C   1 
ATOM   5431 O O   . PHE B 1 158 ? 22.040  -0.807  -47.626 1.00 50.36  ? 158  PHE B O   1 
ATOM   5432 C CB  . PHE B 1 158 ? 19.257  -0.210  -47.102 1.00 46.39  ? 158  PHE B CB  1 
ATOM   5433 C CG  . PHE B 1 158 ? 18.071  0.727   -47.126 1.00 43.62  ? 158  PHE B CG  1 
ATOM   5434 C CD1 . PHE B 1 158 ? 18.255  2.114   -47.211 1.00 40.70  ? 158  PHE B CD1 1 
ATOM   5435 C CD2 . PHE B 1 158 ? 16.777  0.221   -47.106 1.00 40.69  ? 158  PHE B CD2 1 
ATOM   5436 C CE1 . PHE B 1 158 ? 17.176  2.969   -47.263 1.00 38.67  ? 158  PHE B CE1 1 
ATOM   5437 C CE2 . PHE B 1 158 ? 15.688  1.075   -47.154 1.00 40.33  ? 158  PHE B CE2 1 
ATOM   5438 C CZ  . PHE B 1 158 ? 15.888  2.456   -47.234 1.00 39.32  ? 158  PHE B CZ  1 
ATOM   5439 N N   . LEU B 1 159 ? 21.377  -2.249  -49.202 1.00 50.80  ? 159  LEU B N   1 
ATOM   5440 C CA  . LEU B 1 159 ? 22.724  -2.804  -49.316 1.00 52.22  ? 159  LEU B CA  1 
ATOM   5441 C C   . LEU B 1 159 ? 23.617  -1.740  -49.975 1.00 53.19  ? 159  LEU B C   1 
ATOM   5442 O O   . LEU B 1 159 ? 23.255  -1.157  -51.000 1.00 53.36  ? 159  LEU B O   1 
ATOM   5443 C CB  . LEU B 1 159 ? 22.741  -4.116  -50.078 1.00 52.19  ? 159  LEU B CB  1 
ATOM   5444 C CG  . LEU B 1 159 ? 24.119  -4.771  -50.150 1.00 53.18  ? 159  LEU B CG  1 
ATOM   5445 C CD1 . LEU B 1 159 ? 24.045  -6.293  -49.874 1.00 51.69  ? 159  LEU B CD1 1 
ATOM   5446 C CD2 . LEU B 1 159 ? 24.794  -4.477  -51.486 1.00 52.18  ? 159  LEU B CD2 1 
ATOM   5447 N N   . ALA B 1 160 ? 24.758  -1.458  -49.353 1.00 54.48  ? 160  ALA B N   1 
ATOM   5448 C CA  . ALA B 1 160 ? 25.683  -0.459  -49.872 1.00 55.17  ? 160  ALA B CA  1 
ATOM   5449 C C   . ALA B 1 160 ? 27.117  -0.938  -49.783 1.00 57.20  ? 160  ALA B C   1 
ATOM   5450 O O   . ALA B 1 160 ? 27.533  -1.511  -48.776 1.00 57.69  ? 160  ALA B O   1 
ATOM   5451 C CB  . ALA B 1 160 ? 25.533  0.864   -49.121 1.00 54.16  ? 160  ALA B CB  1 
ATOM   5452 N N   . LEU B 1 161 ? 27.860  -0.705  -50.856 1.00 58.54  ? 161  LEU B N   1 
ATOM   5453 C CA  . LEU B 1 161 ? 29.294  -0.753  -50.812 1.00 60.46  ? 161  LEU B CA  1 
ATOM   5454 C C   . LEU B 1 161 ? 29.668  0.674   -51.083 1.00 61.02  ? 161  LEU B C   1 
ATOM   5455 O O   . LEU B 1 161 ? 29.839  1.048   -52.235 1.00 61.38  ? 161  LEU B O   1 
ATOM   5456 C CB  . LEU B 1 161 ? 29.823  -1.696  -51.870 1.00 61.96  ? 161  LEU B CB  1 
ATOM   5457 C CG  . LEU B 1 161 ? 29.525  -3.153  -51.510 1.00 62.78  ? 161  LEU B CG  1 
ATOM   5458 C CD1 . LEU B 1 161 ? 29.716  -4.005  -52.711 1.00 66.03  ? 161  LEU B CD1 1 
ATOM   5459 C CD2 . LEU B 1 161 ? 30.417  -3.670  -50.390 1.00 64.72  ? 161  LEU B CD2 1 
ATOM   5460 N N   . PRO B 1 162 ? 29.738  1.497   -50.009 1.00 61.20  ? 162  PRO B N   1 
ATOM   5461 C CA  . PRO B 1 162 ? 29.808  2.962   -50.105 1.00 61.53  ? 162  PRO B CA  1 
ATOM   5462 C C   . PRO B 1 162 ? 30.981  3.404   -50.925 1.00 64.26  ? 162  PRO B C   1 
ATOM   5463 O O   . PRO B 1 162 ? 32.030  2.770   -50.879 1.00 66.10  ? 162  PRO B O   1 
ATOM   5464 C CB  . PRO B 1 162 ? 29.970  3.402   -48.650 1.00 61.12  ? 162  PRO B CB  1 
ATOM   5465 C CG  . PRO B 1 162 ? 29.294  2.315   -47.875 1.00 59.47  ? 162  PRO B CG  1 
ATOM   5466 C CD  . PRO B 1 162 ? 29.690  1.063   -48.601 1.00 60.77  ? 162  PRO B CD  1 
ATOM   5467 N N   . GLY B 1 163 ? 30.776  4.459   -51.705 1.00 65.13  ? 163  GLY B N   1 
ATOM   5468 C CA  . GLY B 1 163 ? 31.804  4.968   -52.606 1.00 68.27  ? 163  GLY B CA  1 
ATOM   5469 C C   . GLY B 1 163 ? 31.808  4.266   -53.949 1.00 69.93  ? 163  GLY B C   1 
ATOM   5470 O O   . GLY B 1 163 ? 32.483  4.700   -54.878 1.00 71.71  ? 163  GLY B O   1 
ATOM   5471 N N   . SER B 1 164 ? 31.060  3.171   -54.056 1.00 69.79  ? 164  SER B N   1 
ATOM   5472 C CA  . SER B 1 164 ? 30.947  2.453   -55.325 1.00 71.09  ? 164  SER B CA  1 
ATOM   5473 C C   . SER B 1 164 ? 29.889  3.087   -56.228 1.00 70.76  ? 164  SER B C   1 
ATOM   5474 O O   . SER B 1 164 ? 28.974  3.782   -55.764 1.00 69.11  ? 164  SER B O   1 
ATOM   5475 C CB  . SER B 1 164 ? 30.661  0.954   -55.108 1.00 70.67  ? 164  SER B CB  1 
ATOM   5476 O OG  . SER B 1 164 ? 29.275  0.681   -54.955 1.00 67.04  ? 164  SER B OG  1 
ATOM   5477 N N   . ARG B 1 165 ? 30.037  2.822   -57.517 1.00 72.60  ? 165  ARG B N   1 
ATOM   5478 C CA  . ARG B 1 165 ? 29.155  3.310   -58.550 1.00 73.00  ? 165  ARG B CA  1 
ATOM   5479 C C   . ARG B 1 165 ? 27.916  2.418   -58.616 1.00 70.89  ? 165  ARG B C   1 
ATOM   5480 O O   . ARG B 1 165 ? 26.828  2.893   -58.906 1.00 69.88  ? 165  ARG B O   1 
ATOM   5481 C CB  . ARG B 1 165 ? 29.925  3.266   -59.882 1.00 76.00  ? 165  ARG B CB  1 
ATOM   5482 C CG  . ARG B 1 165 ? 29.258  3.886   -61.125 1.00 79.53  ? 165  ARG B CG  1 
ATOM   5483 C CD  . ARG B 1 165 ? 30.207  3.728   -62.348 1.00 87.15  ? 165  ARG B CD  1 
ATOM   5484 N NE  . ARG B 1 165 ? 29.932  4.684   -63.430 1.00 91.37  ? 165  ARG B NE  1 
ATOM   5485 C CZ  . ARG B 1 165 ? 30.871  5.287   -64.168 1.00 95.15  ? 165  ARG B CZ  1 
ATOM   5486 N NH1 . ARG B 1 165 ? 32.157  5.049   -63.942 1.00 97.62  ? 165  ARG B NH1 1 
ATOM   5487 N NH2 . ARG B 1 165 ? 30.529  6.142   -65.130 1.00 95.86  ? 165  ARG B NH2 1 
ATOM   5488 N N   . GLU B 1 166 ? 28.067  1.127   -58.339 1.00 70.81  ? 166  GLU B N   1 
ATOM   5489 C CA  . GLU B 1 166 ? 26.972  0.192   -58.630 1.00 69.58  ? 166  GLU B CA  1 
ATOM   5490 C C   . GLU B 1 166 ? 26.107  -0.224  -57.445 1.00 66.99  ? 166  GLU B C   1 
ATOM   5491 O O   . GLU B 1 166 ? 25.016  -0.748  -57.637 1.00 66.28  ? 166  GLU B O   1 
ATOM   5492 C CB  . GLU B 1 166 ? 27.417  -1.002  -59.504 1.00 71.55  ? 166  GLU B CB  1 
ATOM   5493 C CG  . GLU B 1 166 ? 28.787  -1.584  -59.213 1.00 75.40  ? 166  GLU B CG  1 
ATOM   5494 C CD  . GLU B 1 166 ? 29.937  -0.766  -59.789 1.00 79.82  ? 166  GLU B CD  1 
ATOM   5495 O OE1 . GLU B 1 166 ? 30.224  -0.912  -61.000 1.00 80.87  ? 166  GLU B OE1 1 
ATOM   5496 O OE2 . GLU B 1 166 ? 30.574  -0.002  -59.011 1.00 81.80  ? 166  GLU B OE2 1 
ATOM   5497 N N   . ALA B 1 167 ? 26.573  0.046   -56.230 1.00 65.88  ? 167  ALA B N   1 
ATOM   5498 C CA  . ALA B 1 167 ? 25.748  -0.105  -55.025 1.00 63.10  ? 167  ALA B CA  1 
ATOM   5499 C C   . ALA B 1 167 ? 26.005  1.040   -54.035 1.00 61.87  ? 167  ALA B C   1 
ATOM   5500 O O   . ALA B 1 167 ? 26.625  0.821   -53.002 1.00 62.28  ? 167  ALA B O   1 
ATOM   5501 C CB  . ALA B 1 167 ? 26.010  -1.453  -54.359 1.00 63.34  ? 167  ALA B CB  1 
ATOM   5502 N N   . PRO B 1 168 ? 25.527  2.263   -54.345 1.00 60.51  ? 168  PRO B N   1 
ATOM   5503 C CA  . PRO B 1 168 ? 25.907  3.413   -53.516 1.00 60.07  ? 168  PRO B CA  1 
ATOM   5504 C C   . PRO B 1 168 ? 25.176  3.530   -52.176 1.00 58.43  ? 168  PRO B C   1 
ATOM   5505 O O   . PRO B 1 168 ? 25.529  4.381   -51.367 1.00 58.49  ? 168  PRO B O   1 
ATOM   5506 C CB  . PRO B 1 168 ? 25.587  4.618   -54.409 1.00 59.80  ? 168  PRO B CB  1 
ATOM   5507 C CG  . PRO B 1 168 ? 24.519  4.142   -55.315 1.00 59.35  ? 168  PRO B CG  1 
ATOM   5508 C CD  . PRO B 1 168 ? 24.734  2.666   -55.524 1.00 59.89  ? 168  PRO B CD  1 
ATOM   5509 N N   . GLY B 1 169 ? 24.179  2.677   -51.942 1.00 57.36  ? 169  GLY B N   1 
ATOM   5510 C CA  . GLY B 1 169 ? 23.382  2.727   -50.707 1.00 55.23  ? 169  GLY B CA  1 
ATOM   5511 C C   . GLY B 1 169 ? 22.289  3.775   -50.754 1.00 53.49  ? 169  GLY B C   1 
ATOM   5512 O O   . GLY B 1 169 ? 22.292  4.637   -51.651 1.00 54.21  ? 169  GLY B O   1 
ATOM   5513 N N   . ASN B 1 170 ? 21.352  3.693   -49.802 1.00 51.33  ? 170  ASN B N   1 
ATOM   5514 C CA  . ASN B 1 170 ? 20.245  4.656   -49.677 1.00 49.31  ? 170  ASN B CA  1 
ATOM   5515 C C   . ASN B 1 170 ? 19.208  4.683   -50.825 1.00 48.69  ? 170  ASN B C   1 
ATOM   5516 O O   . ASN B 1 170 ? 18.389  5.625   -50.915 1.00 47.96  ? 170  ASN B O   1 
ATOM   5517 C CB  . ASN B 1 170 ? 20.776  6.076   -49.420 1.00 49.10  ? 170  ASN B CB  1 
ATOM   5518 C CG  . ASN B 1 170 ? 21.495  6.195   -48.109 1.00 49.30  ? 170  ASN B CG  1 
ATOM   5519 O OD1 . ASN B 1 170 ? 21.137  5.554   -47.124 1.00 48.98  ? 170  ASN B OD1 1 
ATOM   5520 N ND2 . ASN B 1 170 ? 22.524  7.014   -48.082 1.00 49.95  ? 170  ASN B ND2 1 
ATOM   5521 N N   . VAL B 1 171 ? 19.214  3.663   -51.687 1.00 48.60  ? 171  VAL B N   1 
ATOM   5522 C CA  . VAL B 1 171 ? 18.343  3.707   -52.872 1.00 47.23  ? 171  VAL B CA  1 
ATOM   5523 C C   . VAL B 1 171 ? 16.881  3.654   -52.471 1.00 46.23  ? 171  VAL B C   1 
ATOM   5524 O O   . VAL B 1 171 ? 16.031  4.239   -53.148 1.00 46.46  ? 171  VAL B O   1 
ATOM   5525 C CB  . VAL B 1 171 ? 18.694  2.668   -53.939 1.00 47.70  ? 171  VAL B CB  1 
ATOM   5526 C CG1 . VAL B 1 171 ? 20.152  2.816   -54.335 1.00 47.97  ? 171  VAL B CG1 1 
ATOM   5527 C CG2 . VAL B 1 171 ? 18.392  1.266   -53.466 1.00 46.80  ? 171  VAL B CG2 1 
ATOM   5528 N N   . GLY B 1 172 ? 16.592  2.995   -51.350 1.00 45.25  ? 172  GLY B N   1 
ATOM   5529 C CA  . GLY B 1 172 ? 15.240  2.991   -50.809 1.00 44.33  ? 172  GLY B CA  1 
ATOM   5530 C C   . GLY B 1 172 ? 14.782  4.421   -50.536 1.00 43.86  ? 172  GLY B C   1 
ATOM   5531 O O   . GLY B 1 172 ? 13.635  4.802   -50.793 1.00 43.07  ? 172  GLY B O   1 
ATOM   5532 N N   . LEU B 1 173 ? 15.699  5.224   -50.021 1.00 44.24  ? 173  LEU B N   1 
ATOM   5533 C CA  . LEU B 1 173 ? 15.391  6.602   -49.731 1.00 43.95  ? 173  LEU B CA  1 
ATOM   5534 C C   . LEU B 1 173 ? 15.265  7.369   -51.019 1.00 43.90  ? 173  LEU B C   1 
ATOM   5535 O O   . LEU B 1 173 ? 14.477  8.295   -51.094 1.00 44.20  ? 173  LEU B O   1 
ATOM   5536 C CB  . LEU B 1 173 ? 16.449  7.209   -48.799 1.00 45.02  ? 173  LEU B CB  1 
ATOM   5537 C CG  . LEU B 1 173 ? 16.295  6.741   -47.342 1.00 44.52  ? 173  LEU B CG  1 
ATOM   5538 C CD1 . LEU B 1 173 ? 17.613  6.708   -46.655 1.00 45.59  ? 173  LEU B CD1 1 
ATOM   5539 C CD2 . LEU B 1 173 ? 15.380  7.722   -46.640 1.00 43.68  ? 173  LEU B CD2 1 
ATOM   5540 N N   . LEU B 1 174 ? 16.009  6.961   -52.040 1.00 44.01  ? 174  LEU B N   1 
ATOM   5541 C CA  . LEU B 1 174 ? 15.933  7.618   -53.329 1.00 44.69  ? 174  LEU B CA  1 
ATOM   5542 C C   . LEU B 1 174 ? 14.633  7.293   -54.055 1.00 45.05  ? 174  LEU B C   1 
ATOM   5543 O O   . LEU B 1 174 ? 14.062  8.174   -54.734 1.00 45.47  ? 174  LEU B O   1 
ATOM   5544 C CB  . LEU B 1 174 ? 17.136  7.268   -54.189 1.00 45.58  ? 174  LEU B CB  1 
ATOM   5545 C CG  . LEU B 1 174 ? 18.452  7.965   -53.819 1.00 46.71  ? 174  LEU B CG  1 
ATOM   5546 C CD1 . LEU B 1 174 ? 19.609  7.452   -54.688 1.00 48.41  ? 174  LEU B CD1 1 
ATOM   5547 C CD2 . LEU B 1 174 ? 18.343  9.478   -53.917 1.00 46.23  ? 174  LEU B CD2 1 
ATOM   5548 N N   . ASP B 1 175 ? 14.186  6.029   -53.924 1.00 44.46  ? 175  ASP B N   1 
ATOM   5549 C CA  . ASP B 1 175 ? 12.870  5.591   -54.373 1.00 43.74  ? 175  ASP B CA  1 
ATOM   5550 C C   . ASP B 1 175 ? 11.824  6.517   -53.788 1.00 43.50  ? 175  ASP B C   1 
ATOM   5551 O O   . ASP B 1 175 ? 10.879  6.910   -54.472 1.00 44.03  ? 175  ASP B O   1 
ATOM   5552 C CB  . ASP B 1 175 ? 12.545  4.193   -53.844 1.00 43.29  ? 175  ASP B CB  1 
ATOM   5553 C CG  . ASP B 1 175 ? 13.388  3.113   -54.459 1.00 44.80  ? 175  ASP B CG  1 
ATOM   5554 O OD1 . ASP B 1 175 ? 14.057  3.354   -55.488 1.00 45.66  ? 175  ASP B OD1 1 
ATOM   5555 O OD2 . ASP B 1 175 ? 13.380  1.993   -53.903 1.00 46.71  ? 175  ASP B OD2 1 
ATOM   5556 N N   . GLN B 1 176 ? 11.968  6.833   -52.503 1.00 42.57  ? 176  GLN B N   1 
ATOM   5557 C CA  . GLN B 1 176 ? 11.011  7.685   -51.845 1.00 42.51  ? 176  GLN B CA  1 
ATOM   5558 C C   . GLN B 1 176 ? 11.114  9.095   -52.408 1.00 43.46  ? 176  GLN B C   1 
ATOM   5559 O O   . GLN B 1 176 ? 10.097  9.741   -52.678 1.00 43.37  ? 176  GLN B O   1 
ATOM   5560 C CB  . GLN B 1 176 ? 11.248  7.726   -50.342 1.00 42.00  ? 176  GLN B CB  1 
ATOM   5561 C CG  . GLN B 1 176 ? 10.989  6.439   -49.569 1.00 41.10  ? 176  GLN B CG  1 
ATOM   5562 C CD  . GLN B 1 176 ? 11.515  6.582   -48.142 1.00 43.27  ? 176  GLN B CD  1 
ATOM   5563 O OE1 . GLN B 1 176 ? 11.699  7.731   -47.648 1.00 39.80  ? 176  GLN B OE1 1 
ATOM   5564 N NE2 . GLN B 1 176 ? 11.774  5.436   -47.471 1.00 39.01  ? 176  GLN B NE2 1 
ATOM   5565 N N   . ARG B 1 177 ? 12.345  9.566   -52.586 1.00 44.25  ? 177  ARG B N   1 
ATOM   5566 C CA  . ARG B 1 177 ? 12.554  10.902  -53.130 1.00 45.60  ? 177  ARG B CA  1 
ATOM   5567 C C   . ARG B 1 177 ? 11.923  11.001  -54.517 1.00 46.51  ? 177  ARG B C   1 
ATOM   5568 O O   . ARG B 1 177 ? 11.406  12.068  -54.895 1.00 47.74  ? 177  ARG B O   1 
ATOM   5569 C CB  . ARG B 1 177 ? 14.043  11.264  -53.184 1.00 46.15  ? 177  ARG B CB  1 
ATOM   5570 C CG  . ARG B 1 177 ? 14.333  12.579  -53.889 1.00 47.87  ? 177  ARG B CG  1 
ATOM   5571 C CD  . ARG B 1 177 ? 15.789  12.986  -53.768 1.00 50.20  ? 177  ARG B CD  1 
ATOM   5572 N NE  . ARG B 1 177 ? 16.115  13.303  -52.376 1.00 52.15  ? 177  ARG B NE  1 
ATOM   5573 C CZ  . ARG B 1 177 ? 17.348  13.357  -51.881 1.00 52.31  ? 177  ARG B CZ  1 
ATOM   5574 N NH1 . ARG B 1 177 ? 18.390  13.121  -52.671 1.00 53.82  ? 177  ARG B NH1 1 
ATOM   5575 N NH2 . ARG B 1 177 ? 17.534  13.629  -50.595 1.00 49.49  ? 177  ARG B NH2 1 
ATOM   5576 N N   . LEU B 1 178 ? 11.944  9.900   -55.272 1.00 46.09  ? 178  LEU B N   1 
ATOM   5577 C CA  . LEU B 1 178 ? 11.414  9.958   -56.632 1.00 46.48  ? 178  LEU B CA  1 
ATOM   5578 C C   . LEU B 1 178 ? 9.883   10.027  -56.611 1.00 46.16  ? 178  LEU B C   1 
ATOM   5579 O O   . LEU B 1 178 ? 9.276   10.740  -57.436 1.00 46.89  ? 178  LEU B O   1 
ATOM   5580 C CB  . LEU B 1 178 ? 11.937  8.818   -57.513 1.00 46.46  ? 178  LEU B CB  1 
ATOM   5581 C CG  . LEU B 1 178 ? 11.454  8.720   -58.971 1.00 46.84  ? 178  LEU B CG  1 
ATOM   5582 C CD1 . LEU B 1 178 ? 11.964  9.819   -59.928 1.00 44.81  ? 178  LEU B CD1 1 
ATOM   5583 C CD2 . LEU B 1 178 ? 11.816  7.359   -59.484 1.00 44.78  ? 178  LEU B CD2 1 
ATOM   5584 N N   . ALA B 1 179 ? 9.272   9.305   -55.663 1.00 44.55  ? 179  ALA B N   1 
ATOM   5585 C CA  . ALA B 1 179 ? 7.830   9.378   -55.468 1.00 43.40  ? 179  ALA B CA  1 
ATOM   5586 C C   . ALA B 1 179 ? 7.478   10.819  -55.119 1.00 43.69  ? 179  ALA B C   1 
ATOM   5587 O O   . ALA B 1 179 ? 6.528   11.374  -55.657 1.00 44.11  ? 179  ALA B O   1 
ATOM   5588 C CB  . ALA B 1 179 ? 7.388   8.446   -54.399 1.00 41.92  ? 179  ALA B CB  1 
ATOM   5589 N N   . LEU B 1 180 ? 8.272   11.424  -54.240 1.00 43.80  ? 180  LEU B N   1 
ATOM   5590 C CA  . LEU B 1 180 ? 8.097   12.827  -53.867 1.00 44.46  ? 180  LEU B CA  1 
ATOM   5591 C C   . LEU B 1 180 ? 8.173   13.742  -55.088 1.00 45.99  ? 180  LEU B C   1 
ATOM   5592 O O   . LEU B 1 180 ? 7.330   14.629  -55.234 1.00 46.42  ? 180  LEU B O   1 
ATOM   5593 C CB  . LEU B 1 180 ? 9.107   13.239  -52.800 1.00 43.87  ? 180  LEU B CB  1 
ATOM   5594 C CG  . LEU B 1 180 ? 8.788   13.104  -51.295 1.00 42.79  ? 180  LEU B CG  1 
ATOM   5595 C CD1 . LEU B 1 180 ? 7.937   11.900  -50.904 1.00 39.49  ? 180  LEU B CD1 1 
ATOM   5596 C CD2 . LEU B 1 180 ? 10.084  13.150  -50.479 1.00 40.55  ? 180  LEU B CD2 1 
ATOM   5597 N N   . GLN B 1 181 ? 9.153   13.506  -55.972 1.00 46.91  ? 181  GLN B N   1 
ATOM   5598 C CA  A GLN B 1 181 ? 9.279   14.280  -57.217 0.50 48.32  ? 181  GLN B CA  1 
ATOM   5599 C CA  B GLN B 1 181 ? 9.281   14.280  -57.223 0.50 48.25  ? 181  GLN B CA  1 
ATOM   5600 C C   . GLN B 1 181 ? 8.057   14.060  -58.116 1.00 48.81  ? 181  GLN B C   1 
ATOM   5601 O O   . GLN B 1 181 ? 7.533   15.007  -58.726 1.00 50.22  ? 181  GLN B O   1 
ATOM   5602 C CB  A GLN B 1 181 ? 10.601  13.962  -57.941 0.50 48.80  ? 181  GLN B CB  1 
ATOM   5603 C CB  B GLN B 1 181 ? 10.574  13.919  -57.969 0.50 48.68  ? 181  GLN B CB  1 
ATOM   5604 C CG  A GLN B 1 181 ? 11.822  14.607  -57.253 0.50 49.57  ? 181  GLN B CG  1 
ATOM   5605 C CG  B GLN B 1 181 ? 10.814  14.668  -59.283 0.50 50.36  ? 181  GLN B CG  1 
ATOM   5606 C CD  A GLN B 1 181 ? 13.178  14.097  -57.745 0.50 49.93  ? 181  GLN B CD  1 
ATOM   5607 C CD  B GLN B 1 181 ? 11.130  16.155  -59.101 0.50 51.42  ? 181  GLN B CD  1 
ATOM   5608 O OE1 A GLN B 1 181 ? 13.299  12.977  -58.244 0.50 50.78  ? 181  GLN B OE1 1 
ATOM   5609 O OE1 B GLN B 1 181 ? 11.776  16.561  -58.129 0.50 51.62  ? 181  GLN B OE1 1 
ATOM   5610 N NE2 A GLN B 1 181 ? 14.210  14.917  -57.575 0.50 49.70  ? 181  GLN B NE2 1 
ATOM   5611 N NE2 B GLN B 1 181 ? 10.686  16.968  -60.051 0.50 51.21  ? 181  GLN B NE2 1 
ATOM   5612 N N   . TRP B 1 182 ? 7.582   12.819  -58.172 1.00 47.79  ? 182  TRP B N   1 
ATOM   5613 C CA  . TRP B 1 182 ? 6.406   12.508  -58.963 1.00 48.19  ? 182  TRP B CA  1 
ATOM   5614 C C   . TRP B 1 182 ? 5.193   13.329  -58.526 1.00 48.25  ? 182  TRP B C   1 
ATOM   5615 O O   . TRP B 1 182 ? 4.352   13.696  -59.352 1.00 48.80  ? 182  TRP B O   1 
ATOM   5616 C CB  . TRP B 1 182 ? 6.086   11.022  -58.869 1.00 47.66  ? 182  TRP B CB  1 
ATOM   5617 C CG  . TRP B 1 182 ? 4.998   10.587  -59.774 1.00 48.63  ? 182  TRP B CG  1 
ATOM   5618 C CD1 . TRP B 1 182 ? 5.127   10.149  -61.062 1.00 50.82  ? 182  TRP B CD1 1 
ATOM   5619 C CD2 . TRP B 1 182 ? 3.605   10.547  -59.472 1.00 49.21  ? 182  TRP B CD2 1 
ATOM   5620 N NE1 . TRP B 1 182 ? 3.893   9.842   -61.592 1.00 51.92  ? 182  TRP B NE1 1 
ATOM   5621 C CE2 . TRP B 1 182 ? 2.938   10.070  -60.636 1.00 50.58  ? 182  TRP B CE2 1 
ATOM   5622 C CE3 . TRP B 1 182 ? 2.854   10.859  -58.336 1.00 48.37  ? 182  TRP B CE3 1 
ATOM   5623 C CZ2 . TRP B 1 182 ? 1.557   9.904   -60.696 1.00 49.77  ? 182  TRP B CZ2 1 
ATOM   5624 C CZ3 . TRP B 1 182 ? 1.478   10.698  -58.391 1.00 50.83  ? 182  TRP B CZ3 1 
ATOM   5625 C CH2 . TRP B 1 182 ? 0.840   10.217  -59.570 1.00 51.62  ? 182  TRP B CH2 1 
ATOM   5626 N N   . VAL B 1 183 ? 5.098   13.571  -57.221 1.00 47.61  ? 183  VAL B N   1 
ATOM   5627 C CA  . VAL B 1 183 ? 3.986   14.304  -56.637 1.00 48.20  ? 183  VAL B CA  1 
ATOM   5628 C C   . VAL B 1 183 ? 4.085   15.788  -57.047 1.00 49.88  ? 183  VAL B C   1 
ATOM   5629 O O   . VAL B 1 183 ? 3.098   16.368  -57.502 1.00 50.84  ? 183  VAL B O   1 
ATOM   5630 C CB  . VAL B 1 183 ? 3.901   14.098  -55.093 1.00 47.39  ? 183  VAL B CB  1 
ATOM   5631 C CG1 . VAL B 1 183 ? 3.077   15.223  -54.402 1.00 47.53  ? 183  VAL B CG1 1 
ATOM   5632 C CG2 . VAL B 1 183 ? 3.342   12.713  -54.763 1.00 45.80  ? 183  VAL B CG2 1 
ATOM   5633 N N   . GLN B 1 184 ? 5.273   16.383  -56.944 1.00 50.15  ? 184  GLN B N   1 
ATOM   5634 C CA  . GLN B 1 184 ? 5.452   17.734  -57.461 1.00 52.03  ? 184  GLN B CA  1 
ATOM   5635 C C   . GLN B 1 184 ? 4.953   17.855  -58.887 1.00 53.45  ? 184  GLN B C   1 
ATOM   5636 O O   . GLN B 1 184 ? 4.306   18.850  -59.248 1.00 55.03  ? 184  GLN B O   1 
ATOM   5637 C CB  . GLN B 1 184 ? 6.910   18.176  -57.395 1.00 52.49  ? 184  GLN B CB  1 
ATOM   5638 C CG  . GLN B 1 184 ? 7.360   18.542  -56.012 1.00 52.21  ? 184  GLN B CG  1 
ATOM   5639 C CD  . GLN B 1 184 ? 6.522   19.654  -55.421 1.00 53.54  ? 184  GLN B CD  1 
ATOM   5640 O OE1 . GLN B 1 184 ? 5.746   19.430  -54.486 1.00 51.76  ? 184  GLN B OE1 1 
ATOM   5641 N NE2 . GLN B 1 184 ? 6.662   20.859  -55.968 1.00 55.05  ? 184  GLN B NE2 1 
ATOM   5642 N N   . GLU B 1 185 ? 5.237   16.836  -59.691 1.00 53.20  ? 185  GLU B N   1 
ATOM   5643 C CA  . GLU B 1 185 ? 5.013   16.921  -61.138 1.00 54.65  ? 185  GLU B CA  1 
ATOM   5644 C C   . GLU B 1 185 ? 3.594   16.602  -61.578 1.00 54.04  ? 185  GLU B C   1 
ATOM   5645 O O   . GLU B 1 185 ? 3.170   17.079  -62.622 1.00 56.03  ? 185  GLU B O   1 
ATOM   5646 C CB  . GLU B 1 185 ? 5.996   16.027  -61.897 1.00 55.15  ? 185  GLU B CB  1 
ATOM   5647 C CG  . GLU B 1 185 ? 7.446   16.465  -61.758 1.00 58.53  ? 185  GLU B CG  1 
ATOM   5648 C CD  . GLU B 1 185 ? 8.424   15.548  -62.483 1.00 62.53  ? 185  GLU B CD  1 
ATOM   5649 O OE1 . GLU B 1 185 ? 8.256   14.301  -62.443 1.00 64.08  ? 185  GLU B OE1 1 
ATOM   5650 O OE2 . GLU B 1 185 ? 9.376   16.088  -63.092 1.00 64.96  ? 185  GLU B OE2 1 
ATOM   5651 N N   . ASN B 1 186 ? 2.869   15.812  -60.788 1.00 51.92  ? 186  ASN B N   1 
ATOM   5652 C CA  . ASN B 1 186 ? 1.583   15.238  -61.222 1.00 51.55  ? 186  ASN B CA  1 
ATOM   5653 C C   . ASN B 1 186 ? 0.374   15.476  -60.337 1.00 51.22  ? 186  ASN B C   1 
ATOM   5654 O O   . ASN B 1 186 ? -0.744  15.404  -60.822 1.00 52.68  ? 186  ASN B O   1 
ATOM   5655 C CB  . ASN B 1 186 ? 1.722   13.730  -61.428 1.00 50.44  ? 186  ASN B CB  1 
ATOM   5656 C CG  . ASN B 1 186 ? 2.818   13.398  -62.390 1.00 50.57  ? 186  ASN B CG  1 
ATOM   5657 O OD1 . ASN B 1 186 ? 2.683   13.587  -63.605 1.00 52.81  ? 186  ASN B OD1 1 
ATOM   5658 N ND2 . ASN B 1 186 ? 3.932   12.948  -61.860 1.00 48.10  ? 186  ASN B ND2 1 
ATOM   5659 N N   . ILE B 1 187 ? 0.583   15.734  -59.049 1.00 49.93  ? 187  ILE B N   1 
ATOM   5660 C CA  . ILE B 1 187 ? -0.515  15.744  -58.095 1.00 49.45  ? 187  ILE B CA  1 
ATOM   5661 C C   . ILE B 1 187 ? -1.620  16.739  -58.483 1.00 51.16  ? 187  ILE B C   1 
ATOM   5662 O O   . ILE B 1 187 ? -2.804  16.398  -58.418 1.00 51.12  ? 187  ILE B O   1 
ATOM   5663 C CB  . ILE B 1 187 ? -0.010  15.874  -56.609 1.00 48.55  ? 187  ILE B CB  1 
ATOM   5664 C CG1 . ILE B 1 187 ? -0.936  15.112  -55.649 1.00 47.56  ? 187  ILE B CG1 1 
ATOM   5665 C CG2 . ILE B 1 187 ? 0.256   17.359  -56.193 1.00 49.36  ? 187  ILE B CG2 1 
ATOM   5666 C CD1 . ILE B 1 187 ? -0.954  13.559  -55.892 1.00 46.19  ? 187  ILE B CD1 1 
ATOM   5667 N N   . ALA B 1 188 ? -1.226  17.936  -58.932 1.00 52.41  ? 188  ALA B N   1 
ATOM   5668 C CA  . ALA B 1 188 ? -2.180  18.956  -59.386 1.00 54.49  ? 188  ALA B CA  1 
ATOM   5669 C C   . ALA B 1 188 ? -3.244  18.339  -60.299 1.00 55.64  ? 188  ALA B C   1 
ATOM   5670 O O   . ALA B 1 188 ? -4.428  18.689  -60.213 1.00 56.49  ? 188  ALA B O   1 
ATOM   5671 C CB  . ALA B 1 188 ? -1.463  20.119  -60.089 1.00 55.57  ? 188  ALA B CB  1 
ATOM   5672 N N   . ALA B 1 189 ? -2.812  17.392  -61.131 1.00 55.36  ? 189  ALA B N   1 
ATOM   5673 C CA  . ALA B 1 189 ? -3.700  16.654  -62.032 1.00 56.44  ? 189  ALA B CA  1 
ATOM   5674 C C   . ALA B 1 189 ? -4.817  15.909  -61.285 1.00 56.35  ? 189  ALA B C   1 
ATOM   5675 O O   . ALA B 1 189 ? -5.844  15.575  -61.897 1.00 57.70  ? 189  ALA B O   1 
ATOM   5676 C CB  . ALA B 1 189 ? -2.894  15.680  -62.893 1.00 55.46  ? 189  ALA B CB  1 
ATOM   5677 N N   . PHE B 1 190 ? -4.605  15.647  -59.987 1.00 54.62  ? 190  PHE B N   1 
ATOM   5678 C CA  . PHE B 1 190 ? -5.574  14.953  -59.145 1.00 54.38  ? 190  PHE B CA  1 
ATOM   5679 C C   . PHE B 1 190 ? -6.278  15.937  -58.200 1.00 55.88  ? 190  PHE B C   1 
ATOM   5680 O O   . PHE B 1 190 ? -7.132  15.536  -57.394 1.00 56.29  ? 190  PHE B O   1 
ATOM   5681 C CB  . PHE B 1 190 ? -4.887  13.897  -58.284 1.00 52.21  ? 190  PHE B CB  1 
ATOM   5682 C CG  . PHE B 1 190 ? -4.196  12.804  -59.054 1.00 51.67  ? 190  PHE B CG  1 
ATOM   5683 C CD1 . PHE B 1 190 ? -2.895  12.981  -59.532 1.00 50.59  ? 190  PHE B CD1 1 
ATOM   5684 C CD2 . PHE B 1 190 ? -4.824  11.570  -59.253 1.00 50.54  ? 190  PHE B CD2 1 
ATOM   5685 C CE1 . PHE B 1 190 ? -2.242  11.958  -60.214 1.00 50.78  ? 190  PHE B CE1 1 
ATOM   5686 C CE2 . PHE B 1 190 ? -4.183  10.540  -59.933 1.00 49.53  ? 190  PHE B CE2 1 
ATOM   5687 C CZ  . PHE B 1 190 ? -2.890  10.729  -60.418 1.00 49.62  ? 190  PHE B CZ  1 
ATOM   5688 N N   . GLY B 1 191 ? -5.905  17.216  -58.274 1.00 56.74  ? 191  GLY B N   1 
ATOM   5689 C CA  . GLY B 1 191 ? -6.435  18.218  -57.365 1.00 57.12  ? 191  GLY B CA  1 
ATOM   5690 C C   . GLY B 1 191 ? -5.618  18.472  -56.107 1.00 56.09  ? 191  GLY B C   1 
ATOM   5691 O O   . GLY B 1 191 ? -6.023  19.272  -55.252 1.00 56.67  ? 191  GLY B O   1 
ATOM   5692 N N   . GLY B 1 192 ? -4.474  17.806  -55.966 1.00 54.78  ? 192  GLY B N   1 
ATOM   5693 C CA  . GLY B 1 192 ? -3.576  18.087  -54.835 1.00 53.43  ? 192  GLY B CA  1 
ATOM   5694 C C   . GLY B 1 192 ? -2.768  19.348  -55.075 1.00 54.13  ? 192  GLY B C   1 
ATOM   5695 O O   . GLY B 1 192 ? -2.500  19.702  -56.218 1.00 55.26  ? 192  GLY B O   1 
ATOM   5696 N N   . ASP B 1 193 ? -2.377  20.032  -54.004 1.00 54.11  ? 193  ASP B N   1 
ATOM   5697 C CA  . ASP B 1 193 ? -1.578  21.254  -54.107 1.00 54.97  ? 193  ASP B CA  1 
ATOM   5698 C C   . ASP B 1 193 ? -0.112  20.933  -53.931 1.00 54.10  ? 193  ASP B C   1 
ATOM   5699 O O   . ASP B 1 193 ? 0.313   20.667  -52.813 1.00 53.12  ? 193  ASP B O   1 
ATOM   5700 C CB  . ASP B 1 193 ? -1.977  22.233  -53.016 1.00 55.45  ? 193  ASP B CB  1 
ATOM   5701 C CG  . ASP B 1 193 ? -1.315  23.589  -53.169 1.00 57.08  ? 193  ASP B CG  1 
ATOM   5702 O OD1 . ASP B 1 193 ? -0.540  23.788  -54.131 1.00 57.21  ? 193  ASP B OD1 1 
ATOM   5703 O OD2 . ASP B 1 193 ? -1.580  24.460  -52.312 1.00 58.79  ? 193  ASP B OD2 1 
ATOM   5704 N N   . PRO B 1 194 ? 0.678   20.975  -55.023 1.00 54.85  ? 194  PRO B N   1 
ATOM   5705 C CA  . PRO B 1 194 ? 2.088   20.617  -54.862 1.00 54.29  ? 194  PRO B CA  1 
ATOM   5706 C C   . PRO B 1 194 ? 2.796   21.635  -53.980 1.00 54.87  ? 194  PRO B C   1 
ATOM   5707 O O   . PRO B 1 194 ? 3.942   21.429  -53.594 1.00 54.43  ? 194  PRO B O   1 
ATOM   5708 C CB  . PRO B 1 194 ? 2.638   20.688  -56.289 1.00 55.22  ? 194  PRO B CB  1 
ATOM   5709 C CG  . PRO B 1 194 ? 1.740   21.687  -56.984 1.00 56.42  ? 194  PRO B CG  1 
ATOM   5710 C CD  . PRO B 1 194 ? 0.377   21.431  -56.395 1.00 56.18  ? 194  PRO B CD  1 
ATOM   5711 N N   . MET B 1 195 ? 2.117   22.728  -53.658 1.00 56.49  ? 195  MET B N   1 
ATOM   5712 C CA  . MET B 1 195 ? 2.726   23.739  -52.794 1.00 57.41  ? 195  MET B CA  1 
ATOM   5713 C C   . MET B 1 195 ? 2.358   23.567  -51.314 1.00 56.15  ? 195  MET B C   1 
ATOM   5714 O O   . MET B 1 195 ? 2.609   24.442  -50.479 1.00 56.42  ? 195  MET B O   1 
ATOM   5715 C CB  . MET B 1 195 ? 2.463   25.134  -53.325 1.00 59.49  ? 195  MET B CB  1 
ATOM   5716 C CG  . MET B 1 195 ? 3.163   25.359  -54.654 1.00 62.20  ? 195  MET B CG  1 
ATOM   5717 S SD  . MET B 1 195 ? 3.047   27.079  -55.187 1.00 69.49  ? 195  MET B SD  1 
ATOM   5718 C CE  . MET B 1 195 ? 3.973   27.856  -53.843 1.00 69.56  ? 195  MET B CE  1 
ATOM   5719 N N   . SER B 1 196 ? 1.831   22.383  -51.006 1.00 54.40  ? 196  SER B N   1 
ATOM   5720 C CA  . SER B 1 196 ? 1.434   22.034  -49.663 1.00 53.30  ? 196  SER B CA  1 
ATOM   5721 C C   . SER B 1 196 ? 1.473   20.534  -49.550 1.00 51.69  ? 196  SER B C   1 
ATOM   5722 O O   . SER B 1 196 ? 0.450   19.847  -49.636 1.00 51.60  ? 196  SER B O   1 
ATOM   5723 C CB  . SER B 1 196 ? 0.050   22.575  -49.316 1.00 54.16  ? 196  SER B CB  1 
ATOM   5724 O OG  . SER B 1 196 ? -0.348  22.128  -48.034 1.00 53.71  ? 196  SER B OG  1 
ATOM   5725 N N   . VAL B 1 197 ? 2.686   20.039  -49.350 1.00 50.63  ? 197  VAL B N   1 
ATOM   5726 C CA  . VAL B 1 197 ? 2.936   18.623  -49.219 1.00 49.06  ? 197  VAL B CA  1 
ATOM   5727 C C   . VAL B 1 197 ? 3.435   18.370  -47.800 1.00 48.33  ? 197  VAL B C   1 
ATOM   5728 O O   . VAL B 1 197 ? 4.352   19.033  -47.339 1.00 49.12  ? 197  VAL B O   1 
ATOM   5729 C CB  . VAL B 1 197 ? 3.970   18.152  -50.260 1.00 48.57  ? 197  VAL B CB  1 
ATOM   5730 C CG1 . VAL B 1 197 ? 4.411   16.701  -49.971 1.00 48.01  ? 197  VAL B CG1 1 
ATOM   5731 C CG2 . VAL B 1 197 ? 3.389   18.285  -51.656 1.00 47.76  ? 197  VAL B CG2 1 
ATOM   5732 N N   . THR B 1 198 ? 2.817   17.416  -47.116 1.00 47.30  ? 198  THR B N   1 
ATOM   5733 C CA  . THR B 1 198 ? 3.196   17.047  -45.780 1.00 46.01  ? 198  THR B CA  1 
ATOM   5734 C C   . THR B 1 198 ? 3.621   15.615  -45.832 1.00 45.03  ? 198  THR B C   1 
ATOM   5735 O O   . THR B 1 198 ? 2.828   14.761  -46.219 1.00 45.71  ? 198  THR B O   1 
ATOM   5736 C CB  . THR B 1 198 ? 2.007   17.180  -44.852 1.00 46.12  ? 198  THR B CB  1 
ATOM   5737 O OG1 . THR B 1 198 ? 1.667   18.563  -44.752 1.00 48.31  ? 198  THR B OG1 1 
ATOM   5738 C CG2 . THR B 1 198 ? 2.316   16.637  -43.460 1.00 45.11  ? 198  THR B CG2 1 
ATOM   5739 N N   . LEU B 1 199 ? 4.874   15.343  -45.468 1.00 44.35  ? 199  LEU B N   1 
ATOM   5740 C CA  . LEU B 1 199 ? 5.351   13.961  -45.348 1.00 43.21  ? 199  LEU B CA  1 
ATOM   5741 C C   . LEU B 1 199 ? 4.929   13.481  -43.981 1.00 43.20  ? 199  LEU B C   1 
ATOM   5742 O O   . LEU B 1 199 ? 4.988   14.246  -43.020 1.00 43.18  ? 199  LEU B O   1 
ATOM   5743 C CB  . LEU B 1 199 ? 6.874   13.870  -45.458 1.00 42.75  ? 199  LEU B CB  1 
ATOM   5744 C CG  . LEU B 1 199 ? 7.621   14.576  -46.595 1.00 42.51  ? 199  LEU B CG  1 
ATOM   5745 C CD1 . LEU B 1 199 ? 9.135   14.305  -46.525 1.00 39.30  ? 199  LEU B CD1 1 
ATOM   5746 C CD2 . LEU B 1 199 ? 7.049   14.226  -47.976 1.00 41.58  ? 199  LEU B CD2 1 
ATOM   5747 N N   . PHE B 1 200 ? 4.468   12.239  -43.897 1.00 42.84  ? 200  PHE B N   1 
ATOM   5748 C CA  . PHE B 1 200 ? 4.202   11.626  -42.604 1.00 43.07  ? 200  PHE B CA  1 
ATOM   5749 C C   . PHE B 1 200 ? 4.439   10.131  -42.668 1.00 43.26  ? 200  PHE B C   1 
ATOM   5750 O O   . PHE B 1 200 ? 4.200   9.491   -43.700 1.00 44.41  ? 200  PHE B O   1 
ATOM   5751 C CB  . PHE B 1 200 ? 2.828   12.026  -42.024 1.00 43.56  ? 200  PHE B CB  1 
ATOM   5752 C CG  . PHE B 1 200 ? 1.627   11.249  -42.555 1.00 44.72  ? 200  PHE B CG  1 
ATOM   5753 C CD1 . PHE B 1 200 ? 1.316   11.212  -43.908 1.00 44.62  ? 200  PHE B CD1 1 
ATOM   5754 C CD2 . PHE B 1 200 ? 0.743   10.641  -41.664 1.00 45.75  ? 200  PHE B CD2 1 
ATOM   5755 C CE1 . PHE B 1 200 ? 0.182   10.525  -44.373 1.00 44.07  ? 200  PHE B CE1 1 
ATOM   5756 C CE2 . PHE B 1 200 ? -0.404  9.964   -42.125 1.00 45.34  ? 200  PHE B CE2 1 
ATOM   5757 C CZ  . PHE B 1 200 ? -0.672  9.903   -43.479 1.00 44.65  ? 200  PHE B CZ  1 
ATOM   5758 N N   . GLY B 1 201 ? 4.973   9.582   -41.590 1.00 42.61  ? 201  GLY B N   1 
ATOM   5759 C CA  . GLY B 1 201 ? 5.408   8.208   -41.601 1.00 42.24  ? 201  GLY B CA  1 
ATOM   5760 C C   . GLY B 1 201 ? 5.583   7.761   -40.186 1.00 42.53  ? 201  GLY B C   1 
ATOM   5761 O O   . GLY B 1 201 ? 5.655   8.594   -39.289 1.00 42.47  ? 201  GLY B O   1 
ATOM   5762 N N   . GLU B 1 202 ? 5.638   6.448   -39.973 1.00 42.73  ? 202  GLU B N   1 
ATOM   5763 C CA  . GLU B 1 202 ? 5.835   5.928   -38.628 1.00 43.02  ? 202  GLU B CA  1 
ATOM   5764 C C   . GLU B 1 202 ? 7.004   4.944   -38.564 1.00 43.34  ? 202  GLU B C   1 
ATOM   5765 O O   . GLU B 1 202 ? 7.287   4.247   -39.546 1.00 43.28  ? 202  GLU B O   1 
ATOM   5766 C CB  . GLU B 1 202 ? 4.524   5.346   -38.103 1.00 43.31  ? 202  GLU B CB  1 
ATOM   5767 C CG  . GLU B 1 202 ? 4.546   4.838   -36.676 1.00 44.44  ? 202  GLU B CG  1 
ATOM   5768 C CD  . GLU B 1 202 ? 4.995   3.374   -36.592 1.00 45.20  ? 202  GLU B CD  1 
ATOM   5769 O OE1 . GLU B 1 202 ? 5.318   2.821   -37.649 1.00 43.59  ? 202  GLU B OE1 1 
ATOM   5770 O OE2 . GLU B 1 202 ? 5.042   2.789   -35.480 1.00 45.93  ? 202  GLU B OE2 1 
ATOM   5771 N N   . SER B 1 203 ? 7.689   4.915   -37.411 1.00 43.67  ? 203  SER B N   1 
ATOM   5772 C CA  . SER B 1 203 ? 8.857   4.053   -37.177 1.00 43.35  ? 203  SER B CA  1 
ATOM   5773 C C   . SER B 1 203 ? 9.917   4.305   -38.257 1.00 43.42  ? 203  SER B C   1 
ATOM   5774 O O   . SER B 1 203 ? 10.317  5.460   -38.468 1.00 43.29  ? 203  SER B O   1 
ATOM   5775 C CB  . SER B 1 203 ? 8.428   2.589   -37.126 1.00 43.66  ? 203  SER B CB  1 
ATOM   5776 O OG  . SER B 1 203 ? 9.463   1.749   -36.644 1.00 43.70  ? 203  SER B OG  1 
ATOM   5777 N N   . ALA B 1 204 ? 10.336  3.257   -38.974 1.00 43.47  ? 204  ALA B N   1 
ATOM   5778 C CA  . ALA B 1 204 ? 11.259  3.442   -40.099 1.00 43.20  ? 204  ALA B CA  1 
ATOM   5779 C C   . ALA B 1 204 ? 10.765  4.541   -41.065 1.00 42.78  ? 204  ALA B C   1 
ATOM   5780 O O   . ALA B 1 204 ? 11.554  5.338   -41.556 1.00 42.96  ? 204  ALA B O   1 
ATOM   5781 C CB  . ALA B 1 204 ? 11.538  2.118   -40.831 1.00 42.13  ? 204  ALA B CB  1 
ATOM   5782 N N   . GLY B 1 205 ? 9.463   4.593   -41.317 1.00 42.67  ? 205  GLY B N   1 
ATOM   5783 C CA  . GLY B 1 205 ? 8.904   5.655   -42.139 1.00 43.26  ? 205  GLY B CA  1 
ATOM   5784 C C   . GLY B 1 205 ? 9.114   7.024   -41.503 1.00 43.83  ? 205  GLY B C   1 
ATOM   5785 O O   . GLY B 1 205 ? 9.257   8.059   -42.199 1.00 43.75  ? 205  GLY B O   1 
ATOM   5786 N N   . ALA B 1 206 ? 9.165   7.037   -40.171 1.00 43.79  ? 206  ALA B N   1 
ATOM   5787 C CA  . ALA B 1 206 ? 9.345   8.283   -39.464 1.00 43.40  ? 206  ALA B CA  1 
ATOM   5788 C C   . ALA B 1 206 ? 10.770  8.757   -39.635 1.00 43.21  ? 206  ALA B C   1 
ATOM   5789 O O   . ALA B 1 206 ? 11.016  9.953   -39.832 1.00 43.90  ? 206  ALA B O   1 
ATOM   5790 C CB  . ALA B 1 206 ? 8.986   8.114   -38.017 1.00 44.00  ? 206  ALA B CB  1 
ATOM   5791 N N   . ALA B 1 207 ? 11.711  7.819   -39.579 1.00 42.67  ? 207  ALA B N   1 
ATOM   5792 C CA  . ALA B 1 207 ? 13.119  8.147   -39.737 1.00 42.15  ? 207  ALA B CA  1 
ATOM   5793 C C   . ALA B 1 207 ? 13.405  8.566   -41.171 1.00 42.77  ? 207  ALA B C   1 
ATOM   5794 O O   . ALA B 1 207 ? 14.257  9.460   -41.412 1.00 43.71  ? 207  ALA B O   1 
ATOM   5795 C CB  . ALA B 1 207 ? 13.962  7.003   -39.345 1.00 42.27  ? 207  ALA B CB  1 
ATOM   5796 N N   . SER B 1 208 ? 12.685  7.950   -42.117 1.00 41.94  ? 208  SER B N   1 
ATOM   5797 C CA  . SER B 1 208 ? 12.780  8.331   -43.516 1.00 42.10  ? 208  SER B CA  1 
ATOM   5798 C C   . SER B 1 208 ? 12.331  9.769   -43.700 1.00 42.13  ? 208  SER B C   1 
ATOM   5799 O O   . SER B 1 208 ? 13.006  10.547  -44.347 1.00 43.16  ? 208  SER B O   1 
ATOM   5800 C CB  . SER B 1 208 ? 11.946  7.418   -44.384 1.00 42.22  ? 208  SER B CB  1 
ATOM   5801 O OG  . SER B 1 208 ? 12.378  6.067   -44.258 1.00 44.50  ? 208  SER B OG  1 
ATOM   5802 N N   . VAL B 1 209 ? 11.203  10.139  -43.117 1.00 41.45  ? 209  VAL B N   1 
ATOM   5803 C CA  . VAL B 1 209 ? 10.770  11.515  -43.169 1.00 41.48  ? 209  VAL B CA  1 
ATOM   5804 C C   . VAL B 1 209 ? 11.917  12.391  -42.639 1.00 42.93  ? 209  VAL B C   1 
ATOM   5805 O O   . VAL B 1 209 ? 12.284  13.424  -43.253 1.00 43.17  ? 209  VAL B O   1 
ATOM   5806 C CB  . VAL B 1 209 ? 9.521   11.727  -42.317 1.00 41.04  ? 209  VAL B CB  1 
ATOM   5807 C CG1 . VAL B 1 209 ? 9.214   13.209  -42.165 1.00 41.42  ? 209  VAL B CG1 1 
ATOM   5808 C CG2 . VAL B 1 209 ? 8.353   11.017  -42.922 1.00 40.62  ? 209  VAL B CG2 1 
ATOM   5809 N N   . GLY B 1 210 ? 12.508  11.952  -41.520 1.00 43.23  ? 210  GLY B N   1 
ATOM   5810 C CA  . GLY B 1 210 ? 13.566  12.712  -40.863 1.00 44.12  ? 210  GLY B CA  1 
ATOM   5811 C C   . GLY B 1 210 ? 14.724  12.902  -41.812 1.00 45.13  ? 210  GLY B C   1 
ATOM   5812 O O   . GLY B 1 210 ? 15.310  13.998  -41.891 1.00 46.34  ? 210  GLY B O   1 
ATOM   5813 N N   . MET B 1 211 ? 15.037  11.841  -42.558 1.00 44.70  ? 211  MET B N   1 
ATOM   5814 C CA  . MET B 1 211 ? 16.112  11.910  -43.557 1.00 45.31  ? 211  MET B CA  1 
ATOM   5815 C C   . MET B 1 211 ? 15.824  12.848  -44.717 1.00 45.33  ? 211  MET B C   1 
ATOM   5816 O O   . MET B 1 211 ? 16.722  13.547  -45.198 1.00 46.82  ? 211  MET B O   1 
ATOM   5817 C CB  . MET B 1 211 ? 16.547  10.529  -44.013 1.00 44.98  ? 211  MET B CB  1 
ATOM   5818 C CG  . MET B 1 211 ? 17.608  10.012  -43.072 1.00 47.28  ? 211  MET B CG  1 
ATOM   5819 S SD  . MET B 1 211 ? 17.351  8.294   -42.809 1.00 53.15  ? 211  MET B SD  1 
ATOM   5820 C CE  . MET B 1 211 ? 17.861  8.056   -41.123 1.00 51.46  ? 211  MET B CE  1 
ATOM   5821 N N   . HIS B 1 212 ? 14.573  12.917  -45.142 1.00 43.87  ? 212  HIS B N   1 
ATOM   5822 C CA  . HIS B 1 212 ? 14.245  13.937  -46.110 1.00 43.81  ? 212  HIS B CA  1 
ATOM   5823 C C   . HIS B 1 212 ? 14.424  15.334  -45.527 1.00 45.02  ? 212  HIS B C   1 
ATOM   5824 O O   . HIS B 1 212 ? 14.729  16.267  -46.264 1.00 46.90  ? 212  HIS B O   1 
ATOM   5825 C CB  . HIS B 1 212 ? 12.863  13.695  -46.690 1.00 42.42  ? 212  HIS B CB  1 
ATOM   5826 C CG  . HIS B 1 212 ? 12.771  12.408  -47.454 1.00 41.02  ? 212  HIS B CG  1 
ATOM   5827 N ND1 . HIS B 1 212 ? 13.368  12.232  -48.684 1.00 38.26  ? 212  HIS B ND1 1 
ATOM   5828 C CD2 . HIS B 1 212 ? 12.190  11.224  -47.143 1.00 36.43  ? 212  HIS B CD2 1 
ATOM   5829 C CE1 . HIS B 1 212 ? 13.146  11.002  -49.102 1.00 37.24  ? 212  HIS B CE1 1 
ATOM   5830 N NE2 . HIS B 1 212 ? 12.434  10.370  -48.187 1.00 35.77  ? 212  HIS B NE2 1 
ATOM   5831 N N   . ILE B 1 213 ? 14.266  15.484  -44.212 1.00 44.81  ? 213  ILE B N   1 
ATOM   5832 C CA  . ILE B 1 213 ? 14.423  16.789  -43.584 1.00 45.41  ? 213  ILE B CA  1 
ATOM   5833 C C   . ILE B 1 213 ? 15.886  17.198  -43.671 1.00 46.97  ? 213  ILE B C   1 
ATOM   5834 O O   . ILE B 1 213 ? 16.213  18.385  -43.882 1.00 48.63  ? 213  ILE B O   1 
ATOM   5835 C CB  . ILE B 1 213 ? 13.951  16.804  -42.095 1.00 44.91  ? 213  ILE B CB  1 
ATOM   5836 C CG1 . ILE B 1 213 ? 12.434  16.711  -42.012 1.00 42.64  ? 213  ILE B CG1 1 
ATOM   5837 C CG2 . ILE B 1 213 ? 14.444  18.089  -41.355 1.00 45.02  ? 213  ILE B CG2 1 
ATOM   5838 C CD1 . ILE B 1 213 ? 11.907  16.544  -40.632 1.00 42.37  ? 213  ILE B CD1 1 
ATOM   5839 N N   . LEU B 1 214 ? 16.759  16.204  -43.528 1.00 46.66  ? 214  LEU B N   1 
ATOM   5840 C CA  . LEU B 1 214 ? 18.192  16.452  -43.376 1.00 47.33  ? 214  LEU B CA  1 
ATOM   5841 C C   . LEU B 1 214 ? 18.954  16.307  -44.673 1.00 48.17  ? 214  LEU B C   1 
ATOM   5842 O O   . LEU B 1 214 ? 20.188  16.327  -44.677 1.00 49.17  ? 214  LEU B O   1 
ATOM   5843 C CB  . LEU B 1 214 ? 18.789  15.522  -42.324 1.00 46.74  ? 214  LEU B CB  1 
ATOM   5844 C CG  . LEU B 1 214 ? 18.157  15.481  -40.933 1.00 45.77  ? 214  LEU B CG  1 
ATOM   5845 C CD1 . LEU B 1 214 ? 18.740  14.290  -40.157 1.00 44.00  ? 214  LEU B CD1 1 
ATOM   5846 C CD2 . LEU B 1 214 ? 18.355  16.804  -40.188 1.00 43.67  ? 214  LEU B CD2 1 
ATOM   5847 N N   . SER B 1 215 ? 18.228  16.189  -45.779 1.00 48.25  ? 215  SER B N   1 
ATOM   5848 C CA  . SER B 1 215 ? 18.867  16.005  -47.073 1.00 49.30  ? 215  SER B CA  1 
ATOM   5849 C C   . SER B 1 215 ? 18.409  17.050  -48.078 1.00 50.77  ? 215  SER B C   1 
ATOM   5850 O O   . SER B 1 215 ? 17.303  16.962  -48.611 1.00 49.68  ? 215  SER B O   1 
ATOM   5851 C CB  . SER B 1 215 ? 18.607  14.595  -47.574 1.00 48.16  ? 215  SER B CB  1 
ATOM   5852 O OG  . SER B 1 215 ? 19.381  14.342  -48.722 1.00 49.00  ? 215  SER B OG  1 
ATOM   5853 N N   . LEU B 1 216 ? 19.271  18.039  -48.337 1.00 53.74  ? 216  LEU B N   1 
ATOM   5854 C CA  . LEU B 1 216 ? 18.897  19.230  -49.118 1.00 55.88  ? 216  LEU B CA  1 
ATOM   5855 C C   . LEU B 1 216 ? 18.099  18.967  -50.434 1.00 56.30  ? 216  LEU B C   1 
ATOM   5856 O O   . LEU B 1 216 ? 17.145  19.707  -50.726 1.00 56.46  ? 216  LEU B O   1 
ATOM   5857 C CB  . LEU B 1 216 ? 20.113  20.148  -49.367 1.00 58.29  ? 216  LEU B CB  1 
ATOM   5858 C CG  . LEU B 1 216 ? 19.790  21.626  -49.734 1.00 62.38  ? 216  LEU B CG  1 
ATOM   5859 C CD1 . LEU B 1 216 ? 19.372  22.452  -48.493 1.00 62.92  ? 216  LEU B CD1 1 
ATOM   5860 C CD2 . LEU B 1 216 ? 20.930  22.357  -50.498 1.00 66.72  ? 216  LEU B CD2 1 
ATOM   5861 N N   . PRO B 1 217 ? 18.467  17.915  -51.225 1.00 56.30  ? 217  PRO B N   1 
ATOM   5862 C CA  . PRO B 1 217 ? 17.674  17.674  -52.436 1.00 55.96  ? 217  PRO B CA  1 
ATOM   5863 C C   . PRO B 1 217 ? 16.229  17.253  -52.195 1.00 54.40  ? 217  PRO B C   1 
ATOM   5864 O O   . PRO B 1 217 ? 15.433  17.380  -53.117 1.00 55.32  ? 217  PRO B O   1 
ATOM   5865 C CB  . PRO B 1 217 ? 18.442  16.550  -53.148 1.00 56.11  ? 217  PRO B CB  1 
ATOM   5866 C CG  . PRO B 1 217 ? 19.828  16.733  -52.706 1.00 57.15  ? 217  PRO B CG  1 
ATOM   5867 C CD  . PRO B 1 217 ? 19.704  17.109  -51.249 1.00 56.68  ? 217  PRO B CD  1 
ATOM   5868 N N   . SER B 1 218 ? 15.885  16.747  -51.006 1.00 52.37  ? 218  SER B N   1 
ATOM   5869 C CA  . SER B 1 218 ? 14.473  16.426  -50.699 1.00 50.58  ? 218  SER B CA  1 
ATOM   5870 C C   . SER B 1 218 ? 13.676  17.655  -50.271 1.00 50.97  ? 218  SER B C   1 
ATOM   5871 O O   . SER B 1 218 ? 12.471  17.689  -50.428 1.00 50.08  ? 218  SER B O   1 
ATOM   5872 C CB  . SER B 1 218 ? 14.328  15.338  -49.624 1.00 48.78  ? 218  SER B CB  1 
ATOM   5873 O OG  . SER B 1 218 ? 14.786  14.087  -50.069 1.00 46.66  ? 218  SER B OG  1 
ATOM   5874 N N   . ARG B 1 219 ? 14.361  18.657  -49.735 1.00 52.61  ? 219  ARG B N   1 
ATOM   5875 C CA  . ARG B 1 219 ? 13.701  19.801  -49.092 1.00 53.65  ? 219  ARG B CA  1 
ATOM   5876 C C   . ARG B 1 219 ? 12.760  20.648  -49.970 1.00 54.22  ? 219  ARG B C   1 
ATOM   5877 O O   . ARG B 1 219 ? 11.808  21.211  -49.461 1.00 54.91  ? 219  ARG B O   1 
ATOM   5878 C CB  . ARG B 1 219 ? 14.706  20.672  -48.323 1.00 54.46  ? 219  ARG B CB  1 
ATOM   5879 C CG  . ARG B 1 219 ? 15.291  19.986  -47.069 1.00 55.61  ? 219  ARG B CG  1 
ATOM   5880 C CD  . ARG B 1 219 ? 14.280  19.787  -45.912 1.00 56.74  ? 219  ARG B CD  1 
ATOM   5881 N NE  . ARG B 1 219 ? 13.804  21.062  -45.371 1.00 61.10  ? 219  ARG B NE  1 
ATOM   5882 C CZ  . ARG B 1 219 ? 14.478  21.819  -44.503 1.00 63.37  ? 219  ARG B CZ  1 
ATOM   5883 N NH1 . ARG B 1 219 ? 15.665  21.437  -44.053 1.00 65.42  ? 219  ARG B NH1 1 
ATOM   5884 N NH2 . ARG B 1 219 ? 13.968  22.967  -44.075 1.00 64.90  ? 219  ARG B NH2 1 
ATOM   5885 N N   . SER B 1 220 ? 12.989  20.699  -51.274 1.00 55.00  ? 220  SER B N   1 
ATOM   5886 C CA  . SER B 1 220 ? 12.081  21.395  -52.184 1.00 55.81  ? 220  SER B CA  1 
ATOM   5887 C C   . SER B 1 220 ? 10.830  20.582  -52.580 1.00 54.51  ? 220  SER B C   1 
ATOM   5888 O O   . SER B 1 220 ? 9.989   21.061  -53.332 1.00 55.35  ? 220  SER B O   1 
ATOM   5889 C CB  . SER B 1 220 ? 12.844  21.822  -53.448 1.00 57.94  ? 220  SER B CB  1 
ATOM   5890 O OG  . SER B 1 220 ? 13.449  20.697  -54.091 1.00 58.31  ? 220  SER B OG  1 
ATOM   5891 N N   . LEU B 1 221 ? 10.709  19.359  -52.077 1.00 52.66  ? 221  LEU B N   1 
ATOM   5892 C CA  . LEU B 1 221 ? 9.628   18.454  -52.470 1.00 50.91  ? 221  LEU B CA  1 
ATOM   5893 C C   . LEU B 1 221 ? 8.531   18.348  -51.413 1.00 50.25  ? 221  LEU B C   1 
ATOM   5894 O O   . LEU B 1 221 ? 7.537   17.654  -51.614 1.00 50.16  ? 221  LEU B O   1 
ATOM   5895 C CB  . LEU B 1 221 ? 10.196  17.064  -52.744 1.00 49.68  ? 221  LEU B CB  1 
ATOM   5896 C CG  . LEU B 1 221 ? 11.475  16.988  -53.579 1.00 49.97  ? 221  LEU B CG  1 
ATOM   5897 C CD1 . LEU B 1 221 ? 11.952  15.526  -53.648 1.00 48.69  ? 221  LEU B CD1 1 
ATOM   5898 C CD2 . LEU B 1 221 ? 11.277  17.556  -54.964 1.00 48.11  ? 221  LEU B CD2 1 
ATOM   5899 N N   . PHE B 1 222 ? 8.717   19.018  -50.279 1.00 50.07  ? 222  PHE B N   1 
ATOM   5900 C CA  . PHE B 1 222 ? 7.725   19.002  -49.200 1.00 49.16  ? 222  PHE B CA  1 
ATOM   5901 C C   . PHE B 1 222 ? 7.905   20.221  -48.302 1.00 50.05  ? 222  PHE B C   1 
ATOM   5902 O O   . PHE B 1 222 ? 8.987   20.790  -48.243 1.00 50.69  ? 222  PHE B O   1 
ATOM   5903 C CB  . PHE B 1 222 ? 7.804   17.705  -48.383 1.00 46.92  ? 222  PHE B CB  1 
ATOM   5904 C CG  . PHE B 1 222 ? 9.048   17.568  -47.553 1.00 45.19  ? 222  PHE B CG  1 
ATOM   5905 C CD1 . PHE B 1 222 ? 10.258  17.179  -48.131 1.00 43.53  ? 222  PHE B CD1 1 
ATOM   5906 C CD2 . PHE B 1 222 ? 9.009   17.791  -46.176 1.00 45.22  ? 222  PHE B CD2 1 
ATOM   5907 C CE1 . PHE B 1 222 ? 11.417  17.026  -47.351 1.00 42.82  ? 222  PHE B CE1 1 
ATOM   5908 C CE2 . PHE B 1 222 ? 10.175  17.651  -45.374 1.00 43.51  ? 222  PHE B CE2 1 
ATOM   5909 C CZ  . PHE B 1 222 ? 11.377  17.260  -45.967 1.00 42.48  ? 222  PHE B CZ  1 
ATOM   5910 N N   . HIS B 1 223 ? 6.847   20.579  -47.585 1.00 50.47  ? 223  HIS B N   1 
ATOM   5911 C CA  . HIS B 1 223 ? 6.794   21.819  -46.829 1.00 52.33  ? 223  HIS B CA  1 
ATOM   5912 C C   . HIS B 1 223 ? 6.704   21.614  -45.318 1.00 51.23  ? 223  HIS B C   1 
ATOM   5913 O O   . HIS B 1 223 ? 6.978   22.554  -44.559 1.00 51.85  ? 223  HIS B O   1 
ATOM   5914 C CB  . HIS B 1 223 ? 5.621   22.670  -47.322 1.00 54.02  ? 223  HIS B CB  1 
ATOM   5915 C CG  . HIS B 1 223 ? 5.628   22.891  -48.803 1.00 57.79  ? 223  HIS B CG  1 
ATOM   5916 N ND1 . HIS B 1 223 ? 5.240   21.917  -49.704 1.00 58.83  ? 223  HIS B ND1 1 
ATOM   5917 C CD2 . HIS B 1 223 ? 5.991   23.970  -49.544 1.00 61.52  ? 223  HIS B CD2 1 
ATOM   5918 C CE1 . HIS B 1 223 ? 5.374   22.382  -50.934 1.00 61.34  ? 223  HIS B CE1 1 
ATOM   5919 N NE2 . HIS B 1 223 ? 5.819   23.629  -50.866 1.00 63.00  ? 223  HIS B NE2 1 
ATOM   5920 N N   . ARG B 1 224 ? 6.329   20.394  -44.901 1.00 49.20  ? 224  ARG B N   1 
ATOM   5921 C CA  . ARG B 1 224 ? 6.070   20.033  -43.500 1.00 47.79  ? 224  ARG B CA  1 
ATOM   5922 C C   . ARG B 1 224 ? 6.226   18.533  -43.298 1.00 46.22  ? 224  ARG B C   1 
ATOM   5923 O O   . ARG B 1 224 ? 6.155   17.746  -44.263 1.00 45.42  ? 224  ARG B O   1 
ATOM   5924 C CB  . ARG B 1 224 ? 4.643   20.381  -43.137 1.00 48.60  ? 224  ARG B CB  1 
ATOM   5925 C CG  . ARG B 1 224 ? 4.447   21.759  -42.620 1.00 52.15  ? 224  ARG B CG  1 
ATOM   5926 C CD  . ARG B 1 224 ? 2.979   22.077  -42.554 1.00 55.86  ? 224  ARG B CD  1 
ATOM   5927 N NE  . ARG B 1 224 ? 2.399   22.197  -43.886 1.00 60.56  ? 224  ARG B NE  1 
ATOM   5928 C CZ  . ARG B 1 224 ? 2.412   23.313  -44.617 1.00 62.50  ? 224  ARG B CZ  1 
ATOM   5929 N NH1 . ARG B 1 224 ? 2.989   24.411  -44.158 1.00 61.57  ? 224  ARG B NH1 1 
ATOM   5930 N NH2 . ARG B 1 224 ? 1.858   23.314  -45.823 1.00 63.47  ? 224  ARG B NH2 1 
ATOM   5931 N N   . ALA B 1 225 ? 6.387   18.121  -42.041 1.00 44.79  ? 225  ALA B N   1 
ATOM   5932 C CA  . ALA B 1 225 ? 6.661   16.729  -41.756 1.00 42.74  ? 225  ALA B CA  1 
ATOM   5933 C C   . ALA B 1 225 ? 6.081   16.252  -40.434 1.00 42.64  ? 225  ALA B C   1 
ATOM   5934 O O   . ALA B 1 225 ? 5.887   17.050  -39.507 1.00 42.70  ? 225  ALA B O   1 
ATOM   5935 C CB  . ALA B 1 225 ? 8.128   16.489  -41.782 1.00 42.82  ? 225  ALA B CB  1 
ATOM   5936 N N   . VAL B 1 226 ? 5.809   14.939  -40.375 1.00 41.44  ? 226  VAL B N   1 
ATOM   5937 C CA  . VAL B 1 226 ? 5.289   14.273  -39.206 1.00 41.06  ? 226  VAL B CA  1 
ATOM   5938 C C   . VAL B 1 226 ? 6.075   12.977  -38.995 1.00 41.45  ? 226  VAL B C   1 
ATOM   5939 O O   . VAL B 1 226 ? 6.081   12.075  -39.854 1.00 41.18  ? 226  VAL B O   1 
ATOM   5940 C CB  . VAL B 1 226 ? 3.793   13.901  -39.333 1.00 40.97  ? 226  VAL B CB  1 
ATOM   5941 C CG1 . VAL B 1 226 ? 3.286   13.301  -38.040 1.00 41.63  ? 226  VAL B CG1 1 
ATOM   5942 C CG2 . VAL B 1 226 ? 2.924   15.080  -39.737 1.00 41.39  ? 226  VAL B CG2 1 
ATOM   5943 N N   . LEU B 1 227 ? 6.722   12.888  -37.835 1.00 41.55  ? 227  LEU B N   1 
ATOM   5944 C CA  . LEU B 1 227 ? 7.522   11.736  -37.479 1.00 41.06  ? 227  LEU B CA  1 
ATOM   5945 C C   . LEU B 1 227 ? 6.848   11.109  -36.295 1.00 41.31  ? 227  LEU B C   1 
ATOM   5946 O O   . LEU B 1 227 ? 6.812   11.698  -35.206 1.00 41.76  ? 227  LEU B O   1 
ATOM   5947 C CB  . LEU B 1 227 ? 8.963   12.142  -37.110 1.00 40.95  ? 227  LEU B CB  1 
ATOM   5948 C CG  . LEU B 1 227 ? 9.814   12.844  -38.168 1.00 40.14  ? 227  LEU B CG  1 
ATOM   5949 C CD1 . LEU B 1 227 ? 9.515   14.327  -38.242 1.00 39.62  ? 227  LEU B CD1 1 
ATOM   5950 C CD2 . LEU B 1 227 ? 11.231  12.663  -37.796 1.00 40.95  ? 227  LEU B CD2 1 
ATOM   5951 N N   . GLN B 1 228 ? 6.334   9.905   -36.511 1.00 41.03  ? 228  GLN B N   1 
ATOM   5952 C CA  . GLN B 1 228 ? 5.592   9.201   -35.513 1.00 41.03  ? 228  GLN B CA  1 
ATOM   5953 C C   . GLN B 1 228 ? 6.445   8.015   -35.075 1.00 41.53  ? 228  GLN B C   1 
ATOM   5954 O O   . GLN B 1 228 ? 6.731   7.109   -35.873 1.00 41.56  ? 228  GLN B O   1 
ATOM   5955 C CB  . GLN B 1 228 ? 4.285   8.689   -36.104 1.00 41.18  ? 228  GLN B CB  1 
ATOM   5956 C CG  . GLN B 1 228 ? 3.300   9.723   -36.631 1.00 42.42  ? 228  GLN B CG  1 
ATOM   5957 C CD  . GLN B 1 228 ? 2.110   9.092   -37.383 1.00 45.43  ? 228  GLN B CD  1 
ATOM   5958 O OE1 . GLN B 1 228 ? 1.421   9.774   -38.126 1.00 46.39  ? 228  GLN B OE1 1 
ATOM   5959 N NE2 . GLN B 1 228 ? 1.877   7.778   -37.192 1.00 47.44  ? 228  GLN B NE2 1 
ATOM   5960 N N   . SER B 1 229 ? 6.843   8.006   -33.803 1.00 41.75  ? 229  SER B N   1 
ATOM   5961 C CA  . SER B 1 229 ? 7.572   6.864   -33.230 1.00 41.38  ? 229  SER B CA  1 
ATOM   5962 C C   . SER B 1 229 ? 8.835   6.520   -34.001 1.00 41.10  ? 229  SER B C   1 
ATOM   5963 O O   . SER B 1 229 ? 9.106   5.337   -34.260 1.00 41.25  ? 229  SER B O   1 
ATOM   5964 C CB  . SER B 1 229 ? 6.667   5.638   -33.155 1.00 41.99  ? 229  SER B CB  1 
ATOM   5965 O OG  . SER B 1 229 ? 5.644   5.841   -32.204 1.00 41.84  ? 229  SER B OG  1 
ATOM   5966 N N   . GLY B 1 230 ? 9.594   7.551   -34.381 1.00 40.66  ? 230  GLY B N   1 
ATOM   5967 C CA  . GLY B 1 230 ? 10.809  7.355   -35.170 1.00 41.18  ? 230  GLY B CA  1 
ATOM   5968 C C   . GLY B 1 230 ? 11.556  8.636   -35.525 1.00 41.79  ? 230  GLY B C   1 
ATOM   5969 O O   . GLY B 1 230 ? 10.967  9.731   -35.645 1.00 42.01  ? 230  GLY B O   1 
ATOM   5970 N N   . THR B 1 231 ? 12.868  8.490   -35.712 1.00 41.95  ? 231  THR B N   1 
ATOM   5971 C CA  . THR B 1 231 ? 13.751  9.620   -35.899 1.00 41.33  ? 231  THR B CA  1 
ATOM   5972 C C   . THR B 1 231 ? 14.960  9.272   -36.771 1.00 41.63  ? 231  THR B C   1 
ATOM   5973 O O   . THR B 1 231 ? 15.372  8.135   -36.826 1.00 41.69  ? 231  THR B O   1 
ATOM   5974 C CB  . THR B 1 231 ? 14.256  10.116  -34.534 1.00 42.32  ? 231  THR B CB  1 
ATOM   5975 O OG1 . THR B 1 231 ? 14.926  9.047   -33.856 1.00 40.47  ? 231  THR B OG1 1 
ATOM   5976 C CG2 . THR B 1 231 ? 13.108  10.655  -33.680 1.00 40.79  ? 231  THR B CG2 1 
ATOM   5977 N N   . PRO B 1 232 ? 15.530  10.261  -37.469 1.00 42.13  ? 232  PRO B N   1 
ATOM   5978 C CA  . PRO B 1 232 ? 16.741  9.950   -38.232 1.00 42.94  ? 232  PRO B CA  1 
ATOM   5979 C C   . PRO B 1 232 ? 17.958  9.746   -37.319 1.00 44.42  ? 232  PRO B C   1 
ATOM   5980 O O   . PRO B 1 232 ? 18.765  8.840   -37.552 1.00 45.69  ? 232  PRO B O   1 
ATOM   5981 C CB  . PRO B 1 232 ? 16.930  11.178  -39.113 1.00 43.54  ? 232  PRO B CB  1 
ATOM   5982 C CG  . PRO B 1 232 ? 16.151  12.292  -38.429 1.00 43.15  ? 232  PRO B CG  1 
ATOM   5983 C CD  . PRO B 1 232 ? 15.090  11.664  -37.610 1.00 41.75  ? 232  PRO B CD  1 
ATOM   5984 N N   . ASN B 1 233 ? 18.089  10.592  -36.293 1.00 44.80  ? 233  ASN B N   1 
ATOM   5985 C CA  . ASN B 1 233 ? 19.045  10.399  -35.188 1.00 45.13  ? 233  ASN B CA  1 
ATOM   5986 C C   . ASN B 1 233 ? 18.722  9.111   -34.446 1.00 45.23  ? 233  ASN B C   1 
ATOM   5987 O O   . ASN B 1 233 ? 17.672  8.508   -34.697 1.00 44.97  ? 233  ASN B O   1 
ATOM   5988 C CB  . ASN B 1 233 ? 18.966  11.589  -34.218 1.00 44.76  ? 233  ASN B CB  1 
ATOM   5989 C CG  . ASN B 1 233 ? 17.555  11.823  -33.692 1.00 43.90  ? 233  ASN B CG  1 
ATOM   5990 O OD1 . ASN B 1 233 ? 16.585  11.962  -34.463 1.00 42.77  ? 233  ASN B OD1 1 
ATOM   5991 N ND2 . ASN B 1 233 ? 17.424  11.846  -32.369 1.00 43.60  ? 233  ASN B ND2 1 
ATOM   5992 N N   . GLY B 1 234 ? 19.603  8.684   -33.541 1.00 46.26  ? 234  GLY B N   1 
ATOM   5993 C CA  . GLY B 1 234 ? 19.332  7.505   -32.707 1.00 46.84  ? 234  GLY B CA  1 
ATOM   5994 C C   . GLY B 1 234 ? 20.017  6.223   -33.164 1.00 47.88  ? 234  GLY B C   1 
ATOM   5995 O O   . GLY B 1 234 ? 20.617  6.182   -34.239 1.00 48.57  ? 234  GLY B O   1 
ATOM   5996 N N   . PRO B 1 235 ? 19.916  5.151   -32.355 1.00 48.51  ? 235  PRO B N   1 
ATOM   5997 C CA  . PRO B 1 235 ? 20.810  3.969   -32.478 1.00 49.49  ? 235  PRO B CA  1 
ATOM   5998 C C   . PRO B 1 235 ? 20.607  3.006   -33.661 1.00 49.10  ? 235  PRO B C   1 
ATOM   5999 O O   . PRO B 1 235 ? 21.506  2.205   -33.951 1.00 49.79  ? 235  PRO B O   1 
ATOM   6000 C CB  . PRO B 1 235 ? 20.575  3.214   -31.167 1.00 50.08  ? 235  PRO B CB  1 
ATOM   6001 C CG  . PRO B 1 235 ? 19.210  3.639   -30.725 1.00 49.74  ? 235  PRO B CG  1 
ATOM   6002 C CD  . PRO B 1 235 ? 19.028  5.058   -31.183 1.00 47.97  ? 235  PRO B CD  1 
ATOM   6003 N N   . TRP B 1 236 ? 19.455  3.077   -34.331 1.00 47.81  ? 236  TRP B N   1 
ATOM   6004 C CA  . TRP B 1 236 ? 19.063  2.041   -35.290 1.00 47.06  ? 236  TRP B CA  1 
ATOM   6005 C C   . TRP B 1 236 ? 18.799  2.529   -36.717 1.00 46.50  ? 236  TRP B C   1 
ATOM   6006 O O   . TRP B 1 236 ? 18.732  1.729   -37.636 1.00 46.98  ? 236  TRP B O   1 
ATOM   6007 C CB  . TRP B 1 236 ? 17.832  1.306   -34.761 1.00 46.49  ? 236  TRP B CB  1 
ATOM   6008 C CG  . TRP B 1 236 ? 16.665  2.212   -34.561 1.00 46.15  ? 236  TRP B CG  1 
ATOM   6009 C CD1 . TRP B 1 236 ? 16.306  2.855   -33.406 1.00 47.19  ? 236  TRP B CD1 1 
ATOM   6010 C CD2 . TRP B 1 236 ? 15.706  2.603   -35.547 1.00 46.76  ? 236  TRP B CD2 1 
ATOM   6011 N NE1 . TRP B 1 236 ? 15.171  3.614   -33.612 1.00 45.51  ? 236  TRP B NE1 1 
ATOM   6012 C CE2 . TRP B 1 236 ? 14.786  3.480   -34.919 1.00 44.95  ? 236  TRP B CE2 1 
ATOM   6013 C CE3 . TRP B 1 236 ? 15.529  2.294   -36.907 1.00 47.80  ? 236  TRP B CE3 1 
ATOM   6014 C CZ2 . TRP B 1 236 ? 13.720  4.055   -35.597 1.00 44.53  ? 236  TRP B CZ2 1 
ATOM   6015 C CZ3 . TRP B 1 236 ? 14.452  2.880   -37.589 1.00 46.84  ? 236  TRP B CZ3 1 
ATOM   6016 C CH2 . TRP B 1 236 ? 13.563  3.743   -36.925 1.00 45.23  ? 236  TRP B CH2 1 
ATOM   6017 N N   . ALA B 1 237 ? 18.630  3.835   -36.904 1.00 46.06  ? 237  ALA B N   1 
ATOM   6018 C CA  . ALA B 1 237 ? 18.149  4.363   -38.179 1.00 44.78  ? 237  ALA B CA  1 
ATOM   6019 C C   . ALA B 1 237 ? 19.248  4.556   -39.204 1.00 45.43  ? 237  ALA B C   1 
ATOM   6020 O O   . ALA B 1 237 ? 18.961  4.639   -40.398 1.00 45.96  ? 237  ALA B O   1 
ATOM   6021 C CB  . ALA B 1 237 ? 17.330  5.658   -37.985 1.00 43.92  ? 237  ALA B CB  1 
ATOM   6022 N N   . THR B 1 238 ? 20.502  4.630   -38.770 1.00 45.76  ? 238  THR B N   1 
ATOM   6023 C CA  . THR B 1 238 ? 21.609  4.731   -39.727 1.00 45.88  ? 238  THR B CA  1 
ATOM   6024 C C   . THR B 1 238 ? 22.742  3.791   -39.352 1.00 47.79  ? 238  THR B C   1 
ATOM   6025 O O   . THR B 1 238 ? 22.747  3.217   -38.265 1.00 48.54  ? 238  THR B O   1 
ATOM   6026 C CB  . THR B 1 238 ? 22.207  6.146   -39.820 1.00 45.73  ? 238  THR B CB  1 
ATOM   6027 O OG1 . THR B 1 238 ? 22.745  6.496   -38.553 1.00 45.28  ? 238  THR B OG1 1 
ATOM   6028 C CG2 . THR B 1 238 ? 21.186  7.187   -40.259 1.00 43.08  ? 238  THR B CG2 1 
ATOM   6029 N N   . VAL B 1 239 ? 23.699  3.637   -40.262 1.00 48.73  ? 239  VAL B N   1 
ATOM   6030 C CA  . VAL B 1 239 ? 24.943  2.941   -39.976 1.00 50.34  ? 239  VAL B CA  1 
ATOM   6031 C C   . VAL B 1 239 ? 26.064  3.754   -40.610 1.00 52.33  ? 239  VAL B C   1 
ATOM   6032 O O   . VAL B 1 239 ? 25.811  4.669   -41.406 1.00 51.94  ? 239  VAL B O   1 
ATOM   6033 C CB  . VAL B 1 239 ? 24.967  1.474   -40.498 1.00 51.01  ? 239  VAL B CB  1 
ATOM   6034 C CG1 . VAL B 1 239 ? 24.223  0.526   -39.536 1.00 49.80  ? 239  VAL B CG1 1 
ATOM   6035 C CG2 . VAL B 1 239 ? 24.418  1.373   -41.925 1.00 49.41  ? 239  VAL B CG2 1 
ATOM   6036 N N   . SER B 1 240 ? 27.304  3.445   -40.248 1.00 54.45  ? 240  SER B N   1 
ATOM   6037 C CA  . SER B 1 240 ? 28.435  4.168   -40.810 1.00 56.18  ? 240  SER B CA  1 
ATOM   6038 C C   . SER B 1 240 ? 28.731  3.542   -42.164 1.00 56.62  ? 240  SER B C   1 
ATOM   6039 O O   . SER B 1 240 ? 28.233  2.450   -42.454 1.00 56.38  ? 240  SER B O   1 
ATOM   6040 C CB  . SER B 1 240 ? 29.637  4.051   -39.890 1.00 57.50  ? 240  SER B CB  1 
ATOM   6041 O OG  . SER B 1 240 ? 30.111  2.722   -39.936 1.00 60.12  ? 240  SER B OG  1 
ATOM   6042 N N   . ALA B 1 241 ? 29.514  4.235   -42.990 1.00 57.66  ? 241  ALA B N   1 
ATOM   6043 C CA  . ALA B 1 241 ? 29.933  3.708   -44.283 1.00 58.62  ? 241  ALA B CA  1 
ATOM   6044 C C   . ALA B 1 241 ? 30.707  2.406   -44.078 1.00 60.36  ? 241  ALA B C   1 
ATOM   6045 O O   . ALA B 1 241 ? 30.484  1.425   -44.787 1.00 60.50  ? 241  ALA B O   1 
ATOM   6046 C CB  . ALA B 1 241 ? 30.769  4.720   -45.029 1.00 59.47  ? 241  ALA B CB  1 
ATOM   6047 N N   . GLY B 1 242 ? 31.590  2.401   -43.082 1.00 61.81  ? 242  GLY B N   1 
ATOM   6048 C CA  . GLY B 1 242 ? 32.370  1.215   -42.740 1.00 63.42  ? 242  GLY B CA  1 
ATOM   6049 C C   . GLY B 1 242 ? 31.514  0.051   -42.275 1.00 62.22  ? 242  GLY B C   1 
ATOM   6050 O O   . GLY B 1 242 ? 31.802  -1.116  -42.587 1.00 63.06  ? 242  GLY B O   1 
ATOM   6051 N N   . GLU B 1 243 ? 30.463  0.362   -41.525 1.00 60.09  ? 243  GLU B N   1 
ATOM   6052 C CA  . GLU B 1 243 ? 29.601  -0.685  -41.000 1.00 59.34  ? 243  GLU B CA  1 
ATOM   6053 C C   . GLU B 1 243 ? 28.739  -1.337  -42.090 1.00 58.32  ? 243  GLU B C   1 
ATOM   6054 O O   . GLU B 1 243 ? 28.551  -2.563  -42.083 1.00 58.96  ? 243  GLU B O   1 
ATOM   6055 C CB  . GLU B 1 243 ? 28.766  -0.171  -39.821 1.00 57.80  ? 243  GLU B CB  1 
ATOM   6056 C CG  . GLU B 1 243 ? 27.801  -1.195  -39.210 1.00 57.00  ? 243  GLU B CG  1 
ATOM   6057 C CD  . GLU B 1 243 ? 28.454  -2.511  -38.777 1.00 57.72  ? 243  GLU B CD  1 
ATOM   6058 O OE1 . GLU B 1 243 ? 29.695  -2.587  -38.635 1.00 59.17  ? 243  GLU B OE1 1 
ATOM   6059 O OE2 . GLU B 1 243 ? 27.695  -3.480  -38.570 1.00 56.79  ? 243  GLU B OE2 1 
ATOM   6060 N N   . ALA B 1 244 ? 28.258  -0.530  -43.039 1.00 56.91  ? 244  ALA B N   1 
ATOM   6061 C CA  . ALA B 1 244 ? 27.476  -1.040  -44.178 1.00 56.05  ? 244  ALA B CA  1 
ATOM   6062 C C   . ALA B 1 244 ? 28.339  -1.913  -45.088 1.00 57.92  ? 244  ALA B C   1 
ATOM   6063 O O   . ALA B 1 244 ? 27.921  -2.989  -45.508 1.00 58.00  ? 244  ALA B O   1 
ATOM   6064 C CB  . ALA B 1 244 ? 26.850  0.096   -44.961 1.00 54.52  ? 244  ALA B CB  1 
ATOM   6065 N N   . ARG B 1 245 ? 29.552  -1.440  -45.364 1.00 59.70  ? 245  ARG B N   1 
ATOM   6066 C CA  . ARG B 1 245 ? 30.534  -2.186  -46.140 1.00 61.68  ? 245  ARG B CA  1 
ATOM   6067 C C   . ARG B 1 245 ? 30.741  -3.579  -45.566 1.00 63.14  ? 245  ARG B C   1 
ATOM   6068 O O   . ARG B 1 245 ? 30.781  -4.572  -46.310 1.00 64.09  ? 245  ARG B O   1 
ATOM   6069 C CB  . ARG B 1 245 ? 31.864  -1.437  -46.204 1.00 62.89  ? 245  ARG B CB  1 
ATOM   6070 C CG  . ARG B 1 245 ? 32.829  -2.048  -47.215 1.00 64.57  ? 245  ARG B CG  1 
ATOM   6071 C CD  . ARG B 1 245 ? 33.947  -1.096  -47.573 1.00 65.62  ? 245  ARG B CD  1 
ATOM   6072 N NE  . ARG B 1 245 ? 33.579  -0.158  -48.629 1.00 64.06  ? 245  ARG B NE  1 
ATOM   6073 C CZ  . ARG B 1 245 ? 33.563  -0.462  -49.929 1.00 65.87  ? 245  ARG B CZ  1 
ATOM   6074 N NH1 . ARG B 1 245 ? 33.219  0.454   -50.829 1.00 65.00  ? 245  ARG B NH1 1 
ATOM   6075 N NH2 . ARG B 1 245 ? 33.868  -1.688  -50.341 1.00 66.50  ? 245  ARG B NH2 1 
ATOM   6076 N N   . ARG B 1 246 ? 30.846  -3.636  -44.240 1.00 63.39  ? 246  ARG B N   1 
ATOM   6077 C CA  . ARG B 1 246 ? 31.113  -4.874  -43.516 1.00 64.75  ? 246  ARG B CA  1 
ATOM   6078 C C   . ARG B 1 246 ? 29.970  -5.879  -43.716 1.00 63.90  ? 246  ARG B C   1 
ATOM   6079 O O   . ARG B 1 246 ? 30.209  -7.058  -43.989 1.00 65.57  ? 246  ARG B O   1 
ATOM   6080 C CB  . ARG B 1 246 ? 31.316  -4.548  -42.041 1.00 64.78  ? 246  ARG B CB  1 
ATOM   6081 C CG  . ARG B 1 246 ? 32.270  -5.444  -41.273 1.00 67.24  ? 246  ARG B CG  1 
ATOM   6082 C CD  . ARG B 1 246 ? 31.539  -6.429  -40.350 1.00 67.32  ? 246  ARG B CD  1 
ATOM   6083 N NE  . ARG B 1 246 ? 30.442  -5.810  -39.602 1.00 63.57  ? 246  ARG B NE  1 
ATOM   6084 C CZ  . ARG B 1 246 ? 29.407  -6.480  -39.103 1.00 62.90  ? 246  ARG B CZ  1 
ATOM   6085 N NH1 . ARG B 1 246 ? 29.305  -7.803  -39.253 1.00 63.42  ? 246  ARG B NH1 1 
ATOM   6086 N NH2 . ARG B 1 246 ? 28.463  -5.825  -38.455 1.00 60.99  ? 246  ARG B NH2 1 
ATOM   6087 N N   . ARG B 1 247 ? 28.730  -5.402  -43.628 1.00 61.79  ? 247  ARG B N   1 
ATOM   6088 C CA  . ARG B 1 247 ? 27.571  -6.284  -43.732 1.00 60.33  ? 247  ARG B CA  1 
ATOM   6089 C C   . ARG B 1 247 ? 27.308  -6.699  -45.171 1.00 60.79  ? 247  ARG B C   1 
ATOM   6090 O O   . ARG B 1 247 ? 26.913  -7.847  -45.431 1.00 62.12  ? 247  ARG B O   1 
ATOM   6091 C CB  . ARG B 1 247 ? 26.341  -5.625  -43.140 1.00 57.85  ? 247  ARG B CB  1 
ATOM   6092 C CG  . ARG B 1 247 ? 26.509  -5.124  -41.732 1.00 56.16  ? 247  ARG B CG  1 
ATOM   6093 C CD  . ARG B 1 247 ? 25.267  -4.363  -41.319 1.00 53.78  ? 247  ARG B CD  1 
ATOM   6094 N NE  . ARG B 1 247 ? 25.378  -3.794  -39.983 1.00 53.21  ? 247  ARG B NE  1 
ATOM   6095 C CZ  . ARG B 1 247 ? 24.351  -3.354  -39.263 1.00 53.37  ? 247  ARG B CZ  1 
ATOM   6096 N NH1 . ARG B 1 247 ? 23.109  -3.408  -39.739 1.00 51.50  ? 247  ARG B NH1 1 
ATOM   6097 N NH2 . ARG B 1 247 ? 24.569  -2.847  -38.056 1.00 53.79  ? 247  ARG B NH2 1 
ATOM   6098 N N   . ALA B 1 248 ? 27.538  -5.773  -46.103 1.00 60.29  ? 248  ALA B N   1 
ATOM   6099 C CA  . ALA B 1 248 ? 27.416  -6.058  -47.530 1.00 60.15  ? 248  ALA B CA  1 
ATOM   6100 C C   . ALA B 1 248 ? 28.373  -7.170  -47.855 1.00 62.72  ? 248  ALA B C   1 
ATOM   6101 O O   . ALA B 1 248 ? 27.993  -8.172  -48.456 1.00 63.58  ? 248  ALA B O   1 
ATOM   6102 C CB  . ALA B 1 248 ? 27.755  -4.843  -48.343 1.00 59.43  ? 248  ALA B CB  1 
ATOM   6103 N N   . THR B 1 249 ? 29.617  -6.985  -47.430 1.00 64.20  ? 249  THR B N   1 
ATOM   6104 C CA  . THR B 1 249 ? 30.670  -7.934  -47.690 1.00 66.72  ? 249  THR B CA  1 
ATOM   6105 C C   . THR B 1 249 ? 30.331  -9.282  -47.061 1.00 67.55  ? 249  THR B C   1 
ATOM   6106 O O   . THR B 1 249 ? 30.581  -10.343 -47.658 1.00 68.88  ? 249  THR B O   1 
ATOM   6107 C CB  . THR B 1 249 ? 32.030  -7.396  -47.163 1.00 68.29  ? 249  THR B CB  1 
ATOM   6108 O OG1 . THR B 1 249 ? 32.249  -6.083  -47.695 1.00 67.38  ? 249  THR B OG1 1 
ATOM   6109 C CG2 . THR B 1 249 ? 33.198  -8.308  -47.577 1.00 70.98  ? 249  THR B CG2 1 
ATOM   6110 N N   . LEU B 1 250 ? 29.759  -9.231  -45.860 1.00 66.87  ? 250  LEU B N   1 
ATOM   6111 C CA  . LEU B 1 250 ? 29.493  -10.449 -45.108 1.00 68.18  ? 250  LEU B CA  1 
ATOM   6112 C C   . LEU B 1 250 ? 28.340  -11.182 -45.765 1.00 67.87  ? 250  LEU B C   1 
ATOM   6113 O O   . LEU B 1 250 ? 28.388  -12.409 -45.934 1.00 69.56  ? 250  LEU B O   1 
ATOM   6114 C CB  . LEU B 1 250 ? 29.224  -10.167 -43.616 1.00 67.42  ? 250  LEU B CB  1 
ATOM   6115 C CG  . LEU B 1 250 ? 28.859  -11.382 -42.740 1.00 67.38  ? 250  LEU B CG  1 
ATOM   6116 C CD1 . LEU B 1 250 ? 29.885  -12.491 -42.874 1.00 69.72  ? 250  LEU B CD1 1 
ATOM   6117 C CD2 . LEU B 1 250 ? 28.674  -11.018 -41.291 1.00 65.40  ? 250  LEU B CD2 1 
ATOM   6118 N N   . LEU B 1 251 ? 27.325  -10.420 -46.166 1.00 66.25  ? 251  LEU B N   1 
ATOM   6119 C CA  . LEU B 1 251 ? 26.195  -10.989 -46.898 1.00 66.01  ? 251  LEU B CA  1 
ATOM   6120 C C   . LEU B 1 251 ? 26.645  -11.655 -48.187 1.00 67.88  ? 251  LEU B C   1 
ATOM   6121 O O   . LEU B 1 251 ? 26.140  -12.716 -48.542 1.00 69.35  ? 251  LEU B O   1 
ATOM   6122 C CB  . LEU B 1 251 ? 25.125  -9.945  -47.207 1.00 63.36  ? 251  LEU B CB  1 
ATOM   6123 C CG  . LEU B 1 251 ? 23.947  -10.667 -47.864 1.00 63.18  ? 251  LEU B CG  1 
ATOM   6124 C CD1 . LEU B 1 251 ? 22.985  -11.204 -46.807 1.00 61.65  ? 251  LEU B CD1 1 
ATOM   6125 C CD2 . LEU B 1 251 ? 23.237  -9.798  -48.893 1.00 61.31  ? 251  LEU B CD2 1 
ATOM   6126 N N   . ALA B 1 252 ? 27.594  -11.033 -48.881 1.00 68.81  ? 252  ALA B N   1 
ATOM   6127 C CA  . ALA B 1 252 ? 28.091  -11.564 -50.135 1.00 70.70  ? 252  ALA B CA  1 
ATOM   6128 C C   . ALA B 1 252 ? 28.778  -12.890 -49.862 1.00 73.98  ? 252  ALA B C   1 
ATOM   6129 O O   . ALA B 1 252 ? 28.583  -13.866 -50.589 1.00 75.11  ? 252  ALA B O   1 
ATOM   6130 C CB  . ALA B 1 252 ? 29.045  -10.592 -50.770 1.00 70.81  ? 252  ALA B CB  1 
ATOM   6131 N N   . ARG B 1 253 ? 29.569  -12.927 -48.793 1.00 75.81  ? 253  ARG B N   1 
ATOM   6132 C CA  . ARG B 1 253 ? 30.258  -14.143 -48.425 1.00 78.97  ? 253  ARG B CA  1 
ATOM   6133 C C   . ARG B 1 253 ? 29.228  -15.222 -48.136 1.00 78.71  ? 253  ARG B C   1 
ATOM   6134 O O   . ARG B 1 253 ? 29.397  -16.366 -48.547 1.00 80.65  ? 253  ARG B O   1 
ATOM   6135 C CB  . ARG B 1 253 ? 31.170  -13.931 -47.213 1.00 80.26  ? 253  ARG B CB  1 
ATOM   6136 C CG  . ARG B 1 253 ? 32.471  -14.728 -47.296 1.00 85.68  ? 253  ARG B CG  1 
ATOM   6137 C CD  . ARG B 1 253 ? 33.229  -14.765 -45.973 1.00 92.23  ? 253  ARG B CD  1 
ATOM   6138 N NE  . ARG B 1 253 ? 32.763  -15.847 -45.098 1.00 96.95  ? 253  ARG B NE  1 
ATOM   6139 C CZ  . ARG B 1 253 ? 32.329  -15.693 -43.844 1.00 98.01  ? 253  ARG B CZ  1 
ATOM   6140 N NH1 . ARG B 1 253 ? 32.307  -14.490 -43.260 1.00 96.09  ? 253  ARG B NH1 1 
ATOM   6141 N NH2 . ARG B 1 253 ? 31.929  -16.762 -43.162 1.00 99.33  ? 253  ARG B NH2 1 
ATOM   6142 N N   . LEU B 1 254 ? 28.145  -14.851 -47.461 1.00 76.39  ? 254  LEU B N   1 
ATOM   6143 C CA  . LEU B 1 254 ? 27.174  -15.845 -47.034 1.00 76.54  ? 254  LEU B CA  1 
ATOM   6144 C C   . LEU B 1 254 ? 26.421  -16.497 -48.190 1.00 76.90  ? 254  LEU B C   1 
ATOM   6145 O O   . LEU B 1 254 ? 25.888  -17.593 -48.037 1.00 78.15  ? 254  LEU B O   1 
ATOM   6146 C CB  . LEU B 1 254 ? 26.207  -15.256 -46.006 1.00 74.49  ? 254  LEU B CB  1 
ATOM   6147 C CG  . LEU B 1 254 ? 26.723  -15.091 -44.571 1.00 74.24  ? 254  LEU B CG  1 
ATOM   6148 C CD1 . LEU B 1 254 ? 25.820  -14.144 -43.793 1.00 70.74  ? 254  LEU B CD1 1 
ATOM   6149 C CD2 . LEU B 1 254 ? 26.835  -16.450 -43.865 1.00 75.97  ? 254  LEU B CD2 1 
ATOM   6150 N N   . VAL B 1 255 ? 26.395  -15.841 -49.347 1.00 76.43  ? 255  VAL B N   1 
ATOM   6151 C CA  . VAL B 1 255 ? 25.698  -16.395 -50.530 1.00 76.67  ? 255  VAL B CA  1 
ATOM   6152 C C   . VAL B 1 255 ? 26.633  -16.859 -51.657 1.00 79.00  ? 255  VAL B C   1 
ATOM   6153 O O   . VAL B 1 255 ? 26.215  -16.963 -52.813 1.00 79.25  ? 255  VAL B O   1 
ATOM   6154 C CB  . VAL B 1 255 ? 24.600  -15.417 -51.104 1.00 73.97  ? 255  VAL B CB  1 
ATOM   6155 C CG1 . VAL B 1 255 ? 23.459  -15.238 -50.113 1.00 71.19  ? 255  VAL B CG1 1 
ATOM   6156 C CG2 . VAL B 1 255 ? 25.201  -14.077 -51.515 1.00 72.24  ? 255  VAL B CG2 1 
ATOM   6157 N N   . GLY B 1 256 ? 27.893  -17.114 -51.331 1.00 81.06  ? 256  GLY B N   1 
ATOM   6158 C CA  . GLY B 1 256 ? 28.850  -17.584 -52.326 1.00 84.08  ? 256  GLY B CA  1 
ATOM   6159 C C   . GLY B 1 256 ? 29.569  -16.519 -53.143 1.00 84.25  ? 256  GLY B C   1 
ATOM   6160 O O   . GLY B 1 256 ? 30.472  -16.840 -53.909 1.00 86.36  ? 256  GLY B O   1 
ATOM   6161 N N   . CYS B 1 257 ? 29.196  -15.255 -52.973 1.00 82.65  ? 257  CYS B N   1 
ATOM   6162 C CA  . CYS B 1 257 ? 29.804  -14.164 -53.743 1.00 83.32  ? 257  CYS B CA  1 
ATOM   6163 C C   . CYS B 1 257 ? 31.151  -13.677 -53.206 1.00 85.67  ? 257  CYS B C   1 
ATOM   6164 O O   . CYS B 1 257 ? 31.264  -13.307 -52.029 1.00 85.10  ? 257  CYS B O   1 
ATOM   6165 C CB  . CYS B 1 257 ? 28.835  -13.003 -53.882 1.00 80.24  ? 257  CYS B CB  1 
ATOM   6166 S SG  . CYS B 1 257 ? 27.486  -13.437 -54.939 1.00 78.87  ? 257  CYS B SG  1 
ATOM   6167 N N   . PRO B 1 258 ? 32.171  -13.620 -54.088 1.00 88.64  ? 258  PRO B N   1 
ATOM   6168 C CA  . PRO B 1 258 ? 32.086  -13.737 -55.561 1.00 89.67  ? 258  PRO B CA  1 
ATOM   6169 C C   . PRO B 1 258 ? 32.119  -15.184 -56.133 1.00 91.90  ? 258  PRO B C   1 
ATOM   6170 O O   . PRO B 1 258 ? 33.176  -15.723 -56.492 1.00 94.30  ? 258  PRO B O   1 
ATOM   6171 C CB  . PRO B 1 258 ? 33.288  -12.908 -56.034 1.00 91.15  ? 258  PRO B CB  1 
ATOM   6172 C CG  . PRO B 1 258 ? 34.310  -13.032 -54.874 1.00 92.89  ? 258  PRO B CG  1 
ATOM   6173 C CD  . PRO B 1 258 ? 33.573  -13.524 -53.632 1.00 90.94  ? 258  PRO B CD  1 
ATOM   6174 N N   . ALA B 1 262 ? 38.264  -14.466 -51.607 1.00 116.53 ? 262  ALA B N   1 
ATOM   6175 C CA  . ALA B 1 262 ? 37.146  -13.522 -51.617 1.00 113.44 ? 262  ALA B CA  1 
ATOM   6176 C C   . ALA B 1 262 ? 37.430  -12.332 -52.560 1.00 113.00 ? 262  ALA B C   1 
ATOM   6177 O O   . ALA B 1 262 ? 38.097  -12.504 -53.599 1.00 115.16 ? 262  ALA B O   1 
ATOM   6178 C CB  . ALA B 1 262 ? 36.823  -13.049 -50.179 1.00 111.66 ? 262  ALA B CB  1 
ATOM   6179 N N   . GLY B 1 263 ? 36.908  -11.148 -52.212 1.00 110.27 ? 263  GLY B N   1 
ATOM   6180 C CA  . GLY B 1 263 ? 37.266  -9.891  -52.891 1.00 109.20 ? 263  GLY B CA  1 
ATOM   6181 C C   . GLY B 1 263 ? 38.549  -9.216  -52.364 1.00 110.28 ? 263  GLY B C   1 
ATOM   6182 O O   . GLY B 1 263 ? 38.983  -9.493  -51.237 1.00 111.02 ? 263  GLY B O   1 
ATOM   6183 N N   . GLY B 1 264 ? 39.182  -8.344  -53.162 1.00 110.14 ? 264  GLY B N   1 
ATOM   6184 C CA  . GLY B 1 264 ? 38.806  -8.069  -54.558 1.00 108.05 ? 264  GLY B CA  1 
ATOM   6185 C C   . GLY B 1 264 ? 37.546  -7.255  -54.847 1.00 103.56 ? 264  GLY B C   1 
ATOM   6186 O O   . GLY B 1 264 ? 36.432  -7.685  -54.522 1.00 101.64 ? 264  GLY B O   1 
ATOM   6187 N N   . ASN B 1 265 ? 37.752  -6.055  -55.403 1.00 101.72 ? 265  ASN B N   1 
ATOM   6188 C CA  . ASN B 1 265 ? 36.835  -5.417  -56.379 1.00 98.23  ? 265  ASN B CA  1 
ATOM   6189 C C   . ASN B 1 265 ? 35.319  -5.360  -56.056 1.00 93.52  ? 265  ASN B C   1 
ATOM   6190 O O   . ASN B 1 265 ? 34.630  -6.388  -56.074 1.00 92.57  ? 265  ASN B O   1 
ATOM   6191 C CB  . ASN B 1 265 ? 37.091  -6.077  -57.753 1.00 100.31 ? 265  ASN B CB  1 
ATOM   6192 C CG  . ASN B 1 265 ? 36.708  -5.190  -58.938 1.00 100.60 ? 265  ASN B CG  1 
ATOM   6193 O OD1 . ASN B 1 265 ? 35.576  -4.694  -59.022 1.00 98.00  ? 265  ASN B OD1 1 
ATOM   6194 N ND2 . ASN B 1 265 ? 37.645  -5.033  -59.893 1.00 102.91 ? 265  ASN B ND2 1 
ATOM   6195 N N   . ASP B 1 266 ? 34.819  -4.148  -55.781 1.00 89.91  ? 266  ASP B N   1 
ATOM   6196 C CA  . ASP B 1 266 ? 33.379  -3.872  -55.550 1.00 85.13  ? 266  ASP B CA  1 
ATOM   6197 C C   . ASP B 1 266 ? 32.471  -4.332  -56.692 1.00 83.45  ? 266  ASP B C   1 
ATOM   6198 O O   . ASP B 1 266 ? 31.478  -5.040  -56.474 1.00 81.86  ? 266  ASP B O   1 
ATOM   6199 C CB  . ASP B 1 266 ? 33.148  -2.368  -55.362 1.00 83.64  ? 266  ASP B CB  1 
ATOM   6200 C CG  . ASP B 1 266 ? 33.425  -1.893  -53.951 1.00 83.00  ? 266  ASP B CG  1 
ATOM   6201 O OD1 . ASP B 1 266 ? 33.721  -2.719  -53.056 1.00 82.72  ? 266  ASP B OD1 1 
ATOM   6202 O OD2 . ASP B 1 266 ? 33.337  -0.667  -53.737 1.00 81.83  ? 266  ASP B OD2 1 
ATOM   6203 N N   . THR B 1 267 ? 32.819  -3.889  -57.901 1.00 83.09  ? 267  THR B N   1 
ATOM   6204 C CA  . THR B 1 267 ? 32.073  -4.157  -59.126 1.00 81.46  ? 267  THR B CA  1 
ATOM   6205 C C   . THR B 1 267 ? 31.785  -5.632  -59.275 1.00 80.92  ? 267  THR B C   1 
ATOM   6206 O O   . THR B 1 267 ? 30.689  -6.026  -59.658 1.00 79.43  ? 267  THR B O   1 
ATOM   6207 C CB  . THR B 1 267 ? 32.892  -3.700  -60.341 1.00 83.67  ? 267  THR B CB  1 
ATOM   6208 O OG1 . THR B 1 267 ? 33.460  -2.420  -60.059 1.00 84.12  ? 267  THR B OG1 1 
ATOM   6209 C CG2 . THR B 1 267 ? 32.039  -3.621  -61.608 1.00 83.20  ? 267  THR B CG2 1 
ATOM   6210 N N   . GLU B 1 268 ? 32.790  -6.434  -58.961 1.00 82.16  ? 268  GLU B N   1 
ATOM   6211 C CA  . GLU B 1 268 ? 32.737  -7.867  -59.139 1.00 82.54  ? 268  GLU B CA  1 
ATOM   6212 C C   . GLU B 1 268 ? 31.802  -8.463  -58.105 1.00 79.58  ? 268  GLU B C   1 
ATOM   6213 O O   . GLU B 1 268 ? 30.998  -9.332  -58.419 1.00 79.04  ? 268  GLU B O   1 
ATOM   6214 C CB  . GLU B 1 268 ? 34.146  -8.451  -59.001 1.00 85.79  ? 268  GLU B CB  1 
ATOM   6215 C CG  . GLU B 1 268 ? 34.464  -9.615  -59.953 1.00 90.16  ? 268  GLU B CG  1 
ATOM   6216 C CD  . GLU B 1 268 ? 35.922  -10.079 -59.854 1.00 96.16  ? 268  GLU B CD  1 
ATOM   6217 O OE1 . GLU B 1 268 ? 36.463  -10.189 -58.718 1.00 97.79  ? 268  GLU B OE1 1 
ATOM   6218 O OE2 . GLU B 1 268 ? 36.528  -10.333 -60.920 1.00 99.05  ? 268  GLU B OE2 1 
ATOM   6219 N N   . LEU B 1 269 ? 31.903  -7.971  -56.876 1.00 77.62  ? 269  LEU B N   1 
ATOM   6220 C CA  . LEU B 1 269 ? 31.088  -8.454  -55.770 1.00 75.26  ? 269  LEU B CA  1 
ATOM   6221 C C   . LEU B 1 269 ? 29.597  -8.203  -56.024 1.00 72.66  ? 269  LEU B C   1 
ATOM   6222 O O   . LEU B 1 269 ? 28.790  -9.128  -55.885 1.00 72.28  ? 269  LEU B O   1 
ATOM   6223 C CB  . LEU B 1 269 ? 31.564  -7.830  -54.451 1.00 74.70  ? 269  LEU B CB  1 
ATOM   6224 C CG  . LEU B 1 269 ? 30.983  -8.297  -53.110 1.00 73.01  ? 269  LEU B CG  1 
ATOM   6225 C CD1 . LEU B 1 269 ? 32.055  -8.416  -52.048 1.00 74.25  ? 269  LEU B CD1 1 
ATOM   6226 C CD2 . LEU B 1 269 ? 29.890  -7.363  -52.635 1.00 70.03  ? 269  LEU B CD2 1 
ATOM   6227 N N   . ILE B 1 270 ? 29.249  -6.969  -56.409 1.00 70.85  ? 270  ILE B N   1 
ATOM   6228 C CA  . ILE B 1 270 ? 27.868  -6.593  -56.753 1.00 68.47  ? 270  ILE B CA  1 
ATOM   6229 C C   . ILE B 1 270 ? 27.328  -7.376  -57.960 1.00 68.88  ? 270  ILE B C   1 
ATOM   6230 O O   . ILE B 1 270 ? 26.192  -7.872  -57.918 1.00 67.94  ? 270  ILE B O   1 
ATOM   6231 C CB  . ILE B 1 270 ? 27.732  -5.071  -57.001 1.00 67.76  ? 270  ILE B CB  1 
ATOM   6232 C CG1 . ILE B 1 270 ? 28.137  -4.296  -55.756 1.00 67.71  ? 270  ILE B CG1 1 
ATOM   6233 C CG2 . ILE B 1 270 ? 26.307  -4.677  -57.355 1.00 64.83  ? 270  ILE B CG2 1 
ATOM   6234 C CD1 . ILE B 1 270 ? 28.868  -3.006  -56.073 1.00 69.87  ? 270  ILE B CD1 1 
ATOM   6235 N N   . ALA B 1 271 ? 28.129  -7.503  -59.020 1.00 70.04  ? 271  ALA B N   1 
ATOM   6236 C CA  . ALA B 1 271 ? 27.737  -8.313  -60.181 1.00 70.66  ? 271  ALA B CA  1 
ATOM   6237 C C   . ALA B 1 271 ? 27.204  -9.681  -59.766 1.00 70.59  ? 271  ALA B C   1 
ATOM   6238 O O   . ALA B 1 271 ? 26.209  -10.160 -60.311 1.00 70.27  ? 271  ALA B O   1 
ATOM   6239 C CB  . ALA B 1 271 ? 28.893  -8.474  -61.151 1.00 72.72  ? 271  ALA B CB  1 
ATOM   6240 N N   . CYS B 1 272 ? 27.863  -10.287 -58.787 1.00 71.23  ? 272  CYS B N   1 
ATOM   6241 C CA  . CYS B 1 272 ? 27.510  -11.616 -58.315 1.00 71.96  ? 272  CYS B CA  1 
ATOM   6242 C C   . CYS B 1 272 ? 26.237  -11.575 -57.488 1.00 69.09  ? 272  CYS B C   1 
ATOM   6243 O O   . CYS B 1 272 ? 25.352  -12.416 -57.655 1.00 68.98  ? 272  CYS B O   1 
ATOM   6244 C CB  . CYS B 1 272 ? 28.671  -12.221 -57.513 1.00 74.17  ? 272  CYS B CB  1 
ATOM   6245 S SG  . CYS B 1 272 ? 28.370  -13.844 -56.761 1.00 77.64  ? 272  CYS B SG  1 
ATOM   6246 N N   . LEU B 1 273 ? 26.144  -10.607 -56.586 1.00 66.95  ? 273  LEU B N   1 
ATOM   6247 C CA  . LEU B 1 273 ? 24.903  -10.413 -55.833 1.00 64.49  ? 273  LEU B CA  1 
ATOM   6248 C C   . LEU B 1 273 ? 23.689  -10.301 -56.778 1.00 63.35  ? 273  LEU B C   1 
ATOM   6249 O O   . LEU B 1 273 ? 22.667  -10.968 -56.559 1.00 62.79  ? 273  LEU B O   1 
ATOM   6250 C CB  . LEU B 1 273 ? 25.000  -9.206  -54.889 1.00 62.72  ? 273  LEU B CB  1 
ATOM   6251 C CG  . LEU B 1 273 ? 25.819  -9.382  -53.604 1.00 62.12  ? 273  LEU B CG  1 
ATOM   6252 C CD1 . LEU B 1 273 ? 25.902  -8.080  -52.805 1.00 59.62  ? 273  LEU B CD1 1 
ATOM   6253 C CD2 . LEU B 1 273 ? 25.235  -10.472 -52.744 1.00 60.70  ? 273  LEU B CD2 1 
ATOM   6254 N N   . ARG B 1 274 ? 23.832  -9.513  -57.848 1.00 62.76  ? 274  ARG B N   1 
ATOM   6255 C CA  . ARG B 1 274 ? 22.779  -9.366  -58.856 1.00 61.88  ? 274  ARG B CA  1 
ATOM   6256 C C   . ARG B 1 274 ? 22.387  -10.675 -59.549 1.00 63.16  ? 274  ARG B C   1 
ATOM   6257 O O   . ARG B 1 274 ? 21.278  -10.801 -60.048 1.00 62.83  ? 274  ARG B O   1 
ATOM   6258 C CB  . ARG B 1 274 ? 23.117  -8.264  -59.862 1.00 61.23  ? 274  ARG B CB  1 
ATOM   6259 C CG  . ARG B 1 274 ? 23.062  -6.868  -59.239 1.00 61.10  ? 274  ARG B CG  1 
ATOM   6260 C CD  . ARG B 1 274 ? 23.161  -5.749  -60.246 1.00 61.68  ? 274  ARG B CD  1 
ATOM   6261 N NE  . ARG B 1 274 ? 24.205  -6.043  -61.214 1.00 65.74  ? 274  ARG B NE  1 
ATOM   6262 C CZ  . ARG B 1 274 ? 25.249  -5.263  -61.461 1.00 66.92  ? 274  ARG B CZ  1 
ATOM   6263 N NH1 . ARG B 1 274 ? 25.372  -4.105  -60.816 1.00 66.83  ? 274  ARG B NH1 1 
ATOM   6264 N NH2 . ARG B 1 274 ? 26.160  -5.644  -62.358 1.00 67.68  ? 274  ARG B NH2 1 
ATOM   6265 N N   . THR B 1 275 ? 23.274  -11.658 -59.562 1.00 65.60  ? 275  THR B N   1 
ATOM   6266 C CA  . THR B 1 275 ? 22.923  -12.957 -60.137 1.00 67.46  ? 275  THR B CA  1 
ATOM   6267 C C   . THR B 1 275 ? 22.134  -13.857 -59.191 1.00 67.41  ? 275  THR B C   1 
ATOM   6268 O O   . THR B 1 275 ? 21.754  -14.954 -59.584 1.00 69.39  ? 275  THR B O   1 
ATOM   6269 C CB  . THR B 1 275 ? 24.151  -13.758 -60.580 1.00 69.88  ? 275  THR B CB  1 
ATOM   6270 O OG1 . THR B 1 275 ? 24.910  -14.137 -59.425 1.00 70.85  ? 275  THR B OG1 1 
ATOM   6271 C CG2 . THR B 1 275 ? 25.008  -12.962 -61.559 1.00 70.88  ? 275  THR B CG2 1 
ATOM   6272 N N   . ARG B 1 276 ? 21.902  -13.421 -57.953 1.00 66.13  ? 276  ARG B N   1 
ATOM   6273 C CA  . ARG B 1 276 ? 21.224  -14.268 -56.969 1.00 65.74  ? 276  ARG B CA  1 
ATOM   6274 C C   . ARG B 1 276 ? 19.728  -13.972 -56.890 1.00 64.05  ? 276  ARG B C   1 
ATOM   6275 O O   . ARG B 1 276 ? 19.324  -12.796 -56.845 1.00 62.27  ? 276  ARG B O   1 
ATOM   6276 C CB  . ARG B 1 276 ? 21.885  -14.161 -55.585 1.00 65.53  ? 276  ARG B CB  1 
ATOM   6277 C CG  . ARG B 1 276 ? 23.326  -14.691 -55.510 1.00 68.52  ? 276  ARG B CG  1 
ATOM   6278 C CD  . ARG B 1 276 ? 23.378  -16.231 -55.493 1.00 73.60  ? 276  ARG B CD  1 
ATOM   6279 N NE  . ARG B 1 276 ? 24.711  -16.766 -55.219 1.00 77.57  ? 276  ARG B NE  1 
ATOM   6280 C CZ  . ARG B 1 276 ? 25.693  -16.854 -56.115 1.00 81.16  ? 276  ARG B CZ  1 
ATOM   6281 N NH1 . ARG B 1 276 ? 25.513  -16.437 -57.360 1.00 81.90  ? 276  ARG B NH1 1 
ATOM   6282 N NH2 . ARG B 1 276 ? 26.866  -17.356 -55.763 1.00 83.82  ? 276  ARG B NH2 1 
ATOM   6283 N N   . PRO B 1 277 ? 18.898  -15.036 -56.920 1.00 64.60  ? 277  PRO B N   1 
ATOM   6284 C CA  . PRO B 1 277 ? 17.467  -14.948 -56.625 1.00 63.45  ? 277  PRO B CA  1 
ATOM   6285 C C   . PRO B 1 277 ? 17.183  -14.146 -55.349 1.00 62.08  ? 277  PRO B C   1 
ATOM   6286 O O   . PRO B 1 277 ? 17.855  -14.349 -54.337 1.00 62.57  ? 277  PRO B O   1 
ATOM   6287 C CB  . PRO B 1 277 ? 17.058  -16.419 -56.425 1.00 64.82  ? 277  PRO B CB  1 
ATOM   6288 C CG  . PRO B 1 277 ? 18.249  -17.272 -56.860 1.00 66.77  ? 277  PRO B CG  1 
ATOM   6289 C CD  . PRO B 1 277 ? 19.243  -16.349 -57.494 1.00 66.71  ? 277  PRO B CD  1 
ATOM   6290 N N   . ALA B 1 278 ? 16.197  -13.250 -55.397 1.00 60.81  ? 278  ALA B N   1 
ATOM   6291 C CA  . ALA B 1 278 ? 15.817  -12.427 -54.233 1.00 59.42  ? 278  ALA B CA  1 
ATOM   6292 C C   . ALA B 1 278 ? 15.772  -13.196 -52.909 1.00 60.27  ? 278  ALA B C   1 
ATOM   6293 O O   . ALA B 1 278 ? 16.355  -12.765 -51.912 1.00 59.89  ? 278  ALA B O   1 
ATOM   6294 C CB  . ALA B 1 278 ? 14.488  -11.707 -54.481 1.00 57.84  ? 278  ALA B CB  1 
ATOM   6295 N N   . GLN B 1 279 ? 15.116  -14.353 -52.900 1.00 62.14  ? 279  GLN B N   1 
ATOM   6296 C CA  . GLN B 1 279 ? 14.923  -15.077 -51.638 1.00 62.96  ? 279  GLN B CA  1 
ATOM   6297 C C   . GLN B 1 279 ? 16.253  -15.474 -51.004 1.00 64.27  ? 279  GLN B C   1 
ATOM   6298 O O   . GLN B 1 279 ? 16.335  -15.584 -49.780 1.00 64.54  ? 279  GLN B O   1 
ATOM   6299 C CB  . GLN B 1 279 ? 13.987  -16.286 -51.790 1.00 64.08  ? 279  GLN B CB  1 
ATOM   6300 C CG  . GLN B 1 279 ? 13.484  -16.883 -50.467 1.00 64.35  ? 279  GLN B CG  1 
ATOM   6301 C CD  . GLN B 1 279 ? 13.012  -15.839 -49.474 1.00 63.11  ? 279  GLN B CD  1 
ATOM   6302 O OE1 . GLN B 1 279 ? 12.153  -15.014 -49.782 1.00 62.18  ? 279  GLN B OE1 1 
ATOM   6303 N NE2 . GLN B 1 279 ? 13.576  -15.868 -48.270 1.00 62.83  ? 279  GLN B NE2 1 
ATOM   6304 N N   . ASP B 1 280 ? 17.285  -15.666 -51.827 1.00 65.53  ? 280  ASP B N   1 
ATOM   6305 C CA  . ASP B 1 280 ? 18.629  -15.973 -51.322 1.00 67.13  ? 280  ASP B CA  1 
ATOM   6306 C C   . ASP B 1 280 ? 19.208  -14.814 -50.505 1.00 65.71  ? 280  ASP B C   1 
ATOM   6307 O O   . ASP B 1 280 ? 19.785  -15.036 -49.435 1.00 66.32  ? 280  ASP B O   1 
ATOM   6308 C CB  . ASP B 1 280 ? 19.570  -16.378 -52.458 1.00 68.64  ? 280  ASP B CB  1 
ATOM   6309 C CG  . ASP B 1 280 ? 19.253  -17.753 -53.006 1.00 72.33  ? 280  ASP B CG  1 
ATOM   6310 O OD1 . ASP B 1 280 ? 18.225  -18.344 -52.588 1.00 74.25  ? 280  ASP B OD1 1 
ATOM   6311 O OD2 . ASP B 1 280 ? 20.035  -18.247 -53.851 1.00 75.46  ? 280  ASP B OD2 1 
ATOM   6312 N N   . LEU B 1 281 ? 19.026  -13.586 -50.995 1.00 63.61  ? 281  LEU B N   1 
ATOM   6313 C CA  . LEU B 1 281 ? 19.423  -12.398 -50.242 1.00 62.16  ? 281  LEU B CA  1 
ATOM   6314 C C   . LEU B 1 281 ? 18.668  -12.283 -48.913 1.00 61.53  ? 281  LEU B C   1 
ATOM   6315 O O   . LEU B 1 281 ? 19.267  -12.013 -47.872 1.00 62.11  ? 281  LEU B O   1 
ATOM   6316 C CB  . LEU B 1 281 ? 19.262  -11.128 -51.094 1.00 60.28  ? 281  LEU B CB  1 
ATOM   6317 C CG  . LEU B 1 281 ? 20.454  -10.707 -51.969 1.00 60.08  ? 281  LEU B CG  1 
ATOM   6318 C CD1 . LEU B 1 281 ? 21.229  -11.886 -52.532 1.00 61.84  ? 281  LEU B CD1 1 
ATOM   6319 C CD2 . LEU B 1 281 ? 20.036  -9.780  -53.091 1.00 58.30  ? 281  LEU B CD2 1 
ATOM   6320 N N   . VAL B 1 282 ? 17.361  -12.516 -48.941 1.00 61.11  ? 282  VAL B N   1 
ATOM   6321 C CA  . VAL B 1 282 ? 16.542  -12.425 -47.727 1.00 60.25  ? 282  VAL B CA  1 
ATOM   6322 C C   . VAL B 1 282 ? 16.903  -13.534 -46.723 1.00 61.80  ? 282  VAL B C   1 
ATOM   6323 O O   . VAL B 1 282 ? 17.013  -13.274 -45.531 1.00 61.25  ? 282  VAL B O   1 
ATOM   6324 C CB  . VAL B 1 282 ? 15.035  -12.401 -48.078 1.00 59.31  ? 282  VAL B CB  1 
ATOM   6325 C CG1 . VAL B 1 282 ? 14.169  -12.495 -46.833 1.00 58.59  ? 282  VAL B CG1 1 
ATOM   6326 C CG2 . VAL B 1 282 ? 14.723  -11.132 -48.829 1.00 57.98  ? 282  VAL B CG2 1 
ATOM   6327 N N   . ASP B 1 283 ? 17.109  -14.750 -47.224 1.00 63.74  ? 283  ASP B N   1 
ATOM   6328 C CA  . ASP B 1 283 ? 17.581  -15.897 -46.436 1.00 66.00  ? 283  ASP B CA  1 
ATOM   6329 C C   . ASP B 1 283 ? 18.709  -15.595 -45.425 1.00 66.53  ? 283  ASP B C   1 
ATOM   6330 O O   . ASP B 1 283 ? 18.695  -16.122 -44.309 1.00 66.86  ? 283  ASP B O   1 
ATOM   6331 C CB  . ASP B 1 283 ? 18.089  -16.990 -47.384 1.00 68.15  ? 283  ASP B CB  1 
ATOM   6332 C CG  . ASP B 1 283 ? 17.048  -18.064 -47.703 1.00 69.46  ? 283  ASP B CG  1 
ATOM   6333 O OD1 . ASP B 1 283 ? 15.842  -17.930 -47.372 1.00 66.44  ? 283  ASP B OD1 1 
ATOM   6334 O OD2 . ASP B 1 283 ? 17.478  -19.072 -48.318 1.00 73.21  ? 283  ASP B OD2 1 
ATOM   6335 N N   . HIS B 1 284 ? 19.687  -14.775 -45.832 1.00 66.64  ? 284  HIS B N   1 
ATOM   6336 C CA  . HIS B 1 284 ? 20.845  -14.435 -44.989 1.00 67.88  ? 284  HIS B CA  1 
ATOM   6337 C C   . HIS B 1 284 ? 20.892  -12.987 -44.469 1.00 66.60  ? 284  HIS B C   1 
ATOM   6338 O O   . HIS B 1 284 ? 21.875  -12.570 -43.841 1.00 66.61  ? 284  HIS B O   1 
ATOM   6339 C CB  . HIS B 1 284 ? 22.145  -14.779 -45.710 1.00 69.23  ? 284  HIS B CB  1 
ATOM   6340 C CG  . HIS B 1 284 ? 22.318  -16.243 -45.941 1.00 72.71  ? 284  HIS B CG  1 
ATOM   6341 N ND1 . HIS B 1 284 ? 22.539  -17.135 -44.911 1.00 74.97  ? 284  HIS B ND1 1 
ATOM   6342 C CD2 . HIS B 1 284 ? 22.267  -16.981 -47.077 1.00 73.39  ? 284  HIS B CD2 1 
ATOM   6343 C CE1 . HIS B 1 284 ? 22.628  -18.357 -45.405 1.00 77.08  ? 284  HIS B CE1 1 
ATOM   6344 N NE2 . HIS B 1 284 ? 22.468  -18.291 -46.716 1.00 76.56  ? 284  HIS B NE2 1 
ATOM   6345 N N   . GLU B 1 285 ? 19.829  -12.233 -44.734 1.00 65.65  ? 285  GLU B N   1 
ATOM   6346 C CA  . GLU B 1 285 ? 19.704  -10.840 -44.301 1.00 64.82  ? 285  GLU B CA  1 
ATOM   6347 C C   . GLU B 1 285 ? 20.001  -10.678 -42.800 1.00 65.50  ? 285  GLU B C   1 
ATOM   6348 O O   . GLU B 1 285 ? 20.750  -9.793  -42.395 1.00 64.69  ? 285  GLU B O   1 
ATOM   6349 C CB  . GLU B 1 285 ? 18.276  -10.369 -44.600 1.00 63.33  ? 285  GLU B CB  1 
ATOM   6350 C CG  . GLU B 1 285 ? 18.136  -8.911  -44.889 1.00 62.19  ? 285  GLU B CG  1 
ATOM   6351 C CD  . GLU B 1 285 ? 16.725  -8.432  -44.709 1.00 61.66  ? 285  GLU B CD  1 
ATOM   6352 O OE1 . GLU B 1 285 ? 15.805  -9.013  -45.300 1.00 62.26  ? 285  GLU B OE1 1 
ATOM   6353 O OE2 . GLU B 1 285 ? 16.530  -7.445  -43.970 1.00 64.42  ? 285  GLU B OE2 1 
ATOM   6354 N N   . TRP B 1 286 ? 19.415  -11.563 -41.995 1.00 67.36  ? 286  TRP B N   1 
ATOM   6355 C CA  . TRP B 1 286 ? 19.447  -11.477 -40.537 1.00 68.79  ? 286  TRP B CA  1 
ATOM   6356 C C   . TRP B 1 286 ? 20.791  -11.878 -39.974 1.00 69.83  ? 286  TRP B C   1 
ATOM   6357 O O   . TRP B 1 286 ? 21.071  -11.638 -38.814 1.00 70.56  ? 286  TRP B O   1 
ATOM   6358 C CB  . TRP B 1 286 ? 18.340  -12.358 -39.932 1.00 70.20  ? 286  TRP B CB  1 
ATOM   6359 C CG  . TRP B 1 286 ? 18.186  -12.313 -38.396 1.00 75.39  ? 286  TRP B CG  1 
ATOM   6360 C CD1 . TRP B 1 286 ? 18.022  -11.189 -37.592 1.00 76.83  ? 286  TRP B CD1 1 
ATOM   6361 C CD2 . TRP B 1 286 ? 18.153  -13.445 -37.502 1.00 81.00  ? 286  TRP B CD2 1 
ATOM   6362 N NE1 . TRP B 1 286 ? 17.922  -11.567 -36.263 1.00 78.70  ? 286  TRP B NE1 1 
ATOM   6363 C CE2 . TRP B 1 286 ? 17.995  -12.936 -36.179 1.00 81.47  ? 286  TRP B CE2 1 
ATOM   6364 C CE3 . TRP B 1 286 ? 18.259  -14.840 -37.690 1.00 85.28  ? 286  TRP B CE3 1 
ATOM   6365 C CZ2 . TRP B 1 286 ? 17.932  -13.777 -35.052 1.00 85.30  ? 286  TRP B CZ2 1 
ATOM   6366 C CZ3 . TRP B 1 286 ? 18.198  -15.684 -36.563 1.00 88.40  ? 286  TRP B CZ3 1 
ATOM   6367 C CH2 . TRP B 1 286 ? 18.033  -15.144 -35.261 1.00 88.57  ? 286  TRP B CH2 1 
ATOM   6368 N N   . HIS B 1 287 ? 21.640  -12.481 -40.787 1.00 71.07  ? 287  HIS B N   1 
ATOM   6369 C CA  . HIS B 1 287 ? 22.886  -13.014 -40.258 1.00 72.38  ? 287  HIS B CA  1 
ATOM   6370 C C   . HIS B 1 287 ? 24.062  -12.050 -40.299 1.00 71.55  ? 287  HIS B C   1 
ATOM   6371 O O   . HIS B 1 287 ? 25.188  -12.466 -40.072 1.00 72.99  ? 287  HIS B O   1 
ATOM   6372 C CB  . HIS B 1 287 ? 23.230  -14.323 -40.953 1.00 74.85  ? 287  HIS B CB  1 
ATOM   6373 C CG  . HIS B 1 287 ? 22.202  -15.393 -40.761 1.00 77.28  ? 287  HIS B CG  1 
ATOM   6374 N ND1 . HIS B 1 287 ? 22.041  -16.440 -41.645 1.00 80.61  ? 287  HIS B ND1 1 
ATOM   6375 C CD2 . HIS B 1 287 ? 21.270  -15.570 -39.793 1.00 78.27  ? 287  HIS B CD2 1 
ATOM   6376 C CE1 . HIS B 1 287 ? 21.067  -17.226 -41.220 1.00 82.11  ? 287  HIS B CE1 1 
ATOM   6377 N NE2 . HIS B 1 287 ? 20.578  -16.716 -40.101 1.00 81.42  ? 287  HIS B NE2 1 
ATOM   6378 N N   . VAL B 1 288 ? 23.815  -10.764 -40.564 1.00 68.90  ? 288  VAL B N   1 
ATOM   6379 C CA  . VAL B 1 288 ? 24.926  -9.813  -40.646 1.00 68.21  ? 288  VAL B CA  1 
ATOM   6380 C C   . VAL B 1 288 ? 25.033  -8.848  -39.464 1.00 67.43  ? 288  VAL B C   1 
ATOM   6381 O O   . VAL B 1 288 ? 25.930  -7.996  -39.442 1.00 67.71  ? 288  VAL B O   1 
ATOM   6382 C CB  . VAL B 1 288 ? 24.965  -9.027  -41.986 1.00 67.13  ? 288  VAL B CB  1 
ATOM   6383 C CG1 . VAL B 1 288 ? 25.040  -9.961  -43.166 1.00 67.84  ? 288  VAL B CG1 1 
ATOM   6384 C CG2 . VAL B 1 288 ? 23.793  -8.076  -42.111 1.00 65.24  ? 288  VAL B CG2 1 
ATOM   6385 N N   . LEU B 1 289 ? 24.136  -8.976  -38.485 1.00 66.35  ? 289  LEU B N   1 
ATOM   6386 C CA  . LEU B 1 289 ? 24.173  -8.107  -37.313 1.00 65.43  ? 289  LEU B CA  1 
ATOM   6387 C C   . LEU B 1 289 ? 25.379  -8.422  -36.429 1.00 67.43  ? 289  LEU B C   1 
ATOM   6388 O O   . LEU B 1 289 ? 25.710  -9.595  -36.231 1.00 69.32  ? 289  LEU B O   1 
ATOM   6389 C CB  . LEU B 1 289 ? 22.872  -8.187  -36.519 1.00 64.17  ? 289  LEU B CB  1 
ATOM   6390 C CG  . LEU B 1 289 ? 21.657  -7.506  -37.159 1.00 61.76  ? 289  LEU B CG  1 
ATOM   6391 C CD1 . LEU B 1 289 ? 20.404  -7.924  -36.435 1.00 60.42  ? 289  LEU B CD1 1 
ATOM   6392 C CD2 . LEU B 1 289 ? 21.782  -5.982  -37.179 1.00 59.28  ? 289  LEU B CD2 1 
ATOM   6393 N N   . PRO B 1 290 ? 26.058  -7.373  -35.915 1.00 67.45  ? 290  PRO B N   1 
ATOM   6394 C CA  . PRO B 1 290 ? 27.276  -7.562  -35.109 1.00 69.49  ? 290  PRO B CA  1 
ATOM   6395 C C   . PRO B 1 290 ? 27.061  -8.351  -33.808 1.00 70.64  ? 290  PRO B C   1 
ATOM   6396 O O   . PRO B 1 290 ? 27.928  -9.120  -33.422 1.00 72.62  ? 290  PRO B O   1 
ATOM   6397 C CB  . PRO B 1 290 ? 27.721  -6.121  -34.803 1.00 68.63  ? 290  PRO B CB  1 
ATOM   6398 C CG  . PRO B 1 290 ? 26.499  -5.287  -34.998 1.00 65.98  ? 290  PRO B CG  1 
ATOM   6399 C CD  . PRO B 1 290 ? 25.757  -5.940  -36.111 1.00 65.55  ? 290  PRO B CD  1 
ATOM   6400 N N   . GLN B 1 291 ? 25.915  -8.150  -33.157 1.00 69.82  ? 291  GLN B N   1 
ATOM   6401 C CA  . GLN B 1 291 ? 25.608  -8.728  -31.845 1.00 71.11  ? 291  GLN B CA  1 
ATOM   6402 C C   . GLN B 1 291 ? 24.228  -9.385  -31.855 1.00 70.94  ? 291  GLN B C   1 
ATOM   6403 O O   . GLN B 1 291 ? 23.420  -9.140  -32.761 1.00 69.63  ? 291  GLN B O   1 
ATOM   6404 C CB  . GLN B 1 291 ? 25.587  -7.631  -30.770 1.00 70.14  ? 291  GLN B CB  1 
ATOM   6405 C CG  . GLN B 1 291 ? 26.908  -6.897  -30.536 1.00 71.89  ? 291  GLN B CG  1 
ATOM   6406 C CD  . GLN B 1 291 ? 27.009  -5.571  -31.290 1.00 72.18  ? 291  GLN B CD  1 
ATOM   6407 O OE1 . GLN B 1 291 ? 25.997  -4.976  -31.698 1.00 71.12  ? 291  GLN B OE1 1 
ATOM   6408 N NE2 . GLN B 1 291 ? 28.238  -5.090  -31.460 1.00 72.27  ? 291  GLN B NE2 1 
ATOM   6409 N N   . GLU B 1 292 ? 23.947  -10.206 -30.843 1.00 72.73  ? 292  GLU B N   1 
ATOM   6410 C CA  . GLU B 1 292 ? 22.555  -10.496 -30.496 1.00 72.59  ? 292  GLU B CA  1 
ATOM   6411 C C   . GLU B 1 292 ? 21.945  -9.114  -30.190 1.00 70.18  ? 292  GLU B C   1 
ATOM   6412 O O   . GLU B 1 292 ? 22.601  -8.285  -29.543 1.00 70.42  ? 292  GLU B O   1 
ATOM   6413 C CB  . GLU B 1 292 ? 22.479  -11.415 -29.270 1.00 74.65  ? 292  GLU B CB  1 
ATOM   6414 C CG  . GLU B 1 292 ? 21.452  -12.565 -29.392 1.00 77.95  ? 292  GLU B CG  1 
ATOM   6415 C CD  . GLU B 1 292 ? 21.101  -13.230 -28.045 1.00 82.81  ? 292  GLU B CD  1 
ATOM   6416 O OE1 . GLU B 1 292 ? 22.009  -13.518 -27.226 1.00 84.39  ? 292  GLU B OE1 1 
ATOM   6417 O OE2 . GLU B 1 292 ? 19.897  -13.475 -27.813 1.00 84.39  ? 292  GLU B OE2 1 
ATOM   6418 N N   . SER B 1 293 ? 20.737  -8.832  -30.678 1.00 67.94  ? 293  SER B N   1 
ATOM   6419 C CA  . SER B 1 293 ? 20.136  -7.516  -30.427 1.00 65.48  ? 293  SER B CA  1 
ATOM   6420 C C   . SER B 1 293 ? 18.648  -7.426  -30.752 1.00 64.14  ? 293  SER B C   1 
ATOM   6421 O O   . SER B 1 293 ? 18.081  -8.327  -31.359 1.00 64.89  ? 293  SER B O   1 
ATOM   6422 C CB  . SER B 1 293 ? 20.910  -6.424  -31.173 1.00 64.40  ? 293  SER B CB  1 
ATOM   6423 O OG  . SER B 1 293 ? 21.045  -6.707  -32.550 1.00 63.41  ? 293  SER B OG  1 
ATOM   6424 N N   . ILE B 1 294 ? 18.009  -6.345  -30.323 1.00 62.55  ? 294  ILE B N   1 
ATOM   6425 C CA  . ILE B 1 294 ? 16.660  -6.036  -30.799 1.00 60.97  ? 294  ILE B CA  1 
ATOM   6426 C C   . ILE B 1 294 ? 16.570  -4.588  -31.179 1.00 58.83  ? 294  ILE B C   1 
ATOM   6427 O O   . ILE B 1 294 ? 17.359  -3.779  -30.707 1.00 58.70  ? 294  ILE B O   1 
ATOM   6428 C CB  . ILE B 1 294 ? 15.560  -6.352  -29.771 1.00 61.84  ? 294  ILE B CB  1 
ATOM   6429 C CG1 . ILE B 1 294 ? 15.981  -5.922  -28.374 1.00 61.43  ? 294  ILE B CG1 1 
ATOM   6430 C CG2 . ILE B 1 294 ? 15.150  -7.876  -29.845 1.00 64.41  ? 294  ILE B CG2 1 
ATOM   6431 C CD1 . ILE B 1 294 ? 14.821  -5.806  -27.459 1.00 63.48  ? 294  ILE B CD1 1 
ATOM   6432 N N   . PHE B 1 295 ? 15.607  -4.264  -32.038 1.00 57.00  ? 295  PHE B N   1 
ATOM   6433 C CA  . PHE B 1 295 ? 15.461  -2.917  -32.564 1.00 54.45  ? 295  PHE B CA  1 
ATOM   6434 C C   . PHE B 1 295 ? 16.775  -2.533  -33.218 1.00 53.99  ? 295  PHE B C   1 
ATOM   6435 O O   . PHE B 1 295 ? 17.242  -1.405  -33.089 1.00 53.74  ? 295  PHE B O   1 
ATOM   6436 C CB  . PHE B 1 295 ? 15.074  -1.919  -31.468 1.00 54.25  ? 295  PHE B CB  1 
ATOM   6437 C CG  . PHE B 1 295 ? 14.083  -0.857  -31.924 1.00 54.28  ? 295  PHE B CG  1 
ATOM   6438 C CD1 . PHE B 1 295 ? 14.267  -0.169  -33.122 1.00 53.05  ? 295  PHE B CD1 1 
ATOM   6439 C CD2 . PHE B 1 295 ? 12.968  -0.553  -31.154 1.00 53.70  ? 295  PHE B CD2 1 
ATOM   6440 C CE1 . PHE B 1 295 ? 13.363  0.766   -33.536 1.00 51.63  ? 295  PHE B CE1 1 
ATOM   6441 C CE2 . PHE B 1 295 ? 12.071  0.399   -31.570 1.00 52.05  ? 295  PHE B CE2 1 
ATOM   6442 C CZ  . PHE B 1 295 ? 12.266  1.050   -32.764 1.00 51.30  ? 295  PHE B CZ  1 
ATOM   6443 N N   . ARG B 1 296 ? 17.382  -3.519  -33.877 1.00 54.22  ? 296  ARG B N   1 
ATOM   6444 C CA  . ARG B 1 296 ? 18.460  -3.314  -34.835 1.00 53.71  ? 296  ARG B CA  1 
ATOM   6445 C C   . ARG B 1 296 ? 18.108  -4.058  -36.145 1.00 53.70  ? 296  ARG B C   1 
ATOM   6446 O O   . ARG B 1 296 ? 17.499  -5.133  -36.123 1.00 54.61  ? 296  ARG B O   1 
ATOM   6447 C CB  . ARG B 1 296 ? 19.797  -3.800  -34.267 1.00 55.12  ? 296  ARG B CB  1 
ATOM   6448 C CG  . ARG B 1 296 ? 20.266  -3.075  -33.016 1.00 54.38  ? 296  ARG B CG  1 
ATOM   6449 C CD  . ARG B 1 296 ? 20.487  -1.608  -33.259 1.00 53.01  ? 296  ARG B CD  1 
ATOM   6450 N NE  . ARG B 1 296 ? 21.062  -0.961  -32.085 1.00 55.64  ? 296  ARG B NE  1 
ATOM   6451 C CZ  . ARG B 1 296 ? 20.369  -0.476  -31.051 1.00 54.76  ? 296  ARG B CZ  1 
ATOM   6452 N NH1 . ARG B 1 296 ? 19.043  -0.549  -31.009 1.00 52.89  ? 296  ARG B NH1 1 
ATOM   6453 N NH2 . ARG B 1 296 ? 21.019  0.086   -30.043 1.00 55.48  ? 296  ARG B NH2 1 
ATOM   6454 N N   . PHE B 1 297 ? 18.492  -3.481  -37.278 1.00 52.36  ? 297  PHE B N   1 
ATOM   6455 C CA  . PHE B 1 297 ? 18.010  -3.924  -38.568 1.00 51.52  ? 297  PHE B CA  1 
ATOM   6456 C C   . PHE B 1 297 ? 19.198  -3.961  -39.516 1.00 52.49  ? 297  PHE B C   1 
ATOM   6457 O O   . PHE B 1 297 ? 19.968  -2.994  -39.559 1.00 53.02  ? 297  PHE B O   1 
ATOM   6458 C CB  . PHE B 1 297 ? 16.955  -2.941  -39.095 1.00 50.04  ? 297  PHE B CB  1 
ATOM   6459 C CG  . PHE B 1 297 ? 15.835  -2.637  -38.114 1.00 48.24  ? 297  PHE B CG  1 
ATOM   6460 C CD1 . PHE B 1 297 ? 15.010  -3.653  -37.631 1.00 47.93  ? 297  PHE B CD1 1 
ATOM   6461 C CD2 . PHE B 1 297 ? 15.612  -1.338  -37.681 1.00 45.31  ? 297  PHE B CD2 1 
ATOM   6462 C CE1 . PHE B 1 297 ? 13.976  -3.374  -36.735 1.00 46.89  ? 297  PHE B CE1 1 
ATOM   6463 C CE2 . PHE B 1 297 ? 14.572  -1.044  -36.792 1.00 44.57  ? 297  PHE B CE2 1 
ATOM   6464 C CZ  . PHE B 1 297 ? 13.750  -2.067  -36.325 1.00 45.25  ? 297  PHE B CZ  1 
ATOM   6465 N N   . SER B 1 298 ? 19.334  -5.061  -40.272 1.00 52.42  ? 298  SER B N   1 
ATOM   6466 C CA  . SER B 1 298 ? 20.555  -5.361  -41.015 1.00 53.02  ? 298  SER B CA  1 
ATOM   6467 C C   . SER B 1 298 ? 20.943  -4.316  -42.057 1.00 52.14  ? 298  SER B C   1 
ATOM   6468 O O   . SER B 1 298 ? 22.099  -3.927  -42.145 1.00 53.49  ? 298  SER B O   1 
ATOM   6469 C CB  . SER B 1 298 ? 20.472  -6.749  -41.664 1.00 54.34  ? 298  SER B CB  1 
ATOM   6470 O OG  . SER B 1 298 ? 20.265  -7.770  -40.690 1.00 55.85  ? 298  SER B OG  1 
ATOM   6471 N N   . PHE B 1 299 ? 19.986  -3.860  -42.851 1.00 50.80  ? 299  PHE B N   1 
ATOM   6472 C CA  . PHE B 1 299 ? 20.269  -2.921  -43.939 1.00 49.27  ? 299  PHE B CA  1 
ATOM   6473 C C   . PHE B 1 299 ? 19.352  -1.752  -43.809 1.00 47.71  ? 299  PHE B C   1 
ATOM   6474 O O   . PHE B 1 299 ? 18.132  -1.900  -43.923 1.00 47.06  ? 299  PHE B O   1 
ATOM   6475 C CB  . PHE B 1 299 ? 20.108  -3.613  -45.290 1.00 49.69  ? 299  PHE B CB  1 
ATOM   6476 C CG  . PHE B 1 299 ? 21.074  -4.730  -45.475 1.00 49.41  ? 299  PHE B CG  1 
ATOM   6477 C CD1 . PHE B 1 299 ? 22.366  -4.468  -45.893 1.00 48.52  ? 299  PHE B CD1 1 
ATOM   6478 C CD2 . PHE B 1 299 ? 20.718  -6.030  -45.146 1.00 49.39  ? 299  PHE B CD2 1 
ATOM   6479 C CE1 . PHE B 1 299 ? 23.281  -5.487  -46.004 1.00 50.58  ? 299  PHE B CE1 1 
ATOM   6480 C CE2 . PHE B 1 299 ? 21.627  -7.061  -45.261 1.00 50.04  ? 299  PHE B CE2 1 
ATOM   6481 C CZ  . PHE B 1 299 ? 22.907  -6.793  -45.695 1.00 50.54  ? 299  PHE B CZ  1 
ATOM   6482 N N   . VAL B 1 300 ? 19.964  -0.605  -43.520 1.00 46.97  ? 300  VAL B N   1 
ATOM   6483 C CA  . VAL B 1 300 ? 19.286  0.622   -43.145 1.00 44.86  ? 300  VAL B CA  1 
ATOM   6484 C C   . VAL B 1 300 ? 20.084  1.734   -43.795 1.00 44.85  ? 300  VAL B C   1 
ATOM   6485 O O   . VAL B 1 300 ? 21.158  1.468   -44.311 1.00 45.95  ? 300  VAL B O   1 
ATOM   6486 C CB  . VAL B 1 300 ? 19.307  0.830   -41.601 1.00 45.29  ? 300  VAL B CB  1 
ATOM   6487 C CG1 . VAL B 1 300 ? 18.682  -0.354  -40.849 1.00 44.94  ? 300  VAL B CG1 1 
ATOM   6488 C CG2 . VAL B 1 300 ? 20.735  1.120   -41.087 1.00 46.22  ? 300  VAL B CG2 1 
ATOM   6489 N N   . PRO B 1 301 ? 19.584  2.987   -43.767 1.00 44.29  ? 301  PRO B N   1 
ATOM   6490 C CA  . PRO B 1 301 ? 20.287  4.030   -44.495 1.00 44.86  ? 301  PRO B CA  1 
ATOM   6491 C C   . PRO B 1 301 ? 21.712  4.132   -44.032 1.00 46.80  ? 301  PRO B C   1 
ATOM   6492 O O   . PRO B 1 301 ? 21.972  3.914   -42.856 1.00 48.08  ? 301  PRO B O   1 
ATOM   6493 C CB  . PRO B 1 301 ? 19.514  5.285   -44.106 1.00 44.00  ? 301  PRO B CB  1 
ATOM   6494 C CG  . PRO B 1 301 ? 18.142  4.815   -43.974 1.00 42.52  ? 301  PRO B CG  1 
ATOM   6495 C CD  . PRO B 1 301 ? 18.250  3.456   -43.337 1.00 42.97  ? 301  PRO B CD  1 
ATOM   6496 N N   . VAL B 1 302 ? 22.634  4.447   -44.940 1.00 48.33  ? 302  VAL B N   1 
ATOM   6497 C CA  . VAL B 1 302 ? 24.061  4.602   -44.592 1.00 49.79  ? 302  VAL B CA  1 
ATOM   6498 C C   . VAL B 1 302 ? 24.504  6.083   -44.615 1.00 50.46  ? 302  VAL B C   1 
ATOM   6499 O O   . VAL B 1 302 ? 24.029  6.874   -45.441 1.00 50.65  ? 302  VAL B O   1 
ATOM   6500 C CB  . VAL B 1 302 ? 24.949  3.743   -45.525 1.00 50.90  ? 302  VAL B CB  1 
ATOM   6501 C CG1 . VAL B 1 302 ? 24.800  4.179   -46.976 1.00 50.55  ? 302  VAL B CG1 1 
ATOM   6502 C CG2 . VAL B 1 302 ? 26.400  3.797   -45.094 1.00 52.67  ? 302  VAL B CG2 1 
ATOM   6503 N N   . VAL B 1 303 ? 25.393  6.460   -43.704 1.00 51.32  ? 303  VAL B N   1 
ATOM   6504 C CA  . VAL B 1 303 ? 25.932  7.815   -43.697 1.00 52.20  ? 303  VAL B CA  1 
ATOM   6505 C C   . VAL B 1 303 ? 26.972  7.816   -44.809 1.00 54.45  ? 303  VAL B C   1 
ATOM   6506 O O   . VAL B 1 303 ? 28.143  7.457   -44.602 1.00 55.84  ? 303  VAL B O   1 
ATOM   6507 C CB  . VAL B 1 303 ? 26.531  8.229   -42.316 1.00 52.54  ? 303  VAL B CB  1 
ATOM   6508 C CG1 . VAL B 1 303 ? 27.075  9.661   -42.335 1.00 52.97  ? 303  VAL B CG1 1 
ATOM   6509 C CG2 . VAL B 1 303 ? 25.497  8.107   -41.254 1.00 50.42  ? 303  VAL B CG2 1 
ATOM   6510 N N   . ASP B 1 304 ? 26.506  8.182   -46.003 1.00 54.89  ? 304  ASP B N   1 
ATOM   6511 C CA  . ASP B 1 304 ? 27.319  8.148   -47.210 1.00 56.83  ? 304  ASP B CA  1 
ATOM   6512 C C   . ASP B 1 304 ? 28.101  9.432   -47.498 1.00 58.34  ? 304  ASP B C   1 
ATOM   6513 O O   . ASP B 1 304 ? 28.992  9.435   -48.346 1.00 60.16  ? 304  ASP B O   1 
ATOM   6514 C CB  . ASP B 1 304 ? 26.450  7.789   -48.413 1.00 56.02  ? 304  ASP B CB  1 
ATOM   6515 C CG  . ASP B 1 304 ? 25.284  8.741   -48.607 1.00 56.39  ? 304  ASP B CG  1 
ATOM   6516 O OD1 . ASP B 1 304 ? 24.990  9.553   -47.693 1.00 56.54  ? 304  ASP B OD1 1 
ATOM   6517 O OD2 . ASP B 1 304 ? 24.646  8.662   -49.686 1.00 56.86  ? 304  ASP B OD2 1 
ATOM   6518 N N   . GLY B 1 305 ? 27.776  10.519  -46.812 1.00 58.00  ? 305  GLY B N   1 
ATOM   6519 C CA  . GLY B 1 305 ? 28.347  11.816  -47.171 1.00 59.73  ? 305  GLY B CA  1 
ATOM   6520 C C   . GLY B 1 305 ? 27.809  12.314  -48.507 1.00 60.27  ? 305  GLY B C   1 
ATOM   6521 O O   . GLY B 1 305 ? 28.364  13.256  -49.099 1.00 61.31  ? 305  GLY B O   1 
ATOM   6522 N N   . ASP B 1 306 ? 26.741  11.669  -48.993 1.00 58.97  ? 306  ASP B N   1 
ATOM   6523 C CA  . ASP B 1 306 ? 26.017  12.143  -50.176 1.00 59.51  ? 306  ASP B CA  1 
ATOM   6524 C C   . ASP B 1 306 ? 24.577  12.507  -49.803 1.00 57.74  ? 306  ASP B C   1 
ATOM   6525 O O   . ASP B 1 306 ? 24.282  13.671  -49.500 1.00 58.44  ? 306  ASP B O   1 
ATOM   6526 C CB  . ASP B 1 306 ? 26.070  11.109  -51.314 1.00 59.94  ? 306  ASP B CB  1 
ATOM   6527 C CG  . ASP B 1 306 ? 25.413  11.602  -52.606 1.00 60.95  ? 306  ASP B CG  1 
ATOM   6528 O OD1 . ASP B 1 306 ? 24.954  12.766  -52.671 1.00 61.53  ? 306  ASP B OD1 1 
ATOM   6529 O OD2 . ASP B 1 306 ? 25.358  10.807  -53.567 1.00 61.11  ? 306  ASP B OD2 1 
ATOM   6530 N N   . PHE B 1 307 ? 23.687  11.518  -49.813 1.00 56.10  ? 307  PHE B N   1 
ATOM   6531 C CA  . PHE B 1 307 ? 22.314  11.742  -49.378 1.00 54.25  ? 307  PHE B CA  1 
ATOM   6532 C C   . PHE B 1 307 ? 22.332  12.330  -47.978 1.00 53.73  ? 307  PHE B C   1 
ATOM   6533 O O   . PHE B 1 307 ? 21.617  13.290  -47.688 1.00 53.06  ? 307  PHE B O   1 
ATOM   6534 C CB  . PHE B 1 307 ? 21.528  10.431  -49.361 1.00 52.94  ? 307  PHE B CB  1 
ATOM   6535 C CG  . PHE B 1 307 ? 20.034  10.616  -49.215 1.00 51.05  ? 307  PHE B CG  1 
ATOM   6536 C CD1 . PHE B 1 307 ? 19.482  11.052  -48.013 1.00 48.68  ? 307  PHE B CD1 1 
ATOM   6537 C CD2 . PHE B 1 307 ? 19.184  10.338  -50.284 1.00 50.44  ? 307  PHE B CD2 1 
ATOM   6538 C CE1 . PHE B 1 307 ? 18.120  11.208  -47.880 1.00 47.74  ? 307  PHE B CE1 1 
ATOM   6539 C CE2 . PHE B 1 307 ? 17.820  10.488  -50.168 1.00 48.70  ? 307  PHE B CE2 1 
ATOM   6540 C CZ  . PHE B 1 307 ? 17.280  10.918  -48.963 1.00 48.80  ? 307  PHE B CZ  1 
ATOM   6541 N N   . LEU B 1 308 ? 23.142  11.710  -47.120 1.00 53.84  ? 308  LEU B N   1 
ATOM   6542 C CA  . LEU B 1 308 ? 23.356  12.156  -45.758 1.00 53.66  ? 308  LEU B CA  1 
ATOM   6543 C C   . LEU B 1 308 ? 24.743  12.778  -45.688 1.00 55.73  ? 308  LEU B C   1 
ATOM   6544 O O   . LEU B 1 308 ? 25.739  12.057  -45.628 1.00 56.95  ? 308  LEU B O   1 
ATOM   6545 C CB  . LEU B 1 308 ? 23.246  10.962  -44.798 1.00 52.63  ? 308  LEU B CB  1 
ATOM   6546 C CG  . LEU B 1 308 ? 21.874  10.313  -44.597 1.00 49.76  ? 308  LEU B CG  1 
ATOM   6547 C CD1 . LEU B 1 308 ? 21.959  9.247   -43.557 1.00 48.07  ? 308  LEU B CD1 1 
ATOM   6548 C CD2 . LEU B 1 308 ? 20.857  11.340  -44.178 1.00 49.06  ? 308  LEU B CD2 1 
ATOM   6549 N N   . SER B 1 309 ? 24.820  14.105  -45.707 1.00 56.64  ? 309  SER B N   1 
ATOM   6550 C CA  . SER B 1 309 ? 26.124  14.776  -45.718 1.00 59.05  ? 309  SER B CA  1 
ATOM   6551 C C   . SER B 1 309 ? 26.990  14.477  -44.474 1.00 59.49  ? 309  SER B C   1 
ATOM   6552 O O   . SER B 1 309 ? 28.206  14.513  -44.551 1.00 60.96  ? 309  SER B O   1 
ATOM   6553 C CB  . SER B 1 309 ? 25.969  16.288  -45.930 1.00 60.11  ? 309  SER B CB  1 
ATOM   6554 O OG  . SER B 1 309 ? 25.434  16.929  -44.778 1.00 61.21  ? 309  SER B OG  1 
ATOM   6555 N N   . ASP B 1 310 ? 26.352  14.178  -43.345 1.00 58.22  ? 310  ASP B N   1 
ATOM   6556 C CA  . ASP B 1 310 ? 27.036  13.834  -42.096 1.00 58.72  ? 310  ASP B CA  1 
ATOM   6557 C C   . ASP B 1 310 ? 26.120  12.860  -41.338 1.00 57.41  ? 310  ASP B C   1 
ATOM   6558 O O   . ASP B 1 310 ? 25.089  12.448  -41.872 1.00 56.30  ? 310  ASP B O   1 
ATOM   6559 C CB  . ASP B 1 310 ? 27.281  15.108  -41.280 1.00 59.32  ? 310  ASP B CB  1 
ATOM   6560 C CG  . ASP B 1 310 ? 28.557  15.050  -40.427 1.00 60.76  ? 310  ASP B CG  1 
ATOM   6561 O OD1 . ASP B 1 310 ? 29.011  13.940  -40.052 1.00 60.42  ? 310  ASP B OD1 1 
ATOM   6562 O OD2 . ASP B 1 310 ? 29.091  16.140  -40.112 1.00 59.41  ? 310  ASP B OD2 1 
ATOM   6563 N N   . THR B 1 311 ? 26.459  12.490  -40.106 1.00 57.87  ? 311  THR B N   1 
ATOM   6564 C CA  . THR B 1 311 ? 25.515  11.720  -39.288 1.00 56.60  ? 311  THR B CA  1 
ATOM   6565 C C   . THR B 1 311 ? 24.287  12.589  -38.975 1.00 56.19  ? 311  THR B C   1 
ATOM   6566 O O   . THR B 1 311 ? 24.396  13.814  -38.833 1.00 56.68  ? 311  THR B O   1 
ATOM   6567 C CB  . THR B 1 311 ? 26.122  11.231  -37.940 1.00 57.10  ? 311  THR B CB  1 
ATOM   6568 O OG1 . THR B 1 311 ? 26.311  12.345  -37.066 1.00 58.36  ? 311  THR B OG1 1 
ATOM   6569 C CG2 . THR B 1 311 ? 27.457  10.474  -38.122 1.00 57.69  ? 311  THR B CG2 1 
ATOM   6570 N N   . PRO B 1 312 ? 23.106  11.966  -38.866 1.00 55.39  ? 312  PRO B N   1 
ATOM   6571 C CA  . PRO B 1 312 ? 21.934  12.727  -38.422 1.00 54.98  ? 312  PRO B CA  1 
ATOM   6572 C C   . PRO B 1 312 ? 22.202  13.592  -37.187 1.00 55.95  ? 312  PRO B C   1 
ATOM   6573 O O   . PRO B 1 312 ? 21.766  14.741  -37.147 1.00 56.03  ? 312  PRO B O   1 
ATOM   6574 C CB  . PRO B 1 312 ? 20.918  11.633  -38.104 1.00 53.60  ? 312  PRO B CB  1 
ATOM   6575 C CG  . PRO B 1 312 ? 21.259  10.571  -39.110 1.00 53.55  ? 312  PRO B CG  1 
ATOM   6576 C CD  . PRO B 1 312 ? 22.761  10.574  -39.208 1.00 54.41  ? 312  PRO B CD  1 
ATOM   6577 N N   . GLU B 1 313 ? 22.917  13.045  -36.208 1.00 56.98  ? 313  GLU B N   1 
ATOM   6578 C CA  . GLU B 1 313 ? 23.307  13.794  -35.021 1.00 58.75  ? 313  GLU B CA  1 
ATOM   6579 C C   . GLU B 1 313 ? 23.975  15.120  -35.384 1.00 59.77  ? 313  GLU B C   1 
ATOM   6580 O O   . GLU B 1 313 ? 23.530  16.189  -34.958 1.00 59.85  ? 313  GLU B O   1 
ATOM   6581 C CB  . GLU B 1 313 ? 24.222  12.954  -34.129 1.00 59.98  ? 313  GLU B CB  1 
ATOM   6582 C CG  . GLU B 1 313 ? 23.436  11.966  -33.229 1.00 63.12  ? 313  GLU B CG  1 
ATOM   6583 C CD  . GLU B 1 313 ? 22.888  10.704  -33.984 1.00 66.04  ? 313  GLU B CD  1 
ATOM   6584 O OE1 . GLU B 1 313 ? 23.243  10.485  -35.194 1.00 65.60  ? 313  GLU B OE1 1 
ATOM   6585 O OE2 . GLU B 1 313 ? 22.110  9.933   -33.338 1.00 64.13  ? 313  GLU B OE2 1 
ATOM   6586 N N   . ALA B 1 314 ? 25.024  15.048  -36.193 1.00 60.56  ? 314  ALA B N   1 
ATOM   6587 C CA  . ALA B 1 314 ? 25.713  16.239  -36.652 1.00 62.00  ? 314  ALA B CA  1 
ATOM   6588 C C   . ALA B 1 314 ? 24.777  17.194  -37.411 1.00 61.61  ? 314  ALA B C   1 
ATOM   6589 O O   . ALA B 1 314 ? 24.917  18.423  -37.315 1.00 62.55  ? 314  ALA B O   1 
ATOM   6590 C CB  . ALA B 1 314 ? 26.903  15.856  -37.507 1.00 63.03  ? 314  ALA B CB  1 
ATOM   6591 N N   . LEU B 1 315 ? 23.817  16.624  -38.141 1.00 60.22  ? 315  LEU B N   1 
ATOM   6592 C CA  . LEU B 1 315 ? 22.957  17.402  -39.022 1.00 59.88  ? 315  LEU B CA  1 
ATOM   6593 C C   . LEU B 1 315 ? 21.882  18.176  -38.278 1.00 59.78  ? 315  LEU B C   1 
ATOM   6594 O O   . LEU B 1 315 ? 21.641  19.353  -38.583 1.00 60.42  ? 315  LEU B O   1 
ATOM   6595 C CB  . LEU B 1 315 ? 22.345  16.520  -40.101 1.00 58.61  ? 315  LEU B CB  1 
ATOM   6596 C CG  . LEU B 1 315 ? 23.314  16.130  -41.223 1.00 58.67  ? 315  LEU B CG  1 
ATOM   6597 C CD1 . LEU B 1 315 ? 22.606  15.320  -42.286 1.00 53.94  ? 315  LEU B CD1 1 
ATOM   6598 C CD2 . LEU B 1 315 ? 23.946  17.375  -41.837 1.00 59.45  ? 315  LEU B CD2 1 
ATOM   6599 N N   . ILE B 1 316 ? 21.270  17.530  -37.286 1.00 59.14  ? 316  ILE B N   1 
ATOM   6600 C CA  . ILE B 1 316 ? 20.268  18.186  -36.450 1.00 59.35  ? 316  ILE B CA  1 
ATOM   6601 C C   . ILE B 1 316 ? 20.908  19.207  -35.508 1.00 61.73  ? 316  ILE B C   1 
ATOM   6602 O O   . ILE B 1 316 ? 20.280  20.212  -35.166 1.00 62.22  ? 316  ILE B O   1 
ATOM   6603 C CB  . ILE B 1 316 ? 19.366  17.189  -35.669 1.00 57.57  ? 316  ILE B CB  1 
ATOM   6604 C CG1 . ILE B 1 316 ? 20.163  16.385  -34.642 1.00 58.54  ? 316  ILE B CG1 1 
ATOM   6605 C CG2 . ILE B 1 316 ? 18.675  16.234  -36.620 1.00 55.91  ? 316  ILE B CG2 1 
ATOM   6606 C CD1 . ILE B 1 316 ? 19.343  15.272  -33.929 1.00 58.16  ? 316  ILE B CD1 1 
ATOM   6607 N N   . ASN B 1 317 ? 22.157  18.964  -35.104 1.00 63.74  ? 317  ASN B N   1 
ATOM   6608 C CA  . ASN B 1 317 ? 22.840  19.859  -34.175 1.00 65.90  ? 317  ASN B CA  1 
ATOM   6609 C C   . ASN B 1 317 ? 23.152  21.195  -34.818 1.00 67.77  ? 317  ASN B C   1 
ATOM   6610 O O   . ASN B 1 317 ? 23.097  22.216  -34.151 1.00 68.79  ? 317  ASN B O   1 
ATOM   6611 C CB  . ASN B 1 317 ? 24.116  19.225  -33.614 1.00 66.94  ? 317  ASN B CB  1 
ATOM   6612 C CG  . ASN B 1 317 ? 23.842  18.215  -32.489 1.00 67.00  ? 317  ASN B CG  1 
ATOM   6613 O OD1 . ASN B 1 317 ? 22.701  18.009  -32.073 1.00 68.44  ? 317  ASN B OD1 1 
ATOM   6614 N ND2 . ASN B 1 317 ? 24.898  17.576  -32.000 1.00 67.55  ? 317  ASN B ND2 1 
ATOM   6615 N N   . THR B 1 318 ? 23.440  21.181  -36.117 1.00 68.50  ? 318  THR B N   1 
ATOM   6616 C CA  . THR B 1 318 ? 23.959  22.358  -36.821 1.00 70.78  ? 318  THR B CA  1 
ATOM   6617 C C   . THR B 1 318 ? 23.076  22.820  -37.981 1.00 70.91  ? 318  THR B C   1 
ATOM   6618 O O   . THR B 1 318 ? 23.470  23.728  -38.720 1.00 72.15  ? 318  THR B O   1 
ATOM   6619 C CB  . THR B 1 318 ? 25.352  22.081  -37.442 1.00 72.26  ? 318  THR B CB  1 
ATOM   6620 O OG1 . THR B 1 318 ? 25.234  21.032  -38.417 1.00 70.88  ? 318  THR B OG1 1 
ATOM   6621 C CG2 . THR B 1 318 ? 26.387  21.694  -36.372 1.00 73.33  ? 318  THR B CG2 1 
ATOM   6622 N N   . GLY B 1 319 ? 21.917  22.180  -38.165 1.00 69.46  ? 319  GLY B N   1 
ATOM   6623 C CA  . GLY B 1 319 ? 21.019  22.519  -39.270 1.00 69.26  ? 319  GLY B CA  1 
ATOM   6624 C C   . GLY B 1 319 ? 20.274  23.821  -39.021 1.00 70.39  ? 319  GLY B C   1 
ATOM   6625 O O   . GLY B 1 319 ? 20.144  24.263  -37.875 1.00 70.51  ? 319  GLY B O   1 
ATOM   6626 N N   . ASP B 1 320 ? 19.807  24.449  -40.099 1.00 71.16  ? 320  ASP B N   1 
ATOM   6627 C CA  . ASP B 1 320 ? 18.904  25.586  -39.990 1.00 71.94  ? 320  ASP B CA  1 
ATOM   6628 C C   . ASP B 1 320 ? 17.506  25.112  -40.365 1.00 70.19  ? 320  ASP B C   1 
ATOM   6629 O O   . ASP B 1 320 ? 17.263  24.726  -41.513 1.00 69.84  ? 320  ASP B O   1 
ATOM   6630 C CB  . ASP B 1 320 ? 19.340  26.744  -40.891 1.00 74.09  ? 320  ASP B CB  1 
ATOM   6631 C CG  . ASP B 1 320 ? 18.546  28.027  -40.628 1.00 76.05  ? 320  ASP B CG  1 
ATOM   6632 O OD1 . ASP B 1 320 ? 17.538  27.989  -39.891 1.00 74.92  ? 320  ASP B OD1 1 
ATOM   6633 O OD2 . ASP B 1 320 ? 18.938  29.096  -41.157 1.00 80.07  ? 320  ASP B OD2 1 
ATOM   6634 N N   . PHE B 1 321 ? 16.596  25.131  -39.392 1.00 69.10  ? 321  PHE B N   1 
ATOM   6635 C CA  . PHE B 1 321 ? 15.249  24.620  -39.605 1.00 67.94  ? 321  PHE B CA  1 
ATOM   6636 C C   . PHE B 1 321 ? 14.198  25.702  -39.420 1.00 69.27  ? 321  PHE B C   1 
ATOM   6637 O O   . PHE B 1 321 ? 13.095  25.431  -38.952 1.00 68.32  ? 321  PHE B O   1 
ATOM   6638 C CB  . PHE B 1 321 ? 14.970  23.416  -38.694 1.00 65.94  ? 321  PHE B CB  1 
ATOM   6639 C CG  . PHE B 1 321 ? 16.000  22.327  -38.793 1.00 63.75  ? 321  PHE B CG  1 
ATOM   6640 C CD1 . PHE B 1 321 ? 16.052  21.492  -39.903 1.00 62.19  ? 321  PHE B CD1 1 
ATOM   6641 C CD2 . PHE B 1 321 ? 16.931  22.141  -37.782 1.00 63.16  ? 321  PHE B CD2 1 
ATOM   6642 C CE1 . PHE B 1 321 ? 17.017  20.474  -40.000 1.00 61.89  ? 321  PHE B CE1 1 
ATOM   6643 C CE2 . PHE B 1 321 ? 17.886  21.120  -37.865 1.00 62.85  ? 321  PHE B CE2 1 
ATOM   6644 C CZ  . PHE B 1 321 ? 17.923  20.282  -38.978 1.00 61.36  ? 321  PHE B CZ  1 
ATOM   6645 N N   . GLN B 1 322 ? 14.550  26.917  -39.838 1.00 71.98  ? 322  GLN B N   1 
ATOM   6646 C CA  . GLN B 1 322 ? 13.727  28.105  -39.656 1.00 73.90  ? 322  GLN B CA  1 
ATOM   6647 C C   . GLN B 1 322 ? 12.295  27.976  -40.204 1.00 73.15  ? 322  GLN B C   1 
ATOM   6648 O O   . GLN B 1 322 ? 11.337  28.200  -39.453 1.00 73.57  ? 322  GLN B O   1 
ATOM   6649 C CB  . GLN B 1 322 ? 14.414  29.324  -40.260 1.00 76.48  ? 322  GLN B CB  1 
ATOM   6650 C CG  . GLN B 1 322 ? 14.033  30.635  -39.587 1.00 81.15  ? 322  GLN B CG  1 
ATOM   6651 C CD  . GLN B 1 322 ? 15.127  31.160  -38.650 1.00 86.13  ? 322  GLN B CD  1 
ATOM   6652 O OE1 . GLN B 1 322 ? 16.202  31.577  -39.108 1.00 88.18  ? 322  GLN B OE1 1 
ATOM   6653 N NE2 . GLN B 1 322 ? 14.849  31.159  -37.332 1.00 86.15  ? 322  GLN B NE2 1 
ATOM   6654 N N   . ASP B 1 323 ? 12.127  27.629  -41.483 1.00 72.09  ? 323  ASP B N   1 
ATOM   6655 C CA  . ASP B 1 323 ? 10.770  27.587  -42.056 1.00 71.38  ? 323  ASP B CA  1 
ATOM   6656 C C   . ASP B 1 323 ? 10.289  26.150  -42.219 1.00 68.63  ? 323  ASP B C   1 
ATOM   6657 O O   . ASP B 1 323 ? 10.004  25.675  -43.326 1.00 68.28  ? 323  ASP B O   1 
ATOM   6658 C CB  . ASP B 1 323 ? 10.657  28.407  -43.361 1.00 73.54  ? 323  ASP B CB  1 
ATOM   6659 C CG  . ASP B 1 323 ? 10.799  29.958  -43.130 1.00 77.85  ? 323  ASP B CG  1 
ATOM   6660 O OD1 . ASP B 1 323 ? 10.576  30.475  -41.999 1.00 80.50  ? 323  ASP B OD1 1 
ATOM   6661 O OD2 . ASP B 1 323 ? 11.135  30.671  -44.102 1.00 80.27  ? 323  ASP B OD2 1 
ATOM   6662 N N   . LEU B 1 324 ? 10.225  25.456  -41.087 1.00 65.82  ? 324  LEU B N   1 
ATOM   6663 C CA  . LEU B 1 324 ? 9.827   24.074  -41.054 1.00 62.22  ? 324  LEU B CA  1 
ATOM   6664 C C   . LEU B 1 324 ? 8.852   23.910  -39.922 1.00 60.57  ? 324  LEU B C   1 
ATOM   6665 O O   . LEU B 1 324 ? 9.033   24.517  -38.861 1.00 60.63  ? 324  LEU B O   1 
ATOM   6666 C CB  . LEU B 1 324 ? 11.037  23.172  -40.802 1.00 61.71  ? 324  LEU B CB  1 
ATOM   6667 C CG  . LEU B 1 324 ? 10.799  21.678  -41.089 1.00 59.66  ? 324  LEU B CG  1 
ATOM   6668 C CD1 . LEU B 1 324 ? 10.753  21.456  -42.594 1.00 59.14  ? 324  LEU B CD1 1 
ATOM   6669 C CD2 . LEU B 1 324 ? 11.871  20.802  -40.450 1.00 57.94  ? 324  LEU B CD2 1 
ATOM   6670 N N   . GLN B 1 325 ? 7.825   23.095  -40.155 1.00 58.02  ? 325  GLN B N   1 
ATOM   6671 C CA  . GLN B 1 325 ? 6.883   22.736  -39.113 1.00 56.33  ? 325  GLN B CA  1 
ATOM   6672 C C   . GLN B 1 325 ? 6.903   21.224  -38.961 1.00 54.25  ? 325  GLN B C   1 
ATOM   6673 O O   . GLN B 1 325 ? 6.788   20.489  -39.950 1.00 54.06  ? 325  GLN B O   1 
ATOM   6674 C CB  . GLN B 1 325 ? 5.470   23.225  -39.434 1.00 56.78  ? 325  GLN B CB  1 
ATOM   6675 C CG  . GLN B 1 325 ? 5.275   24.741  -39.441 1.00 58.90  ? 325  GLN B CG  1 
ATOM   6676 C CD  . GLN B 1 325 ? 5.403   25.360  -40.831 1.00 60.90  ? 325  GLN B CD  1 
ATOM   6677 O OE1 . GLN B 1 325 ? 6.129   26.336  -41.010 1.00 64.31  ? 325  GLN B OE1 1 
ATOM   6678 N NE2 . GLN B 1 325 ? 4.708   24.796  -41.816 1.00 59.38  ? 325  GLN B NE2 1 
ATOM   6679 N N   . VAL B 1 326 ? 7.054   20.753  -37.728 1.00 52.67  ? 326  VAL B N   1 
ATOM   6680 C CA  . VAL B 1 326 ? 7.184   19.323  -37.484 1.00 50.49  ? 326  VAL B CA  1 
ATOM   6681 C C   . VAL B 1 326 ? 6.189   18.869  -36.422 1.00 49.58  ? 326  VAL B C   1 
ATOM   6682 O O   . VAL B 1 326 ? 5.954   19.584  -35.462 1.00 50.32  ? 326  VAL B O   1 
ATOM   6683 C CB  . VAL B 1 326 ? 8.637   18.921  -37.081 1.00 49.85  ? 326  VAL B CB  1 
ATOM   6684 C CG1 . VAL B 1 326 ? 8.726   17.455  -36.894 1.00 49.80  ? 326  VAL B CG1 1 
ATOM   6685 C CG2 . VAL B 1 326 ? 9.619   19.265  -38.160 1.00 50.03  ? 326  VAL B CG2 1 
ATOM   6686 N N   . LEU B 1 327 ? 5.600   17.689  -36.619 1.00 47.86  ? 327  LEU B N   1 
ATOM   6687 C CA  . LEU B 1 327 ? 4.775   17.058  -35.622 1.00 46.99  ? 327  LEU B CA  1 
ATOM   6688 C C   . LEU B 1 327 ? 5.443   15.748  -35.239 1.00 46.34  ? 327  LEU B C   1 
ATOM   6689 O O   . LEU B 1 327 ? 5.646   14.881  -36.090 1.00 45.91  ? 327  LEU B O   1 
ATOM   6690 C CB  . LEU B 1 327 ? 3.359   16.821  -36.147 1.00 46.94  ? 327  LEU B CB  1 
ATOM   6691 C CG  . LEU B 1 327 ? 2.434   16.068  -35.184 1.00 48.01  ? 327  LEU B CG  1 
ATOM   6692 C CD1 . LEU B 1 327 ? 2.201   16.909  -33.942 1.00 50.96  ? 327  LEU B CD1 1 
ATOM   6693 C CD2 . LEU B 1 327 ? 1.089   15.675  -35.788 1.00 48.45  ? 327  LEU B CD2 1 
ATOM   6694 N N   . VAL B 1 328 ? 5.808   15.618  -33.964 1.00 46.03  ? 328  VAL B N   1 
ATOM   6695 C CA  . VAL B 1 328 ? 6.488   14.431  -33.471 1.00 45.34  ? 328  VAL B CA  1 
ATOM   6696 C C   . VAL B 1 328 ? 5.806   13.846  -32.258 1.00 45.53  ? 328  VAL B C   1 
ATOM   6697 O O   . VAL B 1 328 ? 5.254   14.592  -31.415 1.00 46.10  ? 328  VAL B O   1 
ATOM   6698 C CB  . VAL B 1 328 ? 7.940   14.716  -33.037 1.00 45.54  ? 328  VAL B CB  1 
ATOM   6699 C CG1 . VAL B 1 328 ? 8.846   14.767  -34.215 1.00 46.25  ? 328  VAL B CG1 1 
ATOM   6700 C CG2 . VAL B 1 328 ? 8.030   15.989  -32.262 1.00 46.76  ? 328  VAL B CG2 1 
ATOM   6701 N N   . GLY B 1 329 ? 5.888   12.518  -32.144 1.00 44.27  ? 329  GLY B N   1 
ATOM   6702 C CA  . GLY B 1 329 ? 5.391   11.846  -30.979 1.00 44.24  ? 329  GLY B CA  1 
ATOM   6703 C C   . GLY B 1 329 ? 5.706   10.376  -30.859 1.00 44.69  ? 329  GLY B C   1 
ATOM   6704 O O   . GLY B 1 329 ? 6.382   9.763   -31.714 1.00 44.32  ? 329  GLY B O   1 
ATOM   6705 N N   . VAL B 1 330 ? 5.196   9.807   -29.773 1.00 44.75  ? 330  VAL B N   1 
ATOM   6706 C CA  . VAL B 1 330 ? 5.475   8.447   -29.410 1.00 44.43  ? 330  VAL B CA  1 
ATOM   6707 C C   . VAL B 1 330 ? 4.185   7.816   -28.901 1.00 45.32  ? 330  VAL B C   1 
ATOM   6708 O O   . VAL B 1 330 ? 3.262   8.542   -28.513 1.00 45.69  ? 330  VAL B O   1 
ATOM   6709 C CB  . VAL B 1 330 ? 6.537   8.409   -28.301 1.00 45.17  ? 330  VAL B CB  1 
ATOM   6710 C CG1 . VAL B 1 330 ? 7.884   8.906   -28.807 1.00 43.69  ? 330  VAL B CG1 1 
ATOM   6711 C CG2 . VAL B 1 330 ? 6.070   9.210   -27.087 1.00 44.90  ? 330  VAL B CG2 1 
ATOM   6712 N N   . VAL B 1 331 ? 4.115   6.483   -28.906 1.00 45.28  ? 331  VAL B N   1 
ATOM   6713 C CA  . VAL B 1 331 ? 3.001   5.776   -28.280 1.00 46.61  ? 331  VAL B CA  1 
ATOM   6714 C C   . VAL B 1 331 ? 3.392   5.455   -26.832 1.00 47.96  ? 331  VAL B C   1 
ATOM   6715 O O   . VAL B 1 331 ? 4.576   5.527   -26.489 1.00 48.47  ? 331  VAL B O   1 
ATOM   6716 C CB  . VAL B 1 331 ? 2.589   4.483   -29.071 1.00 47.36  ? 331  VAL B CB  1 
ATOM   6717 C CG1 . VAL B 1 331 ? 1.979   4.839   -30.435 1.00 45.93  ? 331  VAL B CG1 1 
ATOM   6718 C CG2 . VAL B 1 331 ? 3.772   3.485   -29.221 1.00 46.56  ? 331  VAL B CG2 1 
ATOM   6719 N N   . LYS B 1 332 ? 2.425   5.102   -25.984 1.00 49.13  ? 332  LYS B N   1 
ATOM   6720 C CA  . LYS B 1 332 ? 2.699   4.826   -24.556 1.00 50.32  ? 332  LYS B CA  1 
ATOM   6721 C C   . LYS B 1 332 ? 3.689   3.672   -24.294 1.00 50.64  ? 332  LYS B C   1 
ATOM   6722 O O   . LYS B 1 332 ? 4.403   3.686   -23.293 1.00 51.18  ? 332  LYS B O   1 
ATOM   6723 C CB  . LYS B 1 332 ? 1.388   4.633   -23.759 1.00 51.66  ? 332  LYS B CB  1 
ATOM   6724 C CG  . LYS B 1 332 ? 1.539   4.247   -22.260 1.00 54.05  ? 332  LYS B CG  1 
ATOM   6725 C CD  . LYS B 1 332 ? 0.190   4.279   -21.489 1.00 58.76  ? 332  LYS B CD  1 
ATOM   6726 C CE  . LYS B 1 332 ? 0.028   3.110   -20.459 1.00 63.35  ? 332  LYS B CE  1 
ATOM   6727 N NZ  . LYS B 1 332 ? -0.004  1.698   -21.055 1.00 61.25  ? 332  LYS B NZ  1 
ATOM   6728 N N   . ASP B 1 333 ? 3.752   2.682   -25.180 1.00 50.46  ? 333  ASP B N   1 
ATOM   6729 C CA  . ASP B 1 333 ? 4.581   1.500   -24.893 1.00 50.99  ? 333  ASP B CA  1 
ATOM   6730 C C   . ASP B 1 333 ? 5.467   1.071   -26.059 1.00 49.78  ? 333  ASP B C   1 
ATOM   6731 O O   . ASP B 1 333 ? 5.366   -0.051  -26.541 1.00 50.88  ? 333  ASP B O   1 
ATOM   6732 C CB  . ASP B 1 333 ? 3.701   0.332   -24.422 1.00 52.28  ? 333  ASP B CB  1 
ATOM   6733 C CG  . ASP B 1 333 ? 3.016   0.615   -23.100 1.00 53.98  ? 333  ASP B CG  1 
ATOM   6734 O OD1 . ASP B 1 333 ? 1.827   1.022   -23.111 1.00 53.64  ? 333  ASP B OD1 1 
ATOM   6735 O OD2 . ASP B 1 333 ? 3.677   0.437   -22.051 1.00 54.98  ? 333  ASP B OD2 1 
ATOM   6736 N N   . GLU B 1 334 ? 6.349   1.961   -26.484 1.00 48.52  ? 334  GLU B N   1 
ATOM   6737 C CA  . GLU B 1 334 ? 7.200   1.737   -27.660 1.00 47.54  ? 334  GLU B CA  1 
ATOM   6738 C C   . GLU B 1 334 ? 7.988   0.442   -27.644 1.00 47.81  ? 334  GLU B C   1 
ATOM   6739 O O   . GLU B 1 334 ? 8.216   -0.154  -28.680 1.00 48.28  ? 334  GLU B O   1 
ATOM   6740 C CB  . GLU B 1 334 ? 8.177   2.903   -27.872 1.00 46.14  ? 334  GLU B CB  1 
ATOM   6741 C CG  . GLU B 1 334 ? 7.519   4.233   -28.114 1.00 46.23  ? 334  GLU B CG  1 
ATOM   6742 C CD  . GLU B 1 334 ? 7.012   4.426   -29.547 1.00 49.03  ? 334  GLU B CD  1 
ATOM   6743 O OE1 . GLU B 1 334 ? 7.112   3.501   -30.376 1.00 47.04  ? 334  GLU B OE1 1 
ATOM   6744 O OE2 . GLU B 1 334 ? 6.502   5.535   -29.847 1.00 51.07  ? 334  GLU B OE2 1 
ATOM   6745 N N   . GLY B 1 335 ? 8.426   0.004   -26.486 1.00 48.59  ? 335  GLY B N   1 
ATOM   6746 C CA  . GLY B 1 335 ? 9.320   -1.131  -26.463 1.00 49.67  ? 335  GLY B CA  1 
ATOM   6747 C C   . GLY B 1 335 ? 8.666   -2.505  -26.394 1.00 51.09  ? 335  GLY B C   1 
ATOM   6748 O O   . GLY B 1 335 ? 9.351   -3.514  -26.587 1.00 51.75  ? 335  GLY B O   1 
ATOM   6749 N N   . SER B 1 336 ? 7.364   -2.569  -26.122 1.00 51.35  ? 336  SER B N   1 
ATOM   6750 C CA  . SER B 1 336 ? 6.779   -3.842  -25.703 1.00 53.53  ? 336  SER B CA  1 
ATOM   6751 C C   . SER B 1 336 ? 6.817   -4.924  -26.784 1.00 54.32  ? 336  SER B C   1 
ATOM   6752 O O   . SER B 1 336 ? 7.275   -6.046  -26.527 1.00 55.85  ? 336  SER B O   1 
ATOM   6753 C CB  . SER B 1 336 ? 5.363   -3.657  -25.156 1.00 54.03  ? 336  SER B CB  1 
ATOM   6754 O OG  . SER B 1 336 ? 4.423   -3.392  -26.180 1.00 53.02  ? 336  SER B OG  1 
ATOM   6755 N N   . ALA B 1 337 ? 6.360   -4.574  -27.989 1.00 53.68  ? 337  ALA B N   1 
ATOM   6756 C CA  . ALA B 1 337 ? 6.313   -5.502  -29.108 1.00 53.90  ? 337  ALA B CA  1 
ATOM   6757 C C   . ALA B 1 337 ? 7.669   -6.149  -29.358 1.00 54.72  ? 337  ALA B C   1 
ATOM   6758 O O   . ALA B 1 337 ? 7.748   -7.371  -29.525 1.00 56.76  ? 337  ALA B O   1 
ATOM   6759 C CB  . ALA B 1 337 ? 5.814   -4.813  -30.351 1.00 52.34  ? 337  ALA B CB  1 
ATOM   6760 N N   . PHE B 1 338 ? 8.725   -5.339  -29.334 1.00 53.87  ? 338  PHE B N   1 
ATOM   6761 C CA  . PHE B 1 338 ? 10.081  -5.776  -29.675 1.00 54.12  ? 338  PHE B CA  1 
ATOM   6762 C C   . PHE B 1 338 ? 10.579  -6.869  -28.789 1.00 55.92  ? 338  PHE B C   1 
ATOM   6763 O O   . PHE B 1 338 ? 11.425  -7.669  -29.204 1.00 57.53  ? 338  PHE B O   1 
ATOM   6764 C CB  . PHE B 1 338 ? 11.056  -4.598  -29.630 1.00 52.98  ? 338  PHE B CB  1 
ATOM   6765 C CG  . PHE B 1 338 ? 10.831  -3.626  -30.721 1.00 51.85  ? 338  PHE B CG  1 
ATOM   6766 C CD1 . PHE B 1 338 ? 9.954   -2.571  -30.552 1.00 51.78  ? 338  PHE B CD1 1 
ATOM   6767 C CD2 . PHE B 1 338 ? 11.445  -3.802  -31.947 1.00 51.49  ? 338  PHE B CD2 1 
ATOM   6768 C CE1 . PHE B 1 338 ? 9.722   -1.680  -31.582 1.00 51.45  ? 338  PHE B CE1 1 
ATOM   6769 C CE2 . PHE B 1 338 ? 11.225  -2.925  -32.983 1.00 50.26  ? 338  PHE B CE2 1 
ATOM   6770 C CZ  . PHE B 1 338 ? 10.362  -1.863  -32.812 1.00 50.84  ? 338  PHE B CZ  1 
ATOM   6771 N N   . LEU B 1 339 ? 10.048  -6.914  -27.577 1.00 56.68  ? 339  LEU B N   1 
ATOM   6772 C CA  . LEU B 1 339 ? 10.479  -7.913  -26.617 1.00 59.06  ? 339  LEU B CA  1 
ATOM   6773 C C   . LEU B 1 339 ? 10.165  -9.340  -27.054 1.00 60.86  ? 339  LEU B C   1 
ATOM   6774 O O   . LEU B 1 339 ? 10.966  -10.245 -26.817 1.00 62.56  ? 339  LEU B O   1 
ATOM   6775 C CB  . LEU B 1 339 ? 9.881   -7.636  -25.241 1.00 59.60  ? 339  LEU B CB  1 
ATOM   6776 C CG  . LEU B 1 339 ? 10.259  -6.273  -24.677 1.00 57.33  ? 339  LEU B CG  1 
ATOM   6777 C CD1 . LEU B 1 339 ? 9.727   -6.115  -23.257 1.00 57.22  ? 339  LEU B CD1 1 
ATOM   6778 C CD2 . LEU B 1 339 ? 11.761  -6.138  -24.713 1.00 57.09  ? 339  LEU B CD2 1 
ATOM   6779 N N   . VAL B 1 340 ? 9.017   -9.538  -27.699 1.00 61.11  ? 340  VAL B N   1 
ATOM   6780 C CA  . VAL B 1 340 ? 8.581   -10.886 -28.059 1.00 63.43  ? 340  VAL B CA  1 
ATOM   6781 C C   . VAL B 1 340 ? 9.445   -11.425 -29.209 1.00 64.20  ? 340  VAL B C   1 
ATOM   6782 O O   . VAL B 1 340 ? 9.475   -12.637 -29.472 1.00 65.30  ? 340  VAL B O   1 
ATOM   6783 C CB  . VAL B 1 340 ? 7.066   -10.957 -28.401 1.00 63.30  ? 340  VAL B CB  1 
ATOM   6784 C CG1 . VAL B 1 340 ? 6.219   -10.296 -27.311 1.00 62.29  ? 340  VAL B CG1 1 
ATOM   6785 C CG2 . VAL B 1 340 ? 6.786   -10.310 -29.735 1.00 62.47  ? 340  VAL B CG2 1 
ATOM   6786 N N   . TYR B 1 341 ? 10.160  -10.505 -29.868 1.00 63.35  ? 341  TYR B N   1 
ATOM   6787 C CA  . TYR B 1 341 ? 11.075  -10.856 -30.953 1.00 63.78  ? 341  TYR B CA  1 
ATOM   6788 C C   . TYR B 1 341 ? 12.517  -11.158 -30.497 1.00 65.39  ? 341  TYR B C   1 
ATOM   6789 O O   . TYR B 1 341 ? 13.474  -10.529 -30.976 1.00 65.18  ? 341  TYR B O   1 
ATOM   6790 C CB  . TYR B 1 341 ? 11.091  -9.746  -31.998 1.00 61.49  ? 341  TYR B CB  1 
ATOM   6791 C CG  . TYR B 1 341 ? 9.852   -9.674  -32.842 1.00 59.99  ? 341  TYR B CG  1 
ATOM   6792 C CD1 . TYR B 1 341 ? 8.858   -8.760  -32.555 1.00 56.44  ? 341  TYR B CD1 1 
ATOM   6793 C CD2 . TYR B 1 341 ? 9.683   -10.514 -33.952 1.00 59.55  ? 341  TYR B CD2 1 
ATOM   6794 C CE1 . TYR B 1 341 ? 7.722   -8.678  -33.338 1.00 55.99  ? 341  TYR B CE1 1 
ATOM   6795 C CE2 . TYR B 1 341 ? 8.544   -10.435 -34.738 1.00 57.87  ? 341  TYR B CE2 1 
ATOM   6796 C CZ  . TYR B 1 341 ? 7.564   -9.517  -34.418 1.00 56.34  ? 341  TYR B CZ  1 
ATOM   6797 O OH  . TYR B 1 341 ? 6.424   -9.419  -35.174 1.00 55.69  ? 341  TYR B OH  1 
ATOM   6798 N N   . GLY B 1 342 ? 12.681  -12.120 -29.589 1.00 67.76  ? 342  GLY B N   1 
ATOM   6799 C CA  . GLY B 1 342 ? 14.025  -12.578 -29.213 1.00 69.07  ? 342  GLY B CA  1 
ATOM   6800 C C   . GLY B 1 342 ? 14.556  -12.367 -27.800 1.00 69.57  ? 342  GLY B C   1 
ATOM   6801 O O   . GLY B 1 342 ? 15.633  -12.866 -27.475 1.00 71.13  ? 342  GLY B O   1 
ATOM   6802 N N   . VAL B 1 343 ? 13.830  -11.634 -26.959 1.00 68.45  ? 343  VAL B N   1 
ATOM   6803 C CA  . VAL B 1 343 ? 14.263  -11.441 -25.579 1.00 68.85  ? 343  VAL B CA  1 
ATOM   6804 C C   . VAL B 1 343 ? 13.731  -12.595 -24.741 1.00 70.86  ? 343  VAL B C   1 
ATOM   6805 O O   . VAL B 1 343 ? 12.519  -12.698 -24.554 1.00 71.15  ? 343  VAL B O   1 
ATOM   6806 C CB  . VAL B 1 343 ? 13.763  -10.116 -24.991 1.00 67.40  ? 343  VAL B CB  1 
ATOM   6807 C CG1 . VAL B 1 343 ? 14.506  -9.811  -23.691 1.00 68.02  ? 343  VAL B CG1 1 
ATOM   6808 C CG2 . VAL B 1 343 ? 13.957  -8.985  -25.985 1.00 65.29  ? 343  VAL B CG2 1 
ATOM   6809 N N   . PRO B 1 344 ? 14.622  -13.475 -24.237 1.00 72.45  ? 344  PRO B N   1 
ATOM   6810 C CA  . PRO B 1 344 ? 14.103  -14.636 -23.508 1.00 74.44  ? 344  PRO B CA  1 
ATOM   6811 C C   . PRO B 1 344 ? 13.182  -14.187 -22.371 1.00 74.00  ? 344  PRO B C   1 
ATOM   6812 O O   . PRO B 1 344 ? 13.395  -13.111 -21.793 1.00 72.48  ? 344  PRO B O   1 
ATOM   6813 C CB  . PRO B 1 344 ? 15.368  -15.313 -22.953 1.00 76.51  ? 344  PRO B CB  1 
ATOM   6814 C CG  . PRO B 1 344 ? 16.485  -14.822 -23.818 1.00 75.44  ? 344  PRO B CG  1 
ATOM   6815 C CD  . PRO B 1 344 ? 16.096  -13.418 -24.201 1.00 72.99  ? 344  PRO B CD  1 
ATOM   6816 N N   . GLY B 1 345 ? 12.158  -14.997 -22.092 1.00 74.86  ? 345  GLY B N   1 
ATOM   6817 C CA  . GLY B 1 345 ? 11.188  -14.718 -21.035 1.00 74.58  ? 345  GLY B CA  1 
ATOM   6818 C C   . GLY B 1 345 ? 9.949   -13.977 -21.501 1.00 72.52  ? 345  GLY B C   1 
ATOM   6819 O O   . GLY B 1 345 ? 8.978   -13.858 -20.758 1.00 73.06  ? 345  GLY B O   1 
ATOM   6820 N N   . PHE B 1 346 ? 9.975   -13.473 -22.730 1.00 70.38  ? 346  PHE B N   1 
ATOM   6821 C CA  . PHE B 1 346 ? 8.839   -12.716 -23.262 1.00 68.59  ? 346  PHE B CA  1 
ATOM   6822 C C   . PHE B 1 346 ? 8.066   -13.476 -24.330 1.00 68.92  ? 346  PHE B C   1 
ATOM   6823 O O   . PHE B 1 346 ? 8.646   -14.230 -25.125 1.00 69.14  ? 346  PHE B O   1 
ATOM   6824 C CB  . PHE B 1 346 ? 9.273   -11.343 -23.788 1.00 65.93  ? 346  PHE B CB  1 
ATOM   6825 C CG  . PHE B 1 346 ? 9.778   -10.421 -22.718 1.00 65.40  ? 346  PHE B CG  1 
ATOM   6826 C CD1 . PHE B 1 346 ? 11.095  -10.510 -22.266 1.00 65.67  ? 346  PHE B CD1 1 
ATOM   6827 C CD2 . PHE B 1 346 ? 8.933   -9.473  -22.150 1.00 64.32  ? 346  PHE B CD2 1 
ATOM   6828 C CE1 . PHE B 1 346 ? 11.570  -9.662  -21.275 1.00 65.61  ? 346  PHE B CE1 1 
ATOM   6829 C CE2 . PHE B 1 346 ? 9.394   -8.618  -21.153 1.00 64.75  ? 346  PHE B CE2 1 
ATOM   6830 C CZ  . PHE B 1 346 ? 10.721  -8.707  -20.717 1.00 65.40  ? 346  PHE B CZ  1 
ATOM   6831 N N   . SER B 1 347 ? 6.750   -13.252 -24.320 1.00 68.83  ? 347  SER B N   1 
ATOM   6832 C CA  . SER B 1 347 ? 5.786   -13.893 -25.204 1.00 69.03  ? 347  SER B CA  1 
ATOM   6833 C C   . SER B 1 347 ? 4.460   -13.143 -25.137 1.00 68.31  ? 347  SER B C   1 
ATOM   6834 O O   . SER B 1 347 ? 4.166   -12.475 -24.148 1.00 67.96  ? 347  SER B O   1 
ATOM   6835 C CB  . SER B 1 347 ? 5.581   -15.355 -24.783 1.00 71.87  ? 347  SER B CB  1 
ATOM   6836 O OG  . SER B 1 347 ? 4.392   -15.890 -25.338 1.00 72.36  ? 347  SER B OG  1 
ATOM   6837 N N   . LYS B 1 348 ? 3.657   -13.259 -26.189 1.00 68.32  ? 348  LYS B N   1 
ATOM   6838 C CA  . LYS B 1 348 ? 2.287   -12.735 -26.163 1.00 68.60  ? 348  LYS B CA  1 
ATOM   6839 C C   . LYS B 1 348 ? 1.315   -13.691 -25.442 1.00 71.52  ? 348  LYS B C   1 
ATOM   6840 O O   . LYS B 1 348 ? 0.223   -13.286 -25.032 1.00 72.06  ? 348  LYS B O   1 
ATOM   6841 C CB  . LYS B 1 348 ? 1.789   -12.472 -27.587 1.00 67.46  ? 348  LYS B CB  1 
ATOM   6842 C CG  . LYS B 1 348 ? 1.346   -13.726 -28.337 1.00 69.19  ? 348  LYS B CG  1 
ATOM   6843 C CD  . LYS B 1 348 ? 0.400   -13.381 -29.463 1.00 68.82  ? 348  LYS B CD  1 
ATOM   6844 C CE  . LYS B 1 348 ? 0.093   -14.601 -30.314 1.00 70.82  ? 348  LYS B CE  1 
ATOM   6845 N NZ  . LYS B 1 348 ? -0.967  -15.435 -29.715 1.00 72.86  ? 348  LYS B NZ  1 
ATOM   6846 N N   . ASP B 1 349 ? 1.718   -14.948 -25.279 1.00 73.45  ? 349  ASP B N   1 
ATOM   6847 C CA  . ASP B 1 349 ? 0.809   -15.987 -24.770 1.00 76.99  ? 349  ASP B CA  1 
ATOM   6848 C C   . ASP B 1 349 ? 0.760   -16.136 -23.234 1.00 78.95  ? 349  ASP B C   1 
ATOM   6849 O O   . ASP B 1 349 ? 0.020   -16.978 -22.707 1.00 81.17  ? 349  ASP B O   1 
ATOM   6850 C CB  . ASP B 1 349 ? 1.081   -17.334 -25.469 1.00 78.48  ? 349  ASP B CB  1 
ATOM   6851 C CG  . ASP B 1 349 ? 0.876   -17.257 -26.988 1.00 77.44  ? 349  ASP B CG  1 
ATOM   6852 O OD1 . ASP B 1 349 ? -0.008  -16.491 -27.437 1.00 76.48  ? 349  ASP B OD1 1 
ATOM   6853 O OD2 . ASP B 1 349 ? 1.605   -17.950 -27.733 1.00 77.69  ? 349  ASP B OD2 1 
ATOM   6854 N N   . ASN B 1 350 ? 1.543   -15.311 -22.534 1.00 77.98  ? 350  ASN B N   1 
ATOM   6855 C CA  . ASN B 1 350 ? 1.468   -15.192 -21.069 1.00 79.56  ? 350  ASN B CA  1 
ATOM   6856 C C   . ASN B 1 350 ? 1.852   -13.776 -20.620 1.00 77.35  ? 350  ASN B C   1 
ATOM   6857 O O   . ASN B 1 350 ? 2.366   -12.987 -21.418 1.00 74.73  ? 350  ASN B O   1 
ATOM   6858 C CB  . ASN B 1 350 ? 2.298   -16.291 -20.350 1.00 81.63  ? 350  ASN B CB  1 
ATOM   6859 C CG  . ASN B 1 350 ? 3.805   -16.205 -20.648 1.00 81.13  ? 350  ASN B CG  1 
ATOM   6860 O OD1 . ASN B 1 350 ? 4.376   -15.119 -20.794 1.00 79.89  ? 350  ASN B OD1 1 
ATOM   6861 N ND2 . ASN B 1 350 ? 4.451   -17.356 -20.718 1.00 82.02  ? 350  ASN B ND2 1 
ATOM   6862 N N   . GLU B 1 351 ? 1.598   -13.463 -19.348 1.00 78.67  ? 351  GLU B N   1 
ATOM   6863 C CA  . GLU B 1 351 ? 1.859   -12.127 -18.782 1.00 77.16  ? 351  GLU B CA  1 
ATOM   6864 C C   . GLU B 1 351 ? 3.338   -11.691 -18.794 1.00 75.10  ? 351  GLU B C   1 
ATOM   6865 O O   . GLU B 1 351 ? 3.646   -10.535 -18.485 1.00 73.38  ? 351  GLU B O   1 
ATOM   6866 C CB  . GLU B 1 351 ? 1.313   -12.045 -17.355 1.00 79.40  ? 351  GLU B CB  1 
ATOM   6867 C CG  . GLU B 1 351 ? -0.207  -12.104 -17.227 1.00 83.22  ? 351  GLU B CG  1 
ATOM   6868 C CD  . GLU B 1 351 ? -0.682  -11.653 -15.844 1.00 88.57  ? 351  GLU B CD  1 
ATOM   6869 O OE1 . GLU B 1 351 ? -0.423  -10.487 -15.467 1.00 88.49  ? 351  GLU B OE1 1 
ATOM   6870 O OE2 . GLU B 1 351 ? -1.315  -12.463 -15.132 1.00 92.84  ? 351  GLU B OE2 1 
ATOM   6871 N N   . SER B 1 352 ? 4.233   -12.620 -19.153 1.00 75.26  ? 352  SER B N   1 
ATOM   6872 C CA  . SER B 1 352 ? 5.685   -12.376 -19.259 1.00 73.84  ? 352  SER B CA  1 
ATOM   6873 C C   . SER B 1 352 ? 6.285   -11.729 -18.013 1.00 74.07  ? 352  SER B C   1 
ATOM   6874 O O   . SER B 1 352 ? 6.782   -10.583 -18.060 1.00 72.38  ? 352  SER B O   1 
ATOM   6875 C CB  . SER B 1 352 ? 6.028   -11.555 -20.506 1.00 70.85  ? 352  SER B CB  1 
ATOM   6876 O OG  . SER B 1 352 ? 5.781   -12.298 -21.676 1.00 70.53  ? 352  SER B OG  1 
ATOM   6877 N N   . LEU B 1 353 ? 6.207   -12.458 -16.900 1.00 75.95  ? 353  LEU B N   1 
ATOM   6878 C CA  . LEU B 1 353 ? 6.811   -12.033 -15.645 1.00 76.44  ? 353  LEU B CA  1 
ATOM   6879 C C   . LEU B 1 353 ? 8.210   -12.625 -15.589 1.00 77.20  ? 353  LEU B C   1 
ATOM   6880 O O   . LEU B 1 353 ? 8.395   -13.800 -15.252 1.00 79.74  ? 353  LEU B O   1 
ATOM   6881 C CB  . LEU B 1 353 ? 5.980   -12.486 -14.440 1.00 78.71  ? 353  LEU B CB  1 
ATOM   6882 C CG  . LEU B 1 353 ? 4.500   -12.097 -14.346 1.00 78.72  ? 353  LEU B CG  1 
ATOM   6883 C CD1 . LEU B 1 353 ? 3.785   -13.034 -13.375 1.00 81.97  ? 353  LEU B CD1 1 
ATOM   6884 C CD2 . LEU B 1 353 ? 4.294   -10.645 -13.942 1.00 75.95  ? 353  LEU B CD2 1 
ATOM   6885 N N   . ILE B 1 354 ? 9.186   -11.799 -15.947 1.00 75.42  ? 354  ILE B N   1 
ATOM   6886 C CA  . ILE B 1 354 ? 10.594  -12.184 -16.009 1.00 75.72  ? 354  ILE B CA  1 
ATOM   6887 C C   . ILE B 1 354 ? 11.300  -12.079 -14.646 1.00 77.53  ? 354  ILE B C   1 
ATOM   6888 O O   . ILE B 1 354 ? 10.796  -11.441 -13.714 1.00 77.73  ? 354  ILE B O   1 
ATOM   6889 C CB  . ILE B 1 354 ? 11.357  -11.312 -17.042 1.00 73.31  ? 354  ILE B CB  1 
ATOM   6890 C CG1 . ILE B 1 354 ? 11.067  -9.825  -16.808 1.00 70.39  ? 354  ILE B CG1 1 
ATOM   6891 C CG2 . ILE B 1 354 ? 10.961  -11.703 -18.449 1.00 72.22  ? 354  ILE B CG2 1 
ATOM   6892 C CD1 . ILE B 1 354 ? 12.134  -8.904  -17.318 1.00 68.23  ? 354  ILE B CD1 1 
ATOM   6893 N N   . SER B 1 355 ? 12.470  -12.712 -14.549 1.00 78.96  ? 355  SER B N   1 
ATOM   6894 C CA  . SER B 1 355 ? 13.338  -12.607 -13.380 1.00 80.53  ? 355  SER B CA  1 
ATOM   6895 C C   . SER B 1 355 ? 14.253  -11.383 -13.503 1.00 78.76  ? 355  SER B C   1 
ATOM   6896 O O   . SER B 1 355 ? 14.246  -10.687 -14.524 1.00 76.56  ? 355  SER B O   1 
ATOM   6897 C CB  . SER B 1 355 ? 14.210  -13.851 -13.280 1.00 82.99  ? 355  SER B CB  1 
ATOM   6898 O OG  . SER B 1 355 ? 15.148  -13.859 -14.345 1.00 82.31  ? 355  SER B OG  1 
ATOM   6899 N N   . ARG B 1 356 ? 15.040  -11.136 -12.456 1.00 79.97  ? 356  ARG B N   1 
ATOM   6900 C CA  . ARG B 1 356 ? 16.112  -10.148 -12.493 1.00 78.86  ? 356  ARG B CA  1 
ATOM   6901 C C   . ARG B 1 356 ? 17.196  -10.534 -13.521 1.00 78.51  ? 356  ARG B C   1 
ATOM   6902 O O   . ARG B 1 356 ? 17.590  -9.712  -14.349 1.00 76.58  ? 356  ARG B O   1 
ATOM   6903 C CB  . ARG B 1 356 ? 16.712  -9.963  -11.095 1.00 80.63  ? 356  ARG B CB  1 
ATOM   6904 C CG  . ARG B 1 356 ? 17.813  -8.921  -11.038 1.00 80.73  ? 356  ARG B CG  1 
ATOM   6905 C CD  . ARG B 1 356 ? 17.610  -7.944  -9.891  1.00 82.13  ? 356  ARG B CD  1 
ATOM   6906 N NE  . ARG B 1 356 ? 18.625  -6.893  -9.897  1.00 81.95  ? 356  ARG B NE  1 
ATOM   6907 C CZ  . ARG B 1 356 ? 18.442  -5.655  -10.354 1.00 79.63  ? 356  ARG B CZ  1 
ATOM   6908 N NH1 . ARG B 1 356 ? 17.267  -5.276  -10.848 1.00 76.94  ? 356  ARG B NH1 1 
ATOM   6909 N NH2 . ARG B 1 356 ? 19.448  -4.790  -10.307 1.00 79.53  ? 356  ARG B NH2 1 
ATOM   6910 N N   . ALA B 1 357 ? 17.664  -11.785 -13.467 1.00 80.54  ? 357  ALA B N   1 
ATOM   6911 C CA  . ALA B 1 357 ? 18.684  -12.273 -14.400 1.00 80.14  ? 357  ALA B CA  1 
ATOM   6912 C C   . ALA B 1 357 ? 18.235  -12.029 -15.832 1.00 77.36  ? 357  ALA B C   1 
ATOM   6913 O O   . ALA B 1 357 ? 19.000  -11.521 -16.650 1.00 75.91  ? 357  ALA B O   1 
ATOM   6914 C CB  . ALA B 1 357 ? 18.982  -13.755 -14.160 1.00 82.89  ? 357  ALA B CB  1 
ATOM   6915 N N   . GLN B 1 358 ? 16.975  -12.356 -16.108 1.00 76.68  ? 358  GLN B N   1 
ATOM   6916 C CA  . GLN B 1 358 ? 16.385  -12.146 -17.426 1.00 74.50  ? 358  GLN B CA  1 
ATOM   6917 C C   . GLN B 1 358 ? 16.392  -10.673 -17.797 1.00 71.60  ? 358  GLN B C   1 
ATOM   6918 O O   . GLN B 1 358 ? 16.616  -10.329 -18.961 1.00 70.15  ? 358  GLN B O   1 
ATOM   6919 C CB  . GLN B 1 358 ? 14.970  -12.715 -17.482 1.00 74.83  ? 358  GLN B CB  1 
ATOM   6920 C CG  . GLN B 1 358 ? 14.954  -14.229 -17.582 1.00 78.72  ? 358  GLN B CG  1 
ATOM   6921 C CD  . GLN B 1 358 ? 13.569  -14.833 -17.410 1.00 81.35  ? 358  GLN B CD  1 
ATOM   6922 O OE1 . GLN B 1 358 ? 12.799  -14.420 -16.536 1.00 82.13  ? 358  GLN B OE1 1 
ATOM   6923 N NE2 . GLN B 1 358 ? 13.251  -15.831 -18.240 1.00 81.46  ? 358  GLN B NE2 1 
ATOM   6924 N N   . PHE B 1 359 ? 16.168  -9.811  -16.806 1.00 70.96  ? 359  PHE B N   1 
ATOM   6925 C CA  . PHE B 1 359 ? 16.211  -8.375  -17.015 1.00 68.47  ? 359  PHE B CA  1 
ATOM   6926 C C   . PHE B 1 359 ? 17.621  -7.934  -17.364 1.00 68.53  ? 359  PHE B C   1 
ATOM   6927 O O   . PHE B 1 359 ? 17.793  -7.147  -18.292 1.00 67.20  ? 359  PHE B O   1 
ATOM   6928 C CB  . PHE B 1 359 ? 15.669  -7.620  -15.797 1.00 68.44  ? 359  PHE B CB  1 
ATOM   6929 C CG  . PHE B 1 359 ? 15.796  -6.111  -15.888 1.00 65.82  ? 359  PHE B CG  1 
ATOM   6930 C CD1 . PHE B 1 359 ? 16.583  -5.413  -14.986 1.00 65.76  ? 359  PHE B CD1 1 
ATOM   6931 C CD2 . PHE B 1 359 ? 15.117  -5.392  -16.854 1.00 63.30  ? 359  PHE B CD2 1 
ATOM   6932 C CE1 . PHE B 1 359 ? 16.696  -4.021  -15.047 1.00 63.80  ? 359  PHE B CE1 1 
ATOM   6933 C CE2 . PHE B 1 359 ? 15.225  -3.998  -16.924 1.00 61.53  ? 359  PHE B CE2 1 
ATOM   6934 C CZ  . PHE B 1 359 ? 16.012  -3.313  -16.017 1.00 61.69  ? 359  PHE B CZ  1 
ATOM   6935 N N   . LEU B 1 360 ? 18.627  -8.454  -16.658 1.00 70.52  ? 360  LEU B N   1 
ATOM   6936 C CA  . LEU B 1 360 ? 20.009  -8.050  -16.930 1.00 71.06  ? 360  LEU B CA  1 
ATOM   6937 C C   . LEU B 1 360 ? 20.454  -8.573  -18.286 1.00 70.87  ? 360  LEU B C   1 
ATOM   6938 O O   . LEU B 1 360 ? 21.190  -7.894  -18.997 1.00 70.00  ? 360  LEU B O   1 
ATOM   6939 C CB  . LEU B 1 360 ? 20.994  -8.481  -15.833 1.00 73.39  ? 360  LEU B CB  1 
ATOM   6940 C CG  . LEU B 1 360 ? 20.641  -8.362  -14.331 1.00 76.41  ? 360  LEU B CG  1 
ATOM   6941 C CD1 . LEU B 1 360 ? 21.870  -8.618  -13.419 1.00 79.81  ? 360  LEU B CD1 1 
ATOM   6942 C CD2 . LEU B 1 360 ? 19.929  -7.053  -13.921 1.00 74.41  ? 360  LEU B CD2 1 
ATOM   6943 N N   . ALA B 1 361 ? 19.992  -9.772  -18.645 1.00 72.08  ? 361  ALA B N   1 
ATOM   6944 C CA  . ALA B 1 361 ? 20.303  -10.367 -19.951 1.00 71.97  ? 361  ALA B CA  1 
ATOM   6945 C C   . ALA B 1 361 ? 19.560  -9.635  -21.062 1.00 69.46  ? 361  ALA B C   1 
ATOM   6946 O O   . ALA B 1 361 ? 20.071  -9.503  -22.169 1.00 68.86  ? 361  ALA B O   1 
ATOM   6947 C CB  . ALA B 1 361 ? 19.978  -11.869 -19.975 1.00 73.40  ? 361  ALA B CB  1 
ATOM   6948 N N   . GLY B 1 362 ? 18.356  -9.161  -20.755 1.00 68.45  ? 362  GLY B N   1 
ATOM   6949 C CA  . GLY B 1 362 ? 17.559  -8.387  -21.706 1.00 66.58  ? 362  GLY B CA  1 
ATOM   6950 C C   . GLY B 1 362 ? 18.181  -7.049  -22.082 1.00 65.25  ? 362  GLY B C   1 
ATOM   6951 O O   . GLY B 1 362 ? 18.125  -6.641  -23.236 1.00 63.45  ? 362  GLY B O   1 
ATOM   6952 N N   . VAL B 1 363 ? 18.778  -6.370  -21.104 1.00 66.22  ? 363  VAL B N   1 
ATOM   6953 C CA  . VAL B 1 363 ? 19.459  -5.099  -21.348 1.00 65.34  ? 363  VAL B CA  1 
ATOM   6954 C C   . VAL B 1 363 ? 20.659  -5.280  -22.287 1.00 66.25  ? 363  VAL B C   1 
ATOM   6955 O O   . VAL B 1 363 ? 20.870  -4.455  -23.165 1.00 65.23  ? 363  VAL B O   1 
ATOM   6956 C CB  . VAL B 1 363 ? 19.854  -4.393  -20.025 1.00 65.89  ? 363  VAL B CB  1 
ATOM   6957 C CG1 . VAL B 1 363 ? 20.547  -3.070  -20.287 1.00 64.04  ? 363  VAL B CG1 1 
ATOM   6958 C CG2 . VAL B 1 363 ? 18.631  -4.156  -19.170 1.00 65.11  ? 363  VAL B CG2 1 
ATOM   6959 N N   . ARG B 1 364 ? 21.422  -6.361  -22.135 1.00 68.78  ? 364  ARG B N   1 
ATOM   6960 C CA  . ARG B 1 364 ? 22.544  -6.616  -23.045 1.00 70.33  ? 364  ARG B CA  1 
ATOM   6961 C C   . ARG B 1 364 ? 22.059  -6.656  -24.497 1.00 69.26  ? 364  ARG B C   1 
ATOM   6962 O O   . ARG B 1 364 ? 22.567  -5.930  -25.350 1.00 68.88  ? 364  ARG B O   1 
ATOM   6963 C CB  . ARG B 1 364 ? 23.280  -7.908  -22.696 1.00 72.62  ? 364  ARG B CB  1 
ATOM   6964 C CG  . ARG B 1 364 ? 23.809  -8.027  -21.248 1.00 77.31  ? 364  ARG B CG  1 
ATOM   6965 C CD  . ARG B 1 364 ? 24.563  -6.787  -20.699 1.00 80.93  ? 364  ARG B CD  1 
ATOM   6966 N NE  . ARG B 1 364 ? 25.516  -6.197  -21.648 1.00 83.42  ? 364  ARG B NE  1 
ATOM   6967 C CZ  . ARG B 1 364 ? 26.843  -6.190  -21.501 1.00 86.02  ? 364  ARG B CZ  1 
ATOM   6968 N NH1 . ARG B 1 364 ? 27.419  -6.742  -20.429 1.00 86.93  ? 364  ARG B NH1 1 
ATOM   6969 N NH2 . ARG B 1 364 ? 27.593  -5.619  -22.439 1.00 85.79  ? 364  ARG B NH2 1 
ATOM   6970 N N   . ILE B 1 365 ? 21.061  -7.499  -24.751 1.00 69.33  ? 365  ILE B N   1 
ATOM   6971 C CA  . ILE B 1 365 ? 20.305  -7.551  -26.007 1.00 67.66  ? 365  ILE B CA  1 
ATOM   6972 C C   . ILE B 1 365 ? 19.701  -6.167  -26.412 1.00 65.60  ? 365  ILE B C   1 
ATOM   6973 O O   . ILE B 1 365 ? 19.770  -5.746  -27.587 1.00 64.26  ? 365  ILE B O   1 
ATOM   6974 C CB  . ILE B 1 365 ? 19.188  -8.632  -25.858 1.00 67.83  ? 365  ILE B CB  1 
ATOM   6975 C CG1 . ILE B 1 365 ? 19.805  -10.016 -25.750 1.00 70.68  ? 365  ILE B CG1 1 
ATOM   6976 C CG2 . ILE B 1 365 ? 18.213  -8.621  -27.002 1.00 67.35  ? 365  ILE B CG2 1 
ATOM   6977 C CD1 . ILE B 1 365 ? 18.782  -11.149 -25.771 1.00 72.93  ? 365  ILE B CD1 1 
ATOM   6978 N N   . GLY B 1 366 ? 19.127  -5.470  -25.430 1.00 65.11  ? 366  GLY B N   1 
ATOM   6979 C CA  . GLY B 1 366 ? 18.386  -4.225  -25.663 1.00 63.47  ? 366  GLY B CA  1 
ATOM   6980 C C   . GLY B 1 366 ? 19.237  -3.012  -25.984 1.00 62.71  ? 366  GLY B C   1 
ATOM   6981 O O   . GLY B 1 366 ? 18.809  -2.118  -26.719 1.00 61.85  ? 366  GLY B O   1 
ATOM   6982 N N   . VAL B 1 367 ? 20.436  -2.980  -25.416 1.00 63.72  ? 367  VAL B N   1 
ATOM   6983 C CA  . VAL B 1 367 ? 21.413  -1.937  -25.691 1.00 63.59  ? 367  VAL B CA  1 
ATOM   6984 C C   . VAL B 1 367 ? 22.680  -2.659  -26.145 1.00 65.38  ? 367  VAL B C   1 
ATOM   6985 O O   . VAL B 1 367 ? 23.658  -2.742  -25.393 1.00 66.57  ? 367  VAL B O   1 
ATOM   6986 C CB  . VAL B 1 367 ? 21.701  -1.075  -24.445 1.00 63.60  ? 367  VAL B CB  1 
ATOM   6987 C CG1 . VAL B 1 367 ? 22.382  0.221   -24.843 1.00 62.41  ? 367  VAL B CG1 1 
ATOM   6988 C CG2 . VAL B 1 367 ? 20.418  -0.781  -23.703 1.00 62.78  ? 367  VAL B CG2 1 
ATOM   6989 N N   . PRO B 1 368 ? 22.658  -3.200  -27.381 1.00 65.51  ? 368  PRO B N   1 
ATOM   6990 C CA  . PRO B 1 368 ? 23.691  -4.128  -27.861 1.00 67.34  ? 368  PRO B CA  1 
ATOM   6991 C C   . PRO B 1 368 ? 25.078  -3.508  -27.901 1.00 68.96  ? 368  PRO B C   1 
ATOM   6992 O O   . PRO B 1 368 ? 26.086  -4.218  -27.733 1.00 69.89  ? 368  PRO B O   1 
ATOM   6993 C CB  . PRO B 1 368 ? 23.228  -4.460  -29.279 1.00 66.45  ? 368  PRO B CB  1 
ATOM   6994 C CG  . PRO B 1 368 ? 22.319  -3.340  -29.662 1.00 64.19  ? 368  PRO B CG  1 
ATOM   6995 C CD  . PRO B 1 368 ? 21.628  -2.958  -28.406 1.00 63.58  ? 368  PRO B CD  1 
ATOM   6996 N N   . GLN B 1 369 ? 25.117  -2.189  -28.111 1.00 68.80  ? 369  GLN B N   1 
ATOM   6997 C CA  . GLN B 1 369 ? 26.379  -1.467  -28.232 1.00 70.88  ? 369  GLN B CA  1 
ATOM   6998 C C   . GLN B 1 369 ? 27.023  -1.214  -26.879 1.00 72.32  ? 369  GLN B C   1 
ATOM   6999 O O   . GLN B 1 369 ? 28.192  -0.831  -26.820 1.00 73.89  ? 369  GLN B O   1 
ATOM   7000 C CB  . GLN B 1 369 ? 26.180  -0.142  -28.974 1.00 69.87  ? 369  GLN B CB  1 
ATOM   7001 C CG  . GLN B 1 369 ? 25.462  0.943   -28.165 1.00 71.45  ? 369  GLN B CG  1 
ATOM   7002 C CD  . GLN B 1 369 ? 23.948  0.902   -28.332 1.00 72.79  ? 369  GLN B CD  1 
ATOM   7003 O OE1 . GLN B 1 369 ? 23.318  -0.172  -28.321 1.00 73.49  ? 369  GLN B OE1 1 
ATOM   7004 N NE2 . GLN B 1 369 ? 23.352  2.081   -28.482 1.00 72.92  ? 369  GLN B NE2 1 
ATOM   7005 N N   . ALA B 1 370 ? 26.267  -1.450  -25.804 1.00 72.44  ? 370  ALA B N   1 
ATOM   7006 C CA  . ALA B 1 370 ? 26.652  -1.020  -24.452 1.00 73.48  ? 370  ALA B CA  1 
ATOM   7007 C C   . ALA B 1 370 ? 27.728  -1.851  -23.801 1.00 75.81  ? 370  ALA B C   1 
ATOM   7008 O O   . ALA B 1 370 ? 27.644  -3.086  -23.784 1.00 76.43  ? 370  ALA B O   1 
ATOM   7009 C CB  . ALA B 1 370 ? 25.441  -0.971  -23.543 1.00 72.91  ? 370  ALA B CB  1 
ATOM   7010 N N   . SER B 1 371 ? 28.706  -1.148  -23.220 1.00 77.15  ? 371  SER B N   1 
ATOM   7011 C CA  . SER B 1 371 ? 29.801  -1.763  -22.468 1.00 79.79  ? 371  SER B CA  1 
ATOM   7012 C C   . SER B 1 371 ? 29.278  -2.365  -21.158 1.00 80.40  ? 371  SER B C   1 
ATOM   7013 O O   . SER B 1 371 ? 28.112  -2.185  -20.826 1.00 79.08  ? 371  SER B O   1 
ATOM   7014 C CB  . SER B 1 371 ? 30.912  -0.735  -22.216 1.00 80.99  ? 371  SER B CB  1 
ATOM   7015 O OG  . SER B 1 371 ? 30.643  0.072   -21.076 1.00 82.11  ? 371  SER B OG  1 
ATOM   7016 N N   . ASP B 1 372 ? 30.121  -3.084  -20.419 1.00 82.59  ? 372  ASP B N   1 
ATOM   7017 C CA  . ASP B 1 372 ? 29.670  -3.674  -19.153 1.00 83.54  ? 372  ASP B CA  1 
ATOM   7018 C C   . ASP B 1 372 ? 29.149  -2.625  -18.165 1.00 82.25  ? 372  ASP B C   1 
ATOM   7019 O O   . ASP B 1 372 ? 28.099  -2.807  -17.538 1.00 81.52  ? 372  ASP B O   1 
ATOM   7020 C CB  . ASP B 1 372 ? 30.775  -4.525  -18.519 1.00 86.66  ? 372  ASP B CB  1 
ATOM   7021 C CG  . ASP B 1 372 ? 30.959  -5.868  -19.224 1.00 88.50  ? 372  ASP B CG  1 
ATOM   7022 O OD1 . ASP B 1 372 ? 30.536  -6.008  -20.400 1.00 86.02  ? 372  ASP B OD1 1 
ATOM   7023 O OD2 . ASP B 1 372 ? 31.537  -6.781  -18.589 1.00 91.49  ? 372  ASP B OD2 1 
ATOM   7024 N N   . LEU B 1 373 ? 29.882  -1.521  -18.062 1.00 81.79  ? 373  LEU B N   1 
ATOM   7025 C CA  . LEU B 1 373 ? 29.542  -0.415  -17.178 1.00 80.79  ? 373  LEU B CA  1 
ATOM   7026 C C   . LEU B 1 373 ? 28.271  0.321   -17.638 1.00 78.19  ? 373  LEU B C   1 
ATOM   7027 O O   . LEU B 1 373 ? 27.364  0.578   -16.840 1.00 77.77  ? 373  LEU B O   1 
ATOM   7028 C CB  . LEU B 1 373 ? 30.732  0.535   -17.092 1.00 81.57  ? 373  LEU B CB  1 
ATOM   7029 C CG  . LEU B 1 373 ? 30.644  1.821   -16.284 1.00 81.23  ? 373  LEU B CG  1 
ATOM   7030 C CD1 . LEU B 1 373 ? 30.439  1.522   -14.806 1.00 82.22  ? 373  LEU B CD1 1 
ATOM   7031 C CD2 . LEU B 1 373 ? 31.914  2.628   -16.497 1.00 81.83  ? 373  LEU B CD2 1 
ATOM   7032 N N   . ALA B 1 374 ? 28.202  0.643   -18.926 1.00 76.47  ? 374  ALA B N   1 
ATOM   7033 C CA  . ALA B 1 374 ? 27.031  1.296   -19.493 1.00 73.69  ? 374  ALA B CA  1 
ATOM   7034 C C   . ALA B 1 374 ? 25.777  0.456   -19.279 1.00 72.69  ? 374  ALA B C   1 
ATOM   7035 O O   . ALA B 1 374 ? 24.720  0.995   -18.969 1.00 71.42  ? 374  ALA B O   1 
ATOM   7036 C CB  . ALA B 1 374 ? 27.249  1.580   -20.969 1.00 72.69  ? 374  ALA B CB  1 
ATOM   7037 N N   . ALA B 1 375 ? 25.912  -0.860  -19.426 1.00 73.40  ? 375  ALA B N   1 
ATOM   7038 C CA  . ALA B 1 375 ? 24.814  -1.804  -19.205 1.00 73.09  ? 375  ALA B CA  1 
ATOM   7039 C C   . ALA B 1 375 ? 24.367  -1.814  -17.756 1.00 73.93  ? 375  ALA B C   1 
ATOM   7040 O O   . ALA B 1 375 ? 23.179  -1.912  -17.470 1.00 73.23  ? 375  ALA B O   1 
ATOM   7041 C CB  . ALA B 1 375 ? 25.220  -3.207  -19.624 1.00 74.45  ? 375  ALA B CB  1 
ATOM   7042 N N   . GLU B 1 376 ? 25.320  -1.725  -16.840 1.00 75.70  ? 376  GLU B N   1 
ATOM   7043 C CA  . GLU B 1 376 ? 24.977  -1.663  -15.429 1.00 76.84  ? 376  GLU B CA  1 
ATOM   7044 C C   . GLU B 1 376 ? 24.321  -0.320  -15.092 1.00 74.52  ? 376  GLU B C   1 
ATOM   7045 O O   . GLU B 1 376 ? 23.391  -0.272  -14.285 1.00 74.32  ? 376  GLU B O   1 
ATOM   7046 C CB  . GLU B 1 376 ? 26.191  -1.947  -14.540 1.00 79.57  ? 376  GLU B CB  1 
ATOM   7047 C CG  . GLU B 1 376 ? 25.833  -2.267  -13.072 1.00 85.14  ? 376  GLU B CG  1 
ATOM   7048 C CD  . GLU B 1 376 ? 25.260  -3.687  -12.862 1.00 90.42  ? 376  GLU B CD  1 
ATOM   7049 O OE1 . GLU B 1 376 ? 25.788  -4.645  -13.481 1.00 92.41  ? 376  GLU B OE1 1 
ATOM   7050 O OE2 . GLU B 1 376 ? 24.295  -3.843  -12.062 1.00 91.36  ? 376  GLU B OE2 1 
ATOM   7051 N N   . ALA B 1 377 ? 24.779  0.761   -15.726 1.00 72.51  ? 377  ALA B N   1 
ATOM   7052 C CA  . ALA B 1 377 ? 24.169  2.069   -15.495 1.00 70.48  ? 377  ALA B CA  1 
ATOM   7053 C C   . ALA B 1 377 ? 22.690  2.001   -15.829 1.00 68.41  ? 377  ALA B C   1 
ATOM   7054 O O   . ALA B 1 377 ? 21.865  2.501   -15.065 1.00 68.32  ? 377  ALA B O   1 
ATOM   7055 C CB  . ALA B 1 377 ? 24.846  3.150   -16.306 1.00 69.70  ? 377  ALA B CB  1 
ATOM   7056 N N   . VAL B 1 378 ? 22.367  1.365   -16.959 1.00 66.65  ? 378  VAL B N   1 
ATOM   7057 C CA  . VAL B 1 378 ? 20.985  1.167   -17.390 1.00 64.28  ? 378  VAL B CA  1 
ATOM   7058 C C   . VAL B 1 378 ? 20.213  0.385   -16.341 1.00 64.93  ? 378  VAL B C   1 
ATOM   7059 O O   . VAL B 1 378 ? 19.170  0.840   -15.879 1.00 64.88  ? 378  VAL B O   1 
ATOM   7060 C CB  . VAL B 1 378 ? 20.871  0.440   -18.761 1.00 63.23  ? 378  VAL B CB  1 
ATOM   7061 C CG1 . VAL B 1 378 ? 19.410  0.226   -19.135 1.00 61.38  ? 378  VAL B CG1 1 
ATOM   7062 C CG2 . VAL B 1 378 ? 21.541  1.235   -19.845 1.00 62.36  ? 378  VAL B CG2 1 
ATOM   7063 N N   . VAL B 1 379 ? 20.719  -0.779  -15.960 1.00 65.76  ? 379  VAL B N   1 
ATOM   7064 C CA  . VAL B 1 379 ? 20.028  -1.605  -14.996 1.00 66.82  ? 379  VAL B CA  1 
ATOM   7065 C C   . VAL B 1 379 ? 19.745  -0.803  -13.723 1.00 67.77  ? 379  VAL B C   1 
ATOM   7066 O O   . VAL B 1 379 ? 18.594  -0.714  -13.263 1.00 67.71  ? 379  VAL B O   1 
ATOM   7067 C CB  . VAL B 1 379 ? 20.816  -2.896  -14.689 1.00 68.80  ? 379  VAL B CB  1 
ATOM   7068 C CG1 . VAL B 1 379 ? 20.232  -3.617  -13.498 1.00 69.19  ? 379  VAL B CG1 1 
ATOM   7069 C CG2 . VAL B 1 379 ? 20.826  -3.802  -15.909 1.00 68.28  ? 379  VAL B CG2 1 
ATOM   7070 N N   . LEU B 1 380 ? 20.784  -0.182  -13.178 1.00 68.68  ? 380  LEU B N   1 
ATOM   7071 C CA  . LEU B 1 380 ? 20.635  0.566   -11.944 1.00 69.44  ? 380  LEU B CA  1 
ATOM   7072 C C   . LEU B 1 380 ? 19.698  1.745   -12.104 1.00 67.58  ? 380  LEU B C   1 
ATOM   7073 O O   . LEU B 1 380 ? 19.077  2.172   -11.143 1.00 68.29  ? 380  LEU B O   1 
ATOM   7074 C CB  . LEU B 1 380 ? 21.994  0.994   -11.376 1.00 71.31  ? 380  LEU B CB  1 
ATOM   7075 C CG  . LEU B 1 380 ? 22.979  -0.140  -11.010 1.00 73.85  ? 380  LEU B CG  1 
ATOM   7076 C CD1 . LEU B 1 380 ? 24.248  0.405   -10.374 1.00 75.88  ? 380  LEU B CD1 1 
ATOM   7077 C CD2 . LEU B 1 380 ? 22.360  -1.191  -10.100 1.00 75.43  ? 380  LEU B CD2 1 
ATOM   7078 N N   . HIS B 1 381 ? 19.572  2.259   -13.317 1.00 65.65  ? 381  HIS B N   1 
ATOM   7079 C CA  . HIS B 1 381 ? 18.620  3.342   -13.557 1.00 64.46  ? 381  HIS B CA  1 
ATOM   7080 C C   . HIS B 1 381 ? 17.176  2.852   -13.618 1.00 63.78  ? 381  HIS B C   1 
ATOM   7081 O O   . HIS B 1 381 ? 16.258  3.561   -13.230 1.00 63.65  ? 381  HIS B O   1 
ATOM   7082 C CB  . HIS B 1 381 ? 18.944  4.097   -14.841 1.00 62.94  ? 381  HIS B CB  1 
ATOM   7083 C CG  . HIS B 1 381 ? 18.060  5.276   -15.071 1.00 61.90  ? 381  HIS B CG  1 
ATOM   7084 N ND1 . HIS B 1 381 ? 18.325  6.519   -14.532 1.00 63.32  ? 381  HIS B ND1 1 
ATOM   7085 C CD2 . HIS B 1 381 ? 16.901  5.398   -15.759 1.00 60.80  ? 381  HIS B CD2 1 
ATOM   7086 C CE1 . HIS B 1 381 ? 17.370  7.360   -14.889 1.00 62.26  ? 381  HIS B CE1 1 
ATOM   7087 N NE2 . HIS B 1 381 ? 16.495  6.705   -15.638 1.00 61.81  ? 381  HIS B NE2 1 
ATOM   7088 N N   . TYR B 1 382 ? 16.974  1.640   -14.110 1.00 63.75  ? 382  TYR B N   1 
ATOM   7089 C CA  . TYR B 1 382 ? 15.626  1.176   -14.385 1.00 62.82  ? 382  TYR B CA  1 
ATOM   7090 C C   . TYR B 1 382 ? 15.051  0.251   -13.334 1.00 64.55  ? 382  TYR B C   1 
ATOM   7091 O O   . TYR B 1 382 ? 13.842  -0.010  -13.343 1.00 64.62  ? 382  TYR B O   1 
ATOM   7092 C CB  . TYR B 1 382 ? 15.549  0.529   -15.767 1.00 61.62  ? 382  TYR B CB  1 
ATOM   7093 C CG  . TYR B 1 382 ? 15.373  1.529   -16.874 1.00 58.43  ? 382  TYR B CG  1 
ATOM   7094 C CD1 . TYR B 1 382 ? 16.460  1.988   -17.601 1.00 56.75  ? 382  TYR B CD1 1 
ATOM   7095 C CD2 . TYR B 1 382 ? 14.111  2.018   -17.188 1.00 56.60  ? 382  TYR B CD2 1 
ATOM   7096 C CE1 . TYR B 1 382 ? 16.286  2.903   -18.626 1.00 55.80  ? 382  TYR B CE1 1 
ATOM   7097 C CE2 . TYR B 1 382 ? 13.928  2.930   -18.199 1.00 54.71  ? 382  TYR B CE2 1 
ATOM   7098 C CZ  . TYR B 1 382 ? 15.015  3.366   -18.914 1.00 54.91  ? 382  TYR B CZ  1 
ATOM   7099 O OH  . TYR B 1 382 ? 14.823  4.279   -19.912 1.00 55.48  ? 382  TYR B OH  1 
ATOM   7100 N N   . THR B 1 383 ? 15.898  -0.250  -12.437 1.00 66.06  ? 383  THR B N   1 
ATOM   7101 C CA  . THR B 1 383 ? 15.402  -0.997  -11.302 1.00 67.74  ? 383  THR B CA  1 
ATOM   7102 C C   . THR B 1 383 ? 14.581  -0.058  -10.422 1.00 68.22  ? 383  THR B C   1 
ATOM   7103 O O   . THR B 1 383 ? 14.940  1.097   -10.241 1.00 67.50  ? 383  THR B O   1 
ATOM   7104 C CB  . THR B 1 383 ? 16.551  -1.636  -10.525 1.00 69.62  ? 383  THR B CB  1 
ATOM   7105 O OG1 . THR B 1 383 ? 17.286  -2.494  -11.401 1.00 69.46  ? 383  THR B OG1 1 
ATOM   7106 C CG2 . THR B 1 383 ? 16.035  -2.465  -9.362  1.00 71.24  ? 383  THR B CG2 1 
ATOM   7107 N N   . ASP B 1 384 ? 13.442  -0.548  -9.938  1.00 70.02  ? 384  ASP B N   1 
ATOM   7108 C CA  . ASP B 1 384 ? 12.647  0.133   -8.907  1.00 71.56  ? 384  ASP B CA  1 
ATOM   7109 C C   . ASP B 1 384 ? 13.199  -0.327  -7.565  1.00 73.76  ? 384  ASP B C   1 
ATOM   7110 O O   . ASP B 1 384 ? 12.917  -1.444  -7.112  1.00 75.27  ? 384  ASP B O   1 
ATOM   7111 C CB  . ASP B 1 384 ? 11.163  -0.247  -9.012  1.00 72.00  ? 384  ASP B CB  1 
ATOM   7112 C CG  . ASP B 1 384 ? 10.248  0.704   -8.239  1.00 74.35  ? 384  ASP B CG  1 
ATOM   7113 O OD1 . ASP B 1 384 ? 10.428  0.856   -7.004  1.00 77.80  ? 384  ASP B OD1 1 
ATOM   7114 O OD2 . ASP B 1 384 ? 9.338   1.292   -8.877  1.00 74.78  ? 384  ASP B OD2 1 
ATOM   7115 N N   . TRP B 1 385 ? 13.996  0.524   -6.931  1.00 73.84  ? 385  TRP B N   1 
ATOM   7116 C CA  . TRP B 1 385 ? 14.774  0.050   -5.797  1.00 76.25  ? 385  TRP B CA  1 
ATOM   7117 C C   . TRP B 1 385 ? 13.903  -0.278  -4.588  1.00 78.81  ? 385  TRP B C   1 
ATOM   7118 O O   . TRP B 1 385 ? 14.371  -0.853  -3.593  1.00 81.15  ? 385  TRP B O   1 
ATOM   7119 C CB  . TRP B 1 385 ? 15.969  0.971   -5.511  1.00 75.76  ? 385  TRP B CB  1 
ATOM   7120 C CG  . TRP B 1 385 ? 16.980  0.802   -6.595  1.00 72.56  ? 385  TRP B CG  1 
ATOM   7121 C CD1 . TRP B 1 385 ? 17.242  1.658   -7.620  1.00 68.28  ? 385  TRP B CD1 1 
ATOM   7122 C CD2 . TRP B 1 385 ? 17.799  -0.346  -6.813  1.00 72.54  ? 385  TRP B CD2 1 
ATOM   7123 N NE1 . TRP B 1 385 ? 18.209  1.138   -8.442  1.00 66.30  ? 385  TRP B NE1 1 
ATOM   7124 C CE2 . TRP B 1 385 ? 18.561  -0.098  -7.977  1.00 70.00  ? 385  TRP B CE2 1 
ATOM   7125 C CE3 . TRP B 1 385 ? 17.972  -1.559  -6.130  1.00 74.19  ? 385  TRP B CE3 1 
ATOM   7126 C CZ2 . TRP B 1 385 ? 19.484  -1.017  -8.475  1.00 70.59  ? 385  TRP B CZ2 1 
ATOM   7127 C CZ3 . TRP B 1 385 ? 18.884  -2.473  -6.628  1.00 75.14  ? 385  TRP B CZ3 1 
ATOM   7128 C CH2 . TRP B 1 385 ? 19.631  -2.196  -7.792  1.00 73.75  ? 385  TRP B CH2 1 
ATOM   7129 N N   . LEU B 1 386 ? 12.616  0.033   -4.728  1.00 78.67  ? 386  LEU B N   1 
ATOM   7130 C CA  . LEU B 1 386 ? 11.619  -0.257  -3.710  1.00 81.01  ? 386  LEU B CA  1 
ATOM   7131 C C   . LEU B 1 386 ? 11.024  -1.657  -3.898  1.00 82.27  ? 386  LEU B C   1 
ATOM   7132 O O   . LEU B 1 386 ? 10.709  -2.346  -2.922  1.00 84.49  ? 386  LEU B O   1 
ATOM   7133 C CB  . LEU B 1 386 ? 10.539  0.821   -3.753  1.00 80.21  ? 386  LEU B CB  1 
ATOM   7134 C CG  . LEU B 1 386 ? 9.695   1.157   -2.524  1.00 82.58  ? 386  LEU B CG  1 
ATOM   7135 C CD1 . LEU B 1 386 ? 10.207  0.531   -1.219  1.00 85.83  ? 386  LEU B CD1 1 
ATOM   7136 C CD2 . LEU B 1 386 ? 9.624   2.685   -2.424  1.00 82.88  ? 386  LEU B CD2 1 
ATOM   7137 N N   . HIS B 1 387 ? 10.877  -2.074  -5.156  1.00 81.17  ? 387  HIS B N   1 
ATOM   7138 C CA  . HIS B 1 387 ? 10.462  -3.445  -5.479  1.00 82.52  ? 387  HIS B CA  1 
ATOM   7139 C C   . HIS B 1 387 ? 11.489  -4.009  -6.473  1.00 81.40  ? 387  HIS B C   1 
ATOM   7140 O O   . HIS B 1 387 ? 11.186  -4.206  -7.660  1.00 80.08  ? 387  HIS B O   1 
ATOM   7141 C CB  . HIS B 1 387 ? 9.024   -3.490  -6.034  1.00 82.05  ? 387  HIS B CB  1 
ATOM   7142 C CG  . HIS B 1 387 ? 8.076   -2.548  -5.352  1.00 82.99  ? 387  HIS B CG  1 
ATOM   7143 N ND1 . HIS B 1 387 ? 7.828   -1.272  -5.821  1.00 81.70  ? 387  HIS B ND1 1 
ATOM   7144 C CD2 . HIS B 1 387 ? 7.326   -2.690  -4.232  1.00 85.64  ? 387  HIS B CD2 1 
ATOM   7145 C CE1 . HIS B 1 387 ? 6.964   -0.669  -5.021  1.00 82.11  ? 387  HIS B CE1 1 
ATOM   7146 N NE2 . HIS B 1 387 ? 6.643   -1.508  -4.050  1.00 85.40  ? 387  HIS B NE2 1 
ATOM   7147 N N   . PRO B 1 388 ? 12.722  -4.254  -5.985  1.00 82.16  ? 388  PRO B N   1 
ATOM   7148 C CA  . PRO B 1 388 ? 13.862  -4.540  -6.854  1.00 80.84  ? 388  PRO B CA  1 
ATOM   7149 C C   . PRO B 1 388 ? 13.725  -5.799  -7.685  1.00 80.50  ? 388  PRO B C   1 
ATOM   7150 O O   . PRO B 1 388 ? 14.292  -5.861  -8.769  1.00 79.12  ? 388  PRO B O   1 
ATOM   7151 C CB  . PRO B 1 388 ? 15.028  -4.686  -5.868  1.00 82.81  ? 388  PRO B CB  1 
ATOM   7152 C CG  . PRO B 1 388 ? 14.394  -5.058  -4.578  1.00 85.33  ? 388  PRO B CG  1 
ATOM   7153 C CD  . PRO B 1 388 ? 13.100  -4.313  -4.559  1.00 84.47  ? 388  PRO B CD  1 
ATOM   7154 N N   . GLU B 1 389 ? 12.996  -6.791  -7.178  1.00 82.11  ? 389  GLU B N   1 
ATOM   7155 C CA  . GLU B 1 389 ? 12.935  -8.110  -7.822  1.00 82.54  ? 389  GLU B CA  1 
ATOM   7156 C C   . GLU B 1 389 ? 11.505  -8.513  -8.192  1.00 81.73  ? 389  GLU B C   1 
ATOM   7157 O O   . GLU B 1 389 ? 11.223  -9.699  -8.407  1.00 83.10  ? 389  GLU B O   1 
ATOM   7158 C CB  . GLU B 1 389 ? 13.612  -9.188  -6.951  1.00 85.60  ? 389  GLU B CB  1 
ATOM   7159 C CG  . GLU B 1 389 ? 15.091  -8.903  -6.607  1.00 87.76  ? 389  GLU B CG  1 
ATOM   7160 C CD  . GLU B 1 389 ? 15.918  -10.170 -6.365  1.00 92.64  ? 389  GLU B CD  1 
ATOM   7161 O OE1 . GLU B 1 389 ? 16.346  -10.826 -7.345  1.00 92.41  ? 389  GLU B OE1 1 
ATOM   7162 O OE2 . GLU B 1 389 ? 16.158  -10.504 -5.185  1.00 96.33  ? 389  GLU B OE2 1 
ATOM   7163 N N   . ASP B 1 390 ? 10.617  -7.519  -8.271  1.00 79.18  ? 390  ASP B N   1 
ATOM   7164 C CA  . ASP B 1 390 ? 9.219   -7.728  -8.651  1.00 78.18  ? 390  ASP B CA  1 
ATOM   7165 C C   . ASP B 1 390 ? 9.149   -7.900  -10.161 1.00 75.82  ? 390  ASP B C   1 
ATOM   7166 O O   . ASP B 1 390 ? 9.521   -6.980  -10.902 1.00 73.63  ? 390  ASP B O   1 
ATOM   7167 C CB  . ASP B 1 390 ? 8.356   -6.540  -8.194  1.00 77.33  ? 390  ASP B CB  1 
ATOM   7168 C CG  . ASP B 1 390 ? 6.940   -6.562  -8.779  1.00 76.78  ? 390  ASP B CG  1 
ATOM   7169 O OD1 . ASP B 1 390 ? 6.126   -7.422  -8.371  1.00 78.29  ? 390  ASP B OD1 1 
ATOM   7170 O OD2 . ASP B 1 390 ? 6.636   -5.694  -9.635  1.00 74.85  ? 390  ASP B OD2 1 
ATOM   7171 N N   . PRO B 1 391 ? 8.680   -9.076  -10.623 1.00 76.34  ? 391  PRO B N   1 
ATOM   7172 C CA  . PRO B 1 391 ? 8.652   -9.441  -12.043 1.00 74.65  ? 391  PRO B CA  1 
ATOM   7173 C C   . PRO B 1 391 ? 7.844   -8.476  -12.915 1.00 72.16  ? 391  PRO B C   1 
ATOM   7174 O O   . PRO B 1 391 ? 8.282   -8.143  -14.012 1.00 70.40  ? 391  PRO B O   1 
ATOM   7175 C CB  . PRO B 1 391 ? 8.015   -10.835 -12.034 1.00 76.76  ? 391  PRO B CB  1 
ATOM   7176 C CG  . PRO B 1 391 ? 8.308   -11.377 -10.680 1.00 79.59  ? 391  PRO B CG  1 
ATOM   7177 C CD  . PRO B 1 391 ? 8.165   -10.170 -9.780  1.00 79.31  ? 391  PRO B CD  1 
ATOM   7178 N N   . THR B 1 392 ? 6.689   -8.027  -12.422 1.00 72.36  ? 392  THR B N   1 
ATOM   7179 C CA  . THR B 1 392 ? 5.861   -7.035  -13.115 1.00 70.16  ? 392  THR B CA  1 
ATOM   7180 C C   . THR B 1 392 ? 6.679   -5.786  -13.387 1.00 68.06  ? 392  THR B C   1 
ATOM   7181 O O   . THR B 1 392 ? 6.661   -5.270  -14.501 1.00 65.99  ? 392  THR B O   1 
ATOM   7182 C CB  . THR B 1 392 ? 4.584   -6.677  -12.307 1.00 71.41  ? 392  THR B CB  1 
ATOM   7183 O OG1 . THR B 1 392 ? 3.843   -7.876  -12.026 1.00 74.10  ? 392  THR B OG1 1 
ATOM   7184 C CG2 . THR B 1 392 ? 3.682   -5.689  -13.063 1.00 68.73  ? 392  THR B CG2 1 
ATOM   7185 N N   . HIS B 1 393 ? 7.414   -5.319  -12.380 1.00 68.94  ? 393  HIS B N   1 
ATOM   7186 C CA  . HIS B 1 393 ? 8.276   -4.143  -12.539 1.00 67.70  ? 393  HIS B CA  1 
ATOM   7187 C C   . HIS B 1 393 ? 9.422   -4.369  -13.507 1.00 65.93  ? 393  HIS B C   1 
ATOM   7188 O O   . HIS B 1 393 ? 9.735   -3.488  -14.297 1.00 64.22  ? 393  HIS B O   1 
ATOM   7189 C CB  . HIS B 1 393 ? 8.829   -3.672  -11.202 1.00 69.58  ? 393  HIS B CB  1 
ATOM   7190 C CG  . HIS B 1 393 ? 7.927   -2.722  -10.481 1.00 72.06  ? 393  HIS B CG  1 
ATOM   7191 N ND1 . HIS B 1 393 ? 7.009   -3.136  -9.538  1.00 75.78  ? 393  HIS B ND1 1 
ATOM   7192 C CD2 . HIS B 1 393 ? 7.805   -1.376  -10.562 1.00 72.88  ? 393  HIS B CD2 1 
ATOM   7193 C CE1 . HIS B 1 393 ? 6.364   -2.085  -9.065  1.00 76.47  ? 393  HIS B CE1 1 
ATOM   7194 N NE2 . HIS B 1 393 ? 6.829   -1.004  -9.666  1.00 74.68  ? 393  HIS B NE2 1 
ATOM   7195 N N   . LEU B 1 394 ? 10.036  -5.548  -13.455 1.00 66.71  ? 394  LEU B N   1 
ATOM   7196 C CA  . LEU B 1 394 ? 11.151  -5.864  -14.351 1.00 65.44  ? 394  LEU B CA  1 
ATOM   7197 C C   . LEU B 1 394 ? 10.711  -5.922  -15.817 1.00 63.76  ? 394  LEU B C   1 
ATOM   7198 O O   . LEU B 1 394 ? 11.337  -5.315  -16.691 1.00 62.02  ? 394  LEU B O   1 
ATOM   7199 C CB  . LEU B 1 394 ? 11.817  -7.168  -13.934 1.00 67.51  ? 394  LEU B CB  1 
ATOM   7200 C CG  . LEU B 1 394 ? 12.328  -7.253  -12.494 1.00 68.56  ? 394  LEU B CG  1 
ATOM   7201 C CD1 . LEU B 1 394 ? 12.762  -8.671  -12.221 1.00 70.62  ? 394  LEU B CD1 1 
ATOM   7202 C CD2 . LEU B 1 394 ? 13.468  -6.291  -12.235 1.00 66.89  ? 394  LEU B CD2 1 
ATOM   7203 N N   . ARG B 1 395 ? 9.619   -6.642  -16.066 1.00 64.26  ? 395  ARG B N   1 
ATOM   7204 C CA  . ARG B 1 395 ? 8.996   -6.696  -17.381 1.00 62.69  ? 395  ARG B CA  1 
ATOM   7205 C C   . ARG B 1 395 ? 8.710   -5.277  -17.899 1.00 60.63  ? 395  ARG B C   1 
ATOM   7206 O O   . ARG B 1 395 ? 9.266   -4.886  -18.913 1.00 59.43  ? 395  ARG B O   1 
ATOM   7207 C CB  . ARG B 1 395 ? 7.749   -7.592  -17.331 1.00 64.01  ? 395  ARG B CB  1 
ATOM   7208 C CG  . ARG B 1 395 ? 6.979   -7.743  -18.625 1.00 62.47  ? 395  ARG B CG  1 
ATOM   7209 C CD  . ARG B 1 395 ? 5.704   -6.918  -18.574 1.00 62.57  ? 395  ARG B CD  1 
ATOM   7210 N NE  . ARG B 1 395 ? 4.591   -7.665  -18.001 1.00 64.15  ? 395  ARG B NE  1 
ATOM   7211 C CZ  . ARG B 1 395 ? 3.548   -7.126  -17.360 1.00 64.45  ? 395  ARG B CZ  1 
ATOM   7212 N NH1 . ARG B 1 395 ? 3.456   -5.812  -17.177 1.00 59.38  ? 395  ARG B NH1 1 
ATOM   7213 N NH2 . ARG B 1 395 ? 2.592   -7.928  -16.883 1.00 67.75  ? 395  ARG B NH2 1 
ATOM   7214 N N   . ASP B 1 396 ? 7.897   -4.493  -17.196 1.00 60.69  ? 396  ASP B N   1 
ATOM   7215 C CA  . ASP B 1 396 ? 7.592   -3.122  -17.648 1.00 59.13  ? 396  ASP B CA  1 
ATOM   7216 C C   . ASP B 1 396 ? 8.849   -2.287  -17.896 1.00 57.83  ? 396  ASP B C   1 
ATOM   7217 O O   . ASP B 1 396 ? 8.898   -1.494  -18.847 1.00 55.98  ? 396  ASP B O   1 
ATOM   7218 C CB  . ASP B 1 396 ? 6.668   -2.392  -16.670 1.00 59.69  ? 396  ASP B CB  1 
ATOM   7219 C CG  . ASP B 1 396 ? 5.302   -3.055  -16.546 1.00 61.86  ? 396  ASP B CG  1 
ATOM   7220 O OD1 . ASP B 1 396 ? 4.921   -3.799  -17.485 1.00 61.93  ? 396  ASP B OD1 1 
ATOM   7221 O OD2 . ASP B 1 396 ? 4.621   -2.831  -15.503 1.00 62.92  ? 396  ASP B OD2 1 
ATOM   7222 N N   . ALA B 1 397 ? 9.854   -2.486  -17.040 1.00 58.76  ? 397  ALA B N   1 
ATOM   7223 C CA  . ALA B 1 397 ? 11.140  -1.798  -17.155 1.00 58.03  ? 397  ALA B CA  1 
ATOM   7224 C C   . ALA B 1 397 ? 11.878  -2.189  -18.434 1.00 57.19  ? 397  ALA B C   1 
ATOM   7225 O O   . ALA B 1 397 ? 12.350  -1.325  -19.171 1.00 55.83  ? 397  ALA B O   1 
ATOM   7226 C CB  . ALA B 1 397 ? 12.000  -2.064  -15.931 1.00 59.31  ? 397  ALA B CB  1 
ATOM   7227 N N   . MET B 1 398 ? 11.964  -3.494  -18.697 1.00 58.36  ? 398  MET B N   1 
ATOM   7228 C CA  . MET B 1 398 ? 12.605  -3.997  -19.904 1.00 57.41  ? 398  MET B CA  1 
ATOM   7229 C C   . MET B 1 398 ? 12.002  -3.348  -21.146 1.00 55.63  ? 398  MET B C   1 
ATOM   7230 O O   . MET B 1 398 ? 12.725  -2.967  -22.068 1.00 54.98  ? 398  MET B O   1 
ATOM   7231 C CB  . MET B 1 398 ? 12.483  -5.509  -19.990 1.00 58.73  ? 398  MET B CB  1 
ATOM   7232 C CG  . MET B 1 398 ? 13.229  -6.101  -21.168 1.00 59.19  ? 398  MET B CG  1 
ATOM   7233 S SD  . MET B 1 398 ? 15.016  -5.904  -20.988 1.00 63.25  ? 398  MET B SD  1 
ATOM   7234 C CE  . MET B 1 398 ? 15.356  -4.439  -21.953 1.00 58.56  ? 398  MET B CE  1 
ATOM   7235 N N   . SER B 1 399 ? 10.673  -3.236  -21.160 1.00 54.98  ? 399  SER B N   1 
ATOM   7236 C CA  . SER B 1 399 ? 9.941   -2.577  -22.237 1.00 52.80  ? 399  SER B CA  1 
ATOM   7237 C C   . SER B 1 399 ? 10.337  -1.098  -22.326 1.00 51.17  ? 399  SER B C   1 
ATOM   7238 O O   . SER B 1 399 ? 10.649  -0.598  -23.404 1.00 49.78  ? 399  SER B O   1 
ATOM   7239 C CB  . SER B 1 399 ? 8.444   -2.715  -21.985 1.00 53.04  ? 399  SER B CB  1 
ATOM   7240 O OG  . SER B 1 399 ? 7.695   -1.725  -22.651 1.00 51.89  ? 399  SER B OG  1 
ATOM   7241 N N   . ALA B 1 400 ? 10.347  -0.427  -21.182 1.00 51.18  ? 400  ALA B N   1 
ATOM   7242 C CA  . ALA B 1 400 ? 10.706  0.989   -21.107 1.00 50.42  ? 400  ALA B CA  1 
ATOM   7243 C C   . ALA B 1 400 ? 12.107  1.242   -21.656 1.00 50.07  ? 400  ALA B C   1 
ATOM   7244 O O   . ALA B 1 400 ? 12.297  2.138   -22.479 1.00 49.18  ? 400  ALA B O   1 
ATOM   7245 C CB  . ALA B 1 400 ? 10.579  1.490   -19.691 1.00 51.06  ? 400  ALA B CB  1 
ATOM   7246 N N   . VAL B 1 401 ? 13.067  0.416   -21.240 1.00 50.97  ? 401  VAL B N   1 
ATOM   7247 C CA  . VAL B 1 401 ? 14.443  0.506   -21.728 1.00 50.59  ? 401  VAL B CA  1 
ATOM   7248 C C   . VAL B 1 401 ? 14.459  0.609   -23.252 1.00 49.79  ? 401  VAL B C   1 
ATOM   7249 O O   . VAL B 1 401 ? 14.914  1.607   -23.813 1.00 49.02  ? 401  VAL B O   1 
ATOM   7250 C CB  . VAL B 1 401 ? 15.306  -0.695  -21.237 1.00 51.93  ? 401  VAL B CB  1 
ATOM   7251 C CG1 . VAL B 1 401 ? 16.537  -0.874  -22.104 1.00 51.26  ? 401  VAL B CG1 1 
ATOM   7252 C CG2 . VAL B 1 401 ? 15.690  -0.531  -19.759 1.00 51.46  ? 401  VAL B CG2 1 
ATOM   7253 N N   . VAL B 1 402 ? 13.912  -0.409  -23.910 1.00 50.07  ? 402  VAL B N   1 
ATOM   7254 C CA  . VAL B 1 402 ? 13.941  -0.501  -25.360 1.00 49.01  ? 402  VAL B CA  1 
ATOM   7255 C C   . VAL B 1 402 ? 13.246  0.692   -26.033 1.00 47.96  ? 402  VAL B C   1 
ATOM   7256 O O   . VAL B 1 402 ? 13.747  1.224   -27.016 1.00 46.96  ? 402  VAL B O   1 
ATOM   7257 C CB  . VAL B 1 402 ? 13.337  -1.860  -25.851 1.00 49.81  ? 402  VAL B CB  1 
ATOM   7258 C CG1 . VAL B 1 402 ? 13.454  -2.003  -27.358 1.00 47.71  ? 402  VAL B CG1 1 
ATOM   7259 C CG2 . VAL B 1 402 ? 14.031  -3.043  -25.167 1.00 50.27  ? 402  VAL B CG2 1 
ATOM   7260 N N   . GLY B 1 403 ? 12.095  1.102   -25.506 1.00 48.24  ? 403  GLY B N   1 
ATOM   7261 C CA  . GLY B 1 403 ? 11.299  2.165   -26.124 1.00 47.07  ? 403  GLY B CA  1 
ATOM   7262 C C   . GLY B 1 403 ? 11.996  3.507   -25.972 1.00 47.07  ? 403  GLY B C   1 
ATOM   7263 O O   . GLY B 1 403 ? 12.054  4.305   -26.904 1.00 45.68  ? 403  GLY B O   1 
ATOM   7264 N N   . ASP B 1 404 ? 12.541  3.724   -24.783 1.00 47.80  ? 404  ASP B N   1 
ATOM   7265 C CA  . ASP B 1 404 ? 13.238  4.937   -24.438 1.00 47.76  ? 404  ASP B CA  1 
ATOM   7266 C C   . ASP B 1 404 ? 14.477  5.112   -25.283 1.00 48.08  ? 404  ASP B C   1 
ATOM   7267 O O   . ASP B 1 404 ? 14.726  6.197   -25.860 1.00 47.58  ? 404  ASP B O   1 
ATOM   7268 C CB  . ASP B 1 404 ? 13.631  4.893   -22.956 1.00 48.29  ? 404  ASP B CB  1 
ATOM   7269 C CG  . ASP B 1 404 ? 12.438  5.010   -22.049 1.00 48.65  ? 404  ASP B CG  1 
ATOM   7270 O OD1 . ASP B 1 404 ? 11.323  5.126   -22.585 1.00 48.81  ? 404  ASP B OD1 1 
ATOM   7271 O OD2 . ASP B 1 404 ? 12.586  4.986   -20.809 1.00 51.67  ? 404  ASP B OD2 1 
ATOM   7272 N N   . HIS B 1 405 ? 15.251  4.030   -25.335 1.00 48.95  ? 405  HIS B N   1 
ATOM   7273 C CA  . HIS B 1 405 ? 16.557  4.038   -25.940 1.00 49.41  ? 405  HIS B CA  1 
ATOM   7274 C C   . HIS B 1 405 ? 16.422  4.292   -27.427 1.00 48.97  ? 405  HIS B C   1 
ATOM   7275 O O   . HIS B 1 405 ? 17.124  5.145   -27.958 1.00 49.68  ? 405  HIS B O   1 
ATOM   7276 C CB  . HIS B 1 405 ? 17.279  2.727   -25.647 1.00 49.90  ? 405  HIS B CB  1 
ATOM   7277 C CG  . HIS B 1 405 ? 18.560  2.543   -26.408 1.00 50.23  ? 405  HIS B CG  1 
ATOM   7278 N ND1 . HIS B 1 405 ? 19.504  3.544   -26.545 1.00 48.70  ? 405  HIS B ND1 1 
ATOM   7279 C CD2 . HIS B 1 405 ? 19.064  1.455   -27.051 1.00 49.75  ? 405  HIS B CD2 1 
ATOM   7280 C CE1 . HIS B 1 405 ? 20.528  3.084   -27.246 1.00 49.62  ? 405  HIS B CE1 1 
ATOM   7281 N NE2 . HIS B 1 405 ? 20.286  1.820   -27.565 1.00 50.60  ? 405  HIS B NE2 1 
ATOM   7282 N N   . ASN B 1 406 ? 15.485  3.594   -28.064 1.00 48.35  ? 406  ASN B N   1 
ATOM   7283 C CA  . ASN B 1 406 ? 15.314  3.619   -29.510 1.00 47.91  ? 406  ASN B CA  1 
ATOM   7284 C C   . ASN B 1 406 ? 14.333  4.662   -30.003 1.00 47.05  ? 406  ASN B C   1 
ATOM   7285 O O   . ASN B 1 406 ? 14.485  5.190   -31.118 1.00 47.20  ? 406  ASN B O   1 
ATOM   7286 C CB  . ASN B 1 406 ? 14.829  2.259   -29.996 1.00 48.31  ? 406  ASN B CB  1 
ATOM   7287 C CG  . ASN B 1 406 ? 15.861  1.174   -29.800 1.00 50.21  ? 406  ASN B CG  1 
ATOM   7288 O OD1 . ASN B 1 406 ? 16.916  1.182   -30.436 1.00 52.65  ? 406  ASN B OD1 1 
ATOM   7289 N ND2 . ASN B 1 406 ? 15.571  0.241   -28.911 1.00 50.24  ? 406  ASN B ND2 1 
ATOM   7290 N N   . VAL B 1 407 ? 13.302  4.942   -29.219 1.00 46.20  ? 407  VAL B N   1 
ATOM   7291 C CA  . VAL B 1 407 ? 12.293  5.860   -29.710 1.00 45.42  ? 407  VAL B CA  1 
ATOM   7292 C C   . VAL B 1 407 ? 12.105  7.147   -28.900 1.00 45.42  ? 407  VAL B C   1 
ATOM   7293 O O   . VAL B 1 407 ? 12.321  8.215   -29.438 1.00 45.97  ? 407  VAL B O   1 
ATOM   7294 C CB  . VAL B 1 407 ? 10.942  5.164   -29.983 1.00 45.13  ? 407  VAL B CB  1 
ATOM   7295 C CG1 . VAL B 1 407 ? 9.939   6.185   -30.519 1.00 45.01  ? 407  VAL B CG1 1 
ATOM   7296 C CG2 . VAL B 1 407 ? 11.115  4.025   -30.974 1.00 43.90  ? 407  VAL B CG2 1 
ATOM   7297 N N   . VAL B 1 408 ? 11.738  7.052   -27.625 1.00 45.49  ? 408  VAL B N   1 
ATOM   7298 C CA  . VAL B 1 408 ? 11.281  8.214   -26.893 1.00 45.77  ? 408  VAL B CA  1 
ATOM   7299 C C   . VAL B 1 408 ? 12.365  9.301   -26.725 1.00 47.01  ? 408  VAL B C   1 
ATOM   7300 O O   . VAL B 1 408 ? 12.110  10.482  -26.934 1.00 46.72  ? 408  VAL B O   1 
ATOM   7301 C CB  . VAL B 1 408 ? 10.664  7.857   -25.518 1.00 46.45  ? 408  VAL B CB  1 
ATOM   7302 C CG1 . VAL B 1 408 ? 10.015  9.109   -24.907 1.00 45.65  ? 408  VAL B CG1 1 
ATOM   7303 C CG2 . VAL B 1 408 ? 9.635   6.723   -25.642 1.00 44.72  ? 408  VAL B CG2 1 
ATOM   7304 N N   . CYS B 1 409 ? 13.574  8.891   -26.364 1.00 47.86  ? 409  CYS B N   1 
ATOM   7305 C CA  . CYS B 1 409 ? 14.647  9.841   -26.130 1.00 47.94  ? 409  CYS B CA  1 
ATOM   7306 C C   . CYS B 1 409 ? 15.237  10.347  -27.441 1.00 47.74  ? 409  CYS B C   1 
ATOM   7307 O O   . CYS B 1 409 ? 15.525  11.549  -27.548 1.00 48.31  ? 409  CYS B O   1 
ATOM   7308 C CB  . CYS B 1 409 ? 15.694  9.247   -25.185 1.00 48.92  ? 409  CYS B CB  1 
ATOM   7309 S SG  . CYS B 1 409 ? 14.963  8.841   -23.559 1.00 49.68  ? 409  CYS B SG  1 
ATOM   7310 N N   . PRO B 1 410 ? 15.399  9.455   -28.452 1.00 46.99  ? 410  PRO B N   1 
ATOM   7311 C CA  . PRO B 1 410 ? 15.658  9.993   -29.770 1.00 46.24  ? 410  PRO B CA  1 
ATOM   7312 C C   . PRO B 1 410 ? 14.591  11.003  -30.141 1.00 45.87  ? 410  PRO B C   1 
ATOM   7313 O O   . PRO B 1 410 ? 14.946  12.111  -30.536 1.00 45.91  ? 410  PRO B O   1 
ATOM   7314 C CB  . PRO B 1 410 ? 15.582  8.765   -30.659 1.00 45.52  ? 410  PRO B CB  1 
ATOM   7315 C CG  . PRO B 1 410 ? 16.173  7.722   -29.825 1.00 46.55  ? 410  PRO B CG  1 
ATOM   7316 C CD  . PRO B 1 410 ? 15.642  8.002   -28.432 1.00 47.30  ? 410  PRO B CD  1 
ATOM   7317 N N   . VAL B 1 411 ? 13.305  10.662  -29.985 1.00 45.25  ? 411  VAL B N   1 
ATOM   7318 C CA  . VAL B 1 411 ? 12.260  11.650  -30.313 1.00 45.04  ? 411  VAL B CA  1 
ATOM   7319 C C   . VAL B 1 411 ? 12.456  12.945  -29.522 1.00 46.00  ? 411  VAL B C   1 
ATOM   7320 O O   . VAL B 1 411 ? 12.272  14.028  -30.074 1.00 46.60  ? 411  VAL B O   1 
ATOM   7321 C CB  . VAL B 1 411 ? 10.811  11.171  -30.097 1.00 44.29  ? 411  VAL B CB  1 
ATOM   7322 C CG1 . VAL B 1 411 ? 9.882   12.391  -30.016 1.00 43.57  ? 411  VAL B CG1 1 
ATOM   7323 C CG2 . VAL B 1 411 ? 10.373  10.265  -31.217 1.00 42.86  ? 411  VAL B CG2 1 
ATOM   7324 N N   . ALA B 1 412 ? 12.828  12.818  -28.245 1.00 46.40  ? 412  ALA B N   1 
ATOM   7325 C CA  . ALA B 1 412 ? 12.941  13.965  -27.360 1.00 47.64  ? 412  ALA B CA  1 
ATOM   7326 C C   . ALA B 1 412 ? 14.076  14.880  -27.827 1.00 48.32  ? 412  ALA B C   1 
ATOM   7327 O O   . ALA B 1 412 ? 13.965  16.105  -27.798 1.00 48.80  ? 412  ALA B O   1 
ATOM   7328 C CB  . ALA B 1 412 ? 13.153  13.518  -25.925 1.00 47.75  ? 412  ALA B CB  1 
ATOM   7329 N N   . GLN B 1 413 ? 15.147  14.249  -28.287 1.00 48.60  ? 413  GLN B N   1 
ATOM   7330 C CA  . GLN B 1 413 ? 16.345  14.926  -28.703 1.00 49.80  ? 413  GLN B CA  1 
ATOM   7331 C C   . GLN B 1 413 ? 16.151  15.688  -30.010 1.00 49.08  ? 413  GLN B C   1 
ATOM   7332 O O   . GLN B 1 413 ? 16.614  16.849  -30.155 1.00 49.85  ? 413  GLN B O   1 
ATOM   7333 C CB  . GLN B 1 413 ? 17.459  13.902  -28.868 1.00 50.42  ? 413  GLN B CB  1 
ATOM   7334 C CG  . GLN B 1 413 ? 18.835  14.529  -28.991 1.00 56.75  ? 413  GLN B CG  1 
ATOM   7335 C CD  . GLN B 1 413 ? 19.888  13.526  -29.371 1.00 63.67  ? 413  GLN B CD  1 
ATOM   7336 O OE1 . GLN B 1 413 ? 19.590  12.418  -29.853 1.00 67.87  ? 413  GLN B OE1 1 
ATOM   7337 N NE2 . GLN B 1 413 ? 21.135  13.904  -29.169 1.00 68.17  ? 413  GLN B NE2 1 
ATOM   7338 N N   . LEU B 1 414 ? 15.486  15.030  -30.958 1.00 46.89  ? 414  LEU B N   1 
ATOM   7339 C CA  . LEU B 1 414 ? 15.147  15.646  -32.211 1.00 46.39  ? 414  LEU B CA  1 
ATOM   7340 C C   . LEU B 1 414 ? 14.249  16.869  -31.980 1.00 46.86  ? 414  LEU B C   1 
ATOM   7341 O O   . LEU B 1 414 ? 14.523  17.953  -32.491 1.00 47.36  ? 414  LEU B O   1 
ATOM   7342 C CB  . LEU B 1 414 ? 14.450  14.635  -33.107 1.00 45.42  ? 414  LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 414 ? 13.999  15.160  -34.468 1.00 44.88  ? 414  LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 414 ? 15.175  15.285  -35.431 1.00 43.62  ? 414  LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 414 ? 12.910  14.283  -35.031 1.00 42.55  ? 414  LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 415 ? 13.197  16.686  -31.186 1.00 46.61  ? 415  ALA B N   1 
ATOM   7347 C CA  . ALA B 1 415 ? 12.245  17.740  -30.896 1.00 47.24  ? 415  ALA B CA  1 
ATOM   7348 C C   . ALA B 1 415 ? 12.949  18.976  -30.375 1.00 48.85  ? 415  ALA B C   1 
ATOM   7349 O O   . ALA B 1 415 ? 12.677  20.092  -30.824 1.00 49.46  ? 415  ALA B O   1 
ATOM   7350 C CB  . ALA B 1 415 ? 11.249  17.261  -29.897 1.00 47.09  ? 415  ALA B CB  1 
ATOM   7351 N N   . GLY B 1 416 ? 13.870  18.766  -29.439 1.00 49.74  ? 416  GLY B N   1 
ATOM   7352 C CA  . GLY B 1 416 ? 14.601  19.860  -28.822 1.00 51.63  ? 416  GLY B CA  1 
ATOM   7353 C C   . GLY B 1 416 ? 15.572  20.536  -29.767 1.00 52.58  ? 416  GLY B C   1 
ATOM   7354 O O   . GLY B 1 416 ? 15.678  21.760  -29.772 1.00 54.08  ? 416  GLY B O   1 
ATOM   7355 N N   . ARG B 1 417 ? 16.290  19.760  -30.571 1.00 52.23  ? 417  ARG B N   1 
ATOM   7356 C CA  . ARG B 1 417 ? 17.225  20.378  -31.501 1.00 53.32  ? 417  ARG B CA  1 
ATOM   7357 C C   . ARG B 1 417 ? 16.487  21.255  -32.525 1.00 52.90  ? 417  ARG B C   1 
ATOM   7358 O O   . ARG B 1 417 ? 16.875  22.426  -32.755 1.00 53.40  ? 417  ARG B O   1 
ATOM   7359 C CB  . ARG B 1 417 ? 18.098  19.330  -32.196 1.00 53.92  ? 417  ARG B CB  1 
ATOM   7360 C CG  . ARG B 1 417 ? 19.021  18.526  -31.273 1.00 56.99  ? 417  ARG B CG  1 
ATOM   7361 C CD  . ARG B 1 417 ? 19.831  19.392  -30.313 1.00 62.29  ? 417  ARG B CD  1 
ATOM   7362 N NE  . ARG B 1 417 ? 20.731  20.297  -31.020 1.00 68.75  ? 417  ARG B NE  1 
ATOM   7363 C CZ  . ARG B 1 417 ? 21.831  20.829  -30.484 1.00 73.10  ? 417  ARG B CZ  1 
ATOM   7364 N NH1 . ARG B 1 417 ? 22.174  20.531  -29.231 1.00 74.10  ? 417  ARG B NH1 1 
ATOM   7365 N NH2 . ARG B 1 417 ? 22.605  21.639  -31.205 1.00 74.35  ? 417  ARG B NH2 1 
ATOM   7366 N N   . LEU B 1 418 ? 15.422  20.687  -33.114 1.00 50.78  ? 418  LEU B N   1 
ATOM   7367 C CA  . LEU B 1 418 ? 14.599  21.389  -34.100 1.00 50.76  ? 418  LEU B CA  1 
ATOM   7368 C C   . LEU B 1 418 ? 14.034  22.694  -33.528 1.00 51.97  ? 418  LEU B C   1 
ATOM   7369 O O   . LEU B 1 418 ? 14.100  23.752  -34.163 1.00 53.03  ? 418  LEU B O   1 
ATOM   7370 C CB  . LEU B 1 418 ? 13.462  20.494  -34.605 1.00 49.25  ? 418  LEU B CB  1 
ATOM   7371 C CG  . LEU B 1 418 ? 13.793  19.261  -35.464 1.00 48.85  ? 418  LEU B CG  1 
ATOM   7372 C CD1 . LEU B 1 418 ? 12.574  18.401  -35.719 1.00 46.51  ? 418  LEU B CD1 1 
ATOM   7373 C CD2 . LEU B 1 418 ? 14.397  19.673  -36.764 1.00 49.14  ? 418  LEU B CD2 1 
ATOM   7374 N N   . ALA B 1 419 ? 13.504  22.617  -32.310 1.00 51.98  ? 419  ALA B N   1 
ATOM   7375 C CA  . ALA B 1 419 ? 12.841  23.746  -31.693 1.00 52.89  ? 419  ALA B CA  1 
ATOM   7376 C C   . ALA B 1 419 ? 13.855  24.838  -31.388 1.00 55.15  ? 419  ALA B C   1 
ATOM   7377 O O   . ALA B 1 419 ? 13.590  26.010  -31.623 1.00 56.21  ? 419  ALA B O   1 
ATOM   7378 C CB  . ALA B 1 419 ? 12.126  23.312  -30.445 1.00 51.81  ? 419  ALA B CB  1 
ATOM   7379 N N   . ALA B 1 420 ? 15.020  24.430  -30.886 1.00 56.20  ? 420  ALA B N   1 
ATOM   7380 C CA  . ALA B 1 420 ? 16.115  25.340  -30.569 1.00 58.67  ? 420  ALA B CA  1 
ATOM   7381 C C   . ALA B 1 420 ? 16.595  26.087  -31.809 1.00 60.20  ? 420  ALA B C   1 
ATOM   7382 O O   . ALA B 1 420 ? 17.015  27.245  -31.722 1.00 62.20  ? 420  ALA B O   1 
ATOM   7383 C CB  . ALA B 1 420 ? 17.266  24.572  -29.951 1.00 58.51  ? 420  ALA B CB  1 
ATOM   7384 N N   . GLN B 1 421 ? 16.493  25.426  -32.957 1.00 59.77  ? 421  GLN B N   1 
ATOM   7385 C CA  . GLN B 1 421 ? 17.096  25.905  -34.188 1.00 61.27  ? 421  GLN B CA  1 
ATOM   7386 C C   . GLN B 1 421 ? 16.087  26.316  -35.263 1.00 60.79  ? 421  GLN B C   1 
ATOM   7387 O O   . GLN B 1 421 ? 16.286  26.061  -36.458 1.00 60.28  ? 421  GLN B O   1 
ATOM   7388 C CB  . GLN B 1 421 ? 18.093  24.871  -34.707 1.00 61.49  ? 421  GLN B CB  1 
ATOM   7389 C CG  . GLN B 1 421 ? 19.382  24.885  -33.882 1.00 65.07  ? 421  GLN B CG  1 
ATOM   7390 C CD  . GLN B 1 421 ? 19.950  23.502  -33.679 1.00 66.66  ? 421  GLN B CD  1 
ATOM   7391 O OE1 . GLN B 1 421 ? 20.198  23.081  -32.541 1.00 68.19  ? 421  GLN B OE1 1 
ATOM   7392 N NE2 . GLN B 1 421 ? 20.164  22.783  -34.779 1.00 66.03  ? 421  GLN B NE2 1 
ATOM   7393 N N   . GLY B 1 422 ? 15.007  26.950  -34.808 1.00 60.91  ? 422  GLY B N   1 
ATOM   7394 C CA  . GLY B 1 422 ? 14.087  27.680  -35.677 1.00 60.78  ? 422  GLY B CA  1 
ATOM   7395 C C   . GLY B 1 422 ? 12.788  26.974  -36.031 1.00 58.68  ? 422  GLY B C   1 
ATOM   7396 O O   . GLY B 1 422 ? 11.805  27.633  -36.349 1.00 59.58  ? 422  GLY B O   1 
ATOM   7397 N N   . ALA B 1 423 ? 12.781  25.645  -35.997 1.00 56.01  ? 423  ALA B N   1 
ATOM   7398 C CA  . ALA B 1 423 ? 11.581  24.890  -36.350 1.00 54.26  ? 423  ALA B CA  1 
ATOM   7399 C C   . ALA B 1 423 ? 10.427  25.171  -35.410 1.00 53.94  ? 423  ALA B C   1 
ATOM   7400 O O   . ALA B 1 423 ? 10.615  25.660  -34.312 1.00 55.05  ? 423  ALA B O   1 
ATOM   7401 C CB  . ALA B 1 423 ? 11.868  23.403  -36.384 1.00 52.47  ? 423  ALA B CB  1 
ATOM   7402 N N   . ARG B 1 424 ? 9.233   24.839  -35.867 1.00 53.06  ? 424  ARG B N   1 
ATOM   7403 C CA  . ARG B 1 424 ? 8.010   24.960  -35.116 1.00 52.77  ? 424  ARG B CA  1 
ATOM   7404 C C   . ARG B 1 424 ? 7.562   23.540  -34.832 1.00 50.60  ? 424  ARG B C   1 
ATOM   7405 O O   . ARG B 1 424 ? 7.273   22.770  -35.764 1.00 49.74  ? 424  ARG B O   1 
ATOM   7406 C CB  . ARG B 1 424 ? 7.018   25.609  -36.036 1.00 54.12  ? 424  ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 424 ? 5.784   26.086  -35.391 1.00 58.94  ? 424  ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 424 ? 5.513   27.518  -35.901 1.00 67.25  ? 424  ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 424 ? 4.158   27.886  -35.535 1.00 70.77  ? 424  ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 424 ? 3.836   28.377  -34.348 1.00 72.59  ? 424  ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 424 ? 4.779   28.584  -33.432 1.00 72.01  ? 424  ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 424 ? 2.573   28.658  -34.088 1.00 74.63  ? 424  ARG B NH2 1 
ATOM   7413 N N   . VAL B 1 425 ? 7.528   23.160  -33.562 1.00 49.27  ? 425  VAL B N   1 
ATOM   7414 C CA  . VAL B 1 425 ? 7.438   21.731  -33.239 1.00 46.34  ? 425  VAL B CA  1 
ATOM   7415 C C   . VAL B 1 425 ? 6.236   21.495  -32.352 1.00 46.20  ? 425  VAL B C   1 
ATOM   7416 O O   . VAL B 1 425 ? 5.974   22.286  -31.447 1.00 47.40  ? 425  VAL B O   1 
ATOM   7417 C CB  . VAL B 1 425 ? 8.734   21.227  -32.529 1.00 45.66  ? 425  VAL B CB  1 
ATOM   7418 C CG1 . VAL B 1 425 ? 8.632   19.747  -32.141 1.00 44.46  ? 425  VAL B CG1 1 
ATOM   7419 C CG2 . VAL B 1 425 ? 9.922   21.464  -33.398 1.00 43.33  ? 425  VAL B CG2 1 
ATOM   7420 N N   . TYR B 1 426 ? 5.521   20.409  -32.618 1.00 44.34  ? 426  TYR B N   1 
ATOM   7421 C CA  . TYR B 1 426 ? 4.383   20.007  -31.836 1.00 43.82  ? 426  TYR B CA  1 
ATOM   7422 C C   . TYR B 1 426 ? 4.609   18.540  -31.442 1.00 43.71  ? 426  TYR B C   1 
ATOM   7423 O O   . TYR B 1 426 ? 4.933   17.694  -32.290 1.00 42.60  ? 426  TYR B O   1 
ATOM   7424 C CB  . TYR B 1 426 ? 3.144   20.138  -32.696 1.00 43.53  ? 426  TYR B CB  1 
ATOM   7425 C CG  . TYR B 1 426 ? 2.721   21.558  -32.974 1.00 43.68  ? 426  TYR B CG  1 
ATOM   7426 C CD1 . TYR B 1 426 ? 3.020   22.184  -34.174 1.00 42.24  ? 426  TYR B CD1 1 
ATOM   7427 C CD2 . TYR B 1 426 ? 2.013   22.277  -32.032 1.00 43.99  ? 426  TYR B CD2 1 
ATOM   7428 C CE1 . TYR B 1 426 ? 2.614   23.485  -34.417 1.00 42.12  ? 426  TYR B CE1 1 
ATOM   7429 C CE2 . TYR B 1 426 ? 1.622   23.568  -32.268 1.00 44.89  ? 426  TYR B CE2 1 
ATOM   7430 C CZ  . TYR B 1 426 ? 1.907   24.159  -33.463 1.00 43.97  ? 426  TYR B CZ  1 
ATOM   7431 O OH  . TYR B 1 426 ? 1.491   25.454  -33.642 1.00 47.78  ? 426  TYR B OH  1 
ATOM   7432 N N   . ALA B 1 427 ? 4.454   18.239  -30.158 1.00 43.70  ? 427  ALA B N   1 
ATOM   7433 C CA  . ALA B 1 427 ? 4.825   16.939  -29.665 1.00 43.09  ? 427  ALA B CA  1 
ATOM   7434 C C   . ALA B 1 427 ? 3.643   16.250  -28.993 1.00 44.08  ? 427  ALA B C   1 
ATOM   7435 O O   . ALA B 1 427 ? 2.795   16.931  -28.408 1.00 44.04  ? 427  ALA B O   1 
ATOM   7436 C CB  . ALA B 1 427 ? 5.983   17.067  -28.717 1.00 42.73  ? 427  ALA B CB  1 
ATOM   7437 N N   . TYR B 1 428 ? 3.608   14.908  -29.057 1.00 43.49  ? 428  TYR B N   1 
ATOM   7438 C CA  . TYR B 1 428 ? 2.496   14.147  -28.497 1.00 44.47  ? 428  TYR B CA  1 
ATOM   7439 C C   . TYR B 1 428 ? 2.914   12.791  -27.915 1.00 45.43  ? 428  TYR B C   1 
ATOM   7440 O O   . TYR B 1 428 ? 3.897   12.160  -28.345 1.00 45.25  ? 428  TYR B O   1 
ATOM   7441 C CB  . TYR B 1 428 ? 1.397   13.918  -29.554 1.00 44.23  ? 428  TYR B CB  1 
ATOM   7442 C CG  . TYR B 1 428 ? 1.767   12.875  -30.615 1.00 43.87  ? 428  TYR B CG  1 
ATOM   7443 C CD1 . TYR B 1 428 ? 1.653   11.496  -30.355 1.00 44.34  ? 428  TYR B CD1 1 
ATOM   7444 C CD2 . TYR B 1 428 ? 2.260   13.265  -31.859 1.00 42.68  ? 428  TYR B CD2 1 
ATOM   7445 C CE1 . TYR B 1 428 ? 2.025   10.542  -31.313 1.00 43.10  ? 428  TYR B CE1 1 
ATOM   7446 C CE2 . TYR B 1 428 ? 2.631   12.327  -32.815 1.00 43.30  ? 428  TYR B CE2 1 
ATOM   7447 C CZ  . TYR B 1 428 ? 2.509   10.973  -32.532 1.00 43.93  ? 428  TYR B CZ  1 
ATOM   7448 O OH  . TYR B 1 428 ? 2.873   10.065  -33.487 1.00 43.44  ? 428  TYR B OH  1 
ATOM   7449 N N   . ILE B 1 429 ? 2.139   12.319  -26.949 1.00 46.61  ? 429  ILE B N   1 
ATOM   7450 C CA  . ILE B 1 429 ? 2.245   10.947  -26.522 1.00 47.12  ? 429  ILE B CA  1 
ATOM   7451 C C   . ILE B 1 429 ? 0.878   10.285  -26.701 1.00 48.05  ? 429  ILE B C   1 
ATOM   7452 O O   . ILE B 1 429 ? -0.153  10.836  -26.311 1.00 49.17  ? 429  ILE B O   1 
ATOM   7453 C CB  . ILE B 1 429 ? 2.800   10.837  -25.086 1.00 47.71  ? 429  ILE B CB  1 
ATOM   7454 C CG1 . ILE B 1 429 ? 2.779   9.378   -24.606 1.00 48.41  ? 429  ILE B CG1 1 
ATOM   7455 C CG2 . ILE B 1 429 ? 2.027   11.739  -24.145 1.00 49.25  ? 429  ILE B CG2 1 
ATOM   7456 C CD1 . ILE B 1 429 ? 3.777   9.096   -23.461 1.00 50.77  ? 429  ILE B CD1 1 
ATOM   7457 N N   . PHE B 1 430 ? 0.864   9.115   -27.319 1.00 47.78  ? 430  PHE B N   1 
ATOM   7458 C CA  . PHE B 1 430 ? -0.394  8.496   -27.699 1.00 48.48  ? 430  PHE B CA  1 
ATOM   7459 C C   . PHE B 1 430 ? -0.641  7.349   -26.723 1.00 49.72  ? 430  PHE B C   1 
ATOM   7460 O O   . PHE B 1 430 ? 0.185   6.439   -26.613 1.00 50.55  ? 430  PHE B O   1 
ATOM   7461 C CB  . PHE B 1 430 ? -0.304  8.033   -29.160 1.00 47.26  ? 430  PHE B CB  1 
ATOM   7462 C CG  . PHE B 1 430 ? -1.578  7.471   -29.704 1.00 47.83  ? 430  PHE B CG  1 
ATOM   7463 C CD1 . PHE B 1 430 ? -1.919  6.113   -29.485 1.00 48.48  ? 430  PHE B CD1 1 
ATOM   7464 C CD2 . PHE B 1 430 ? -2.433  8.266   -30.457 1.00 46.58  ? 430  PHE B CD2 1 
ATOM   7465 C CE1 . PHE B 1 430 ? -3.104  5.576   -29.987 1.00 46.84  ? 430  PHE B CE1 1 
ATOM   7466 C CE2 . PHE B 1 430 ? -3.632  7.727   -30.971 1.00 47.06  ? 430  PHE B CE2 1 
ATOM   7467 C CZ  . PHE B 1 430 ? -3.963  6.387   -30.730 1.00 46.69  ? 430  PHE B CZ  1 
ATOM   7468 N N   . GLU B 1 431 ? -1.755  7.399   -25.997 1.00 50.78  ? 431  GLU B N   1 
ATOM   7469 C CA  . GLU B 1 431 ? -1.941  6.529   -24.832 1.00 51.53  ? 431  GLU B CA  1 
ATOM   7470 C C   . GLU B 1 431 ? -3.200  5.672   -24.922 1.00 52.50  ? 431  GLU B C   1 
ATOM   7471 O O   . GLU B 1 431 ? -3.548  5.001   -23.943 1.00 53.52  ? 431  GLU B O   1 
ATOM   7472 C CB  . GLU B 1 431 ? -2.024  7.360   -23.533 1.00 52.33  ? 431  GLU B CB  1 
ATOM   7473 C CG  . GLU B 1 431 ? -0.733  7.998   -23.063 1.00 52.21  ? 431  GLU B CG  1 
ATOM   7474 C CD  . GLU B 1 431 ? -0.922  9.035   -21.956 1.00 53.53  ? 431  GLU B CD  1 
ATOM   7475 O OE1 . GLU B 1 431 ? -1.949  9.751   -21.944 1.00 54.93  ? 431  GLU B OE1 1 
ATOM   7476 O OE2 . GLU B 1 431 ? -0.029  9.139   -21.090 1.00 53.60  ? 431  GLU B OE2 1 
ATOM   7477 N N   . HIS B 1 432 ? -3.909  5.712   -26.046 1.00 51.55  ? 432  HIS B N   1 
ATOM   7478 C CA  . HIS B 1 432 ? -5.120  4.931   -26.134 1.00 53.00  ? 432  HIS B CA  1 
ATOM   7479 C C   . HIS B 1 432 ? -4.863  3.545   -26.696 1.00 52.96  ? 432  HIS B C   1 
ATOM   7480 O O   . HIS B 1 432 ? -4.394  3.416   -27.821 1.00 52.11  ? 432  HIS B O   1 
ATOM   7481 C CB  . HIS B 1 432 ? -6.199  5.623   -26.960 1.00 53.23  ? 432  HIS B CB  1 
ATOM   7482 C CG  . HIS B 1 432 ? -7.403  4.756   -27.206 1.00 54.94  ? 432  HIS B CG  1 
ATOM   7483 N ND1 . HIS B 1 432 ? -8.310  4.441   -26.215 1.00 56.22  ? 432  HIS B ND1 1 
ATOM   7484 C CD2 . HIS B 1 432 ? -7.829  4.112   -28.320 1.00 55.36  ? 432  HIS B CD2 1 
ATOM   7485 C CE1 . HIS B 1 432 ? -9.257  3.668   -26.713 1.00 56.78  ? 432  HIS B CE1 1 
ATOM   7486 N NE2 . HIS B 1 432 ? -8.991  3.455   -27.989 1.00 57.32  ? 432  HIS B NE2 1 
ATOM   7487 N N   . ARG B 1 433 ? -5.196  2.516   -25.920 1.00 54.55  ? 433  ARG B N   1 
ATOM   7488 C CA  . ARG B 1 433 ? -5.166  1.139   -26.418 1.00 55.35  ? 433  ARG B CA  1 
ATOM   7489 C C   . ARG B 1 433 ? -6.448  0.816   -27.191 1.00 56.75  ? 433  ARG B C   1 
ATOM   7490 O O   . ARG B 1 433 ? -7.538  0.762   -26.619 1.00 58.32  ? 433  ARG B O   1 
ATOM   7491 C CB  . ARG B 1 433 ? -4.984  0.144   -25.272 1.00 56.35  ? 433  ARG B CB  1 
ATOM   7492 C CG  . ARG B 1 433 ? -4.542  -1.230  -25.715 1.00 56.15  ? 433  ARG B CG  1 
ATOM   7493 C CD  . ARG B 1 433 ? -4.658  -2.184  -24.566 1.00 58.87  ? 433  ARG B CD  1 
ATOM   7494 N NE  . ARG B 1 433 ? -4.977  -3.556  -24.973 1.00 59.75  ? 433  ARG B NE  1 
ATOM   7495 C CZ  . ARG B 1 433 ? -4.062  -4.505  -25.139 1.00 59.55  ? 433  ARG B CZ  1 
ATOM   7496 N NH1 . ARG B 1 433 ? -2.773  -4.223  -24.948 1.00 57.97  ? 433  ARG B NH1 1 
ATOM   7497 N NH2 . ARG B 1 433 ? -4.433  -5.726  -25.490 1.00 57.97  ? 433  ARG B NH2 1 
ATOM   7498 N N   . ALA B 1 434 ? -6.304  0.611   -28.495 1.00 56.52  ? 434  ALA B N   1 
ATOM   7499 C CA  . ALA B 1 434 ? -7.412  0.171   -29.344 1.00 58.17  ? 434  ALA B CA  1 
ATOM   7500 C C   . ALA B 1 434 ? -8.079  -1.095  -28.808 1.00 60.52  ? 434  ALA B C   1 
ATOM   7501 O O   . ALA B 1 434 ? -7.401  -2.073  -28.508 1.00 60.61  ? 434  ALA B O   1 
ATOM   7502 C CB  . ALA B 1 434 ? -6.921  -0.061  -30.762 1.00 56.95  ? 434  ALA B CB  1 
ATOM   7503 N N   . SER B 1 435 ? -9.405  -1.043  -28.697 1.00 62.64  ? 435  SER B N   1 
ATOM   7504 C CA  . SER B 1 435 ? -10.234 -2.125  -28.180 1.00 65.56  ? 435  SER B CA  1 
ATOM   7505 C C   . SER B 1 435 ? -10.119 -3.433  -28.982 1.00 66.79  ? 435  SER B C   1 
ATOM   7506 O O   . SER B 1 435 ? -10.302 -4.525  -28.442 1.00 67.84  ? 435  SER B O   1 
ATOM   7507 C CB  . SER B 1 435 ? -11.699 -1.668  -28.123 1.00 67.21  ? 435  SER B CB  1 
ATOM   7508 O OG  . SER B 1 435 ? -12.213 -1.356  -29.411 1.00 66.28  ? 435  SER B OG  1 
ATOM   7509 N N   . THR B 1 436 ? -9.795  -3.295  -30.267 1.00 66.53  ? 436  THR B N   1 
ATOM   7510 C CA  . THR B 1 436 ? -9.670  -4.415  -31.205 1.00 67.64  ? 436  THR B CA  1 
ATOM   7511 C C   . THR B 1 436 ? -8.343  -5.192  -31.087 1.00 67.18  ? 436  THR B C   1 
ATOM   7512 O O   . THR B 1 436 ? -8.158  -6.216  -31.764 1.00 68.13  ? 436  THR B O   1 
ATOM   7513 C CB  . THR B 1 436 ? -9.789  -3.906  -32.662 1.00 66.65  ? 436  THR B CB  1 
ATOM   7514 O OG1 . THR B 1 436 ? -8.889  -2.798  -32.866 1.00 65.56  ? 436  THR B OG1 1 
ATOM   7515 C CG2 . THR B 1 436 ? -11.210 -3.473  -32.959 1.00 67.74  ? 436  THR B CG2 1 
ATOM   7516 N N   . LEU B 1 437 ? -7.438  -4.716  -30.228 1.00 65.97  ? 437  LEU B N   1 
ATOM   7517 C CA  . LEU B 1 437 ? -6.067  -5.227  -30.155 1.00 64.83  ? 437  LEU B CA  1 
ATOM   7518 C C   . LEU B 1 437 ? -5.971  -6.680  -29.720 1.00 66.82  ? 437  LEU B C   1 
ATOM   7519 O O   . LEU B 1 437 ? -6.530  -7.086  -28.694 1.00 68.74  ? 437  LEU B O   1 
ATOM   7520 C CB  . LEU B 1 437 ? -5.235  -4.356  -29.231 1.00 63.62  ? 437  LEU B CB  1 
ATOM   7521 C CG  . LEU B 1 437 ? -3.874  -3.992  -29.808 1.00 61.80  ? 437  LEU B CG  1 
ATOM   7522 C CD1 . LEU B 1 437 ? -3.819  -2.495  -29.990 1.00 60.04  ? 437  LEU B CD1 1 
ATOM   7523 C CD2 . LEU B 1 437 ? -2.775  -4.472  -28.904 1.00 61.82  ? 437  LEU B CD2 1 
ATOM   7524 N N   . THR B 1 438 ? -5.250  -7.460  -30.514 1.00 66.29  ? 438  THR B N   1 
ATOM   7525 C CA  . THR B 1 438 ? -5.145  -8.884  -30.270 1.00 67.83  ? 438  THR B CA  1 
ATOM   7526 C C   . THR B 1 438 ? -3.869  -9.219  -29.500 1.00 66.90  ? 438  THR B C   1 
ATOM   7527 O O   . THR B 1 438 ? -3.647  -10.398 -29.154 1.00 68.39  ? 438  THR B O   1 
ATOM   7528 C CB  . THR B 1 438 ? -5.231  -9.682  -31.591 1.00 68.46  ? 438  THR B CB  1 
ATOM   7529 O OG1 . THR B 1 438 ? -4.252  -9.191  -32.513 1.00 66.89  ? 438  THR B OG1 1 
ATOM   7530 C CG2 . THR B 1 438 ? -6.612  -9.510  -32.213 1.00 69.59  ? 438  THR B CG2 1 
ATOM   7531 N N   . TRP B 1 439 ? -3.047  -8.190  -29.245 1.00 63.62  ? 439  TRP B N   1 
ATOM   7532 C CA  . TRP B 1 439 ? -1.843  -8.324  -28.430 1.00 62.80  ? 439  TRP B CA  1 
ATOM   7533 C C   . TRP B 1 439 ? -2.262  -8.306  -26.974 1.00 64.44  ? 439  TRP B C   1 
ATOM   7534 O O   . TRP B 1 439 ? -3.316  -7.764  -26.655 1.00 64.90  ? 439  TRP B O   1 
ATOM   7535 C CB  . TRP B 1 439 ? -0.862  -7.189  -28.680 1.00 60.33  ? 439  TRP B CB  1 
ATOM   7536 C CG  . TRP B 1 439 ? -0.168  -7.262  -29.978 1.00 58.31  ? 439  TRP B CG  1 
ATOM   7537 C CD1 . TRP B 1 439 ? -0.407  -6.491  -31.072 1.00 56.14  ? 439  TRP B CD1 1 
ATOM   7538 C CD2 . TRP B 1 439 ? 0.887   -8.163  -30.339 1.00 58.34  ? 439  TRP B CD2 1 
ATOM   7539 N NE1 . TRP B 1 439 ? 0.429   -6.854  -32.100 1.00 56.36  ? 439  TRP B NE1 1 
ATOM   7540 C CE2 . TRP B 1 439 ? 1.236   -7.879  -31.677 1.00 57.05  ? 439  TRP B CE2 1 
ATOM   7541 C CE3 . TRP B 1 439 ? 1.562   -9.191  -29.665 1.00 59.24  ? 439  TRP B CE3 1 
ATOM   7542 C CZ2 . TRP B 1 439 ? 2.232   -8.582  -32.357 1.00 56.07  ? 439  TRP B CZ2 1 
ATOM   7543 C CZ3 . TRP B 1 439 ? 2.561   -9.884  -30.338 1.00 58.96  ? 439  TRP B CZ3 1 
ATOM   7544 C CH2 . TRP B 1 439 ? 2.882   -9.577  -31.675 1.00 57.49  ? 439  TRP B CH2 1 
ATOM   7545 N N   . PRO B 1 440 ? -1.451  -8.898  -26.075 1.00 65.31  ? 440  PRO B N   1 
ATOM   7546 C CA  . PRO B 1 440 ? -1.954  -8.981  -24.708 1.00 66.76  ? 440  PRO B CA  1 
ATOM   7547 C C   . PRO B 1 440 ? -1.823  -7.653  -23.957 1.00 65.66  ? 440  PRO B C   1 
ATOM   7548 O O   . PRO B 1 440 ? -1.105  -6.752  -24.397 1.00 63.33  ? 440  PRO B O   1 
ATOM   7549 C CB  . PRO B 1 440 ? -1.081  -10.067 -24.081 1.00 67.95  ? 440  PRO B CB  1 
ATOM   7550 C CG  . PRO B 1 440 ? 0.202   -9.957  -24.815 1.00 66.45  ? 440  PRO B CG  1 
ATOM   7551 C CD  . PRO B 1 440 ? -0.120  -9.517  -26.214 1.00 64.86  ? 440  PRO B CD  1 
ATOM   7552 N N   . LEU B 1 441 ? -2.516  -7.572  -22.826 1.00 67.29  ? 441  LEU B N   1 
ATOM   7553 C CA  . LEU B 1 441 ? -2.636  -6.367  -22.024 1.00 66.92  ? 441  LEU B CA  1 
ATOM   7554 C C   . LEU B 1 441 ? -1.311  -5.739  -21.603 1.00 65.18  ? 441  LEU B C   1 
ATOM   7555 O O   . LEU B 1 441 ? -1.180  -4.504  -21.577 1.00 63.80  ? 441  LEU B O   1 
ATOM   7556 C CB  . LEU B 1 441 ? -3.490  -6.652  -20.788 1.00 69.51  ? 441  LEU B CB  1 
ATOM   7557 C CG  . LEU B 1 441 ? -4.974  -6.282  -20.901 1.00 72.18  ? 441  LEU B CG  1 
ATOM   7558 C CD1 . LEU B 1 441 ? -5.859  -7.175  -19.980 1.00 76.16  ? 441  LEU B CD1 1 
ATOM   7559 C CD2 . LEU B 1 441 ? -5.194  -4.766  -20.625 1.00 71.43  ? 441  LEU B CD2 1 
ATOM   7560 N N   . TRP B 1 442 ? -0.334  -6.587  -21.289 1.00 65.13  ? 442  TRP B N   1 
ATOM   7561 C CA  . TRP B 1 442 ? 0.926   -6.118  -20.734 1.00 63.64  ? 442  TRP B CA  1 
ATOM   7562 C C   . TRP B 1 442 ? 1.766   -5.385  -21.757 1.00 61.46  ? 442  TRP B C   1 
ATOM   7563 O O   . TRP B 1 442 ? 2.719   -4.698  -21.409 1.00 60.96  ? 442  TRP B O   1 
ATOM   7564 C CB  . TRP B 1 442 ? 1.716   -7.267  -20.116 1.00 65.01  ? 442  TRP B CB  1 
ATOM   7565 C CG  . TRP B 1 442 ? 2.363   -8.218  -21.086 1.00 63.73  ? 442  TRP B CG  1 
ATOM   7566 C CD1 . TRP B 1 442 ? 1.947   -9.480  -21.388 1.00 64.91  ? 442  TRP B CD1 1 
ATOM   7567 C CD2 . TRP B 1 442 ? 3.561   -7.997  -21.843 1.00 61.41  ? 442  TRP B CD2 1 
ATOM   7568 N NE1 . TRP B 1 442 ? 2.794   -10.052 -22.299 1.00 63.84  ? 442  TRP B NE1 1 
ATOM   7569 C CE2 . TRP B 1 442 ? 3.793   -9.167  -22.602 1.00 60.88  ? 442  TRP B CE2 1 
ATOM   7570 C CE3 . TRP B 1 442 ? 4.450   -6.913  -21.972 1.00 58.62  ? 442  TRP B CE3 1 
ATOM   7571 C CZ2 . TRP B 1 442 ? 4.884   -9.298  -23.475 1.00 59.50  ? 442  TRP B CZ2 1 
ATOM   7572 C CZ3 . TRP B 1 442 ? 5.532   -7.036  -22.841 1.00 57.70  ? 442  TRP B CZ3 1 
ATOM   7573 C CH2 . TRP B 1 442 ? 5.743   -8.230  -23.582 1.00 57.72  ? 442  TRP B CH2 1 
ATOM   7574 N N   . MET B 1 443 ? 1.415   -5.534  -23.023 1.00 60.68  ? 443  MET B N   1 
ATOM   7575 C CA  . MET B 1 443 ? 2.106   -4.809  -24.067 1.00 58.56  ? 443  MET B CA  1 
ATOM   7576 C C   . MET B 1 443 ? 1.640   -3.350  -24.199 1.00 57.08  ? 443  MET B C   1 
ATOM   7577 O O   . MET B 1 443 ? 2.307   -2.550  -24.836 1.00 55.47  ? 443  MET B O   1 
ATOM   7578 C CB  . MET B 1 443 ? 2.047   -5.575  -25.387 1.00 58.08  ? 443  MET B CB  1 
ATOM   7579 C CG  . MET B 1 443 ? 3.094   -6.660  -25.446 1.00 59.27  ? 443  MET B CG  1 
ATOM   7580 S SD  . MET B 1 443 ? 3.069   -7.680  -26.924 1.00 61.49  ? 443  MET B SD  1 
ATOM   7581 C CE  . MET B 1 443 ? 2.961   -6.418  -28.173 1.00 60.10  ? 443  MET B CE  1 
ATOM   7582 N N   . GLY B 1 444 ? 0.520   -3.006  -23.574 1.00 57.70  ? 444  GLY B N   1 
ATOM   7583 C CA  . GLY B 1 444 ? 0.069   -1.618  -23.548 1.00 57.06  ? 444  GLY B CA  1 
ATOM   7584 C C   . GLY B 1 444 ? -0.378  -1.102  -24.903 1.00 56.05  ? 444  GLY B C   1 
ATOM   7585 O O   . GLY B 1 444 ? -1.145  -1.772  -25.599 1.00 57.08  ? 444  GLY B O   1 
ATOM   7586 N N   . VAL B 1 445 ? 0.094   0.085   -25.271 1.00 54.40  ? 445  VAL B N   1 
ATOM   7587 C CA  . VAL B 1 445 ? -0.152  0.655   -26.584 1.00 53.49  ? 445  VAL B CA  1 
ATOM   7588 C C   . VAL B 1 445 ? 1.139   0.392   -27.357 1.00 52.90  ? 445  VAL B C   1 
ATOM   7589 O O   . VAL B 1 445 ? 2.077   1.179   -27.274 1.00 53.14  ? 445  VAL B O   1 
ATOM   7590 C CB  . VAL B 1 445 ? -0.373  2.220   -26.504 1.00 53.18  ? 445  VAL B CB  1 
ATOM   7591 C CG1 . VAL B 1 445 ? -0.748  2.814   -27.859 1.00 51.64  ? 445  VAL B CG1 1 
ATOM   7592 C CG2 . VAL B 1 445 ? -1.412  2.615   -25.448 1.00 53.86  ? 445  VAL B CG2 1 
ATOM   7593 N N   . PRO B 1 446 ? 1.216   -0.714  -28.104 1.00 52.98  ? 446  PRO B N   1 
ATOM   7594 C CA  . PRO B 1 446 ? 2.482   -1.087  -28.733 1.00 52.34  ? 446  PRO B CA  1 
ATOM   7595 C C   . PRO B 1 446 ? 2.921   -0.200  -29.904 1.00 50.97  ? 446  PRO B C   1 
ATOM   7596 O O   . PRO B 1 446 ? 2.133   0.593   -30.412 1.00 51.05  ? 446  PRO B O   1 
ATOM   7597 C CB  . PRO B 1 446 ? 2.208   -2.516  -29.241 1.00 53.15  ? 446  PRO B CB  1 
ATOM   7598 C CG  . PRO B 1 446 ? 0.966   -2.944  -28.563 1.00 54.45  ? 446  PRO B CG  1 
ATOM   7599 C CD  . PRO B 1 446 ? 0.171   -1.703  -28.399 1.00 54.16  ? 446  PRO B CD  1 
ATOM   7600 N N   . HIS B 1 447 ? 4.180   -0.358  -30.318 1.00 50.53  ? 447  HIS B N   1 
ATOM   7601 C CA  . HIS B 1 447 ? 4.778   0.327   -31.489 1.00 49.15  ? 447  HIS B CA  1 
ATOM   7602 C C   . HIS B 1 447 ? 3.933   0.104   -32.754 1.00 49.14  ? 447  HIS B C   1 
ATOM   7603 O O   . HIS B 1 447 ? 3.790   -1.038  -33.267 1.00 49.19  ? 447  HIS B O   1 
ATOM   7604 C CB  . HIS B 1 447 ? 6.220   -0.188  -31.670 1.00 49.31  ? 447  HIS B CB  1 
ATOM   7605 C CG  . HIS B 1 447 ? 7.062   0.572   -32.652 1.00 47.73  ? 447  HIS B CG  1 
ATOM   7606 N ND1 . HIS B 1 447 ? 7.480   1.869   -32.441 1.00 47.00  ? 447  HIS B ND1 1 
ATOM   7607 C CD2 . HIS B 1 447 ? 7.633   0.183   -33.819 1.00 47.54  ? 447  HIS B CD2 1 
ATOM   7608 C CE1 . HIS B 1 447 ? 8.237   2.260   -33.452 1.00 45.40  ? 447  HIS B CE1 1 
ATOM   7609 N NE2 . HIS B 1 447 ? 8.345   1.255   -34.303 1.00 45.48  ? 447  HIS B NE2 1 
ATOM   7610 N N   . GLY B 1 448 ? 3.330   1.198   -33.223 1.00 47.78  ? 448  GLY B N   1 
ATOM   7611 C CA  . GLY B 1 448 ? 2.587   1.178   -34.472 1.00 47.01  ? 448  GLY B CA  1 
ATOM   7612 C C   . GLY B 1 448 ? 1.075   1.149   -34.369 1.00 47.80  ? 448  GLY B C   1 
ATOM   7613 O O   . GLY B 1 448 ? 0.397   1.151   -35.400 1.00 47.88  ? 448  GLY B O   1 
ATOM   7614 N N   . TYR B 1 449 ? 0.523   1.116   -33.153 1.00 48.34  ? 449  TYR B N   1 
ATOM   7615 C CA  . TYR B 1 449 ? -0.940  1.031   -33.026 1.00 49.09  ? 449  TYR B CA  1 
ATOM   7616 C C   . TYR B 1 449 ? -1.661  2.369   -32.818 1.00 48.99  ? 449  TYR B C   1 
ATOM   7617 O O   . TYR B 1 449 ? -2.809  2.410   -32.365 1.00 49.61  ? 449  TYR B O   1 
ATOM   7618 C CB  . TYR B 1 449 ? -1.363  -0.039  -32.032 1.00 49.79  ? 449  TYR B CB  1 
ATOM   7619 C CG  . TYR B 1 449 ? -1.034  -1.398  -32.546 1.00 50.36  ? 449  TYR B CG  1 
ATOM   7620 C CD1 . TYR B 1 449 ? 0.222   -1.958  -32.331 1.00 50.77  ? 449  TYR B CD1 1 
ATOM   7621 C CD2 . TYR B 1 449 ? -1.961  -2.124  -33.265 1.00 51.43  ? 449  TYR B CD2 1 
ATOM   7622 C CE1 . TYR B 1 449 ? 0.541   -3.217  -32.810 1.00 51.47  ? 449  TYR B CE1 1 
ATOM   7623 C CE2 . TYR B 1 449 ? -1.653  -3.385  -33.757 1.00 52.31  ? 449  TYR B CE2 1 
ATOM   7624 C CZ  . TYR B 1 449 ? -0.398  -3.924  -33.531 1.00 52.44  ? 449  TYR B CZ  1 
ATOM   7625 O OH  . TYR B 1 449 ? -0.083  -5.175  -34.024 1.00 53.46  ? 449  TYR B OH  1 
ATOM   7626 N N   . GLU B 1 450 ? -1.000  3.456   -33.196 1.00 47.99  ? 450  GLU B N   1 
ATOM   7627 C CA  . GLU B 1 450 ? -1.707  4.715   -33.314 1.00 48.48  ? 450  GLU B CA  1 
ATOM   7628 C C   . GLU B 1 450 ? -2.130  4.912   -34.764 1.00 49.00  ? 450  GLU B C   1 
ATOM   7629 O O   . GLU B 1 450 ? -2.959  5.782   -35.046 1.00 49.88  ? 450  GLU B O   1 
ATOM   7630 C CB  . GLU B 1 450 ? -0.836  5.873   -32.861 1.00 47.64  ? 450  GLU B CB  1 
ATOM   7631 C CG  . GLU B 1 450 ? 0.050   6.476   -33.941 1.00 46.28  ? 450  GLU B CG  1 
ATOM   7632 C CD  . GLU B 1 450 ? 1.336   5.693   -34.206 1.00 46.82  ? 450  GLU B CD  1 
ATOM   7633 O OE1 . GLU B 1 450 ? 1.414   4.458   -33.898 1.00 43.83  ? 450  GLU B OE1 1 
ATOM   7634 O OE2 . GLU B 1 450 ? 2.268   6.344   -34.758 1.00 44.52  ? 450  GLU B OE2 1 
ATOM   7635 N N   . ILE B 1 451 ? -1.575  4.105   -35.685 1.00 48.54  ? 451  ILE B N   1 
ATOM   7636 C CA  . ILE B 1 451 ? -1.713  4.405   -37.114 1.00 47.67  ? 451  ILE B CA  1 
ATOM   7637 C C   . ILE B 1 451 ? -3.169  4.255   -37.516 1.00 48.75  ? 451  ILE B C   1 
ATOM   7638 O O   . ILE B 1 451 ? -3.810  5.214   -37.952 1.00 49.05  ? 451  ILE B O   1 
ATOM   7639 C CB  . ILE B 1 451 ? -0.800  3.537   -37.992 1.00 47.23  ? 451  ILE B CB  1 
ATOM   7640 C CG1 . ILE B 1 451 ? 0.676   3.865   -37.736 1.00 45.69  ? 451  ILE B CG1 1 
ATOM   7641 C CG2 . ILE B 1 451 ? -1.162  3.730   -39.470 1.00 47.02  ? 451  ILE B CG2 1 
ATOM   7642 C CD1 . ILE B 1 451 ? 1.649   2.892   -38.366 1.00 46.28  ? 451  ILE B CD1 1 
ATOM   7643 N N   . GLU B 1 452 ? -3.649  3.019   -37.403 1.00 49.52  ? 452  GLU B N   1 
ATOM   7644 C CA  . GLU B 1 452 ? -5.049  2.672   -37.212 1.00 50.40  ? 452  GLU B CA  1 
ATOM   7645 C C   . GLU B 1 452 ? -5.973  3.895   -36.994 1.00 50.43  ? 452  GLU B C   1 
ATOM   7646 O O   . GLU B 1 452 ? -6.935  4.095   -37.743 1.00 50.78  ? 452  GLU B O   1 
ATOM   7647 C CB  . GLU B 1 452 ? -5.070  1.814   -35.952 1.00 51.54  ? 452  GLU B CB  1 
ATOM   7648 C CG  . GLU B 1 452 ? -6.075  0.751   -35.893 1.00 53.73  ? 452  GLU B CG  1 
ATOM   7649 C CD  . GLU B 1 452 ? -5.620  -0.364  -34.983 1.00 57.32  ? 452  GLU B CD  1 
ATOM   7650 O OE1 . GLU B 1 452 ? -4.538  -0.945  -35.233 1.00 57.52  ? 452  GLU B OE1 1 
ATOM   7651 O OE2 . GLU B 1 452 ? -6.347  -0.683  -34.022 1.00 60.76  ? 452  GLU B OE2 1 
ATOM   7652 N N   . PHE B 1 453 ? -5.671  4.698   -35.966 1.00 49.40  ? 453  PHE B N   1 
ATOM   7653 C CA  . PHE B 1 453 ? -6.512  5.844   -35.584 1.00 49.78  ? 453  PHE B CA  1 
ATOM   7654 C C   . PHE B 1 453 ? -6.334  7.044   -36.477 1.00 48.94  ? 453  PHE B C   1 
ATOM   7655 O O   . PHE B 1 453 ? -7.311  7.534   -37.015 1.00 49.91  ? 453  PHE B O   1 
ATOM   7656 C CB  . PHE B 1 453 ? -6.364  6.201   -34.098 1.00 49.44  ? 453  PHE B CB  1 
ATOM   7657 C CG  . PHE B 1 453 ? -6.855  5.125   -33.206 1.00 50.33  ? 453  PHE B CG  1 
ATOM   7658 C CD1 . PHE B 1 453 ? -8.192  5.061   -32.849 1.00 51.84  ? 453  PHE B CD1 1 
ATOM   7659 C CD2 . PHE B 1 453 ? -6.005  4.106   -32.796 1.00 50.45  ? 453  PHE B CD2 1 
ATOM   7660 C CE1 . PHE B 1 453 ? -8.677  4.032   -32.038 1.00 53.30  ? 453  PHE B CE1 1 
ATOM   7661 C CE2 . PHE B 1 453 ? -6.473  3.069   -31.990 1.00 52.12  ? 453  PHE B CE2 1 
ATOM   7662 C CZ  . PHE B 1 453 ? -7.821  3.038   -31.605 1.00 53.17  ? 453  PHE B CZ  1 
ATOM   7663 N N   . ILE B 1 454 ? -5.092  7.494   -36.636 1.00 47.84  ? 454  ILE B N   1 
ATOM   7664 C CA  . ILE B 1 454 ? -4.723  8.555   -37.580 1.00 47.53  ? 454  ILE B CA  1 
ATOM   7665 C C   . ILE B 1 454 ? -5.297  8.366   -38.981 1.00 47.97  ? 454  ILE B C   1 
ATOM   7666 O O   . ILE B 1 454 ? -5.675  9.335   -39.625 1.00 48.51  ? 454  ILE B O   1 
ATOM   7667 C CB  . ILE B 1 454 ? -3.198  8.668   -37.704 1.00 46.16  ? 454  ILE B CB  1 
ATOM   7668 C CG1 . ILE B 1 454 ? -2.544  8.765   -36.322 1.00 46.54  ? 454  ILE B CG1 1 
ATOM   7669 C CG2 . ILE B 1 454 ? -2.814  9.872   -38.540 1.00 46.72  ? 454  ILE B CG2 1 
ATOM   7670 C CD1 . ILE B 1 454 ? -3.002  9.957   -35.495 1.00 50.22  ? 454  ILE B CD1 1 
ATOM   7671 N N   . PHE B 1 455 ? -5.368  7.118   -39.445 1.00 48.43  ? 455  PHE B N   1 
ATOM   7672 C CA  . PHE B 1 455 ? -5.914  6.813   -40.784 1.00 48.88  ? 455  PHE B CA  1 
ATOM   7673 C C   . PHE B 1 455 ? -7.446  6.802   -40.866 1.00 50.49  ? 455  PHE B C   1 
ATOM   7674 O O   . PHE B 1 455 ? -8.006  6.748   -41.969 1.00 51.39  ? 455  PHE B O   1 
ATOM   7675 C CB  . PHE B 1 455 ? -5.299  5.525   -41.380 1.00 47.74  ? 455  PHE B CB  1 
ATOM   7676 C CG  . PHE B 1 455 ? -4.028  5.773   -42.161 1.00 46.23  ? 455  PHE B CG  1 
ATOM   7677 C CD1 . PHE B 1 455 ? -2.794  5.854   -41.515 1.00 45.62  ? 455  PHE B CD1 1 
ATOM   7678 C CD2 . PHE B 1 455 ? -4.064  5.958   -43.535 1.00 46.52  ? 455  PHE B CD2 1 
ATOM   7679 C CE1 . PHE B 1 455 ? -1.627  6.108   -42.223 1.00 43.97  ? 455  PHE B CE1 1 
ATOM   7680 C CE2 . PHE B 1 455 ? -2.898  6.207   -44.261 1.00 45.05  ? 455  PHE B CE2 1 
ATOM   7681 C CZ  . PHE B 1 455 ? -1.680  6.285   -43.599 1.00 44.84  ? 455  PHE B CZ  1 
ATOM   7682 N N   . GLY B 1 456 ? -8.108  6.845   -39.708 1.00 51.23  ? 456  GLY B N   1 
ATOM   7683 C CA  . GLY B 1 456 ? -9.571  6.822   -39.631 1.00 53.16  ? 456  GLY B CA  1 
ATOM   7684 C C   . GLY B 1 456 ? -10.236 5.448   -39.687 1.00 54.68  ? 456  GLY B C   1 
ATOM   7685 O O   . GLY B 1 456 ? -11.454 5.359   -39.876 1.00 56.21  ? 456  GLY B O   1 
ATOM   7686 N N   . LEU B 1 457 ? -9.476  4.369   -39.496 1.00 54.11  ? 457  LEU B N   1 
ATOM   7687 C CA  . LEU B 1 457 ? -10.105 3.033   -39.550 1.00 56.10  ? 457  LEU B CA  1 
ATOM   7688 C C   . LEU B 1 457 ? -11.308 2.828   -38.623 1.00 58.23  ? 457  LEU B C   1 
ATOM   7689 O O   . LEU B 1 457 ? -12.222 2.093   -38.983 1.00 60.56  ? 457  LEU B O   1 
ATOM   7690 C CB  . LEU B 1 457 ? -9.102  1.883   -39.389 1.00 55.03  ? 457  LEU B CB  1 
ATOM   7691 C CG  . LEU B 1 457 ? -8.510  1.347   -40.694 1.00 54.71  ? 457  LEU B CG  1 
ATOM   7692 C CD1 . LEU B 1 457 ? -7.530  2.372   -41.331 1.00 51.29  ? 457  LEU B CD1 1 
ATOM   7693 C CD2 . LEU B 1 457 ? -7.830  -0.010  -40.454 1.00 54.26  ? 457  LEU B CD2 1 
ATOM   7694 N N   . PRO B 1 458 ? -11.329 3.462   -37.436 1.00 58.58  ? 458  PRO B N   1 
ATOM   7695 C CA  . PRO B 1 458 ? -12.541 3.215   -36.637 1.00 60.85  ? 458  PRO B CA  1 
ATOM   7696 C C   . PRO B 1 458 ? -13.827 3.773   -37.249 1.00 62.88  ? 458  PRO B C   1 
ATOM   7697 O O   . PRO B 1 458 ? -14.914 3.492   -36.744 1.00 65.13  ? 458  PRO B O   1 
ATOM   7698 C CB  . PRO B 1 458 ? -12.234 3.897   -35.304 1.00 60.60  ? 458  PRO B CB  1 
ATOM   7699 C CG  . PRO B 1 458 ? -10.721 3.949   -35.240 1.00 58.30  ? 458  PRO B CG  1 
ATOM   7700 C CD  . PRO B 1 458 ? -10.267 4.122   -36.653 1.00 56.82  ? 458  PRO B CD  1 
ATOM   7701 N N   . LEU B 1 459 ? -13.718 4.534   -38.335 1.00 62.76  ? 459  LEU B N   1 
ATOM   7702 C CA  . LEU B 1 459 ? -14.911 5.080   -38.994 1.00 65.16  ? 459  LEU B CA  1 
ATOM   7703 C C   . LEU B 1 459 ? -15.676 4.051   -39.833 1.00 66.89  ? 459  LEU B C   1 
ATOM   7704 O O   . LEU B 1 459 ? -16.825 4.259   -40.194 1.00 68.66  ? 459  LEU B O   1 
ATOM   7705 C CB  . LEU B 1 459 ? -14.545 6.288   -39.842 1.00 63.96  ? 459  LEU B CB  1 
ATOM   7706 C CG  . LEU B 1 459 ? -14.409 7.606   -39.102 1.00 64.29  ? 459  LEU B CG  1 
ATOM   7707 C CD1 . LEU B 1 459 ? -13.287 7.572   -38.072 1.00 63.96  ? 459  LEU B CD1 1 
ATOM   7708 C CD2 . LEU B 1 459 ? -14.148 8.692   -40.113 1.00 64.79  ? 459  LEU B CD2 1 
ATOM   7709 N N   . ASP B 1 460 ? -15.016 2.950   -40.151 1.00 67.19  ? 460  ASP B N   1 
ATOM   7710 C CA  . ASP B 1 460 ? -15.645 1.829   -40.820 1.00 69.70  ? 460  ASP B CA  1 
ATOM   7711 C C   . ASP B 1 460 ? -16.361 0.987   -39.763 1.00 72.00  ? 460  ASP B C   1 
ATOM   7712 O O   . ASP B 1 460 ? -15.705 0.342   -38.935 1.00 71.56  ? 460  ASP B O   1 
ATOM   7713 C CB  . ASP B 1 460 ? -14.577 0.993   -41.517 1.00 68.45  ? 460  ASP B CB  1 
ATOM   7714 C CG  . ASP B 1 460 ? -15.165 -0.100  -42.398 1.00 71.17  ? 460  ASP B CG  1 
ATOM   7715 O OD1 . ASP B 1 460 ? -16.334 -0.531  -42.180 1.00 72.45  ? 460  ASP B OD1 1 
ATOM   7716 O OD2 . ASP B 1 460 ? -14.429 -0.528  -43.317 1.00 71.57  ? 460  ASP B OD2 1 
ATOM   7717 N N   . PRO B 1 461 ? -17.706 0.994   -39.778 1.00 74.83  ? 461  PRO B N   1 
ATOM   7718 C CA  . PRO B 1 461 ? -18.421 0.327   -38.689 1.00 77.22  ? 461  PRO B CA  1 
ATOM   7719 C C   . PRO B 1 461 ? -18.195 -1.184  -38.671 1.00 77.81  ? 461  PRO B C   1 
ATOM   7720 O O   . PRO B 1 461 ? -18.360 -1.805  -37.616 1.00 79.17  ? 461  PRO B O   1 
ATOM   7721 C CB  . PRO B 1 461 ? -19.909 0.662   -38.962 1.00 79.91  ? 461  PRO B CB  1 
ATOM   7722 C CG  . PRO B 1 461 ? -19.901 1.773   -40.001 1.00 78.84  ? 461  PRO B CG  1 
ATOM   7723 C CD  . PRO B 1 461 ? -18.632 1.547   -40.785 1.00 76.46  ? 461  PRO B CD  1 
ATOM   7724 N N   . SER B 1 462 ? -17.797 -1.755  -39.810 1.00 76.89  ? 462  SER B N   1 
ATOM   7725 C CA  . SER B 1 462 ? -17.608 -3.202  -39.918 1.00 77.54  ? 462  SER B CA  1 
ATOM   7726 C C   . SER B 1 462 ? -16.379 -3.713  -39.155 1.00 75.96  ? 462  SER B C   1 
ATOM   7727 O O   . SER B 1 462 ? -16.280 -4.913  -38.866 1.00 76.66  ? 462  SER B O   1 
ATOM   7728 C CB  . SER B 1 462 ? -17.596 -3.660  -41.392 1.00 77.80  ? 462  SER B CB  1 
ATOM   7729 O OG  . SER B 1 462 ? -16.323 -3.544  -42.009 1.00 75.45  ? 462  SER B OG  1 
ATOM   7730 N N   . LEU B 1 463 ? -15.460 -2.805  -38.823 1.00 73.45  ? 463  LEU B N   1 
ATOM   7731 C CA  . LEU B 1 463 ? -14.263 -3.162  -38.064 1.00 72.15  ? 463  LEU B CA  1 
ATOM   7732 C C   . LEU B 1 463 ? -14.469 -3.180  -36.550 1.00 73.12  ? 463  LEU B C   1 
ATOM   7733 O O   . LEU B 1 463 ? -13.529 -3.439  -35.801 1.00 72.36  ? 463  LEU B O   1 
ATOM   7734 C CB  . LEU B 1 463 ? -13.088 -2.255  -38.420 1.00 69.68  ? 463  LEU B CB  1 
ATOM   7735 C CG  . LEU B 1 463 ? -12.458 -2.391  -39.812 1.00 68.78  ? 463  LEU B CG  1 
ATOM   7736 C CD1 . LEU B 1 463 ? -11.365 -1.340  -39.948 1.00 64.62  ? 463  LEU B CD1 1 
ATOM   7737 C CD2 . LEU B 1 463 ? -11.920 -3.826  -40.099 1.00 68.13  ? 463  LEU B CD2 1 
ATOM   7738 N N   . ASN B 1 464 ? -15.697 -2.910  -36.116 1.00 75.09  ? 464  ASN B N   1 
ATOM   7739 C CA  . ASN B 1 464 ? -16.107 -3.030  -34.710 1.00 76.59  ? 464  ASN B CA  1 
ATOM   7740 C C   . ASN B 1 464 ? -15.294 -2.211  -33.687 1.00 74.46  ? 464  ASN B C   1 
ATOM   7741 O O   . ASN B 1 464 ? -15.008 -2.689  -32.589 1.00 75.15  ? 464  ASN B O   1 
ATOM   7742 C CB  . ASN B 1 464 ? -16.200 -4.517  -34.273 1.00 78.63  ? 464  ASN B CB  1 
ATOM   7743 C CG  . ASN B 1 464 ? -17.221 -5.320  -35.090 1.00 82.04  ? 464  ASN B CG  1 
ATOM   7744 O OD1 . ASN B 1 464 ? -18.410 -5.000  -35.107 1.00 84.59  ? 464  ASN B OD1 1 
ATOM   7745 N ND2 . ASN B 1 464 ? -16.753 -6.377  -35.760 1.00 82.58  ? 464  ASN B ND2 1 
ATOM   7746 N N   . TYR B 1 465 ? -14.935 -0.976  -34.020 1.00 71.95  ? 465  TYR B N   1 
ATOM   7747 C CA  . TYR B 1 465 ? -14.451 -0.081  -32.973 1.00 70.55  ? 465  TYR B CA  1 
ATOM   7748 C C   . TYR B 1 465 ? -15.651 0.553   -32.258 1.00 72.25  ? 465  TYR B C   1 
ATOM   7749 O O   . TYR B 1 465 ? -16.750 0.613   -32.823 1.00 73.45  ? 465  TYR B O   1 
ATOM   7750 C CB  . TYR B 1 465 ? -13.557 1.018   -33.526 1.00 68.19  ? 465  TYR B CB  1 
ATOM   7751 C CG  . TYR B 1 465 ? -12.232 0.596   -34.135 1.00 65.17  ? 465  TYR B CG  1 
ATOM   7752 C CD1 . TYR B 1 465 ? -11.036 0.748   -33.430 1.00 63.42  ? 465  TYR B CD1 1 
ATOM   7753 C CD2 . TYR B 1 465 ? -12.167 0.122   -35.438 1.00 64.10  ? 465  TYR B CD2 1 
ATOM   7754 C CE1 . TYR B 1 465 ? -9.810  0.402   -33.995 1.00 60.92  ? 465  TYR B CE1 1 
ATOM   7755 C CE2 . TYR B 1 465 ? -10.954 -0.231  -36.013 1.00 62.74  ? 465  TYR B CE2 1 
ATOM   7756 C CZ  . TYR B 1 465 ? -9.779  -0.085  -35.290 1.00 61.56  ? 465  TYR B CZ  1 
ATOM   7757 O OH  . TYR B 1 465 ? -8.587  -0.429  -35.882 1.00 58.65  ? 465  TYR B OH  1 
ATOM   7758 N N   . THR B 1 466 ? -15.423 1.020   -31.027 1.00 71.92  ? 466  THR B N   1 
ATOM   7759 C CA  . THR B 1 466 ? -16.446 1.692   -30.212 1.00 73.47  ? 466  THR B CA  1 
ATOM   7760 C C   . THR B 1 466 ? -16.727 3.116   -30.694 1.00 72.87  ? 466  THR B C   1 
ATOM   7761 O O   . THR B 1 466 ? -15.917 3.714   -31.397 1.00 70.84  ? 466  THR B O   1 
ATOM   7762 C CB  . THR B 1 466 ? -16.046 1.763   -28.711 1.00 73.64  ? 466  THR B CB  1 
ATOM   7763 O OG1 . THR B 1 466 ? -15.151 2.860   -28.489 1.00 71.45  ? 466  THR B OG1 1 
ATOM   7764 C CG2 . THR B 1 466 ? -15.377 0.464   -28.253 1.00 73.65  ? 466  THR B CG2 1 
ATOM   7765 N N   . THR B 1 467 ? -17.877 3.651   -30.298 1.00 74.89  ? 467  THR B N   1 
ATOM   7766 C CA  . THR B 1 467 ? -18.282 5.014   -30.646 1.00 74.82  ? 467  THR B CA  1 
ATOM   7767 C C   . THR B 1 467 ? -17.211 6.008   -30.207 1.00 72.92  ? 467  THR B C   1 
ATOM   7768 O O   . THR B 1 467 ? -16.836 6.909   -30.961 1.00 71.48  ? 467  THR B O   1 
ATOM   7769 C CB  . THR B 1 467 ? -19.630 5.363   -29.978 1.00 77.49  ? 467  THR B CB  1 
ATOM   7770 O OG1 . THR B 1 467 ? -20.601 4.387   -30.357 1.00 79.73  ? 467  THR B OG1 1 
ATOM   7771 C CG2 . THR B 1 467 ? -20.130 6.759   -30.376 1.00 77.71  ? 467  THR B CG2 1 
ATOM   7772 N N   . GLU B 1 468 ? -16.739 5.827   -28.973 1.00 73.01  ? 468  GLU B N   1 
ATOM   7773 C CA  . GLU B 1 468 ? -15.670 6.618   -28.394 1.00 71.70  ? 468  GLU B CA  1 
ATOM   7774 C C   . GLU B 1 468 ? -14.506 6.706   -29.400 1.00 69.08  ? 468  GLU B C   1 
ATOM   7775 O O   . GLU B 1 468 ? -14.061 7.807   -29.782 1.00 67.89  ? 468  GLU B O   1 
ATOM   7776 C CB  . GLU B 1 468 ? -15.209 5.973   -27.071 1.00 72.19  ? 468  GLU B CB  1 
ATOM   7777 C CG  . GLU B 1 468 ? -16.093 6.223   -25.836 1.00 76.84  ? 468  GLU B CG  1 
ATOM   7778 C CD  . GLU B 1 468 ? -17.460 5.483   -25.847 1.00 84.42  ? 468  GLU B CD  1 
ATOM   7779 O OE1 . GLU B 1 468 ? -17.600 4.385   -26.455 1.00 85.60  ? 468  GLU B OE1 1 
ATOM   7780 O OE2 . GLU B 1 468 ? -18.413 6.004   -25.215 1.00 87.36  ? 468  GLU B OE2 1 
ATOM   7781 N N   . GLU B 1 469 ? -14.054 5.532   -29.852 1.00 68.01  ? 469  GLU B N   1 
ATOM   7782 C CA  . GLU B 1 469 ? -12.910 5.412   -30.749 1.00 65.29  ? 469  GLU B CA  1 
ATOM   7783 C C   . GLU B 1 469 ? -13.113 6.056   -32.125 1.00 64.62  ? 469  GLU B C   1 
ATOM   7784 O O   . GLU B 1 469 ? -12.158 6.581   -32.696 1.00 63.51  ? 469  GLU B O   1 
ATOM   7785 C CB  . GLU B 1 469 ? -12.508 3.953   -30.898 1.00 65.03  ? 469  GLU B CB  1 
ATOM   7786 C CG  . GLU B 1 469 ? -11.914 3.372   -29.644 1.00 64.91  ? 469  GLU B CG  1 
ATOM   7787 C CD  . GLU B 1 469 ? -11.588 1.896   -29.773 1.00 65.37  ? 469  GLU B CD  1 
ATOM   7788 O OE1 . GLU B 1 469 ? -12.419 1.133   -30.331 1.00 67.55  ? 469  GLU B OE1 1 
ATOM   7789 O OE2 . GLU B 1 469 ? -10.511 1.492   -29.285 1.00 63.83  ? 469  GLU B OE2 1 
ATOM   7790 N N   . ARG B 1 470 ? -14.334 6.018   -32.651 1.00 65.72  ? 470  ARG B N   1 
ATOM   7791 C CA  . ARG B 1 470 ? -14.653 6.703   -33.896 1.00 65.52  ? 470  ARG B CA  1 
ATOM   7792 C C   . ARG B 1 470 ? -14.502 8.210   -33.728 1.00 64.68  ? 470  ARG B C   1 
ATOM   7793 O O   . ARG B 1 470 ? -14.053 8.897   -34.634 1.00 63.50  ? 470  ARG B O   1 
ATOM   7794 C CB  . ARG B 1 470 ? -16.073 6.369   -34.365 1.00 68.13  ? 470  ARG B CB  1 
ATOM   7795 C CG  . ARG B 1 470 ? -16.477 7.039   -35.685 1.00 70.79  ? 470  ARG B CG  1 
ATOM   7796 C CD  . ARG B 1 470 ? -17.966 7.438   -35.739 1.00 78.45  ? 470  ARG B CD  1 
ATOM   7797 N NE  . ARG B 1 470 ? -18.836 6.258   -35.744 1.00 84.58  ? 470  ARG B NE  1 
ATOM   7798 C CZ  . ARG B 1 470 ? -19.850 6.049   -34.902 1.00 88.73  ? 470  ARG B CZ  1 
ATOM   7799 N NH1 . ARG B 1 470 ? -20.174 6.956   -33.986 1.00 90.05  ? 470  ARG B NH1 1 
ATOM   7800 N NH2 . ARG B 1 470 ? -20.558 4.930   -34.992 1.00 91.47  ? 470  ARG B NH2 1 
ATOM   7801 N N   . ILE B 1 471 ? -14.884 8.723   -32.569 1.00 65.59  ? 471  ILE B N   1 
ATOM   7802 C CA  . ILE B 1 471 ? -14.842 10.163  -32.341 1.00 65.60  ? 471  ILE B CA  1 
ATOM   7803 C C   . ILE B 1 471 ? -13.403 10.580  -32.117 1.00 63.39  ? 471  ILE B C   1 
ATOM   7804 O O   . ILE B 1 471 ? -12.989 11.663  -32.540 1.00 62.71  ? 471  ILE B O   1 
ATOM   7805 C CB  . ILE B 1 471 ? -15.735 10.589  -31.148 1.00 67.72  ? 471  ILE B CB  1 
ATOM   7806 C CG1 . ILE B 1 471 ? -17.216 10.425  -31.532 1.00 70.09  ? 471  ILE B CG1 1 
ATOM   7807 C CG2 . ILE B 1 471 ? -15.390 12.022  -30.686 1.00 66.70  ? 471  ILE B CG2 1 
ATOM   7808 C CD1 . ILE B 1 471 ? -18.213 10.876  -30.481 1.00 73.55  ? 471  ILE B CD1 1 
ATOM   7809 N N   . PHE B 1 472 ? -12.653 9.694   -31.465 1.00 62.25  ? 472  PHE B N   1 
ATOM   7810 C CA  . PHE B 1 472 ? -11.230 9.883   -31.207 1.00 60.15  ? 472  PHE B CA  1 
ATOM   7811 C C   . PHE B 1 472 ? -10.456 9.882   -32.534 1.00 58.88  ? 472  PHE B C   1 
ATOM   7812 O O   . PHE B 1 472 ? -9.644  10.785  -32.797 1.00 57.93  ? 472  PHE B O   1 
ATOM   7813 C CB  . PHE B 1 472 ? -10.761 8.779   -30.251 1.00 59.88  ? 472  PHE B CB  1 
ATOM   7814 C CG  . PHE B 1 472 ? -9.289  8.792   -29.942 1.00 56.66  ? 472  PHE B CG  1 
ATOM   7815 C CD1 . PHE B 1 472 ? -8.631  9.976   -29.604 1.00 54.74  ? 472  PHE B CD1 1 
ATOM   7816 C CD2 . PHE B 1 472 ? -8.575  7.589   -29.933 1.00 54.09  ? 472  PHE B CD2 1 
ATOM   7817 C CE1 . PHE B 1 472 ? -7.277  9.973   -29.294 1.00 53.25  ? 472  PHE B CE1 1 
ATOM   7818 C CE2 . PHE B 1 472 ? -7.221  7.566   -29.626 1.00 52.59  ? 472  PHE B CE2 1 
ATOM   7819 C CZ  . PHE B 1 472 ? -6.566  8.759   -29.309 1.00 52.71  ? 472  PHE B CZ  1 
ATOM   7820 N N   . ALA B 1 473 ? -10.735 8.891   -33.381 1.00 58.68  ? 473  ALA B N   1 
ATOM   7821 C CA  . ALA B 1 473 ? -10.168 8.871   -34.715 1.00 57.47  ? 473  ALA B CA  1 
ATOM   7822 C C   . ALA B 1 473 ? -10.493 10.156  -35.455 1.00 57.80  ? 473  ALA B C   1 
ATOM   7823 O O   . ALA B 1 473 ? -9.649  10.671  -36.155 1.00 57.25  ? 473  ALA B O   1 
ATOM   7824 C CB  . ALA B 1 473 ? -10.651 7.673   -35.494 1.00 57.82  ? 473  ALA B CB  1 
ATOM   7825 N N   . GLN B 1 474 ? -11.705 10.680  -35.306 1.00 59.61  ? 474  GLN B N   1 
ATOM   7826 C CA  . GLN B 1 474 ? -12.087 11.881  -36.034 1.00 60.51  ? 474  GLN B CA  1 
ATOM   7827 C C   . GLN B 1 474 ? -11.294 13.087  -35.542 1.00 60.12  ? 474  GLN B C   1 
ATOM   7828 O O   . GLN B 1 474 ? -10.924 13.966  -36.326 1.00 59.89  ? 474  GLN B O   1 
ATOM   7829 C CB  . GLN B 1 474 ? -13.574 12.142  -35.902 1.00 62.88  ? 474  GLN B CB  1 
ATOM   7830 C CG  . GLN B 1 474 ? -14.435 11.403  -36.900 1.00 66.06  ? 474  GLN B CG  1 
ATOM   7831 C CD  . GLN B 1 474 ? -15.926 11.571  -36.624 1.00 71.07  ? 474  GLN B CD  1 
ATOM   7832 O OE1 . GLN B 1 474 ? -16.434 11.128  -35.592 1.00 73.41  ? 474  GLN B OE1 1 
ATOM   7833 N NE2 . GLN B 1 474 ? -16.634 12.207  -37.554 1.00 72.93  ? 474  GLN B NE2 1 
ATOM   7834 N N   . ARG B 1 475 ? -11.043 13.122  -34.236 1.00 60.14  ? 475  ARG B N   1 
ATOM   7835 C CA  . ARG B 1 475 ? -10.235 14.159  -33.639 1.00 59.39  ? 475  ARG B CA  1 
ATOM   7836 C C   . ARG B 1 475 ? -8.837  14.133  -34.240 1.00 57.33  ? 475  ARG B C   1 
ATOM   7837 O O   . ARG B 1 475 ? -8.262  15.183  -34.571 1.00 56.86  ? 475  ARG B O   1 
ATOM   7838 C CB  . ARG B 1 475 ? -10.158 13.955  -32.127 1.00 59.84  ? 475  ARG B CB  1 
ATOM   7839 C CG  . ARG B 1 475 ? -10.985 14.959  -31.331 1.00 63.04  ? 475  ARG B CG  1 
ATOM   7840 C CD  . ARG B 1 475 ? -11.006 14.676  -29.817 1.00 63.05  ? 475  ARG B CD  1 
ATOM   7841 N NE  . ARG B 1 475 ? -9.736  15.020  -29.182 1.00 60.25  ? 475  ARG B NE  1 
ATOM   7842 C CZ  . ARG B 1 475 ? -9.040  14.181  -28.426 1.00 59.69  ? 475  ARG B CZ  1 
ATOM   7843 N NH1 . ARG B 1 475 ? -9.500  12.956  -28.209 1.00 59.42  ? 475  ARG B NH1 1 
ATOM   7844 N NH2 . ARG B 1 475 ? -7.893  14.566  -27.881 1.00 58.32  ? 475  ARG B NH2 1 
ATOM   7845 N N   . LEU B 1 476 ? -8.301  12.928  -34.390 1.00 55.72  ? 476  LEU B N   1 
ATOM   7846 C CA  . LEU B 1 476 ? -6.921  12.775  -34.778 1.00 53.74  ? 476  LEU B CA  1 
ATOM   7847 C C   . LEU B 1 476 ? -6.700  13.224  -36.221 1.00 53.19  ? 476  LEU B C   1 
ATOM   7848 O O   . LEU B 1 476 ? -5.745  13.955  -36.510 1.00 52.57  ? 476  LEU B O   1 
ATOM   7849 C CB  . LEU B 1 476 ? -6.459  11.338  -34.524 1.00 53.25  ? 476  LEU B CB  1 
ATOM   7850 C CG  . LEU B 1 476 ? -6.282  11.019  -33.032 1.00 52.93  ? 476  LEU B CG  1 
ATOM   7851 C CD1 . LEU B 1 476 ? -6.003  9.560   -32.830 1.00 52.57  ? 476  LEU B CD1 1 
ATOM   7852 C CD2 . LEU B 1 476 ? -5.153  11.813  -32.445 1.00 52.55  ? 476  LEU B CD2 1 
ATOM   7853 N N   . MET B 1 477 ? -7.618  12.838  -37.104 1.00 53.35  ? 477  MET B N   1 
ATOM   7854 C CA  . MET B 1 477 ? -7.555  13.207  -38.504 1.00 52.99  ? 477  MET B CA  1 
ATOM   7855 C C   . MET B 1 477 ? -7.638  14.717  -38.666 1.00 53.61  ? 477  MET B C   1 
ATOM   7856 O O   . MET B 1 477 ? -7.063  15.268  -39.592 1.00 53.68  ? 477  MET B O   1 
ATOM   7857 C CB  . MET B 1 477 ? -8.694  12.541  -39.271 1.00 54.47  ? 477  MET B CB  1 
ATOM   7858 C CG  . MET B 1 477 ? -8.630  10.997  -39.305 1.00 55.51  ? 477  MET B CG  1 
ATOM   7859 S SD  . MET B 1 477 ? -10.170 10.251  -39.877 1.00 60.03  ? 477  MET B SD  1 
ATOM   7860 C CE  . MET B 1 477 ? -9.926  10.199  -41.619 1.00 58.18  ? 477  MET B CE  1 
ATOM   7861 N N   . LYS B 1 478 ? -8.355  15.382  -37.768 1.00 54.19  ? 478  LYS B N   1 
ATOM   7862 C CA  . LYS B 1 478 ? -8.430  16.828  -37.767 1.00 55.13  ? 478  LYS B CA  1 
ATOM   7863 C C   . LYS B 1 478 ? -7.081  17.451  -37.396 1.00 53.49  ? 478  LYS B C   1 
ATOM   7864 O O   . LYS B 1 478 ? -6.666  18.442  -38.002 1.00 53.21  ? 478  LYS B O   1 
ATOM   7865 C CB  . LYS B 1 478 ? -9.530  17.325  -36.811 1.00 57.25  ? 478  LYS B CB  1 
ATOM   7866 C CG  . LYS B 1 478 ? -10.819 17.779  -37.467 1.00 61.06  ? 478  LYS B CG  1 
ATOM   7867 C CD  . LYS B 1 478 ? -10.713 19.205  -38.019 1.00 65.42  ? 478  LYS B CD  1 
ATOM   7868 C CE  . LYS B 1 478 ? -11.965 19.606  -38.855 1.00 69.70  ? 478  LYS B CE  1 
ATOM   7869 N NZ  . LYS B 1 478 ? -11.942 19.134  -40.293 1.00 68.58  ? 478  LYS B NZ  1 
ATOM   7870 N N   . TYR B 1 479 ? -6.406  16.880  -36.398 1.00 51.95  ? 479  TYR B N   1 
ATOM   7871 C CA  . TYR B 1 479 ? -5.112  17.412  -35.983 1.00 50.59  ? 479  TYR B CA  1 
ATOM   7872 C C   . TYR B 1 479 ? -4.114  17.286  -37.129 1.00 49.33  ? 479  TYR B C   1 
ATOM   7873 O O   . TYR B 1 479 ? -3.505  18.282  -37.526 1.00 49.80  ? 479  TYR B O   1 
ATOM   7874 C CB  . TYR B 1 479 ? -4.533  16.662  -34.792 1.00 49.77  ? 479  TYR B CB  1 
ATOM   7875 C CG  . TYR B 1 479 ? -5.233  16.826  -33.481 1.00 49.55  ? 479  TYR B CG  1 
ATOM   7876 C CD1 . TYR B 1 479 ? -5.771  18.055  -33.081 1.00 50.52  ? 479  TYR B CD1 1 
ATOM   7877 C CD2 . TYR B 1 479 ? -5.301  15.755  -32.597 1.00 48.58  ? 479  TYR B CD2 1 
ATOM   7878 C CE1 . TYR B 1 479 ? -6.401  18.189  -31.834 1.00 50.25  ? 479  TYR B CE1 1 
ATOM   7879 C CE2 . TYR B 1 479 ? -5.929  15.877  -31.372 1.00 50.01  ? 479  TYR B CE2 1 
ATOM   7880 C CZ  . TYR B 1 479 ? -6.470  17.089  -30.996 1.00 50.31  ? 479  TYR B CZ  1 
ATOM   7881 O OH  . TYR B 1 479 ? -7.074  17.159  -29.772 1.00 53.34  ? 479  TYR B OH  1 
ATOM   7882 N N   . TRP B 1 480 ? -3.954  16.066  -37.646 1.00 47.31  ? 480  TRP B N   1 
ATOM   7883 C CA  . TRP B 1 480 ? -3.008  15.810  -38.731 1.00 46.28  ? 480  TRP B CA  1 
ATOM   7884 C C   . TRP B 1 480 ? -3.256  16.664  -39.988 1.00 46.63  ? 480  TRP B C   1 
ATOM   7885 O O   . TRP B 1 480 ? -2.321  17.224  -40.564 1.00 45.33  ? 480  TRP B O   1 
ATOM   7886 C CB  . TRP B 1 480 ? -2.998  14.320  -39.099 1.00 45.17  ? 480  TRP B CB  1 
ATOM   7887 C CG  . TRP B 1 480 ? -1.954  13.518  -38.400 1.00 44.67  ? 480  TRP B CG  1 
ATOM   7888 C CD1 . TRP B 1 480 ? -0.991  12.764  -38.993 1.00 44.78  ? 480  TRP B CD1 1 
ATOM   7889 C CD2 . TRP B 1 480 ? -1.765  13.360  -36.978 1.00 44.45  ? 480  TRP B CD2 1 
ATOM   7890 N NE1 . TRP B 1 480 ? -0.197  12.166  -38.042 1.00 43.67  ? 480  TRP B NE1 1 
ATOM   7891 C CE2 . TRP B 1 480 ? -0.658  12.501  -36.798 1.00 43.14  ? 480  TRP B CE2 1 
ATOM   7892 C CE3 . TRP B 1 480 ? -2.425  13.854  -35.845 1.00 46.44  ? 480  TRP B CE3 1 
ATOM   7893 C CZ2 . TRP B 1 480 ? -0.189  12.123  -35.534 1.00 41.68  ? 480  TRP B CZ2 1 
ATOM   7894 C CZ3 . TRP B 1 480 ? -1.960  13.472  -34.575 1.00 46.60  ? 480  TRP B CZ3 1 
ATOM   7895 C CH2 . TRP B 1 480 ? -0.849  12.602  -34.441 1.00 44.61  ? 480  TRP B CH2 1 
ATOM   7896 N N   . THR B 1 481 ? -4.514  16.731  -40.422 1.00 47.83  ? 481  THR B N   1 
ATOM   7897 C CA  . THR B 1 481 ? -4.843  17.441  -41.645 1.00 49.03  ? 481  THR B CA  1 
ATOM   7898 C C   . THR B 1 481 ? -4.855  18.959  -41.372 1.00 50.03  ? 481  THR B C   1 
ATOM   7899 O O   . THR B 1 481 ? -4.500  19.734  -42.245 1.00 50.22  ? 481  THR B O   1 
ATOM   7900 C CB  . THR B 1 481 ? -6.165  16.956  -42.250 1.00 49.92  ? 481  THR B CB  1 
ATOM   7901 O OG1 . THR B 1 481 ? -7.141  16.898  -41.219 1.00 52.59  ? 481  THR B OG1 1 
ATOM   7902 C CG2 . THR B 1 481 ? -6.043  15.562  -42.802 1.00 49.55  ? 481  THR B CG2 1 
ATOM   7903 N N   . ASN B 1 482 ? -5.223  19.377  -40.162 1.00 50.77  ? 482  ASN B N   1 
ATOM   7904 C CA  . ASN B 1 482 ? -5.012  20.787  -39.761 1.00 52.56  ? 482  ASN B CA  1 
ATOM   7905 C C   . ASN B 1 482 ? -3.539  21.138  -39.782 1.00 51.92  ? 482  ASN B C   1 
ATOM   7906 O O   . ASN B 1 482 ? -3.144  22.287  -40.079 1.00 51.87  ? 482  ASN B O   1 
ATOM   7907 C CB  . ASN B 1 482 ? -5.544  21.073  -38.358 1.00 52.97  ? 482  ASN B CB  1 
ATOM   7908 C CG  . ASN B 1 482 ? -7.029  21.332  -38.340 1.00 54.93  ? 482  ASN B CG  1 
ATOM   7909 O OD1 . ASN B 1 482 ? -7.613  21.770  -39.336 1.00 55.95  ? 482  ASN B OD1 1 
ATOM   7910 N ND2 . ASN B 1 482 ? -7.655  21.062  -37.194 1.00 56.62  ? 482  ASN B ND2 1 
ATOM   7911 N N   . PHE B 1 483 ? -2.735  20.126  -39.457 1.00 50.60  ? 483  PHE B N   1 
ATOM   7912 C CA  . PHE B 1 483 ? -1.314  20.310  -39.449 1.00 50.14  ? 483  PHE B CA  1 
ATOM   7913 C C   . PHE B 1 483 ? -0.800  20.404  -40.882 1.00 50.45  ? 483  PHE B C   1 
ATOM   7914 O O   . PHE B 1 483 ? 0.024   21.278  -41.198 1.00 51.32  ? 483  PHE B O   1 
ATOM   7915 C CB  . PHE B 1 483 ? -0.570  19.233  -38.664 1.00 48.43  ? 483  PHE B CB  1 
ATOM   7916 C CG  . PHE B 1 483 ? 0.905   19.390  -38.757 1.00 47.38  ? 483  PHE B CG  1 
ATOM   7917 C CD1 . PHE B 1 483 ? 1.537   20.470  -38.091 1.00 44.82  ? 483  PHE B CD1 1 
ATOM   7918 C CD2 . PHE B 1 483 ? 1.661   18.529  -39.569 1.00 44.30  ? 483  PHE B CD2 1 
ATOM   7919 C CE1 . PHE B 1 483 ? 2.895   20.673  -38.197 1.00 43.20  ? 483  PHE B CE1 1 
ATOM   7920 C CE2 . PHE B 1 483 ? 3.029   18.705  -39.686 1.00 44.91  ? 483  PHE B CE2 1 
ATOM   7921 C CZ  . PHE B 1 483 ? 3.658   19.809  -38.992 1.00 44.86  ? 483  PHE B CZ  1 
ATOM   7922 N N   . ALA B 1 484 ? -1.322  19.547  -41.753 1.00 50.21  ? 484  ALA B N   1 
ATOM   7923 C CA  . ALA B 1 484 ? -0.919  19.561  -43.154 1.00 50.43  ? 484  ALA B CA  1 
ATOM   7924 C C   . ALA B 1 484 ? -1.357  20.858  -43.796 1.00 52.08  ? 484  ALA B C   1 
ATOM   7925 O O   . ALA B 1 484 ? -0.642  21.437  -44.598 1.00 52.86  ? 484  ALA B O   1 
ATOM   7926 C CB  . ALA B 1 484 ? -1.494  18.351  -43.901 1.00 50.05  ? 484  ALA B CB  1 
ATOM   7927 N N   . ARG B 1 485 ? -2.528  21.327  -43.406 1.00 53.80  ? 485  ARG B N   1 
ATOM   7928 C CA  . ARG B 1 485 ? -3.130  22.498  -44.011 1.00 56.19  ? 485  ARG B CA  1 
ATOM   7929 C C   . ARG B 1 485 ? -2.370  23.765  -43.640 1.00 56.75  ? 485  ARG B C   1 
ATOM   7930 O O   . ARG B 1 485 ? -2.212  24.652  -44.471 1.00 57.89  ? 485  ARG B O   1 
ATOM   7931 C CB  . ARG B 1 485 ? -4.600  22.597  -43.579 1.00 57.37  ? 485  ARG B CB  1 
ATOM   7932 C CG  . ARG B 1 485 ? -5.516  23.408  -44.484 1.00 62.33  ? 485  ARG B CG  1 
ATOM   7933 C CD  . ARG B 1 485 ? -7.008  23.166  -44.116 1.00 69.56  ? 485  ARG B CD  1 
ATOM   7934 N NE  . ARG B 1 485 ? -7.571  21.898  -44.653 1.00 73.29  ? 485  ARG B NE  1 
ATOM   7935 C CZ  . ARG B 1 485 ? -7.949  20.828  -43.928 1.00 73.15  ? 485  ARG B CZ  1 
ATOM   7936 N NH1 . ARG B 1 485 ? -7.840  20.810  -42.597 1.00 72.89  ? 485  ARG B NH1 1 
ATOM   7937 N NH2 . ARG B 1 485 ? -8.457  19.759  -44.536 1.00 72.83  ? 485  ARG B NH2 1 
ATOM   7938 N N   . THR B 1 486 ? -1.904  23.850  -42.392 1.00 56.21  ? 486  THR B N   1 
ATOM   7939 C CA  . THR B 1 486 ? -1.472  25.143  -41.833 1.00 56.80  ? 486  THR B CA  1 
ATOM   7940 C C   . THR B 1 486 ? -0.115  25.091  -41.093 1.00 56.51  ? 486  THR B C   1 
ATOM   7941 O O   . THR B 1 486 ? 0.493   26.137  -40.829 1.00 57.30  ? 486  THR B O   1 
ATOM   7942 C CB  . THR B 1 486 ? -2.560  25.756  -40.878 1.00 57.92  ? 486  THR B CB  1 
ATOM   7943 O OG1 . THR B 1 486 ? -2.625  25.018  -39.652 1.00 55.91  ? 486  THR B OG1 1 
ATOM   7944 C CG2 . THR B 1 486 ? -3.951  25.766  -41.517 1.00 57.91  ? 486  THR B CG2 1 
ATOM   7945 N N   . GLY B 1 487 ? 0.353   23.879  -40.769 1.00 54.99  ? 487  GLY B N   1 
ATOM   7946 C CA  . GLY B 1 487 ? 1.553   23.712  -39.962 1.00 54.27  ? 487  GLY B CA  1 
ATOM   7947 C C   . GLY B 1 487 ? 1.263   23.768  -38.480 1.00 54.86  ? 487  GLY B C   1 
ATOM   7948 O O   . GLY B 1 487 ? 2.172   23.900  -37.675 1.00 54.31  ? 487  GLY B O   1 
ATOM   7949 N N   . ASP B 1 488 ? -0.017  23.640  -38.131 1.00 56.35  ? 488  ASP B N   1 
ATOM   7950 C CA  . ASP B 1 488 ? -0.547  23.913  -36.781 1.00 57.41  ? 488  ASP B CA  1 
ATOM   7951 C C   . ASP B 1 488 ? -1.727  22.965  -36.571 1.00 57.94  ? 488  ASP B C   1 
ATOM   7952 O O   . ASP B 1 488 ? -2.728  23.094  -37.275 1.00 59.30  ? 488  ASP B O   1 
ATOM   7953 C CB  . ASP B 1 488 ? -1.023  25.371  -36.695 1.00 58.60  ? 488  ASP B CB  1 
ATOM   7954 C CG  . ASP B 1 488 ? -1.382  25.789  -35.295 1.00 58.76  ? 488  ASP B CG  1 
ATOM   7955 O OD1 . ASP B 1 488 ? -1.556  24.881  -34.459 1.00 57.50  ? 488  ASP B OD1 1 
ATOM   7956 O OD2 . ASP B 1 488 ? -1.490  27.018  -35.027 1.00 58.85  ? 488  ASP B OD2 1 
ATOM   7957 N N   . PRO B 1 489 ? -1.621  22.017  -35.615 1.00 57.64  ? 489  PRO B N   1 
ATOM   7958 C CA  . PRO B 1 489 ? -2.656  20.980  -35.499 1.00 58.39  ? 489  PRO B CA  1 
ATOM   7959 C C   . PRO B 1 489 ? -3.936  21.501  -34.852 1.00 61.03  ? 489  PRO B C   1 
ATOM   7960 O O   . PRO B 1 489 ? -4.929  20.786  -34.769 1.00 61.52  ? 489  PRO B O   1 
ATOM   7961 C CB  . PRO B 1 489 ? -1.993  19.927  -34.613 1.00 56.97  ? 489  PRO B CB  1 
ATOM   7962 C CG  . PRO B 1 489 ? -1.065  20.731  -33.757 1.00 56.97  ? 489  PRO B CG  1 
ATOM   7963 C CD  . PRO B 1 489 ? -0.574  21.866  -34.591 1.00 56.63  ? 489  PRO B CD  1 
ATOM   7964 N N   . ASN B 1 490 ? -3.910  22.749  -34.413 1.00 63.75  ? 490  ASN B N   1 
ATOM   7965 C CA  . ASN B 1 490 ? -5.044  23.329  -33.744 1.00 67.13  ? 490  ASN B CA  1 
ATOM   7966 C C   . ASN B 1 490 ? -6.125  23.740  -34.719 1.00 70.10  ? 490  ASN B C   1 
ATOM   7967 O O   . ASN B 1 490 ? -5.842  24.213  -35.825 1.00 70.07  ? 490  ASN B O   1 
ATOM   7968 C CB  . ASN B 1 490 ? -4.609  24.504  -32.877 1.00 67.70  ? 490  ASN B CB  1 
ATOM   7969 C CG  . ASN B 1 490 ? -3.770  24.067  -31.705 1.00 66.08  ? 490  ASN B CG  1 
ATOM   7970 O OD1 . ASN B 1 490 ? -4.254  23.399  -30.799 1.00 65.54  ? 490  ASN B OD1 1 
ATOM   7971 N ND2 . ASN B 1 490 ? -2.497  24.441  -31.718 1.00 64.77  ? 490  ASN B ND2 1 
ATOM   7972 N N   . ASP B 1 491 ? -7.365  23.532  -34.277 1.00 73.63  ? 491  ASP B N   1 
ATOM   7973 C CA  . ASP B 1 491 ? -8.568  23.777  -35.060 1.00 77.31  ? 491  ASP B CA  1 
ATOM   7974 C C   . ASP B 1 491 ? -8.884  25.287  -35.008 1.00 80.17  ? 491  ASP B C   1 
ATOM   7975 O O   . ASP B 1 491 ? -9.372  25.801  -33.986 1.00 80.83  ? 491  ASP B O   1 
ATOM   7976 C CB  . ASP B 1 491 ? -9.721  22.898  -34.515 1.00 78.33  ? 491  ASP B CB  1 
ATOM   7977 C CG  . ASP B 1 491 ? -10.908 22.777  -35.487 1.00 81.73  ? 491  ASP B CG  1 
ATOM   7978 O OD1 . ASP B 1 491 ? -10.732 22.296  -36.634 1.00 83.03  ? 491  ASP B OD1 1 
ATOM   7979 O OD2 . ASP B 1 491 ? -12.038 23.146  -35.090 1.00 86.21  ? 491  ASP B OD2 1 
ATOM   7980 N N   . PRO B 1 492 ? -8.606  25.998  -36.119 1.00 81.87  ? 492  PRO B N   1 
ATOM   7981 C CA  . PRO B 1 492 ? -8.707  27.457  -36.130 1.00 84.73  ? 492  PRO B CA  1 
ATOM   7982 C C   . PRO B 1 492 ? -10.165 27.926  -36.112 1.00 87.76  ? 492  PRO B C   1 
ATOM   7983 O O   . PRO B 1 492 ? -10.415 29.126  -36.018 1.00 89.67  ? 492  PRO B O   1 
ATOM   7984 C CB  . PRO B 1 492 ? -8.017  27.847  -37.443 1.00 84.45  ? 492  PRO B CB  1 
ATOM   7985 C CG  . PRO B 1 492 ? -8.296  26.679  -38.370 1.00 83.14  ? 492  PRO B CG  1 
ATOM   7986 C CD  . PRO B 1 492 ? -8.475  25.444  -37.486 1.00 81.51  ? 492  PRO B CD  1 
ATOM   7987 N N   . ARG B 1 493 ? -11.101 26.973  -36.202 1.00 88.73  ? 493  ARG B N   1 
ATOM   7988 C CA  . ARG B 1 493 ? -12.543 27.233  -36.074 1.00 91.67  ? 493  ARG B CA  1 
ATOM   7989 C C   . ARG B 1 493 ? -12.953 27.216  -34.598 1.00 92.84  ? 493  ARG B C   1 
ATOM   7990 O O   . ARG B 1 493 ? -13.430 28.240  -34.064 1.00 94.54  ? 493  ARG B O   1 
ATOM   7991 C CB  . ARG B 1 493 ? -13.374 26.200  -36.889 1.00 91.69  ? 493  ARG B CB  1 
ATOM   7992 N N   . ASP B 1 494 ? -12.770 26.055  -33.954 1.00 91.66  ? 494  ASP B N   1 
ATOM   7993 C CA  . ASP B 1 494 ? -13.005 25.917  -32.514 1.00 92.63  ? 494  ASP B CA  1 
ATOM   7994 C C   . ASP B 1 494 ? -12.215 26.998  -31.740 1.00 92.83  ? 494  ASP B C   1 
ATOM   7995 O O   . ASP B 1 494 ? -10.983 27.082  -31.808 1.00 91.44  ? 494  ASP B O   1 
ATOM   7996 C CB  . ASP B 1 494 ? -12.683 24.487  -32.030 1.00 91.07  ? 494  ASP B CB  1 
ATOM   7997 C CG  . ASP B 1 494 ? -12.539 24.382  -30.500 1.00 92.17  ? 494  ASP B CG  1 
ATOM   7998 O OD1 . ASP B 1 494 ? -13.453 24.828  -29.764 1.00 94.11  ? 494  ASP B OD1 1 
ATOM   7999 O OD2 . ASP B 1 494 ? -11.504 23.837  -30.040 1.00 90.70  ? 494  ASP B OD2 1 
ATOM   8000 N N   . SER B 1 495 ? -12.957 27.847  -31.042 1.00 94.81  ? 495  SER B N   1 
ATOM   8001 C CA  . SER B 1 495 ? -12.381 28.934  -30.258 1.00 95.04  ? 495  SER B CA  1 
ATOM   8002 C C   . SER B 1 495 ? -12.438 28.593  -28.755 1.00 94.66  ? 495  SER B C   1 
ATOM   8003 O O   . SER B 1 495 ? -12.427 29.490  -27.896 1.00 95.88  ? 495  SER B O   1 
ATOM   8004 C CB  . SER B 1 495 ? -13.131 30.258  -30.574 1.00 97.51  ? 495  SER B CB  1 
ATOM   8005 N N   . LYS B 1 496 ? -12.485 27.295  -28.443 1.00 92.51  ? 496  LYS B N   1 
ATOM   8006 C CA  . LYS B 1 496 ? -12.818 26.861  -27.087 1.00 92.23  ? 496  LYS B CA  1 
ATOM   8007 C C   . LYS B 1 496 ? -11.868 25.807  -26.548 1.00 89.37  ? 496  LYS B C   1 
ATOM   8008 O O   . LYS B 1 496 ? -12.314 24.703  -26.195 1.00 89.26  ? 496  LYS B O   1 
ATOM   8009 C CB  . LYS B 1 496 ? -14.291 26.364  -27.016 1.00 94.02  ? 496  LYS B CB  1 
ATOM   8010 N N   . SER B 1 497 ? -10.570 26.155  -26.496 1.00 86.96  ? 497  SER B N   1 
ATOM   8011 C CA  . SER B 1 497 ? -9.486  25.333  -25.868 1.00 83.54  ? 497  SER B CA  1 
ATOM   8012 C C   . SER B 1 497 ? -9.482  23.808  -26.236 1.00 80.52  ? 497  SER B C   1 
ATOM   8013 O O   . SER B 1 497 ? -10.082 23.406  -27.239 1.00 80.16  ? 497  SER B O   1 
ATOM   8014 C CB  . SER B 1 497 ? -9.487  25.531  -24.326 1.00 84.60  ? 497  SER B CB  1 
ATOM   8015 O OG  . SER B 1 497 ? -8.995  26.805  -23.950 1.00 84.86  ? 497  SER B OG  1 
ATOM   8016 N N   . PRO B 1 498 ? -8.715  22.981  -25.486 1.00 77.99  ? 498  PRO B N   1 
ATOM   8017 C CA  . PRO B 1 498 ? -7.494  23.425  -24.794 1.00 75.81  ? 498  PRO B CA  1 
ATOM   8018 C C   . PRO B 1 498 ? -6.445  23.386  -25.886 1.00 72.25  ? 498  PRO B C   1 
ATOM   8019 O O   . PRO B 1 498 ? -6.368  22.394  -26.626 1.00 70.73  ? 498  PRO B O   1 
ATOM   8020 C CB  . PRO B 1 498 ? -7.244  22.351  -23.720 1.00 75.21  ? 498  PRO B CB  1 
ATOM   8021 C CG  . PRO B 1 498 ? -8.397  21.364  -23.833 1.00 76.95  ? 498  PRO B CG  1 
ATOM   8022 C CD  . PRO B 1 498 ? -9.045  21.574  -25.180 1.00 77.54  ? 498  PRO B CD  1 
ATOM   8023 N N   . GLN B 1 499 ? -5.686  24.464  -26.031 1.00 69.90  ? 499  GLN B N   1 
ATOM   8024 C CA  . GLN B 1 499 ? -4.789  24.572  -27.167 1.00 66.32  ? 499  GLN B CA  1 
ATOM   8025 C C   . GLN B 1 499 ? -3.590  23.608  -27.067 1.00 62.61  ? 499  GLN B C   1 
ATOM   8026 O O   . GLN B 1 499 ? -3.045  23.394  -25.995 1.00 62.07  ? 499  GLN B O   1 
ATOM   8027 C CB  . GLN B 1 499 ? -4.358  26.031  -27.340 1.00 67.72  ? 499  GLN B CB  1 
ATOM   8028 C CG  . GLN B 1 499 ? -5.496  26.959  -27.759 1.00 69.37  ? 499  GLN B CG  1 
ATOM   8029 C CD  . GLN B 1 499 ? -6.007  26.695  -29.180 1.00 70.77  ? 499  GLN B CD  1 
ATOM   8030 O OE1 . GLN B 1 499 ? -7.190  26.376  -29.386 1.00 70.35  ? 499  GLN B OE1 1 
ATOM   8031 N NE2 . GLN B 1 499 ? -5.116  26.842  -30.171 1.00 70.40  ? 499  GLN B NE2 1 
ATOM   8032 N N   . TRP B 1 500 ? -3.225  22.999  -28.187 1.00 59.38  ? 500  TRP B N   1 
ATOM   8033 C CA  . TRP B 1 500 ? -1.966  22.262  -28.323 1.00 56.16  ? 500  TRP B CA  1 
ATOM   8034 C C   . TRP B 1 500 ? -0.829  23.293  -28.475 1.00 55.35  ? 500  TRP B C   1 
ATOM   8035 O O   . TRP B 1 500 ? -0.820  24.090  -29.436 1.00 55.00  ? 500  TRP B O   1 
ATOM   8036 C CB  . TRP B 1 500 ? -2.034  21.391  -29.560 1.00 54.46  ? 500  TRP B CB  1 
ATOM   8037 C CG  . TRP B 1 500 ? -0.965  20.369  -29.657 1.00 54.26  ? 500  TRP B CG  1 
ATOM   8038 C CD1 . TRP B 1 500 ? 0.284   20.427  -29.112 1.00 53.68  ? 500  TRP B CD1 1 
ATOM   8039 C CD2 . TRP B 1 500 ? -1.031  19.122  -30.377 1.00 52.04  ? 500  TRP B CD2 1 
ATOM   8040 N NE1 . TRP B 1 500 ? 0.988   19.290  -29.432 1.00 51.20  ? 500  TRP B NE1 1 
ATOM   8041 C CE2 . TRP B 1 500 ? 0.209   18.482  -30.215 1.00 50.26  ? 500  TRP B CE2 1 
ATOM   8042 C CE3 . TRP B 1 500 ? -2.025  18.489  -31.142 1.00 52.30  ? 500  TRP B CE3 1 
ATOM   8043 C CZ2 . TRP B 1 500 ? 0.490   17.230  -30.784 1.00 51.33  ? 500  TRP B CZ2 1 
ATOM   8044 C CZ3 . TRP B 1 500 ? -1.752  17.238  -31.702 1.00 50.83  ? 500  TRP B CZ3 1 
ATOM   8045 C CH2 . TRP B 1 500 ? -0.504  16.623  -31.519 1.00 50.67  ? 500  TRP B CH2 1 
ATOM   8046 N N   . PRO B 1 501 ? 0.111   23.331  -27.506 1.00 54.28  ? 501  PRO B N   1 
ATOM   8047 C CA  . PRO B 1 501 ? 1.134   24.353  -27.635 1.00 53.70  ? 501  PRO B CA  1 
ATOM   8048 C C   . PRO B 1 501 ? 2.374   23.833  -28.364 1.00 51.92  ? 501  PRO B C   1 
ATOM   8049 O O   . PRO B 1 501 ? 2.636   22.623  -28.398 1.00 49.06  ? 501  PRO B O   1 
ATOM   8050 C CB  . PRO B 1 501 ? 1.468   24.704  -26.182 1.00 54.37  ? 501  PRO B CB  1 
ATOM   8051 C CG  . PRO B 1 501 ? 0.481   23.925  -25.338 1.00 55.29  ? 501  PRO B CG  1 
ATOM   8052 C CD  . PRO B 1 501 ? 0.153   22.737  -26.167 1.00 54.05  ? 501  PRO B CD  1 
ATOM   8053 N N   . PRO B 1 502 ? 3.137   24.757  -28.963 1.00 52.01  ? 502  PRO B N   1 
ATOM   8054 C CA  . PRO B 1 502 ? 4.355   24.302  -29.618 1.00 50.78  ? 502  PRO B CA  1 
ATOM   8055 C C   . PRO B 1 502 ? 5.336   23.718  -28.591 1.00 50.44  ? 502  PRO B C   1 
ATOM   8056 O O   . PRO B 1 502 ? 5.429   24.200  -27.455 1.00 51.80  ? 502  PRO B O   1 
ATOM   8057 C CB  . PRO B 1 502 ? 4.901   25.596  -30.255 1.00 51.41  ? 502  PRO B CB  1 
ATOM   8058 C CG  . PRO B 1 502 ? 3.700   26.496  -30.366 1.00 52.65  ? 502  PRO B CG  1 
ATOM   8059 C CD  . PRO B 1 502 ? 2.916   26.204  -29.135 1.00 52.75  ? 502  PRO B CD  1 
ATOM   8060 N N   . TYR B 1 503 ? 6.060   22.689  -28.975 1.00 49.15  ? 503  TYR B N   1 
ATOM   8061 C CA  . TYR B 1 503 ? 7.087   22.149  -28.101 1.00 49.57  ? 503  TYR B CA  1 
ATOM   8062 C C   . TYR B 1 503 ? 8.295   23.069  -28.141 1.00 50.29  ? 503  TYR B C   1 
ATOM   8063 O O   . TYR B 1 503 ? 8.747   23.418  -29.220 1.00 51.49  ? 503  TYR B O   1 
ATOM   8064 C CB  . TYR B 1 503 ? 7.490   20.747  -28.566 1.00 48.27  ? 503  TYR B CB  1 
ATOM   8065 C CG  . TYR B 1 503 ? 8.604   20.158  -27.756 1.00 48.13  ? 503  TYR B CG  1 
ATOM   8066 C CD1 . TYR B 1 503 ? 9.930   20.467  -28.026 1.00 49.81  ? 503  TYR B CD1 1 
ATOM   8067 C CD2 . TYR B 1 503 ? 8.330   19.312  -26.702 1.00 47.43  ? 503  TYR B CD2 1 
ATOM   8068 C CE1 . TYR B 1 503 ? 10.954  19.926  -27.257 1.00 51.35  ? 503  TYR B CE1 1 
ATOM   8069 C CE2 . TYR B 1 503 ? 9.334   18.776  -25.938 1.00 48.10  ? 503  TYR B CE2 1 
ATOM   8070 C CZ  . TYR B 1 503 ? 10.638  19.072  -26.214 1.00 49.62  ? 503  TYR B CZ  1 
ATOM   8071 O OH  . TYR B 1 503 ? 11.617  18.507  -25.437 1.00 50.39  ? 503  TYR B OH  1 
ATOM   8072 N N   . THR B 1 504 ? 8.818   23.454  -26.982 1.00 51.02  ? 504  THR B N   1 
ATOM   8073 C CA  . THR B 1 504 ? 10.000  24.342  -26.899 1.00 51.94  ? 504  THR B CA  1 
ATOM   8074 C C   . THR B 1 504 ? 11.024  23.759  -25.928 1.00 52.43  ? 504  THR B C   1 
ATOM   8075 O O   . THR B 1 504 ? 10.681  22.898  -25.117 1.00 52.68  ? 504  THR B O   1 
ATOM   8076 C CB  . THR B 1 504 ? 9.646   25.788  -26.442 1.00 53.10  ? 504  THR B CB  1 
ATOM   8077 O OG1 . THR B 1 504 ? 9.110   25.761  -25.110 1.00 52.86  ? 504  THR B OG1 1 
ATOM   8078 C CG2 . THR B 1 504 ? 8.655   26.431  -27.389 1.00 51.75  ? 504  THR B CG2 1 
ATOM   8079 N N   . THR B 1 505 ? 12.278  24.199  -26.025 1.00 53.18  ? 505  THR B N   1 
ATOM   8080 C CA  . THR B 1 505 ? 13.338  23.683  -25.142 1.00 53.71  ? 505  THR B CA  1 
ATOM   8081 C C   . THR B 1 505 ? 13.070  24.100  -23.700 1.00 54.73  ? 505  THR B C   1 
ATOM   8082 O O   . THR B 1 505 ? 13.130  23.276  -22.794 1.00 55.05  ? 505  THR B O   1 
ATOM   8083 C CB  . THR B 1 505 ? 14.786  24.066  -25.610 1.00 54.50  ? 505  THR B CB  1 
ATOM   8084 O OG1 . THR B 1 505 ? 14.918  25.494  -25.747 1.00 57.28  ? 505  THR B OG1 1 
ATOM   8085 C CG2 . THR B 1 505 ? 15.105  23.417  -26.952 1.00 52.92  ? 505  THR B CG2 1 
ATOM   8086 N N   . ALA B 1 506 ? 12.739  25.378  -23.522 1.00 56.06  ? 506  ALA B N   1 
ATOM   8087 C CA  . ALA B 1 506 ? 12.339  25.961  -22.254 1.00 57.05  ? 506  ALA B CA  1 
ATOM   8088 C C   . ALA B 1 506 ? 11.200  25.197  -21.551 1.00 56.65  ? 506  ALA B C   1 
ATOM   8089 O O   . ALA B 1 506 ? 11.399  24.669  -20.462 1.00 57.48  ? 506  ALA B O   1 
ATOM   8090 C CB  . ALA B 1 506 ? 11.936  27.402  -22.480 1.00 58.17  ? 506  ALA B CB  1 
ATOM   8091 N N   . ALA B 1 507 ? 10.017  25.141  -22.168 1.00 55.71  ? 507  ALA B N   1 
ATOM   8092 C CA  . ALA B 1 507 ? 8.836   24.584  -21.513 1.00 55.08  ? 507  ALA B CA  1 
ATOM   8093 C C   . ALA B 1 507 ? 8.601   23.094  -21.778 1.00 53.76  ? 507  ALA B C   1 
ATOM   8094 O O   . ALA B 1 507 ? 7.982   22.429  -20.971 1.00 54.12  ? 507  ALA B O   1 
ATOM   8095 C CB  . ALA B 1 507 ? 7.621   25.381  -21.878 1.00 55.60  ? 507  ALA B CB  1 
ATOM   8096 N N   . GLN B 1 508 ? 9.084   22.576  -22.900 1.00 52.62  ? 508  GLN B N   1 
ATOM   8097 C CA  . GLN B 1 508 ? 8.980   21.154  -23.215 1.00 51.72  ? 508  GLN B CA  1 
ATOM   8098 C C   . GLN B 1 508 ? 7.552   20.613  -23.231 1.00 51.09  ? 508  GLN B C   1 
ATOM   8099 O O   . GLN B 1 508 ? 7.323   19.425  -22.974 1.00 50.75  ? 508  GLN B O   1 
ATOM   8100 C CB  . GLN B 1 508 ? 9.853   20.326  -22.272 1.00 52.23  ? 508  GLN B CB  1 
ATOM   8101 C CG  . GLN B 1 508 ? 11.294  20.234  -22.690 1.00 53.33  ? 508  GLN B CG  1 
ATOM   8102 C CD  . GLN B 1 508 ? 12.225  20.182  -21.512 1.00 56.15  ? 508  GLN B CD  1 
ATOM   8103 O OE1 . GLN B 1 508 ? 12.803  19.145  -21.228 1.00 55.92  ? 508  GLN B OE1 1 
ATOM   8104 N NE2 . GLN B 1 508 ? 12.376  21.315  -20.809 1.00 58.28  ? 508  GLN B NE2 1 
ATOM   8105 N N   . GLN B 1 509 ? 6.604   21.480  -23.574 1.00 51.02  ? 509  GLN B N   1 
ATOM   8106 C CA  . GLN B 1 509 ? 5.193   21.123  -23.608 1.00 50.28  ? 509  GLN B CA  1 
ATOM   8107 C C   . GLN B 1 509 ? 4.816   20.140  -24.700 1.00 49.06  ? 509  GLN B C   1 
ATOM   8108 O O   . GLN B 1 509 ? 5.177   20.297  -25.864 1.00 48.98  ? 509  GLN B O   1 
ATOM   8109 C CB  . GLN B 1 509 ? 4.340   22.375  -23.733 1.00 51.02  ? 509  GLN B CB  1 
ATOM   8110 C CG  . GLN B 1 509 ? 4.378   23.190  -22.494 1.00 52.20  ? 509  GLN B CG  1 
ATOM   8111 C CD  . GLN B 1 509 ? 3.652   24.507  -22.611 1.00 54.43  ? 509  GLN B CD  1 
ATOM   8112 O OE1 . GLN B 1 509 ? 4.002   25.376  -23.421 1.00 54.32  ? 509  GLN B OE1 1 
ATOM   8113 N NE2 . GLN B 1 509 ? 2.655   24.684  -21.761 1.00 56.07  ? 509  GLN B NE2 1 
ATOM   8114 N N   . TYR B 1 510 ? 4.059   19.128  -24.322 1.00 48.58  ? 510  TYR B N   1 
ATOM   8115 C CA  . TYR B 1 510 ? 3.513   18.198  -25.286 1.00 47.66  ? 510  TYR B CA  1 
ATOM   8116 C C   . TYR B 1 510 ? 2.144   17.779  -24.779 1.00 48.40  ? 510  TYR B C   1 
ATOM   8117 O O   . TYR B 1 510 ? 1.742   18.214  -23.688 1.00 49.55  ? 510  TYR B O   1 
ATOM   8118 C CB  . TYR B 1 510 ? 4.434   17.000  -25.435 1.00 46.31  ? 510  TYR B CB  1 
ATOM   8119 C CG  . TYR B 1 510 ? 4.522   16.138  -24.198 1.00 47.34  ? 510  TYR B CG  1 
ATOM   8120 C CD1 . TYR B 1 510 ? 5.326   16.515  -23.096 1.00 48.29  ? 510  TYR B CD1 1 
ATOM   8121 C CD2 . TYR B 1 510 ? 3.814   14.938  -24.125 1.00 46.39  ? 510  TYR B CD2 1 
ATOM   8122 C CE1 . TYR B 1 510 ? 5.402   15.715  -21.956 1.00 48.79  ? 510  TYR B CE1 1 
ATOM   8123 C CE2 . TYR B 1 510 ? 3.886   14.138  -23.003 1.00 48.30  ? 510  TYR B CE2 1 
ATOM   8124 C CZ  . TYR B 1 510 ? 4.679   14.520  -21.923 1.00 50.15  ? 510  TYR B CZ  1 
ATOM   8125 O OH  . TYR B 1 510 ? 4.723   13.685  -20.823 1.00 52.03  ? 510  TYR B OH  1 
ATOM   8126 N N   . VAL B 1 511 ? 1.432   16.950  -25.552 1.00 47.54  ? 511  VAL B N   1 
ATOM   8127 C CA  . VAL B 1 511 ? 0.061   16.588  -25.217 1.00 48.00  ? 511  VAL B CA  1 
ATOM   8128 C C   . VAL B 1 511 ? -0.222  15.084  -25.270 1.00 48.36  ? 511  VAL B C   1 
ATOM   8129 O O   . VAL B 1 511 ? 0.291   14.345  -26.123 1.00 46.68  ? 511  VAL B O   1 
ATOM   8130 C CB  . VAL B 1 511 ? -0.971  17.333  -26.095 1.00 48.14  ? 511  VAL B CB  1 
ATOM   8131 C CG1 . VAL B 1 511 ? -0.784  18.833  -26.017 1.00 49.04  ? 511  VAL B CG1 1 
ATOM   8132 C CG2 . VAL B 1 511 ? -0.888  16.882  -27.544 1.00 46.66  ? 511  VAL B CG2 1 
ATOM   8133 N N   . SER B 1 512 ? -1.084  14.650  -24.360 1.00 50.04  ? 512  SER B N   1 
ATOM   8134 C CA  . SER B 1 512 ? -1.576  13.283  -24.347 1.00 51.01  ? 512  SER B CA  1 
ATOM   8135 C C   . SER B 1 512 ? -2.668  13.125  -25.396 1.00 51.45  ? 512  SER B C   1 
ATOM   8136 O O   . SER B 1 512 ? -3.599  13.920  -25.461 1.00 52.73  ? 512  SER B O   1 
ATOM   8137 C CB  . SER B 1 512 ? -2.153  12.966  -22.981 1.00 52.10  ? 512  SER B CB  1 
ATOM   8138 O OG  . SER B 1 512 ? -3.138  13.943  -22.651 1.00 54.79  ? 512  SER B OG  1 
ATOM   8139 N N   . LEU B 1 513 ? -2.549  12.107  -26.228 1.00 51.05  ? 513  LEU B N   1 
ATOM   8140 C CA  . LEU B 1 513 ? -3.602  11.794  -27.163 1.00 51.57  ? 513  LEU B CA  1 
ATOM   8141 C C   . LEU B 1 513 ? -4.225  10.511  -26.669 1.00 52.81  ? 513  LEU B C   1 
ATOM   8142 O O   . LEU B 1 513 ? -3.606  9.433   -26.722 1.00 52.30  ? 513  LEU B O   1 
ATOM   8143 C CB  . LEU B 1 513 ? -3.060  11.653  -28.599 1.00 50.39  ? 513  LEU B CB  1 
ATOM   8144 C CG  . LEU B 1 513 ? -2.539  12.941  -29.255 1.00 48.83  ? 513  LEU B CG  1 
ATOM   8145 C CD1 . LEU B 1 513 ? -1.956  12.687  -30.639 1.00 47.70  ? 513  LEU B CD1 1 
ATOM   8146 C CD2 . LEU B 1 513 ? -3.619  13.987  -29.330 1.00 47.52  ? 513  LEU B CD2 1 
ATOM   8147 N N   . ASN B 1 514 ? -5.431  10.655  -26.134 1.00 54.49  ? 514  ASN B N   1 
ATOM   8148 C CA  . ASN B 1 514 ? -6.210  9.548   -25.615 1.00 56.38  ? 514  ASN B CA  1 
ATOM   8149 C C   . ASN B 1 514 ? -7.657  9.983   -25.707 1.00 58.20  ? 514  ASN B C   1 
ATOM   8150 O O   . ASN B 1 514 ? -7.937  11.022  -26.291 1.00 58.70  ? 514  ASN B O   1 
ATOM   8151 C CB  . ASN B 1 514 ? -5.802  9.213   -24.174 1.00 56.82  ? 514  ASN B CB  1 
ATOM   8152 C CG  . ASN B 1 514 ? -5.926  10.413  -23.235 1.00 59.20  ? 514  ASN B CG  1 
ATOM   8153 O OD1 . ASN B 1 514 ? -6.897  11.176  -23.317 1.00 61.91  ? 514  ASN B OD1 1 
ATOM   8154 N ND2 . ASN B 1 514 ? -4.938  10.591  -22.338 1.00 58.63  ? 514  ASN B ND2 1 
ATOM   8155 N N   . LEU B 1 515 ? -8.572  9.209   -25.129 1.00 60.37  ? 515  LEU B N   1 
ATOM   8156 C CA  . LEU B 1 515 ? -10.012 9.493   -25.219 1.00 62.27  ? 515  LEU B CA  1 
ATOM   8157 C C   . LEU B 1 515 ? -10.450 10.765  -24.500 1.00 63.79  ? 515  LEU B C   1 
ATOM   8158 O O   . LEU B 1 515 ? -11.401 11.408  -24.923 1.00 65.02  ? 515  LEU B O   1 
ATOM   8159 C CB  . LEU B 1 515 ? -10.830 8.310   -24.717 1.00 63.31  ? 515  LEU B CB  1 
ATOM   8160 C CG  . LEU B 1 515 ? -10.654 7.030   -25.522 1.00 62.55  ? 515  LEU B CG  1 
ATOM   8161 C CD1 . LEU B 1 515 ? -11.433 5.893   -24.900 1.00 63.34  ? 515  LEU B CD1 1 
ATOM   8162 C CD2 . LEU B 1 515 ? -11.089 7.248   -26.963 1.00 62.50  ? 515  LEU B CD2 1 
ATOM   8163 N N   . LYS B 1 516 ? -9.765  11.105  -23.412 1.00 64.16  ? 516  LYS B N   1 
ATOM   8164 C CA  . LYS B 1 516 ? -10.022 12.339  -22.673 1.00 65.68  ? 516  LYS B CA  1 
ATOM   8165 C C   . LYS B 1 516 ? -9.498  13.522  -23.490 1.00 64.24  ? 516  LYS B C   1 
ATOM   8166 O O   . LYS B 1 516 ? -8.605  13.344  -24.306 1.00 62.97  ? 516  LYS B O   1 
ATOM   8167 C CB  . LYS B 1 516 ? -9.340  12.272  -21.298 1.00 66.25  ? 516  LYS B CB  1 
ATOM   8168 C CG  . LYS B 1 516 ? -9.779  11.060  -20.428 1.00 70.05  ? 516  LYS B CG  1 
ATOM   8169 C CD  . LYS B 1 516 ? -8.753  10.660  -19.328 1.00 73.56  ? 516  LYS B CD  1 
ATOM   8170 C CE  . LYS B 1 516 ? -8.440  11.808  -18.334 1.00 75.78  ? 516  LYS B CE  1 
ATOM   8171 N NZ  . LYS B 1 516 ? -8.189  11.338  -16.924 1.00 77.05  ? 516  LYS B NZ  1 
ATOM   8172 N N   . PRO B 1 517 ? -10.045 14.731  -23.280 1.00 65.20  ? 517  PRO B N   1 
ATOM   8173 C CA  . PRO B 1 517 ? -9.616  15.901  -24.054 1.00 64.22  ? 517  PRO B CA  1 
ATOM   8174 C C   . PRO B 1 517 ? -8.145  16.200  -23.831 1.00 62.39  ? 517  PRO B C   1 
ATOM   8175 O O   . PRO B 1 517 ? -7.626  15.896  -22.762 1.00 62.78  ? 517  PRO B O   1 
ATOM   8176 C CB  . PRO B 1 517 ? -10.452 17.047  -23.443 1.00 66.15  ? 517  PRO B CB  1 
ATOM   8177 C CG  . PRO B 1 517 ? -11.610 16.377  -22.801 1.00 67.75  ? 517  PRO B CG  1 
ATOM   8178 C CD  . PRO B 1 517 ? -11.031 15.106  -22.252 1.00 67.36  ? 517  PRO B CD  1 
ATOM   8179 N N   . LEU B 1 518 ? -7.479  16.799  -24.813 1.00 60.86  ? 518  LEU B N   1 
ATOM   8180 C CA  . LEU B 1 518 ? -6.051  17.126  -24.676 1.00 59.43  ? 518  LEU B CA  1 
ATOM   8181 C C   . LEU B 1 518 ? -5.675  17.597  -23.277 1.00 60.41  ? 518  LEU B C   1 
ATOM   8182 O O   . LEU B 1 518 ? -6.267  18.559  -22.739 1.00 61.33  ? 518  LEU B O   1 
ATOM   8183 C CB  . LEU B 1 518 ? -5.627  18.243  -25.639 1.00 58.78  ? 518  LEU B CB  1 
ATOM   8184 C CG  . LEU B 1 518 ? -5.442  18.037  -27.132 1.00 56.56  ? 518  LEU B CG  1 
ATOM   8185 C CD1 . LEU B 1 518 ? -4.913  19.321  -27.694 1.00 54.98  ? 518  LEU B CD1 1 
ATOM   8186 C CD2 . LEU B 1 518 ? -4.512  16.883  -27.427 1.00 53.33  ? 518  LEU B CD2 1 
ATOM   8187 N N   . GLU B 1 519 ? -4.672  16.924  -22.720 1.00 59.65  ? 519  GLU B N   1 
ATOM   8188 C CA  . GLU B 1 519 ? -3.981  17.375  -21.517 1.00 60.72  ? 519  GLU B CA  1 
ATOM   8189 C C   . GLU B 1 519 ? -2.572  17.849  -21.917 1.00 58.70  ? 519  GLU B C   1 
ATOM   8190 O O   . GLU B 1 519 ? -1.898  17.206  -22.704 1.00 57.79  ? 519  GLU B O   1 
ATOM   8191 C CB  . GLU B 1 519 ? -3.943  16.236  -20.486 1.00 61.46  ? 519  GLU B CB  1 
ATOM   8192 C CG  . GLU B 1 519 ? -3.102  16.492  -19.236 1.00 65.31  ? 519  GLU B CG  1 
ATOM   8193 C CD  . GLU B 1 519 ? -3.061  15.275  -18.300 1.00 69.40  ? 519  GLU B CD  1 
ATOM   8194 O OE1 . GLU B 1 519 ? -4.052  15.087  -17.551 1.00 73.06  ? 519  GLU B OE1 1 
ATOM   8195 O OE2 . GLU B 1 519 ? -2.049  14.522  -18.306 1.00 67.21  ? 519  GLU B OE2 1 
ATOM   8196 N N   . VAL B 1 520 ? -2.144  18.983  -21.394 1.00 58.72  ? 520  VAL B N   1 
ATOM   8197 C CA  . VAL B 1 520 ? -0.815  19.514  -21.678 1.00 57.29  ? 520  VAL B CA  1 
ATOM   8198 C C   . VAL B 1 520 ? 0.199   19.100  -20.582 1.00 56.89  ? 520  VAL B C   1 
ATOM   8199 O O   . VAL B 1 520 ? 0.060   19.482  -19.419 1.00 57.95  ? 520  VAL B O   1 
ATOM   8200 C CB  . VAL B 1 520 ? -0.872  21.068  -21.843 1.00 58.02  ? 520  VAL B CB  1 
ATOM   8201 C CG1 . VAL B 1 520 ? 0.510   21.658  -21.995 1.00 57.29  ? 520  VAL B CG1 1 
ATOM   8202 C CG2 . VAL B 1 520 ? -1.739  21.447  -23.032 1.00 57.88  ? 520  VAL B CG2 1 
ATOM   8203 N N   . ARG B 1 521 ? 1.208   18.317  -20.958 1.00 54.99  ? 521  ARG B N   1 
ATOM   8204 C CA  . ARG B 1 521 ? 2.251   17.912  -20.026 1.00 54.68  ? 521  ARG B CA  1 
ATOM   8205 C C   . ARG B 1 521 ? 3.576   18.568  -20.391 1.00 54.66  ? 521  ARG B C   1 
ATOM   8206 O O   . ARG B 1 521 ? 3.765   19.007  -21.521 1.00 54.66  ? 521  ARG B O   1 
ATOM   8207 C CB  . ARG B 1 521 ? 2.392   16.401  -20.028 1.00 53.85  ? 521  ARG B CB  1 
ATOM   8208 C CG  . ARG B 1 521 ? 1.074   15.687  -19.806 1.00 53.91  ? 521  ARG B CG  1 
ATOM   8209 C CD  . ARG B 1 521 ? 1.275   14.216  -19.624 1.00 52.57  ? 521  ARG B CD  1 
ATOM   8210 N NE  . ARG B 1 521 ? -0.006  13.528  -19.522 1.00 52.70  ? 521  ARG B NE  1 
ATOM   8211 C CZ  . ARG B 1 521 ? -0.246  12.329  -20.036 1.00 51.30  ? 521  ARG B CZ  1 
ATOM   8212 N NH1 . ARG B 1 521 ? 0.709   11.701  -20.696 1.00 50.86  ? 521  ARG B NH1 1 
ATOM   8213 N NH2 . ARG B 1 521 ? -1.445  11.776  -19.918 1.00 51.55  ? 521  ARG B NH2 1 
ATOM   8214 N N   . ARG B 1 522 ? 4.497   18.657  -19.441 1.00 55.20  ? 522  ARG B N   1 
ATOM   8215 C CA  . ARG B 1 522 ? 5.790   19.273  -19.712 1.00 55.27  ? 522  ARG B CA  1 
ATOM   8216 C C   . ARG B 1 522 ? 6.927   18.290  -19.538 1.00 55.06  ? 522  ARG B C   1 
ATOM   8217 O O   . ARG B 1 522 ? 6.920   17.490  -18.620 1.00 56.42  ? 522  ARG B O   1 
ATOM   8218 C CB  . ARG B 1 522 ? 5.983   20.473  -18.819 1.00 56.06  ? 522  ARG B CB  1 
ATOM   8219 C CG  . ARG B 1 522 ? 5.026   21.557  -19.172 1.00 57.56  ? 522  ARG B CG  1 
ATOM   8220 C CD  . ARG B 1 522 ? 5.091   22.686  -18.200 1.00 61.66  ? 522  ARG B CD  1 
ATOM   8221 N NE  . ARG B 1 522 ? 6.437   23.236  -18.177 1.00 64.58  ? 522  ARG B NE  1 
ATOM   8222 C CZ  . ARG B 1 522 ? 6.771   24.399  -17.639 1.00 66.32  ? 522  ARG B CZ  1 
ATOM   8223 N NH1 . ARG B 1 522 ? 5.847   25.166  -17.084 1.00 66.53  ? 522  ARG B NH1 1 
ATOM   8224 N NH2 . ARG B 1 522 ? 8.041   24.784  -17.665 1.00 67.27  ? 522  ARG B NH2 1 
ATOM   8225 N N   . GLY B 1 523 ? 7.902   18.326  -20.424 1.00 54.44  ? 523  GLY B N   1 
ATOM   8226 C CA  . GLY B 1 523 ? 9.063   17.461  -20.253 1.00 54.99  ? 523  GLY B CA  1 
ATOM   8227 C C   . GLY B 1 523 ? 8.771   16.023  -20.592 1.00 54.35  ? 523  GLY B C   1 
ATOM   8228 O O   . GLY B 1 523 ? 8.052   15.337  -19.879 1.00 55.02  ? 523  GLY B O   1 
ATOM   8229 N N   . LEU B 1 524 ? 9.332   15.579  -21.702 1.00 54.01  ? 524  LEU B N   1 
ATOM   8230 C CA  . LEU B 1 524 ? 9.049   14.270  -22.229 1.00 54.27  ? 524  LEU B CA  1 
ATOM   8231 C C   . LEU B 1 524 ? 10.133  13.336  -21.725 1.00 54.91  ? 524  LEU B C   1 
ATOM   8232 O O   . LEU B 1 524 ? 11.212  13.253  -22.320 1.00 54.92  ? 524  LEU B O   1 
ATOM   8233 C CB  . LEU B 1 524 ? 9.030   14.333  -23.764 1.00 53.46  ? 524  LEU B CB  1 
ATOM   8234 C CG  . LEU B 1 524 ? 8.757   13.042  -24.539 1.00 54.34  ? 524  LEU B CG  1 
ATOM   8235 C CD1 . LEU B 1 524 ? 7.393   12.463  -24.186 1.00 55.40  ? 524  LEU B CD1 1 
ATOM   8236 C CD2 . LEU B 1 524 ? 8.869   13.267  -26.056 1.00 55.51  ? 524  LEU B CD2 1 
ATOM   8237 N N   . ARG B 1 525 ? 9.844   12.657  -20.612 1.00 55.96  ? 525  ARG B N   1 
ATOM   8238 C CA  . ARG B 1 525 ? 10.806  11.788  -19.916 1.00 56.59  ? 525  ARG B CA  1 
ATOM   8239 C C   . ARG B 1 525 ? 12.130  12.502  -19.663 1.00 56.92  ? 525  ARG B C   1 
ATOM   8240 O O   . ARG B 1 525 ? 13.211  11.958  -19.927 1.00 57.22  ? 525  ARG B O   1 
ATOM   8241 C CB  . ARG B 1 525 ? 11.015  10.477  -20.674 1.00 55.98  ? 525  ARG B CB  1 
ATOM   8242 C CG  . ARG B 1 525 ? 9.722   9.740   -20.867 1.00 57.55  ? 525  ARG B CG  1 
ATOM   8243 C CD  . ARG B 1 525 ? 9.786   8.221   -20.647 1.00 59.63  ? 525  ARG B CD  1 
ATOM   8244 N NE  . ARG B 1 525 ? 8.408   7.741   -20.771 1.00 62.93  ? 525  ARG B NE  1 
ATOM   8245 C CZ  . ARG B 1 525 ? 8.018   6.529   -21.173 1.00 64.85  ? 525  ARG B CZ  1 
ATOM   8246 N NH1 . ARG B 1 525 ? 8.901   5.587   -21.494 1.00 65.99  ? 525  ARG B NH1 1 
ATOM   8247 N NH2 . ARG B 1 525 ? 6.714   6.252   -21.256 1.00 65.73  ? 525  ARG B NH2 1 
ATOM   8248 N N   . ALA B 1 526 ? 12.030  13.718  -19.124 1.00 56.88  ? 526  ALA B N   1 
ATOM   8249 C CA  . ALA B 1 526 ? 13.154  14.624  -19.077 1.00 56.64  ? 526  ALA B CA  1 
ATOM   8250 C C   . ALA B 1 526 ? 14.324  14.027  -18.356 1.00 57.18  ? 526  ALA B C   1 
ATOM   8251 O O   . ALA B 1 526 ? 15.415  14.034  -18.909 1.00 57.91  ? 526  ALA B O   1 
ATOM   8252 C CB  . ALA B 1 526 ? 12.764  15.970  -18.488 1.00 57.50  ? 526  ALA B CB  1 
ATOM   8253 N N   . GLN B 1 527 ? 14.106  13.487  -17.156 1.00 57.71  ? 527  GLN B N   1 
ATOM   8254 C CA  . GLN B 1 527 ? 15.203  12.887  -16.365 1.00 58.60  ? 527  GLN B CA  1 
ATOM   8255 C C   . GLN B 1 527 ? 15.760  11.643  -17.051 1.00 57.39  ? 527  GLN B C   1 
ATOM   8256 O O   . GLN B 1 527 ? 16.974  11.501  -17.192 1.00 57.69  ? 527  GLN B O   1 
ATOM   8257 C CB  . GLN B 1 527 ? 14.789  12.534  -14.917 1.00 59.73  ? 527  GLN B CB  1 
ATOM   8258 C CG  . GLN B 1 527 ? 14.413  13.705  -14.027 1.00 61.96  ? 527  GLN B CG  1 
ATOM   8259 C CD  . GLN B 1 527 ? 15.519  14.758  -13.894 1.00 65.89  ? 527  GLN B CD  1 
ATOM   8260 O OE1 . GLN B 1 527 ? 15.389  15.887  -14.406 1.00 66.34  ? 527  GLN B OE1 1 
ATOM   8261 N NE2 . GLN B 1 527 ? 16.610  14.400  -13.195 1.00 66.46  ? 527  GLN B NE2 1 
ATOM   8262 N N   . THR B 1 528 ? 14.877  10.752  -17.480 1.00 55.93  ? 528  THR B N   1 
ATOM   8263 C CA  . THR B 1 528 ? 15.320  9.501   -18.101 1.00 55.58  ? 528  THR B CA  1 
ATOM   8264 C C   . THR B 1 528 ? 16.086  9.762   -19.396 1.00 54.69  ? 528  THR B C   1 
ATOM   8265 O O   . THR B 1 528 ? 17.117  9.124   -19.650 1.00 55.40  ? 528  THR B O   1 
ATOM   8266 C CB  . THR B 1 528 ? 14.139  8.523   -18.327 1.00 55.24  ? 528  THR B CB  1 
ATOM   8267 O OG1 . THR B 1 528 ? 13.714  8.011   -17.056 1.00 56.79  ? 528  THR B OG1 1 
ATOM   8268 C CG2 . THR B 1 528 ? 14.517  7.353   -19.262 1.00 53.90  ? 528  THR B CG2 1 
ATOM   8269 N N   . CYS B 1 529 ? 15.608  10.710  -20.200 1.00 53.08  ? 529  CYS B N   1 
ATOM   8270 C CA  . CYS B 1 529 ? 16.295  11.028  -21.448 1.00 51.84  ? 529  CYS B CA  1 
ATOM   8271 C C   . CYS B 1 529 ? 17.595  11.815  -21.240 1.00 52.31  ? 529  CYS B C   1 
ATOM   8272 O O   . CYS B 1 529 ? 18.458  11.795  -22.106 1.00 52.34  ? 529  CYS B O   1 
ATOM   8273 C CB  . CYS B 1 529 ? 15.366  11.695  -22.471 1.00 50.45  ? 529  CYS B CB  1 
ATOM   8274 S SG  . CYS B 1 529 ? 14.034  10.621  -23.042 1.00 50.39  ? 529  CYS B SG  1 
ATOM   8275 N N   . ALA B 1 530 ? 17.751  12.494  -20.107 1.00 52.71  ? 530  ALA B N   1 
ATOM   8276 C CA  . ALA B 1 530 ? 19.049  13.090  -19.791 1.00 53.86  ? 530  ALA B CA  1 
ATOM   8277 C C   . ALA B 1 530 ? 20.040  11.966  -19.614 1.00 54.58  ? 530  ALA B C   1 
ATOM   8278 O O   . ALA B 1 530 ? 21.184  12.058  -20.078 1.00 55.17  ? 530  ALA B O   1 
ATOM   8279 C CB  . ALA B 1 530 ? 18.996  13.924  -18.551 1.00 54.70  ? 530  ALA B CB  1 
ATOM   8280 N N   . PHE B 1 531 ? 19.580  10.891  -18.967 1.00 54.71  ? 531  PHE B N   1 
ATOM   8281 C CA  . PHE B 1 531 ? 20.391  9.693   -18.807 1.00 55.23  ? 531  PHE B CA  1 
ATOM   8282 C C   . PHE B 1 531 ? 20.871  9.206   -20.160 1.00 54.77  ? 531  PHE B C   1 
ATOM   8283 O O   . PHE B 1 531 ? 22.080  9.021   -20.347 1.00 55.47  ? 531  PHE B O   1 
ATOM   8284 C CB  . PHE B 1 531 ? 19.637  8.583   -18.088 1.00 55.03  ? 531  PHE B CB  1 
ATOM   8285 C CG  . PHE B 1 531 ? 20.421  7.314   -17.973 1.00 55.16  ? 531  PHE B CG  1 
ATOM   8286 C CD1 . PHE B 1 531 ? 21.450  7.199   -17.049 1.00 56.72  ? 531  PHE B CD1 1 
ATOM   8287 C CD2 . PHE B 1 531 ? 20.144  6.237   -18.793 1.00 53.77  ? 531  PHE B CD2 1 
ATOM   8288 C CE1 . PHE B 1 531 ? 22.177  6.024   -16.951 1.00 57.64  ? 531  PHE B CE1 1 
ATOM   8289 C CE2 . PHE B 1 531 ? 20.865  5.057   -18.692 1.00 54.68  ? 531  PHE B CE2 1 
ATOM   8290 C CZ  . PHE B 1 531 ? 21.869  4.947   -17.778 1.00 56.53  ? 531  PHE B CZ  1 
ATOM   8291 N N   . TRP B 1 532 ? 19.921  9.042   -21.087 1.00 53.57  ? 532  TRP B N   1 
ATOM   8292 C CA  . TRP B 1 532 ? 20.172  8.476   -22.413 1.00 53.48  ? 532  TRP B CA  1 
ATOM   8293 C C   . TRP B 1 532 ? 20.879  9.399   -23.385 1.00 54.04  ? 532  TRP B C   1 
ATOM   8294 O O   . TRP B 1 532 ? 21.626  8.937   -24.247 1.00 54.31  ? 532  TRP B O   1 
ATOM   8295 C CB  . TRP B 1 532 ? 18.868  8.020   -23.069 1.00 51.71  ? 532  TRP B CB  1 
ATOM   8296 C CG  . TRP B 1 532 ? 18.395  6.705   -22.605 1.00 51.07  ? 532  TRP B CG  1 
ATOM   8297 C CD1 . TRP B 1 532 ? 17.281  6.471   -21.880 1.00 51.16  ? 532  TRP B CD1 1 
ATOM   8298 C CD2 . TRP B 1 532 ? 19.010  5.426   -22.823 1.00 50.31  ? 532  TRP B CD2 1 
ATOM   8299 N NE1 . TRP B 1 532 ? 17.146  5.131   -21.630 1.00 51.11  ? 532  TRP B NE1 1 
ATOM   8300 C CE2 . TRP B 1 532 ? 18.195  4.461   -22.193 1.00 50.03  ? 532  TRP B CE2 1 
ATOM   8301 C CE3 . TRP B 1 532 ? 20.161  4.999   -23.497 1.00 51.60  ? 532  TRP B CE3 1 
ATOM   8302 C CZ2 . TRP B 1 532 ? 18.482  3.090   -22.212 1.00 50.35  ? 532  TRP B CZ2 1 
ATOM   8303 C CZ3 . TRP B 1 532 ? 20.457  3.605   -23.515 1.00 51.97  ? 532  TRP B CZ3 1 
ATOM   8304 C CH2 . TRP B 1 532 ? 19.613  2.681   -22.873 1.00 51.38  ? 532  TRP B CH2 1 
ATOM   8305 N N   . ASN B 1 533 ? 20.636  10.697  -23.261 1.00 54.88  ? 533  ASN B N   1 
ATOM   8306 C CA  . ASN B 1 533 ? 21.120  11.643  -24.254 1.00 55.55  ? 533  ASN B CA  1 
ATOM   8307 C C   . ASN B 1 533 ? 22.330  12.415  -23.841 1.00 58.00  ? 533  ASN B C   1 
ATOM   8308 O O   . ASN B 1 533 ? 23.078  12.877  -24.703 1.00 58.75  ? 533  ASN B O   1 
ATOM   8309 C CB  . ASN B 1 533 ? 20.026  12.612  -24.657 1.00 54.55  ? 533  ASN B CB  1 
ATOM   8310 C CG  . ASN B 1 533 ? 18.915  11.940  -25.396 1.00 53.08  ? 533  ASN B CG  1 
ATOM   8311 O OD1 . ASN B 1 533 ? 19.060  10.815  -25.892 1.00 53.23  ? 533  ASN B OD1 1 
ATOM   8312 N ND2 . ASN B 1 533 ? 17.790  12.616  -25.479 1.00 52.24  ? 533  ASN B ND2 1 
ATOM   8313 N N   . ARG B 1 534 ? 22.527  12.576  -22.534 1.00 59.90  ? 534  ARG B N   1 
ATOM   8314 C CA  A ARG B 1 534 ? 23.683  13.315  -22.037 0.50 61.89  ? 534  ARG B CA  1 
ATOM   8315 C CA  B ARG B 1 534 ? 23.675  13.324  -22.031 0.50 62.06  ? 534  ARG B CA  1 
ATOM   8316 C C   . ARG B 1 534 ? 24.685  12.423  -21.336 1.00 63.84  ? 534  ARG B C   1 
ATOM   8317 O O   . ARG B 1 534 ? 25.862  12.431  -21.681 1.00 65.43  ? 534  ARG B O   1 
ATOM   8318 C CB  A ARG B 1 534 ? 23.265  14.463  -21.120 0.50 62.07  ? 534  ARG B CB  1 
ATOM   8319 C CB  B ARG B 1 534 ? 23.229  14.462  -21.107 0.50 62.32  ? 534  ARG B CB  1 
ATOM   8320 C CG  A ARG B 1 534 ? 22.693  15.655  -21.848 0.50 60.43  ? 534  ARG B CG  1 
ATOM   8321 C CG  B ARG B 1 534 ? 22.423  15.545  -21.809 0.50 61.20  ? 534  ARG B CG  1 
ATOM   8322 C CD  A ARG B 1 534 ? 22.073  16.598  -20.852 0.50 58.92  ? 534  ARG B CD  1 
ATOM   8323 C CD  B ARG B 1 534 ? 21.324  16.073  -20.903 0.50 60.40  ? 534  ARG B CD  1 
ATOM   8324 N NE  A ARG B 1 534 ? 21.480  17.779  -21.465 0.50 56.08  ? 534  ARG B NE  1 
ATOM   8325 N NE  B ARG B 1 534 ? 20.609  17.212  -21.480 0.50 59.45  ? 534  ARG B NE  1 
ATOM   8326 C CZ  A ARG B 1 534 ? 22.137  18.907  -21.678 0.50 56.05  ? 534  ARG B CZ  1 
ATOM   8327 C CZ  B ARG B 1 534 ? 19.427  17.133  -22.087 0.50 57.27  ? 534  ARG B CZ  1 
ATOM   8328 N NH1 A ARG B 1 534 ? 23.415  18.993  -21.337 0.50 57.42  ? 534  ARG B NH1 1 
ATOM   8329 N NH1 B ARG B 1 534 ? 18.804  15.960  -22.215 0.50 54.89  ? 534  ARG B NH1 1 
ATOM   8330 N NH2 A ARG B 1 534 ? 21.515  19.941  -22.229 0.50 55.32  ? 534  ARG B NH2 1 
ATOM   8331 N NH2 B ARG B 1 534 ? 18.868  18.237  -22.564 0.50 56.13  ? 534  ARG B NH2 1 
ATOM   8332 N N   . PHE B 1 535 ? 24.233  11.644  -20.357 1.00 65.01  ? 535  PHE B N   1 
ATOM   8333 C CA  . PHE B 1 535 ? 25.199  10.853  -19.600 1.00 67.87  ? 535  PHE B CA  1 
ATOM   8334 C C   . PHE B 1 535 ? 25.818  9.761   -20.543 1.00 69.47  ? 535  PHE B C   1 
ATOM   8335 O O   . PHE B 1 535 ? 27.083  9.331   -20.257 1.00 71.57  ? 535  PHE B O   1 
ATOM   8336 C CB  . PHE B 1 535 ? 24.563  10.182  -18.378 1.00 67.43  ? 535  PHE B CB  1 
ATOM   8337 C CG  . PHE B 1 535 ? 25.561  9.499   -17.511 1.00 66.74  ? 535  PHE B CG  1 
ATOM   8338 C CD1 . PHE B 1 535 ? 26.568  10.233  -16.903 1.00 66.63  ? 535  PHE B CD1 1 
ATOM   8339 C CD2 . PHE B 1 535 ? 25.534  8.125   -17.336 1.00 65.48  ? 535  PHE B CD2 1 
ATOM   8340 C CE1 . PHE B 1 535 ? 27.519  9.618   -16.123 1.00 67.20  ? 535  PHE B CE1 1 
ATOM   8341 C CE2 . PHE B 1 535 ? 26.491  7.496   -16.546 1.00 66.80  ? 535  PHE B CE2 1 
ATOM   8342 C CZ  . PHE B 1 535 ? 27.478  8.249   -15.935 1.00 67.69  ? 535  PHE B CZ  1 
ATOM   8343 N N   . LEU B 1 536 ? 24.917  8.987   -21.125 1.00 69.88  ? 536  LEU B N   1 
ATOM   8344 C CA  . LEU B 1 536 ? 25.360  7.744   -21.679 1.00 72.48  ? 536  LEU B CA  1 
ATOM   8345 C C   . LEU B 1 536 ? 26.409  7.904   -22.804 1.00 74.63  ? 536  LEU B C   1 
ATOM   8346 O O   . LEU B 1 536 ? 27.370  7.132   -22.833 1.00 75.77  ? 536  LEU B O   1 
ATOM   8347 C CB  . LEU B 1 536 ? 24.159  6.896   -22.080 1.00 71.17  ? 536  LEU B CB  1 
ATOM   8348 C CG  . LEU B 1 536 ? 24.487  5.392   -22.073 1.00 72.58  ? 536  LEU B CG  1 
ATOM   8349 C CD1 . LEU B 1 536 ? 25.632  5.108   -21.093 1.00 76.14  ? 536  LEU B CD1 1 
ATOM   8350 C CD2 . LEU B 1 536 ? 23.279  4.614   -21.639 1.00 71.86  ? 536  LEU B CD2 1 
ATOM   8351 N N   . PRO B 1 537 ? 26.247  8.907   -23.712 1.00 75.60  ? 537  PRO B N   1 
ATOM   8352 C CA  . PRO B 1 537 ? 27.377  9.185   -24.611 1.00 77.59  ? 537  PRO B CA  1 
ATOM   8353 C C   . PRO B 1 537 ? 28.717  9.278   -23.858 1.00 80.93  ? 537  PRO B C   1 
ATOM   8354 O O   . PRO B 1 537 ? 29.719  8.699   -24.305 1.00 82.30  ? 537  PRO B O   1 
ATOM   8355 C CB  . PRO B 1 537 ? 27.004  10.545  -25.227 1.00 76.95  ? 537  PRO B CB  1 
ATOM   8356 C CG  . PRO B 1 537 ? 25.509  10.521  -25.291 1.00 74.42  ? 537  PRO B CG  1 
ATOM   8357 C CD  . PRO B 1 537 ? 25.043  9.683   -24.102 1.00 74.20  ? 537  PRO B CD  1 
ATOM   8358 N N   . LYS B 1 538 ? 28.718  9.968   -22.716 1.00 82.84  ? 538  LYS B N   1 
ATOM   8359 C CA  . LYS B 1 538 ? 29.933  10.165  -21.920 1.00 86.28  ? 538  LYS B CA  1 
ATOM   8360 C C   . LYS B 1 538 ? 30.568  8.865   -21.409 1.00 88.39  ? 538  LYS B C   1 
ATOM   8361 O O   . LYS B 1 538 ? 31.736  8.858   -21.056 1.00 90.63  ? 538  LYS B O   1 
ATOM   8362 C CB  . LYS B 1 538 ? 29.692  11.170  -20.792 1.00 86.57  ? 538  LYS B CB  1 
ATOM   8363 C CG  . LYS B 1 538 ? 29.816  12.631  -21.225 1.00 87.64  ? 538  LYS B CG  1 
ATOM   8364 C CD  . LYS B 1 538 ? 28.853  13.525  -20.434 1.00 89.75  ? 538  LYS B CD  1 
ATOM   8365 C CE  . LYS B 1 538 ? 29.173  15.014  -20.569 1.00 91.34  ? 538  LYS B CE  1 
ATOM   8366 N NZ  . LYS B 1 538 ? 30.230  15.448  -19.597 1.00 94.96  ? 538  LYS B NZ  1 
ATOM   8367 N N   . LEU B 1 539 ? 29.808  7.772   -21.382 1.00 88.81  ? 539  LEU B N   1 
ATOM   8368 C CA  . LEU B 1 539 ? 30.390  6.423   -21.283 1.00 91.34  ? 539  LEU B CA  1 
ATOM   8369 C C   . LEU B 1 539 ? 30.774  5.902   -22.670 1.00 92.42  ? 539  LEU B C   1 
ATOM   8370 O O   . LEU B 1 539 ? 30.064  5.078   -23.276 1.00 91.47  ? 539  LEU B O   1 
ATOM   8371 C CB  . LEU B 1 539 ? 29.423  5.449   -20.615 1.00 90.52  ? 539  LEU B CB  1 
ATOM   8372 C CG  . LEU B 1 539 ? 29.611  5.131   -19.142 1.00 91.49  ? 539  LEU B CG  1 
ATOM   8373 C CD1 . LEU B 1 539 ? 30.170  6.322   -18.391 1.00 92.81  ? 539  LEU B CD1 1 
ATOM   8374 C CD2 . LEU B 1 539 ? 28.289  4.701   -18.558 1.00 89.74  ? 539  LEU B CD2 1 
ATOM   8375 N N   . LEU B 1 540 ? 31.899  6.414   -23.168 1.00 95.08  ? 540  LEU B N   1 
ATOM   8376 C CA  . LEU B 1 540 ? 32.450  6.054   -24.483 1.00 96.13  ? 540  LEU B CA  1 
ATOM   8377 C C   . LEU B 1 540 ? 33.493  4.923   -24.346 1.00 98.53  ? 540  LEU B C   1 
ATOM   8378 O O   . LEU B 1 540 ? 33.286  3.814   -24.860 1.00 98.40  ? 540  LEU B O   1 
ATOM   8379 C CB  . LEU B 1 540 ? 33.037  7.301   -25.192 1.00 96.60  ? 540  LEU B CB  1 
ATOM   8380 C CG  . LEU B 1 540 ? 33.545  8.518   -24.372 1.00 98.59  ? 540  LEU B CG  1 
ATOM   8381 C CD1 . LEU B 1 540 ? 35.000  8.368   -23.836 1.00 101.40 ? 540  LEU B CD1 1 
ATOM   8382 C CD2 . LEU B 1 540 ? 33.379  9.842   -25.148 1.00 97.60  ? 540  LEU B CD2 1 
ATOM   8383 N N   . SER B 1 541 ? 34.550  5.068   -23.708 1.00 100.72 ? 541  SER B N   1 
HETATM 8384 C C1  . NAG C 2 .   ? 12.194  35.030  26.541  1.00 148.55 ? 1542 NAG A C1  1 
HETATM 8385 C C2  . NAG C 2 .   ? 13.337  35.762  25.835  1.00 148.69 ? 1542 NAG A C2  1 
HETATM 8386 C C3  . NAG C 2 .   ? 13.544  37.103  26.554  1.00 148.71 ? 1542 NAG A C3  1 
HETATM 8387 C C4  . NAG C 2 .   ? 12.240  37.907  26.584  1.00 148.75 ? 1542 NAG A C4  1 
HETATM 8388 C C5  . NAG C 2 .   ? 11.074  37.052  27.114  1.00 148.73 ? 1542 NAG A C5  1 
HETATM 8389 C C6  . NAG C 2 .   ? 9.729   37.775  27.002  1.00 148.56 ? 1542 NAG A C6  1 
HETATM 8390 C C7  . NAG C 2 .   ? 14.875  34.079  24.822  1.00 148.01 ? 1542 NAG A C7  1 
HETATM 8391 C C8  . NAG C 2 .   ? 16.181  33.355  24.982  1.00 147.53 ? 1542 NAG A C8  1 
HETATM 8392 N N2  . NAG C 2 .   ? 14.554  34.951  25.792  1.00 148.51 ? 1542 NAG A N2  1 
HETATM 8393 O O3  . NAG C 2 .   ? 14.555  37.871  25.943  1.00 148.63 ? 1542 NAG A O3  1 
HETATM 8394 O O4  . NAG C 2 .   ? 12.424  39.063  27.376  1.00 148.39 ? 1542 NAG A O4  1 
HETATM 8395 O O5  . NAG C 2 .   ? 11.007  35.799  26.439  1.00 148.39 ? 1542 NAG A O5  1 
HETATM 8396 O O6  . NAG C 2 .   ? 9.190   37.628  25.704  1.00 148.35 ? 1542 NAG A O6  1 
HETATM 8397 O O7  . NAG C 2 .   ? 14.176  33.845  23.834  1.00 147.62 ? 1542 NAG A O7  1 
HETATM 8398 O O1  . P6G D 3 .   ? 17.032  10.813  -11.821 1.00 71.24  ? 1543 P6G A O1  1 
HETATM 8399 C C2  . P6G D 3 .   ? 18.210  10.334  -12.779 1.00 72.55  ? 1543 P6G A C2  1 
HETATM 8400 C C3  . P6G D 3 .   ? 18.497  11.222  -13.843 1.00 72.66  ? 1543 P6G A C3  1 
HETATM 8401 O O4  . P6G D 3 .   ? 19.555  10.636  -14.623 1.00 73.46  ? 1543 P6G A O4  1 
HETATM 8402 C C5  . P6G D 3 .   ? 20.760  11.545  -15.049 1.00 72.63  ? 1543 P6G A C5  1 
HETATM 8403 C C6  . P6G D 3 .   ? 22.027  10.841  -15.169 1.00 72.51  ? 1543 P6G A C6  1 
HETATM 8404 O O7  . P6G D 3 .   ? 22.184  9.732   -14.226 1.00 72.66  ? 1543 P6G A O7  1 
HETATM 8405 C C8  . P6G D 3 .   ? 23.663  9.209   -13.996 1.00 70.92  ? 1543 P6G A C8  1 
HETATM 8406 C C9  . P6G D 3 .   ? 23.991  7.805   -14.185 1.00 70.14  ? 1543 P6G A C9  1 
HETATM 8407 O O10 . P6G D 3 .   ? 23.357  7.003   -13.190 1.00 70.86  ? 1543 P6G A O10 1 
HETATM 8408 C C11 . P6G D 3 .   ? 23.417  5.404   -13.345 1.00 72.89  ? 1543 P6G A C11 1 
HETATM 8409 C C12 . P6G D 3 .   ? 22.570  4.606   -12.336 1.00 74.46  ? 1543 P6G A C12 1 
HETATM 8410 O O13 . P6G D 3 .   ? 21.497  5.446   -11.883 1.00 77.55  ? 1543 P6G A O13 1 
HETATM 8411 C C14 . P6G D 3 .   ? 21.135  5.201   -10.411 1.00 79.92  ? 1543 P6G A C14 1 
HETATM 8412 C C15 . P6G D 3 .   ? 19.753  5.118   -10.027 1.00 81.81  ? 1543 P6G A C15 1 
HETATM 8413 O O16 . P6G D 3 .   ? 19.088  6.348   -10.384 1.00 83.05  ? 1543 P6G A O16 1 
HETATM 8414 C C17 . P6G D 3 .   ? 17.637  6.103   -10.929 1.00 85.03  ? 1543 P6G A C17 1 
HETATM 8415 C C18 . P6G D 3 .   ? 16.778  7.376   -11.152 1.00 87.06  ? 1543 P6G A C18 1 
HETATM 8416 O O19 . P6G D 3 .   ? 15.763  7.691   -12.131 1.00 88.53  ? 1543 P6G A O19 1 
HETATM 8417 N N2  . TZ5 E 4 .   ? 39.000  20.531  10.730  1.00 64.66  ? 1544 TZ5 A N2  1 
HETATM 8418 C C8  . TZ5 E 4 .   ? 39.065  21.898  10.577  1.00 64.68  ? 1544 TZ5 A C8  1 
HETATM 8419 C C7  . TZ5 E 4 .   ? 40.182  22.655  11.032  1.00 63.35  ? 1544 TZ5 A C7  1 
HETATM 8420 C C6  . TZ5 E 4 .   ? 40.192  24.017  10.831  1.00 64.28  ? 1544 TZ5 A C6  1 
HETATM 8421 C C5  . TZ5 E 4 .   ? 39.122  24.737  10.150  1.00 67.37  ? 1544 TZ5 A C5  1 
HETATM 8422 C C19 . TZ5 E 4 .   ? 38.004  22.564  9.944   1.00 66.29  ? 1544 TZ5 A C19 1 
HETATM 8423 C C18 . TZ5 E 4 .   ? 37.944  23.985  9.732   1.00 66.54  ? 1544 TZ5 A C18 1 
HETATM 8424 N N3  . TZ5 E 4 .   ? 36.993  24.613  8.852   1.00 64.85  ? 1544 TZ5 A N3  1 
HETATM 8425 C C11 . TZ5 E 4 .   ? 37.179  25.866  8.330   1.00 68.37  ? 1544 TZ5 A C11 1 
HETATM 8426 C C12 . TZ5 E 4 .   ? 36.241  26.592  7.383   1.00 69.27  ? 1544 TZ5 A C12 1 
HETATM 8427 C C13 . TZ5 E 4 .   ? 35.417  27.609  7.913   1.00 68.44  ? 1544 TZ5 A C13 1 
HETATM 8428 C C14 . TZ5 E 4 .   ? 34.583  28.327  7.055   1.00 68.39  ? 1544 TZ5 A C14 1 
HETATM 8429 C C15 . TZ5 E 4 .   ? 34.585  28.035  5.683   1.00 69.04  ? 1544 TZ5 A C15 1 
HETATM 8430 C C16 . TZ5 E 4 .   ? 35.409  27.039  5.138   1.00 68.76  ? 1544 TZ5 A C16 1 
HETATM 8431 C C17 . TZ5 E 4 .   ? 36.246  26.323  5.991   1.00 69.42  ? 1544 TZ5 A C17 1 
HETATM 8432 C C10 . TZ5 E 4 .   ? 38.362  26.617  8.670   1.00 69.13  ? 1544 TZ5 A C10 1 
HETATM 8433 C C9  . TZ5 E 4 .   ? 38.628  27.892  8.024   1.00 70.37  ? 1544 TZ5 A C9  1 
HETATM 8434 C C4  . TZ5 E 4 .   ? 39.341  26.081  9.581   1.00 68.93  ? 1544 TZ5 A C4  1 
HETATM 8435 C C3  . TZ5 E 4 .   ? 40.514  26.907  9.801   1.00 70.11  ? 1544 TZ5 A C3  1 
HETATM 8436 C C2  . TZ5 E 4 .   ? 40.736  28.132  9.183   1.00 71.46  ? 1544 TZ5 A C2  1 
HETATM 8437 C C1  . TZ5 E 4 .   ? 39.761  28.654  8.260   1.00 72.28  ? 1544 TZ5 A C1  1 
HETATM 8438 N N1  . TZ5 E 4 .   ? 39.922  29.875  7.613   1.00 70.89  ? 1544 TZ5 A N1  1 
HETATM 8439 C C20 . TZ5 E 4 .   ? 35.743  23.919  8.401   1.00 62.08  ? 1544 TZ5 A C20 1 
HETATM 8440 C C21 . TZ5 E 4 .   ? 35.152  22.692  9.115   1.00 59.84  ? 1544 TZ5 A C21 1 
HETATM 8441 C C22 . TZ5 E 4 .   ? 33.714  22.309  8.698   1.00 56.57  ? 1544 TZ5 A C22 1 
HETATM 8442 C C23 . TZ5 E 4 .   ? 32.621  22.881  9.610   1.00 53.16  ? 1544 TZ5 A C23 1 
HETATM 8443 C C24 . TZ5 E 4 .   ? 31.247  22.315  9.230   1.00 52.23  ? 1544 TZ5 A C24 1 
HETATM 8444 C C25 . TZ5 E 4 .   ? 30.195  22.311  10.352  1.00 49.99  ? 1544 TZ5 A C25 1 
HETATM 8445 C C26 . TZ5 E 4 .   ? 30.351  21.158  11.316  1.00 48.44  ? 1544 TZ5 A C26 1 
HETATM 8446 N N4  . TZ5 E 4 .   ? 30.863  21.073  12.567  1.00 45.61  ? 1544 TZ5 A N4  1 
HETATM 8447 N N5  . TZ5 E 4 .   ? 30.817  19.821  13.035  1.00 44.97  ? 1544 TZ5 A N5  1 
HETATM 8448 N N6  . TZ5 E 4 .   ? 30.277  19.029  12.142  1.00 45.38  ? 1544 TZ5 A N6  1 
HETATM 8449 C C27 . TZ5 E 4 .   ? 29.983  19.824  11.105  1.00 46.81  ? 1544 TZ5 A C27 1 
HETATM 8450 C C28 . TZ5 E 4 .   ? 31.406  22.252  13.231  1.00 42.01  ? 1544 TZ5 A C28 1 
HETATM 8451 C C29 . TZ5 E 4 .   ? 30.331  23.188  13.764  1.00 40.80  ? 1544 TZ5 A C29 1 
HETATM 8452 N N7  . TZ5 E 4 .   ? 29.449  22.552  14.752  1.00 41.09  ? 1544 TZ5 A N7  1 
HETATM 8453 C C30 . TZ5 E 4 .   ? 28.204  22.103  14.309  1.00 41.59  ? 1544 TZ5 A C30 1 
HETATM 8454 C C31 . TZ5 E 4 .   ? 27.293  22.818  13.441  1.00 41.03  ? 1544 TZ5 A C31 1 
HETATM 8455 C C32 . TZ5 E 4 .   ? 27.461  24.189  12.981  1.00 39.56  ? 1544 TZ5 A C32 1 
HETATM 8456 C C33 . TZ5 E 4 .   ? 26.091  22.170  13.043  1.00 38.97  ? 1544 TZ5 A C33 1 
HETATM 8457 C C34 . TZ5 E 4 .   ? 25.159  22.848  12.194  1.00 38.33  ? 1544 TZ5 A C34 1 
HETATM 8458 C C35 . TZ5 E 4 .   ? 25.377  24.142  11.789  1.00 38.19  ? 1544 TZ5 A C35 1 
HETATM 8459 C C36 . TZ5 E 4 .   ? 26.555  24.828  12.178  1.00 38.87  ? 1544 TZ5 A C36 1 
HETATM 8460 N N8  . TZ5 E 4 .   ? 25.769  20.939  13.493  1.00 40.11  ? 1544 TZ5 A N8  1 
HETATM 8461 C C37 . TZ5 E 4 .   ? 26.618  20.236  14.303  1.00 40.50  ? 1544 TZ5 A C37 1 
HETATM 8462 C C38 . TZ5 E 4 .   ? 26.219  18.901  14.751  1.00 38.74  ? 1544 TZ5 A C38 1 
HETATM 8463 C C39 . TZ5 E 4 .   ? 27.843  20.802  14.784  1.00 40.55  ? 1544 TZ5 A C39 1 
HETATM 8464 C C40 . TZ5 E 4 .   ? 28.578  20.037  15.800  1.00 41.15  ? 1544 TZ5 A C40 1 
HETATM 8465 C C41 . TZ5 E 4 .   ? 28.132  18.779  16.213  1.00 39.39  ? 1544 TZ5 A C41 1 
HETATM 8466 C C42 . TZ5 E 4 .   ? 27.113  18.126  15.443  1.00 37.33  ? 1544 TZ5 A C42 1 
HETATM 8467 N N2  . TZ5 F 4 .   ? 16.122  -7.701  -40.403 1.00 83.49  ? 1541 TZ5 B N2  1 
HETATM 8468 C C8  . TZ5 F 4 .   ? 15.636  -8.980  -40.192 1.00 83.76  ? 1541 TZ5 B C8  1 
HETATM 8469 C C7  . TZ5 F 4 .   ? 15.847  -10.020 -41.148 1.00 83.27  ? 1541 TZ5 B C7  1 
HETATM 8470 C C6  . TZ5 F 4 .   ? 15.347  -11.282 -40.900 1.00 82.62  ? 1541 TZ5 B C6  1 
HETATM 8471 C C5  . TZ5 F 4 .   ? 14.639  -11.627 -39.686 1.00 83.36  ? 1541 TZ5 B C5  1 
HETATM 8472 C C19 . TZ5 F 4 .   ? 14.916  -9.280  -39.020 1.00 83.78  ? 1541 TZ5 B C19 1 
HETATM 8473 C C18 . TZ5 F 4 .   ? 14.373  -10.573 -38.732 1.00 83.07  ? 1541 TZ5 B C18 1 
HETATM 8474 N N3  . TZ5 F 4 .   ? 13.978  -10.950 -37.408 1.00 82.52  ? 1541 TZ5 B N3  1 
HETATM 8475 C C11 . TZ5 F 4 .   ? 13.899  -12.255 -36.947 1.00 83.35  ? 1541 TZ5 B C11 1 
HETATM 8476 C C12 . TZ5 F 4 .   ? 13.503  -12.682 -35.536 1.00 82.36  ? 1541 TZ5 B C12 1 
HETATM 8477 C C13 . TZ5 F 4 .   ? 12.214  -13.214 -35.304 1.00 81.30  ? 1541 TZ5 B C13 1 
HETATM 8478 C C14 . TZ5 F 4 .   ? 11.843  -13.641 -34.023 1.00 80.94  ? 1541 TZ5 B C14 1 
HETATM 8479 C C15 . TZ5 F 4 .   ? 12.756  -13.550 -32.964 1.00 81.36  ? 1541 TZ5 B C15 1 
HETATM 8480 C C16 . TZ5 F 4 .   ? 14.043  -13.034 -33.181 1.00 82.07  ? 1541 TZ5 B C16 1 
HETATM 8481 C C17 . TZ5 F 4 .   ? 14.417  -12.601 -34.462 1.00 82.21  ? 1541 TZ5 B C17 1 
HETATM 8482 C C10 . TZ5 F 4 .   ? 14.195  -13.316 -37.869 1.00 84.00  ? 1541 TZ5 B C10 1 
HETATM 8483 C C9  . TZ5 F 4 .   ? 14.273  -14.690 -37.406 1.00 85.18  ? 1541 TZ5 B C9  1 
HETATM 8484 C C4  . TZ5 F 4 .   ? 14.590  -13.018 -39.226 1.00 83.96  ? 1541 TZ5 B C4  1 
HETATM 8485 C C3  . TZ5 F 4 .   ? 15.069  -14.146 -39.999 1.00 85.18  ? 1541 TZ5 B C3  1 
HETATM 8486 C C2  . TZ5 F 4 .   ? 15.134  -15.455 -39.534 1.00 85.37  ? 1541 TZ5 B C2  1 
HETATM 8487 C C1  . TZ5 F 4 .   ? 14.723  -15.743 -38.192 1.00 85.88  ? 1541 TZ5 B C1  1 
HETATM 8488 N N1  . TZ5 F 4 .   ? 14.767  -17.025 -37.667 1.00 85.16  ? 1541 TZ5 B N1  1 
HETATM 8489 C C20 . TZ5 F 4 .   ? 13.679  -9.865  -36.424 1.00 79.29  ? 1541 TZ5 B C20 1 
HETATM 8490 C C21 . TZ5 F 4 .   ? 12.387  -9.067  -36.555 1.00 77.12  ? 1541 TZ5 B C21 1 
HETATM 8491 C C22 . TZ5 F 4 .   ? 12.615  -7.609  -36.102 1.00 73.72  ? 1541 TZ5 B C22 1 
HETATM 8492 C C23 . TZ5 F 4 .   ? 11.387  -6.689  -36.141 1.00 69.80  ? 1541 TZ5 B C23 1 
HETATM 8493 C C24 . TZ5 F 4 .   ? 10.504  -6.717  -34.873 1.00 67.38  ? 1541 TZ5 B C24 1 
HETATM 8494 C C25 . TZ5 F 4 .   ? 9.248   -5.814  -34.915 1.00 65.14  ? 1541 TZ5 B C25 1 
HETATM 8495 C C26 . TZ5 F 4 .   ? 9.190   -4.816  -36.054 1.00 63.80  ? 1541 TZ5 B C26 1 
HETATM 8496 N N4  . TZ5 F 4 .   ? 8.882   -4.900  -37.381 1.00 61.36  ? 1541 TZ5 B N4  1 
HETATM 8497 N N5  . TZ5 F 4 .   ? 8.996   -3.732  -37.986 1.00 62.13  ? 1541 TZ5 B N5  1 
HETATM 8498 N N6  . TZ5 F 4 .   ? 9.365   -2.809  -37.137 1.00 64.25  ? 1541 TZ5 B N6  1 
HETATM 8499 C C27 . TZ5 F 4 .   ? 9.494   -3.461  -35.977 1.00 63.82  ? 1541 TZ5 B C27 1 
HETATM 8500 C C28 . TZ5 F 4 .   ? 8.476   -6.154  -38.017 1.00 57.65  ? 1541 TZ5 B C28 1 
HETATM 8501 C C29 . TZ5 F 4 .   ? 7.051   -6.519  -37.621 1.00 53.73  ? 1541 TZ5 B C29 1 
HETATM 8502 N N7  . TZ5 F 4 .   ? 6.175   -5.448  -38.111 1.00 52.33  ? 1541 TZ5 B N7  1 
HETATM 8503 C C30 . TZ5 F 4 .   ? 5.611   -4.579  -37.179 1.00 51.12  ? 1541 TZ5 B C30 1 
HETATM 8504 C C31 . TZ5 F 4 .   ? 5.078   -4.978  -35.909 1.00 50.14  ? 1541 TZ5 B C31 1 
HETATM 8505 C C32 . TZ5 F 4 .   ? 4.982   -6.343  -35.423 1.00 49.21  ? 1541 TZ5 B C32 1 
HETATM 8506 C C33 . TZ5 F 4 .   ? 4.570   -3.965  -35.057 1.00 48.63  ? 1541 TZ5 B C33 1 
HETATM 8507 C C34 . TZ5 F 4 .   ? 4.006   -4.312  -33.771 1.00 48.80  ? 1541 TZ5 B C34 1 
HETATM 8508 C C35 . TZ5 F 4 .   ? 3.951   -5.622  -33.354 1.00 50.49  ? 1541 TZ5 B C35 1 
HETATM 8509 C C36 . TZ5 F 4 .   ? 4.456   -6.666  -34.198 1.00 49.06  ? 1541 TZ5 B C36 1 
HETATM 8510 N N8  . TZ5 F 4 .   ? 4.569   -2.664  -35.425 1.00 49.31  ? 1541 TZ5 B N8  1 
HETATM 8511 C C37 . TZ5 F 4 .   ? 5.070   -2.253  -36.604 1.00 48.78  ? 1541 TZ5 B C37 1 
HETATM 8512 C C38 . TZ5 F 4 .   ? 4.938   -0.843  -36.954 1.00 48.16  ? 1541 TZ5 B C38 1 
HETATM 8513 C C39 . TZ5 F 4 .   ? 5.585   -3.191  -37.550 1.00 49.05  ? 1541 TZ5 B C39 1 
HETATM 8514 C C40 . TZ5 F 4 .   ? 5.862   -2.655  -38.877 1.00 46.98  ? 1541 TZ5 B C40 1 
HETATM 8515 C C41 . TZ5 F 4 .   ? 5.700   -1.307  -39.158 1.00 46.84  ? 1541 TZ5 B C41 1 
HETATM 8516 C C42 . TZ5 F 4 .   ? 5.604   -0.377  -38.063 1.00 45.94  ? 1541 TZ5 B C42 1 
HETATM 8517 O O   . HOH G 5 .   ? 29.453  10.932  54.652  1.00 26.00  ? 2001 HOH A O   1 
HETATM 8518 O O   . HOH G 5 .   ? 26.480  19.953  46.157  1.00 23.98  ? 2002 HOH A O   1 
HETATM 8519 O O   . HOH G 5 .   ? 40.671  15.517  44.665  1.00 26.75  ? 2003 HOH A O   1 
HETATM 8520 O O   . HOH G 5 .   ? 19.630  24.315  38.652  1.00 27.49  ? 2004 HOH A O   1 
HETATM 8521 O O   . HOH G 5 .   ? 13.753  23.964  35.119  1.00 39.74  ? 2005 HOH A O   1 
HETATM 8522 O O   . HOH G 5 .   ? 8.792   21.560  41.029  1.00 52.08  ? 2006 HOH A O   1 
HETATM 8523 O O   . HOH G 5 .   ? 11.540  17.779  34.155  1.00 25.28  ? 2007 HOH A O   1 
HETATM 8524 O O   . HOH G 5 .   ? 41.156  13.430  33.628  1.00 31.36  ? 2008 HOH A O   1 
HETATM 8525 O O   . HOH G 5 .   ? 56.661  15.809  25.857  1.00 15.39  ? 2009 HOH A O   1 
HETATM 8526 O O   . HOH G 5 .   ? 45.004  3.276   38.255  1.00 39.93  ? 2010 HOH A O   1 
HETATM 8527 O O   . HOH G 5 .   ? 47.045  3.075   40.280  1.00 20.65  ? 2011 HOH A O   1 
HETATM 8528 O O   . HOH G 5 .   ? 44.485  12.580  45.089  1.00 22.57  ? 2012 HOH A O   1 
HETATM 8529 O O   . HOH G 5 .   ? 39.813  16.293  46.727  1.00 28.21  ? 2013 HOH A O   1 
HETATM 8530 O O   . HOH G 5 .   ? 38.318  3.760   38.151  1.00 23.99  ? 2014 HOH A O   1 
HETATM 8531 O O   . HOH G 5 .   ? 42.878  17.747  23.714  1.00 28.15  ? 2015 HOH A O   1 
HETATM 8532 O O   . HOH G 5 .   ? 40.339  27.727  17.331  1.00 33.79  ? 2016 HOH A O   1 
HETATM 8533 O O   . HOH G 5 .   ? 33.141  31.644  20.360  1.00 35.12  ? 2017 HOH A O   1 
HETATM 8534 O O   . HOH G 5 .   ? 39.720  9.409   2.681   1.00 18.68  ? 2018 HOH A O   1 
HETATM 8535 O O   . HOH G 5 .   ? 30.181  20.915  19.070  1.00 17.00  ? 2019 HOH A O   1 
HETATM 8536 O O   . HOH G 5 .   ? 32.312  24.328  16.614  1.00 26.57  ? 2020 HOH A O   1 
HETATM 8537 O O   . HOH G 5 .   ? 39.580  25.440  34.882  1.00 24.34  ? 2021 HOH A O   1 
HETATM 8538 O O   . HOH G 5 .   ? 46.831  15.093  24.169  1.00 33.37  ? 2022 HOH A O   1 
HETATM 8539 O O   . HOH G 5 .   ? 48.683  21.595  25.969  1.00 22.43  ? 2023 HOH A O   1 
HETATM 8540 O O   . HOH G 5 .   ? 42.092  14.690  31.554  1.00 32.40  ? 2024 HOH A O   1 
HETATM 8541 O O   . HOH G 5 .   ? 40.318  15.698  39.322  1.00 24.11  ? 2025 HOH A O   1 
HETATM 8542 O O   . HOH G 5 .   ? 29.787  12.872  24.486  1.00 20.45  ? 2026 HOH A O   1 
HETATM 8543 O O   . HOH G 5 .   ? 34.411  24.427  14.945  1.00 25.47  ? 2027 HOH A O   1 
HETATM 8544 O O   . HOH G 5 .   ? 33.565  15.196  17.075  1.00 24.95  ? 2028 HOH A O   1 
HETATM 8545 O O   . HOH G 5 .   ? 31.497  22.032  16.644  1.00 25.24  ? 2029 HOH A O   1 
HETATM 8546 O O   . HOH G 5 .   ? 30.857  36.708  -2.256  1.00 33.39  ? 2030 HOH A O   1 
HETATM 8547 O O   . HOH G 5 .   ? 28.151  37.388  1.392   1.00 50.14  ? 2031 HOH A O   1 
HETATM 8548 O O   . HOH G 5 .   ? 35.780  18.209  24.192  1.00 24.85  ? 2032 HOH A O   1 
HETATM 8549 O O   . HOH G 5 .   ? 26.272  25.287  25.334  1.00 40.66  ? 2033 HOH A O   1 
HETATM 8550 O O   . HOH G 5 .   ? 24.079  23.929  23.020  1.00 37.63  ? 2034 HOH A O   1 
HETATM 8551 O O   . HOH G 5 .   ? 26.382  15.881  18.486  1.00 28.19  ? 2035 HOH A O   1 
HETATM 8552 O O   . HOH G 5 .   ? 29.440  18.443  19.924  1.00 30.11  ? 2036 HOH A O   1 
HETATM 8553 O O   . HOH G 5 .   ? 14.508  4.999   36.970  1.00 24.17  ? 2037 HOH A O   1 
HETATM 8554 O O   . HOH G 5 .   ? 33.249  19.570  29.044  1.00 32.73  ? 2038 HOH A O   1 
HETATM 8555 O O   . HOH G 5 .   ? 41.488  17.261  21.509  1.00 19.87  ? 2039 HOH A O   1 
HETATM 8556 O O   . HOH G 5 .   ? 44.039  19.529  16.183  1.00 33.47  ? 2040 HOH A O   1 
HETATM 8557 O O   . HOH G 5 .   ? 47.719  8.155   17.915  1.00 17.82  ? 2041 HOH A O   1 
HETATM 8558 O O   . HOH G 5 .   ? 40.497  2.138   25.958  1.00 33.71  ? 2042 HOH A O   1 
HETATM 8559 O O   . HOH G 5 .   ? 40.820  -1.033  24.062  1.00 33.01  ? 2043 HOH A O   1 
HETATM 8560 O O   . HOH G 5 .   ? 37.086  6.072   38.634  1.00 32.69  ? 2044 HOH A O   1 
HETATM 8561 O O   . HOH G 5 .   ? 36.654  2.425   36.719  1.00 26.74  ? 2045 HOH A O   1 
HETATM 8562 O O   . HOH G 5 .   ? 30.099  16.554  13.107  1.00 22.75  ? 2046 HOH A O   1 
HETATM 8563 O O   . HOH G 5 .   ? 38.195  -4.939  16.815  1.00 22.66  ? 2047 HOH A O   1 
HETATM 8564 O O   . HOH G 5 .   ? 29.090  0.272   29.511  1.00 21.16  ? 2048 HOH A O   1 
HETATM 8565 O O   . HOH G 5 .   ? 26.908  -6.489  25.312  1.00 25.94  ? 2049 HOH A O   1 
HETATM 8566 O O   . HOH G 5 .   ? 27.522  8.974   7.775   1.00 24.24  ? 2050 HOH A O   1 
HETATM 8567 O O   . HOH G 5 .   ? 31.121  8.564   6.789   1.00 17.21  ? 2051 HOH A O   1 
HETATM 8568 O O   . HOH G 5 .   ? 36.827  6.200   2.784   1.00 57.44  ? 2052 HOH A O   1 
HETATM 8569 O O   . HOH G 5 .   ? 37.786  10.172  4.389   1.00 15.63  ? 2053 HOH A O   1 
HETATM 8570 O O   . HOH G 5 .   ? 41.268  7.503   2.734   1.00 17.41  ? 2054 HOH A O   1 
HETATM 8571 O O   . HOH G 5 .   ? 43.376  6.557   0.444   1.00 32.20  ? 2055 HOH A O   1 
HETATM 8572 O O   . HOH G 5 .   ? 46.540  2.527   3.300   1.00 28.12  ? 2056 HOH A O   1 
HETATM 8573 O O   . HOH G 5 .   ? 51.063  3.639   7.531   1.00 25.96  ? 2057 HOH A O   1 
HETATM 8574 O O   . HOH G 5 .   ? 64.531  6.005   16.723  1.00 40.80  ? 2058 HOH A O   1 
HETATM 8575 O O   . HOH G 5 .   ? 54.217  21.176  25.344  1.00 45.22  ? 2059 HOH A O   1 
HETATM 8576 O O   . HOH G 5 .   ? 41.457  27.429  19.850  1.00 27.56  ? 2060 HOH A O   1 
HETATM 8577 O O   . HOH G 5 .   ? 48.551  25.950  23.033  1.00 54.87  ? 2061 HOH A O   1 
HETATM 8578 O O   . HOH G 5 .   ? 40.879  17.386  12.622  1.00 45.62  ? 2062 HOH A O   1 
HETATM 8579 O O   . HOH G 5 .   ? 36.831  13.412  6.898   1.00 27.55  ? 2063 HOH A O   1 
HETATM 8580 O O   . HOH G 5 .   ? 12.006  23.050  6.853   1.00 31.48  ? 2064 HOH A O   1 
HETATM 8581 O O   . HOH G 5 .   ? 14.278  21.957  0.647   1.00 47.31  ? 2065 HOH A O   1 
HETATM 8582 O O   . HOH G 5 .   ? 26.175  35.096  -1.406  1.00 43.10  ? 2066 HOH A O   1 
HETATM 8583 O O   . HOH G 5 .   ? 30.820  33.216  -1.126  1.00 31.94  ? 2067 HOH A O   1 
HETATM 8584 O O   . HOH G 5 .   ? 15.508  31.494  3.229   1.00 19.00  ? 2068 HOH A O   1 
HETATM 8585 O O   . HOH G 5 .   ? 25.997  29.312  -14.947 1.00 13.78  ? 2069 HOH A O   1 
HETATM 8586 O O   . HOH G 5 .   ? 31.565  25.878  -12.675 1.00 27.46  ? 2070 HOH A O   1 
HETATM 8587 O O   . HOH G 5 .   ? 30.782  16.699  0.953   1.00 29.49  ? 2071 HOH A O   1 
HETATM 8588 O O   . HOH G 5 .   ? 15.419  16.407  -9.405  1.00 52.07  ? 2072 HOH A O   1 
HETATM 8589 O O   . HOH G 5 .   ? 16.793  17.628  -4.881  1.00 31.51  ? 2073 HOH A O   1 
HETATM 8590 O O   . HOH G 5 .   ? 26.213  -9.235  0.301   1.00 25.14  ? 2074 HOH A O   1 
HETATM 8591 O O   . HOH G 5 .   ? 19.144  12.382  13.520  1.00 24.84  ? 2075 HOH A O   1 
HETATM 8592 O O   . HOH G 5 .   ? 7.186   17.367  7.349   1.00 32.43  ? 2076 HOH A O   1 
HETATM 8593 O O   . HOH G 5 .   ? 14.767  21.524  14.352  1.00 23.03  ? 2077 HOH A O   1 
HETATM 8594 O O   . HOH G 5 .   ? 6.492   19.940  12.092  1.00 27.46  ? 2078 HOH A O   1 
HETATM 8595 O O   . HOH G 5 .   ? 20.535  28.253  16.808  1.00 41.32  ? 2079 HOH A O   1 
HETATM 8596 O O   . HOH G 5 .   ? 15.022  32.859  6.416   1.00 30.82  ? 2080 HOH A O   1 
HETATM 8597 O O   . HOH G 5 .   ? 11.569  26.511  1.665   1.00 46.83  ? 2081 HOH A O   1 
HETATM 8598 O O   . HOH G 5 .   ? 13.528  24.162  1.688   1.00 43.58  ? 2082 HOH A O   1 
HETATM 8599 O O   . HOH G 5 .   ? 21.369  15.909  13.070  1.00 29.81  ? 2083 HOH A O   1 
HETATM 8600 O O   . HOH G 5 .   ? 17.708  26.225  18.045  1.00 35.59  ? 2084 HOH A O   1 
HETATM 8601 O O   . HOH G 5 .   ? 19.652  20.561  18.639  1.00 20.79  ? 2085 HOH A O   1 
HETATM 8602 O O   . HOH G 5 .   ? 17.925  15.495  28.915  1.00 29.79  ? 2086 HOH A O   1 
HETATM 8603 O O   . HOH G 5 .   ? 16.365  23.490  33.183  1.00 39.24  ? 2087 HOH A O   1 
HETATM 8604 O O   . HOH G 5 .   ? 10.599  26.102  26.088  1.00 26.41  ? 2088 HOH A O   1 
HETATM 8605 O O   . HOH G 5 .   ? 10.424  -2.445  6.794   1.00 28.86  ? 2089 HOH A O   1 
HETATM 8606 O O   . HOH G 5 .   ? 10.098  7.124   1.023   1.00 14.18  ? 2090 HOH A O   1 
HETATM 8607 O O   . HOH G 5 .   ? 12.690  12.570  2.258   1.00 29.86  ? 2091 HOH A O   1 
HETATM 8608 O O   . HOH G 5 .   ? 15.147  8.697   -4.404  1.00 26.47  ? 2092 HOH A O   1 
HETATM 8609 O O   . HOH H 5 .   ? 0.191   16.174  -68.292 1.00 18.49  ? 2001 HOH B O   1 
HETATM 8610 O O   . HOH H 5 .   ? 0.399   16.421  -65.808 1.00 22.98  ? 2002 HOH B O   1 
HETATM 8611 O O   . HOH H 5 .   ? 3.662   10.082  -64.991 1.00 18.52  ? 2003 HOH B O   1 
HETATM 8612 O O   . HOH H 5 .   ? 4.688   7.814   -63.761 1.00 21.08  ? 2004 HOH B O   1 
HETATM 8613 O O   . HOH H 5 .   ? 8.439   0.719   -67.912 1.00 18.78  ? 2005 HOH B O   1 
HETATM 8614 O O   . HOH H 5 .   ? 3.955   0.657   -68.519 1.00 17.88  ? 2006 HOH B O   1 
HETATM 8615 O O   . HOH H 5 .   ? -1.084  6.653   -72.388 1.00 19.53  ? 2007 HOH B O   1 
HETATM 8616 O O   . HOH H 5 .   ? 4.432   4.350   -47.944 1.00 19.49  ? 2008 HOH B O   1 
HETATM 8617 O O   . HOH H 5 .   ? 0.877   -2.349  -19.113 1.00 16.69  ? 2009 HOH B O   1 
HETATM 8618 O O   . HOH H 5 .   ? 8.800   -8.949  -40.832 1.00 27.83  ? 2010 HOH B O   1 
HETATM 8619 O O   . HOH H 5 .   ? -3.354  0.548   -47.878 1.00 27.22  ? 2011 HOH B O   1 
HETATM 8620 O O   . HOH H 5 .   ? -9.630  -2.685  -48.542 1.00 27.57  ? 2012 HOH B O   1 
HETATM 8621 O O   . HOH H 5 .   ? 1.519   0.188   -52.536 1.00 20.50  ? 2013 HOH B O   1 
HETATM 8622 O O   . HOH H 5 .   ? 17.163  -8.263  -48.238 1.00 33.39  ? 2014 HOH B O   1 
HETATM 8623 O O   . HOH H 5 .   ? 1.264   18.569  -59.867 1.00 22.16  ? 2015 HOH B O   1 
HETATM 8624 O O   . HOH H 5 .   ? 20.710  18.988  -44.093 1.00 27.91  ? 2016 HOH B O   1 
HETATM 8625 O O   . HOH H 5 .   ? 5.941   16.692  -53.531 1.00 19.68  ? 2017 HOH B O   1 
HETATM 8626 O O   . HOH H 5 .   ? 13.525  6.673   -33.360 1.00 24.38  ? 2018 HOH B O   1 
HETATM 8627 O O   . HOH H 5 .   ? 19.327  -0.716  -37.170 1.00 26.50  ? 2019 HOH B O   1 
HETATM 8628 O O   . HOH H 5 .   ? 29.639  7.006   -42.458 1.00 24.61  ? 2020 HOH B O   1 
HETATM 8629 O O   . HOH H 5 .   ? 8.919   27.492  -39.229 1.00 25.62  ? 2021 HOH B O   1 
HETATM 8630 O O   . HOH H 5 .   ? -2.344  0.550   -22.080 1.00 19.46  ? 2022 HOH B O   1 
HETATM 8631 O O   . HOH H 5 .   ? 2.840   -0.948  -18.924 1.00 26.95  ? 2023 HOH B O   1 
HETATM 8632 O O   . HOH H 5 .   ? 7.639   -18.243 -20.839 1.00 18.62  ? 2024 HOH B O   1 
HETATM 8633 O O   . HOH H 5 .   ? 24.667  -1.570  -31.338 1.00 29.24  ? 2025 HOH B O   1 
HETATM 8634 O O   . HOH H 5 .   ? -0.058  27.125  -32.105 1.00 15.17  ? 2026 HOH B O   1 
HETATM 8635 O O   . HOH H 5 .   ? -4.793  6.826   -20.075 1.00 51.33  ? 2027 HOH B O   1 
HETATM 8636 O O   . HOH H 5 .   ? -3.810  -6.940  -33.128 1.00 27.79  ? 2028 HOH B O   1 
HETATM 8637 O O   . HOH H 5 .   ? 3.877   4.046   -33.455 1.00 19.42  ? 2029 HOH B O   1 
HETATM 8638 O O   . HOH H 5 .   ? 3.354   7.398   -32.817 1.00 28.16  ? 2030 HOH B O   1 
HETATM 8639 O O   . HOH H 5 .   ? -5.575  -3.650  -34.413 1.00 26.26  ? 2031 HOH B O   1 
HETATM 8640 O O   . HOH H 5 .   ? -18.327 -8.499  -36.200 1.00 24.78  ? 2032 HOH B O   1 
HETATM 8641 O O   . HOH H 5 .   ? -1.477  27.167  -29.921 1.00 18.27  ? 2033 HOH B O   1 
HETATM 8642 O O   . HOH H 5 .   ? 6.664   24.190  -24.900 1.00 21.41  ? 2034 HOH B O   1 
HETATM 8643 O O   . HOH H 5 .   ? 12.797  26.687  -27.946 1.00 13.24  ? 2035 HOH B O   1 
HETATM 8644 O O   . HOH H 5 .   ? 12.640  27.252  -25.528 1.00 25.36  ? 2036 HOH B O   1 
HETATM 8645 O O   . HOH H 5 .   ? 3.865   19.982  -28.192 1.00 15.11  ? 2037 HOH B O   1 
HETATM 8646 O O   . HOH H 5 .   ? -8.137  7.285   -23.093 1.00 31.75  ? 2038 HOH B O   1 
HETATM 8647 O O   . HOH H 5 .   ? -6.969  14.993  -19.301 1.00 17.69  ? 2039 HOH B O   1 
HETATM 8648 O O   . HOH H 5 .   ? 4.108   16.303  -16.569 1.00 25.05  ? 2040 HOH B O   1 
HETATM 8649 O O   . HOH H 5 .   ? 11.455  16.824  -22.921 1.00 14.85  ? 2041 HOH B O   1 
HETATM 8650 O O   . HOH H 5 .   ? 35.091  4.963   -21.314 1.00 23.69  ? 2042 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.1880 1.2285 0.8365 0.1352  -0.0249 0.0203  1   GLU A N   
2    C CA  . GLU A 1   ? 1.1974 1.2332 0.8377 0.1410  -0.0149 0.0094  1   GLU A CA  
3    C C   . GLU A 1   ? 1.1723 1.2115 0.8297 0.1415  0.0003  0.0247  1   GLU A C   
4    O O   . GLU A 1   ? 1.1499 1.1803 0.8320 0.1347  0.0013  0.0336  1   GLU A O   
5    C CB  . GLU A 1   ? 1.1983 1.2126 0.8432 0.1377  -0.0212 -0.0111 1   GLU A CB  
6    C CG  . GLU A 1   ? 1.2401 1.2493 0.8574 0.1461  -0.0211 -0.0309 1   GLU A CG  
7    C CD  . GLU A 1   ? 1.2987 1.3203 0.8841 0.1500  -0.0286 -0.0360 1   GLU A CD  
8    O OE1 . GLU A 1   ? 1.3085 1.3280 0.8902 0.1425  -0.0433 -0.0406 1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.3159 1.3517 0.8799 0.1604  -0.0201 -0.0351 1   GLU A OE2 
10   N N   . GLY A 2   ? 1.1740 1.2267 0.8181 0.1489  0.0120  0.0277  2   GLY A N   
11   C CA  . GLY A 2   ? 1.1829 1.2451 0.7967 0.1587  0.0122  0.0153  2   GLY A CA  
12   C C   . GLY A 2   ? 1.1710 1.2306 0.7837 0.1658  0.0220  0.0040  2   GLY A C   
13   O O   . GLY A 2   ? 1.1706 1.2484 0.7770 0.1726  0.0348  0.0114  2   GLY A O   
14   N N   . ARG A 3   ? 1.1540 1.1921 0.7743 0.1643  0.0161  -0.0125 3   ARG A N   
15   C CA  . ARG A 3   ? 1.1537 1.1853 0.7687 0.1736  0.0228  -0.0270 3   ARG A CA  
16   C C   . ARG A 3   ? 1.1139 1.1356 0.7584 0.1694  0.0280  -0.0244 3   ARG A C   
17   O O   . ARG A 3   ? 1.1171 1.1364 0.7612 0.1779  0.0350  -0.0331 3   ARG A O   
18   C CB  . ARG A 3   ? 1.1832 1.1938 0.7761 0.1771  0.0112  -0.0507 3   ARG A CB  
19   C CG  . ARG A 3   ? 1.2366 1.2563 0.7950 0.1830  0.0060  -0.0577 3   ARG A CG  
20   C CD  . ARG A 3   ? 1.2932 1.3306 0.8295 0.1990  0.0194  -0.0600 3   ARG A CD  
21   N NE  . ARG A 3   ? 1.3462 1.3915 0.8467 0.2053  0.0142  -0.0683 3   ARG A NE  
22   C CZ  . ARG A 3   ? 1.3742 1.4416 0.8517 0.2185  0.0249  -0.0668 3   ARG A CZ  
23   N NH1 . ARG A 3   ? 1.3604 1.4467 0.8483 0.2262  0.0416  -0.0564 3   ARG A NH1 
24   N NH2 . ARG A 3   ? 1.4091 1.4821 0.8529 0.2233  0.0186  -0.0754 3   ARG A NH2 
25   N N   . GLU A 4   ? 1.0705 1.0871 0.7399 0.1573  0.0246  -0.0124 4   GLU A N   
26   C CA  . GLU A 4   ? 1.0306 1.0359 0.7271 0.1518  0.0272  -0.0110 4   GLU A CA  
27   C C   . GLU A 4   ? 0.9960 1.0189 0.7082 0.1509  0.0411  0.0051  4   GLU A C   
28   O O   . GLU A 4   ? 0.9978 1.0396 0.7037 0.1512  0.0477  0.0190  4   GLU A O   
29   C CB  . GLU A 4   ? 1.0182 1.0090 0.7334 0.1394  0.0169  -0.0070 4   GLU A CB  
30   C CG  . GLU A 4   ? 1.0554 1.0325 0.7588 0.1365  0.0021  -0.0199 4   GLU A CG  
31   C CD  . GLU A 4   ? 1.0779 1.0520 0.7984 0.1258  -0.0062 -0.0104 4   GLU A CD  
32   O OE1 . GLU A 4   ? 1.0861 1.0706 0.7970 0.1248  -0.0116 -0.0038 4   GLU A OE1 
33   O OE2 . GLU A 4   ? 1.0683 1.0313 0.8117 0.1193  -0.0066 -0.0087 4   GLU A OE2 
34   N N   . ASP A 5   ? 0.9552 0.9716 0.6877 0.1488  0.0447  0.0037  5   ASP A N   
35   C CA  . ASP A 5   ? 0.9197 0.9518 0.6698 0.1455  0.0563  0.0178  5   ASP A CA  
36   C C   . ASP A 5   ? 0.8982 0.9303 0.6602 0.1331  0.0554  0.0356  5   ASP A C   
37   O O   . ASP A 5   ? 0.8802 0.8948 0.6559 0.1250  0.0478  0.0359  5   ASP A O   
38   C CB  . ASP A 5   ? 0.8960 0.9177 0.6654 0.1446  0.0569  0.0112  5   ASP A CB  
39   C CG  . ASP A 5   ? 0.8734 0.9138 0.6608 0.1412  0.0683  0.0237  5   ASP A CG  
40   O OD1 . ASP A 5   ? 0.8507 0.9040 0.6432 0.1331  0.0734  0.0403  5   ASP A OD1 
41   O OD2 . ASP A 5   ? 0.8541 0.8956 0.6507 0.1463  0.0716  0.0172  5   ASP A OD2 
42   N N   . PRO A 6   ? 0.9004 0.9516 0.6559 0.1322  0.0633  0.0508  6   PRO A N   
43   C CA  . PRO A 6   ? 0.8849 0.9328 0.6484 0.1215  0.0631  0.0686  6   PRO A CA  
44   C C   . PRO A 6   ? 0.8538 0.8900 0.6431 0.1103  0.0643  0.0751  6   PRO A C   
45   O O   . PRO A 6   ? 0.8506 0.8747 0.6467 0.1023  0.0613  0.0856  6   PRO A O   
46   C CB  . PRO A 6   ? 0.8997 0.9716 0.6522 0.1227  0.0739  0.0834  6   PRO A CB  
47   C CG  . PRO A 6   ? 0.9097 1.0010 0.6565 0.1324  0.0821  0.0747  6   PRO A CG  
48   C CD  . PRO A 6   ? 0.9204 0.9969 0.6593 0.1416  0.0734  0.0528  6   PRO A CD  
49   N N   . GLN A 7   ? 0.8320 0.8714 0.6343 0.1104  0.0685  0.0688  7   GLN A N   
50   C CA  . GLN A 7   ? 0.8066 0.8369 0.6320 0.0993  0.0695  0.0746  7   GLN A CA  
51   C C   . GLN A 7   ? 0.7827 0.7880 0.6182 0.0962  0.0590  0.0661  7   GLN A C   
52   O O   . GLN A 7   ? 0.7742 0.7686 0.6265 0.0871  0.0584  0.0708  7   GLN A O   
53   C CB  . GLN A 7   ? 0.8040 0.8504 0.6408 0.1003  0.0776  0.0726  7   GLN A CB  
54   C CG  . GLN A 7   ? 0.8119 0.8598 0.6687 0.0864  0.0822  0.0848  7   GLN A CG  
55   C CD  . GLN A 7   ? 0.8575 0.9162 0.7105 0.0773  0.0890  0.1037  7   GLN A CD  
56   O OE1 . GLN A 7   ? 0.8908 0.9691 0.7295 0.0826  0.0949  0.1091  7   GLN A OE1 
57   N NE2 . GLN A 7   ? 0.8602 0.9046 0.7247 0.0633  0.0883  0.1138  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.7765 0.7736 0.6007 0.1031  0.0505  0.0538  8   LEU A N   
59   C CA  . LEU A 8   ? 0.7496 0.7272 0.5829 0.1004  0.0406  0.0446  8   LEU A CA  
60   C C   . LEU A 8   ? 0.7531 0.7222 0.5827 0.0978  0.0326  0.0494  8   LEU A C   
61   O O   . LEU A 8   ? 0.7489 0.7050 0.5865 0.0950  0.0243  0.0436  8   LEU A O   
62   C CB  . LEU A 8   ? 0.7540 0.7267 0.5789 0.1084  0.0357  0.0268  8   LEU A CB  
63   C CG  . LEU A 8   ? 0.7340 0.7137 0.5625 0.1142  0.0430  0.0206  8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.7276 0.6957 0.5440 0.1228  0.0371  0.0029  8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.6937 0.6698 0.5459 0.1066  0.0457  0.0253  8   LEU A CD2 
66   N N   . LEU A 9   ? 0.7596 0.7376 0.5771 0.0989  0.0352  0.0609  9   LEU A N   
67   C CA  . LEU A 9   ? 0.7564 0.7288 0.5699 0.0983  0.0278  0.0670  9   LEU A CA  
68   C C   . LEU A 9   ? 0.7504 0.7152 0.5739 0.0921  0.0320  0.0832  9   LEU A C   
69   O O   . LEU A 9   ? 0.7629 0.7340 0.5816 0.0902  0.0403  0.0956  9   LEU A O   
70   C CB  . LEU A 9   ? 0.7778 0.7633 0.5683 0.1053  0.0258  0.0681  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.7921 0.7839 0.5671 0.1123  0.0227  0.0514  9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.8058 0.8123 0.5555 0.1191  0.0214  0.0534  9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.7676 0.7456 0.5483 0.1106  0.0117  0.0356  9   LEU A CD2 
74   N N   . VAL A 10  ? 0.7328 0.6831 0.5696 0.0887  0.0265  0.0829  10  VAL A N   
75   C CA  . VAL A 10  ? 0.7271 0.6648 0.5717 0.0839  0.0295  0.0963  10  VAL A CA  
76   C C   . VAL A 10  ? 0.7255 0.6563 0.5708 0.0877  0.0213  0.0989  10  VAL A C   
77   O O   . VAL A 10  ? 0.7167 0.6490 0.5669 0.0893  0.0131  0.0882  10  VAL A O   
78   C CB  . VAL A 10  ? 0.7164 0.6432 0.5790 0.0762  0.0332  0.0938  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.7123 0.6214 0.5802 0.0715  0.0354  0.1060  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.7151 0.6530 0.5785 0.0727  0.0417  0.0933  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.7295 0.6535 0.5692 0.0891  0.0235  0.1139  11  ARG A N   
82   C CA  . ARG A 11  ? 0.7194 0.6364 0.5609 0.0943  0.0173  0.1192  11  ARG A CA  
83   C C   . ARG A 11  ? 0.7132 0.6091 0.5671 0.0904  0.0206  0.1238  11  ARG A C   
84   O O   . ARG A 11  ? 0.7242 0.6070 0.5757 0.0855  0.0280  0.1334  11  ARG A O   
85   C CB  . ARG A 11  ? 0.7381 0.6598 0.5633 0.1010  0.0172  0.1332  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.7350 0.6496 0.5621 0.1084  0.0120  0.1413  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.7290 0.6508 0.5389 0.1170  0.0106  0.1553  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.7071 0.6536 0.5064 0.1208  0.0037  0.1492  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.7165 0.6772 0.5176 0.1261  -0.0067 0.1445  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 0.7000 0.6816 0.4889 0.1279  -0.0132 0.1385  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.7211 0.6767 0.5361 0.1293  -0.0109 0.1455  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.6975 0.5902 0.5639 0.0917  0.0149  0.1164  12  VAL A N   
93   C CA  . VAL A 12  ? 0.7001 0.5737 0.5756 0.0912  0.0167  0.1205  12  VAL A CA  
94   C C   . VAL A 12  ? 0.7205 0.5950 0.5925 0.1020  0.0116  0.1281  12  VAL A C   
95   O O   . VAL A 12  ? 0.7338 0.6250 0.5970 0.1079  0.0067  0.1305  12  VAL A O   
96   C CB  . VAL A 12  ? 0.6695 0.5407 0.5618 0.0864  0.0147  0.1082  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.6509 0.5208 0.5476 0.0770  0.0201  0.1021  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.6629 0.5509 0.5605 0.0896  0.0058  0.0989  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.7248 0.5831 0.6032 0.1052  0.0126  0.1316  13  ARG A N   
100  C CA  . ARG A 13  ? 0.7504 0.6092 0.6259 0.1177  0.0090  0.1403  13  ARG A CA  
101  C C   . ARG A 13  ? 0.7509 0.6355 0.6337 0.1240  -0.0005 0.1353  13  ARG A C   
102  O O   . ARG A 13  ? 0.7590 0.6506 0.6381 0.1353  -0.0039 0.1442  13  ARG A O   
103  C CB  . ARG A 13  ? 0.7558 0.5903 0.6357 0.1206  0.0130  0.1435  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.7964 0.6216 0.6661 0.1341  0.0131  0.1570  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.8014 0.6311 0.6814 0.1444  0.0097  0.1551  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.8323 0.6810 0.7081 0.1585  0.0042  0.1641  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.8373 0.6730 0.6987 0.1697  0.0064  0.1786  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.8832 0.6846 0.7328 0.1665  0.0140  0.1850  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 0.8102 0.6669 0.6690 0.1834  0.0008  0.1869  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.7467 0.6450 0.6400 0.1167  -0.0050 0.1220  14  GLY A N   
111  C CA  . GLY A 14  ? 0.7474 0.6701 0.6475 0.1193  -0.0147 0.1172  14  GLY A CA  
112  C C   . GLY A 14  ? 0.7637 0.7044 0.6528 0.1172  -0.0203 0.1138  14  GLY A C   
113  O O   . GLY A 14  ? 0.7700 0.7322 0.6610 0.1183  -0.0296 0.1106  14  GLY A O   
114  N N   . GLY A 15  ? 0.7692 0.7024 0.6461 0.1138  -0.0148 0.1143  15  GLY A N   
115  C CA  . GLY A 15  ? 0.7831 0.7315 0.6464 0.1126  -0.0186 0.1101  15  GLY A CA  
116  C C   . GLY A 15  ? 0.7815 0.7238 0.6412 0.1049  -0.0132 0.1011  15  GLY A C   
117  O O   . GLY A 15  ? 0.7784 0.7054 0.6453 0.1003  -0.0057 0.1008  15  GLY A O   
118  N N   . GLN A 16  ? 0.7871 0.7423 0.6350 0.1041  -0.0172 0.0934  16  GLN A N   
119  C CA  . GLN A 16  ? 0.7876 0.7399 0.6294 0.1000  -0.0114 0.0857  16  GLN A CA  
120  C C   . GLN A 16  ? 0.7659 0.7134 0.6182 0.0938  -0.0137 0.0702  16  GLN A C   
121  O O   . GLN A 16  ? 0.7595 0.7107 0.6178 0.0915  -0.0225 0.0623  16  GLN A O   
122  C CB  . GLN A 16  ? 0.8141 0.7809 0.6351 0.1038  -0.0136 0.0843  16  GLN A CB  
123  C CG  . GLN A 16  ? 0.8456 0.8176 0.6540 0.1100  -0.0105 0.1006  16  GLN A CG  
124  C CD  . GLN A 16  ? 0.9106 0.8997 0.6975 0.1142  -0.0142 0.0983  16  GLN A CD  
125  O OE1 . GLN A 16  ? 0.9089 0.9098 0.6907 0.1152  -0.0249 0.0908  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 0.9238 0.9158 0.6972 0.1159  -0.0054 0.1048  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.7535 0.6937 0.6079 0.0908  -0.0056 0.0668  17  LEU A N   
128  C CA  . LEU A 17  ? 0.7337 0.6683 0.5966 0.0864  -0.0066 0.0534  17  LEU A CA  
129  C C   . LEU A 17  ? 0.7445 0.6837 0.5945 0.0887  -0.0027 0.0458  17  LEU A C   
130  O O   . LEU A 17  ? 0.7523 0.6973 0.5935 0.0913  0.0052  0.0532  17  LEU A O   
131  C CB  . LEU A 17  ? 0.7149 0.6378 0.5945 0.0819  -0.0002 0.0566  17  LEU A CB  
132  C CG  . LEU A 17  ? 0.6963 0.6124 0.5875 0.0811  -0.0018 0.0644  17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.6774 0.5813 0.5779 0.0771  0.0065  0.0700  17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.6787 0.5959 0.5803 0.0788  -0.0105 0.0559  17  LEU A CD2 
135  N N   . ARG A 18  ? 0.7453 0.6814 0.5932 0.0881  -0.0079 0.0313  18  ARG A N   
136  C CA  . ARG A 18  ? 0.7649 0.7020 0.6025 0.0920  -0.0030 0.0227  18  ARG A CA  
137  C C   . ARG A 18  ? 0.7525 0.6793 0.6057 0.0889  0.0002  0.0174  18  ARG A C   
138  O O   . ARG A 18  ? 0.7523 0.6694 0.6148 0.0847  -0.0065 0.0111  18  ARG A O   
139  C CB  . ARG A 18  ? 0.7884 0.7259 0.6075 0.0953  -0.0110 0.0093  18  ARG A CB  
140  C CG  . ARG A 18  ? 0.8259 0.7632 0.6307 0.1024  -0.0054 -0.0009 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.8795 0.8127 0.6622 0.1059  -0.0139 -0.0158 18  ARG A CD  
142  N NE  . ARG A 18  ? 0.9197 0.8474 0.7046 0.0982  -0.0270 -0.0195 18  ARG A NE  
143  C CZ  . ARG A 18  ? 0.9577 0.8960 0.7316 0.0971  -0.0345 -0.0168 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 0.9837 0.9366 0.7416 0.1037  -0.0304 -0.0107 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 0.9862 0.9227 0.7655 0.0892  -0.0464 -0.0195 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.7485 0.6796 0.6049 0.0906  0.0104  0.0212  19  GLY A N   
147  C CA  . GLY A 19  ? 0.7332 0.6581 0.6036 0.0887  0.0138  0.0169  19  GLY A CA  
148  C C   . GLY A 19  ? 0.7521 0.6773 0.6122 0.0963  0.0153  0.0050  19  GLY A C   
149  O O   . GLY A 19  ? 0.7754 0.7029 0.6164 0.1025  0.0129  -0.0017 19  GLY A O   
150  N N   . ILE A 20  ? 0.7453 0.6677 0.6167 0.0969  0.0194  0.0022  20  ILE A N   
151  C CA  . ILE A 20  ? 0.7576 0.6792 0.6203 0.1063  0.0219  -0.0084 20  ILE A CA  
152  C C   . ILE A 20  ? 0.7536 0.6911 0.6258 0.1093  0.0329  -0.0020 20  ILE A C   
153  O O   . ILE A 20  ? 0.7383 0.6793 0.6282 0.1013  0.0358  0.0070  20  ILE A O   
154  C CB  . ILE A 20  ? 0.7586 0.6593 0.6246 0.1055  0.0139  -0.0198 20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.7808 0.6757 0.6345 0.1174  0.0161  -0.0316 20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.7358 0.6324 0.6248 0.0972  0.0139  -0.0139 20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.7944 0.6635 0.6445 0.1169  0.0071  -0.0438 20  ILE A CD1 
158  N N   . ARG A 21  ? 0.7745 0.7227 0.6342 0.1208  0.0388  -0.0068 21  ARG A N   
159  C CA  . ARG A 21  ? 0.7762 0.7448 0.6440 0.1254  0.0494  -0.0014 21  ARG A CA  
160  C C   . ARG A 21  ? 0.7757 0.7350 0.6504 0.1318  0.0485  -0.0101 21  ARG A C   
161  O O   . ARG A 21  ? 0.7932 0.7380 0.6535 0.1422  0.0450  -0.0230 21  ARG A O   
162  C CB  . ARG A 21  ? 0.8008 0.7883 0.6502 0.1364  0.0567  -0.0017 21  ARG A CB  
163  C CG  . ARG A 21  ? 0.8179 0.8338 0.6733 0.1428  0.0686  0.0047  21  ARG A CG  
164  C CD  . ARG A 21  ? 0.8991 0.9278 0.7310 0.1569  0.0737  -0.0004 21  ARG A CD  
165  N NE  . ARG A 21  ? 0.9538 1.0102 0.7860 0.1691  0.0850  0.0014  21  ARG A NE  
166  C CZ  . ARG A 21  ? 0.9954 1.0523 0.8330 0.1801  0.0874  -0.0055 21  ARG A CZ  
167  N NH1 . ARG A 21  ? 0.9997 1.0287 0.8437 0.1790  0.0790  -0.0143 21  ARG A NH1 
168  N NH2 . ARG A 21  ? 0.9949 1.0824 0.8326 0.1924  0.0985  -0.0023 21  ARG A NH2 
169  N N   . LEU A 22  ? 0.7549 0.7208 0.6505 0.1253  0.0512  -0.0029 22  LEU A N   
170  C CA  . LEU A 22  ? 0.7521 0.7098 0.6565 0.1302  0.0499  -0.0087 22  LEU A CA  
171  C C   . LEU A 22  ? 0.7535 0.7378 0.6662 0.1379  0.0596  -0.0038 22  LEU A C   
172  O O   . LEU A 22  ? 0.7461 0.7549 0.6663 0.1321  0.0664  0.0075  22  LEU A O   
173  C CB  . LEU A 22  ? 0.7293 0.6734 0.6510 0.1171  0.0437  -0.0053 22  LEU A CB  
174  C CG  . LEU A 22  ? 0.7303 0.6492 0.6482 0.1100  0.0333  -0.0105 22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.7077 0.6201 0.6439 0.0984  0.0298  -0.0051 22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.7691 0.6665 0.6733 0.1181  0.0269  -0.0239 22  LEU A CD2 
177  N N   . LYS A 23  ? 0.7675 0.7468 0.6782 0.1510  0.0601  -0.0117 23  LYS A N   
178  C CA  . LYS A 23  ? 0.7743 0.7805 0.6957 0.1596  0.0685  -0.0068 23  LYS A CA  
179  C C   . LYS A 23  ? 0.7448 0.7564 0.6897 0.1481  0.0670  0.0011  23  LYS A C   
180  O O   . LYS A 23  ? 0.7397 0.7278 0.6893 0.1441  0.0596  -0.0030 23  LYS A O   
181  C CB  . LYS A 23  ? 0.7999 0.7980 0.7091 0.1807  0.0699  -0.0180 23  LYS A CB  
182  C CG  . LYS A 23  ? 0.8666 0.8756 0.7544 0.1969  0.0764  -0.0236 23  LYS A CG  
183  C CD  . LYS A 23  ? 0.9521 0.9455 0.8240 0.2197  0.0772  -0.0366 23  LYS A CD  
184  C CE  . LYS A 23  ? 0.9760 0.9795 0.8652 0.2278  0.0800  -0.0328 23  LYS A CE  
185  N NZ  . LYS A 23  ? 0.9592 1.0111 0.8634 0.2333  0.0913  -0.0210 23  LYS A NZ  
186  N N   . ALA A 24  ? 0.7306 0.7739 0.6893 0.1414  0.0739  0.0129  24  ALA A N   
187  C CA  . ALA A 24  ? 0.7128 0.7691 0.6922 0.1345  0.0741  0.0197  24  ALA A CA  
188  C C   . ALA A 24  ? 0.7230 0.8125 0.7066 0.1493  0.0824  0.0222  24  ALA A C   
189  O O   . ALA A 24  ? 0.7450 0.8486 0.7161 0.1623  0.0890  0.0203  24  ALA A O   
190  C CB  . ALA A 24  ? 0.6945 0.7609 0.6861 0.1138  0.0744  0.0311  24  ALA A CB  
191  N N   . PRO A 25  ? 0.7093 0.8130 0.7098 0.1489  0.0824  0.0265  25  PRO A N   
192  C CA  . PRO A 25  ? 0.7114 0.8504 0.7180 0.1645  0.0902  0.0298  25  PRO A CA  
193  C C   . PRO A 25  ? 0.7076 0.8875 0.7164 0.1628  0.0999  0.0394  25  PRO A C   
194  O O   . PRO A 25  ? 0.7161 0.9156 0.7167 0.1817  0.1074  0.0374  25  PRO A O   
195  C CB  . PRO A 25  ? 0.6972 0.8480 0.7246 0.1567  0.0872  0.0361  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.7004 0.8092 0.7257 0.1472  0.0771  0.0299  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.6894 0.7766 0.7026 0.1366  0.0749  0.0275  25  PRO A CD  
198  N N   . GLY A 26  ? 0.6914 0.8826 0.7100 0.1406  0.1001  0.0498  26  GLY A N   
199  C CA  . GLY A 26  ? 0.6886 0.9189 0.7110 0.1349  0.1089  0.0612  26  GLY A CA  
200  C C   . GLY A 26  ? 0.7010 0.9234 0.7044 0.1364  0.1122  0.0600  26  GLY A C   
201  O O   . GLY A 26  ? 0.7032 0.9559 0.7078 0.1305  0.1196  0.0704  26  GLY A O   
202  N N   . GLY A 27  ? 0.7026 0.8856 0.6884 0.1432  0.1063  0.0480  27  GLY A N   
203  C CA  . GLY A 27  ? 0.7126 0.8863 0.6783 0.1460  0.1080  0.0455  27  GLY A CA  
204  C C   . GLY A 27  ? 0.7117 0.8430 0.6680 0.1366  0.0983  0.0395  27  GLY A C   
205  O O   . GLY A 27  ? 0.6964 0.8036 0.6606 0.1302  0.0905  0.0356  27  GLY A O   
206  N N   . PRO A 28  ? 0.7204 0.8450 0.6599 0.1361  0.0989  0.0393  28  PRO A N   
207  C CA  . PRO A 28  ? 0.7212 0.8088 0.6498 0.1308  0.0896  0.0326  28  PRO A CA  
208  C C   . PRO A 28  ? 0.7049 0.7804 0.6449 0.1100  0.0850  0.0416  28  PRO A C   
209  O O   . PRO A 28  ? 0.7004 0.7957 0.6506 0.0983  0.0901  0.0543  28  PRO A O   
210  C CB  . PRO A 28  ? 0.7417 0.8337 0.6485 0.1383  0.0928  0.0312  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.7406 0.8725 0.6511 0.1391  0.1042  0.0429  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.7308 0.8846 0.6600 0.1418  0.1084  0.0456  28  PRO A CD  
213  N N   . VAL A 29  ? 0.6926 0.7360 0.6304 0.1059  0.0756  0.0350  29  VAL A N   
214  C CA  . VAL A 29  ? 0.6813 0.7087 0.6242 0.0899  0.0709  0.0417  29  VAL A CA  
215  C C   . VAL A 29  ? 0.6858 0.6900 0.6140 0.0917  0.0639  0.0360  29  VAL A C   
216  O O   . VAL A 29  ? 0.6972 0.6911 0.6138 0.1026  0.0599  0.0244  29  VAL A O   
217  C CB  . VAL A 29  ? 0.6595 0.6747 0.6197 0.0801  0.0661  0.0419  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.6620 0.7015 0.6373 0.0750  0.0719  0.0492  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.6665 0.6626 0.6264 0.0881  0.0593  0.0298  29  VAL A CG2 
220  N N   . SER A 30  ? 0.6736 0.6693 0.6017 0.0810  0.0620  0.0442  30  SER A N   
221  C CA  . SER A 30  ? 0.6742 0.6504 0.5917 0.0818  0.0545  0.0404  30  SER A CA  
222  C C   . SER A 30  ? 0.6556 0.6111 0.5842 0.0759  0.0468  0.0365  30  SER A C   
223  O O   . SER A 30  ? 0.6420 0.5958 0.5844 0.0673  0.0479  0.0415  30  SER A O   
224  C CB  . SER A 30  ? 0.6859 0.6641 0.5964 0.0759  0.0567  0.0521  30  SER A CB  
225  O OG  . SER A 30  ? 0.7226 0.7223 0.6232 0.0799  0.0645  0.0579  30  SER A OG  
226  N N   . ALA A 31  ? 0.6566 0.5974 0.5785 0.0799  0.0388  0.0275  31  ALA A N   
227  C CA  . ALA A 31  ? 0.6391 0.5628 0.5704 0.0744  0.0314  0.0248  31  ALA A CA  
228  C C   . ALA A 31  ? 0.6450 0.5602 0.5676 0.0739  0.0246  0.0247  31  ALA A C   
229  O O   . ALA A 31  ? 0.6719 0.5883 0.5800 0.0799  0.0215  0.0190  31  ALA A O   
230  C CB  . ALA A 31  ? 0.6341 0.5498 0.5687 0.0786  0.0275  0.0140  31  ALA A CB  
231  N N   . PHE A 32  ? 0.6258 0.5334 0.5566 0.0675  0.0221  0.0308  32  PHE A N   
232  C CA  . PHE A 32  ? 0.6146 0.5165 0.5407 0.0677  0.0149  0.0310  32  PHE A CA  
233  C C   . PHE A 32  ? 0.6016 0.4938 0.5406 0.0635  0.0094  0.0273  32  PHE A C   
234  O O   . PHE A 32  ? 0.5916 0.4793 0.5406 0.0592  0.0111  0.0332  32  PHE A O   
235  C CB  . PHE A 32  ? 0.6194 0.5228 0.5419 0.0663  0.0180  0.0432  32  PHE A CB  
236  C CG  . PHE A 32  ? 0.6090 0.5234 0.5184 0.0696  0.0238  0.0481  32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.5941 0.5156 0.5063 0.0668  0.0324  0.0533  32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.5966 0.5170 0.4906 0.0753  0.0204  0.0474  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.5839 0.5189 0.4845 0.0695  0.0384  0.0588  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.6143 0.5465 0.4951 0.0788  0.0262  0.0521  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.5978 0.5377 0.4823 0.0760  0.0356  0.0582  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.6031 0.4911 0.5407 0.0647  0.0031  0.0173  33  LEU A N   
243  C CA  . LEU A 33  ? 0.5820 0.4620 0.5316 0.0602  -0.0020 0.0136  33  LEU A CA  
244  C C   . LEU A 33  ? 0.5864 0.4666 0.5358 0.0579  -0.0103 0.0138  33  LEU A C   
245  O O   . LEU A 33  ? 0.6006 0.4848 0.5379 0.0602  -0.0147 0.0114  33  LEU A O   
246  C CB  . LEU A 33  ? 0.5846 0.4580 0.5321 0.0621  -0.0039 0.0036  33  LEU A CB  
247  C CG  . LEU A 33  ? 0.5881 0.4654 0.5368 0.0662  0.0042  0.0034  33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.5714 0.4395 0.5179 0.0701  0.0019  -0.0062 33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.5301 0.4119 0.4931 0.0613  0.0101  0.0118  33  LEU A CD2 
250  N N   . GLY A 34  ? 0.5688 0.4473 0.5311 0.0536  -0.0124 0.0170  34  GLY A N   
251  C CA  . GLY A 34  ? 0.5677 0.4513 0.5323 0.0516  -0.0199 0.0183  34  GLY A CA  
252  C C   . GLY A 34  ? 0.5789 0.4712 0.5385 0.0557  -0.0199 0.0265  34  GLY A C   
253  O O   . GLY A 34  ? 0.5928 0.4938 0.5493 0.0556  -0.0272 0.0265  34  GLY A O   
254  N N   . ILE A 35  ? 0.5761 0.4662 0.5342 0.0589  -0.0123 0.0342  35  ILE A N   
255  C CA  . ILE A 35  ? 0.5856 0.4803 0.5397 0.0636  -0.0118 0.0437  35  ILE A CA  
256  C C   . ILE A 35  ? 0.5867 0.4837 0.5529 0.0637  -0.0147 0.0470  35  ILE A C   
257  O O   . ILE A 35  ? 0.5890 0.4789 0.5653 0.0610  -0.0115 0.0464  35  ILE A O   
258  C CB  . ILE A 35  ? 0.5867 0.4736 0.5366 0.0653  -0.0028 0.0515  35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.5854 0.4745 0.5250 0.0652  0.0012  0.0492  35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.5908 0.4774 0.5357 0.0710  -0.0021 0.0623  35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.5403 0.4230 0.4804 0.0624  0.0102  0.0550  35  ILE A CD1 
262  N N   . PRO A 36  ? 0.5897 0.4991 0.5552 0.0669  -0.0210 0.0503  36  PRO A N   
263  C CA  . PRO A 36  ? 0.5828 0.4978 0.5606 0.0684  -0.0227 0.0543  36  PRO A CA  
264  C C   . PRO A 36  ? 0.5845 0.4923 0.5604 0.0767  -0.0162 0.0643  36  PRO A C   
265  O O   . PRO A 36  ? 0.5981 0.5060 0.5633 0.0825  -0.0152 0.0706  36  PRO A O   
266  C CB  . PRO A 36  ? 0.5862 0.5210 0.5639 0.0688  -0.0322 0.0548  36  PRO A CB  
267  C CG  . PRO A 36  ? 0.5978 0.5345 0.5592 0.0724  -0.0331 0.0561  36  PRO A CG  
268  C CD  . PRO A 36  ? 0.6015 0.5228 0.5556 0.0694  -0.0270 0.0506  36  PRO A CD  
269  N N   . PHE A 37  ? 0.5799 0.4803 0.5646 0.0774  -0.0122 0.0655  37  PHE A N   
270  C CA  . PHE A 37  ? 0.5972 0.4856 0.5781 0.0856  -0.0062 0.0736  37  PHE A CA  
271  C C   . PHE A 37  ? 0.6054 0.5043 0.5938 0.0941  -0.0079 0.0783  37  PHE A C   
272  O O   . PHE A 37  ? 0.6187 0.5078 0.6016 0.1041  -0.0036 0.0856  37  PHE A O   
273  C CB  . PHE A 37  ? 0.5960 0.4634 0.5765 0.0811  0.0011  0.0715  37  PHE A CB  
274  C CG  . PHE A 37  ? 0.5850 0.4533 0.5777 0.0761  0.0011  0.0653  37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.6011 0.4633 0.5973 0.0813  0.0043  0.0675  37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.5644 0.4377 0.5632 0.0672  -0.0015 0.0575  37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.5870 0.4512 0.5931 0.0769  0.0046  0.0624  37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.5621 0.4358 0.5712 0.0627  -0.0014 0.0532  37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.5629 0.4333 0.5759 0.0671  0.0017  0.0557  37  PHE A CZ  
280  N N   . ALA A 38  ? 0.5983 0.5167 0.5985 0.0906  -0.0138 0.0747  38  ALA A N   
281  C CA  . ALA A 38  ? 0.6011 0.5362 0.6100 0.0991  -0.0153 0.0802  38  ALA A CA  
282  C C   . ALA A 38  ? 0.6009 0.5652 0.6164 0.0966  -0.0248 0.0808  38  ALA A C   
283  O O   . ALA A 38  ? 0.5997 0.5679 0.6139 0.0861  -0.0305 0.0746  38  ALA A O   
284  C CB  . ALA A 38  ? 0.5866 0.5191 0.6059 0.0973  -0.0118 0.0771  38  ALA A CB  
285  N N   . GLU A 39  ? 0.5968 0.5816 0.6187 0.1062  -0.0266 0.0883  39  GLU A N   
286  C CA  . GLU A 39  ? 0.5928 0.6099 0.6243 0.1017  -0.0362 0.0893  39  GLU A CA  
287  C C   . GLU A 39  ? 0.5752 0.5992 0.6198 0.0885  -0.0388 0.0828  39  GLU A C   
288  O O   . GLU A 39  ? 0.5701 0.5868 0.6211 0.0898  -0.0328 0.0822  39  GLU A O   
289  C CB  . GLU A 39  ? 0.5964 0.6377 0.6333 0.1164  -0.0368 0.1000  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.6248 0.6647 0.6484 0.1274  -0.0375 0.1072  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.6554 0.7136 0.6754 0.1185  -0.0479 0.1052  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.6964 0.7877 0.7278 0.1150  -0.0561 0.1072  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.6262 0.6673 0.6318 0.1146  -0.0480 0.1016  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.5757 0.6118 0.6227 0.0753  -0.0481 0.0779  40  PRO A N   
295  C CA  . PRO A 40  ? 0.5723 0.6091 0.6300 0.0621  -0.0500 0.0723  40  PRO A CA  
296  C C   . PRO A 40  ? 0.5699 0.6275 0.6431 0.0666  -0.0474 0.0789  40  PRO A C   
297  O O   . PRO A 40  ? 0.5794 0.6675 0.6607 0.0706  -0.0518 0.0861  40  PRO A O   
298  C CB  . PRO A 40  ? 0.5786 0.6281 0.6356 0.0485  -0.0617 0.0679  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.5829 0.6274 0.6242 0.0538  -0.0639 0.0673  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.5800 0.6284 0.6196 0.0712  -0.0572 0.0770  40  PRO A CD  
301  N N   . PRO A 41  ? 0.5615 0.6050 0.6386 0.0668  -0.0400 0.0769  41  PRO A N   
302  C CA  . PRO A 41  ? 0.5566 0.6176 0.6455 0.0739  -0.0355 0.0829  41  PRO A CA  
303  C C   . PRO A 41  ? 0.5494 0.6390 0.6542 0.0614  -0.0420 0.0848  41  PRO A C   
304  O O   . PRO A 41  ? 0.5390 0.6289 0.6515 0.0567  -0.0386 0.0843  41  PRO A O   
305  C CB  . PRO A 41  ? 0.5517 0.5846 0.6362 0.0753  -0.0265 0.0782  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.5443 0.5568 0.6235 0.0613  -0.0297 0.0698  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.5609 0.5737 0.6313 0.0601  -0.0359 0.0688  41  PRO A CD  
308  N N   . VAL A 42  ? 0.5528 0.6670 0.6618 0.0553  -0.0516 0.0877  42  VAL A N   
309  C CA  . VAL A 42  ? 0.5518 0.6925 0.6750 0.0395  -0.0594 0.0897  42  VAL A CA  
310  C C   . VAL A 42  ? 0.5559 0.7422 0.6941 0.0461  -0.0614 0.1009  42  VAL A C   
311  O O   . VAL A 42  ? 0.5589 0.7556 0.6948 0.0642  -0.0577 0.1068  42  VAL A O   
312  C CB  . VAL A 42  ? 0.5628 0.6968 0.6794 0.0227  -0.0707 0.0830  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.5636 0.6553 0.6660 0.0187  -0.0677 0.0725  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.5484 0.6976 0.6585 0.0285  -0.0769 0.0855  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.5543 0.7680 0.7075 0.0315  -0.0672 0.1045  43  GLY A N   
316  C CA  . GLY A 43  ? 0.5579 0.8214 0.7277 0.0353  -0.0699 0.1160  43  GLY A CA  
317  C C   . GLY A 43  ? 0.5596 0.8330 0.7335 0.0582  -0.0578 0.1225  43  GLY A C   
318  O O   . GLY A 43  ? 0.5603 0.8163 0.7336 0.0609  -0.0492 0.1200  43  GLY A O   
319  N N   . SER A 44  ? 0.5691 0.8681 0.7452 0.0757  -0.0572 0.1305  44  SER A N   
320  C CA  . SER A 44  ? 0.5746 0.8830 0.7527 0.1004  -0.0460 0.1370  44  SER A CA  
321  C C   . SER A 44  ? 0.5816 0.8403 0.7414 0.1136  -0.0353 0.1297  44  SER A C   
322  O O   . SER A 44  ? 0.5853 0.8421 0.7431 0.1330  -0.0253 0.1326  44  SER A O   
323  C CB  . SER A 44  ? 0.5805 0.9224 0.7619 0.1178  -0.0483 0.1470  44  SER A CB  
324  O OG  . SER A 44  ? 0.5806 0.8959 0.7451 0.1232  -0.0510 0.1436  44  SER A OG  
325  N N   . ARG A 45  ? 0.5853 0.8049 0.7316 0.1028  -0.0377 0.1202  45  ARG A N   
326  C CA  . ARG A 45  ? 0.5939 0.7676 0.7229 0.1121  -0.0289 0.1136  45  ARG A CA  
327  C C   . ARG A 45  ? 0.5776 0.7282 0.7061 0.1023  -0.0240 0.1063  45  ARG A C   
328  O O   . ARG A 45  ? 0.5885 0.7037 0.7041 0.1079  -0.0170 0.1008  45  ARG A O   
329  C CB  . ARG A 45  ? 0.6060 0.7530 0.7198 0.1090  -0.0330 0.1089  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.6426 0.7974 0.7493 0.1266  -0.0333 0.1162  45  ARG A CG  
331  C CD  . ARG A 45  ? 0.7207 0.8447 0.8099 0.1236  -0.0355 0.1114  45  ARG A CD  
332  N NE  . ARG A 45  ? 0.7794 0.9128 0.8613 0.1380  -0.0374 0.1193  45  ARG A NE  
333  C CZ  . ARG A 45  ? 0.8169 0.9846 0.9048 0.1356  -0.0471 0.1246  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 0.8369 1.0124 0.9173 0.1501  -0.0484 0.1325  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 0.8250 1.0195 0.9261 0.1179  -0.0560 0.1223  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.5560 0.7273 0.6983 0.0872  -0.0278 0.1071  46  ARG A N   
337  C CA  . ARG A 46  ? 0.5305 0.6838 0.6730 0.0782  -0.0235 0.1019  46  ARG A CA  
338  C C   . ARG A 46  ? 0.5314 0.6817 0.6714 0.0956  -0.0121 0.1034  46  ARG A C   
339  O O   . ARG A 46  ? 0.5451 0.7227 0.6912 0.1102  -0.0089 0.1108  46  ARG A O   
340  C CB  . ARG A 46  ? 0.5126 0.6916 0.6705 0.0593  -0.0300 0.1049  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.4801 0.6397 0.6377 0.0472  -0.0278 0.1001  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.4552 0.6452 0.6290 0.0306  -0.0332 0.1063  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.4432 0.6210 0.6159 0.0097  -0.0435 0.1022  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.4620 0.6594 0.6462 -0.0089 -0.0506 0.1070  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.4952 0.7301 0.6948 -0.0094 -0.0481 0.1169  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.4556 0.6351 0.6354 -0.0272 -0.0600 0.1020  46  ARG A NH2 
347  N N   . PHE A 47  ? 0.5303 0.6480 0.6606 0.0944  -0.0063 0.0963  47  PHE A N   
348  C CA  . PHE A 47  ? 0.5322 0.6390 0.6553 0.1099  0.0042  0.0952  47  PHE A CA  
349  C C   . PHE A 47  ? 0.5509 0.6398 0.6602 0.1298  0.0092  0.0955  47  PHE A C   
350  O O   . PHE A 47  ? 0.5537 0.6248 0.6526 0.1426  0.0175  0.0929  47  PHE A O   
351  C CB  . PHE A 47  ? 0.5225 0.6654 0.6586 0.1150  0.0081  0.1019  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.4965 0.6609 0.6472 0.0950  0.0026  0.1044  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.4823 0.6229 0.6295 0.0802  0.0017  0.0982  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.4698 0.6791 0.6380 0.0908  -0.0019 0.1138  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.4534 0.6103 0.6127 0.0619  -0.0034 0.1014  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.4723 0.6989 0.6530 0.0706  -0.0072 0.1169  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.4466 0.6446 0.6221 0.0562  -0.0079 0.1106  47  PHE A CZ  
358  N N   . MET A 48  ? 0.5656 0.6568 0.6729 0.1316  0.0039  0.0983  48  MET A N   
359  C CA  . MET A 48  ? 0.6041 0.6800 0.6984 0.1506  0.0078  0.1008  48  MET A CA  
360  C C   . MET A 48  ? 0.6098 0.6404 0.6864 0.1473  0.0093  0.0940  48  MET A C   
361  O O   . MET A 48  ? 0.6055 0.6248 0.6820 0.1303  0.0047  0.0887  48  MET A O   
362  C CB  . MET A 48  ? 0.6082 0.7147 0.7099 0.1554  0.0012  0.1092  48  MET A CB  
363  C CG  . MET A 48  ? 0.6792 0.7932 0.7762 0.1807  0.0067  0.1165  48  MET A CG  
364  S SD  . MET A 48  ? 0.7187 0.8932 0.8364 0.1912  0.0060  0.1276  48  MET A SD  
365  C CE  . MET A 48  ? 0.6937 0.8952 0.8168 0.1897  -0.0050 0.1355  48  MET A CE  
366  N N   . PRO A 49  ? 0.6257 0.6298 0.6866 0.1634  0.0161  0.0943  49  PRO A N   
367  C CA  . PRO A 49  ? 0.6365 0.5996 0.6805 0.1600  0.0175  0.0898  49  PRO A CA  
368  C C   . PRO A 49  ? 0.6333 0.6003 0.6778 0.1509  0.0102  0.0917  49  PRO A C   
369  O O   . PRO A 49  ? 0.6313 0.6273 0.6839 0.1542  0.0048  0.0979  49  PRO A O   
370  C CB  . PRO A 49  ? 0.6590 0.6021 0.6879 0.1815  0.0240  0.0940  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.6574 0.6194 0.6918 0.1954  0.0289  0.0958  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.6400 0.6485 0.6970 0.1853  0.0233  0.0984  49  PRO A CD  
373  N N   . PRO A 50  ? 0.6356 0.5755 0.6709 0.1397  0.0098  0.0863  50  PRO A N   
374  C CA  . PRO A 50  ? 0.6355 0.5798 0.6693 0.1327  0.0035  0.0877  50  PRO A CA  
375  C C   . PRO A 50  ? 0.6680 0.6087 0.6917 0.1474  0.0041  0.0958  50  PRO A C   
376  O O   . PRO A 50  ? 0.6910 0.6082 0.7028 0.1598  0.0107  0.0984  50  PRO A O   
377  C CB  . PRO A 50  ? 0.6303 0.5458 0.6555 0.1204  0.0053  0.0808  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.6390 0.5276 0.6549 0.1263  0.0132  0.0789  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.6371 0.5439 0.6625 0.1334  0.0150  0.0793  50  PRO A CD  
380  N N   . GLU A 51  ? 0.6786 0.6411 0.7056 0.1459  -0.0030 0.0999  51  GLU A N   
381  C CA  . GLU A 51  ? 0.7070 0.6667 0.7231 0.1579  -0.0036 0.1081  51  GLU A CA  
382  C C   . GLU A 51  ? 0.6983 0.6419 0.7036 0.1475  -0.0058 0.1058  51  GLU A C   
383  O O   . GLU A 51  ? 0.6887 0.6424 0.6992 0.1331  -0.0113 0.0998  51  GLU A O   
384  C CB  . GLU A 51  ? 0.7107 0.7108 0.7374 0.1648  -0.0104 0.1154  51  GLU A CB  
385  C CG  . GLU A 51  ? 0.7959 0.8078 0.8255 0.1855  -0.0060 0.1234  51  GLU A CG  
386  C CD  . GLU A 51  ? 0.8780 0.9362 0.9197 0.1919  -0.0134 0.1319  51  GLU A CD  
387  O OE1 . GLU A 51  ? 0.8762 0.9627 0.9315 0.1761  -0.0215 0.1287  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 0.8984 0.9639 0.9358 0.2123  -0.0115 0.1418  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.7156 0.6338 0.7049 0.1552  -0.0014 0.1110  52  PRO A N   
390  C CA  . PRO A 52  ? 0.7123 0.6176 0.6907 0.1461  -0.0025 0.1102  52  PRO A CA  
391  C C   . PRO A 52  ? 0.7023 0.6362 0.6845 0.1405  -0.0115 0.1100  52  PRO A C   
392  O O   . PRO A 52  ? 0.7017 0.6623 0.6893 0.1484  -0.0168 0.1156  52  PRO A O   
393  C CB  . PRO A 52  ? 0.7394 0.6211 0.7011 0.1589  0.0025  0.1200  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.7528 0.6211 0.7139 0.1719  0.0082  0.1221  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.7367 0.6368 0.7160 0.1734  0.0048  0.1187  52  PRO A CD  
396  N N   . LYS A 53  ? 0.6980 0.6270 0.6767 0.1272  -0.0133 0.1032  53  LYS A N   
397  C CA  . LYS A 53  ? 0.6889 0.6405 0.6681 0.1206  -0.0220 0.1005  53  LYS A CA  
398  C C   . LYS A 53  ? 0.7092 0.6697 0.6770 0.1302  -0.0248 0.1099  53  LYS A C   
399  O O   . LYS A 53  ? 0.7264 0.6673 0.6804 0.1345  -0.0196 0.1153  53  LYS A O   
400  C CB  . LYS A 53  ? 0.6752 0.6157 0.6504 0.1070  -0.0219 0.0908  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.6647 0.6211 0.6342 0.1015  -0.0299 0.0871  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.6511 0.6318 0.6322 0.0957  -0.0391 0.0829  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.6429 0.6328 0.6161 0.0873  -0.0473 0.0758  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.6303 0.6470 0.6130 0.0827  -0.0577 0.0753  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.7079 0.6991 0.6812 0.1326  -0.0334 0.1125  54  ARG A N   
406  C CA  . ARG A 54  ? 0.7227 0.7271 0.6856 0.1421  -0.0373 0.1219  54  ARG A CA  
407  C C   . ARG A 54  ? 0.7216 0.7212 0.6706 0.1333  -0.0397 0.1172  54  ARG A C   
408  O O   . ARG A 54  ? 0.7134 0.7147 0.6651 0.1200  -0.0433 0.1057  54  ARG A O   
409  C CB  . ARG A 54  ? 0.7191 0.7622 0.6930 0.1458  -0.0467 0.1259  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.7423 0.7949 0.7267 0.1610  -0.0433 0.1348  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.7934 0.8888 0.7863 0.1679  -0.0525 0.1426  54  ARG A CD  
412  N NE  . ARG A 54  ? 0.8250 0.9458 0.8277 0.1501  -0.0628 0.1339  54  ARG A NE  
413  C CZ  . ARG A 54  ? 0.8260 0.9685 0.8472 0.1430  -0.0661 0.1309  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 0.8161 0.9618 0.8485 0.1540  -0.0595 0.1360  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 0.7985 0.9587 0.8255 0.1248  -0.0761 0.1230  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.7337 0.7264 0.6668 0.1415  -0.0374 0.1262  55  PRO A N   
417  C CA  . PRO A 55  ? 0.7373 0.7265 0.6557 0.1343  -0.0383 0.1221  55  PRO A CA  
418  C C   . PRO A 55  ? 0.7347 0.7492 0.6532 0.1257  -0.0495 0.1134  55  PRO A C   
419  O O   . PRO A 55  ? 0.7345 0.7752 0.6606 0.1279  -0.0579 0.1157  55  PRO A O   
420  C CB  . PRO A 55  ? 0.7484 0.7336 0.6512 0.1466  -0.0355 0.1365  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.7539 0.7228 0.6610 0.1578  -0.0289 0.1457  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.7450 0.7292 0.6712 0.1579  -0.0325 0.1406  55  PRO A CD  
423  N N   . TRP A 56  ? 0.7361 0.7428 0.6458 0.1160  -0.0495 0.1032  56  TRP A N   
424  C CA  . TRP A 56  ? 0.7401 0.7642 0.6453 0.1074  -0.0600 0.0931  56  TRP A CA  
425  C C   . TRP A 56  ? 0.7639 0.7932 0.6477 0.1109  -0.0614 0.0956  56  TRP A C   
426  O O   . TRP A 56  ? 0.7786 0.7967 0.6521 0.1186  -0.0534 0.1052  56  TRP A O   
427  C CB  . TRP A 56  ? 0.7276 0.7378 0.6369 0.0950  -0.0594 0.0781  56  TRP A CB  
428  C CG  . TRP A 56  ? 0.7336 0.7206 0.6345 0.0949  -0.0489 0.0761  56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.7525 0.7360 0.6363 0.0942  -0.0472 0.0718  56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.7150 0.6819 0.6241 0.0954  -0.0387 0.0787  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.7379 0.7029 0.6205 0.0940  -0.0364 0.0725  56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.7123 0.6665 0.6102 0.0940  -0.0315 0.0766  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.6963 0.6561 0.6204 0.0969  -0.0350 0.0825  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.7032 0.6391 0.6054 0.0925  -0.0217 0.0786  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.6944 0.6329 0.6207 0.0959  -0.0253 0.0834  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.6886 0.6159 0.6046 0.0929  -0.0192 0.0817  56  TRP A CH2 
437  N N   . SER A 57  ? 0.7743 0.8201 0.6501 0.1049  -0.0718 0.0873  57  SER A N   
438  C CA  . SER A 57  ? 0.7975 0.8480 0.6510 0.1077  -0.0730 0.0876  57  SER A CA  
439  C C   . SER A 57  ? 0.8017 0.8416 0.6441 0.0984  -0.0740 0.0710  57  SER A C   
440  O O   . SER A 57  ? 0.7884 0.8204 0.6402 0.0890  -0.0768 0.0591  57  SER A O   
441  C CB  . SER A 57  ? 0.8123 0.8922 0.6598 0.1111  -0.0846 0.0931  57  SER A CB  
442  O OG  . SER A 57  ? 0.8302 0.9219 0.6804 0.0991  -0.0963 0.0798  57  SER A OG  
443  N N   . GLY A 58  ? 0.8173 0.8571 0.6388 0.1022  -0.0713 0.0710  58  GLY A N   
444  C CA  . GLY A 58  ? 0.8184 0.8461 0.6269 0.0975  -0.0691 0.0567  58  GLY A CA  
445  C C   . GLY A 58  ? 0.8007 0.8066 0.6179 0.0968  -0.0566 0.0555  58  GLY A C   
446  O O   . GLY A 58  ? 0.7864 0.7847 0.6167 0.0997  -0.0491 0.0664  58  GLY A O   
447  N N   . VAL A 59  ? 0.8023 0.7979 0.6111 0.0933  -0.0548 0.0419  59  VAL A N   
448  C CA  . VAL A 59  ? 0.7856 0.7645 0.6012 0.0928  -0.0437 0.0397  59  VAL A CA  
449  C C   . VAL A 59  ? 0.7699 0.7377 0.6015 0.0850  -0.0477 0.0295  59  VAL A C   
450  O O   . VAL A 59  ? 0.7791 0.7438 0.6038 0.0803  -0.0554 0.0157  59  VAL A O   
451  C CB  . VAL A 59  ? 0.8039 0.7813 0.5995 0.0963  -0.0386 0.0319  59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.7832 0.7485 0.5867 0.0965  -0.0268 0.0311  59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.8146 0.8064 0.5920 0.1034  -0.0362 0.0423  59  VAL A CG2 
454  N N   . LEU A 60  ? 0.7470 0.7078 0.5983 0.0836  -0.0427 0.0363  60  LEU A N   
455  C CA  . LEU A 60  ? 0.7339 0.6844 0.6014 0.0765  -0.0448 0.0287  60  LEU A CA  
456  C C   . LEU A 60  ? 0.7428 0.6792 0.6071 0.0756  -0.0390 0.0188  60  LEU A C   
457  O O   . LEU A 60  ? 0.7445 0.6774 0.6079 0.0794  -0.0287 0.0236  60  LEU A O   
458  C CB  . LEU A 60  ? 0.7119 0.6592 0.5991 0.0765  -0.0403 0.0386  60  LEU A CB  
459  C CG  . LEU A 60  ? 0.6858 0.6261 0.5904 0.0693  -0.0429 0.0328  60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.6893 0.6381 0.6087 0.0700  -0.0452 0.0417  60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.6593 0.5843 0.5708 0.0681  -0.0340 0.0305  60  LEU A CD2 
462  N N   . ASP A 61  ? 0.7521 0.6807 0.6146 0.0704  -0.0457 0.0057  61  ASP A N   
463  C CA  . ASP A 61  ? 0.7579 0.6717 0.6185 0.0708  -0.0410 -0.0039 61  ASP A CA  
464  C C   . ASP A 61  ? 0.7355 0.6413 0.6166 0.0683  -0.0346 0.0003  61  ASP A C   
465  O O   . ASP A 61  ? 0.7274 0.6309 0.6232 0.0621  -0.0390 0.0012  61  ASP A O   
466  C CB  . ASP A 61  ? 0.7839 0.6872 0.6354 0.0657  -0.0510 -0.0186 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.8132 0.6990 0.6612 0.0683  -0.0463 -0.0286 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.8136 0.6902 0.6780 0.0646  -0.0444 -0.0280 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 0.8552 0.7377 0.6835 0.0753  -0.0440 -0.0364 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.7302 0.6335 0.6119 0.0727  -0.0242 0.0028  62  ALA A N   
471  C CA  . ALA A 62  ? 0.7060 0.6039 0.6056 0.0701  -0.0180 0.0075  62  ALA A CA  
472  C C   . ALA A 62  ? 0.7109 0.6015 0.6094 0.0727  -0.0128 0.0001  62  ALA A C   
473  O O   . ALA A 62  ? 0.6985 0.5914 0.6044 0.0738  -0.0041 0.0054  62  ALA A O   
474  C CB  . ALA A 62  ? 0.6963 0.6002 0.6002 0.0716  -0.0104 0.0208  62  ALA A CB  
475  N N   . THR A 63  ? 0.7212 0.6029 0.6101 0.0735  -0.0187 -0.0120 63  THR A N   
476  C CA  . THR A 63  ? 0.7291 0.6029 0.6131 0.0791  -0.0143 -0.0201 63  THR A CA  
477  C C   . THR A 63  ? 0.7241 0.5834 0.6195 0.0753  -0.0171 -0.0250 63  THR A C   
478  O O   . THR A 63  ? 0.7362 0.5883 0.6285 0.0812  -0.0135 -0.0308 63  THR A O   
479  C CB  . THR A 63  ? 0.7614 0.6305 0.6215 0.0857  -0.0176 -0.0317 63  THR A CB  
480  O OG1 . THR A 63  ? 0.7654 0.6198 0.6199 0.0797  -0.0292 -0.0412 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.7714 0.6558 0.6178 0.0895  -0.0157 -0.0270 63  THR A CG2 
482  N N   . THR A 64  ? 0.7124 0.5684 0.6203 0.0665  -0.0233 -0.0222 64  THR A N   
483  C CA  . THR A 64  ? 0.7025 0.5450 0.6206 0.0619  -0.0263 -0.0258 64  THR A CA  
484  C C   . THR A 64  ? 0.6822 0.5305 0.6199 0.0545  -0.0266 -0.0168 64  THR A C   
485  O O   . THR A 64  ? 0.6674 0.5268 0.6089 0.0522  -0.0275 -0.0098 64  THR A O   
486  C CB  . THR A 64  ? 0.7224 0.5483 0.6299 0.0574  -0.0370 -0.0365 64  THR A CB  
487  O OG1 . THR A 64  ? 0.7203 0.5534 0.6294 0.0489  -0.0454 -0.0341 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.7596 0.5759 0.6440 0.0654  -0.0377 -0.0475 64  THR A CG2 
489  N N   . PHE A 65  ? 0.6703 0.5108 0.6192 0.0521  -0.0255 -0.0168 65  PHE A N   
490  C CA  . PHE A 65  ? 0.6475 0.4924 0.6136 0.0458  -0.0254 -0.0095 65  PHE A CA  
491  C C   . PHE A 65  ? 0.6581 0.5045 0.6271 0.0380  -0.0345 -0.0094 65  PHE A C   
492  O O   . PHE A 65  ? 0.6873 0.5234 0.6500 0.0337  -0.0419 -0.0162 65  PHE A O   
493  C CB  . PHE A 65  ? 0.6226 0.4598 0.5981 0.0452  -0.0227 -0.0099 65  PHE A CB  
494  C CG  . PHE A 65  ? 0.6180 0.4617 0.5974 0.0505  -0.0135 -0.0062 65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.5831 0.4379 0.5686 0.0493  -0.0082 0.0018  65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.5902 0.4291 0.5662 0.0568  -0.0101 -0.0104 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.5832 0.4445 0.5721 0.0516  -0.0004 0.0055  65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.5753 0.4249 0.5562 0.0606  -0.0020 -0.0063 65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.5869 0.4480 0.5744 0.0568  0.0026  0.0017  65  PHE A CZ  
500  N N   . GLN A 66  ? 0.6528 0.5121 0.6306 0.0363  -0.0339 -0.0013 66  GLN A N   
501  C CA  . GLN A 66  ? 0.6566 0.5241 0.6402 0.0297  -0.0415 0.0010  66  GLN A CA  
502  C C   . GLN A 66  ? 0.6438 0.5093 0.6418 0.0230  -0.0428 0.0031  66  GLN A C   
503  O O   . GLN A 66  ? 0.6351 0.4907 0.6367 0.0238  -0.0385 0.0019  66  GLN A O   
504  C CB  . GLN A 66  ? 0.6541 0.5368 0.6396 0.0337  -0.0395 0.0091  66  GLN A CB  
505  C CG  . GLN A 66  ? 0.6981 0.5949 0.6886 0.0291  -0.0474 0.0123  66  GLN A CG  
506  C CD  . GLN A 66  ? 0.7365 0.6343 0.7155 0.0245  -0.0569 0.0057  66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.7467 0.6485 0.7130 0.0292  -0.0578 0.0047  66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.7737 0.6678 0.7562 0.0145  -0.0645 0.0014  66  GLN A NE2 
509  N N   . ASN A 67  ? 0.6377 0.5146 0.6438 0.0164  -0.0490 0.0067  67  ASN A N   
510  C CA  . ASN A 67  ? 0.6226 0.4996 0.6411 0.0085  -0.0514 0.0090  67  ASN A CA  
511  C C   . ASN A 67  ? 0.6001 0.4782 0.6294 0.0119  -0.0432 0.0142  67  ASN A C   
512  O O   . ASN A 67  ? 0.5935 0.4763 0.6235 0.0192  -0.0364 0.0180  67  ASN A O   
513  C CB  . ASN A 67  ? 0.6237 0.5202 0.6507 0.0020  -0.0580 0.0141  67  ASN A CB  
514  C CG  . ASN A 67  ? 0.6529 0.5498 0.6707 -0.0056 -0.0685 0.0089  67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.6523 0.5299 0.6590 -0.0099 -0.0727 0.0005  67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.6807 0.6002 0.7026 -0.0071 -0.0732 0.0138  67  ASN A ND2 
517  N N   . VAL A 68  ? 0.5939 0.4669 0.6306 0.0059  -0.0442 0.0147  68  VAL A N   
518  C CA  . VAL A 68  ? 0.5747 0.4498 0.6211 0.0079  -0.0375 0.0193  68  VAL A CA  
519  C C   . VAL A 68  ? 0.5734 0.4666 0.6317 0.0044  -0.0387 0.0263  68  VAL A C   
520  O O   . VAL A 68  ? 0.5838 0.4847 0.6457 -0.0038 -0.0460 0.0274  68  VAL A O   
521  C CB  . VAL A 68  ? 0.5747 0.4351 0.6215 0.0045  -0.0378 0.0168  68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.5539 0.4197 0.6110 0.0045  -0.0327 0.0221  68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.5691 0.4149 0.6053 0.0108  -0.0349 0.0107  68  VAL A CG2 
524  N N   . CYS A 69  ? 0.5576 0.4583 0.6214 0.0104  -0.0319 0.0309  69  CYS A N   
525  C CA  . CYS A 69  ? 0.5589 0.4786 0.6333 0.0099  -0.0316 0.0376  69  CYS A CA  
526  C C   . CYS A 69  ? 0.5592 0.4838 0.6425 0.0005  -0.0348 0.0401  69  CYS A C   
527  O O   . CYS A 69  ? 0.5668 0.4773 0.6486 -0.0034 -0.0347 0.0377  69  CYS A O   
528  C CB  . CYS A 69  ? 0.5531 0.4746 0.6282 0.0191  -0.0233 0.0406  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.5804 0.4987 0.6456 0.0288  -0.0207 0.0406  69  CYS A SG  
530  N N   . TYR A 70  ? 0.5648 0.5107 0.6574 -0.0034 -0.0381 0.0459  70  TYR A N   
531  C CA  . TYR A 70  ? 0.5669 0.5190 0.6679 -0.0148 -0.0420 0.0495  70  TYR A CA  
532  C C   . TYR A 70  ? 0.5615 0.5092 0.6659 -0.0130 -0.0354 0.0517  70  TYR A C   
533  O O   . TYR A 70  ? 0.5549 0.5092 0.6605 -0.0035 -0.0282 0.0535  70  TYR A O   
534  C CB  . TYR A 70  ? 0.5634 0.5449 0.6753 -0.0200 -0.0464 0.0566  70  TYR A CB  
535  C CG  . TYR A 70  ? 0.5794 0.5596 0.6938 -0.0368 -0.0558 0.0573  70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.5830 0.5662 0.6938 -0.0446 -0.0651 0.0548  70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.5877 0.5607 0.7059 -0.0454 -0.0557 0.0601  70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.6091 0.5859 0.7197 -0.0618 -0.0744 0.0544  70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.6192 0.5856 0.7377 -0.0614 -0.0642 0.0610  70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.6344 0.6013 0.7488 -0.0701 -0.0736 0.0578  70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.6923 0.6487 0.8055 -0.0878 -0.0824 0.0585  70  TYR A OH  
542  N N   . GLN A 71  ? 0.5608 0.4955 0.6650 -0.0215 -0.0381 0.0513  71  GLN A N   
543  C CA  . GLN A 71  ? 0.5572 0.4862 0.6627 -0.0196 -0.0325 0.0530  71  GLN A CA  
544  C C   . GLN A 71  ? 0.5787 0.4979 0.6856 -0.0297 -0.0363 0.0558  71  GLN A C   
545  O O   . GLN A 71  ? 0.5861 0.4934 0.6897 -0.0384 -0.0434 0.0542  71  GLN A O   
546  C CB  . GLN A 71  ? 0.5529 0.4648 0.6494 -0.0105 -0.0276 0.0468  71  GLN A CB  
547  C CG  . GLN A 71  ? 0.5620 0.4530 0.6492 -0.0115 -0.0316 0.0402  71  GLN A CG  
548  C CD  . GLN A 71  ? 0.5522 0.4328 0.6324 -0.0027 -0.0263 0.0354  71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.5954 0.4660 0.6737 -0.0013 -0.0243 0.0343  71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.5170 0.4012 0.5935 0.0032  -0.0240 0.0335  71  GLN A NE2 
551  N N   . TYR A 72  ? 0.5893 0.5118 0.6995 -0.0283 -0.0313 0.0599  72  TYR A N   
552  C CA  . TYR A 72  ? 0.6076 0.5206 0.7186 -0.0362 -0.0337 0.0642  72  TYR A CA  
553  C C   . TYR A 72  ? 0.6188 0.5045 0.7199 -0.0329 -0.0347 0.0581  72  TYR A C   
554  O O   . TYR A 72  ? 0.6147 0.4961 0.7117 -0.0234 -0.0297 0.0540  72  TYR A O   
555  C CB  . TYR A 72  ? 0.5995 0.5279 0.7162 -0.0347 -0.0278 0.0710  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.6469 0.5649 0.7632 -0.0415 -0.0296 0.0764  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.6821 0.5994 0.8022 -0.0551 -0.0357 0.0832  72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.6642 0.5726 0.7757 -0.0351 -0.0257 0.0754  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.7248 0.6289 0.8430 -0.0613 -0.0376 0.0892  72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.6941 0.5926 0.8044 -0.0399 -0.0275 0.0814  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.7508 0.6455 0.8640 -0.0527 -0.0333 0.0886  72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.7867 0.6687 0.8975 -0.0577 -0.0352 0.0958  72  TYR A OH  
563  N N   . VAL A 73  ? 0.6412 0.5085 0.7379 -0.0407 -0.0414 0.0578  73  VAL A N   
564  C CA  . VAL A 73  ? 0.6542 0.4949 0.7405 -0.0360 -0.0427 0.0521  73  VAL A CA  
565  C C   . VAL A 73  ? 0.6685 0.5026 0.7556 -0.0361 -0.0410 0.0583  73  VAL A C   
566  O O   . VAL A 73  ? 0.6871 0.5225 0.7783 -0.0461 -0.0438 0.0662  73  VAL A O   
567  C CB  . VAL A 73  ? 0.6752 0.4947 0.7529 -0.0432 -0.0510 0.0476  73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.6860 0.4765 0.7511 -0.0358 -0.0518 0.0414  73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.6656 0.4945 0.7420 -0.0431 -0.0532 0.0421  73  VAL A CG2 
570  N N   . ASP A 74  ? 0.6665 0.4956 0.7501 -0.0256 -0.0364 0.0555  74  ASP A N   
571  C CA  . ASP A 74  ? 0.6741 0.4991 0.7580 -0.0240 -0.0348 0.0616  74  ASP A CA  
572  C C   . ASP A 74  ? 0.6967 0.4944 0.7732 -0.0275 -0.0406 0.0634  74  ASP A C   
573  O O   . ASP A 74  ? 0.6999 0.4771 0.7671 -0.0220 -0.0428 0.0565  74  ASP A O   
574  C CB  . ASP A 74  ? 0.6630 0.4929 0.7455 -0.0124 -0.0292 0.0583  74  ASP A CB  
575  C CG  . ASP A 74  ? 0.6719 0.5007 0.7545 -0.0097 -0.0280 0.0647  74  ASP A CG  
576  O OD1 . ASP A 74  ? 0.6933 0.5195 0.7775 -0.0166 -0.0303 0.0729  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 0.6911 0.5235 0.7723 -0.0010 -0.0247 0.0623  74  ASP A OD2 
578  N N   . THR A 75  ? 0.7176 0.5142 0.7970 -0.0363 -0.0428 0.0730  75  THR A N   
579  C CA  . THR A 75  ? 0.7635 0.5300 0.8344 -0.0395 -0.0481 0.0762  75  THR A CA  
580  C C   . THR A 75  ? 0.7758 0.5411 0.8470 -0.0359 -0.0458 0.0855  75  THR A C   
581  O O   . THR A 75  ? 0.8044 0.5523 0.8720 -0.0432 -0.0499 0.0934  75  THR A O   
582  C CB  . THR A 75  ? 0.7838 0.5408 0.8546 -0.0569 -0.0553 0.0806  75  THR A CB  
583  O OG1 . THR A 75  ? 0.7594 0.5466 0.8428 -0.0666 -0.0534 0.0894  75  THR A OG1 
584  C CG2 . THR A 75  ? 0.7929 0.5387 0.8574 -0.0599 -0.0604 0.0702  75  THR A CG2 
585  N N   . LEU A 76  ? 0.7654 0.5486 0.8401 -0.0253 -0.0398 0.0849  76  LEU A N   
586  C CA  . LEU A 76  ? 0.7699 0.5572 0.8451 -0.0212 -0.0377 0.0937  76  LEU A CA  
587  C C   . LEU A 76  ? 0.7997 0.5583 0.8650 -0.0128 -0.0405 0.0945  76  LEU A C   
588  O O   . LEU A 76  ? 0.8170 0.5624 0.8789 -0.0155 -0.0428 0.1043  76  LEU A O   
589  C CB  . LEU A 76  ? 0.7460 0.5595 0.8261 -0.0130 -0.0315 0.0913  76  LEU A CB  
590  C CG  . LEU A 76  ? 0.7517 0.5737 0.8318 -0.0078 -0.0295 0.0993  76  LEU A CG  
591  C CD1 . LEU A 76  ? 0.7525 0.5769 0.8341 -0.0174 -0.0309 0.1120  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 0.7239 0.5718 0.8078 -0.0026 -0.0244 0.0951  76  LEU A CD2 
593  N N   . TYR A 77  ? 0.8057 0.5543 0.8654 -0.0018 -0.0399 0.0845  77  TYR A N   
594  C CA  . TYR A 77  ? 0.8280 0.5489 0.8770 0.0092  -0.0419 0.0839  77  TYR A CA  
595  C C   . TYR A 77  ? 0.8509 0.5455 0.8894 0.0106  -0.0455 0.0732  77  TYR A C   
596  O O   . TYR A 77  ? 0.8331 0.5311 0.8691 0.0213  -0.0428 0.0639  77  TYR A O   
597  C CB  . TYR A 77  ? 0.8137 0.5503 0.8647 0.0249  -0.0372 0.0836  77  TYR A CB  
598  C CG  . TYR A 77  ? 0.7774 0.5374 0.8357 0.0241  -0.0348 0.0937  77  TYR A CG  
599  C CD1 . TYR A 77  ? 0.7807 0.5289 0.8357 0.0237  -0.0372 0.1055  77  TYR A CD1 
600  C CD2 . TYR A 77  ? 0.7242 0.5165 0.7911 0.0241  -0.0303 0.0915  77  TYR A CD2 
601  C CE1 . TYR A 77  ? 0.7728 0.5438 0.8331 0.0233  -0.0351 0.1148  77  TYR A CE1 
602  C CE2 . TYR A 77  ? 0.7197 0.5329 0.7911 0.0233  -0.0285 0.0995  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 0.7728 0.5768 0.8410 0.0231  -0.0309 0.1112  77  TYR A CZ  
604  O OH  . TYR A 77  ? 0.7832 0.6096 0.8546 0.0225  -0.0292 0.1192  77  TYR A OH  
605  N N   . PRO A 78  ? 0.8855 0.5547 0.9175 -0.0015 -0.0518 0.0748  78  PRO A N   
606  C CA  . PRO A 78  ? 0.9142 0.5522 0.9325 -0.0021 -0.0568 0.0649  78  PRO A CA  
607  C C   . PRO A 78  ? 0.9266 0.5453 0.9327 0.0178  -0.0549 0.0574  78  PRO A C   
608  O O   . PRO A 78  ? 0.9399 0.5463 0.9416 0.0284  -0.0539 0.0633  78  PRO A O   
609  C CB  . PRO A 78  ? 0.9493 0.5580 0.9608 -0.0162 -0.0638 0.0725  78  PRO A CB  
610  C CG  . PRO A 78  ? 0.9339 0.5727 0.9608 -0.0300 -0.0625 0.0840  78  PRO A CG  
611  C CD  . PRO A 78  ? 0.8932 0.5661 0.9309 -0.0180 -0.0546 0.0862  78  PRO A CD  
612  N N   . GLY A 79  ? 0.9181 0.5375 0.9192 0.0236  -0.0539 0.0453  79  GLY A N   
613  C CA  . GLY A 79  ? 0.9296 0.5346 0.9188 0.0433  -0.0513 0.0373  79  GLY A CA  
614  C C   . GLY A 79  ? 0.9009 0.5350 0.8990 0.0593  -0.0436 0.0394  79  GLY A C   
615  O O   . GLY A 79  ? 0.9064 0.5335 0.8962 0.0768  -0.0407 0.0342  79  GLY A O   
616  N N   . PHE A 80  ? 0.8579 0.5253 0.8722 0.0532  -0.0404 0.0468  80  PHE A N   
617  C CA  . PHE A 80  ? 0.8281 0.5236 0.8512 0.0649  -0.0344 0.0502  80  PHE A CA  
618  C C   . PHE A 80  ? 0.8001 0.5218 0.8292 0.0664  -0.0298 0.0429  80  PHE A C   
619  O O   . PHE A 80  ? 0.7816 0.5206 0.8189 0.0546  -0.0292 0.0427  80  PHE A O   
620  C CB  . PHE A 80  ? 0.8111 0.5262 0.8457 0.0571  -0.0339 0.0617  80  PHE A CB  
621  C CG  . PHE A 80  ? 0.7767 0.5230 0.8204 0.0660  -0.0289 0.0652  80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.7764 0.5216 0.8167 0.0831  -0.0272 0.0672  80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.7486 0.5256 0.8038 0.0573  -0.0261 0.0667  80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.7620 0.5393 0.8116 0.0897  -0.0235 0.0710  80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.7284 0.5335 0.7909 0.0632  -0.0225 0.0695  80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.7648 0.5718 0.8253 0.0785  -0.0215 0.0719  80  PHE A CZ  
627  N N   . GLU A 81  ? 0.8029 0.5284 0.8279 0.0816  -0.0260 0.0378  81  GLU A N   
628  C CA  . GLU A 81  ? 0.7869 0.5364 0.8165 0.0829  -0.0214 0.0318  81  GLU A CA  
629  C C   . GLU A 81  ? 0.7400 0.5215 0.7842 0.0733  -0.0186 0.0365  81  GLU A C   
630  O O   . GLU A 81  ? 0.7194 0.5138 0.7669 0.0670  -0.0167 0.0325  81  GLU A O   
631  C CB  . GLU A 81  ? 0.8071 0.5626 0.8322 0.1014  -0.0168 0.0283  81  GLU A CB  
632  C CG  . GLU A 81  ? 0.8545 0.6338 0.8828 0.1027  -0.0118 0.0227  81  GLU A CG  
633  C CD  . GLU A 81  ? 0.9590 0.7300 0.9751 0.1187  -0.0089 0.0150  81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.0046 0.7494 1.0085 0.1306  -0.0108 0.0130  81  GLU A OE1 
635  O OE2 . GLU A 81  ? 0.9849 0.7748 1.0025 0.1195  -0.0046 0.0111  81  GLU A OE2 
636  N N   . GLY A 82  ? 0.7224 0.5143 0.7735 0.0724  -0.0187 0.0451  82  GLY A N   
637  C CA  . GLY A 82  ? 0.6843 0.5050 0.7467 0.0650  -0.0161 0.0489  82  GLY A CA  
638  C C   . GLY A 82  ? 0.6623 0.4850 0.7279 0.0506  -0.0171 0.0478  82  GLY A C   
639  O O   . GLY A 82  ? 0.6385 0.4799 0.7094 0.0456  -0.0141 0.0463  82  GLY A O   
640  N N   . THR A 83  ? 0.6684 0.4712 0.7301 0.0439  -0.0213 0.0491  83  THR A N   
641  C CA  . THR A 83  ? 0.6475 0.4533 0.7124 0.0313  -0.0225 0.0485  83  THR A CA  
642  C C   . THR A 83  ? 0.6557 0.4500 0.7147 0.0300  -0.0241 0.0405  83  THR A C   
643  O O   . THR A 83  ? 0.6340 0.4400 0.6961 0.0254  -0.0225 0.0375  83  THR A O   
644  C CB  . THR A 83  ? 0.6531 0.4495 0.7188 0.0227  -0.0264 0.0561  83  THR A CB  
645  O OG1 . THR A 83  ? 0.6677 0.4367 0.7246 0.0263  -0.0305 0.0568  83  THR A OG1 
646  C CG2 . THR A 83  ? 0.6242 0.4376 0.6960 0.0221  -0.0244 0.0642  83  THR A CG2 
647  N N   . GLU A 84  ? 0.6838 0.4543 0.7327 0.0350  -0.0274 0.0368  84  GLU A N   
648  C CA  . GLU A 84  ? 0.6980 0.4565 0.7391 0.0333  -0.0298 0.0287  84  GLU A CA  
649  C C   . GLU A 84  ? 0.6775 0.4517 0.7189 0.0389  -0.0251 0.0227  84  GLU A C   
650  O O   . GLU A 84  ? 0.6907 0.4631 0.7282 0.0352  -0.0267 0.0177  84  GLU A O   
651  C CB  . GLU A 84  ? 0.7281 0.4554 0.7553 0.0389  -0.0340 0.0243  84  GLU A CB  
652  C CG  . GLU A 84  ? 0.7873 0.4934 0.8118 0.0328  -0.0391 0.0307  84  GLU A CG  
653  C CD  . GLU A 84  ? 0.8453 0.5394 0.8679 0.0167  -0.0458 0.0307  84  GLU A CD  
654  O OE1 . GLU A 84  ? 0.8413 0.5488 0.8672 0.0100  -0.0463 0.0268  84  GLU A OE1 
655  O OE2 . GLU A 84  ? 0.8905 0.5619 0.9082 0.0106  -0.0507 0.0355  84  GLU A OE2 
656  N N   . MET A 85  ? 0.6583 0.4491 0.7040 0.0469  -0.0198 0.0241  85  MET A N   
657  C CA  . MET A 85  ? 0.6363 0.4419 0.6819 0.0507  -0.0152 0.0196  85  MET A CA  
658  C C   . MET A 85  ? 0.6120 0.4316 0.6637 0.0412  -0.0140 0.0204  85  MET A C   
659  O O   . MET A 85  ? 0.6141 0.4426 0.6646 0.0425  -0.0108 0.0175  85  MET A O   
660  C CB  . MET A 85  ? 0.6267 0.4495 0.6765 0.0597  -0.0101 0.0218  85  MET A CB  
661  C CG  . MET A 85  ? 0.6171 0.4568 0.6774 0.0544  -0.0088 0.0286  85  MET A CG  
662  S SD  . MET A 85  ? 0.6131 0.4790 0.6797 0.0614  -0.0037 0.0313  85  MET A SD  
663  C CE  . MET A 85  ? 0.5809 0.4605 0.6483 0.0557  0.0004  0.0277  85  MET A CE  
664  N N   . TRP A 86  ? 0.5997 0.4214 0.6574 0.0325  -0.0160 0.0250  86  TRP A N   
665  C CA  . TRP A 86  ? 0.5727 0.4078 0.6357 0.0258  -0.0141 0.0263  86  TRP A CA  
666  C C   . TRP A 86  ? 0.5783 0.4072 0.6399 0.0193  -0.0183 0.0253  86  TRP A C   
667  O O   . TRP A 86  ? 0.5457 0.3844 0.6101 0.0160  -0.0170 0.0258  86  TRP A O   
668  C CB  . TRP A 86  ? 0.5616 0.4076 0.6319 0.0219  -0.0126 0.0321  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.5575 0.4132 0.6299 0.0266  -0.0094 0.0336  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.5624 0.4182 0.6364 0.0298  -0.0104 0.0377  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.5511 0.4195 0.6243 0.0281  -0.0051 0.0318  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.5537 0.4244 0.6304 0.0334  -0.0072 0.0384  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.5441 0.4225 0.6205 0.0314  -0.0041 0.0347  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.5406 0.4129 0.6120 0.0263  -0.0024 0.0288  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.5270 0.4209 0.6055 0.0313  -0.0006 0.0344  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.5242 0.4085 0.5967 0.0262  0.0013  0.0288  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.5085 0.4042 0.5849 0.0279  0.0020  0.0314  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.5937 0.4060 0.6506 0.0175  -0.0237 0.0244  87  ASN A N   
679  C CA  . ASN A 87  ? 0.6117 0.4190 0.6677 0.0090  -0.0291 0.0241  87  ASN A CA  
680  C C   . ASN A 87  ? 0.6247 0.4301 0.6734 0.0107  -0.0305 0.0175  87  ASN A C   
681  O O   . ASN A 87  ? 0.6355 0.4371 0.6772 0.0190  -0.0279 0.0126  87  ASN A O   
682  C CB  . ASN A 87  ? 0.6367 0.4241 0.6885 0.0045  -0.0350 0.0256  87  ASN A CB  
683  C CG  . ASN A 87  ? 0.6362 0.4292 0.6965 -0.0018 -0.0351 0.0345  87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.5858 0.3989 0.6550 -0.0036 -0.0314 0.0389  87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.6041 0.3777 0.6601 -0.0045 -0.0393 0.0373  87  ASN A ND2 
686  N N   . PRO A 88  ? 0.6233 0.4338 0.6736 0.0030  -0.0347 0.0180  88  PRO A N   
687  C CA  . PRO A 88  ? 0.6243 0.4352 0.6672 0.0046  -0.0366 0.0125  88  PRO A CA  
688  C C   . PRO A 88  ? 0.6446 0.4347 0.6733 0.0083  -0.0401 0.0046  88  PRO A C   
689  O O   . PRO A 88  ? 0.6652 0.4370 0.6894 0.0045  -0.0450 0.0035  88  PRO A O   
690  C CB  . PRO A 88  ? 0.6165 0.4370 0.6647 -0.0055 -0.0421 0.0158  88  PRO A CB  
691  C CG  . PRO A 88  ? 0.6076 0.4413 0.6682 -0.0089 -0.0392 0.0237  88  PRO A CG  
692  C CD  . PRO A 88  ? 0.6187 0.4402 0.6787 -0.0065 -0.0371 0.0247  88  PRO A CD  
693  N N   . ASN A 89  ? 0.6400 0.4323 0.6607 0.0158  -0.0374 -0.0005 89  ASN A N   
694  C CA  . ASN A 89  ? 0.6530 0.4282 0.6579 0.0219  -0.0395 -0.0092 89  ASN A CA  
695  C C   . ASN A 89  ? 0.6608 0.4373 0.6564 0.0187  -0.0445 -0.0141 89  ASN A C   
696  O O   . ASN A 89  ? 0.6774 0.4432 0.6581 0.0245  -0.0456 -0.0219 89  ASN A O   
697  C CB  . ASN A 89  ? 0.6466 0.4261 0.6485 0.0345  -0.0315 -0.0107 89  ASN A CB  
698  C CG  . ASN A 89  ? 0.6295 0.4303 0.6365 0.0364  -0.0257 -0.0074 89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.6398 0.4514 0.6541 0.0300  -0.0267 -0.0030 89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.6064 0.4131 0.6092 0.0456  -0.0195 -0.0089 89  ASN A ND2 
701  N N   . ARG A 90  ? 0.6558 0.4476 0.6600 0.0105  -0.0473 -0.0093 90  ARG A N   
702  C CA  . ARG A 90  ? 0.6655 0.4623 0.6628 0.0061  -0.0533 -0.0124 90  ARG A CA  
703  C C   . ARG A 90  ? 0.6568 0.4617 0.6641 -0.0069 -0.0601 -0.0073 90  ARG A C   
704  O O   . ARG A 90  ? 0.6494 0.4584 0.6689 -0.0108 -0.0583 -0.0008 90  ARG A O   
705  C CB  . ARG A 90  ? 0.6488 0.4646 0.6472 0.0127  -0.0480 -0.0096 90  ARG A CB  
706  C CG  . ARG A 90  ? 0.6627 0.4738 0.6489 0.0236  -0.0427 -0.0147 90  ARG A CG  
707  C CD  . ARG A 90  ? 0.7297 0.5281 0.6973 0.0247  -0.0485 -0.0243 90  ARG A CD  
708  N NE  . ARG A 90  ? 0.7897 0.5875 0.7467 0.0365  -0.0418 -0.0281 90  ARG A NE  
709  C CZ  . ARG A 90  ? 0.8519 0.6380 0.8041 0.0447  -0.0373 -0.0319 90  ARG A CZ  
710  N NH1 . ARG A 90  ? 0.8490 0.6193 0.8044 0.0426  -0.0396 -0.0330 90  ARG A NH1 
711  N NH2 . ARG A 90  ? 0.8530 0.6448 0.7969 0.0556  -0.0305 -0.0341 90  ARG A NH2 
712  N N   . GLU A 91  ? 0.6616 0.4712 0.6638 -0.0139 -0.0679 -0.0096 91  GLU A N   
713  C CA  . GLU A 91  ? 0.6619 0.4852 0.6751 -0.0269 -0.0745 -0.0037 91  GLU A CA  
714  C C   . GLU A 91  ? 0.6388 0.4883 0.6702 -0.0250 -0.0686 0.0068  91  GLU A C   
715  O O   . GLU A 91  ? 0.6248 0.4863 0.6582 -0.0148 -0.0617 0.0092  91  GLU A O   
716  C CB  . GLU A 91  ? 0.6787 0.5094 0.6838 -0.0326 -0.0830 -0.0075 91  GLU A CB  
717  C CG  . GLU A 91  ? 0.7151 0.5601 0.7299 -0.0483 -0.0919 -0.0023 91  GLU A CG  
718  C CD  . GLU A 91  ? 0.7573 0.6152 0.7651 -0.0536 -0.1006 -0.0052 91  GLU A CD  
719  O OE1 . GLU A 91  ? 0.7732 0.6231 0.7655 -0.0453 -0.1002 -0.0128 91  GLU A OE1 
720  O OE2 . GLU A 91  ? 0.7573 0.6362 0.7756 -0.0658 -0.1076 0.0006  91  GLU A OE2 
721  N N   . LEU A 92  ? 0.6284 0.4852 0.6718 -0.0348 -0.0710 0.0133  92  LEU A N   
722  C CA  . LEU A 92  ? 0.5991 0.4821 0.6586 -0.0335 -0.0663 0.0229  92  LEU A CA  
723  C C   . LEU A 92  ? 0.5955 0.5039 0.6602 -0.0372 -0.0714 0.0266  92  LEU A C   
724  O O   . LEU A 92  ? 0.6187 0.5307 0.6836 -0.0500 -0.0807 0.0265  92  LEU A O   
725  C CB  . LEU A 92  ? 0.5898 0.4742 0.6599 -0.0425 -0.0667 0.0291  92  LEU A CB  
726  C CG  . LEU A 92  ? 0.5873 0.4534 0.6563 -0.0387 -0.0612 0.0289  92  LEU A CG  
727  C CD1 . LEU A 92  ? 0.5805 0.4565 0.6614 -0.0479 -0.0617 0.0375  92  LEU A CD1 
728  C CD2 . LEU A 92  ? 0.5579 0.4275 0.6274 -0.0246 -0.0512 0.0286  92  LEU A CD2 
729  N N   . SER A 93  ? 0.5726 0.4981 0.6409 -0.0264 -0.0659 0.0303  93  SER A N   
730  C CA  . SER A 93  ? 0.5719 0.5245 0.6458 -0.0269 -0.0699 0.0352  93  SER A CA  
731  C C   . SER A 93  ? 0.5643 0.5337 0.6459 -0.0140 -0.0613 0.0420  93  SER A C   
732  O O   . SER A 93  ? 0.5644 0.5205 0.6420 -0.0042 -0.0529 0.0405  93  SER A O   
733  C CB  . SER A 93  ? 0.5891 0.5371 0.6492 -0.0251 -0.0752 0.0290  93  SER A CB  
734  O OG  . SER A 93  ? 0.5702 0.5440 0.6340 -0.0195 -0.0763 0.0346  93  SER A OG  
735  N N   . GLU A 94  ? 0.5612 0.5599 0.6530 -0.0135 -0.0634 0.0494  94  GLU A N   
736  C CA  . GLU A 94  ? 0.5493 0.5620 0.6462 0.0008  -0.0552 0.0557  94  GLU A CA  
737  C C   . GLU A 94  ? 0.5533 0.5583 0.6384 0.0125  -0.0528 0.0537  94  GLU A C   
738  O O   . GLU A 94  ? 0.5452 0.5484 0.6290 0.0252  -0.0449 0.0568  94  GLU A O   
739  C CB  . GLU A 94  ? 0.5469 0.5957 0.6582 0.0000  -0.0578 0.0648  94  GLU A CB  
740  C CG  . GLU A 94  ? 0.5436 0.6041 0.6679 -0.0072 -0.0561 0.0697  94  GLU A CG  
741  C CD  . GLU A 94  ? 0.5447 0.6432 0.6829 -0.0015 -0.0545 0.0797  94  GLU A CD  
742  O OE1 . GLU A 94  ? 0.5409 0.6432 0.6796 0.0143  -0.0455 0.0827  94  GLU A OE1 
743  O OE2 . GLU A 94  ? 0.5547 0.6796 0.7027 -0.0128 -0.0626 0.0846  94  GLU A OE2 
744  N N   . ASP A 95  ? 0.5643 0.5638 0.6396 0.0076  -0.0600 0.0486  95  ASP A N   
745  C CA  . ASP A 95  ? 0.5669 0.5584 0.6288 0.0165  -0.0588 0.0464  95  ASP A CA  
746  C C   . ASP A 95  ? 0.5659 0.5279 0.6176 0.0183  -0.0530 0.0394  95  ASP A C   
747  O O   . ASP A 95  ? 0.5818 0.5293 0.6245 0.0121  -0.0570 0.0319  95  ASP A O   
748  C CB  . ASP A 95  ? 0.5769 0.5770 0.6318 0.0091  -0.0697 0.0432  95  ASP A CB  
749  C CG  . ASP A 95  ? 0.6022 0.5983 0.6426 0.0185  -0.0689 0.0421  95  ASP A CG  
750  O OD1 . ASP A 95  ? 0.5932 0.5756 0.6276 0.0290  -0.0601 0.0430  95  ASP A OD1 
751  O OD2 . ASP A 95  ? 0.6252 0.6324 0.6592 0.0144  -0.0777 0.0405  95  ASP A OD2 
752  N N   . CYS A 96  ? 0.5540 0.5075 0.6067 0.0267  -0.0436 0.0418  96  CYS A N   
753  C CA  . CYS A 96  ? 0.5547 0.4850 0.6005 0.0273  -0.0380 0.0364  96  CYS A CA  
754  C C   . CYS A 96  ? 0.5530 0.4750 0.5928 0.0375  -0.0296 0.0392  96  CYS A C   
755  O O   . CYS A 96  ? 0.5620 0.4684 0.5972 0.0378  -0.0244 0.0360  96  CYS A O   
756  C CB  . CYS A 96  ? 0.5477 0.4722 0.6022 0.0216  -0.0360 0.0354  96  CYS A CB  
757  S SG  . CYS A 96  ? 0.5481 0.4870 0.6149 0.0263  -0.0305 0.0431  96  CYS A SG  
758  N N   . LEU A 97  ? 0.5458 0.4777 0.5851 0.0455  -0.0283 0.0456  97  LEU A N   
759  C CA  . LEU A 97  ? 0.5438 0.4638 0.5762 0.0540  -0.0205 0.0488  97  LEU A CA  
760  C C   . LEU A 97  ? 0.5548 0.4654 0.5740 0.0553  -0.0198 0.0472  97  LEU A C   
761  O O   . LEU A 97  ? 0.5707 0.4859 0.5826 0.0616  -0.0205 0.0518  97  LEU A O   
762  C CB  . LEU A 97  ? 0.5450 0.4751 0.5801 0.0640  -0.0185 0.0566  97  LEU A CB  
763  C CG  . LEU A 97  ? 0.5358 0.4732 0.5822 0.0646  -0.0162 0.0581  97  LEU A CG  
764  C CD1 . LEU A 97  ? 0.5294 0.4749 0.5768 0.0777  -0.0127 0.0655  97  LEU A CD1 
765  C CD2 . LEU A 97  ? 0.5228 0.4421 0.5689 0.0605  -0.0107 0.0536  97  LEU A CD2 
766  N N   . TYR A 98  ? 0.5488 0.4476 0.5647 0.0502  -0.0181 0.0412  98  TYR A N   
767  C CA  . TYR A 98  ? 0.5505 0.4425 0.5544 0.0513  -0.0163 0.0393  98  TYR A CA  
768  C C   . TYR A 98  ? 0.5445 0.4235 0.5471 0.0504  -0.0087 0.0388  98  TYR A C   
769  O O   . TYR A 98  ? 0.5400 0.4148 0.5506 0.0471  -0.0065 0.0372  98  TYR A O   
770  C CB  . TYR A 98  ? 0.5559 0.4497 0.5558 0.0465  -0.0226 0.0315  98  TYR A CB  
771  C CG  . TYR A 98  ? 0.5602 0.4675 0.5607 0.0446  -0.0315 0.0315  98  TYR A CG  
772  C CD1 . TYR A 98  ? 0.5711 0.4861 0.5608 0.0481  -0.0351 0.0327  98  TYR A CD1 
773  C CD2 . TYR A 98  ? 0.5336 0.4487 0.5457 0.0389  -0.0364 0.0314  98  TYR A CD2 
774  C CE1 . TYR A 98  ? 0.5606 0.4910 0.5511 0.0453  -0.0442 0.0329  98  TYR A CE1 
775  C CE2 . TYR A 98  ? 0.5464 0.4773 0.5602 0.0354  -0.0451 0.0322  98  TYR A CE2 
776  C CZ  . TYR A 98  ? 0.5529 0.4916 0.5561 0.0385  -0.0493 0.0327  98  TYR A CZ  
777  O OH  . TYR A 98  ? 0.5776 0.5346 0.5831 0.0339  -0.0587 0.0336  98  TYR A OH  
778  N N   . LEU A 99  ? 0.5478 0.4227 0.5405 0.0525  -0.0047 0.0406  99  LEU A N   
779  C CA  . LEU A 99  ? 0.5344 0.4008 0.5265 0.0498  0.0019  0.0405  99  LEU A CA  
780  C C   . LEU A 99  ? 0.5333 0.4024 0.5175 0.0497  0.0034  0.0374  99  LEU A C   
781  O O   . LEU A 99  ? 0.5332 0.4079 0.5096 0.0526  -0.0002 0.0354  99  LEU A O   
782  C CB  . LEU A 99  ? 0.5325 0.3897 0.5212 0.0513  0.0076  0.0482  99  LEU A CB  
783  C CG  . LEU A 99  ? 0.5331 0.3889 0.5107 0.0563  0.0090  0.0555  99  LEU A CG  
784  C CD1 . LEU A 99  ? 0.5031 0.3616 0.4725 0.0544  0.0121  0.0558  99  LEU A CD1 
785  C CD2 . LEU A 99  ? 0.5367 0.3776 0.5111 0.0582  0.0136  0.0627  99  LEU A CD2 
786  N N   . ASN A 100 ? 0.5299 0.3966 0.5158 0.0468  0.0089  0.0372  100 ASN A N   
787  C CA  . ASN A 100 ? 0.5358 0.4081 0.5158 0.0479  0.0117  0.0347  100 ASN A CA  
788  C C   . ASN A 100 ? 0.5527 0.4259 0.5302 0.0451  0.0191  0.0414  100 ASN A C   
789  O O   . ASN A 100 ? 0.5543 0.4211 0.5373 0.0400  0.0219  0.0451  100 ASN A O   
790  C CB  . ASN A 100 ? 0.5220 0.3950 0.5084 0.0471  0.0103  0.0272  100 ASN A CB  
791  C CG  . ASN A 100 ? 0.4954 0.3644 0.4863 0.0465  0.0030  0.0223  100 ASN A CG  
792  O OD1 . ASN A 100 ? 0.5031 0.3729 0.4876 0.0484  -0.0023 0.0192  100 ASN A OD1 
793  N ND2 . ASN A 100 ? 0.4663 0.3320 0.4678 0.0428  0.0025  0.0221  100 ASN A ND2 
794  N N   . VAL A 101 ? 0.5703 0.4516 0.5386 0.0477  0.0223  0.0431  101 VAL A N   
795  C CA  . VAL A 101 ? 0.5804 0.4659 0.5461 0.0437  0.0294  0.0506  101 VAL A CA  
796  C C   . VAL A 101 ? 0.5959 0.4966 0.5598 0.0464  0.0332  0.0476  101 VAL A C   
797  O O   . VAL A 101 ? 0.6158 0.5225 0.5701 0.0533  0.0320  0.0440  101 VAL A O   
798  C CB  . VAL A 101 ? 0.5903 0.4735 0.5443 0.0452  0.0310  0.0592  101 VAL A CB  
799  C CG1 . VAL A 101 ? 0.5843 0.4717 0.5357 0.0390  0.0384  0.0680  101 VAL A CG1 
800  C CG2 . VAL A 101 ? 0.5968 0.4654 0.5512 0.0454  0.0280  0.0632  101 VAL A CG2 
801  N N   . TRP A 102 ? 0.5951 0.5032 0.5676 0.0416  0.0375  0.0488  102 TRP A N   
802  C CA  . TRP A 102 ? 0.6014 0.5283 0.5726 0.0445  0.0429  0.0490  102 TRP A CA  
803  C C   . TRP A 102 ? 0.6219 0.5575 0.5904 0.0373  0.0495  0.0602  102 TRP A C   
804  O O   . TRP A 102 ? 0.6270 0.5530 0.5994 0.0273  0.0501  0.0664  102 TRP A O   
805  C CB  . TRP A 102 ? 0.5851 0.5196 0.5682 0.0440  0.0435  0.0448  102 TRP A CB  
806  C CG  . TRP A 102 ? 0.5748 0.5021 0.5588 0.0518  0.0381  0.0346  102 TRP A CG  
807  C CD1 . TRP A 102 ? 0.5602 0.4933 0.5388 0.0622  0.0383  0.0277  102 TRP A CD1 
808  C CD2 . TRP A 102 ? 0.5542 0.4657 0.5439 0.0495  0.0318  0.0305  102 TRP A CD2 
809  N NE1 . TRP A 102 ? 0.5741 0.4930 0.5541 0.0654  0.0319  0.0196  102 TRP A NE1 
810  C CE2 . TRP A 102 ? 0.5558 0.4635 0.5436 0.0572  0.0279  0.0217  102 TRP A CE2 
811  C CE3 . TRP A 102 ? 0.5412 0.4413 0.5366 0.0421  0.0293  0.0335  102 TRP A CE3 
812  C CZ2 . TRP A 102 ? 0.5364 0.4307 0.5290 0.0559  0.0216  0.0171  102 TRP A CZ2 
813  C CZ3 . TRP A 102 ? 0.5203 0.4103 0.5209 0.0424  0.0236  0.0286  102 TRP A CZ3 
814  C CH2 . TRP A 102 ? 0.5307 0.4185 0.5304 0.0484  0.0197  0.0210  102 TRP A CH2 
815  N N   . THR A 103 ? 0.6400 0.5924 0.6004 0.0421  0.0543  0.0627  103 THR A N   
816  C CA  . THR A 103 ? 0.6632 0.6282 0.6216 0.0343  0.0613  0.0746  103 THR A CA  
817  C C   . THR A 103 ? 0.6717 0.6649 0.6290 0.0405  0.0677  0.0747  103 THR A C   
818  O O   . THR A 103 ? 0.6746 0.6726 0.6267 0.0533  0.0666  0.0654  103 THR A O   
819  C CB  . THR A 103 ? 0.6785 0.6343 0.6232 0.0336  0.0618  0.0827  103 THR A CB  
820  O OG1 . THR A 103 ? 0.7084 0.6723 0.6407 0.0457  0.0613  0.0781  103 THR A OG1 
821  C CG2 . THR A 103 ? 0.6763 0.6059 0.6201 0.0314  0.0559  0.0827  103 THR A CG2 
822  N N   . PRO A 104 ? 0.6832 0.6950 0.6442 0.0316  0.0746  0.0855  104 PRO A N   
823  C CA  . PRO A 104 ? 0.6964 0.7397 0.6562 0.0379  0.0820  0.0877  104 PRO A CA  
824  C C   . PRO A 104 ? 0.7197 0.7670 0.6619 0.0504  0.0836  0.0856  104 PRO A C   
825  O O   . PRO A 104 ? 0.7300 0.7597 0.6609 0.0497  0.0804  0.0878  104 PRO A O   
826  C CB  . PRO A 104 ? 0.6992 0.7572 0.6641 0.0220  0.0880  0.1026  104 PRO A CB  
827  C CG  . PRO A 104 ? 0.6931 0.7310 0.6680 0.0085  0.0831  0.1033  104 PRO A CG  
828  C CD  . PRO A 104 ? 0.6864 0.6917 0.6542 0.0144  0.0757  0.0955  104 PRO A CD  
829  N N   . TYR A 105 ? 0.7324 0.8033 0.6715 0.0627  0.0886  0.0812  105 TYR A N   
830  C CA  . TYR A 105 ? 0.7541 0.8332 0.6748 0.0749  0.0914  0.0789  105 TYR A CA  
831  C C   . TYR A 105 ? 0.7713 0.8872 0.6919 0.0756  0.1023  0.0889  105 TYR A C   
832  O O   . TYR A 105 ? 0.7707 0.9098 0.7001 0.0818  0.1070  0.0867  105 TYR A O   
833  C CB  . TYR A 105 ? 0.7544 0.8240 0.6674 0.0914  0.0869  0.0621  105 TYR A CB  
834  C CG  . TYR A 105 ? 0.7642 0.8376 0.6551 0.1047  0.0881  0.0566  105 TYR A CG  
835  C CD1 . TYR A 105 ? 0.7552 0.8048 0.6326 0.1075  0.0797  0.0490  105 TYR A CD1 
836  C CD2 . TYR A 105 ? 0.7779 0.8808 0.6611 0.1148  0.0975  0.0585  105 TYR A CD2 
837  C CE1 . TYR A 105 ? 0.7757 0.8287 0.6312 0.1189  0.0799  0.0431  105 TYR A CE1 
838  C CE2 . TYR A 105 ? 0.7903 0.8960 0.6509 0.1277  0.0985  0.0523  105 TYR A CE2 
839  C CZ  . TYR A 105 ? 0.7884 0.8681 0.6348 0.1291  0.0894  0.0443  105 TYR A CZ  
840  O OH  . TYR A 105 ? 0.8205 0.9033 0.6432 0.1409  0.0896  0.0376  105 TYR A OH  
841  N N   . PRO A 106 ? 0.7962 0.9195 0.7072 0.0695  0.1067  0.1011  106 PRO A N   
842  C CA  . PRO A 106 ? 0.8126 0.9111 0.7121 0.0639  0.1018  0.1057  106 PRO A CA  
843  C C   . PRO A 106 ? 0.8105 0.8876 0.7214 0.0463  0.0980  0.1138  106 PRO A C   
844  O O   . PRO A 106 ? 0.8036 0.8914 0.7293 0.0347  0.1012  0.1200  106 PRO A O   
845  C CB  . PRO A 106 ? 0.8292 0.9504 0.7156 0.0639  0.1100  0.1182  106 PRO A CB  
846  C CG  . PRO A 106 ? 0.8238 0.9801 0.7229 0.0590  0.1194  0.1264  106 PRO A CG  
847  C CD  . PRO A 106 ? 0.8101 0.9715 0.7214 0.0680  0.1177  0.1130  106 PRO A CD  
848  N N   . ARG A 107 ? 0.8226 0.8705 0.7261 0.0449  0.0911  0.1132  107 ARG A N   
849  C CA  . ARG A 107 ? 0.8314 0.8550 0.7413 0.0305  0.0879  0.1209  107 ARG A CA  
850  C C   . ARG A 107 ? 0.8462 0.8804 0.7578 0.0154  0.0951  0.1377  107 ARG A C   
851  O O   . ARG A 107 ? 0.8606 0.9121 0.7618 0.0164  0.1011  0.1473  107 ARG A O   
852  C CB  . ARG A 107 ? 0.8405 0.8372 0.7388 0.0342  0.0814  0.1210  107 ARG A CB  
853  C CG  . ARG A 107 ? 0.8511 0.8350 0.7492 0.0454  0.0728  0.1055  107 ARG A CG  
854  C CD  . ARG A 107 ? 0.8970 0.8571 0.7878 0.0467  0.0663  0.1078  107 ARG A CD  
855  N NE  . ARG A 107 ? 0.9338 0.8967 0.8083 0.0487  0.0686  0.1190  107 ARG A NE  
856  C CZ  . ARG A 107 ? 0.9633 0.9359 0.8238 0.0596  0.0665  0.1152  107 ARG A CZ  
857  N NH1 . ARG A 107 ? 0.9668 0.9443 0.8270 0.0685  0.0619  0.0998  107 ARG A NH1 
858  N NH2 . ARG A 107 ? 0.9745 0.9507 0.8199 0.0613  0.0687  0.1267  107 ARG A NH2 
859  N N   . PRO A 108 ? 0.8503 0.8740 0.7743 0.0004  0.0942  0.1416  108 PRO A N   
860  C CA  . PRO A 108 ? 0.8657 0.8994 0.7933 -0.0177 0.1001  0.1569  108 PRO A CA  
861  C C   . PRO A 108 ? 0.8912 0.9071 0.8037 -0.0248 0.1018  0.1716  108 PRO A C   
862  O O   . PRO A 108 ? 0.8933 0.8776 0.7966 -0.0206 0.0963  0.1703  108 PRO A O   
863  C CB  . PRO A 108 ? 0.8620 0.8790 0.8033 -0.0308 0.0958  0.1537  108 PRO A CB  
864  C CG  . PRO A 108 ? 0.8442 0.8311 0.7837 -0.0203 0.0875  0.1408  108 PRO A CG  
865  C CD  . PRO A 108 ? 0.8370 0.8370 0.7708 -0.0010 0.0868  0.1314  108 PRO A CD  
866  N N   . ALA A 109 ? 0.9081 0.9457 0.8183 -0.0351 0.1094  0.1863  109 ALA A N   
867  C CA  . ALA A 109 ? 0.9415 0.9639 0.8367 -0.0434 0.1119  0.2030  109 ALA A CA  
868  C C   . ALA A 109 ? 0.9544 0.9332 0.8472 -0.0572 0.1071  0.2081  109 ALA A C   
869  O O   . ALA A 109 ? 0.9644 0.9142 0.8425 -0.0537 0.1048  0.2139  109 ALA A O   
870  C CB  . ALA A 109 ? 0.9579 1.0152 0.8536 -0.0550 0.1216  0.2189  109 ALA A CB  
871  N N   . SER A 110 ? 0.9487 0.9235 0.8550 -0.0719 0.1056  0.2057  110 SER A N   
872  C CA  . SER A 110 ? 0.9665 0.8991 0.8693 -0.0855 0.1011  0.2088  110 SER A CA  
873  C C   . SER A 110 ? 0.9413 0.8540 0.8524 -0.0790 0.0937  0.1917  110 SER A C   
874  O O   . SER A 110 ? 0.9157 0.8527 0.8404 -0.0721 0.0927  0.1800  110 SER A O   
875  C CB  . SER A 110 ? 0.9852 0.9235 0.8926 -0.1116 0.1048  0.2216  110 SER A CB  
876  O OG  . SER A 110 ? 0.9723 0.9382 0.8986 -0.1183 0.1044  0.2140  110 SER A OG  
877  N N   . PRO A 111 ? 0.9524 0.8211 0.8546 -0.0801 0.0888  0.1909  111 PRO A N   
878  C CA  . PRO A 111 ? 0.9280 0.7764 0.8354 -0.0715 0.0821  0.1759  111 PRO A CA  
879  C C   . PRO A 111 ? 0.9002 0.7662 0.8250 -0.0786 0.0805  0.1658  111 PRO A C   
880  O O   . PRO A 111 ? 0.9053 0.7842 0.8364 -0.0962 0.0830  0.1716  111 PRO A O   
881  C CB  . PRO A 111 ? 0.9592 0.7603 0.8538 -0.0791 0.0796  0.1811  111 PRO A CB  
882  C CG  . PRO A 111 ? 0.9910 0.7832 0.8700 -0.0823 0.0838  0.1978  111 PRO A CG  
883  C CD  . PRO A 111 ? 0.9880 0.8226 0.8739 -0.0907 0.0899  0.2055  111 PRO A CD  
884  N N   . THR A 112 ? 0.8729 0.7398 0.8054 -0.0655 0.0760  0.1515  112 THR A N   
885  C CA  . THR A 112 ? 0.8464 0.7314 0.7949 -0.0692 0.0742  0.1419  112 THR A CA  
886  C C   . THR A 112 ? 0.8340 0.6905 0.7837 -0.0677 0.0681  0.1317  112 THR A C   
887  O O   . THR A 112 ? 0.8337 0.6680 0.7758 -0.0555 0.0652  0.1280  112 THR A O   
888  C CB  . THR A 112 ? 0.8206 0.7393 0.7780 -0.0540 0.0752  0.1341  112 THR A CB  
889  O OG1 . THR A 112 ? 0.8385 0.7822 0.7916 -0.0528 0.0814  0.1434  112 THR A OG1 
890  C CG2 . THR A 112 ? 0.7975 0.7387 0.7715 -0.0581 0.0743  0.1271  112 THR A CG2 
891  N N   . PRO A 113 ? 0.8230 0.6815 0.7817 -0.0805 0.0663  0.1280  113 PRO A N   
892  C CA  . PRO A 113 ? 0.8053 0.6448 0.7670 -0.0780 0.0609  0.1170  113 PRO A CA  
893  C C   . PRO A 113 ? 0.7673 0.6160 0.7354 -0.0587 0.0582  0.1062  113 PRO A C   
894  O O   . PRO A 113 ? 0.7482 0.6259 0.7242 -0.0507 0.0597  0.1041  113 PRO A O   
895  C CB  . PRO A 113 ? 0.8028 0.6594 0.7757 -0.0943 0.0602  0.1158  113 PRO A CB  
896  C CG  . PRO A 113 ? 0.8324 0.6888 0.7992 -0.1126 0.0639  0.1290  113 PRO A CG  
897  C CD  . PRO A 113 ? 0.8393 0.7107 0.8019 -0.1018 0.0689  0.1367  113 PRO A CD  
898  N N   . VAL A 114 ? 0.7537 0.5763 0.7174 -0.0517 0.0542  0.0999  114 VAL A N   
899  C CA  . VAL A 114 ? 0.7168 0.5419 0.6841 -0.0349 0.0510  0.0913  114 VAL A CA  
900  C C   . VAL A 114 ? 0.6988 0.5209 0.6746 -0.0360 0.0473  0.0819  114 VAL A C   
901  O O   . VAL A 114 ? 0.7097 0.5089 0.6803 -0.0424 0.0459  0.0808  114 VAL A O   
902  C CB  . VAL A 114 ? 0.7280 0.5275 0.6827 -0.0250 0.0499  0.0938  114 VAL A CB  
903  C CG1 . VAL A 114 ? 0.7034 0.5055 0.6627 -0.0103 0.0458  0.0854  114 VAL A CG1 
904  C CG2 . VAL A 114 ? 0.7355 0.5381 0.6805 -0.0231 0.0533  0.1039  114 VAL A CG2 
905  N N   . LEU A 115 ? 0.6767 0.5208 0.6640 -0.0297 0.0457  0.0753  115 LEU A N   
906  C CA  . LEU A 115 ? 0.6544 0.4962 0.6491 -0.0290 0.0420  0.0671  115 LEU A CA  
907  C C   . LEU A 115 ? 0.6402 0.4743 0.6339 -0.0150 0.0390  0.0622  115 LEU A C   
908  O O   . LEU A 115 ? 0.6485 0.4930 0.6422 -0.0060 0.0388  0.0620  115 LEU A O   
909  C CB  . LEU A 115 ? 0.6369 0.5067 0.6447 -0.0303 0.0417  0.0640  115 LEU A CB  
910  C CG  . LEU A 115 ? 0.6564 0.5462 0.6698 -0.0431 0.0444  0.0690  115 LEU A CG  
911  C CD1 . LEU A 115 ? 0.6353 0.5443 0.6612 -0.0437 0.0421  0.0641  115 LEU A CD1 
912  C CD2 . LEU A 115 ? 0.7038 0.5758 0.7096 -0.0592 0.0449  0.0739  115 LEU A CD2 
913  N N   . ILE A 116 ? 0.6315 0.4486 0.6236 -0.0133 0.0365  0.0582  116 ILE A N   
914  C CA  . ILE A 116 ? 0.6186 0.4346 0.6129 -0.0012 0.0334  0.0537  116 ILE A CA  
915  C C   . ILE A 116 ? 0.6029 0.4257 0.6069 -0.0010 0.0305  0.0470  116 ILE A C   
916  O O   . ILE A 116 ? 0.6220 0.4354 0.6251 -0.0068 0.0303  0.0450  116 ILE A O   
917  C CB  . ILE A 116 ? 0.6327 0.4268 0.6172 0.0046  0.0332  0.0560  116 ILE A CB  
918  C CG1 . ILE A 116 ? 0.6458 0.4333 0.6200 0.0059  0.0357  0.0639  116 ILE A CG1 
919  C CG2 . ILE A 116 ? 0.6057 0.4049 0.5951 0.0157  0.0297  0.0520  116 ILE A CG2 
920  C CD1 . ILE A 116 ? 0.6789 0.4417 0.6413 0.0110  0.0364  0.0680  116 ILE A CD1 
921  N N   . TRP A 117 ? 0.5713 0.4087 0.5829 0.0054  0.0281  0.0435  117 TRP A N   
922  C CA  . TRP A 117 ? 0.5524 0.3964 0.5727 0.0056  0.0255  0.0386  117 TRP A CA  
923  C C   . TRP A 117 ? 0.5461 0.3837 0.5674 0.0121  0.0225  0.0361  117 TRP A C   
924  O O   . TRP A 117 ? 0.5450 0.3833 0.5650 0.0187  0.0208  0.0366  117 TRP A O   
925  C CB  . TRP A 117 ? 0.5458 0.4068 0.5729 0.0087  0.0245  0.0366  117 TRP A CB  
926  C CG  . TRP A 117 ? 0.5461 0.4126 0.5815 0.0106  0.0213  0.0325  117 TRP A CG  
927  C CD1 . TRP A 117 ? 0.5397 0.4068 0.5778 0.0170  0.0177  0.0295  117 TRP A CD1 
928  C CD2 . TRP A 117 ? 0.5551 0.4271 0.5961 0.0054  0.0210  0.0316  117 TRP A CD2 
929  N NE1 . TRP A 117 ? 0.5476 0.4190 0.5926 0.0163  0.0157  0.0276  117 TRP A NE1 
930  C CE2 . TRP A 117 ? 0.5530 0.4286 0.6001 0.0099  0.0177  0.0289  117 TRP A CE2 
931  C CE3 . TRP A 117 ? 0.5497 0.4244 0.5908 -0.0037 0.0228  0.0332  117 TRP A CE3 
932  C CZ2 . TRP A 117 ? 0.5242 0.4066 0.5772 0.0072  0.0165  0.0283  117 TRP A CZ2 
933  C CZ3 . TRP A 117 ? 0.5479 0.4308 0.5951 -0.0070 0.0211  0.0317  117 TRP A CZ3 
934  C CH2 . TRP A 117 ? 0.5495 0.4366 0.6025 -0.0008 0.0182  0.0296  117 TRP A CH2 
935  N N   . ILE A 118 ? 0.5354 0.3696 0.5594 0.0099  0.0218  0.0336  118 ILE A N   
936  C CA  . ILE A 118 ? 0.5024 0.3357 0.5291 0.0157  0.0195  0.0319  118 ILE A CA  
937  C C   . ILE A 118 ? 0.4897 0.3340 0.5256 0.0144  0.0170  0.0292  118 ILE A C   
938  O O   . ILE A 118 ? 0.4869 0.3326 0.5243 0.0094  0.0175  0.0279  118 ILE A O   
939  C CB  . ILE A 118 ? 0.5019 0.3213 0.5218 0.0163  0.0215  0.0319  118 ILE A CB  
940  C CG1 . ILE A 118 ? 0.4957 0.2993 0.5043 0.0162  0.0244  0.0353  118 ILE A CG1 
941  C CG2 . ILE A 118 ? 0.4704 0.2932 0.4936 0.0240  0.0199  0.0315  118 ILE A CG2 
942  C CD1 . ILE A 118 ? 0.4356 0.2206 0.4344 0.0207  0.0264  0.0353  118 ILE A CD1 
943  N N   . TYR A 119 ? 0.4784 0.3299 0.5197 0.0183  0.0138  0.0286  119 TYR A N   
944  C CA  . TYR A 119 ? 0.4796 0.3388 0.5284 0.0168  0.0114  0.0271  119 TYR A CA  
945  C C   . TYR A 119 ? 0.4916 0.3513 0.5429 0.0156  0.0112  0.0271  119 TYR A C   
946  O O   . TYR A 119 ? 0.5015 0.3564 0.5493 0.0179  0.0126  0.0277  119 TYR A O   
947  C CB  . TYR A 119 ? 0.4644 0.3269 0.5164 0.0199  0.0075  0.0263  119 TYR A CB  
948  C CG  . TYR A 119 ? 0.4476 0.3097 0.4995 0.0225  0.0049  0.0273  119 TYR A CG  
949  C CD1 . TYR A 119 ? 0.4002 0.2659 0.4569 0.0222  0.0037  0.0288  119 TYR A CD1 
950  C CD2 . TYR A 119 ? 0.4323 0.2933 0.4795 0.0255  0.0037  0.0272  119 TYR A CD2 
951  C CE1 . TYR A 119 ? 0.3753 0.2458 0.4337 0.0244  0.0011  0.0307  119 TYR A CE1 
952  C CE2 . TYR A 119 ? 0.4286 0.2929 0.4765 0.0275  0.0005  0.0286  119 TYR A CE2 
953  C CZ  . TYR A 119 ? 0.4042 0.2742 0.4585 0.0268  -0.0008 0.0305  119 TYR A CZ  
954  O OH  . TYR A 119 ? 0.4293 0.3068 0.4853 0.0287  -0.0040 0.0327  119 TYR A OH  
955  N N   . GLY A 120 ? 0.4897 0.3559 0.5464 0.0133  0.0097  0.0268  120 GLY A N   
956  C CA  . GLY A 120 ? 0.4988 0.3681 0.5579 0.0125  0.0093  0.0274  120 GLY A CA  
957  C C   . GLY A 120 ? 0.5022 0.3766 0.5678 0.0138  0.0057  0.0295  120 GLY A C   
958  O O   . GLY A 120 ? 0.5125 0.3853 0.5791 0.0153  0.0032  0.0294  120 GLY A O   
959  N N   . GLY A 121 ? 0.4980 0.3779 0.5668 0.0123  0.0052  0.0314  121 GLY A N   
960  C CA  . GLY A 121 ? 0.5076 0.3921 0.5824 0.0116  0.0019  0.0347  121 GLY A CA  
961  C C   . GLY A 121 ? 0.5125 0.4052 0.5890 0.0120  0.0034  0.0373  121 GLY A C   
962  O O   . GLY A 121 ? 0.5057 0.4044 0.5868 0.0116  0.0014  0.0404  121 GLY A O   
963  N N   . GLY A 122 ? 0.5139 0.4080 0.5861 0.0127  0.0069  0.0361  122 GLY A N   
964  C CA  . GLY A 122 ? 0.5266 0.4298 0.5988 0.0144  0.0093  0.0383  122 GLY A CA  
965  C C   . GLY A 122 ? 0.5395 0.4464 0.6119 0.0198  0.0111  0.0392  122 GLY A C   
966  O O   . GLY A 122 ? 0.5492 0.4691 0.6254 0.0215  0.0122  0.0430  122 GLY A O   
967  N N   . PHE A 123 ? 0.5379 0.4355 0.6064 0.0228  0.0114  0.0366  123 PHE A N   
968  C CA  . PHE A 123 ? 0.5296 0.4314 0.5988 0.0288  0.0121  0.0384  123 PHE A CA  
969  C C   . PHE A 123 ? 0.5202 0.4375 0.5999 0.0265  0.0081  0.0436  123 PHE A C   
970  O O   . PHE A 123 ? 0.5291 0.4572 0.6116 0.0315  0.0086  0.0465  123 PHE A O   
971  C CB  . PHE A 123 ? 0.5314 0.4342 0.5943 0.0366  0.0174  0.0378  123 PHE A CB  
972  C CG  . PHE A 123 ? 0.5282 0.4117 0.5783 0.0391  0.0207  0.0326  123 PHE A CG  
973  C CD1 . PHE A 123 ? 0.5309 0.4020 0.5754 0.0427  0.0213  0.0318  123 PHE A CD1 
974  C CD2 . PHE A 123 ? 0.5223 0.3997 0.5650 0.0370  0.0230  0.0288  123 PHE A CD2 
975  C CE1 . PHE A 123 ? 0.5571 0.4077 0.5886 0.0434  0.0242  0.0278  123 PHE A CE1 
976  C CE2 . PHE A 123 ? 0.5154 0.3736 0.5453 0.0371  0.0254  0.0238  123 PHE A CE2 
977  C CZ  . PHE A 123 ? 0.5698 0.4133 0.5940 0.0399  0.0261  0.0234  123 PHE A CZ  
978  N N   . TYR A 124 ? 0.5087 0.4270 0.5939 0.0188  0.0039  0.0450  124 TYR A N   
979  C CA  . TYR A 124 ? 0.5028 0.4329 0.5969 0.0134  -0.0008 0.0499  124 TYR A CA  
980  C C   . TYR A 124 ? 0.5089 0.4281 0.6028 0.0081  -0.0066 0.0479  124 TYR A C   
981  O O   . TYR A 124 ? 0.5195 0.4443 0.6180 0.0033  -0.0115 0.0503  124 TYR A O   
982  C CB  . TYR A 124 ? 0.4942 0.4351 0.5938 0.0086  -0.0005 0.0550  124 TYR A CB  
983  C CG  . TYR A 124 ? 0.4748 0.4054 0.5742 0.0021  -0.0036 0.0553  124 TYR A CG  
984  C CD1 . TYR A 124 ? 0.5050 0.4322 0.6086 -0.0056 -0.0096 0.0582  124 TYR A CD1 
985  C CD2 . TYR A 124 ? 0.4596 0.3834 0.5539 0.0038  -0.0009 0.0531  124 TYR A CD2 
986  C CE1 . TYR A 124 ? 0.4879 0.4029 0.5901 -0.0096 -0.0123 0.0590  124 TYR A CE1 
987  C CE2 . TYR A 124 ? 0.4743 0.3904 0.5689 -0.0003 -0.0037 0.0544  124 TYR A CE2 
988  C CZ  . TYR A 124 ? 0.5025 0.4130 0.6006 -0.0061 -0.0091 0.0575  124 TYR A CZ  
989  O OH  . TYR A 124 ? 0.5019 0.4017 0.5987 -0.0083 -0.0119 0.0592  124 TYR A OH  
990  N N   . SER A 125 ? 0.5068 0.4112 0.5948 0.0088  -0.0061 0.0433  125 SER A N   
991  C CA  . SER A 125 ? 0.5160 0.4092 0.6014 0.0065  -0.0105 0.0403  125 SER A CA  
992  C C   . SER A 125 ? 0.5173 0.4014 0.5955 0.0115  -0.0077 0.0355  125 SER A C   
993  O O   . SER A 125 ? 0.5094 0.3940 0.5846 0.0152  -0.0030 0.0349  125 SER A O   
994  C CB  . SER A 125 ? 0.5226 0.4083 0.6092 0.0018  -0.0136 0.0414  125 SER A CB  
995  O OG  . SER A 125 ? 0.5144 0.4004 0.6008 0.0033  -0.0100 0.0422  125 SER A OG  
996  N N   . GLY A 126 ? 0.5223 0.3973 0.5965 0.0115  -0.0104 0.0322  126 GLY A N   
997  C CA  . GLY A 126 ? 0.5208 0.3905 0.5886 0.0158  -0.0072 0.0288  126 GLY A CA  
998  C C   . GLY A 126 ? 0.5248 0.3924 0.5874 0.0180  -0.0093 0.0267  126 GLY A C   
999  O O   . GLY A 126 ? 0.5300 0.4029 0.5941 0.0168  -0.0126 0.0282  126 GLY A O   
1000 N N   . ALA A 127 ? 0.5145 0.3770 0.5710 0.0210  -0.0074 0.0238  127 ALA A N   
1001 C CA  . ALA A 127 ? 0.5222 0.3821 0.5717 0.0233  -0.0097 0.0212  127 ALA A CA  
1002 C C   . ALA A 127 ? 0.5264 0.3847 0.5703 0.0269  -0.0051 0.0198  127 ALA A C   
1003 O O   . ALA A 127 ? 0.5290 0.3867 0.5744 0.0275  -0.0029 0.0188  127 ALA A O   
1004 C CB  . ALA A 127 ? 0.5308 0.3840 0.5782 0.0213  -0.0156 0.0177  127 ALA A CB  
1005 N N   . ALA A 128 ? 0.5247 0.3844 0.5628 0.0294  -0.0034 0.0207  128 ALA A N   
1006 C CA  . ALA A 128 ? 0.5255 0.3858 0.5580 0.0318  0.0014  0.0207  128 ALA A CA  
1007 C C   . ALA A 128 ? 0.5269 0.3861 0.5536 0.0355  0.0001  0.0160  128 ALA A C   
1008 O O   . ALA A 128 ? 0.5338 0.3970 0.5566 0.0381  0.0044  0.0162  128 ALA A O   
1009 C CB  . ALA A 128 ? 0.5181 0.3788 0.5446 0.0333  0.0035  0.0243  128 ALA A CB  
1010 N N   . SER A 129 ? 0.5295 0.3831 0.5547 0.0356  -0.0055 0.0120  129 SER A N   
1011 C CA  . SER A 129 ? 0.5587 0.4070 0.5749 0.0406  -0.0070 0.0061  129 SER A CA  
1012 C C   . SER A 129 ? 0.5662 0.4101 0.5844 0.0437  -0.0060 0.0039  129 SER A C   
1013 O O   . SER A 129 ? 0.6025 0.4391 0.6120 0.0495  -0.0072 -0.0015 129 SER A O   
1014 C CB  . SER A 129 ? 0.5668 0.4074 0.5764 0.0388  -0.0145 0.0017  129 SER A CB  
1015 O OG  . SER A 129 ? 0.5511 0.3868 0.5679 0.0326  -0.0195 0.0025  129 SER A OG  
1016 N N   . LEU A 130 ? 0.5611 0.4083 0.5893 0.0407  -0.0043 0.0077  130 LEU A N   
1017 C CA  . LEU A 130 ? 0.5610 0.4050 0.5920 0.0440  -0.0042 0.0070  130 LEU A CA  
1018 C C   . LEU A 130 ? 0.5671 0.4201 0.5959 0.0515  0.0013  0.0065  130 LEU A C   
1019 O O   . LEU A 130 ? 0.5717 0.4372 0.6018 0.0504  0.0062  0.0094  130 LEU A O   
1020 C CB  . LEU A 130 ? 0.5513 0.3999 0.5932 0.0384  -0.0038 0.0121  130 LEU A CB  
1021 C CG  . LEU A 130 ? 0.5335 0.3789 0.5802 0.0312  -0.0078 0.0144  130 LEU A CG  
1022 C CD1 . LEU A 130 ? 0.5571 0.4087 0.6122 0.0282  -0.0060 0.0187  130 LEU A CD1 
1023 C CD2 . LEU A 130 ? 0.5410 0.3731 0.5842 0.0300  -0.0141 0.0118  130 LEU A CD2 
1024 N N   . ASP A 131 ? 0.5843 0.4312 0.6097 0.0592  0.0008  0.0035  131 ASP A N   
1025 C CA  . ASP A 131 ? 0.5957 0.4543 0.6195 0.0687  0.0063  0.0032  131 ASP A CA  
1026 C C   . ASP A 131 ? 0.5827 0.4631 0.6171 0.0649  0.0115  0.0097  131 ASP A C   
1027 O O   . ASP A 131 ? 0.5940 0.4889 0.6272 0.0671  0.0166  0.0111  131 ASP A O   
1028 C CB  . ASP A 131 ? 0.6039 0.4519 0.6241 0.0786  0.0048  0.0005  131 ASP A CB  
1029 C CG  . ASP A 131 ? 0.6573 0.4836 0.6618 0.0848  0.0010  -0.0078 131 ASP A CG  
1030 O OD1 . ASP A 131 ? 0.6630 0.4849 0.6605 0.0804  -0.0011 -0.0111 131 ASP A OD1 
1031 O OD2 . ASP A 131 ? 0.7178 0.5304 0.7155 0.0946  -0.0001 -0.0112 131 ASP A OD2 
1032 N N   . VAL A 132 ? 0.5653 0.4481 0.6092 0.0580  0.0102  0.0138  132 VAL A N   
1033 C CA  . VAL A 132 ? 0.5486 0.4501 0.6011 0.0529  0.0139  0.0190  132 VAL A CA  
1034 C C   . VAL A 132 ? 0.5505 0.4560 0.6023 0.0443  0.0163  0.0211  132 VAL A C   
1035 O O   . VAL A 132 ? 0.5486 0.4678 0.6055 0.0384  0.0194  0.0251  132 VAL A O   
1036 C CB  . VAL A 132 ? 0.5409 0.4439 0.6018 0.0482  0.0115  0.0222  132 VAL A CB  
1037 C CG1 . VAL A 132 ? 0.5416 0.4422 0.6031 0.0577  0.0098  0.0221  132 VAL A CG1 
1038 C CG2 . VAL A 132 ? 0.5293 0.4190 0.5901 0.0408  0.0079  0.0219  132 VAL A CG2 
1039 N N   . TYR A 133 ? 0.5552 0.4488 0.6001 0.0431  0.0148  0.0189  133 TYR A N   
1040 C CA  . TYR A 133 ? 0.5559 0.4519 0.5986 0.0368  0.0176  0.0220  133 TYR A CA  
1041 C C   . TYR A 133 ? 0.5652 0.4664 0.5998 0.0414  0.0209  0.0217  133 TYR A C   
1042 O O   . TYR A 133 ? 0.5728 0.4718 0.6025 0.0378  0.0224  0.0243  133 TYR A O   
1043 C CB  . TYR A 133 ? 0.5503 0.4338 0.5919 0.0318  0.0145  0.0222  133 TYR A CB  
1044 C CG  . TYR A 133 ? 0.5519 0.4310 0.6000 0.0284  0.0115  0.0223  133 TYR A CG  
1045 C CD1 . TYR A 133 ? 0.5410 0.4277 0.5954 0.0250  0.0126  0.0242  133 TYR A CD1 
1046 C CD2 . TYR A 133 ? 0.5525 0.4224 0.6003 0.0282  0.0073  0.0210  133 TYR A CD2 
1047 C CE1 . TYR A 133 ? 0.5297 0.4135 0.5887 0.0223  0.0100  0.0246  133 TYR A CE1 
1048 C CE2 . TYR A 133 ? 0.5164 0.3848 0.5700 0.0251  0.0051  0.0221  133 TYR A CE2 
1049 C CZ  . TYR A 133 ? 0.5149 0.3895 0.5734 0.0226  0.0066  0.0237  133 TYR A CZ  
1050 O OH  . TYR A 133 ? 0.5005 0.3749 0.5635 0.0198  0.0048  0.0251  133 TYR A OH  
1051 N N   . ASP A 134 ? 0.5705 0.4783 0.6025 0.0502  0.0223  0.0191  134 ASP A N   
1052 C CA  . ASP A 134 ? 0.5826 0.4951 0.6048 0.0568  0.0253  0.0175  134 ASP A CA  
1053 C C   . ASP A 134 ? 0.5807 0.5105 0.6047 0.0520  0.0315  0.0242  134 ASP A C   
1054 O O   . ASP A 134 ? 0.5826 0.5300 0.6140 0.0514  0.0351  0.0276  134 ASP A O   
1055 C CB  . ASP A 134 ? 0.5866 0.5011 0.6048 0.0694  0.0258  0.0124  134 ASP A CB  
1056 C CG  . ASP A 134 ? 0.6141 0.5341 0.6201 0.0777  0.0294  0.0098  134 ASP A CG  
1057 O OD1 . ASP A 134 ? 0.6334 0.5628 0.6370 0.0731  0.0330  0.0145  134 ASP A OD1 
1058 O OD2 . ASP A 134 ? 0.6165 0.5305 0.6140 0.0892  0.0288  0.0033  134 ASP A OD2 
1059 N N   . GLY A 135 ? 0.5902 0.5158 0.6074 0.0479  0.0324  0.0269  135 GLY A N   
1060 C CA  . GLY A 135 ? 0.5795 0.5174 0.5973 0.0405  0.0379  0.0348  135 GLY A CA  
1061 C C   . GLY A 135 ? 0.5804 0.5381 0.5938 0.0461  0.0439  0.0372  135 GLY A C   
1062 O O   . GLY A 135 ? 0.5797 0.5495 0.5936 0.0391  0.0486  0.0447  135 GLY A O   
1063 N N   . ARG A 136 ? 0.5888 0.5499 0.5972 0.0589  0.0440  0.0309  136 ARG A N   
1064 C CA  . ARG A 136 ? 0.5962 0.5763 0.5979 0.0671  0.0501  0.0320  136 ARG A CA  
1065 C C   . ARG A 136 ? 0.5904 0.5990 0.6029 0.0634  0.0565  0.0397  136 ARG A C   
1066 O O   . ARG A 136 ? 0.5996 0.6270 0.6090 0.0626  0.0627  0.0458  136 ARG A O   
1067 C CB  . ARG A 136 ? 0.6053 0.5794 0.5972 0.0829  0.0487  0.0222  136 ARG A CB  
1068 C CG  . ARG A 136 ? 0.6272 0.6112 0.6260 0.0925  0.0502  0.0194  136 ARG A CG  
1069 C CD  . ARG A 136 ? 0.6856 0.6555 0.6710 0.1084  0.0481  0.0088  136 ARG A CD  
1070 N NE  . ARG A 136 ? 0.7502 0.6905 0.7276 0.1047  0.0399  0.0023  136 ARG A NE  
1071 C CZ  . ARG A 136 ? 0.7809 0.7030 0.7422 0.1132  0.0361  -0.0073 136 ARG A CZ  
1072 N NH1 . ARG A 136 ? 0.7794 0.6792 0.7366 0.1064  0.0281  -0.0114 136 ARG A NH1 
1073 N NH2 . ARG A 136 ? 0.7968 0.7235 0.7457 0.1281  0.0401  -0.0130 136 ARG A NH2 
1074 N N   . PHE A 137 ? 0.5773 0.5911 0.6027 0.0604  0.0548  0.0401  137 PHE A N   
1075 C CA  . PHE A 137 ? 0.5655 0.6101 0.6029 0.0570  0.0597  0.0471  137 PHE A CA  
1076 C C   . PHE A 137 ? 0.5682 0.6197 0.6103 0.0384  0.0615  0.0565  137 PHE A C   
1077 O O   . PHE A 137 ? 0.5746 0.6517 0.6194 0.0341  0.0674  0.0643  137 PHE A O   
1078 C CB  . PHE A 137 ? 0.5476 0.5955 0.5960 0.0597  0.0564  0.0449  137 PHE A CB  
1079 C CG  . PHE A 137 ? 0.5590 0.5926 0.6015 0.0763  0.0536  0.0360  137 PHE A CG  
1080 C CD1 . PHE A 137 ? 0.5456 0.5953 0.5855 0.0930  0.0580  0.0340  137 PHE A CD1 
1081 C CD2 . PHE A 137 ? 0.5602 0.5636 0.5993 0.0754  0.0466  0.0299  137 PHE A CD2 
1082 C CE1 . PHE A 137 ? 0.5583 0.5895 0.5901 0.1084  0.0552  0.0254  137 PHE A CE1 
1083 C CE2 . PHE A 137 ? 0.5724 0.5597 0.6048 0.0890  0.0435  0.0222  137 PHE A CE2 
1084 C CZ  . PHE A 137 ? 0.5633 0.5622 0.5912 0.1054  0.0476  0.0196  137 PHE A CZ  
1085 N N   . LEU A 138 ? 0.5660 0.5942 0.6083 0.0272  0.0565  0.0561  138 LEU A N   
1086 C CA  . LEU A 138 ? 0.5750 0.6016 0.6181 0.0100  0.0576  0.0639  138 LEU A CA  
1087 C C   . LEU A 138 ? 0.5918 0.6208 0.6246 0.0089  0.0624  0.0697  138 LEU A C   
1088 O O   . LEU A 138 ? 0.5945 0.6383 0.6293 -0.0028 0.0666  0.0789  138 LEU A O   
1089 C CB  . LEU A 138 ? 0.5743 0.5705 0.6152 0.0027  0.0518  0.0607  138 LEU A CB  
1090 C CG  . LEU A 138 ? 0.5631 0.5597 0.6139 -0.0024 0.0478  0.0582  138 LEU A CG  
1091 C CD1 . LEU A 138 ? 0.5419 0.5096 0.5888 -0.0022 0.0424  0.0525  138 LEU A CD1 
1092 C CD2 . LEU A 138 ? 0.5787 0.5874 0.6350 -0.0198 0.0490  0.0651  138 LEU A CD2 
1093 N N   . ALA A 139 ? 0.5983 0.6136 0.6198 0.0205  0.0616  0.0647  139 ALA A N   
1094 C CA  . ALA A 139 ? 0.6090 0.6262 0.6187 0.0218  0.0656  0.0697  139 ALA A CA  
1095 C C   . ALA A 139 ? 0.6187 0.6700 0.6301 0.0260  0.0732  0.0748  139 ALA A C   
1096 O O   . ALA A 139 ? 0.6314 0.6963 0.6425 0.0156  0.0780  0.0852  139 ALA A O   
1097 C CB  . ALA A 139 ? 0.6055 0.6042 0.6031 0.0338  0.0620  0.0622  139 ALA A CB  
1098 N N   . GLN A 140 ? 0.6196 0.6849 0.6323 0.0412  0.0744  0.0680  140 GLN A N   
1099 C CA  . GLN A 140 ? 0.6281 0.7282 0.6416 0.0486  0.0824  0.0723  140 GLN A CA  
1100 C C   . GLN A 140 ? 0.6293 0.7597 0.6582 0.0356  0.0864  0.0828  140 GLN A C   
1101 O O   . GLN A 140 ? 0.6390 0.7942 0.6677 0.0300  0.0931  0.0928  140 GLN A O   
1102 C CB  . GLN A 140 ? 0.6250 0.7308 0.6360 0.0693  0.0827  0.0622  140 GLN A CB  
1103 C CG  . GLN A 140 ? 0.6395 0.7730 0.6428 0.0829  0.0911  0.0636  140 GLN A CG  
1104 C CD  . GLN A 140 ? 0.6449 0.8225 0.6620 0.0805  0.0989  0.0737  140 GLN A CD  
1105 O OE1 . GLN A 140 ? 0.6442 0.8345 0.6770 0.0771  0.0974  0.0755  140 GLN A OE1 
1106 N NE2 . GLN A 140 ? 0.6320 0.8360 0.6432 0.0831  0.1071  0.0808  140 GLN A NE2 
1107 N N   . VAL A 141 ? 0.6166 0.7463 0.6585 0.0298  0.0821  0.0812  141 VAL A N   
1108 C CA  . VAL A 141 ? 0.6146 0.7774 0.6720 0.0188  0.0848  0.0898  141 VAL A CA  
1109 C C   . VAL A 141 ? 0.6236 0.7816 0.6832 -0.0056 0.0841  0.0993  141 VAL A C   
1110 O O   . VAL A 141 ? 0.6309 0.8194 0.6975 -0.0165 0.0889  0.1099  141 VAL A O   
1111 C CB  . VAL A 141 ? 0.6048 0.7743 0.6750 0.0234  0.0805  0.0848  141 VAL A CB  
1112 C CG1 . VAL A 141 ? 0.5874 0.7938 0.6740 0.0099  0.0823  0.0945  141 VAL A CG1 
1113 C CG2 . VAL A 141 ? 0.5903 0.7662 0.6577 0.0483  0.0822  0.0768  141 VAL A CG2 
1114 N N   . GLU A 142 ? 0.6307 0.7507 0.6839 -0.0142 0.0781  0.0960  142 GLU A N   
1115 C CA  . GLU A 142 ? 0.6425 0.7510 0.6952 -0.0371 0.0768  0.1040  142 GLU A CA  
1116 C C   . GLU A 142 ? 0.6594 0.7472 0.6973 -0.0417 0.0791  0.1097  142 GLU A C   
1117 O O   . GLU A 142 ? 0.6741 0.7478 0.7085 -0.0597 0.0785  0.1170  142 GLU A O   
1118 C CB  . GLU A 142 ? 0.6329 0.7144 0.6879 -0.0448 0.0693  0.0978  142 GLU A CB  
1119 C CG  . GLU A 142 ? 0.6398 0.7444 0.7098 -0.0463 0.0668  0.0957  142 GLU A CG  
1120 C CD  . GLU A 142 ? 0.6739 0.8126 0.7546 -0.0636 0.0693  0.1060  142 GLU A CD  
1121 O OE1 . GLU A 142 ? 0.7090 0.8420 0.7848 -0.0814 0.0708  0.1142  142 GLU A OE1 
1122 O OE2 . GLU A 142 ? 0.6868 0.8588 0.7810 -0.0599 0.0694  0.1065  142 GLU A OE2 
1123 N N   . GLY A 143 ? 0.6622 0.7469 0.6901 -0.0252 0.0814  0.1063  143 GLY A N   
1124 C CA  . GLY A 143 ? 0.6816 0.7491 0.6946 -0.0267 0.0833  0.1118  143 GLY A CA  
1125 C C   . GLY A 143 ? 0.6871 0.7125 0.6920 -0.0315 0.0773  0.1090  143 GLY A C   
1126 O O   . GLY A 143 ? 0.7119 0.7201 0.7066 -0.0397 0.0783  0.1169  143 GLY A O   
1127 N N   . ALA A 144 ? 0.6702 0.6793 0.6791 -0.0254 0.0713  0.0983  144 ALA A N   
1128 C CA  . ALA A 144 ? 0.6724 0.6451 0.6753 -0.0287 0.0658  0.0952  144 ALA A CA  
1129 C C   . ALA A 144 ? 0.6694 0.6246 0.6624 -0.0138 0.0630  0.0892  144 ALA A C   
1130 O O   . ALA A 144 ? 0.6570 0.6238 0.6503 -0.0002 0.0626  0.0825  144 ALA A O   
1131 C CB  . ALA A 144 ? 0.6594 0.6262 0.6725 -0.0329 0.0610  0.0883  144 ALA A CB  
1132 N N   . VAL A 145 ? 0.6726 0.5999 0.6562 -0.0165 0.0607  0.0919  145 VAL A N   
1133 C CA  . VAL A 145 ? 0.6671 0.5771 0.6439 -0.0043 0.0563  0.0860  145 VAL A CA  
1134 C C   . VAL A 145 ? 0.6535 0.5495 0.6377 -0.0035 0.0509  0.0775  145 VAL A C   
1135 O O   . VAL A 145 ? 0.6533 0.5327 0.6382 -0.0124 0.0498  0.0790  145 VAL A O   
1136 C CB  . VAL A 145 ? 0.6870 0.5759 0.6503 -0.0049 0.0566  0.0939  145 VAL A CB  
1137 C CG1 . VAL A 145 ? 0.6672 0.5453 0.6251 0.0083  0.0516  0.0882  145 VAL A CG1 
1138 C CG2 . VAL A 145 ? 0.6968 0.5989 0.6519 -0.0077 0.0623  0.1043  145 VAL A CG2 
1139 N N   . LEU A 146 ? 0.6344 0.5361 0.6230 0.0069  0.0475  0.0687  146 LEU A N   
1140 C CA  . LEU A 146 ? 0.6249 0.5166 0.6208 0.0075  0.0428  0.0616  146 LEU A CA  
1141 C C   . LEU A 146 ? 0.6202 0.4998 0.6115 0.0168  0.0381  0.0574  146 LEU A C   
1142 O O   . LEU A 146 ? 0.6232 0.5090 0.6091 0.0248  0.0373  0.0556  146 LEU A O   
1143 C CB  . LEU A 146 ? 0.6182 0.5274 0.6247 0.0097  0.0424  0.0560  146 LEU A CB  
1144 C CG  . LEU A 146 ? 0.6126 0.5146 0.6275 0.0082  0.0382  0.0505  146 LEU A CG  
1145 C CD1 . LEU A 146 ? 0.6021 0.5218 0.6267 0.0031  0.0399  0.0510  146 LEU A CD1 
1146 C CD2 . LEU A 146 ? 0.5894 0.4871 0.6052 0.0184  0.0336  0.0432  146 LEU A CD2 
1147 N N   . VAL A 147 ? 0.6203 0.4836 0.6130 0.0156  0.0351  0.0560  147 VAL A N   
1148 C CA  . VAL A 147 ? 0.6155 0.4704 0.6056 0.0235  0.0307  0.0533  147 VAL A CA  
1149 C C   . VAL A 147 ? 0.6048 0.4567 0.6039 0.0235  0.0271  0.0474  147 VAL A C   
1150 O O   . VAL A 147 ? 0.6160 0.4615 0.6185 0.0173  0.0283  0.0477  147 VAL A O   
1151 C CB  . VAL A 147 ? 0.6318 0.4705 0.6132 0.0242  0.0314  0.0598  147 VAL A CB  
1152 C CG1 . VAL A 147 ? 0.6138 0.4491 0.5947 0.0329  0.0266  0.0577  147 VAL A CG1 
1153 C CG2 . VAL A 147 ? 0.6435 0.4840 0.6147 0.0234  0.0352  0.0676  147 VAL A CG2 
1154 N N   . SER A 148 ? 0.5871 0.4436 0.5893 0.0295  0.0225  0.0421  148 SER A N   
1155 C CA  . SER A 148 ? 0.5676 0.4211 0.5774 0.0299  0.0187  0.0382  148 SER A CA  
1156 C C   . SER A 148 ? 0.5700 0.4226 0.5781 0.0355  0.0142  0.0378  148 SER A C   
1157 O O   . SER A 148 ? 0.5815 0.4386 0.5838 0.0393  0.0122  0.0376  148 SER A O   
1158 C CB  . SER A 148 ? 0.5629 0.4239 0.5802 0.0292  0.0171  0.0329  148 SER A CB  
1159 O OG  . SER A 148 ? 0.5573 0.4243 0.5711 0.0339  0.0154  0.0295  148 SER A OG  
1160 N N   . MET A 149 ? 0.5620 0.4110 0.5750 0.0359  0.0125  0.0378  149 MET A N   
1161 C CA  . MET A 149 ? 0.5551 0.4070 0.5688 0.0409  0.0085  0.0390  149 MET A CA  
1162 C C   . MET A 149 ? 0.5291 0.3872 0.5525 0.0390  0.0043  0.0353  149 MET A C   
1163 O O   . MET A 149 ? 0.5288 0.3853 0.5576 0.0352  0.0056  0.0331  149 MET A O   
1164 C CB  . MET A 149 ? 0.5564 0.3995 0.5677 0.0438  0.0114  0.0434  149 MET A CB  
1165 C CG  . MET A 149 ? 0.5668 0.4067 0.5844 0.0397  0.0129  0.0405  149 MET A CG  
1166 S SD  . MET A 149 ? 0.7059 0.5287 0.7170 0.0387  0.0182  0.0425  149 MET A SD  
1167 C CE  . MET A 149 ? 0.6629 0.4732 0.6617 0.0372  0.0219  0.0477  149 MET A CE  
1168 N N   . ASN A 150 ? 0.5140 0.3801 0.5397 0.0410  -0.0009 0.0353  150 ASN A N   
1169 C CA  . ASN A 150 ? 0.5048 0.3775 0.5402 0.0385  -0.0043 0.0344  150 ASN A CA  
1170 C C   . ASN A 150 ? 0.4969 0.3730 0.5348 0.0432  -0.0023 0.0391  150 ASN A C   
1171 O O   . ASN A 150 ? 0.5086 0.3862 0.5417 0.0492  -0.0019 0.0430  150 ASN A O   
1172 C CB  . ASN A 150 ? 0.4989 0.3797 0.5360 0.0358  -0.0117 0.0321  150 ASN A CB  
1173 C CG  . ASN A 150 ? 0.5285 0.4029 0.5624 0.0323  -0.0136 0.0263  150 ASN A CG  
1174 O OD1 . ASN A 150 ? 0.5597 0.4274 0.5923 0.0323  -0.0093 0.0247  150 ASN A OD1 
1175 N ND2 . ASN A 150 ? 0.5596 0.4358 0.5916 0.0292  -0.0204 0.0229  150 ASN A ND2 
1176 N N   . TYR A 151 ? 0.4858 0.3635 0.5304 0.0418  -0.0007 0.0390  151 TYR A N   
1177 C CA  . TYR A 151 ? 0.4909 0.3748 0.5382 0.0477  0.0010  0.0428  151 TYR A CA  
1178 C C   . TYR A 151 ? 0.4892 0.3880 0.5476 0.0442  -0.0021 0.0434  151 TYR A C   
1179 O O   . TYR A 151 ? 0.4890 0.3868 0.5516 0.0369  -0.0038 0.0407  151 TYR A O   
1180 C CB  . TYR A 151 ? 0.4932 0.3628 0.5344 0.0507  0.0075  0.0426  151 TYR A CB  
1181 C CG  . TYR A 151 ? 0.4781 0.3431 0.5220 0.0439  0.0090  0.0387  151 TYR A CG  
1182 C CD1 . TYR A 151 ? 0.4345 0.2924 0.4763 0.0377  0.0092  0.0357  151 TYR A CD1 
1183 C CD2 . TYR A 151 ? 0.4602 0.3303 0.5084 0.0446  0.0106  0.0386  151 TYR A CD2 
1184 C CE1 . TYR A 151 ? 0.4011 0.2573 0.4455 0.0323  0.0103  0.0331  151 TYR A CE1 
1185 C CE2 . TYR A 151 ? 0.4369 0.3041 0.4866 0.0386  0.0116  0.0357  151 TYR A CE2 
1186 C CZ  . TYR A 151 ? 0.4237 0.2841 0.4717 0.0325  0.0112  0.0331  151 TYR A CZ  
1187 O OH  . TYR A 151 ? 0.4385 0.2988 0.4885 0.0273  0.0118  0.0309  151 TYR A OH  
1188 N N   . ARG A 152 ? 0.4958 0.4096 0.5590 0.0496  -0.0026 0.0479  152 ARG A N   
1189 C CA  . ARG A 152 ? 0.4887 0.4211 0.5634 0.0454  -0.0056 0.0503  152 ARG A CA  
1190 C C   . ARG A 152 ? 0.4897 0.4191 0.5668 0.0436  -0.0014 0.0492  152 ARG A C   
1191 O O   . ARG A 152 ? 0.4979 0.4198 0.5696 0.0506  0.0046  0.0487  152 ARG A O   
1192 C CB  . ARG A 152 ? 0.4870 0.4409 0.5674 0.0527  -0.0063 0.0564  152 ARG A CB  
1193 C CG  . ARG A 152 ? 0.4834 0.4491 0.5649 0.0517  -0.0129 0.0585  152 ARG A CG  
1194 C CD  . ARG A 152 ? 0.4792 0.4666 0.5649 0.0629  -0.0121 0.0657  152 ARG A CD  
1195 N NE  . ARG A 152 ? 0.4138 0.3877 0.4890 0.0769  -0.0059 0.0671  152 ARG A NE  
1196 C CZ  . ARG A 152 ? 0.4904 0.4783 0.5667 0.0904  -0.0035 0.0732  152 ARG A CZ  
1197 N NH1 . ARG A 152 ? 0.4788 0.4990 0.5682 0.0908  -0.0068 0.0786  152 ARG A NH1 
1198 N NH2 . ARG A 152 ? 0.4696 0.4397 0.5338 0.1036  0.0021  0.0747  152 ARG A NH2 
1199 N N   . VAL A 153 ? 0.4912 0.4250 0.5751 0.0342  -0.0048 0.0487  153 VAL A N   
1200 C CA  . VAL A 153 ? 0.4886 0.4218 0.5749 0.0317  -0.0016 0.0485  153 VAL A CA  
1201 C C   . VAL A 153 ? 0.4903 0.4464 0.5872 0.0297  -0.0026 0.0544  153 VAL A C   
1202 O O   . VAL A 153 ? 0.4889 0.4620 0.5922 0.0289  -0.0066 0.0584  153 VAL A O   
1203 C CB  . VAL A 153 ? 0.4909 0.4111 0.5759 0.0235  -0.0040 0.0449  153 VAL A CB  
1204 C CG1 . VAL A 153 ? 0.4976 0.4004 0.5731 0.0264  -0.0014 0.0403  153 VAL A CG1 
1205 C CG2 . VAL A 153 ? 0.4881 0.4109 0.5773 0.0155  -0.0115 0.0453  153 VAL A CG2 
1206 N N   . GLY A 154 ? 0.4900 0.4492 0.5886 0.0285  0.0008  0.0554  154 GLY A N   
1207 C CA  . GLY A 154 ? 0.4883 0.4712 0.5973 0.0255  0.0005  0.0620  154 GLY A CA  
1208 C C   . GLY A 154 ? 0.5015 0.5062 0.6145 0.0353  0.0033  0.0666  154 GLY A C   
1209 O O   . GLY A 154 ? 0.5068 0.5041 0.6117 0.0476  0.0079  0.0641  154 GLY A O   
1210 N N   . THR A 155 ? 0.4918 0.5232 0.6169 0.0300  0.0004  0.0738  155 THR A N   
1211 C CA  . THR A 155 ? 0.4936 0.5521 0.6248 0.0398  0.0031  0.0795  155 THR A CA  
1212 C C   . THR A 155 ? 0.5006 0.5540 0.6271 0.0483  0.0016  0.0777  155 THR A C   
1213 O O   . THR A 155 ? 0.5177 0.5755 0.6402 0.0636  0.0070  0.0786  155 THR A O   
1214 C CB  . THR A 155 ? 0.4937 0.5846 0.6405 0.0297  -0.0017 0.0884  155 THR A CB  
1215 O OG1 . THR A 155 ? 0.4852 0.5672 0.6343 0.0147  -0.0110 0.0873  155 THR A OG1 
1216 C CG2 . THR A 155 ? 0.4814 0.5856 0.6336 0.0247  0.0019  0.0933  155 THR A CG2 
1217 N N   . PHE A 156 ? 0.4922 0.5348 0.6178 0.0394  -0.0056 0.0752  156 PHE A N   
1218 C CA  . PHE A 156 ? 0.4885 0.5299 0.6100 0.0459  -0.0082 0.0747  156 PHE A CA  
1219 C C   . PHE A 156 ? 0.4954 0.5142 0.6035 0.0596  -0.0015 0.0706  156 PHE A C   
1220 O O   . PHE A 156 ? 0.5121 0.5356 0.6170 0.0711  -0.0003 0.0731  156 PHE A O   
1221 C CB  . PHE A 156 ? 0.4833 0.5127 0.6027 0.0338  -0.0164 0.0710  156 PHE A CB  
1222 C CG  . PHE A 156 ? 0.4662 0.5093 0.5957 0.0181  -0.0235 0.0739  156 PHE A CG  
1223 C CD1 . PHE A 156 ? 0.4733 0.5455 0.6130 0.0135  -0.0295 0.0800  156 PHE A CD1 
1224 C CD2 . PHE A 156 ? 0.4441 0.4713 0.5727 0.0076  -0.0245 0.0711  156 PHE A CD2 
1225 C CE1 . PHE A 156 ? 0.4846 0.5681 0.6332 -0.0038 -0.0368 0.0832  156 PHE A CE1 
1226 C CE2 . PHE A 156 ? 0.4610 0.4967 0.5973 -0.0076 -0.0312 0.0745  156 PHE A CE2 
1227 C CZ  . PHE A 156 ? 0.4754 0.5382 0.6215 -0.0144 -0.0375 0.0804  156 PHE A CZ  
1228 N N   . GLY A 157 ? 0.4945 0.4894 0.5943 0.0580  0.0025  0.0649  157 GLY A N   
1229 C CA  . GLY A 157 ? 0.5011 0.4714 0.5872 0.0674  0.0080  0.0606  157 GLY A CA  
1230 C C   . GLY A 157 ? 0.5103 0.4797 0.5913 0.0789  0.0157  0.0606  157 GLY A C   
1231 O O   . GLY A 157 ? 0.5187 0.4712 0.5879 0.0901  0.0202  0.0590  157 GLY A O   
1232 N N   . PHE A 158 ? 0.5029 0.4889 0.5912 0.0763  0.0174  0.0625  158 PHE A N   
1233 C CA  . PHE A 158 ? 0.5083 0.4895 0.5890 0.0851  0.0248  0.0602  158 PHE A CA  
1234 C C   . PHE A 158 ? 0.5180 0.5299 0.6068 0.0924  0.0286  0.0659  158 PHE A C   
1235 O O   . PHE A 158 ? 0.5311 0.5390 0.6110 0.1026  0.0355  0.0634  158 PHE A O   
1236 C CB  . PHE A 158 ? 0.5059 0.4666 0.5799 0.0756  0.0254  0.0540  158 PHE A CB  
1237 C CG  . PHE A 158 ? 0.4986 0.4304 0.5626 0.0719  0.0239  0.0485  158 PHE A CG  
1238 C CD1 . PHE A 158 ? 0.4925 0.4016 0.5417 0.0811  0.0283  0.0449  158 PHE A CD1 
1239 C CD2 . PHE A 158 ? 0.4571 0.3846 0.5257 0.0599  0.0184  0.0476  158 PHE A CD2 
1240 C CE1 . PHE A 158 ? 0.4999 0.3858 0.5410 0.0763  0.0271  0.0414  158 PHE A CE1 
1241 C CE2 . PHE A 158 ? 0.4631 0.3689 0.5234 0.0572  0.0178  0.0436  158 PHE A CE2 
1242 C CZ  . PHE A 158 ? 0.4692 0.3557 0.5167 0.0644  0.0220  0.0410  158 PHE A CZ  
1243 N N   . LEU A 159 ? 0.5059 0.5489 0.6106 0.0872  0.0243  0.0735  159 LEU A N   
1244 C CA  . LEU A 159 ? 0.5033 0.5803 0.6170 0.0945  0.0282  0.0805  159 LEU A CA  
1245 C C   . LEU A 159 ? 0.5208 0.5987 0.6264 0.1164  0.0345  0.0808  159 LEU A C   
1246 O O   . LEU A 159 ? 0.5386 0.6110 0.6421 0.1225  0.0322  0.0817  159 LEU A O   
1247 C CB  . LEU A 159 ? 0.4863 0.5973 0.6189 0.0832  0.0214  0.0893  159 LEU A CB  
1248 C CG  . LEU A 159 ? 0.4796 0.6335 0.6249 0.0884  0.0249  0.0986  159 LEU A CG  
1249 C CD1 . LEU A 159 ? 0.4349 0.6150 0.5973 0.0685  0.0182  0.1063  159 LEU A CD1 
1250 C CD2 . LEU A 159 ? 0.4620 0.6372 0.6103 0.1057  0.0269  0.1034  159 LEU A CD2 
1251 N N   . ALA A 160 ? 0.5364 0.6192 0.6356 0.1292  0.0427  0.0799  160 ALA A N   
1252 C CA  . ALA A 160 ? 0.5585 0.6339 0.6456 0.1520  0.0495  0.0786  160 ALA A CA  
1253 C C   . ALA A 160 ? 0.5693 0.6810 0.6626 0.1663  0.0563  0.0846  160 ALA A C   
1254 O O   . ALA A 160 ? 0.5694 0.6947 0.6653 0.1616  0.0594  0.0849  160 ALA A O   
1255 C CB  . ALA A 160 ? 0.5728 0.6034 0.6371 0.1566  0.0539  0.0678  160 ALA A CB  
1256 N N   . LEU A 161 ? 0.5815 0.7113 0.6774 0.1843  0.0586  0.0903  161 LEU A N   
1257 C CA  . LEU A 161 ? 0.5949 0.7541 0.6918 0.2043  0.0672  0.0947  161 LEU A CA  
1258 C C   . LEU A 161 ? 0.6264 0.7516 0.7002 0.2285  0.0741  0.0884  161 LEU A C   
1259 O O   . LEU A 161 ? 0.6352 0.7679 0.7092 0.2453  0.0749  0.0934  161 LEU A O   
1260 C CB  . LEU A 161 ? 0.5836 0.7975 0.7042 0.2053  0.0642  0.1080  161 LEU A CB  
1261 C CG  . LEU A 161 ? 0.5781 0.8189 0.7157 0.1816  0.0601  0.1125  161 LEU A CG  
1262 C CD1 . LEU A 161 ? 0.5724 0.8298 0.7281 0.1598  0.0485  0.1187  161 LEU A CD1 
1263 C CD2 . LEU A 161 ? 0.5802 0.8658 0.7271 0.1902  0.0677  0.1200  161 LEU A CD2 
1264 N N   . PRO A 162 ? 0.6463 0.7318 0.6989 0.2297  0.0786  0.0772  162 PRO A N   
1265 C CA  . PRO A 162 ? 0.6844 0.7233 0.7113 0.2461  0.0830  0.0691  162 PRO A CA  
1266 C C   . PRO A 162 ? 0.7193 0.7717 0.7410 0.2762  0.0903  0.0736  162 PRO A C   
1267 O O   . PRO A 162 ? 0.7251 0.8138 0.7535 0.2883  0.0964  0.0778  162 PRO A O   
1268 C CB  . PRO A 162 ? 0.6910 0.7013 0.6995 0.2419  0.0872  0.0576  162 PRO A CB  
1269 C CG  . PRO A 162 ? 0.6521 0.6823 0.6772 0.2168  0.0816  0.0594  162 PRO A CG  
1270 C CD  . PRO A 162 ? 0.6352 0.7188 0.6858 0.2160  0.0798  0.0720  162 PRO A CD  
1271 N N   . GLY A 163 ? 0.7498 0.7749 0.7600 0.2886  0.0899  0.0739  163 GLY A N   
1272 C CA  . GLY A 163 ? 0.7871 0.8227 0.7917 0.3192  0.0964  0.0793  163 GLY A CA  
1273 C C   . GLY A 163 ? 0.7801 0.8607 0.8082 0.3220  0.0912  0.0932  163 GLY A C   
1274 O O   . GLY A 163 ? 0.8061 0.8934 0.8305 0.3466  0.0945  0.0993  163 GLY A O   
1275 N N   . SER A 164 ? 0.7511 0.8620 0.8024 0.2971  0.0827  0.0981  164 SER A N   
1276 C CA  . SER A 164 ? 0.7403 0.8954 0.8139 0.2957  0.0762  0.1106  164 SER A CA  
1277 C C   . SER A 164 ? 0.7570 0.8835 0.8243 0.2917  0.0693  0.1111  164 SER A C   
1278 O O   . SER A 164 ? 0.7676 0.8430 0.8170 0.2838  0.0684  0.1022  164 SER A O   
1279 C CB  . SER A 164 ? 0.7021 0.8996 0.8013 0.2700  0.0695  0.1155  164 SER A CB  
1280 O OG  . SER A 164 ? 0.6491 0.8232 0.7497 0.2440  0.0605  0.1111  164 SER A OG  
1281 N N   . ARG A 165 ? 0.7616 0.9238 0.8438 0.2967  0.0642  0.1221  165 ARG A N   
1282 C CA  . ARG A 165 ? 0.7776 0.9212 0.8556 0.2929  0.0571  0.1244  165 ARG A CA  
1283 C C   . ARG A 165 ? 0.7408 0.8975 0.8345 0.2619  0.0460  0.1243  165 ARG A C   
1284 O O   . ARG A 165 ? 0.7393 0.8646 0.8245 0.2503  0.0409  0.1204  165 ARG A O   
1285 C CB  . ARG A 165 ? 0.8028 0.9777 0.8863 0.3168  0.0572  0.1364  165 ARG A CB  
1286 C CG  . ARG A 165 ? 0.8498 1.0136 0.9300 0.3148  0.0495  0.1411  165 ARG A CG  
1287 C CD  . ARG A 165 ? 0.9342 1.1380 1.0225 0.3393  0.0494  0.1545  165 ARG A CD  
1288 N NE  . ARG A 165 ? 1.0072 1.1924 1.0858 0.3439  0.0441  0.1592  165 ARG A NE  
1289 C CZ  . ARG A 165 ? 1.0563 1.2220 1.1187 0.3719  0.0489  0.1647  165 ARG A CZ  
1290 N NH1 . ARG A 165 ? 1.0860 1.2467 1.1390 0.3995  0.0594  0.1652  165 ARG A NH1 
1291 N NH2 . ARG A 165 ? 1.0670 1.2178 1.1214 0.3733  0.0434  0.1700  165 ARG A NH2 
1292 N N   . GLU A 166 ? 0.7137 0.9152 0.8289 0.2487  0.0429  0.1284  166 GLU A N   
1293 C CA  . GLU A 166 ? 0.6847 0.9040 0.8156 0.2215  0.0317  0.1298  166 GLU A CA  
1294 C C   . GLU A 166 ? 0.6648 0.8528 0.7911 0.1982  0.0296  0.1199  166 GLU A C   
1295 O O   . GLU A 166 ? 0.6593 0.8455 0.7914 0.1775  0.0207  0.1185  166 GLU A O   
1296 C CB  . GLU A 166 ? 0.6766 0.9582 0.8328 0.2154  0.0280  0.1400  166 GLU A CB  
1297 C CG  . GLU A 166 ? 0.6993 1.0241 0.8648 0.2368  0.0285  0.1519  166 GLU A CG  
1298 C CD  . GLU A 166 ? 0.7422 1.0866 0.9071 0.2629  0.0405  0.1556  166 GLU A CD  
1299 O OE1 . GLU A 166 ? 0.7398 1.0583 0.8929 0.2666  0.0489  0.1479  166 GLU A OE1 
1300 O OE2 . GLU A 166 ? 0.7765 1.1644 0.9522 0.2808  0.0414  0.1666  166 GLU A OE2 
1301 N N   . ALA A 167 ? 0.6599 0.8243 0.7753 0.2021  0.0376  0.1129  167 ALA A N   
1302 C CA  . ALA A 167 ? 0.6362 0.7709 0.7460 0.1826  0.0365  0.1038  167 ALA A CA  
1303 C C   . ALA A 167 ? 0.6507 0.7449 0.7392 0.1940  0.0454  0.0949  167 ALA A C   
1304 O O   . ALA A 167 ? 0.6550 0.7536 0.7422 0.1951  0.0509  0.0922  167 ALA A O   
1305 C CB  . ALA A 167 ? 0.6123 0.7792 0.7396 0.1660  0.0341  0.1068  167 ALA A CB  
1306 N N   . PRO A 168 ? 0.6620 0.7161 0.7324 0.2014  0.0465  0.0905  168 PRO A N   
1307 C CA  . PRO A 168 ? 0.6845 0.6995 0.7327 0.2137  0.0546  0.0827  168 PRO A CA  
1308 C C   . PRO A 168 ? 0.6812 0.6664 0.7211 0.1962  0.0543  0.0728  168 PRO A C   
1309 O O   . PRO A 168 ? 0.7059 0.6588 0.7269 0.2030  0.0600  0.0652  168 PRO A O   
1310 C CB  . PRO A 168 ? 0.7055 0.6892 0.7385 0.2247  0.0544  0.0835  168 PRO A CB  
1311 C CG  . PRO A 168 ? 0.6818 0.6761 0.7265 0.2088  0.0451  0.0875  168 PRO A CG  
1312 C CD  . PRO A 168 ? 0.6599 0.7029 0.7284 0.1985  0.0402  0.0931  168 PRO A CD  
1313 N N   . GLY A 169 ? 0.6543 0.6494 0.7072 0.1742  0.0473  0.0727  169 GLY A N   
1314 C CA  . GLY A 169 ? 0.6402 0.6104 0.6874 0.1570  0.0458  0.0647  169 GLY A CA  
1315 C C   . GLY A 169 ? 0.6471 0.5772 0.6801 0.1517  0.0440  0.0595  169 GLY A C   
1316 O O   . GLY A 169 ? 0.6662 0.5802 0.6894 0.1629  0.0452  0.0614  169 GLY A O   
1317 N N   . ASN A 170 ? 0.6307 0.5466 0.6631 0.1344  0.0412  0.0540  170 ASN A N   
1318 C CA  . ASN A 170 ? 0.6265 0.5083 0.6469 0.1267  0.0398  0.0493  170 ASN A CA  
1319 C C   . ASN A 170 ? 0.6145 0.4979 0.6397 0.1222  0.0344  0.0536  170 ASN A C   
1320 O O   . ASN A 170 ? 0.6274 0.4852 0.6424 0.1178  0.0339  0.0514  170 ASN A O   
1321 C CB  . ASN A 170 ? 0.6526 0.5000 0.6513 0.1381  0.0458  0.0448  170 ASN A CB  
1322 C CG  . ASN A 170 ? 0.6650 0.5016 0.6544 0.1367  0.0498  0.0372  170 ASN A CG  
1323 O OD1 . ASN A 170 ? 0.6445 0.4903 0.6412 0.1229  0.0474  0.0345  170 ASN A OD1 
1324 N ND2 . ASN A 170 ? 0.6408 0.4571 0.6126 0.1516  0.0558  0.0337  170 ASN A ND2 
1325 N N   . VAL A 171 ? 0.5890 0.5033 0.6291 0.1221  0.0300  0.0597  171 VAL A N   
1326 C CA  . VAL A 171 ? 0.5733 0.4901 0.6157 0.1194  0.0247  0.0634  171 VAL A CA  
1327 C C   . VAL A 171 ? 0.5684 0.4711 0.6100 0.1030  0.0207  0.0591  171 VAL A C   
1328 O O   . VAL A 171 ? 0.5765 0.4703 0.6131 0.1018  0.0182  0.0604  171 VAL A O   
1329 C CB  . VAL A 171 ? 0.5599 0.5142 0.6175 0.1222  0.0200  0.0708  171 VAL A CB  
1330 C CG1 . VAL A 171 ? 0.5566 0.5281 0.6156 0.1402  0.0250  0.0757  171 VAL A CG1 
1331 C CG2 . VAL A 171 ? 0.5320 0.5082 0.6048 0.1063  0.0144  0.0704  171 VAL A CG2 
1332 N N   . GLY A 172 ? 0.5523 0.4541 0.5981 0.0917  0.0202  0.0544  172 GLY A N   
1333 C CA  . GLY A 172 ? 0.5325 0.4215 0.5769 0.0786  0.0174  0.0503  172 GLY A CA  
1334 C C   . GLY A 172 ? 0.5362 0.3960 0.5659 0.0793  0.0212  0.0474  172 GLY A C   
1335 O O   . GLY A 172 ? 0.5247 0.3751 0.5510 0.0732  0.0194  0.0468  172 GLY A O   
1336 N N   . LEU A 173 ? 0.5532 0.3982 0.5730 0.0863  0.0264  0.0456  173 LEU A N   
1337 C CA  . LEU A 173 ? 0.5754 0.3896 0.5794 0.0859  0.0297  0.0434  173 LEU A CA  
1338 C C   . LEU A 173 ? 0.5843 0.3912 0.5820 0.0936  0.0296  0.0489  173 LEU A C   
1339 O O   . LEU A 173 ? 0.6024 0.3931 0.5926 0.0878  0.0294  0.0496  173 LEU A O   
1340 C CB  . LEU A 173 ? 0.5905 0.3865 0.5822 0.0921  0.0349  0.0393  173 LEU A CB  
1341 C CG  . LEU A 173 ? 0.5932 0.3953 0.5888 0.0839  0.0350  0.0337  173 LEU A CG  
1342 C CD1 . LEU A 173 ? 0.6096 0.3961 0.5915 0.0926  0.0401  0.0294  173 LEU A CD1 
1343 C CD2 . LEU A 173 ? 0.5683 0.3629 0.5644 0.0678  0.0326  0.0303  173 LEU A CD2 
1344 N N   . LEU A 174 ? 0.5837 0.4057 0.5850 0.1065  0.0295  0.0539  174 LEU A N   
1345 C CA  . LEU A 174 ? 0.5917 0.4109 0.5875 0.1159  0.0290  0.0604  174 LEU A CA  
1346 C C   . LEU A 174 ? 0.5904 0.4192 0.5913 0.1067  0.0237  0.0626  174 LEU A C   
1347 O O   . LEU A 174 ? 0.6105 0.4248 0.6014 0.1085  0.0241  0.0663  174 LEU A O   
1348 C CB  . LEU A 174 ? 0.5894 0.4295 0.5906 0.1318  0.0296  0.0656  174 LEU A CB  
1349 C CG  . LEU A 174 ? 0.6218 0.4440 0.6108 0.1464  0.0363  0.0644  174 LEU A CG  
1350 C CD1 . LEU A 174 ? 0.6314 0.4776 0.6260 0.1646  0.0373  0.0710  174 LEU A CD1 
1351 C CD2 . LEU A 174 ? 0.6376 0.4184 0.6055 0.1504  0.0401  0.0641  174 LEU A CD2 
1352 N N   . ASP A 175 ? 0.5602 0.4111 0.5747 0.0969  0.0189  0.0601  175 ASP A N   
1353 C CA  . ASP A 175 ? 0.5452 0.4028 0.5623 0.0885  0.0141  0.0602  175 ASP A CA  
1354 C C   . ASP A 175 ? 0.5521 0.3871 0.5597 0.0806  0.0167  0.0576  175 ASP A C   
1355 O O   . ASP A 175 ? 0.5580 0.3893 0.5597 0.0795  0.0157  0.0602  175 ASP A O   
1356 C CB  . ASP A 175 ? 0.5370 0.4148 0.5676 0.0787  0.0089  0.0567  175 ASP A CB  
1357 C CG  . ASP A 175 ? 0.5391 0.4433 0.5810 0.0829  0.0054  0.0601  175 ASP A CG  
1358 O OD1 . ASP A 175 ? 0.5365 0.4485 0.5771 0.0949  0.0065  0.0657  175 ASP A OD1 
1359 O OD2 . ASP A 175 ? 0.5101 0.4281 0.5625 0.0740  0.0016  0.0578  175 ASP A OD2 
1360 N N   . GLN A 176 ? 0.5543 0.3772 0.5606 0.0745  0.0197  0.0528  176 GLN A N   
1361 C CA  . GLN A 176 ? 0.5643 0.3693 0.5632 0.0654  0.0221  0.0507  176 GLN A CA  
1362 C C   . GLN A 176 ? 0.5997 0.3815 0.5837 0.0703  0.0258  0.0553  176 GLN A C   
1363 O O   . GLN A 176 ? 0.6101 0.3834 0.5879 0.0645  0.0266  0.0576  176 GLN A O   
1364 C CB  . GLN A 176 ? 0.5589 0.3577 0.5592 0.0586  0.0240  0.0451  176 GLN A CB  
1365 C CG  . GLN A 176 ? 0.5650 0.3835 0.5789 0.0528  0.0206  0.0413  176 GLN A CG  
1366 C CD  . GLN A 176 ? 0.6014 0.4148 0.6153 0.0475  0.0225  0.0368  176 GLN A CD  
1367 O OE1 . GLN A 176 ? 0.5668 0.3608 0.5697 0.0466  0.0260  0.0353  176 GLN A OE1 
1368 N NE2 . GLN A 176 ? 0.5139 0.3429 0.5386 0.0435  0.0200  0.0347  176 GLN A NE2 
1369 N N   . ARG A 177 ? 0.6109 0.3818 0.5881 0.0814  0.0284  0.0571  177 ARG A N   
1370 C CA  . ARG A 177 ? 0.6483 0.3929 0.6095 0.0868  0.0318  0.0620  177 ARG A CA  
1371 C C   . ARG A 177 ? 0.6516 0.4039 0.6111 0.0910  0.0297  0.0696  177 ARG A C   
1372 O O   . ARG A 177 ? 0.6802 0.4124 0.6269 0.0906  0.0319  0.0749  177 ARG A O   
1373 C CB  . ARG A 177 ? 0.6692 0.3999 0.6219 0.1014  0.0351  0.0627  177 ARG A CB  
1374 C CG  . ARG A 177 ? 0.7000 0.3977 0.6338 0.1069  0.0386  0.0675  177 ARG A CG  
1375 C CD  . ARG A 177 ? 0.7744 0.4555 0.6978 0.1233  0.0423  0.0670  177 ARG A CD  
1376 N NE  . ARG A 177 ? 0.7961 0.4598 0.7133 0.1176  0.0448  0.0580  177 ARG A NE  
1377 C CZ  . ARG A 177 ? 0.8143 0.4685 0.7241 0.1304  0.0482  0.0542  177 ARG A CZ  
1378 N NH1 . ARG A 177 ? 0.8065 0.4689 0.7158 0.1509  0.0500  0.0592  177 ARG A NH1 
1379 N NH2 . ARG A 177 ? 0.8173 0.4558 0.7199 0.1231  0.0498  0.0454  177 ARG A NH2 
1380 N N   . LEU A 178 ? 0.6167 0.3976 0.5881 0.0945  0.0253  0.0704  178 LEU A N   
1381 C CA  . LEU A 178 ? 0.6163 0.4067 0.5852 0.1000  0.0226  0.0772  178 LEU A CA  
1382 C C   . LEU A 178 ? 0.6175 0.4099 0.5853 0.0881  0.0215  0.0762  178 LEU A C   
1383 O O   . LEU A 178 ? 0.6398 0.4251 0.5979 0.0894  0.0223  0.0824  178 LEU A O   
1384 C CB  . LEU A 178 ? 0.5963 0.4167 0.5768 0.1072  0.0176  0.0784  178 LEU A CB  
1385 C CG  . LEU A 178 ? 0.5934 0.4276 0.5711 0.1139  0.0136  0.0856  178 LEU A CG  
1386 C CD1 . LEU A 178 ? 0.5769 0.3935 0.5408 0.1276  0.0172  0.0947  178 LEU A CD1 
1387 C CD2 . LEU A 178 ? 0.5389 0.4063 0.5303 0.1165  0.0073  0.0855  178 LEU A CD2 
1388 N N   . ALA A 179 ? 0.5987 0.4010 0.5760 0.0775  0.0199  0.0690  179 ALA A N   
1389 C CA  . ALA A 179 ? 0.5809 0.3848 0.5570 0.0675  0.0200  0.0674  179 ALA A CA  
1390 C C   . ALA A 179 ? 0.5968 0.3769 0.5613 0.0628  0.0254  0.0712  179 ALA A C   
1391 O O   . ALA A 179 ? 0.6029 0.3809 0.5602 0.0599  0.0268  0.0759  179 ALA A O   
1392 C CB  . ALA A 179 ? 0.5496 0.3643 0.5368 0.0590  0.0183  0.0596  179 ALA A CB  
1393 N N   . LEU A 180 ? 0.6085 0.3706 0.5701 0.0614  0.0283  0.0692  180 LEU A N   
1394 C CA  . LEU A 180 ? 0.6442 0.3803 0.5930 0.0555  0.0326  0.0729  180 LEU A CA  
1395 C C   . LEU A 180 ? 0.6742 0.3959 0.6095 0.0633  0.0341  0.0826  180 LEU A C   
1396 O O   . LEU A 180 ? 0.6906 0.4021 0.6175 0.0559  0.0365  0.0882  180 LEU A O   
1397 C CB  . LEU A 180 ? 0.6555 0.3716 0.6005 0.0532  0.0347  0.0680  180 LEU A CB  
1398 C CG  . LEU A 180 ? 0.6330 0.3544 0.5851 0.0393  0.0345  0.0611  180 LEU A CG  
1399 C CD1 . LEU A 180 ? 0.5859 0.3367 0.5543 0.0384  0.0311  0.0561  180 LEU A CD1 
1400 C CD2 . LEU A 180 ? 0.6218 0.3236 0.5676 0.0386  0.0360  0.0560  180 LEU A CD2 
1401 N N   . GLN A 181 ? 0.6836 0.4075 0.6175 0.0782  0.0328  0.0858  181 GLN A N   
1402 C CA  . GLN A 181 ? 0.7249 0.4353 0.6454 0.0877  0.0341  0.0962  181 GLN A CA  
1403 C C   . GLN A 181 ? 0.7145 0.4419 0.6345 0.0849  0.0323  0.1016  181 GLN A C   
1404 O O   . GLN A 181 ? 0.7393 0.4520 0.6468 0.0829  0.0350  0.1101  181 GLN A O   
1405 C CB  . GLN A 181 ? 0.7368 0.4508 0.6572 0.1061  0.0329  0.0989  181 GLN A CB  
1406 C CG  . GLN A 181 ? 0.7982 0.4797 0.7060 0.1147  0.0371  0.0996  181 GLN A CG  
1407 C CD  . GLN A 181 ? 0.8327 0.5269 0.7471 0.1310  0.0364  0.0975  181 GLN A CD  
1408 O OE1 . GLN A 181 ? 0.8538 0.5819 0.7841 0.1325  0.0325  0.0949  181 GLN A OE1 
1409 N NE2 . GLN A 181 ? 0.8387 0.5054 0.7402 0.1427  0.0404  0.0986  181 GLN A NE2 
1410 N N   . TRP A 182 ? 0.6782 0.4352 0.6106 0.0844  0.0279  0.0966  182 TRP A N   
1411 C CA  . TRP A 182 ? 0.6746 0.4503 0.6066 0.0818  0.0257  0.0986  182 TRP A CA  
1412 C C   . TRP A 182 ? 0.6760 0.4451 0.6029 0.0693  0.0297  0.1001  182 TRP A C   
1413 O O   . TRP A 182 ? 0.6815 0.4564 0.6008 0.0690  0.0304  0.1062  182 TRP A O   
1414 C CB  . TRP A 182 ? 0.6449 0.4478 0.5907 0.0802  0.0202  0.0898  182 TRP A CB  
1415 C CG  . TRP A 182 ? 0.6513 0.4719 0.5943 0.0790  0.0174  0.0901  182 TRP A CG  
1416 C CD1 . TRP A 182 ? 0.6558 0.4916 0.5956 0.0868  0.0125  0.0934  182 TRP A CD1 
1417 C CD2 . TRP A 182 ? 0.6661 0.4920 0.6078 0.0702  0.0192  0.0869  182 TRP A CD2 
1418 N NE1 . TRP A 182 ? 0.6708 0.5188 0.6059 0.0831  0.0111  0.0915  182 TRP A NE1 
1419 C CE2 . TRP A 182 ? 0.6686 0.5111 0.6049 0.0738  0.0156  0.0875  182 TRP A CE2 
1420 C CE3 . TRP A 182 ? 0.6721 0.4925 0.6167 0.0601  0.0235  0.0836  182 TRP A CE3 
1421 C CZ2 . TRP A 182 ? 0.6736 0.5257 0.6061 0.0690  0.0168  0.0843  182 TRP A CZ2 
1422 C CZ3 . TRP A 182 ? 0.6834 0.5163 0.6264 0.0555  0.0248  0.0815  182 TRP A CZ3 
1423 C CH2 . TRP A 182 ? 0.6831 0.5308 0.6195 0.0607  0.0218  0.0816  182 TRP A CH2 
1424 N N   . VAL A 183 ? 0.6702 0.4302 0.6015 0.0590  0.0323  0.0948  183 VAL A N   
1425 C CA  . VAL A 183 ? 0.6706 0.4301 0.5998 0.0462  0.0359  0.0963  183 VAL A CA  
1426 C C   . VAL A 183 ? 0.7063 0.4416 0.6205 0.0438  0.0400  0.1072  183 VAL A C   
1427 O O   . VAL A 183 ? 0.7170 0.4577 0.6249 0.0398  0.0423  0.1143  183 VAL A O   
1428 C CB  . VAL A 183 ? 0.6589 0.4200 0.5983 0.0354  0.0366  0.0879  183 VAL A CB  
1429 C CG1 . VAL A 183 ? 0.6470 0.4025 0.5826 0.0214  0.0409  0.0921  183 VAL A CG1 
1430 C CG2 . VAL A 183 ? 0.6131 0.4003 0.5658 0.0366  0.0330  0.0792  183 VAL A CG2 
1431 N N   . GLN A 184 ? 0.7268 0.4347 0.6336 0.0472  0.0410  0.1089  184 GLN A N   
1432 C CA  . GLN A 184 ? 0.7608 0.4397 0.6506 0.0468  0.0444  0.1198  184 GLN A CA  
1433 C C   . GLN A 184 ? 0.7732 0.4609 0.6553 0.0552  0.0441  0.1301  184 GLN A C   
1434 O O   . GLN A 184 ? 0.7902 0.4679 0.6612 0.0489  0.0474  0.1404  184 GLN A O   
1435 C CB  . GLN A 184 ? 0.7776 0.4256 0.6587 0.0557  0.0448  0.1194  184 GLN A CB  
1436 C CG  . GLN A 184 ? 0.7854 0.4163 0.6675 0.0449  0.0458  0.1110  184 GLN A CG  
1437 C CD  . GLN A 184 ? 0.8060 0.4200 0.6805 0.0258  0.0486  0.1150  184 GLN A CD  
1438 O OE1 . GLN A 184 ? 0.7749 0.4065 0.6598 0.0120  0.0485  0.1103  184 GLN A OE1 
1439 N NE2 . GLN A 184 ? 0.8595 0.4393 0.7156 0.0247  0.0511  0.1244  184 GLN A NE2 
1440 N N   . GLU A 185 ? 0.7571 0.4649 0.6447 0.0687  0.0400  0.1282  185 GLU A N   
1441 C CA  . GLU A 185 ? 0.7707 0.4855 0.6488 0.0780  0.0391  0.1385  185 GLU A CA  
1442 C C   . GLU A 185 ? 0.7486 0.4890 0.6281 0.0715  0.0391  0.1392  185 GLU A C   
1443 O O   . GLU A 185 ? 0.7716 0.5116 0.6394 0.0728  0.0408  0.1499  185 GLU A O   
1444 C CB  . GLU A 185 ? 0.7710 0.4984 0.6525 0.0950  0.0342  0.1381  185 GLU A CB  
1445 C CG  . GLU A 185 ? 0.8124 0.5541 0.6852 0.1037  0.0320  0.1479  185 GLU A CG  
1446 C CD  . GLU A 185 ? 0.8629 0.6062 0.7331 0.1218  0.0286  0.1536  185 GLU A CD  
1447 O OE1 . GLU A 185 ? 0.8624 0.6166 0.7445 0.1279  0.0254  0.1461  185 GLU A OE1 
1448 O OE2 . GLU A 185 ? 0.8606 0.5965 0.7170 0.1299  0.0294  0.1663  185 GLU A OE2 
1449 N N   . ASN A 186 ? 0.7070 0.4690 0.5996 0.0654  0.0374  0.1281  186 ASN A N   
1450 C CA  . ASN A 186 ? 0.6822 0.4701 0.5751 0.0638  0.0366  0.1268  186 ASN A CA  
1451 C C   . ASN A 186 ? 0.6767 0.4731 0.5737 0.0509  0.0408  0.1238  186 ASN A C   
1452 O O   . ASN A 186 ? 0.6847 0.4980 0.5769 0.0498  0.0426  0.1265  186 ASN A O   
1453 C CB  . ASN A 186 ? 0.6607 0.4702 0.5625 0.0711  0.0300  0.1171  186 ASN A CB  
1454 C CG  . ASN A 186 ? 0.6554 0.4643 0.5545 0.0838  0.0255  0.1212  186 ASN A CG  
1455 O OD1 . ASN A 186 ? 0.6887 0.5067 0.5783 0.0908  0.0235  0.1281  186 ASN A OD1 
1456 N ND2 . ASN A 186 ? 0.6043 0.4050 0.5115 0.0878  0.0239  0.1174  186 ASN A ND2 
1457 N N   . ILE A 187 ? 0.6688 0.4563 0.5744 0.0418  0.0425  0.1185  187 ILE A N   
1458 C CA  . ILE A 187 ? 0.6580 0.4593 0.5701 0.0304  0.0459  0.1154  187 ILE A CA  
1459 C C   . ILE A 187 ? 0.6829 0.4910 0.5853 0.0241  0.0515  0.1264  187 ILE A C   
1460 O O   . ILE A 187 ? 0.6694 0.5014 0.5752 0.0222  0.0535  0.1240  187 ILE A O   
1461 C CB  . ILE A 187 ? 0.6450 0.4352 0.5662 0.0204  0.0467  0.1099  187 ILE A CB  
1462 C CG1 . ILE A 187 ? 0.6220 0.4361 0.5555 0.0154  0.0471  0.1018  187 ILE A CG1 
1463 C CG2 . ILE A 187 ? 0.6643 0.4291 0.5765 0.0090  0.0508  0.1192  187 ILE A CG2 
1464 C CD1 . ILE A 187 ? 0.5888 0.4199 0.5294 0.0258  0.0422  0.0914  187 ILE A CD1 
1465 N N   . ALA A 188 ? 0.7137 0.5006 0.6036 0.0218  0.0541  0.1388  188 ALA A N   
1466 C CA  . ALA A 188 ? 0.7359 0.5282 0.6149 0.0164  0.0592  0.1517  188 ALA A CA  
1467 C C   . ALA A 188 ? 0.7331 0.5549 0.6088 0.0248  0.0591  0.1512  188 ALA A C   
1468 O O   . ALA A 188 ? 0.7431 0.5829 0.6165 0.0189  0.0642  0.1564  188 ALA A O   
1469 C CB  . ALA A 188 ? 0.7651 0.5277 0.6288 0.0177  0.0602  0.1649  188 ALA A CB  
1470 N N   . ALA A 189 ? 0.7250 0.5531 0.6001 0.0383  0.0534  0.1448  189 ALA A N   
1471 C CA  . ALA A 189 ? 0.7189 0.5726 0.5889 0.0462  0.0521  0.1420  189 ALA A CA  
1472 C C   . ALA A 189 ? 0.7024 0.5788 0.5811 0.0425  0.0543  0.1321  189 ALA A C   
1473 O O   . ALA A 189 ? 0.7151 0.6125 0.5874 0.0474  0.0555  0.1305  189 ALA A O   
1474 C CB  . ALA A 189 ? 0.7041 0.5602 0.5734 0.0590  0.0442  0.1355  189 ALA A CB  
1475 N N   . PHE A 190 ? 0.6906 0.5632 0.5829 0.0350  0.0550  0.1256  190 PHE A N   
1476 C CA  . PHE A 190 ? 0.6722 0.5659 0.5739 0.0333  0.0568  0.1163  190 PHE A CA  
1477 C C   . PHE A 190 ? 0.6807 0.5798 0.5872 0.0201  0.0638  0.1237  190 PHE A C   
1478 O O   . PHE A 190 ? 0.6711 0.5880 0.5876 0.0175  0.0660  0.1179  190 PHE A O   
1479 C CB  . PHE A 190 ? 0.6382 0.5274 0.5531 0.0352  0.0515  0.1032  190 PHE A CB  
1480 C CG  . PHE A 190 ? 0.6356 0.5208 0.5484 0.0454  0.0440  0.0959  190 PHE A CG  
1481 C CD1 . PHE A 190 ? 0.6383 0.5057 0.5495 0.0480  0.0403  0.0996  190 PHE A CD1 
1482 C CD2 . PHE A 190 ? 0.6135 0.5126 0.5263 0.0524  0.0403  0.0849  190 PHE A CD2 
1483 C CE1 . PHE A 190 ? 0.6405 0.5091 0.5519 0.0566  0.0330  0.0936  190 PHE A CE1 
1484 C CE2 . PHE A 190 ? 0.5983 0.4947 0.5097 0.0592  0.0325  0.0784  190 PHE A CE2 
1485 C CZ  . PHE A 190 ? 0.6123 0.4960 0.5243 0.0608  0.0288  0.0831  190 PHE A CZ  
1486 N N   . GLY A 191 ? 0.6942 0.5776 0.5939 0.0115  0.0668  0.1366  191 GLY A N   
1487 C CA  . GLY A 191 ? 0.7114 0.5987 0.6152 -0.0042 0.0726  0.1448  191 GLY A CA  
1488 C C   . GLY A 191 ? 0.7089 0.5809 0.6239 -0.0151 0.0707  0.1404  191 GLY A C   
1489 O O   . GLY A 191 ? 0.7137 0.5937 0.6347 -0.0292 0.0744  0.1450  191 GLY A O   
1490 N N   . GLY A 192 ? 0.7019 0.5543 0.6197 -0.0090 0.0649  0.1318  192 GLY A N   
1491 C CA  . GLY A 192 ? 0.6997 0.5333 0.6243 -0.0184 0.0630  0.1280  192 GLY A CA  
1492 C C   . GLY A 192 ? 0.7327 0.5333 0.6453 -0.0267 0.0640  0.1380  192 GLY A C   
1493 O O   . GLY A 192 ? 0.7480 0.5348 0.6477 -0.0197 0.0642  0.1458  192 GLY A O   
1494 N N   . ASP A 193 ? 0.7413 0.5288 0.6570 -0.0416 0.0643  0.1381  193 ASP A N   
1495 C CA  . ASP A 193 ? 0.7715 0.5220 0.6743 -0.0512 0.0647  0.1458  193 ASP A CA  
1496 C C   . ASP A 193 ? 0.7794 0.5027 0.6800 -0.0425 0.0602  0.1369  193 ASP A C   
1497 O O   . ASP A 193 ? 0.7650 0.4886 0.6746 -0.0469 0.0578  0.1271  193 ASP A O   
1498 C CB  . ASP A 193 ? 0.7806 0.5313 0.6871 -0.0734 0.0664  0.1488  193 ASP A CB  
1499 C CG  . ASP A 193 ? 0.8294 0.5391 0.7192 -0.0864 0.0671  0.1585  193 ASP A CG  
1500 O OD1 . ASP A 193 ? 0.8317 0.5071 0.7072 -0.0762 0.0659  0.1606  193 ASP A OD1 
1501 O OD2 . ASP A 193 ? 0.8458 0.5575 0.7364 -0.1073 0.0687  0.1644  193 ASP A OD2 
1502 N N   . PRO A 194 ? 0.8026 0.5035 0.6911 -0.0294 0.0593  0.1408  194 PRO A N   
1503 C CA  . PRO A 194 ? 0.8021 0.4813 0.6897 -0.0195 0.0557  0.1321  194 PRO A CA  
1504 C C   . PRO A 194 ? 0.8304 0.4761 0.7103 -0.0321 0.0557  0.1308  194 PRO A C   
1505 O O   . PRO A 194 ? 0.8379 0.4702 0.7189 -0.0265 0.0532  0.1215  194 PRO A O   
1506 C CB  . PRO A 194 ? 0.8136 0.4791 0.6894 -0.0025 0.0551  0.1386  194 PRO A CB  
1507 C CG  . PRO A 194 ? 0.8236 0.4915 0.6895 -0.0070 0.0586  0.1526  194 PRO A CG  
1508 C CD  . PRO A 194 ? 0.8164 0.5119 0.6916 -0.0225 0.0614  0.1533  194 PRO A CD  
1509 N N   . MET A 195 ? 0.8561 0.4894 0.7280 -0.0496 0.0584  0.1398  195 MET A N   
1510 C CA  . MET A 195 ? 0.8889 0.4881 0.7513 -0.0647 0.0578  0.1385  195 MET A CA  
1511 C C   . MET A 195 ? 0.8672 0.4872 0.7438 -0.0799 0.0560  0.1297  195 MET A C   
1512 O O   . MET A 195 ? 0.8805 0.4788 0.7505 -0.0965 0.0549  0.1283  195 MET A O   
1513 C CB  . MET A 195 ? 0.9415 0.5141 0.7870 -0.0787 0.0607  0.1532  195 MET A CB  
1514 C CG  . MET A 195 ? 0.9854 0.5283 0.8131 -0.0636 0.0620  0.1628  195 MET A CG  
1515 S SD  . MET A 195 ? 1.1182 0.6190 0.9228 -0.0811 0.0650  0.1800  195 MET A SD  
1516 C CE  . MET A 195 ? 1.1513 0.5967 0.9403 -0.0879 0.0619  0.1704  195 MET A CE  
1517 N N   . SER A 196 ? 0.8395 0.5008 0.7346 -0.0738 0.0554  0.1235  196 SER A N   
1518 C CA  . SER A 196 ? 0.8160 0.5020 0.7261 -0.0847 0.0537  0.1157  196 SER A CA  
1519 C C   . SER A 196 ? 0.7855 0.4978 0.7104 -0.0692 0.0516  0.1053  196 SER A C   
1520 O O   . SER A 196 ? 0.7644 0.5131 0.7027 -0.0665 0.0524  0.1046  196 SER A O   
1521 C CB  . SER A 196 ? 0.8159 0.5308 0.7335 -0.1004 0.0566  0.1240  196 SER A CB  
1522 O OG  . SER A 196 ? 0.8276 0.5659 0.7593 -0.1109 0.0546  0.1174  196 SER A OG  
1523 N N   . VAL A 197 ? 0.7883 0.4810 0.7097 -0.0586 0.0488  0.0973  197 VAL A N   
1524 C CA  . VAL A 197 ? 0.7448 0.4573 0.6788 -0.0451 0.0463  0.0878  197 VAL A CA  
1525 C C   . VAL A 197 ? 0.7378 0.4485 0.6768 -0.0524 0.0436  0.0787  197 VAL A C   
1526 O O   . VAL A 197 ? 0.7614 0.4421 0.6890 -0.0559 0.0427  0.0758  197 VAL A O   
1527 C CB  . VAL A 197 ? 0.7472 0.4452 0.6747 -0.0262 0.0454  0.0870  197 VAL A CB  
1528 C CG1 . VAL A 197 ? 0.7143 0.4254 0.6529 -0.0156 0.0423  0.0770  197 VAL A CG1 
1529 C CG2 . VAL A 197 ? 0.7332 0.4426 0.6585 -0.0178 0.0470  0.0951  197 VAL A CG2 
1530 N N   . THR A 198 ? 0.7103 0.4527 0.6650 -0.0538 0.0424  0.0741  198 THR A N   
1531 C CA  . THR A 198 ? 0.6917 0.4400 0.6534 -0.0590 0.0395  0.0659  198 THR A CA  
1532 C C   . THR A 198 ? 0.6674 0.4286 0.6385 -0.0435 0.0374  0.0590  198 THR A C   
1533 O O   . THR A 198 ? 0.6486 0.4321 0.6288 -0.0355 0.0376  0.0596  198 THR A O   
1534 C CB  . THR A 198 ? 0.6804 0.4567 0.6531 -0.0731 0.0396  0.0678  198 THR A CB  
1535 O OG1 . THR A 198 ? 0.7094 0.4711 0.6729 -0.0913 0.0404  0.0735  198 THR A OG1 
1536 C CG2 . THR A 198 ? 0.6561 0.4476 0.6391 -0.0745 0.0362  0.0599  198 THR A CG2 
1537 N N   . LEU A 199 ? 0.6652 0.4110 0.6327 -0.0395 0.0355  0.0525  199 LEU A N   
1538 C CA  . LEU A 199 ? 0.6397 0.3983 0.6165 -0.0278 0.0333  0.0466  199 LEU A CA  
1539 C C   . LEU A 199 ? 0.6238 0.4037 0.6122 -0.0342 0.0312  0.0422  199 LEU A C   
1540 O O   . LEU A 199 ? 0.6316 0.4070 0.6169 -0.0463 0.0303  0.0404  199 LEU A O   
1541 C CB  . LEU A 199 ? 0.6502 0.3860 0.6178 -0.0198 0.0330  0.0427  199 LEU A CB  
1542 C CG  . LEU A 199 ? 0.6560 0.3676 0.6105 -0.0111 0.0351  0.0470  199 LEU A CG  
1543 C CD1 . LEU A 199 ? 0.6430 0.3395 0.5913 -0.0004 0.0351  0.0420  199 LEU A CD1 
1544 C CD2 . LEU A 199 ? 0.6287 0.3543 0.5880 -0.0016 0.0354  0.0524  199 LEU A CD2 
1545 N N   . PHE A 200 ? 0.5948 0.3967 0.5952 -0.0264 0.0298  0.0405  200 PHE A N   
1546 C CA  . PHE A 200 ? 0.5769 0.3967 0.5876 -0.0292 0.0275  0.0366  200 PHE A CA  
1547 C C   . PHE A 200 ? 0.5712 0.4000 0.5896 -0.0178 0.0253  0.0334  200 PHE A C   
1548 O O   . PHE A 200 ? 0.5685 0.3980 0.5879 -0.0087 0.0253  0.0345  200 PHE A O   
1549 C CB  . PHE A 200 ? 0.5733 0.4153 0.5917 -0.0381 0.0280  0.0396  200 PHE A CB  
1550 C CG  . PHE A 200 ? 0.5519 0.4141 0.5783 -0.0304 0.0292  0.0421  200 PHE A CG  
1551 C CD1 . PHE A 200 ? 0.5318 0.3888 0.5534 -0.0236 0.0311  0.0448  200 PHE A CD1 
1552 C CD2 . PHE A 200 ? 0.5485 0.4354 0.5860 -0.0298 0.0284  0.0417  200 PHE A CD2 
1553 C CE1 . PHE A 200 ? 0.5135 0.3880 0.5399 -0.0164 0.0321  0.0458  200 PHE A CE1 
1554 C CE2 . PHE A 200 ? 0.5178 0.4210 0.5602 -0.0212 0.0299  0.0430  200 PHE A CE2 
1555 C CZ  . PHE A 200 ? 0.4961 0.3923 0.5323 -0.0149 0.0317  0.0444  200 PHE A CZ  
1556 N N   . GLY A 201 ? 0.5595 0.3951 0.5829 -0.0194 0.0232  0.0299  201 GLY A N   
1557 C CA  . GLY A 201 ? 0.5393 0.3815 0.5691 -0.0109 0.0211  0.0277  201 GLY A CA  
1558 C C   . GLY A 201 ? 0.5359 0.3880 0.5706 -0.0149 0.0191  0.0255  201 GLY A C   
1559 O O   . GLY A 201 ? 0.5369 0.3879 0.5679 -0.0242 0.0190  0.0244  201 GLY A O   
1560 N N   . GLU A 202 ? 0.5118 0.3732 0.5540 -0.0087 0.0170  0.0250  202 GLU A N   
1561 C CA  . GLU A 202 ? 0.5096 0.3818 0.5565 -0.0112 0.0149  0.0242  202 GLU A CA  
1562 C C   . GLU A 202 ? 0.5118 0.3806 0.5587 -0.0061 0.0139  0.0230  202 GLU A C   
1563 O O   . GLU A 202 ? 0.5150 0.3796 0.5629 0.0002  0.0139  0.0238  202 GLU A O   
1564 C CB  . GLU A 202 ? 0.5008 0.3901 0.5571 -0.0091 0.0136  0.0265  202 GLU A CB  
1565 C CG  . GLU A 202 ? 0.4936 0.3964 0.5555 -0.0102 0.0111  0.0271  202 GLU A CG  
1566 C CD  . GLU A 202 ? 0.4864 0.3877 0.5517 -0.0036 0.0091  0.0278  202 GLU A CD  
1567 O OE1 . GLU A 202 ? 0.4655 0.3570 0.5294 0.0009  0.0094  0.0273  202 GLU A OE1 
1568 O OE2 . GLU A 202 ? 0.4763 0.3870 0.5453 -0.0034 0.0071  0.0294  202 GLU A OE2 
1569 N N   . SER A 203 ? 0.5139 0.3865 0.5595 -0.0092 0.0129  0.0217  203 SER A N   
1570 C CA  . SER A 203 ? 0.5181 0.3911 0.5637 -0.0048 0.0126  0.0215  203 SER A CA  
1571 C C   . SER A 203 ? 0.5291 0.3894 0.5685 0.0007  0.0151  0.0203  203 SER A C   
1572 O O   . SER A 203 ? 0.5345 0.3812 0.5635 -0.0008 0.0173  0.0174  203 SER A O   
1573 C CB  . SER A 203 ? 0.5011 0.3847 0.5568 -0.0007 0.0102  0.0252  203 SER A CB  
1574 O OG  . SER A 203 ? 0.4980 0.3846 0.5541 0.0015  0.0101  0.0263  203 SER A OG  
1575 N N   . ALA A 204 ? 0.5280 0.3925 0.5732 0.0068  0.0146  0.0229  204 ALA A N   
1576 C CA  . ALA A 204 ? 0.5411 0.3984 0.5818 0.0133  0.0169  0.0229  204 ALA A CA  
1577 C C   . ALA A 204 ? 0.5528 0.3968 0.5872 0.0143  0.0185  0.0223  204 ALA A C   
1578 O O   . ALA A 204 ? 0.5729 0.4047 0.5984 0.0187  0.0212  0.0213  204 ALA A O   
1579 C CB  . ALA A 204 ? 0.5311 0.3992 0.5808 0.0177  0.0152  0.0267  204 ALA A CB  
1580 N N   . GLY A 205 ? 0.5468 0.3927 0.5847 0.0110  0.0171  0.0235  205 GLY A N   
1581 C CA  . GLY A 205 ? 0.5478 0.3827 0.5793 0.0105  0.0188  0.0240  205 GLY A CA  
1582 C C   . GLY A 205 ? 0.5612 0.3831 0.5827 0.0040  0.0208  0.0219  205 GLY A C   
1583 O O   . GLY A 205 ? 0.5868 0.3928 0.5988 0.0048  0.0230  0.0224  205 GLY A O   
1584 N N   . ALA A 206 ? 0.5517 0.3795 0.5742 -0.0029 0.0197  0.0197  206 ALA A N   
1585 C CA  . ALA A 206 ? 0.5629 0.3785 0.5750 -0.0114 0.0206  0.0169  206 ALA A CA  
1586 C C   . ALA A 206 ? 0.5787 0.3760 0.5784 -0.0062 0.0227  0.0133  206 ALA A C   
1587 O O   . ALA A 206 ? 0.5948 0.3702 0.5813 -0.0084 0.0245  0.0118  206 ALA A O   
1588 C CB  . ALA A 206 ? 0.5552 0.3849 0.5716 -0.0196 0.0181  0.0154  206 ALA A CB  
1589 N N   . ALA A 207 ? 0.5598 0.3658 0.5632 0.0012  0.0227  0.0126  207 ALA A N   
1590 C CA  . ALA A 207 ? 0.5807 0.3746 0.5737 0.0092  0.0255  0.0097  207 ALA A CA  
1591 C C   . ALA A 207 ? 0.6036 0.3824 0.5908 0.0174  0.0280  0.0120  207 ALA A C   
1592 O O   . ALA A 207 ? 0.6223 0.3778 0.5940 0.0211  0.0307  0.0092  207 ALA A O   
1593 C CB  . ALA A 207 ? 0.5693 0.3815 0.5708 0.0159  0.0253  0.0110  207 ALA A CB  
1594 N N   . SER A 208 ? 0.5901 0.3807 0.5883 0.0205  0.0268  0.0171  208 SER A N   
1595 C CA  . SER A 208 ? 0.5962 0.3761 0.5899 0.0278  0.0284  0.0205  208 SER A CA  
1596 C C   . SER A 208 ? 0.6150 0.3707 0.5952 0.0221  0.0299  0.0201  208 SER A C   
1597 O O   . SER A 208 ? 0.6382 0.3725 0.6054 0.0290  0.0326  0.0202  208 SER A O   
1598 C CB  . SER A 208 ? 0.5780 0.3749 0.5840 0.0298  0.0259  0.0251  208 SER A CB  
1599 O OG  . SER A 208 ? 0.5806 0.3976 0.5983 0.0323  0.0239  0.0256  208 SER A OG  
1600 N N   . VAL A 209 ? 0.5987 0.3575 0.5815 0.0097  0.0284  0.0202  209 VAL A N   
1601 C CA  . VAL A 209 ? 0.6121 0.3505 0.5834 0.0013  0.0295  0.0213  209 VAL A CA  
1602 C C   . VAL A 209 ? 0.6435 0.3539 0.5969 0.0007  0.0312  0.0163  209 VAL A C   
1603 O O   . VAL A 209 ? 0.6602 0.3445 0.5996 0.0031  0.0333  0.0179  209 VAL A O   
1604 C CB  . VAL A 209 ? 0.6011 0.3532 0.5797 -0.0127 0.0276  0.0223  209 VAL A CB  
1605 C CG1 . VAL A 209 ? 0.6237 0.3562 0.5902 -0.0251 0.0285  0.0232  209 VAL A CG1 
1606 C CG2 . VAL A 209 ? 0.5912 0.3637 0.5823 -0.0100 0.0270  0.0270  209 VAL A CG2 
1607 N N   . GLY A 210 ? 0.6431 0.3582 0.5958 -0.0011 0.0302  0.0103  210 GLY A N   
1608 C CA  . GLY A 210 ? 0.6720 0.3619 0.6063 -0.0016 0.0314  0.0037  210 GLY A CA  
1609 C C   . GLY A 210 ? 0.6953 0.3680 0.6193 0.0155  0.0352  0.0034  210 GLY A C   
1610 O O   . GLY A 210 ? 0.7445 0.3844 0.6488 0.0173  0.0371  0.0005  210 GLY A O   
1611 N N   . MET A 211 ? 0.6734 0.3674 0.6098 0.0282  0.0361  0.0069  211 MET A N   
1612 C CA  . MET A 211 ? 0.6827 0.3656 0.6114 0.0457  0.0397  0.0084  211 MET A CA  
1613 C C   . MET A 211 ? 0.6959 0.3551 0.6146 0.0494  0.0412  0.0134  211 MET A C   
1614 O O   . MET A 211 ? 0.7159 0.3494 0.6182 0.0611  0.0445  0.0124  211 MET A O   
1615 C CB  . MET A 211 ? 0.6610 0.3748 0.6059 0.0568  0.0399  0.0119  211 MET A CB  
1616 C CG  . MET A 211 ? 0.6845 0.4066 0.6272 0.0611  0.0415  0.0064  211 MET A CG  
1617 S SD  . MET A 211 ? 0.7161 0.4803 0.6829 0.0604  0.0389  0.0107  211 MET A SD  
1618 C CE  . MET A 211 ? 0.6876 0.4571 0.6488 0.0579  0.0400  0.0041  211 MET A CE  
1619 N N   . HIS A 212 ? 0.6692 0.3357 0.5962 0.0401  0.0390  0.0189  212 HIS A N   
1620 C CA  . HIS A 212 ? 0.6823 0.3271 0.5993 0.0416  0.0403  0.0249  212 HIS A CA  
1621 C C   . HIS A 212 ? 0.7274 0.3345 0.6237 0.0320  0.0413  0.0215  212 HIS A C   
1622 O O   . HIS A 212 ? 0.7537 0.3304 0.6336 0.0386  0.0436  0.0243  212 HIS A O   
1623 C CB  . HIS A 212 ? 0.6377 0.3014 0.5674 0.0345  0.0383  0.0315  212 HIS A CB  
1624 C CG  . HIS A 212 ? 0.6172 0.3110 0.5630 0.0444  0.0368  0.0347  212 HIS A CG  
1625 N ND1 . HIS A 212 ? 0.5881 0.2823 0.5323 0.0601  0.0380  0.0392  212 HIS A ND1 
1626 C CD2 . HIS A 212 ? 0.5178 0.2416 0.4809 0.0405  0.0339  0.0341  212 HIS A CD2 
1627 C CE1 . HIS A 212 ? 0.5681 0.2926 0.5284 0.0636  0.0353  0.0409  212 HIS A CE1 
1628 N NE2 . HIS A 212 ? 0.4849 0.2252 0.4559 0.0519  0.0329  0.0377  212 HIS A NE2 
1629 N N   . ILE A 213 ? 0.7312 0.3396 0.6273 0.0163  0.0390  0.0157  213 ILE A N   
1630 C CA  . ILE A 213 ? 0.7741 0.3474 0.6499 0.0050  0.0389  0.0112  213 ILE A CA  
1631 C C   . ILE A 213 ? 0.8111 0.3533 0.6663 0.0195  0.0419  0.0051  213 ILE A C   
1632 O O   . ILE A 213 ? 0.8531 0.3546 0.6861 0.0162  0.0428  0.0031  213 ILE A O   
1633 C CB  . ILE A 213 ? 0.7635 0.3494 0.6438 -0.0138 0.0352  0.0055  213 ILE A CB  
1634 C CG1 . ILE A 213 ? 0.7363 0.3476 0.6332 -0.0276 0.0330  0.0122  213 ILE A CG1 
1635 C CG2 . ILE A 213 ? 0.8081 0.3556 0.6647 -0.0262 0.0341  -0.0010 213 ILE A CG2 
1636 C CD1 . ILE A 213 ? 0.7355 0.3695 0.6418 -0.0430 0.0292  0.0083  213 ILE A CD1 
1637 N N   . LEU A 214 ? 0.8004 0.3616 0.6626 0.0356  0.0437  0.0025  214 LEU A N   
1638 C CA  . LEU A 214 ? 0.8302 0.3694 0.6743 0.0498  0.0470  -0.0049 214 LEU A CA  
1639 C C   . LEU A 214 ? 0.8452 0.3777 0.6852 0.0733  0.0513  0.0002  214 LEU A C   
1640 O O   . LEU A 214 ? 0.8775 0.3935 0.7026 0.0894  0.0551  -0.0049 214 LEU A O   
1641 C CB  . LEU A 214 ? 0.8104 0.3777 0.6636 0.0512  0.0465  -0.0114 214 LEU A CB  
1642 C CG  . LEU A 214 ? 0.8077 0.3759 0.6582 0.0311  0.0425  -0.0186 214 LEU A CG  
1643 C CD1 . LEU A 214 ? 0.7324 0.3350 0.5960 0.0332  0.0418  -0.0216 214 LEU A CD1 
1644 C CD2 . LEU A 214 ? 0.8163 0.3391 0.6370 0.0261  0.0426  -0.0278 214 LEU A CD2 
1645 N N   . SER A 215 ? 0.8318 0.3779 0.6842 0.0761  0.0508  0.0103  215 SER A N   
1646 C CA  . SER A 215 ? 0.8391 0.3863 0.6910 0.0980  0.0539  0.0170  215 SER A CA  
1647 C C   . SER A 215 ? 0.8796 0.3949 0.7179 0.0981  0.0545  0.0242  215 SER A C   
1648 O O   . SER A 215 ? 0.8651 0.3908 0.7130 0.0866  0.0520  0.0309  215 SER A O   
1649 C CB  . SER A 215 ? 0.7896 0.3844 0.6682 0.1018  0.0520  0.0233  215 SER A CB  
1650 O OG  . SER A 215 ? 0.7653 0.3720 0.6460 0.1238  0.0549  0.0268  215 SER A OG  
1651 N N   . LEU A 216 ? 0.9432 0.4188 0.7577 0.1119  0.0582  0.0231  216 LEU A N   
1652 C CA  . LEU A 216 ? 0.9915 0.4288 0.7885 0.1125  0.0591  0.0305  216 LEU A CA  
1653 C C   . LEU A 216 ? 0.9754 0.4350 0.7869 0.1135  0.0576  0.0434  216 LEU A C   
1654 O O   . LEU A 216 ? 0.9779 0.4253 0.7864 0.0976  0.0559  0.0488  216 LEU A O   
1655 C CB  . LEU A 216 ? 1.0494 0.4477 0.8216 0.1358  0.0639  0.0292  216 LEU A CB  
1656 C CG  . LEU A 216 ? 1.1370 0.4743 0.8770 0.1286  0.0648  0.0226  216 LEU A CG  
1657 C CD1 . LEU A 216 ? 1.1701 0.4737 0.8977 0.1200  0.0639  0.0330  216 LEU A CD1 
1658 C CD2 . LEU A 216 ? 1.1629 0.4999 0.9022 0.1047  0.0614  0.0107  216 LEU A CD2 
1659 N N   . PRO A 217 ? 0.9588 0.4533 0.7859 0.1312  0.0581  0.0485  217 PRO A N   
1660 C CA  . PRO A 217 ? 0.9443 0.4595 0.7829 0.1325  0.0561  0.0600  217 PRO A CA  
1661 C C   . PRO A 217 ? 0.9084 0.4508 0.7645 0.1108  0.0520  0.0611  217 PRO A C   
1662 O O   . PRO A 217 ? 0.9095 0.4627 0.7705 0.1096  0.0506  0.0700  217 PRO A O   
1663 C CB  . PRO A 217 ? 0.9213 0.4728 0.7743 0.1534  0.0564  0.0632  217 PRO A CB  
1664 C CG  . PRO A 217 ? 0.9393 0.4778 0.7821 0.1681  0.0604  0.0560  217 PRO A CG  
1665 C CD  . PRO A 217 ? 0.9478 0.4656 0.7822 0.1502  0.0603  0.0448  217 PRO A CD  
1666 N N   . SER A 218 ? 0.8798 0.4333 0.7441 0.0952  0.0504  0.0525  218 SER A N   
1667 C CA  . SER A 218 ? 0.8486 0.4241 0.7270 0.0754  0.0471  0.0535  218 SER A CA  
1668 C C   . SER A 218 ? 0.8739 0.4227 0.7406 0.0556  0.0470  0.0537  218 SER A C   
1669 O O   . SER A 218 ? 0.8573 0.4224 0.7333 0.0420  0.0454  0.0576  218 SER A O   
1670 C CB  . SER A 218 ? 0.8070 0.4166 0.7043 0.0694  0.0447  0.0464  218 SER A CB  
1671 O OG  . SER A 218 ? 0.7699 0.4073 0.6798 0.0844  0.0442  0.0472  218 SER A OG  
1672 N N   . ARG A 219 ? 0.9168 0.4251 0.7625 0.0538  0.0488  0.0496  219 ARG A N   
1673 C CA  A ARG A 219 ? 0.9444 0.4259 0.7779 0.0323  0.0479  0.0492  219 ARG A CA  
1674 C CA  B ARG A 219 ? 0.9424 0.4263 0.7772 0.0318  0.0478  0.0492  219 ARG A CA  
1675 C C   . ARG A 219 ? 0.9551 0.4274 0.7843 0.0248  0.0485  0.0612  219 ARG A C   
1676 O O   . ARG A 219 ? 0.9609 0.4303 0.7896 0.0038  0.0473  0.0633  219 ARG A O   
1677 C CB  A ARG A 219 ? 0.9887 0.4228 0.7966 0.0329  0.0493  0.0419  219 ARG A CB  
1678 C CB  B ARG A 219 ? 0.9834 0.4237 0.7947 0.0296  0.0487  0.0407  219 ARG A CB  
1679 C CG  A ARG A 219 ? 0.9891 0.4306 0.7987 0.0307  0.0481  0.0288  219 ARG A CG  
1680 C CG  B ARG A 219 ? 0.9769 0.4318 0.7942 0.0214  0.0465  0.0287  219 ARG A CG  
1681 C CD  A ARG A 219 ? 0.9693 0.4393 0.7947 0.0079  0.0442  0.0256  219 ARG A CD  
1682 C CD  B ARG A 219 ? 0.9406 0.4287 0.7767 -0.0003 0.0430  0.0291  219 ARG A CD  
1683 N NE  A ARG A 219 ? 0.9864 0.4302 0.7987 -0.0152 0.0421  0.0254  219 ARG A NE  
1684 N NE  B ARG A 219 ? 0.9642 0.4302 0.7897 -0.0231 0.0413  0.0312  219 ARG A NE  
1685 C CZ  A ARG A 219 ? 1.0146 0.4249 0.8069 -0.0241 0.0408  0.0165  219 ARG A CZ  
1686 C CZ  B ARG A 219 ? 0.9496 0.4257 0.7820 -0.0346 0.0411  0.0412  219 ARG A CZ  
1687 N NH1 A ARG A 219 ? 1.0314 0.4293 0.8131 -0.0100 0.0421  0.0066  219 ARG A NH1 
1688 N NH1 B ARG A 219 ? 0.9195 0.4254 0.7678 -0.0248 0.0423  0.0487  219 ARG A NH1 
1689 N NH2 A ARG A 219 ? 1.0427 0.4325 0.8249 -0.0477 0.0382  0.0175  219 ARG A NH2 
1690 N NH2 B ARG A 219 ? 0.9587 0.4165 0.7817 -0.0566 0.0396  0.0436  219 ARG A NH2 
1691 N N   . SER A 220 ? 0.9584 0.4278 0.7843 0.0422  0.0503  0.0697  220 SER A N   
1692 C CA  . SER A 220 ? 0.9658 0.4279 0.7866 0.0374  0.0511  0.0824  220 SER A CA  
1693 C C   . SER A 220 ? 0.9160 0.4231 0.7578 0.0309  0.0495  0.0871  220 SER A C   
1694 O O   . SER A 220 ? 0.9192 0.4254 0.7580 0.0226  0.0503  0.0967  220 SER A O   
1695 C CB  . SER A 220 ? 0.9955 0.4348 0.8020 0.0591  0.0534  0.0909  220 SER A CB  
1696 O OG  . SER A 220 ? 0.9844 0.4419 0.7985 0.0811  0.0536  0.0869  220 SER A OG  
1697 N N   . LEU A 221 ? 0.8700 0.4147 0.7315 0.0347  0.0475  0.0803  221 LEU A N   
1698 C CA  . LEU A 221 ? 0.8307 0.4152 0.7098 0.0323  0.0459  0.0834  221 LEU A CA  
1699 C C   . LEU A 221 ? 0.8120 0.4175 0.7033 0.0134  0.0446  0.0790  221 LEU A C   
1700 O O   . LEU A 221 ? 0.7903 0.4303 0.6973 0.0131  0.0431  0.0786  221 LEU A O   
1701 C CB  . LEU A 221 ? 0.8077 0.4212 0.7008 0.0484  0.0438  0.0797  221 LEU A CB  
1702 C CG  . LEU A 221 ? 0.8143 0.4182 0.7012 0.0694  0.0446  0.0811  221 LEU A CG  
1703 C CD1 . LEU A 221 ? 0.7322 0.3738 0.6374 0.0788  0.0417  0.0777  221 LEU A CD1 
1704 C CD2 . LEU A 221 ? 0.8148 0.4009 0.6878 0.0790  0.0461  0.0928  221 LEU A CD2 
1705 N N   . PHE A 222 ? 0.8241 0.4103 0.7082 -0.0017 0.0448  0.0753  222 PHE A N   
1706 C CA  . PHE A 222 ? 0.8082 0.4167 0.7041 -0.0200 0.0435  0.0725  222 PHE A CA  
1707 C C   . PHE A 222 ? 0.8392 0.4192 0.7221 -0.0376 0.0434  0.0711  222 PHE A C   
1708 O O   . PHE A 222 ? 0.8749 0.4180 0.7405 -0.0341 0.0439  0.0687  222 PHE A O   
1709 C CB  . PHE A 222 ? 0.7617 0.4015 0.6755 -0.0169 0.0410  0.0634  222 PHE A CB  
1710 C CG  . PHE A 222 ? 0.7599 0.3851 0.6689 -0.0146 0.0399  0.0540  222 PHE A CG  
1711 C CD1 . PHE A 222 ? 0.7597 0.3746 0.6639 0.0032  0.0406  0.0513  222 PHE A CD1 
1712 C CD2 . PHE A 222 ? 0.7554 0.3793 0.6644 -0.0299 0.0382  0.0481  222 PHE A CD2 
1713 C CE1 . PHE A 222 ? 0.7545 0.3566 0.6527 0.0065  0.0404  0.0427  222 PHE A CE1 
1714 C CE2 . PHE A 222 ? 0.7593 0.3692 0.6614 -0.0275 0.0372  0.0389  222 PHE A CE2 
1715 C CZ  . PHE A 222 ? 0.7516 0.3503 0.6479 -0.0089 0.0387  0.0361  222 PHE A CZ  
1716 N N   . HIS A 223 ? 0.8383 0.4360 0.7292 -0.0562 0.0426  0.0722  223 HIS A N   
1717 C CA  . HIS A 223 ? 0.8767 0.4500 0.7554 -0.0768 0.0418  0.0728  223 HIS A CA  
1718 C C   . HIS A 223 ? 0.8580 0.4485 0.7458 -0.0902 0.0385  0.0642  223 HIS A C   
1719 O O   . HIS A 223 ? 0.8869 0.4538 0.7626 -0.1061 0.0364  0.0611  223 HIS A O   
1720 C CB  . HIS A 223 ? 0.8978 0.4752 0.7753 -0.0901 0.0440  0.0853  223 HIS A CB  
1721 C CG  . HIS A 223 ? 0.9538 0.5171 0.8221 -0.0763 0.0470  0.0947  223 HIS A CG  
1722 N ND1 . HIS A 223 ? 0.9494 0.5430 0.8296 -0.0615 0.0483  0.0981  223 HIS A ND1 
1723 C CD2 . HIS A 223 ? 1.0114 0.5322 0.8586 -0.0736 0.0486  0.1011  223 HIS A CD2 
1724 C CE1 . HIS A 223 ? 0.9809 0.5544 0.8486 -0.0510 0.0504  0.1066  223 HIS A CE1 
1725 N NE2 . HIS A 223 ? 1.0256 0.5548 0.8734 -0.0573 0.0508  0.1091  223 HIS A NE2 
1726 N N   . ARG A 224 ? 0.8090 0.4389 0.7166 -0.0834 0.0375  0.0604  224 ARG A N   
1727 C CA  . ARG A 224 ? 0.7883 0.4439 0.7081 -0.0950 0.0345  0.0548  224 ARG A CA  
1728 C C   . ARG A 224 ? 0.7490 0.4318 0.6840 -0.0796 0.0335  0.0486  224 ARG A C   
1729 O O   . ARG A 224 ? 0.7294 0.4241 0.6712 -0.0645 0.0351  0.0510  224 ARG A O   
1730 C CB  . ARG A 224 ? 0.7838 0.4684 0.7149 -0.1103 0.0351  0.0627  224 ARG A CB  
1731 C CG  . ARG A 224 ? 0.8452 0.5130 0.7658 -0.1343 0.0337  0.0658  224 ARG A CG  
1732 C CD  . ARG A 224 ? 0.8766 0.5763 0.8089 -0.1492 0.0353  0.0760  224 ARG A CD  
1733 N NE  . ARG A 224 ? 0.9210 0.6220 0.8520 -0.1411 0.0400  0.0859  224 ARG A NE  
1734 C CZ  . ARG A 224 ? 0.9776 0.6468 0.8922 -0.1471 0.0420  0.0940  224 ARG A CZ  
1735 N NH1 . ARG A 224 ? 1.0267 0.6564 0.9236 -0.1613 0.0397  0.0926  224 ARG A NH1 
1736 N NH2 . ARG A 224 ? 0.9802 0.6549 0.8941 -0.1384 0.0462  0.1034  224 ARG A NH2 
1737 N N   . ALA A 225 ? 0.7264 0.4191 0.6661 -0.0845 0.0304  0.0410  225 ALA A N   
1738 C CA  . ALA A 225 ? 0.6928 0.4049 0.6438 -0.0710 0.0293  0.0355  225 ALA A CA  
1739 C C   . ALA A 225 ? 0.6728 0.4151 0.6373 -0.0794 0.0262  0.0324  225 ALA A C   
1740 O O   . ALA A 225 ? 0.6854 0.4264 0.6461 -0.0957 0.0238  0.0310  225 ALA A O   
1741 C CB  . ALA A 225 ? 0.7108 0.3965 0.6492 -0.0605 0.0293  0.0288  225 ALA A CB  
1742 N N   . VAL A 226 ? 0.6305 0.3993 0.6100 -0.0683 0.0258  0.0318  226 VAL A N   
1743 C CA  . VAL A 226 ? 0.6086 0.4065 0.6012 -0.0724 0.0231  0.0300  226 VAL A CA  
1744 C C   . VAL A 226 ? 0.5957 0.3983 0.5928 -0.0594 0.0218  0.0250  226 VAL A C   
1745 O O   . VAL A 226 ? 0.5904 0.3943 0.5915 -0.0461 0.0232  0.0260  226 VAL A O   
1746 C CB  . VAL A 226 ? 0.5890 0.4164 0.5957 -0.0718 0.0244  0.0361  226 VAL A CB  
1747 C CG1 . VAL A 226 ? 0.5894 0.4473 0.6104 -0.0704 0.0220  0.0347  226 VAL A CG1 
1748 C CG2 . VAL A 226 ? 0.6026 0.4317 0.6065 -0.0865 0.0259  0.0422  226 VAL A CG2 
1749 N N   . LEU A 227 ? 0.5905 0.3965 0.5865 -0.0641 0.0190  0.0200  227 LEU A N   
1750 C CA  . LEU A 227 ? 0.5738 0.3848 0.5731 -0.0534 0.0180  0.0161  227 LEU A CA  
1751 C C   . LEU A 227 ? 0.5559 0.3964 0.5684 -0.0552 0.0150  0.0167  227 LEU A C   
1752 O O   . LEU A 227 ? 0.5702 0.4173 0.5807 -0.0652 0.0122  0.0144  227 LEU A O   
1753 C CB  . LEU A 227 ? 0.5942 0.3806 0.5774 -0.0537 0.0180  0.0097  227 LEU A CB  
1754 C CG  . LEU A 227 ? 0.6076 0.3616 0.5755 -0.0484 0.0211  0.0087  227 LEU A CG  
1755 C CD1 . LEU A 227 ? 0.6033 0.3356 0.5585 -0.0622 0.0212  0.0096  227 LEU A CD1 
1756 C CD2 . LEU A 227 ? 0.6105 0.3491 0.5670 -0.0399 0.0220  0.0024  227 LEU A CD2 
1757 N N   . GLN A 228 ? 0.5341 0.3916 0.5591 -0.0456 0.0153  0.0199  228 GLN A N   
1758 C CA  . GLN A 228 ? 0.5171 0.4004 0.5540 -0.0449 0.0127  0.0215  228 GLN A CA  
1759 C C   . GLN A 228 ? 0.5082 0.3918 0.5458 -0.0375 0.0113  0.0194  228 GLN A C   
1760 O O   . GLN A 228 ? 0.5122 0.3887 0.5508 -0.0279 0.0125  0.0196  228 GLN A O   
1761 C CB  . GLN A 228 ? 0.5018 0.4003 0.5498 -0.0379 0.0139  0.0260  228 GLN A CB  
1762 C CG  . GLN A 228 ? 0.5309 0.4346 0.5793 -0.0446 0.0160  0.0295  228 GLN A CG  
1763 C CD  . GLN A 228 ? 0.5415 0.4549 0.5965 -0.0353 0.0182  0.0327  228 GLN A CD  
1764 O OE1 . GLN A 228 ? 0.5298 0.4400 0.5818 -0.0372 0.0210  0.0353  228 GLN A OE1 
1765 N NE2 . GLN A 228 ? 0.5711 0.4955 0.6339 -0.0252 0.0169  0.0326  228 GLN A NE2 
1766 N N   . SER A 229 ? 0.5028 0.3961 0.5397 -0.0425 0.0085  0.0178  229 SER A N   
1767 C CA  . SER A 229 ? 0.4994 0.3983 0.5385 -0.0356 0.0072  0.0176  229 SER A CA  
1768 C C   . SER A 229 ? 0.5089 0.3901 0.5407 -0.0284 0.0096  0.0150  229 SER A C   
1769 O O   . SER A 229 ? 0.5042 0.3901 0.5417 -0.0203 0.0096  0.0174  229 SER A O   
1770 C CB  . SER A 229 ? 0.4806 0.3963 0.5332 -0.0276 0.0061  0.0229  229 SER A CB  
1771 O OG  . SER A 229 ? 0.4839 0.4183 0.5441 -0.0309 0.0047  0.0261  229 SER A OG  
1772 N N   . GLY A 230 ? 0.5180 0.3791 0.5370 -0.0312 0.0115  0.0106  230 GLY A N   
1773 C CA  . GLY A 230 ? 0.5269 0.3733 0.5385 -0.0226 0.0143  0.0083  230 GLY A CA  
1774 C C   . GLY A 230 ? 0.5578 0.3791 0.5528 -0.0253 0.0164  0.0032  230 GLY A C   
1775 O O   . GLY A 230 ? 0.5628 0.3751 0.5531 -0.0345 0.0158  0.0026  230 GLY A O   
1776 N N   . THR A 231 ? 0.5726 0.3824 0.5580 -0.0171 0.0189  -0.0002 231 THR A N   
1777 C CA  . THR A 231 ? 0.5995 0.3807 0.5657 -0.0167 0.0213  -0.0059 231 THR A CA  
1778 C C   . THR A 231 ? 0.6107 0.3823 0.5711 -0.0016 0.0256  -0.0067 231 THR A C   
1779 O O   . THR A 231 ? 0.6018 0.3917 0.5717 0.0065  0.0264  -0.0038 231 THR A O   
1780 C CB  . THR A 231 ? 0.6222 0.3957 0.5739 -0.0257 0.0194  -0.0132 231 THR A CB  
1781 O OG1 . THR A 231 ? 0.5972 0.3822 0.5474 -0.0188 0.0200  -0.0154 231 THR A OG1 
1782 C CG2 . THR A 231 ? 0.6368 0.4246 0.5950 -0.0409 0.0147  -0.0120 231 THR A CG2 
1783 N N   . PRO A 232 ? 0.6413 0.3847 0.5859 0.0026  0.0285  -0.0097 232 PRO A N   
1784 C CA  . PRO A 232 ? 0.6432 0.3801 0.5820 0.0190  0.0329  -0.0101 232 PRO A CA  
1785 C C   . PRO A 232 ? 0.6538 0.3935 0.5829 0.0241  0.0346  -0.0161 232 PRO A C   
1786 O O   . PRO A 232 ? 0.6459 0.4037 0.5823 0.0351  0.0370  -0.0134 232 PRO A O   
1787 C CB  . PRO A 232 ? 0.6703 0.3729 0.5921 0.0215  0.0351  -0.0120 232 PRO A CB  
1788 C CG  . PRO A 232 ? 0.6798 0.3667 0.5923 0.0043  0.0319  -0.0158 232 PRO A CG  
1789 C CD  . PRO A 232 ? 0.6652 0.3814 0.5960 -0.0072 0.0278  -0.0122 232 PRO A CD  
1790 N N   . ASN A 233 ? 0.6739 0.3969 0.5863 0.0153  0.0331  -0.0241 233 ASN A N   
1791 C CA  . ASN A 233 ? 0.6741 0.4017 0.5759 0.0166  0.0336  -0.0306 233 ASN A CA  
1792 C C   . ASN A 233 ? 0.6532 0.4173 0.5735 0.0123  0.0308  -0.0256 233 ASN A C   
1793 O O   . ASN A 233 ? 0.6229 0.4033 0.5612 0.0053  0.0276  -0.0189 233 ASN A O   
1794 C CB  . ASN A 233 ? 0.6910 0.3941 0.5725 0.0032  0.0304  -0.0397 233 ASN A CB  
1795 C CG  . ASN A 233 ? 0.6666 0.3774 0.5587 -0.0154 0.0247  -0.0364 233 ASN A CG  
1796 O OD1 . ASN A 233 ? 0.6327 0.3417 0.5349 -0.0179 0.0245  -0.0303 233 ASN A OD1 
1797 N ND2 . ASN A 233 ? 0.6382 0.3611 0.5286 -0.0279 0.0200  -0.0398 233 ASN A ND2 
1798 N N   . GLY A 234 ? 0.6620 0.4375 0.5764 0.0171  0.0322  -0.0286 234 GLY A N   
1799 C CA  . GLY A 234 ? 0.6462 0.4542 0.5759 0.0142  0.0300  -0.0227 234 GLY A CA  
1800 C C   . GLY A 234 ? 0.6433 0.4719 0.5812 0.0273  0.0344  -0.0172 234 GLY A C   
1801 O O   . GLY A 234 ? 0.6548 0.4768 0.5896 0.0399  0.0393  -0.0171 234 GLY A O   
1802 N N   . PRO A 235 ? 0.6274 0.4824 0.5761 0.0243  0.0326  -0.0117 235 PRO A N   
1803 C CA  . PRO A 235 ? 0.6180 0.4947 0.5736 0.0342  0.0366  -0.0057 235 PRO A CA  
1804 C C   . PRO A 235 ? 0.5941 0.4841 0.5701 0.0382  0.0371  0.0040  235 PRO A C   
1805 O O   . PRO A 235 ? 0.5796 0.4891 0.5626 0.0455  0.0404  0.0100  235 PRO A O   
1806 C CB  . PRO A 235 ? 0.6132 0.5107 0.5724 0.0269  0.0335  -0.0022 235 PRO A CB  
1807 C CG  . PRO A 235 ? 0.5959 0.4905 0.5629 0.0145  0.0270  -0.0011 235 PRO A CG  
1808 C CD  . PRO A 235 ? 0.6225 0.4890 0.5758 0.0118  0.0269  -0.0104 235 PRO A CD  
1809 N N   . TRP A 236 ? 0.5790 0.4603 0.5641 0.0330  0.0338  0.0059  236 TRP A N   
1810 C CA  . TRP A 236 ? 0.5558 0.4509 0.5600 0.0340  0.0325  0.0147  236 TRP A CA  
1811 C C   . TRP A 236 ? 0.5561 0.4386 0.5628 0.0383  0.0331  0.0148  236 TRP A C   
1812 O O   . TRP A 236 ? 0.5438 0.4382 0.5631 0.0414  0.0327  0.0211  236 TRP A O   
1813 C CB  . TRP A 236 ? 0.5257 0.4306 0.5425 0.0238  0.0271  0.0198  236 TRP A CB  
1814 C CG  . TRP A 236 ? 0.5257 0.4167 0.5403 0.0160  0.0236  0.0159  236 TRP A CG  
1815 C CD1 . TRP A 236 ? 0.5317 0.4204 0.5393 0.0086  0.0212  0.0120  236 TRP A CD1 
1816 C CD2 . TRP A 236 ? 0.5383 0.4189 0.5579 0.0146  0.0222  0.0162  236 TRP A CD2 
1817 N NE1 . TRP A 236 ? 0.5044 0.3839 0.5137 0.0022  0.0186  0.0105  236 TRP A NE1 
1818 C CE2 . TRP A 236 ? 0.5243 0.3981 0.5404 0.0061  0.0195  0.0130  236 TRP A CE2 
1819 C CE3 . TRP A 236 ? 0.5410 0.4200 0.5680 0.0193  0.0227  0.0194  236 TRP A CE3 
1820 C CZ2 . TRP A 236 ? 0.5267 0.3924 0.5463 0.0027  0.0182  0.0131  236 TRP A CZ2 
1821 C CZ3 . TRP A 236 ? 0.5131 0.3822 0.5420 0.0162  0.0210  0.0189  236 TRP A CZ3 
1822 C CH2 . TRP A 236 ? 0.5188 0.3814 0.5440 0.0082  0.0192  0.0160  236 TRP A CH2 
1823 N N   . ALA A 237 ? 0.5664 0.4250 0.5607 0.0375  0.0335  0.0083  237 ALA A N   
1824 C CA  . ALA A 237 ? 0.5635 0.4102 0.5599 0.0407  0.0335  0.0096  237 ALA A CA  
1825 C C   . ALA A 237 ? 0.5761 0.4203 0.5675 0.0550  0.0384  0.0102  237 ALA A C   
1826 O O   . ALA A 237 ? 0.5766 0.4178 0.5725 0.0594  0.0382  0.0135  237 ALA A O   
1827 C CB  . ALA A 237 ? 0.5759 0.3988 0.5620 0.0333  0.0321  0.0046  237 ALA A CB  
1828 N N   . THR A 238 ? 0.5821 0.4289 0.5637 0.0636  0.0427  0.0072  238 THR A N   
1829 C CA  . THR A 238 ? 0.5961 0.4451 0.5745 0.0796  0.0478  0.0087  238 THR A CA  
1830 C C   . THR A 238 ? 0.6037 0.4781 0.5852 0.0870  0.0516  0.0113  238 THR A C   
1831 O O   . THR A 238 ? 0.6162 0.4998 0.5969 0.0800  0.0508  0.0101  238 THR A O   
1832 C CB  . THR A 238 ? 0.6247 0.4401 0.5800 0.0887  0.0517  0.0009  238 THR A CB  
1833 O OG1 . THR A 238 ? 0.6385 0.4420 0.5764 0.0870  0.0534  -0.0077 238 THR A OG1 
1834 C CG2 . THR A 238 ? 0.6051 0.3954 0.5563 0.0811  0.0486  -0.0004 238 THR A CG2 
1835 N N   . VAL A 239 ? 0.6043 0.4922 0.5892 0.1013  0.0559  0.0155  239 VAL A N   
1836 C CA  . VAL A 239 ? 0.6064 0.5178 0.5907 0.1117  0.0615  0.0175  239 VAL A CA  
1837 C C   . VAL A 239 ? 0.6426 0.5403 0.6112 0.1315  0.0681  0.0134  239 VAL A C   
1838 O O   . VAL A 239 ? 0.6552 0.5316 0.6190 0.1364  0.0675  0.0124  239 VAL A O   
1839 C CB  . VAL A 239 ? 0.5825 0.5335 0.5905 0.1101  0.0604  0.0294  239 VAL A CB  
1840 C CG1 . VAL A 239 ? 0.5488 0.5124 0.5700 0.0919  0.0545  0.0339  239 VAL A CG1 
1841 C CG2 . VAL A 239 ? 0.5664 0.5218 0.5855 0.1144  0.0584  0.0350  239 VAL A CG2 
1842 N N   . SER A 240 ? 0.6622 0.5718 0.6218 0.1440  0.0746  0.0114  240 SER A N   
1843 C CA  . SER A 240 ? 0.6890 0.5905 0.6340 0.1665  0.0820  0.0083  240 SER A CA  
1844 C C   . SER A 240 ? 0.6783 0.6116 0.6423 0.1775  0.0837  0.0197  240 SER A C   
1845 O O   . SER A 240 ? 0.6487 0.6135 0.6362 0.1668  0.0796  0.0294  240 SER A O   
1846 C CB  . SER A 240 ? 0.7033 0.6131 0.6335 0.1766  0.0888  0.0031  240 SER A CB  
1847 O OG  . SER A 240 ? 0.6909 0.6483 0.6411 0.1768  0.0908  0.0137  240 SER A OG  
1848 N N   . ALA A 241 ? 0.7103 0.6357 0.6633 0.1994  0.0897  0.0185  241 ALA A N   
1849 C CA  . ALA A 241 ? 0.7033 0.6616 0.6736 0.2118  0.0914  0.0296  241 ALA A CA  
1850 C C   . ALA A 241 ? 0.6864 0.6974 0.6762 0.2110  0.0937  0.0388  241 ALA A C   
1851 O O   . ALA A 241 ? 0.6595 0.7027 0.6734 0.2021  0.0892  0.0496  241 ALA A O   
1852 C CB  . ALA A 241 ? 0.7340 0.6747 0.6866 0.2385  0.0983  0.0267  241 ALA A CB  
1853 N N   . GLY A 242 ? 0.7051 0.7237 0.6830 0.2191  0.1006  0.0345  242 GLY A N   
1854 C CA  . GLY A 242 ? 0.6849 0.7534 0.6785 0.2190  0.1042  0.0436  242 GLY A CA  
1855 C C   . GLY A 242 ? 0.6576 0.7450 0.6722 0.1928  0.0963  0.0510  242 GLY A C   
1856 O O   . GLY A 242 ? 0.6414 0.7715 0.6786 0.1874  0.0953  0.0633  242 GLY A O   
1857 N N   . GLU A 243 ? 0.6497 0.7053 0.6569 0.1761  0.0903  0.0440  243 GLU A N   
1858 C CA  . GLU A 243 ? 0.6245 0.6951 0.6489 0.1534  0.0835  0.0506  243 GLU A CA  
1859 C C   . GLU A 243 ? 0.6083 0.6878 0.6536 0.1433  0.0761  0.0587  243 GLU A C   
1860 O O   . GLU A 243 ? 0.5955 0.7046 0.6609 0.1303  0.0721  0.0690  243 GLU A O   
1861 C CB  . GLU A 243 ? 0.6231 0.6629 0.6343 0.1398  0.0796  0.0417  243 GLU A CB  
1862 C CG  . GLU A 243 ? 0.5932 0.6446 0.6208 0.1180  0.0723  0.0486  243 GLU A CG  
1863 C CD  . GLU A 243 ? 0.5792 0.6711 0.6196 0.1139  0.0746  0.0596  243 GLU A CD  
1864 O OE1 . GLU A 243 ? 0.5858 0.7000 0.6214 0.1275  0.0825  0.0613  243 GLU A OE1 
1865 O OE2 . GLU A 243 ? 0.5427 0.6433 0.5972 0.0969  0.0685  0.0670  243 GLU A OE2 
1866 N N   . ALA A 244 ? 0.6056 0.6596 0.6454 0.1488  0.0740  0.0544  244 ALA A N   
1867 C CA  . ALA A 244 ? 0.5870 0.6512 0.6444 0.1418  0.0675  0.0616  244 ALA A CA  
1868 C C   . ALA A 244 ? 0.5900 0.6988 0.6639 0.1509  0.0700  0.0727  244 ALA A C   
1869 O O   . ALA A 244 ? 0.5849 0.7189 0.6787 0.1384  0.0641  0.0816  244 ALA A O   
1870 C CB  . ALA A 244 ? 0.5907 0.6212 0.6377 0.1471  0.0655  0.0558  244 ALA A CB  
1871 N N   . ARG A 245 ? 0.6084 0.7284 0.6739 0.1724  0.0788  0.0722  245 ARG A N   
1872 C CA  . ARG A 245 ? 0.6000 0.7677 0.6818 0.1824  0.0820  0.0835  245 ARG A CA  
1873 C C   . ARG A 245 ? 0.5856 0.7910 0.6850 0.1663  0.0806  0.0928  245 ARG A C   
1874 O O   . ARG A 245 ? 0.5739 0.8142 0.6949 0.1572  0.0761  0.1040  245 ARG A O   
1875 C CB  . ARG A 245 ? 0.6212 0.7941 0.6889 0.2110  0.0929  0.0809  245 ARG A CB  
1876 C CG  . ARG A 245 ? 0.6021 0.8306 0.6882 0.2237  0.0969  0.0938  245 ARG A CG  
1877 C CD  . ARG A 245 ? 0.6385 0.8654 0.7095 0.2562  0.1068  0.0909  245 ARG A CD  
1878 N NE  . ARG A 245 ? 0.6276 0.8281 0.6929 0.2657  0.1035  0.0890  245 ARG A NE  
1879 C CZ  . ARG A 245 ? 0.6229 0.8528 0.7065 0.2683  0.0993  0.0995  245 ARG A CZ  
1880 N NH1 . ARG A 245 ? 0.5949 0.8819 0.7043 0.2611  0.0976  0.1124  245 ARG A NH1 
1881 N NH2 . ARG A 245 ? 0.6349 0.8378 0.7109 0.2769  0.0964  0.0977  245 ARG A NH2 
1882 N N   . ARG A 246 ? 0.5899 0.7872 0.6791 0.1618  0.0838  0.0885  246 ARG A N   
1883 C CA  . ARG A 246 ? 0.5815 0.8117 0.6850 0.1468  0.0830  0.0981  246 ARG A CA  
1884 C C   . ARG A 246 ? 0.5602 0.7897 0.6806 0.1218  0.0720  0.1040  246 ARG A C   
1885 O O   . ARG A 246 ? 0.5514 0.8172 0.6914 0.1106  0.0693  0.1163  246 ARG A O   
1886 C CB  . ARG A 246 ? 0.5910 0.8082 0.6783 0.1457  0.0875  0.0919  246 ARG A CB  
1887 C CG  . ARG A 246 ? 0.5873 0.8439 0.6879 0.1343  0.0888  0.1039  246 ARG A CG  
1888 C CD  . ARG A 246 ? 0.5912 0.8327 0.6771 0.1282  0.0905  0.0990  246 ARG A CD  
1889 N NE  . ARG A 246 ? 0.5693 0.7716 0.6501 0.1125  0.0820  0.0922  246 ARG A NE  
1890 C CZ  . ARG A 246 ? 0.5494 0.7522 0.6435 0.0917  0.0741  0.0993  246 ARG A CZ  
1891 N NH1 . ARG A 246 ? 0.5342 0.7718 0.6477 0.0809  0.0724  0.1136  246 ARG A NH1 
1892 N NH2 . ARG A 246 ? 0.5459 0.7135 0.6335 0.0815  0.0676  0.0923  246 ARG A NH2 
1893 N N   . ARG A 247 ? 0.5551 0.7434 0.6674 0.1131  0.0657  0.0955  247 ARG A N   
1894 C CA  . ARG A 247 ? 0.5337 0.7160 0.6583 0.0910  0.0557  0.0993  247 ARG A CA  
1895 C C   . ARG A 247 ? 0.5275 0.7293 0.6690 0.0863  0.0497  0.1066  247 ARG A C   
1896 O O   . ARG A 247 ? 0.5248 0.7429 0.6813 0.0685  0.0431  0.1148  247 ARG A O   
1897 C CB  . ARG A 247 ? 0.5292 0.6662 0.6407 0.0848  0.0514  0.0885  247 ARG A CB  
1898 C CG  . ARG A 247 ? 0.5177 0.6388 0.6153 0.0835  0.0547  0.0827  247 ARG A CG  
1899 C CD  . ARG A 247 ? 0.4863 0.5677 0.5735 0.0765  0.0499  0.0733  247 ARG A CD  
1900 N NE  . ARG A 247 ? 0.5007 0.5679 0.5729 0.0768  0.0529  0.0669  247 ARG A NE  
1901 C CZ  . ARG A 247 ? 0.5020 0.5404 0.5651 0.0697  0.0493  0.0596  247 ARG A CZ  
1902 N NH1 . ARG A 247 ? 0.4863 0.5060 0.5532 0.0626  0.0433  0.0575  247 ARG A NH1 
1903 N NH2 . ARG A 247 ? 0.5015 0.5323 0.5515 0.0698  0.0517  0.0546  247 ARG A NH2 
1904 N N   . ALA A 248 ? 0.5269 0.7263 0.6649 0.1018  0.0515  0.1038  248 ALA A N   
1905 C CA  . ALA A 248 ? 0.5188 0.7372 0.6711 0.0993  0.0454  0.1101  248 ALA A CA  
1906 C C   . ALA A 248 ? 0.5203 0.7913 0.6919 0.0962  0.0463  0.1235  248 ALA A C   
1907 O O   . ALA A 248 ? 0.5167 0.8063 0.7042 0.0791  0.0380  0.1310  248 ALA A O   
1908 C CB  . ALA A 248 ? 0.5226 0.7294 0.6656 0.1194  0.0484  0.1057  248 ALA A CB  
1909 N N   . THR A 249 ? 0.5272 0.8217 0.6963 0.1126  0.0563  0.1261  249 THR A N   
1910 C CA  . THR A 249 ? 0.5188 0.8682 0.7053 0.1131  0.0596  0.1394  249 THR A CA  
1911 C C   . THR A 249 ? 0.5117 0.8744 0.7100 0.0877  0.0547  0.1473  249 THR A C   
1912 O O   . THR A 249 ? 0.5068 0.9071 0.7247 0.0749  0.0501  0.1593  249 THR A O   
1913 C CB  . THR A 249 ? 0.5297 0.8950 0.7062 0.1369  0.0727  0.1384  249 THR A CB  
1914 O OG1 . THR A 249 ? 0.5468 0.8950 0.7102 0.1614  0.0772  0.1311  249 THR A OG1 
1915 C CG2 . THR A 249 ? 0.5233 0.9496 0.7187 0.1386  0.0769  0.1530  249 THR A CG2 
1916 N N   . LEU A 250 ? 0.5151 0.8467 0.7013 0.0800  0.0552  0.1412  250 LEU A N   
1917 C CA  . LEU A 250 ? 0.5094 0.8482 0.7041 0.0572  0.0509  0.1490  250 LEU A CA  
1918 C C   . LEU A 250 ? 0.5110 0.8385 0.7161 0.0351  0.0384  0.1515  250 LEU A C   
1919 O O   . LEU A 250 ? 0.5059 0.8593 0.7264 0.0170  0.0335  0.1632  250 LEU A O   
1920 C CB  . LEU A 250 ? 0.5054 0.8141 0.6837 0.0558  0.0541  0.1422  250 LEU A CB  
1921 C CG  . LEU A 250 ? 0.5029 0.8131 0.6876 0.0331  0.0493  0.1506  250 LEU A CG  
1922 C CD1 . LEU A 250 ? 0.4862 0.8462 0.6893 0.0233  0.0505  0.1674  250 LEU A CD1 
1923 C CD2 . LEU A 250 ? 0.4954 0.7829 0.6638 0.0348  0.0534  0.1452  250 LEU A CD2 
1924 N N   . LEU A 251 ? 0.5189 0.8082 0.7147 0.0366  0.0332  0.1407  251 LEU A N   
1925 C CA  . LEU A 251 ? 0.5185 0.7948 0.7211 0.0190  0.0217  0.1410  251 LEU A CA  
1926 C C   . LEU A 251 ? 0.5240 0.8402 0.7440 0.0150  0.0174  0.1505  251 LEU A C   
1927 O O   . LEU A 251 ? 0.5269 0.8539 0.7585 -0.0060 0.0089  0.1576  251 LEU A O   
1928 C CB  . LEU A 251 ? 0.5224 0.7561 0.7114 0.0250  0.0187  0.1281  251 LEU A CB  
1929 C CG  . LEU A 251 ? 0.5252 0.7480 0.7200 0.0075  0.0070  0.1282  251 LEU A CG  
1930 C CD1 . LEU A 251 ? 0.5156 0.7082 0.7056 -0.0092 0.0018  0.1258  251 LEU A CD1 
1931 C CD2 . LEU A 251 ? 0.5363 0.7406 0.7242 0.0167  0.0043  0.1201  251 LEU A CD2 
1932 N N   . ALA A 252 ? 0.5295 0.8664 0.7504 0.0352  0.0229  0.1505  252 ALA A N   
1933 C CA  . ALA A 252 ? 0.5329 0.9142 0.7709 0.0350  0.0197  0.1602  252 ALA A CA  
1934 C C   . ALA A 252 ? 0.5403 0.9640 0.7961 0.0178  0.0186  0.1745  252 ALA A C   
1935 O O   . ALA A 252 ? 0.5413 0.9849 0.8113 -0.0014 0.0091  0.1821  252 ALA A O   
1936 C CB  . ALA A 252 ? 0.5401 0.9409 0.7752 0.0635  0.0290  0.1599  252 ALA A CB  
1937 N N   . ARG A 253 ? 0.5530 0.9895 0.8068 0.0236  0.0280  0.1782  253 ARG A N   
1938 C CA  . ARG A 253 ? 0.5650 1.0432 0.8348 0.0081  0.0284  0.1931  253 ARG A CA  
1939 C C   . ARG A 253 ? 0.5618 1.0187 0.8349 -0.0223 0.0174  0.1960  253 ARG A C   
1940 O O   . ARG A 253 ? 0.5637 1.0500 0.8532 -0.0423 0.0105  0.2075  253 ARG A O   
1941 C CB  . ARG A 253 ? 0.5706 1.0612 0.8338 0.0213  0.0410  0.1951  253 ARG A CB  
1942 C CG  . ARG A 253 ? 0.6238 1.1759 0.9054 0.0169  0.0457  0.2121  253 ARG A CG  
1943 C CD  . ARG A 253 ? 0.7042 1.2787 0.9781 0.0432  0.0607  0.2119  253 ARG A CD  
1944 N NE  . ARG A 253 ? 0.7602 1.2889 1.0110 0.0509  0.0657  0.1997  253 ARG A NE  
1945 C CZ  . ARG A 253 ? 0.7898 1.3045 1.0227 0.0776  0.0755  0.1890  253 ARG A CZ  
1946 N NH1 . ARG A 253 ? 0.7775 1.2510 0.9898 0.0805  0.0782  0.1782  253 ARG A NH1 
1947 N NH2 . ARG A 253 ? 0.7926 1.3336 1.0272 0.1016  0.0823  0.1890  253 ARG A NH2 
1948 N N   . LEU A 254 ? 0.5638 0.9683 0.8204 -0.0253 0.0155  0.1853  254 LEU A N   
1949 C CA  . LEU A 254 ? 0.5659 0.9426 0.8216 -0.0503 0.0061  0.1867  254 LEU A CA  
1950 C C   . LEU A 254 ? 0.5733 0.9461 0.8367 -0.0686 -0.0069 0.1874  254 LEU A C   
1951 O O   . LEU A 254 ? 0.5783 0.9451 0.8462 -0.0922 -0.0147 0.1938  254 LEU A O   
1952 C CB  . LEU A 254 ? 0.5597 0.8829 0.7961 -0.0458 0.0069  0.1743  254 LEU A CB  
1953 C CG  . LEU A 254 ? 0.5588 0.8792 0.7864 -0.0380 0.0163  0.1751  254 LEU A CG  
1954 C CD1 . LEU A 254 ? 0.5496 0.8206 0.7584 -0.0304 0.0167  0.1611  254 LEU A CD1 
1955 C CD2 . LEU A 254 ? 0.5669 0.9005 0.8017 -0.0578 0.0145  0.1886  254 LEU A CD2 
1956 N N   . VAL A 255 ? 0.5798 0.9543 0.8431 -0.0578 -0.0094 0.1809  255 VAL A N   
1957 C CA  . VAL A 255 ? 0.5921 0.9636 0.8607 -0.0738 -0.0222 0.1802  255 VAL A CA  
1958 C C   . VAL A 255 ? 0.6067 1.0354 0.8952 -0.0787 -0.0252 0.1922  255 VAL A C   
1959 O O   . VAL A 255 ? 0.6089 1.0425 0.9019 -0.0888 -0.0355 0.1914  255 VAL A O   
1960 C CB  . VAL A 255 ? 0.5862 0.9207 0.8408 -0.0620 -0.0252 0.1656  255 VAL A CB  
1961 C CG1 . VAL A 255 ? 0.5743 0.8535 0.8116 -0.0645 -0.0260 0.1549  255 VAL A CG1 
1962 C CG2 . VAL A 255 ? 0.5683 0.9158 0.8198 -0.0339 -0.0158 0.1621  255 VAL A CG2 
1963 N N   . GLY A 256 ? 0.6187 1.0927 0.9187 -0.0711 -0.0161 0.2033  256 GLY A N   
1964 C CA  . GLY A 256 ? 0.6377 1.1737 0.9590 -0.0753 -0.0178 0.2169  256 GLY A CA  
1965 C C   . GLY A 256 ? 0.6473 1.2067 0.9706 -0.0495 -0.0137 0.2142  256 GLY A C   
1966 O O   . GLY A 256 ? 0.6469 1.2428 0.9841 -0.0546 -0.0205 0.2206  256 GLY A O   
1967 N N   . CYS A 257 ? 0.6588 1.1965 0.9676 -0.0221 -0.0030 0.2050  257 CYS A N   
1968 C CA  . CYS A 257 ? 0.6737 1.2320 0.9826 0.0056  0.0028  0.2036  257 CYS A CA  
1969 C C   . CYS A 257 ? 0.6992 1.2806 1.0065 0.0295  0.0179  0.2068  257 CYS A C   
1970 O O   . CYS A 257 ? 0.7060 1.2553 0.9953 0.0521  0.0261  0.1961  257 CYS A O   
1971 C CB  . CYS A 257 ? 0.6640 1.1708 0.9538 0.0180  0.0008  0.1884  257 CYS A CB  
1972 S SG  . CYS A 257 ? 0.6383 1.1315 0.9305 -0.0032 -0.0160 0.1854  257 CYS A SG  
1973 N N   . PRO A 258 ? 0.7242 1.3617 1.0495 0.0244  0.0218  0.2217  258 PRO A N   
1974 C CA  . PRO A 258 ? 0.7434 1.4077 1.0669 0.0486  0.0368  0.2251  258 PRO A CA  
1975 C C   . PRO A 258 ? 0.7630 1.4192 1.0741 0.0840  0.0449  0.2169  258 PRO A C   
1976 O O   . PRO A 258 ? 0.7587 1.4313 1.0766 0.0920  0.0403  0.2187  258 PRO A O   
1977 C CB  . PRO A 258 ? 0.7439 1.4830 1.0937 0.0396  0.0372  0.2443  258 PRO A CB  
1978 C CG  . PRO A 258 ? 0.7353 1.4725 1.0965 0.0019  0.0234  0.2504  258 PRO A CG  
1979 C CD  . PRO A 258 ? 0.7281 1.4079 1.0758 -0.0047 0.0124  0.2362  258 PRO A CD  
1980 N N   . PRO A 259 ? 0.7836 1.4098 1.0745 0.1042  0.0562  0.2073  259 PRO A N   
1981 C CA  . PRO A 259 ? 0.8020 1.4325 1.0813 0.1405  0.0682  0.2028  259 PRO A CA  
1982 C C   . PRO A 259 ? 0.8089 1.5100 1.1047 0.1547  0.0775  0.2171  259 PRO A C   
1983 O O   . PRO A 259 ? 0.8046 1.5583 1.1235 0.1481  0.0725  0.2304  259 PRO A O   
1984 C CB  . PRO A 259 ? 0.8107 1.3910 1.0646 0.1486  0.0759  0.1895  259 PRO A CB  
1985 C CG  . PRO A 259 ? 0.7983 1.3676 1.0562 0.1179  0.0701  0.1919  259 PRO A CG  
1986 C CD  . PRO A 259 ? 0.7836 1.3581 1.0578 0.0924  0.0560  0.1975  259 PRO A CD  
1987 N N   . GLY A 264 ? 0.8599 1.6354 1.1311 0.3177  0.1177  0.2188  264 GLY A N   
1988 C CA  . GLY A 264 ? 0.8401 1.5820 1.1153 0.2799  0.1033  0.2149  264 GLY A CA  
1989 C C   . GLY A 264 ? 0.8415 1.5033 1.0906 0.2821  0.0989  0.1982  264 GLY A C   
1990 O O   . GLY A 264 ? 0.8423 1.4520 1.0730 0.2722  0.0996  0.1859  264 GLY A O   
1991 N N   . ASN A 265 ? 0.8394 1.4952 1.0879 0.2947  0.0942  0.1990  265 ASN A N   
1992 C CA  . ASN A 265 ? 0.8351 1.4204 1.0588 0.3015  0.0915  0.1853  265 ASN A CA  
1993 C C   . ASN A 265 ? 0.7974 1.3424 1.0202 0.2687  0.0785  0.1788  265 ASN A C   
1994 O O   . ASN A 265 ? 0.7752 1.3437 1.0164 0.2393  0.0699  0.1846  265 ASN A O   
1995 C CB  . ASN A 265 ? 0.8600 1.4503 1.0794 0.3317  0.0931  0.1890  265 ASN A CB  
1996 C CG  . ASN A 265 ? 0.8608 1.5050 1.1071 0.3223  0.0825  0.2033  265 ASN A CG  
1997 O OD1 . ASN A 265 ? 0.8502 1.4892 1.1063 0.2924  0.0696  0.2036  265 ASN A OD1 
1998 N ND2 . ASN A 265 ? 0.8759 1.5717 1.1328 0.3492  0.0877  0.2148  265 ASN A ND2 
1999 N N   . ASP A 266 ? 0.7846 1.2679 0.9846 0.2746  0.0773  0.1669  266 ASP A N   
2000 C CA  . ASP A 266 ? 0.7471 1.1852 0.9413 0.2480  0.0675  0.1585  266 ASP A CA  
2001 C C   . ASP A 266 ? 0.7260 1.1777 0.9343 0.2321  0.0545  0.1643  266 ASP A C   
2002 O O   . ASP A 266 ? 0.7120 1.1469 0.9238 0.2045  0.0452  0.1610  266 ASP A O   
2003 C CB  . ASP A 266 ? 0.7570 1.1269 0.9217 0.2596  0.0716  0.1443  266 ASP A CB  
2004 C CG  . ASP A 266 ? 0.7518 1.1001 0.9002 0.2666  0.0817  0.1358  266 ASP A CG  
2005 O OD1 . ASP A 266 ? 0.7176 1.0918 0.8768 0.2530  0.0830  0.1388  266 ASP A OD1 
2006 O OD2 . ASP A 266 ? 0.7512 1.0556 0.8750 0.2851  0.0881  0.1262  266 ASP A OD2 
2007 N N   . THR A 267 ? 0.7188 1.2009 0.9340 0.2503  0.0538  0.1728  267 THR A N   
2008 C CA  . THR A 267 ? 0.6964 1.1940 0.9232 0.2379  0.0414  0.1784  267 THR A CA  
2009 C C   . THR A 267 ? 0.6707 1.2098 0.9216 0.2067  0.0316  0.1858  267 THR A C   
2010 O O   . THR A 267 ? 0.6629 1.1828 0.9144 0.1826  0.0206  0.1820  267 THR A O   
2011 C CB  . THR A 267 ? 0.7116 1.2423 0.9428 0.2654  0.0431  0.1881  267 THR A CB  
2012 O OG1 . THR A 267 ? 0.7329 1.2188 0.9391 0.2943  0.0526  0.1811  267 THR A OG1 
2013 C CG2 . THR A 267 ? 0.7014 1.2437 0.9410 0.2532  0.0297  0.1928  267 THR A CG2 
2014 N N   . GLU A 268 ? 0.6587 1.2529 0.9280 0.2071  0.0358  0.1962  268 GLU A N   
2015 C CA  . GLU A 268 ? 0.6372 1.2731 0.9298 0.1763  0.0269  0.2049  268 GLU A CA  
2016 C C   . GLU A 268 ? 0.6121 1.2048 0.8977 0.1471  0.0220  0.1958  268 GLU A C   
2017 O O   . GLU A 268 ? 0.6005 1.1959 0.8952 0.1192  0.0099  0.1972  268 GLU A O   
2018 C CB  . GLU A 268 ? 0.6388 1.3364 0.9494 0.1828  0.0351  0.2173  268 GLU A CB  
2019 C CG  . GLU A 268 ? 0.6752 1.4314 0.9993 0.2082  0.0390  0.2296  268 GLU A CG  
2020 C CD  . GLU A 268 ? 0.7225 1.5480 1.0685 0.2085  0.0456  0.2437  268 GLU A CD  
2021 O OE1 . GLU A 268 ? 0.7275 1.5495 1.0745 0.1924  0.0491  0.2428  268 GLU A OE1 
2022 O OE2 . GLU A 268 ? 0.7288 1.6150 1.0915 0.2251  0.0473  0.2564  268 GLU A OE2 
2023 N N   . LEU A 269 ? 0.6001 1.1534 0.8685 0.1550  0.0313  0.1865  269 LEU A N   
2024 C CA  . LEU A 269 ? 0.5812 1.0966 0.8423 0.1323  0.0290  0.1788  269 LEU A CA  
2025 C C   . LEU A 269 ? 0.5749 1.0383 0.8234 0.1193  0.0198  0.1681  269 LEU A C   
2026 O O   . LEU A 269 ? 0.5660 1.0194 0.8191 0.0926  0.0104  0.1671  269 LEU A O   
2027 C CB  . LEU A 269 ? 0.5860 1.0762 0.8305 0.1485  0.0419  0.1716  269 LEU A CB  
2028 C CG  . LEU A 269 ? 0.5743 1.0315 0.8106 0.1303  0.0421  0.1649  269 LEU A CG  
2029 C CD1 . LEU A 269 ? 0.5780 1.0487 0.8096 0.1442  0.0546  0.1660  269 LEU A CD1 
2030 C CD2 . LEU A 269 ? 0.5754 0.9677 0.7904 0.1288  0.0397  0.1504  269 LEU A CD2 
2031 N N   . ILE A 270 ? 0.5765 1.0060 0.8078 0.1391  0.0229  0.1605  270 ILE A N   
2032 C CA  . ILE A 270 ? 0.5643 0.9480 0.7828 0.1305  0.0155  0.1512  270 ILE A CA  
2033 C C   . ILE A 270 ? 0.5541 0.9628 0.7860 0.1149  0.0028  0.1571  270 ILE A C   
2034 O O   . ILE A 270 ? 0.5535 0.9378 0.7823 0.0943  -0.0061 0.1516  270 ILE A O   
2035 C CB  . ILE A 270 ? 0.5782 0.9259 0.7764 0.1557  0.0221  0.1444  270 ILE A CB  
2036 C CG1 . ILE A 270 ? 0.5817 0.8980 0.7642 0.1655  0.0328  0.1364  270 ILE A CG1 
2037 C CG2 . ILE A 270 ? 0.5681 0.8750 0.7545 0.1474  0.0148  0.1368  270 ILE A CG2 
2038 C CD1 . ILE A 270 ? 0.6208 0.9192 0.7869 0.1949  0.0421  0.1334  270 ILE A CD1 
2039 N N   . ALA A 271 ? 0.5495 1.0089 0.7962 0.1245  0.0018  0.1681  271 ALA A N   
2040 C CA  . ALA A 271 ? 0.5463 1.0350 0.8063 0.1085  -0.0112 0.1742  271 ALA A CA  
2041 C C   . ALA A 271 ? 0.5395 1.0370 0.8110 0.0754  -0.0201 0.1757  271 ALA A C   
2042 O O   . ALA A 271 ? 0.5399 1.0233 0.8098 0.0555  -0.0317 0.1719  271 ALA A O   
2043 C CB  . ALA A 271 ? 0.5442 1.0929 0.8202 0.1244  -0.0105 0.1874  271 ALA A CB  
2044 N N   . CYS A 272 ? 0.5361 1.0541 0.8172 0.0702  -0.0142 0.1810  272 CYS A N   
2045 C CA  . CYS A 272 ? 0.5350 1.0597 0.8262 0.0396  -0.0213 0.1840  272 CYS A CA  
2046 C C   . CYS A 272 ? 0.5317 0.9946 0.8058 0.0251  -0.0249 0.1711  272 CYS A C   
2047 O O   . CYS A 272 ? 0.5373 0.9899 0.8131 0.0004  -0.0362 0.1695  272 CYS A O   
2048 C CB  . CYS A 272 ? 0.5383 1.0980 0.8416 0.0406  -0.0124 0.1933  272 CYS A CB  
2049 S SG  . CYS A 272 ? 0.5753 1.1472 0.8919 0.0029  -0.0203 0.2004  272 CYS A SG  
2050 N N   . LEU A 273 ? 0.5223 0.9443 0.7794 0.0404  -0.0155 0.1619  273 LEU A N   
2051 C CA  . LEU A 273 ? 0.5100 0.8761 0.7509 0.0300  -0.0180 0.1500  273 LEU A CA  
2052 C C   . LEU A 273 ? 0.5126 0.8569 0.7463 0.0230  -0.0282 0.1437  273 LEU A C   
2053 O O   . LEU A 273 ? 0.5148 0.8318 0.7435 0.0039  -0.0359 0.1380  273 LEU A O   
2054 C CB  . LEU A 273 ? 0.5072 0.8375 0.7309 0.0497  -0.0068 0.1414  273 LEU A CB  
2055 C CG  . LEU A 273 ? 0.4950 0.8280 0.7185 0.0518  0.0023  0.1430  273 LEU A CG  
2056 C CD1 . LEU A 273 ? 0.4766 0.7743 0.6812 0.0719  0.0122  0.1335  273 LEU A CD1 
2057 C CD2 . LEU A 273 ? 0.4771 0.7957 0.7028 0.0271  -0.0030 0.1427  273 LEU A CD2 
2058 N N   . ARG A 274 ? 0.5109 0.8676 0.7433 0.0394  -0.0283 0.1450  274 ARG A N   
2059 C CA  . ARG A 274 ? 0.5091 0.8490 0.7338 0.0344  -0.0377 0.1398  274 ARG A CA  
2060 C C   . ARG A 274 ? 0.5115 0.8740 0.7473 0.0094  -0.0513 0.1436  274 ARG A C   
2061 O O   . ARG A 274 ? 0.5220 0.8650 0.7492 0.0003  -0.0601 0.1373  274 ARG A O   
2062 C CB  . ARG A 274 ? 0.5054 0.8563 0.7262 0.0581  -0.0349 0.1422  274 ARG A CB  
2063 C CG  . ARG A 274 ? 0.5148 0.8280 0.7183 0.0797  -0.0240 0.1355  274 ARG A CG  
2064 C CD  . ARG A 274 ? 0.5363 0.8452 0.7307 0.0987  -0.0238 0.1362  274 ARG A CD  
2065 N NE  . ARG A 274 ? 0.5653 0.9263 0.7743 0.1088  -0.0258 0.1480  274 ARG A NE  
2066 C CZ  . ARG A 274 ? 0.5481 0.9312 0.7604 0.1325  -0.0166 0.1547  274 ARG A CZ  
2067 N NH1 . ARG A 274 ? 0.5605 0.9142 0.7604 0.1480  -0.0051 0.1497  274 ARG A NH1 
2068 N NH2 . ARG A 274 ? 0.5220 0.9568 0.7491 0.1410  -0.0193 0.1662  274 ARG A NH2 
2069 N N   . THR A 275 ? 0.5132 0.9170 0.7672 -0.0025 -0.0531 0.1538  275 THR A N   
2070 C CA  . THR A 275 ? 0.5218 0.9454 0.7855 -0.0291 -0.0669 0.1575  275 THR A CA  
2071 C C   . THR A 275 ? 0.5271 0.9161 0.7853 -0.0523 -0.0709 0.1522  275 THR A C   
2072 O O   . THR A 275 ? 0.5458 0.9374 0.8072 -0.0763 -0.0827 0.1527  275 THR A O   
2073 C CB  . THR A 275 ? 0.5209 1.0104 0.8086 -0.0349 -0.0689 0.1728  275 THR A CB  
2074 O OG1 . THR A 275 ? 0.5338 1.0339 0.8302 -0.0401 -0.0616 0.1789  275 THR A OG1 
2075 C CG2 . THR A 275 ? 0.5176 1.0453 0.8120 -0.0081 -0.0631 0.1798  275 THR A CG2 
2076 N N   . ARG A 276 ? 0.5225 0.8784 0.7717 -0.0452 -0.0614 0.1471  276 ARG A N   
2077 C CA  . ARG A 276 ? 0.5266 0.8522 0.7713 -0.0646 -0.0639 0.1440  276 ARG A CA  
2078 C C   . ARG A 276 ? 0.5358 0.8087 0.7616 -0.0697 -0.0693 0.1305  276 ARG A C   
2079 O O   . ARG A 276 ? 0.5405 0.7894 0.7536 -0.0526 -0.0648 0.1224  276 ARG A O   
2080 C CB  . ARG A 276 ? 0.5165 0.8367 0.7611 -0.0550 -0.0516 0.1461  276 ARG A CB  
2081 C CG  . ARG A 276 ? 0.5261 0.8976 0.7895 -0.0565 -0.0471 0.1602  276 ARG A CG  
2082 C CD  . ARG A 276 ? 0.5784 0.9701 0.8545 -0.0863 -0.0578 0.1689  276 ARG A CD  
2083 N NE  . ARG A 276 ? 0.6242 1.0746 0.9209 -0.0884 -0.0543 0.1841  276 ARG A NE  
2084 C CZ  . ARG A 276 ? 0.6428 1.1442 0.9551 -0.0880 -0.0582 0.1930  276 ARG A CZ  
2085 N NH1 . ARG A 276 ? 0.6364 1.1368 0.9455 -0.0860 -0.0664 0.1879  276 ARG A NH1 
2086 N NH2 . ARG A 276 ? 0.6433 1.2001 0.9749 -0.0894 -0.0537 0.2076  276 ARG A NH2 
2087 N N   . PRO A 277 ? 0.5483 0.8022 0.7712 -0.0932 -0.0789 0.1284  277 PRO A N   
2088 C CA  . PRO A 277 ? 0.5573 0.7611 0.7612 -0.0969 -0.0836 0.1154  277 PRO A CA  
2089 C C   . PRO A 277 ? 0.5528 0.7222 0.7453 -0.0805 -0.0728 0.1086  277 PRO A C   
2090 O O   . PRO A 277 ? 0.5504 0.7248 0.7480 -0.0764 -0.0646 0.1134  277 PRO A O   
2091 C CB  . PRO A 277 ? 0.5714 0.7606 0.7753 -0.1233 -0.0927 0.1167  277 PRO A CB  
2092 C CG  . PRO A 277 ? 0.5733 0.8116 0.7966 -0.1377 -0.0975 0.1299  277 PRO A CG  
2093 C CD  . PRO A 277 ? 0.5561 0.8340 0.7924 -0.1175 -0.0860 0.1383  277 PRO A CD  
2094 N N   . ALA A 278 ? 0.5564 0.6927 0.7332 -0.0720 -0.0728 0.0976  278 ALA A N   
2095 C CA  . ALA A 278 ? 0.5540 0.6609 0.7208 -0.0581 -0.0632 0.0917  278 ALA A CA  
2096 C C   . ALA A 278 ? 0.5616 0.6471 0.7269 -0.0676 -0.0616 0.0919  278 ALA A C   
2097 O O   . ALA A 278 ? 0.5493 0.6302 0.7143 -0.0579 -0.0525 0.0929  278 ALA A O   
2098 C CB  . ALA A 278 ? 0.5613 0.6389 0.7122 -0.0498 -0.0641 0.0809  278 ALA A CB  
2099 N N   . GLN A 279 ? 0.5792 0.6509 0.7424 -0.0865 -0.0708 0.0914  279 GLN A N   
2100 C CA  . GLN A 279 ? 0.5872 0.6353 0.7474 -0.0954 -0.0703 0.0923  279 GLN A CA  
2101 C C   . GLN A 279 ? 0.5878 0.6629 0.7616 -0.0983 -0.0647 0.1042  279 GLN A C   
2102 O O   . GLN A 279 ? 0.5908 0.6509 0.7617 -0.0964 -0.0594 0.1055  279 GLN A O   
2103 C CB  . GLN A 279 ? 0.6152 0.6405 0.7685 -0.1151 -0.0819 0.0896  279 GLN A CB  
2104 C CG  . GLN A 279 ? 0.6209 0.6100 0.7655 -0.1209 -0.0819 0.0882  279 GLN A CG  
2105 C CD  . GLN A 279 ? 0.6177 0.5798 0.7510 -0.1033 -0.0743 0.0798  279 GLN A CD  
2106 O OE1 . GLN A 279 ? 0.6060 0.5538 0.7291 -0.0937 -0.0745 0.0700  279 GLN A OE1 
2107 N NE2 . GLN A 279 ? 0.6042 0.5613 0.7393 -0.0994 -0.0676 0.0842  279 GLN A NE2 
2108 N N   . ASP A 280 ? 0.5898 0.7069 0.7782 -0.1021 -0.0656 0.1134  280 ASP A N   
2109 C CA  . ASP A 280 ? 0.5861 0.7354 0.7877 -0.1015 -0.0587 0.1251  280 ASP A CA  
2110 C C   . ASP A 280 ? 0.5640 0.7136 0.7623 -0.0795 -0.0461 0.1228  280 ASP A C   
2111 O O   . ASP A 280 ? 0.5618 0.7131 0.7616 -0.0790 -0.0400 0.1276  280 ASP A O   
2112 C CB  . ASP A 280 ? 0.5894 0.7885 0.8082 -0.1080 -0.0617 0.1356  280 ASP A CB  
2113 C CG  . ASP A 280 ? 0.6381 0.8405 0.8620 -0.1349 -0.0739 0.1407  280 ASP A CG  
2114 O OD1 . ASP A 280 ? 0.6908 0.8517 0.9020 -0.1463 -0.0807 0.1339  280 ASP A OD1 
2115 O OD2 . ASP A 280 ? 0.6624 0.9084 0.9023 -0.1448 -0.0771 0.1515  280 ASP A OD2 
2116 N N   . LEU A 281 ? 0.5471 0.6931 0.7394 -0.0621 -0.0425 0.1156  281 LEU A N   
2117 C CA  . LEU A 281 ? 0.5386 0.6800 0.7254 -0.0428 -0.0313 0.1127  281 LEU A CA  
2118 C C   . LEU A 281 ? 0.5431 0.6473 0.7183 -0.0437 -0.0291 0.1065  281 LEU A C   
2119 O O   . LEU A 281 ? 0.5418 0.6478 0.7164 -0.0392 -0.0222 0.1090  281 LEU A O   
2120 C CB  . LEU A 281 ? 0.5332 0.6742 0.7144 -0.0249 -0.0281 0.1069  281 LEU A CB  
2121 C CG  . LEU A 281 ? 0.5253 0.7042 0.7174 -0.0212 -0.0305 0.1133  281 LEU A CG  
2122 C CD1 . LEU A 281 ? 0.5329 0.7090 0.7176 0.0004  -0.0245 0.1092  281 LEU A CD1 
2123 C CD2 . LEU A 281 ? 0.5151 0.7361 0.7225 -0.0236 -0.0273 0.1252  281 LEU A CD2 
2124 N N   . VAL A 282 ? 0.5475 0.6202 0.7135 -0.0496 -0.0354 0.0989  282 VAL A N   
2125 C CA  . VAL A 282 ? 0.5503 0.5899 0.7061 -0.0499 -0.0340 0.0937  282 VAL A CA  
2126 C C   . VAL A 282 ? 0.5605 0.6028 0.7211 -0.0618 -0.0345 0.1020  282 VAL A C   
2127 O O   . VAL A 282 ? 0.5578 0.5934 0.7149 -0.0562 -0.0284 0.1024  282 VAL A O   
2128 C CB  . VAL A 282 ? 0.5588 0.5662 0.7036 -0.0531 -0.0406 0.0844  282 VAL A CB  
2129 C CG1 . VAL A 282 ? 0.5628 0.5395 0.6987 -0.0540 -0.0398 0.0808  282 VAL A CG1 
2130 C CG2 . VAL A 282 ? 0.5463 0.5500 0.6847 -0.0395 -0.0380 0.0771  282 VAL A CG2 
2131 N N   . ASP A 283 ? 0.5701 0.6233 0.7384 -0.0786 -0.0417 0.1092  283 ASP A N   
2132 C CA  . ASP A 283 ? 0.5876 0.6432 0.7603 -0.0915 -0.0424 0.1190  283 ASP A CA  
2133 C C   . ASP A 283 ? 0.5802 0.6638 0.7598 -0.0844 -0.0329 0.1271  283 ASP A C   
2134 O O   . ASP A 283 ? 0.5831 0.6652 0.7635 -0.0920 -0.0318 0.1346  283 ASP A O   
2135 C CB  . ASP A 283 ? 0.6051 0.6727 0.7863 -0.1128 -0.0517 0.1270  283 ASP A CB  
2136 C CG  . ASP A 283 ? 0.6308 0.6635 0.8016 -0.1234 -0.0623 0.1192  283 ASP A CG  
2137 O OD1 . ASP A 283 ? 0.6069 0.6056 0.7643 -0.1144 -0.0619 0.1087  283 ASP A OD1 
2138 O OD2 . ASP A 283 ? 0.6698 0.7107 0.8456 -0.1413 -0.0711 0.1236  283 ASP A OD2 
2139 N N   . HIS A 284 ? 0.5753 0.6832 0.7584 -0.0695 -0.0260 0.1258  284 HIS A N   
2140 C CA  . HIS A 284 ? 0.5756 0.7128 0.7641 -0.0620 -0.0168 0.1332  284 HIS A CA  
2141 C C   . HIS A 284 ? 0.5759 0.7041 0.7542 -0.0424 -0.0078 0.1252  284 HIS A C   
2142 O O   . HIS A 284 ? 0.5753 0.7182 0.7531 -0.0361 -0.0004 0.1290  284 HIS A O   
2143 C CB  . HIS A 284 ? 0.5737 0.7559 0.7769 -0.0628 -0.0160 0.1421  284 HIS A CB  
2144 C CG  . HIS A 284 ? 0.5773 0.7767 0.7923 -0.0851 -0.0235 0.1535  284 HIS A CG  
2145 N ND1 . HIS A 284 ? 0.5827 0.7969 0.8033 -0.0956 -0.0212 0.1652  284 HIS A ND1 
2146 C CD2 . HIS A 284 ? 0.5691 0.7723 0.7903 -0.1002 -0.0336 0.1553  284 HIS A CD2 
2147 C CE1 . HIS A 284 ? 0.5963 0.8216 0.8266 -0.1171 -0.0297 0.1741  284 HIS A CE1 
2148 N NE2 . HIS A 284 ? 0.5950 0.8142 0.8257 -0.1205 -0.0375 0.1679  284 HIS A NE2 
2149 N N   . GLU A 285 ? 0.5891 0.6928 0.7582 -0.0336 -0.0087 0.1142  285 GLU A N   
2150 C CA  . GLU A 285 ? 0.6013 0.6871 0.7582 -0.0185 -0.0021 0.1051  285 GLU A CA  
2151 C C   . GLU A 285 ? 0.6119 0.6917 0.7623 -0.0162 0.0034  0.1056  285 GLU A C   
2152 O O   . GLU A 285 ? 0.6084 0.6943 0.7529 -0.0037 0.0108  0.1028  285 GLU A O   
2153 C CB  . GLU A 285 ? 0.6003 0.6532 0.7487 -0.0190 -0.0069 0.0957  285 GLU A CB  
2154 C CG  . GLU A 285 ? 0.6235 0.6678 0.7643 -0.0051 -0.0032 0.0876  285 GLU A CG  
2155 C CD  . GLU A 285 ? 0.6399 0.6530 0.7716 -0.0058 -0.0066 0.0791  285 GLU A CD  
2156 O OE1 . GLU A 285 ? 0.6448 0.6436 0.7763 -0.0160 -0.0123 0.0791  285 GLU A OE1 
2157 O OE2 . GLU A 285 ? 0.6725 0.6752 0.7966 0.0046  -0.0032 0.0728  285 GLU A OE2 
2158 N N   . TRP A 286 ? 0.6331 0.6990 0.7827 -0.0277 -0.0007 0.1089  286 TRP A N   
2159 C CA  . TRP A 286 ? 0.6528 0.7110 0.7953 -0.0261 0.0031  0.1096  286 TRP A CA  
2160 C C   . TRP A 286 ? 0.6489 0.7377 0.7955 -0.0247 0.0093  0.1185  286 TRP A C   
2161 O O   . TRP A 286 ? 0.6577 0.7464 0.7965 -0.0191 0.0143  0.1177  286 TRP A O   
2162 C CB  . TRP A 286 ? 0.6726 0.7091 0.8139 -0.0382 -0.0035 0.1128  286 TRP A CB  
2163 C CG  . TRP A 286 ? 0.7441 0.7713 0.8781 -0.0373 -0.0012 0.1148  286 TRP A CG  
2164 C CD1 . TRP A 286 ? 0.7817 0.7893 0.9059 -0.0299 -0.0002 0.1067  286 TRP A CD1 
2165 C CD2 . TRP A 286 ? 0.8064 0.8454 0.9427 -0.0446 -0.0004 0.1264  286 TRP A CD2 
2166 N NE1 . TRP A 286 ? 0.7975 0.8050 0.9178 -0.0315 0.0009  0.1122  286 TRP A NE1 
2167 C CE2 . TRP A 286 ? 0.8270 0.8524 0.9539 -0.0400 0.0010  0.1244  286 TRP A CE2 
2168 C CE3 . TRP A 286 ? 0.8485 0.9103 0.9941 -0.0551 -0.0006 0.1393  286 TRP A CE3 
2169 C CZ2 . TRP A 286 ? 0.8629 0.8955 0.9883 -0.0446 0.0021  0.1348  286 TRP A CZ2 
2170 C CZ3 . TRP A 286 ? 0.8747 0.9430 1.0189 -0.0605 0.0010  0.1502  286 TRP A CZ3 
2171 C CH2 . TRP A 286 ? 0.8860 0.9389 1.0195 -0.0546 0.0023  0.1477  286 TRP A CH2 
2172 N N   . HIS A 287 ? 0.6397 0.7570 0.7982 -0.0296 0.0090  0.1271  287 HIS A N   
2173 C CA  . HIS A 287 ? 0.6357 0.7862 0.7998 -0.0300 0.0148  0.1376  287 HIS A CA  
2174 C C   . HIS A 287 ? 0.6245 0.7963 0.7846 -0.0121 0.0245  0.1343  287 HIS A C   
2175 O O   . HIS A 287 ? 0.6221 0.8239 0.7858 -0.0103 0.0304  0.1427  287 HIS A O   
2176 C CB  . HIS A 287 ? 0.6438 0.8191 0.8235 -0.0448 0.0101  0.1497  287 HIS A CB  
2177 C CG  . HIS A 287 ? 0.6820 0.8350 0.8631 -0.0634 0.0010  0.1542  287 HIS A CG  
2178 N ND1 . HIS A 287 ? 0.7155 0.8615 0.9029 -0.0756 -0.0078 0.1545  287 HIS A ND1 
2179 C CD2 . HIS A 287 ? 0.7121 0.8454 0.8873 -0.0710 -0.0008 0.1580  287 HIS A CD2 
2180 C CE1 . HIS A 287 ? 0.7372 0.8580 0.9216 -0.0899 -0.0145 0.1578  287 HIS A CE1 
2181 N NE2 . HIS A 287 ? 0.7552 0.8678 0.9325 -0.0868 -0.0102 0.1605  287 HIS A NE2 
2182 N N   . VAL A 288 ? 0.6100 0.7659 0.7617 0.0015  0.0265  0.1226  288 VAL A N   
2183 C CA  . VAL A 288 ? 0.6055 0.7764 0.7508 0.0198  0.0356  0.1188  288 VAL A CA  
2184 C C   . VAL A 288 ? 0.6086 0.7602 0.7361 0.0294  0.0409  0.1096  288 VAL A C   
2185 O O   . VAL A 288 ? 0.6160 0.7744 0.7347 0.0450  0.0484  0.1049  288 VAL A O   
2186 C CB  . VAL A 288 ? 0.6038 0.7748 0.7504 0.0310  0.0358  0.1135  288 VAL A CB  
2187 C CG1 . VAL A 288 ? 0.5991 0.7926 0.7630 0.0208  0.0297  0.1225  288 VAL A CG1 
2188 C CG2 . VAL A 288 ? 0.5936 0.7249 0.7282 0.0344  0.0328  0.1012  288 VAL A CG2 
2189 N N   . LEU A 289 ? 0.6003 0.7283 0.7217 0.0209  0.0370  0.1071  289 LEU A N   
2190 C CA  . LEU A 289 ? 0.6030 0.7138 0.7074 0.0280  0.0407  0.0982  289 LEU A CA  
2191 C C   . LEU A 289 ? 0.6091 0.7439 0.7086 0.0324  0.0477  0.1032  289 LEU A C   
2192 O O   . LEU A 289 ? 0.6079 0.7665 0.7176 0.0242  0.0476  0.1155  289 LEU A O   
2193 C CB  . LEU A 289 ? 0.5948 0.6791 0.6954 0.0181  0.0344  0.0955  289 LEU A CB  
2194 C CG  . LEU A 289 ? 0.5935 0.6498 0.6923 0.0178  0.0295  0.0866  289 LEU A CG  
2195 C CD1 . LEU A 289 ? 0.5549 0.5927 0.6544 0.0075  0.0231  0.0874  289 LEU A CD1 
2196 C CD2 . LEU A 289 ? 0.5676 0.6073 0.6522 0.0299  0.0336  0.0742  289 LEU A CD2 
2197 N N   . PRO A 290 ? 0.6157 0.7440 0.6985 0.0451  0.0537  0.0938  290 PRO A N   
2198 C CA  . PRO A 290 ? 0.6289 0.7823 0.7055 0.0513  0.0610  0.0980  290 PRO A CA  
2199 C C   . PRO A 290 ? 0.6320 0.7877 0.7044 0.0416  0.0594  0.1033  290 PRO A C   
2200 O O   . PRO A 290 ? 0.6427 0.8244 0.7134 0.0436  0.0648  0.1105  290 PRO A O   
2201 C CB  . PRO A 290 ? 0.6402 0.7804 0.6970 0.0686  0.0674  0.0843  290 PRO A CB  
2202 C CG  . PRO A 290 ? 0.6359 0.7388 0.6864 0.0664  0.0619  0.0734  290 PRO A CG  
2203 C CD  . PRO A 290 ? 0.6192 0.7211 0.6883 0.0559  0.0550  0.0799  290 PRO A CD  
2204 N N   . GLN A 291 ? 0.6306 0.7611 0.7011 0.0323  0.0524  0.1004  291 GLN A N   
2205 C CA  . GLN A 291 ? 0.6439 0.7757 0.7103 0.0243  0.0502  0.1061  291 GLN A CA  
2206 C C   . GLN A 291 ? 0.6392 0.7521 0.7151 0.0116  0.0413  0.1102  291 GLN A C   
2207 O O   . GLN A 291 ? 0.6327 0.7270 0.7131 0.0107  0.0373  0.1043  291 GLN A O   
2208 C CB  . GLN A 291 ? 0.6523 0.7706 0.6983 0.0306  0.0518  0.0946  291 GLN A CB  
2209 C CG  . GLN A 291 ? 0.6795 0.8044 0.7099 0.0452  0.0599  0.0854  291 GLN A CG  
2210 C CD  . GLN A 291 ? 0.7147 0.8158 0.7390 0.0537  0.0604  0.0721  291 GLN A CD  
2211 O OE1 . GLN A 291 ? 0.7099 0.7887 0.7396 0.0479  0.0544  0.0685  291 GLN A OE1 
2212 N NE2 . GLN A 291 ? 0.7242 0.8296 0.7364 0.0684  0.0679  0.0652  291 GLN A NE2 
2213 N N   . GLU A 292 ? 0.6482 0.7653 0.7259 0.0027  0.0384  0.1205  292 GLU A N   
2214 C CA  . GLU A 292 ? 0.6509 0.7460 0.7325 -0.0060 0.0306  0.1226  292 GLU A CA  
2215 C C   . GLU A 292 ? 0.6461 0.7201 0.7164 0.0000  0.0291  0.1084  292 GLU A C   
2216 O O   . GLU A 292 ? 0.6519 0.7305 0.7090 0.0066  0.0330  0.1018  292 GLU A O   
2217 C CB  . GLU A 292 ? 0.6662 0.7691 0.7469 -0.0130 0.0290  0.1354  292 GLU A CB  
2218 C CG  . GLU A 292 ? 0.7112 0.7910 0.7945 -0.0200 0.0212  0.1392  292 GLU A CG  
2219 C CD  . GLU A 292 ? 0.7880 0.8749 0.8703 -0.0264 0.0197  0.1543  292 GLU A CD  
2220 O OE1 . GLU A 292 ? 0.8119 0.9237 0.8934 -0.0276 0.0247  0.1633  292 GLU A OE1 
2221 O OE2 . GLU A 292 ? 0.8121 0.8802 0.8940 -0.0295 0.0139  0.1579  292 GLU A OE2 
2222 N N   . SER A 293 ? 0.6350 0.6868 0.7094 -0.0023 0.0239  0.1031  293 SER A N   
2223 C CA  . SER A 293 ? 0.6374 0.6722 0.7023 0.0024  0.0230  0.0902  293 SER A CA  
2224 C C   . SER A 293 ? 0.6347 0.6483 0.7047 -0.0009 0.0171  0.0870  293 SER A C   
2225 O O   . SER A 293 ? 0.6397 0.6480 0.7197 -0.0056 0.0137  0.0925  293 SER A O   
2226 C CB  . SER A 293 ? 0.6331 0.6675 0.6905 0.0110  0.0283  0.0798  293 SER A CB  
2227 O OG  . SER A 293 ? 0.6283 0.6623 0.6952 0.0122  0.0287  0.0803  293 SER A OG  
2228 N N   . ILE A 294 ? 0.6300 0.6322 0.6923 0.0011  0.0157  0.0780  294 ILE A N   
2229 C CA  . ILE A 294 ? 0.6177 0.6025 0.6840 -0.0002 0.0116  0.0736  294 ILE A CA  
2230 C C   . ILE A 294 ? 0.6094 0.5846 0.6681 0.0033  0.0135  0.0618  294 ILE A C   
2231 O O   . ILE A 294 ? 0.6084 0.5870 0.6562 0.0062  0.0170  0.0563  294 ILE A O   
2232 C CB  . ILE A 294 ? 0.6287 0.6101 0.6951 -0.0026 0.0070  0.0769  294 ILE A CB  
2233 C CG1 . ILE A 294 ? 0.6270 0.6157 0.6827 -0.0017 0.0076  0.0726  294 ILE A CG1 
2234 C CG2 . ILE A 294 ? 0.6468 0.6318 0.7196 -0.0060 0.0044  0.0896  294 ILE A CG2 
2235 C CD1 . ILE A 294 ? 0.6590 0.6440 0.7158 -0.0027 0.0032  0.0722  294 ILE A CD1 
2236 N N   . PHE A 295 ? 0.5913 0.5529 0.6542 0.0029  0.0113  0.0581  295 PHE A N   
2237 C CA  . PHE A 295 ? 0.5820 0.5322 0.6385 0.0052  0.0130  0.0485  295 PHE A CA  
2238 C C   . PHE A 295 ? 0.5793 0.5314 0.6305 0.0108  0.0181  0.0454  295 PHE A C   
2239 O O   . PHE A 295 ? 0.5857 0.5296 0.6253 0.0138  0.0209  0.0374  295 PHE A O   
2240 C CB  . PHE A 295 ? 0.5862 0.5339 0.6338 0.0026  0.0118  0.0429  295 PHE A CB  
2241 C CG  . PHE A 295 ? 0.6175 0.5521 0.6641 0.0009  0.0106  0.0367  295 PHE A CG  
2242 C CD1 . PHE A 295 ? 0.6329 0.5553 0.6765 0.0037  0.0133  0.0317  295 PHE A CD1 
2243 C CD2 . PHE A 295 ? 0.6118 0.5482 0.6603 -0.0031 0.0071  0.0367  295 PHE A CD2 
2244 C CE1 . PHE A 295 ? 0.6039 0.5148 0.6461 0.0014  0.0124  0.0274  295 PHE A CE1 
2245 C CE2 . PHE A 295 ? 0.6029 0.5305 0.6509 -0.0054 0.0066  0.0320  295 PHE A CE2 
2246 C CZ  . PHE A 295 ? 0.6030 0.5171 0.6477 -0.0037 0.0093  0.0276  295 PHE A CZ  
2247 N N   . ARG A 296 ? 0.5625 0.5255 0.6218 0.0122  0.0192  0.0521  296 ARG A N   
2248 C CA  . ARG A 296 ? 0.5578 0.5255 0.6159 0.0192  0.0238  0.0508  296 ARG A CA  
2249 C C   . ARG A 296 ? 0.5416 0.5123 0.6125 0.0176  0.0214  0.0560  296 ARG A C   
2250 O O   . ARG A 296 ? 0.5406 0.5153 0.6209 0.0107  0.0172  0.0629  296 ARG A O   
2251 C CB  . ARG A 296 ? 0.5615 0.5480 0.6161 0.0231  0.0285  0.0545  296 ARG A CB  
2252 C CG  . ARG A 296 ? 0.5724 0.5573 0.6121 0.0248  0.0307  0.0487  296 ARG A CG  
2253 C CD  . ARG A 296 ? 0.5832 0.5506 0.6080 0.0315  0.0339  0.0372  296 ARG A CD  
2254 N NE  . ARG A 296 ? 0.5951 0.5604 0.6032 0.0325  0.0357  0.0307  296 ARG A NE  
2255 C CZ  . ARG A 296 ? 0.6020 0.5586 0.6036 0.0252  0.0316  0.0264  296 ARG A CZ  
2256 N NH1 . ARG A 296 ? 0.6022 0.5528 0.6133 0.0178  0.0264  0.0284  296 ARG A NH1 
2257 N NH2 . ARG A 296 ? 0.6136 0.5691 0.5986 0.0256  0.0328  0.0200  296 ARG A NH2 
2258 N N   . PHE A 297 ? 0.5219 0.4899 0.5920 0.0239  0.0236  0.0529  297 PHE A N   
2259 C CA  . PHE A 297 ? 0.5052 0.4753 0.5856 0.0224  0.0205  0.0563  297 PHE A CA  
2260 C C   . PHE A 297 ? 0.5131 0.4986 0.5956 0.0307  0.0247  0.0586  297 PHE A C   
2261 O O   . PHE A 297 ? 0.5264 0.5085 0.5986 0.0405  0.0300  0.0535  297 PHE A O   
2262 C CB  . PHE A 297 ? 0.4985 0.4482 0.5759 0.0220  0.0178  0.0503  297 PHE A CB  
2263 C CG  . PHE A 297 ? 0.5045 0.4412 0.5777 0.0169  0.0155  0.0468  297 PHE A CG  
2264 C CD1 . PHE A 297 ? 0.5030 0.4401 0.5827 0.0102  0.0109  0.0511  297 PHE A CD1 
2265 C CD2 . PHE A 297 ? 0.4847 0.4088 0.5469 0.0188  0.0176  0.0397  297 PHE A CD2 
2266 C CE1 . PHE A 297 ? 0.4788 0.4076 0.5554 0.0075  0.0091  0.0487  297 PHE A CE1 
2267 C CE2 . PHE A 297 ? 0.4586 0.3762 0.5187 0.0137  0.0152  0.0375  297 PHE A CE2 
2268 C CZ  . PHE A 297 ? 0.4520 0.3735 0.5198 0.0090  0.0112  0.0422  297 PHE A CZ  
2269 N N   . SER A 298 ? 0.5061 0.5081 0.6011 0.0271  0.0221  0.0659  298 SER A N   
2270 C CA  . SER A 298 ? 0.5101 0.5358 0.6100 0.0344  0.0260  0.0707  298 SER A CA  
2271 C C   . SER A 298 ? 0.5158 0.5358 0.6103 0.0468  0.0290  0.0660  298 SER A C   
2272 O O   . SER A 298 ? 0.5384 0.5685 0.6279 0.0588  0.0353  0.0655  298 SER A O   
2273 C CB  . SER A 298 ? 0.5036 0.5504 0.6192 0.0251  0.0215  0.0804  298 SER A CB  
2274 O OG  . SER A 298 ? 0.5181 0.5640 0.6374 0.0130  0.0180  0.0854  298 SER A OG  
2275 N N   . PHE A 299 ? 0.5072 0.5111 0.6015 0.0449  0.0248  0.0627  299 PHE A N   
2276 C CA  . PHE A 299 ? 0.5027 0.5024 0.5929 0.0561  0.0267  0.0604  299 PHE A CA  
2277 C C   . PHE A 299 ? 0.5095 0.4778 0.5868 0.0576  0.0268  0.0522  299 PHE A C   
2278 O O   . PHE A 299 ? 0.5230 0.4792 0.6019 0.0494  0.0219  0.0506  299 PHE A O   
2279 C CB  . PHE A 299 ? 0.4880 0.5048 0.5911 0.0526  0.0215  0.0667  299 PHE A CB  
2280 C CG  . PHE A 299 ? 0.4681 0.5193 0.5842 0.0511  0.0220  0.0757  299 PHE A CG  
2281 C CD1 . PHE A 299 ? 0.4629 0.5348 0.5795 0.0650  0.0282  0.0788  299 PHE A CD1 
2282 C CD2 . PHE A 299 ? 0.4615 0.5239 0.5883 0.0361  0.0168  0.0815  299 PHE A CD2 
2283 C CE1 . PHE A 299 ? 0.4577 0.5662 0.5873 0.0635  0.0294  0.0883  299 PHE A CE1 
2284 C CE2 . PHE A 299 ? 0.4508 0.5465 0.5899 0.0327  0.0175  0.0912  299 PHE A CE2 
2285 C CZ  . PHE A 299 ? 0.4347 0.5561 0.5760 0.0463  0.0240  0.0948  299 PHE A CZ  
2286 N N   . VAL A 300 ? 0.5062 0.4612 0.5698 0.0675  0.0324  0.0469  300 VAL A N   
2287 C CA  . VAL A 300 ? 0.5061 0.4310 0.5557 0.0667  0.0330  0.0392  300 VAL A CA  
2288 C C   . VAL A 300 ? 0.5227 0.4329 0.5590 0.0808  0.0381  0.0361  300 VAL A C   
2289 O O   . VAL A 300 ? 0.5269 0.4521 0.5648 0.0925  0.0416  0.0395  300 VAL A O   
2290 C CB  . VAL A 300 ? 0.5128 0.4306 0.5556 0.0601  0.0338  0.0347  300 VAL A CB  
2291 C CG1 . VAL A 300 ? 0.4984 0.4302 0.5538 0.0479  0.0290  0.0393  300 VAL A CG1 
2292 C CG2 . VAL A 300 ? 0.5151 0.4385 0.5489 0.0690  0.0397  0.0328  300 VAL A CG2 
2293 N N   . PRO A 301 ? 0.5342 0.4154 0.5572 0.0800  0.0384  0.0304  301 PRO A N   
2294 C CA  . PRO A 301 ? 0.5563 0.4191 0.5648 0.0936  0.0431  0.0279  301 PRO A CA  
2295 C C   . PRO A 301 ? 0.5786 0.4468 0.5788 0.1063  0.0492  0.0259  301 PRO A C   
2296 O O   . PRO A 301 ? 0.5908 0.4624 0.5876 0.1019  0.0504  0.0223  301 PRO A O   
2297 C CB  . PRO A 301 ? 0.5623 0.3927 0.5564 0.0861  0.0424  0.0215  301 PRO A CB  
2298 C CG  . PRO A 301 ? 0.5469 0.3838 0.5532 0.0719  0.0367  0.0238  301 PRO A CG  
2299 C CD  . PRO A 301 ? 0.5317 0.3976 0.5540 0.0675  0.0344  0.0277  301 PRO A CD  
2300 N N   . VAL A 302 ? 0.5870 0.4593 0.5844 0.1229  0.0531  0.0288  302 VAL A N   
2301 C CA  . VAL A 302 ? 0.6118 0.4883 0.5993 0.1380  0.0600  0.0265  302 VAL A CA  
2302 C C   . VAL A 302 ? 0.6583 0.4949 0.6209 0.1491  0.0641  0.0191  302 VAL A C   
2303 O O   . VAL A 302 ? 0.6680 0.4843 0.6257 0.1517  0.0628  0.0205  302 VAL A O   
2304 C CB  . VAL A 302 ? 0.6027 0.5156 0.6040 0.1514  0.0625  0.0354  302 VAL A CB  
2305 C CG1 . VAL A 302 ? 0.6103 0.5217 0.6154 0.1591  0.0607  0.0408  302 VAL A CG1 
2306 C CG2 . VAL A 302 ? 0.6132 0.5304 0.6027 0.1701  0.0707  0.0328  302 VAL A CG2 
2307 N N   . VAL A 303 ? 0.6867 0.5109 0.6322 0.1554  0.0689  0.0114  303 VAL A N   
2308 C CA  . VAL A 303 ? 0.7273 0.5103 0.6460 0.1667  0.0730  0.0034  303 VAL A CA  
2309 C C   . VAL A 303 ? 0.7494 0.5419 0.6667 0.1912  0.0788  0.0084  303 VAL A C   
2310 O O   . VAL A 303 ? 0.7644 0.5724 0.6773 0.2063  0.0849  0.0072  303 VAL A O   
2311 C CB  . VAL A 303 ? 0.7487 0.5152 0.6479 0.1645  0.0756  -0.0076 303 VAL A CB  
2312 C CG1 . VAL A 303 ? 0.7818 0.5022 0.6499 0.1777  0.0800  -0.0169 303 VAL A CG1 
2313 C CG2 . VAL A 303 ? 0.7163 0.4781 0.6192 0.1400  0.0690  -0.0110 303 VAL A CG2 
2314 N N   . ASP A 304 ? 0.7553 0.5414 0.6768 0.1955  0.0769  0.0147  304 ASP A N   
2315 C CA  . ASP A 304 ? 0.7662 0.5699 0.6921 0.2178  0.0808  0.0224  304 ASP A CA  
2316 C C   . ASP A 304 ? 0.8094 0.5741 0.7089 0.2390  0.0866  0.0182  304 ASP A C   
2317 O O   . ASP A 304 ? 0.8170 0.5957 0.7178 0.2612  0.0908  0.0244  304 ASP A O   
2318 C CB  . ASP A 304 ? 0.7425 0.5662 0.6886 0.2121  0.0749  0.0328  304 ASP A CB  
2319 C CG  . ASP A 304 ? 0.7666 0.5538 0.7039 0.1998  0.0703  0.0313  304 ASP A CG  
2320 O OD1 . ASP A 304 ? 0.7713 0.5212 0.6907 0.1911  0.0706  0.0226  304 ASP A OD1 
2321 O OD2 . ASP A 304 ? 0.7622 0.5608 0.7112 0.1979  0.0662  0.0393  304 ASP A OD2 
2322 N N   . GLY A 305 ? 0.8410 0.5571 0.7163 0.2323  0.0866  0.0082  305 GLY A N   
2323 C CA  . GLY A 305 ? 0.8994 0.5686 0.7460 0.2501  0.0912  0.0038  305 GLY A CA  
2324 C C   . GLY A 305 ? 0.9119 0.5691 0.7611 0.2538  0.0886  0.0131  305 GLY A C   
2325 O O   . GLY A 305 ? 0.9436 0.5764 0.7761 0.2752  0.0929  0.0148  305 GLY A O   
2326 N N   . ASP A 306 ? 0.8815 0.5561 0.7507 0.2339  0.0817  0.0192  306 ASP A N   
2327 C CA  . ASP A 306 ? 0.8862 0.5560 0.7602 0.2345  0.0784  0.0287  306 ASP A CA  
2328 C C   . ASP A 306 ? 0.8712 0.5231 0.7466 0.2080  0.0722  0.0273  306 ASP A C   
2329 O O   . ASP A 306 ? 0.9092 0.5152 0.7633 0.2028  0.0724  0.0235  306 ASP A O   
2330 C CB  . ASP A 306 ? 0.8544 0.5778 0.7556 0.2412  0.0764  0.0399  306 ASP A CB  
2331 C CG  . ASP A 306 ? 0.8715 0.5926 0.7756 0.2460  0.0733  0.0501  306 ASP A CG  
2332 O OD1 . ASP A 306 ? 0.8953 0.5729 0.7805 0.2451  0.0733  0.0498  306 ASP A OD1 
2333 O OD2 . ASP A 306 ? 0.8422 0.6064 0.7673 0.2500  0.0706  0.0590  306 ASP A OD2 
2334 N N   . PHE A 307 ? 0.8143 0.5020 0.7138 0.1916  0.0668  0.0308  307 PHE A N   
2335 C CA  . PHE A 307 ? 0.7946 0.4728 0.6977 0.1673  0.0616  0.0291  307 PHE A CA  
2336 C C   . PHE A 307 ? 0.8132 0.4628 0.7003 0.1560  0.0625  0.0183  307 PHE A C   
2337 O O   . PHE A 307 ? 0.8208 0.4402 0.6965 0.1423  0.0605  0.0157  307 PHE A O   
2338 C CB  . PHE A 307 ? 0.7502 0.4715 0.6799 0.1541  0.0565  0.0324  307 PHE A CB  
2339 C CG  . PHE A 307 ? 0.7179 0.4349 0.6533 0.1346  0.0514  0.0335  307 PHE A CG  
2340 C CD1 . PHE A 307 ? 0.6836 0.3858 0.6142 0.1174  0.0500  0.0268  307 PHE A CD1 
2341 C CD2 . PHE A 307 ? 0.7204 0.4496 0.6651 0.1341  0.0481  0.0414  307 PHE A CD2 
2342 C CE1 . PHE A 307 ? 0.6650 0.3659 0.6010 0.1010  0.0460  0.0284  307 PHE A CE1 
2343 C CE2 . PHE A 307 ? 0.6881 0.4144 0.6368 0.1175  0.0442  0.0422  307 PHE A CE2 
2344 C CZ  . PHE A 307 ? 0.6680 0.3808 0.6128 0.1015  0.0435  0.0360  307 PHE A CZ  
2345 N N   . LEU A 308 ? 0.8170 0.4795 0.7036 0.1614  0.0653  0.0124  308 LEU A N   
2346 C CA  . LEU A 308 ? 0.8282 0.4693 0.6992 0.1527  0.0661  0.0015  308 LEU A CA  
2347 C C   . LEU A 308 ? 0.8715 0.4899 0.7198 0.1740  0.0727  -0.0044 308 LEU A C   
2348 O O   . LEU A 308 ? 0.8678 0.5132 0.7219 0.1885  0.0767  -0.0040 308 LEU A O   
2349 C CB  . LEU A 308 ? 0.7854 0.4638 0.6746 0.1417  0.0638  0.0000  308 LEU A CB  
2350 C CG  . LEU A 308 ? 0.7461 0.4411 0.6537 0.1205  0.0574  0.0035  308 LEU A CG  
2351 C CD1 . LEU A 308 ? 0.6857 0.4149 0.6095 0.1115  0.0554  0.0028  308 LEU A CD1 
2352 C CD2 . LEU A 308 ? 0.7485 0.4087 0.6418 0.1047  0.0548  -0.0012 308 LEU A CD2 
2353 N N   . SER A 309 ? 0.9190 0.4873 0.7405 0.1761  0.0742  -0.0096 309 SER A N   
2354 C CA  . SER A 309 ? 0.9671 0.5085 0.7643 0.1997  0.0808  -0.0149 309 SER A CA  
2355 C C   . SER A 309 ? 0.9793 0.5229 0.7656 0.2011  0.0835  -0.0263 309 SER A C   
2356 O O   . SER A 309 ? 1.0132 0.5491 0.7839 0.2235  0.0901  -0.0308 309 SER A O   
2357 C CB  . SER A 309 ? 1.0218 0.5037 0.7906 0.2019  0.0814  -0.0171 309 SER A CB  
2358 O OG  . SER A 309 ? 1.0510 0.5044 0.8096 0.1760  0.0764  -0.0235 309 SER A OG  
2359 N N   . ASP A 310 ? 0.9570 0.5133 0.7516 0.1781  0.0787  -0.0306 310 ASP A N   
2360 C CA  . ASP A 310 ? 0.9566 0.5222 0.7441 0.1760  0.0801  -0.0403 310 ASP A CA  
2361 C C   . ASP A 310 ? 0.9138 0.5166 0.7263 0.1531  0.0740  -0.0372 310 ASP A C   
2362 O O   . ASP A 310 ? 0.8758 0.4956 0.7095 0.1422  0.0697  -0.0283 310 ASP A O   
2363 C CB  . ASP A 310 ? 1.0008 0.5127 0.7533 0.1712  0.0800  -0.0540 310 ASP A CB  
2364 C CG  . ASP A 310 ? 1.0275 0.5400 0.7624 0.1813  0.0843  -0.0652 310 ASP A CG  
2365 O OD1 . ASP A 310 ? 0.9935 0.5515 0.7466 0.1801  0.0849  -0.0630 310 ASP A OD1 
2366 O OD2 . ASP A 310 ? 1.0215 0.4875 0.7229 0.1901  0.0871  -0.0764 310 ASP A OD2 
2367 N N   . THR A 311 ? 0.9152 0.5303 0.7243 0.1469  0.0738  -0.0442 311 THR A N   
2368 C CA  . THR A 311 ? 0.8834 0.5275 0.7119 0.1257  0.0679  -0.0420 311 THR A CA  
2369 C C   . THR A 311 ? 0.8911 0.5112 0.7167 0.1037  0.0614  -0.0436 311 THR A C   
2370 O O   . THR A 311 ? 0.9314 0.5084 0.7331 0.1017  0.0613  -0.0504 311 THR A O   
2371 C CB  . THR A 311 ? 0.8927 0.5463 0.7112 0.1230  0.0687  -0.0504 311 THR A CB  
2372 O OG1 . THR A 311 ? 0.9278 0.5402 0.7186 0.1134  0.0663  -0.0626 311 THR A OG1 
2373 C CG2 . THR A 311 ? 0.8972 0.5671 0.7101 0.1467  0.0767  -0.0512 311 THR A CG2 
2374 N N   . PRO A 312 ? 0.8612 0.5085 0.7101 0.0870  0.0560  -0.0372 312 PRO A N   
2375 C CA  . PRO A 312 ? 0.8694 0.4993 0.7164 0.0661  0.0503  -0.0384 312 PRO A CA  
2376 C C   . PRO A 312 ? 0.9116 0.5149 0.7350 0.0543  0.0479  -0.0501 312 PRO A C   
2377 O O   . PRO A 312 ? 0.9397 0.5075 0.7472 0.0446  0.0458  -0.0536 312 PRO A O   
2378 C CB  . PRO A 312 ? 0.8243 0.4937 0.6994 0.0543  0.0459  -0.0308 312 PRO A CB  
2379 C CG  . PRO A 312 ? 0.8011 0.4994 0.6933 0.0691  0.0490  -0.0232 312 PRO A CG  
2380 C CD  . PRO A 312 ? 0.8190 0.5122 0.6959 0.0865  0.0549  -0.0284 312 PRO A CD  
2381 N N   . GLU A 313 ? 0.9202 0.5392 0.7398 0.0544  0.0480  -0.0559 313 GLU A N   
2382 C CA  . GLU A 313 ? 0.9660 0.5607 0.7613 0.0430  0.0450  -0.0679 313 GLU A CA  
2383 C C   . GLU A 313 ? 1.0138 0.5568 0.7760 0.0515  0.0481  -0.0777 313 GLU A C   
2384 O O   . GLU A 313 ? 1.0452 0.5555 0.7878 0.0362  0.0439  -0.0854 313 GLU A O   
2385 C CB  . GLU A 313 ? 0.9636 0.5860 0.7594 0.0419  0.0443  -0.0721 313 GLU A CB  
2386 C CG  . GLU A 313 ? 1.0386 0.6590 0.8178 0.0628  0.0512  -0.0784 313 GLU A CG  
2387 C CD  . GLU A 313 ? 1.1136 0.7401 0.8769 0.0575  0.0495  -0.0881 313 GLU A CD  
2388 O OE1 . GLU A 313 ? 1.1570 0.7534 0.8971 0.0445  0.0451  -0.0990 313 GLU A OE1 
2389 O OE2 . GLU A 313 ? 1.1114 0.7728 0.8842 0.0661  0.0526  -0.0846 313 GLU A OE2 
2390 N N   . ALA A 314 ? 1.0214 0.5563 0.7770 0.0754  0.0552  -0.0769 314 ALA A N   
2391 C CA  . ALA A 314 ? 1.0739 0.5570 0.7974 0.0860  0.0586  -0.0853 314 ALA A CA  
2392 C C   . ALA A 314 ? 1.0931 0.5427 0.8127 0.0746  0.0554  -0.0812 314 ALA A C   
2393 O O   . ALA A 314 ? 1.1439 0.5450 0.8353 0.0680  0.0539  -0.0895 314 ALA A O   
2394 C CB  . ALA A 314 ? 1.0786 0.5650 0.7983 0.1162  0.0672  -0.0836 314 ALA A CB  
2395 N N   . LEU A 315 ? 1.0612 0.5363 0.8083 0.0712  0.0542  -0.0682 315 LEU A N   
2396 C CA  . LEU A 315 ? 1.0711 0.5197 0.8165 0.0618  0.0520  -0.0622 315 LEU A CA  
2397 C C   . LEU A 315 ? 1.0789 0.5214 0.8249 0.0319  0.0447  -0.0636 315 LEU A C   
2398 O O   . LEU A 315 ? 1.1131 0.5170 0.8428 0.0211  0.0427  -0.0642 315 LEU A O   
2399 C CB  . LEU A 315 ? 1.0267 0.5038 0.7982 0.0712  0.0538  -0.0482 315 LEU A CB  
2400 C CG  . LEU A 315 ? 1.0168 0.5052 0.7902 0.0999  0.0606  -0.0453 315 LEU A CG  
2401 C CD1 . LEU A 315 ? 0.9405 0.4735 0.7457 0.1047  0.0605  -0.0326 315 LEU A CD1 
2402 C CD2 . LEU A 315 ? 1.0221 0.4627 0.7685 0.1173  0.0652  -0.0472 315 LEU A CD2 
2403 N N   . ILE A 316 ? 1.0557 0.5367 0.8201 0.0184  0.0405  -0.0634 316 ILE A N   
2404 C CA  . ILE A 316 ? 1.0686 0.5463 0.8319 -0.0090 0.0335  -0.0656 316 ILE A CA  
2405 C C   . ILE A 316 ? 1.1275 0.5665 0.8582 -0.0188 0.0307  -0.0797 316 ILE A C   
2406 O O   . ILE A 316 ? 1.1443 0.5663 0.8670 -0.0418 0.0250  -0.0817 316 ILE A O   
2407 C CB  . ILE A 316 ? 1.0108 0.5402 0.8032 -0.0211 0.0293  -0.0600 316 ILE A CB  
2408 C CG1 . ILE A 316 ? 1.0101 0.5599 0.8000 -0.0199 0.0281  -0.0676 316 ILE A CG1 
2409 C CG2 . ILE A 316 ? 0.9742 0.5366 0.7949 -0.0106 0.0319  -0.0478 316 ILE A CG2 
2410 C CD1 . ILE A 316 ? 0.9676 0.5700 0.7876 -0.0260 0.0250  -0.0602 316 ILE A CD1 
2411 N N   . ASN A 317 ? 1.1621 0.5884 0.8737 -0.0018 0.0346  -0.0894 317 ASN A N   
2412 C CA  . ASN A 317 ? 1.2316 0.6186 0.9088 -0.0094 0.0320  -0.1045 317 ASN A CA  
2413 C C   . ASN A 317 ? 1.2928 0.6178 0.9406 -0.0081 0.0333  -0.1085 317 ASN A C   
2414 O O   . ASN A 317 ? 1.3412 0.6281 0.9623 -0.0245 0.0285  -0.1189 317 ASN A O   
2415 C CB  . ASN A 317 ? 1.2426 0.6370 0.9065 0.0085  0.0360  -0.1147 317 ASN A CB  
2416 C CG  . ASN A 317 ? 1.2253 0.6761 0.9133 0.0033  0.0336  -0.1117 317 ASN A CG  
2417 O OD1 . ASN A 317 ? 1.2247 0.7051 0.9363 -0.0149 0.0281  -0.1039 317 ASN A OD1 
2418 N ND2 . ASN A 317 ? 1.2271 0.6936 0.9090 0.0204  0.0381  -0.1169 317 ASN A ND2 
2419 N N   . THR A 318 ? 1.2965 0.6108 0.9485 0.0105  0.0392  -0.1000 318 THR A N   
2420 C CA  . THR A 318 ? 1.3645 0.6169 0.9856 0.0178  0.0417  -0.1034 318 THR A CA  
2421 C C   . THR A 318 ? 1.3618 0.6036 0.9935 0.0131  0.0417  -0.0896 318 THR A C   
2422 O O   . THR A 318 ? 1.4120 0.6003 1.0185 0.0165  0.0432  -0.0901 318 THR A O   
2423 C CB  . THR A 318 ? 1.3882 0.6251 0.9930 0.0519  0.0502  -0.1082 318 THR A CB  
2424 O OG1 . THR A 318 ? 1.3461 0.6341 0.9826 0.0702  0.0550  -0.0967 318 THR A OG1 
2425 C CG2 . THR A 318 ? 1.4178 0.6476 0.9997 0.0563  0.0506  -0.1245 318 THR A CG2 
2426 N N   . GLY A 319 ? 1.3042 0.5949 0.9710 0.0058  0.0402  -0.0773 319 GLY A N   
2427 C CA  . GLY A 319 ? 1.3039 0.5915 0.9825 0.0001  0.0401  -0.0638 319 GLY A CA  
2428 C C   . GLY A 319 ? 1.3374 0.5955 1.0043 -0.0295 0.0342  -0.0633 319 GLY A C   
2429 O O   . GLY A 319 ? 1.3392 0.6033 1.0038 -0.0521 0.0282  -0.0702 319 GLY A O   
2430 N N   . ASP A 320 ? 1.3651 0.5925 1.0245 -0.0295 0.0358  -0.0542 320 ASP A N   
2431 C CA  . ASP A 320 ? 1.3955 0.5965 1.0461 -0.0576 0.0309  -0.0501 320 ASP A CA  
2432 C C   . ASP A 320 ? 1.3422 0.5914 1.0265 -0.0684 0.0299  -0.0356 320 ASP A C   
2433 O O   . ASP A 320 ? 1.3241 0.5861 1.0213 -0.0526 0.0342  -0.0247 320 ASP A O   
2434 C CB  . ASP A 320 ? 1.4594 0.5955 1.0795 -0.0501 0.0337  -0.0476 320 ASP A CB  
2435 C CG  . ASP A 320 ? 1.4989 0.6057 1.1094 -0.0803 0.0291  -0.0410 320 ASP A CG  
2436 O OD1 . ASP A 320 ? 1.4729 0.6112 1.1004 -0.1074 0.0237  -0.0385 320 ASP A OD1 
2437 O OD2 . ASP A 320 ? 1.5670 0.6187 1.1523 -0.0767 0.0309  -0.0374 320 ASP A OD2 
2438 N N   . PHE A 321 ? 1.3203 0.5977 1.0183 -0.0945 0.0242  -0.0356 321 PHE A N   
2439 C CA  . PHE A 321 ? 1.2717 0.5961 1.0007 -0.1042 0.0235  -0.0226 321 PHE A CA  
2440 C C   . PHE A 321 ? 1.3029 0.6139 1.0272 -0.1346 0.0193  -0.0166 321 PHE A C   
2441 O O   . PHE A 321 ? 1.2685 0.6218 1.0155 -0.1516 0.0164  -0.0108 321 PHE A O   
2442 C CB  . PHE A 321 ? 1.2098 0.5932 0.9666 -0.1035 0.0218  -0.0249 321 PHE A CB  
2443 C CG  . PHE A 321 ? 1.1710 0.5649 0.9291 -0.0780 0.0252  -0.0319 321 PHE A CG  
2444 C CD1 . PHE A 321 ? 1.1348 0.5462 0.9067 -0.0544 0.0303  -0.0251 321 PHE A CD1 
2445 C CD2 . PHE A 321 ? 1.1723 0.5597 0.9170 -0.0782 0.0231  -0.0451 321 PHE A CD2 
2446 C CE1 . PHE A 321 ? 1.1128 0.5371 0.8870 -0.0323 0.0335  -0.0304 321 PHE A CE1 
2447 C CE2 . PHE A 321 ? 1.1544 0.5540 0.9003 -0.0548 0.0269  -0.0506 321 PHE A CE2 
2448 C CZ  . PHE A 321 ? 1.1210 0.5399 0.8825 -0.0323 0.0322  -0.0427 321 PHE A CZ  
2449 N N   . GLN A 322 ? 1.3731 0.6244 1.0671 -0.1408 0.0191  -0.0179 322 GLN A N   
2450 C CA  . GLN A 322 ? 1.4123 0.6428 1.0990 -0.1674 0.0163  -0.0090 322 GLN A CA  
2451 C C   . GLN A 322 ? 1.3709 0.6437 1.0858 -0.1645 0.0197  0.0072  322 GLN A C   
2452 O O   . GLN A 322 ? 1.3483 0.6334 1.0728 -0.1389 0.0250  0.0122  322 GLN A O   
2453 C CB  . GLN A 322 ? 1.4893 0.6469 1.1402 -0.1640 0.0179  -0.0095 322 GLN A CB  
2454 C CG  . GLN A 322 ? 1.5759 0.6889 1.2016 -0.1969 0.0115  -0.0129 322 GLN A CG  
2455 C CD  . GLN A 322 ? 1.6421 0.7375 1.2489 -0.2045 0.0061  -0.0319 322 GLN A CD  
2456 O OE1 . GLN A 322 ? 1.6721 0.7335 1.2567 -0.1827 0.0085  -0.0439 322 GLN A OE1 
2457 N NE2 . GLN A 322 ? 1.6446 0.7653 1.2597 -0.2351 -0.0013 -0.0346 322 GLN A NE2 
2458 N N   . ASP A 323 ? 1.3621 0.6577 1.0893 -0.1910 0.0166  0.0155  323 ASP A N   
2459 C CA  . ASP A 323 ? 1.3052 0.6640 1.0665 -0.1902 0.0181  0.0250  323 ASP A CA  
2460 C C   . ASP A 323 ? 1.2368 0.6318 1.0194 -0.1617 0.0232  0.0287  323 ASP A C   
2461 O O   . ASP A 323 ? 1.2369 0.6226 1.0183 -0.1460 0.0279  0.0371  323 ASP A O   
2462 C CB  . ASP A 323 ? 1.3234 0.7016 1.0948 -0.2182 0.0163  0.0371  323 ASP A CB  
2463 C CG  . ASP A 323 ? 1.3212 0.7551 1.1165 -0.2340 0.0118  0.0347  323 ASP A CG  
2464 O OD1 . ASP A 323 ? 1.3184 0.7981 1.1372 -0.2401 0.0133  0.0455  323 ASP A OD1 
2465 O OD2 . ASP A 323 ? 1.3399 0.7727 1.1298 -0.2380 0.0071  0.0219  323 ASP A OD2 
2466 N N   . LEU A 324 ? 1.1736 0.6088 0.9742 -0.1567 0.0215  0.0216  324 LEU A N   
2467 C CA  . LEU A 324 ? 1.0968 0.5774 0.9225 -0.1387 0.0242  0.0246  324 LEU A CA  
2468 C C   . LEU A 324 ? 1.0532 0.5793 0.8993 -0.1564 0.0204  0.0250  324 LEU A C   
2469 O O   . LEU A 324 ? 1.0636 0.5860 0.9032 -0.1731 0.0155  0.0178  324 LEU A O   
2470 C CB  . LEU A 324 ? 1.0857 0.5641 0.9089 -0.1166 0.0251  0.0142  324 LEU A CB  
2471 C CG  . LEU A 324 ? 1.0302 0.5576 0.8797 -0.1016 0.0263  0.0149  324 LEU A CG  
2472 C CD1 . LEU A 324 ? 1.0142 0.5480 0.8713 -0.0837 0.0307  0.0238  324 LEU A CD1 
2473 C CD2 . LEU A 324 ? 1.0202 0.5496 0.8671 -0.0891 0.0257  0.0039  324 LEU A CD2 
2474 N N   . GLN A 325 ? 0.9960 0.5648 0.8654 -0.1528 0.0224  0.0333  325 GLN A N   
2475 C CA  . GLN A 325 ? 0.9524 0.5675 0.8422 -0.1655 0.0194  0.0343  325 GLN A CA  
2476 C C   . GLN A 325 ? 0.8941 0.5457 0.8036 -0.1462 0.0204  0.0316  325 GLN A C   
2477 O O   . GLN A 325 ? 0.8710 0.5335 0.7892 -0.1301 0.0242  0.0366  325 GLN A O   
2478 C CB  . GLN A 325 ? 0.9490 0.5857 0.8492 -0.1803 0.0208  0.0469  325 GLN A CB  
2479 C CG  . GLN A 325 ? 0.9880 0.5916 0.8702 -0.2034 0.0194  0.0515  325 GLN A CG  
2480 C CD  . GLN A 325 ? 1.0188 0.5979 0.8916 -0.1983 0.0243  0.0619  325 GLN A CD  
2481 O OE1 . GLN A 325 ? 0.9832 0.5835 0.8678 -0.1821 0.0287  0.0681  325 GLN A OE1 
2482 N NE2 . GLN A 325 ? 1.0884 0.6209 0.9381 -0.2128 0.0233  0.0640  325 GLN A NE2 
2483 N N   . VAL A 326 ? 0.8676 0.5362 0.7824 -0.1484 0.0166  0.0238  326 VAL A N   
2484 C CA  . VAL A 326 ? 0.8185 0.5209 0.7514 -0.1320 0.0170  0.0219  326 VAL A CA  
2485 C C   . VAL A 326 ? 0.7891 0.5325 0.7388 -0.1425 0.0133  0.0225  326 VAL A C   
2486 O O   . VAL A 326 ? 0.8071 0.5510 0.7517 -0.1608 0.0089  0.0197  326 VAL A O   
2487 C CB  . VAL A 326 ? 0.8140 0.5009 0.7388 -0.1161 0.0169  0.0125  326 VAL A CB  
2488 C CG1 . VAL A 326 ? 0.8357 0.4882 0.7465 -0.1014 0.0210  0.0126  326 VAL A CG1 
2489 C CG2 . VAL A 326 ? 0.8513 0.5250 0.7626 -0.1278 0.0125  0.0033  326 VAL A CG2 
2490 N N   . LEU A 327 ? 0.7424 0.5197 0.7113 -0.1305 0.0149  0.0263  327 LEU A N   
2491 C CA  . LEU A 327 ? 0.7144 0.5312 0.6998 -0.1339 0.0120  0.0269  327 LEU A CA  
2492 C C   . LEU A 327 ? 0.6942 0.5161 0.6837 -0.1169 0.0114  0.0213  327 LEU A C   
2493 O O   . LEU A 327 ? 0.6810 0.4993 0.6738 -0.1003 0.0146  0.0221  327 LEU A O   
2494 C CB  . LEU A 327 ? 0.6942 0.5433 0.6964 -0.1326 0.0149  0.0362  327 LEU A CB  
2495 C CG  . LEU A 327 ? 0.6761 0.5666 0.6980 -0.1240 0.0143  0.0383  327 LEU A CG  
2496 C CD1 . LEU A 327 ? 0.7075 0.6215 0.7349 -0.1375 0.0092  0.0374  327 LEU A CD1 
2497 C CD2 . LEU A 327 ? 0.6824 0.5965 0.7157 -0.1202 0.0184  0.0465  327 LEU A CD2 
2498 N N   . VAL A 328 ? 0.6943 0.5246 0.6828 -0.1221 0.0071  0.0159  328 VAL A N   
2499 C CA  . VAL A 328 ? 0.6734 0.5091 0.6646 -0.1079 0.0064  0.0113  328 VAL A CA  
2500 C C   . VAL A 328 ? 0.6487 0.5222 0.6548 -0.1098 0.0029  0.0135  328 VAL A C   
2501 O O   . VAL A 328 ? 0.6584 0.5506 0.6688 -0.1245 -0.0002 0.0160  328 VAL A O   
2502 C CB  . VAL A 328 ? 0.6960 0.5031 0.6675 -0.1098 0.0048  0.0021  328 VAL A CB  
2503 C CG1 . VAL A 328 ? 0.7290 0.4969 0.6838 -0.1065 0.0082  -0.0001 328 VAL A CG1 
2504 C CG2 . VAL A 328 ? 0.7030 0.5131 0.6669 -0.1294 -0.0006 -0.0016 328 VAL A CG2 
2505 N N   . GLY A 329 ? 0.6154 0.5008 0.6293 -0.0956 0.0030  0.0132  329 GLY A N   
2506 C CA  . GLY A 329 ? 0.5939 0.5126 0.6203 -0.0960 -0.0005 0.0159  329 GLY A CA  
2507 C C   . GLY A 329 ? 0.5787 0.5064 0.6127 -0.0800 -0.0001 0.0168  329 GLY A C   
2508 O O   . GLY A 329 ? 0.5810 0.4908 0.6114 -0.0690 0.0028  0.0152  329 GLY A O   
2509 N N   . VAL A 330 ? 0.5582 0.5148 0.6028 -0.0790 -0.0032 0.0204  330 VAL A N   
2510 C CA  . VAL A 330 ? 0.5358 0.5011 0.5863 -0.0662 -0.0038 0.0222  330 VAL A CA  
2511 C C   . VAL A 330 ? 0.5306 0.5262 0.5965 -0.0608 -0.0051 0.0293  330 VAL A C   
2512 O O   . VAL A 330 ? 0.5291 0.5448 0.6011 -0.0687 -0.0063 0.0323  330 VAL A O   
2513 C CB  . VAL A 330 ? 0.5508 0.5157 0.5919 -0.0701 -0.0073 0.0181  330 VAL A CB  
2514 C CG1 . VAL A 330 ? 0.5604 0.4942 0.5830 -0.