data_2XY7
# 
_entry.id   2XY7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2XY7         
PDBE  EBI-46254    
WWPDB D_1290046254 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2XY6 unspecified 
'CRYSTAL STRUCTURE OF A SALICYLIC ALDEHYDE BASEPAIR IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS' 
PDB 2XY5 unspecified 
;CRYSTAL STRUCTURE OF AN ARTIFICIAL SALEN- COPPER BASEPAIR IN COMPLEX WITH FRAGMENT DNA POLYMERASE I FROM BACILLUS STEAROTHERMOPHILUS
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2XY7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kaul, C.'      1 
'Mueller, M.'   2 
'Wagner, M.'    3 
'Schneider, S.' 4 
'Carell, T.'    5 
# 
_citation.id                        primary 
_citation.title                     
'Reversible Bond Formation Enables the Replication and Amplification of a Crosslinking Salen Complex as an Orthogonal Base Pair.' 
_citation.journal_abbrev            'Nature Chem.' 
_citation.journal_volume            3 
_citation.page_first                794 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1755-4330 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21941252 
_citation.pdbx_database_id_DOI      10.1038/NCHEM.1117 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kaul, C.'      1 ? 
primary 'Mueller, M.'   2 ? 
primary 'Wagner, M.'    3 ? 
primary 'Schneider, S.' 4 ? 
primary 'Carell, T.'    5 ? 
# 
_cell.entry_id           2XY7 
_cell.length_a           86.037 
_cell.length_b           94.022 
_cell.length_c           106.711 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2XY7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE I'                                  66175.898 1 2.7.7.7 YES ? ?                        
2 polymer     syn "5'-D(*GP*CP*CP*TP*GP*AP*CP*TP*CP*GP)-3'"           3020.979  1 ?       ?   ? POLYDESOXYRIBONUCLEOTIDE 
3 polymer     syn "5'-D(*SAYP*CP*GP*AP*GP*TP*CP*AP*GP*GP*CP)-3'"      3370.218  1 ?       ?   ? POLYDESOXYRIBONUCLEOTIDE 
4 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1 ?       ?   ? ?                        
5 non-polymer syn 'SULFATE ION'                                       96.063    2 ?       ?   ? ?                        
6 water       nat water                                               18.015    8 ?       ?   ? ?                        
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        sucrose 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
2 polydeoxyribonucleotide no no  '(DG)(DC)(DC)(DT)(DG)(DA)(DC)(DT)(DC)(DG)' GCCTGACTCG B ? 
3 polydeoxyribonucleotide no yes '(SAY)(DC)(DG)(DA)(DG)(DT)(DC)(DA)(DG)(DG)(DC)' XCGAGTCAGGC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LYS n 
1 3   MET n 
1 4   ALA n 
1 5   PHE n 
1 6   THR n 
1 7   LEU n 
1 8   ALA n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  THR n 
1 13  GLU n 
1 14  GLU n 
1 15  MET n 
1 16  LEU n 
1 17  ALA n 
1 18  ASP n 
1 19  LYS n 
1 20  ALA n 
1 21  ALA n 
1 22  LEU n 
1 23  VAL n 
1 24  VAL n 
1 25  GLU n 
1 26  VAL n 
1 27  VAL n 
1 28  GLU n 
1 29  GLU n 
1 30  ASN n 
1 31  TYR n 
1 32  HIS n 
1 33  ALA n 
1 34  ALA n 
1 35  PRO n 
1 36  ILE n 
1 37  VAL n 
1 38  GLY n 
1 39  ILE n 
1 40  ALA n 
1 41  VAL n 
1 42  VAL n 
1 43  ASN n 
1 44  GLU n 
1 45  HIS n 
1 46  GLY n 
1 47  ARG n 
1 48  PHE n 
1 49  PHE n 
1 50  LEU n 
1 51  ARG n 
1 52  PRO n 
1 53  GLU n 
1 54  THR n 
1 55  ALA n 
1 56  LEU n 
1 57  ALA n 
1 58  ASP n 
1 59  PRO n 
1 60  GLN n 
1 61  PHE n 
1 62  VAL n 
1 63  ALA n 
1 64  TRP n 
1 65  LEU n 
1 66  GLY n 
1 67  ASP n 
1 68  GLU n 
1 69  THR n 
1 70  LYS n 
1 71  LYS n 
1 72  LYS n 
1 73  SER n 
1 74  MET n 
1 75  PHE n 
1 76  ASP n 
1 77  SER n 
1 78  LYS n 
1 79  ARG n 
1 80  ALA n 
1 81  ALA n 
1 82  VAL n 
1 83  ALA n 
1 84  LEU n 
1 85  LYS n 
1 86  TRP n 
1 87  LYS n 
1 88  GLY n 
1 89  ILE n 
1 90  GLU n 
1 91  LEU n 
1 92  CYS n 
1 93  GLY n 
1 94  VAL n 
1 95  SER n 
1 96  PHE n 
1 97  ASP n 
1 98  LEU n 
1 99  LEU n 
1 100 LEU n 
1 101 ALA n 
1 102 ALA n 
1 103 TYR n 
1 104 LEU n 
1 105 LEU n 
1 106 ASP n 
1 107 PRO n 
1 108 ALA n 
1 109 GLN n 
1 110 GLY n 
1 111 VAL n 
1 112 ASP n 
1 113 ASP n 
1 114 VAL n 
1 115 ALA n 
1 116 ALA n 
1 117 ALA n 
1 118 ALA n 
1 119 LYS n 
1 120 MET n 
1 121 LYS n 
1 122 GLN n 
1 123 TYR n 
1 124 GLU n 
1 125 ALA n 
1 126 VAL n 
1 127 ARG n 
1 128 PRO n 
1 129 ASP n 
1 130 GLU n 
1 131 ALA n 
1 132 VAL n 
1 133 TYR n 
1 134 GLY n 
1 135 LYS n 
1 136 GLY n 
1 137 ALA n 
1 138 LYS n 
1 139 ARG n 
1 140 ALA n 
1 141 VAL n 
1 142 PRO n 
1 143 ASP n 
1 144 GLU n 
1 145 PRO n 
1 146 VAL n 
1 147 LEU n 
1 148 ALA n 
1 149 GLU n 
1 150 HIS n 
1 151 LEU n 
1 152 VAL n 
1 153 ARG n 
1 154 LYS n 
1 155 ALA n 
1 156 ALA n 
1 157 ALA n 
1 158 ILE n 
1 159 TRP n 
1 160 ALA n 
1 161 LEU n 
1 162 GLU n 
1 163 ARG n 
1 164 PRO n 
1 165 PHE n 
1 166 LEU n 
1 167 ASP n 
1 168 GLU n 
1 169 LEU n 
1 170 ARG n 
1 171 ARG n 
1 172 ASN n 
1 173 GLU n 
1 174 GLN n 
1 175 ASP n 
1 176 ARG n 
1 177 LEU n 
1 178 LEU n 
1 179 VAL n 
1 180 GLU n 
1 181 LEU n 
1 182 GLU n 
1 183 GLN n 
1 184 PRO n 
1 185 LEU n 
1 186 SER n 
1 187 SER n 
1 188 ILE n 
1 189 LEU n 
1 190 ALA n 
1 191 GLU n 
1 192 MET n 
1 193 GLU n 
1 194 PHE n 
1 195 ALA n 
1 196 GLY n 
1 197 VAL n 
1 198 LYS n 
1 199 VAL n 
1 200 ASP n 
1 201 THR n 
1 202 LYS n 
1 203 ARG n 
1 204 LEU n 
1 205 GLU n 
1 206 GLN n 
1 207 MET n 
1 208 GLY n 
1 209 GLU n 
1 210 GLU n 
1 211 LEU n 
1 212 ALA n 
1 213 GLU n 
1 214 GLN n 
1 215 LEU n 
1 216 ARG n 
1 217 THR n 
1 218 VAL n 
1 219 GLU n 
1 220 GLN n 
1 221 ARG n 
1 222 ILE n 
1 223 TYR n 
1 224 GLU n 
1 225 LEU n 
1 226 ALA n 
1 227 GLY n 
1 228 GLN n 
1 229 GLU n 
1 230 PHE n 
1 231 ASN n 
1 232 ILE n 
1 233 ASN n 
1 234 SER n 
1 235 PRO n 
1 236 LYS n 
1 237 GLN n 
1 238 LEU n 
1 239 GLY n 
1 240 VAL n 
1 241 ILE n 
1 242 LEU n 
1 243 PHE n 
1 244 GLU n 
1 245 LYS n 
1 246 LEU n 
1 247 GLN n 
1 248 LEU n 
1 249 PRO n 
1 250 VAL n 
1 251 LEU n 
1 252 LYS n 
1 253 LYS n 
1 254 SER n 
1 255 LYS n 
1 256 THR n 
1 257 GLY n 
1 258 TYR n 
1 259 SER n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 ASP n 
1 264 VAL n 
1 265 LEU n 
1 266 GLU n 
1 267 LYS n 
1 268 LEU n 
1 269 ALA n 
1 270 PRO n 
1 271 TYR n 
1 272 HIS n 
1 273 GLU n 
1 274 ILE n 
1 275 VAL n 
1 276 GLU n 
1 277 ASN n 
1 278 ILE n 
1 279 LEU n 
1 280 HIS n 
1 281 TYR n 
1 282 ARG n 
1 283 GLN n 
1 284 LEU n 
1 285 GLY n 
1 286 LYS n 
1 287 LEU n 
1 288 GLN n 
1 289 SER n 
1 290 THR n 
1 291 TYR n 
1 292 ILE n 
1 293 GLU n 
1 294 GLY n 
1 295 LEU n 
1 296 LEU n 
1 297 LYS n 
1 298 VAL n 
1 299 VAL n 
1 300 ARG n 
1 301 PRO n 
1 302 ASP n 
1 303 THR n 
1 304 LYS n 
1 305 LYS n 
1 306 VAL n 
1 307 HIS n 
1 308 THR n 
1 309 ILE n 
1 310 PHE n 
1 311 ASN n 
1 312 GLN n 
1 313 ALA n 
1 314 LEU n 
1 315 THR n 
1 316 GLN n 
1 317 THR n 
1 318 GLY n 
1 319 ARG n 
1 320 LEU n 
1 321 SER n 
1 322 SER n 
1 323 THR n 
1 324 GLU n 
1 325 PRO n 
1 326 ASN n 
1 327 LEU n 
1 328 GLN n 
1 329 ASN n 
1 330 ILE n 
1 331 PRO n 
1 332 ILE n 
1 333 ARG n 
1 334 LEU n 
1 335 GLU n 
1 336 GLU n 
1 337 GLY n 
1 338 ARG n 
1 339 LYS n 
1 340 ILE n 
1 341 ARG n 
1 342 GLN n 
1 343 ALA n 
1 344 PHE n 
1 345 VAL n 
1 346 PRO n 
1 347 SER n 
1 348 GLU n 
1 349 SER n 
1 350 ASP n 
1 351 TRP n 
1 352 LEU n 
1 353 ILE n 
1 354 PHE n 
1 355 ALA n 
1 356 ALA n 
1 357 ASP n 
1 358 TYR n 
1 359 SER n 
1 360 GLN n 
1 361 ILE n 
1 362 GLU n 
1 363 LEU n 
1 364 ARG n 
1 365 VAL n 
1 366 LEU n 
1 367 ALA n 
1 368 HIS n 
1 369 ILE n 
1 370 ALA n 
1 371 GLU n 
1 372 ASP n 
1 373 ASP n 
1 374 ASN n 
1 375 LEU n 
1 376 MET n 
1 377 GLU n 
1 378 ALA n 
1 379 PHE n 
1 380 ARG n 
1 381 ARG n 
1 382 ASP n 
1 383 LEU n 
1 384 ASP n 
1 385 ILE n 
1 386 HIS n 
1 387 THR n 
1 388 LYS n 
1 389 THR n 
1 390 ALA n 
1 391 MET n 
1 392 ASP n 
1 393 ILE n 
1 394 PHE n 
1 395 GLN n 
1 396 VAL n 
1 397 SER n 
1 398 GLU n 
1 399 ASP n 
1 400 GLU n 
1 401 VAL n 
1 402 THR n 
1 403 PRO n 
1 404 ASN n 
1 405 MET n 
1 406 ARG n 
1 407 ARG n 
1 408 GLN n 
1 409 ALA n 
1 410 LYS n 
1 411 ALA n 
1 412 VAL n 
1 413 ASN n 
1 414 PHE n 
1 415 GLY n 
1 416 ILE n 
1 417 VAL n 
1 418 TYR n 
1 419 GLY n 
1 420 ILE n 
1 421 SER n 
1 422 ASP n 
1 423 TYR n 
1 424 GLY n 
1 425 LEU n 
1 426 ALA n 
1 427 GLN n 
1 428 ASN n 
1 429 LEU n 
1 430 ASN n 
1 431 ILE n 
1 432 SER n 
1 433 ARG n 
1 434 LYS n 
1 435 GLU n 
1 436 ALA n 
1 437 ALA n 
1 438 GLU n 
1 439 PHE n 
1 440 ILE n 
1 441 GLU n 
1 442 ARG n 
1 443 TYR n 
1 444 PHE n 
1 445 GLU n 
1 446 SER n 
1 447 PHE n 
1 448 PRO n 
1 449 GLY n 
1 450 VAL n 
1 451 LYS n 
1 452 ARG n 
1 453 TYR n 
1 454 MET n 
1 455 GLU n 
1 456 ASN n 
1 457 ILE n 
1 458 VAL n 
1 459 GLN n 
1 460 GLU n 
1 461 ALA n 
1 462 LYS n 
1 463 GLN n 
1 464 LYS n 
1 465 GLY n 
1 466 TYR n 
1 467 VAL n 
1 468 THR n 
1 469 THR n 
1 470 LEU n 
1 471 LEU n 
1 472 HIS n 
1 473 ARG n 
1 474 ARG n 
1 475 ARG n 
1 476 TYR n 
1 477 LEU n 
1 478 PRO n 
1 479 ASP n 
1 480 ILE n 
1 481 THR n 
1 482 SER n 
1 483 ARG n 
1 484 ASN n 
1 485 PHE n 
1 486 ASN n 
1 487 VAL n 
1 488 ARG n 
1 489 SER n 
1 490 PHE n 
1 491 ALA n 
1 492 GLU n 
1 493 ARG n 
1 494 MET n 
1 495 ALA n 
1 496 MET n 
1 497 ASN n 
1 498 THR n 
1 499 PRO n 
1 500 ILE n 
1 501 GLN n 
1 502 GLY n 
1 503 SER n 
1 504 ALA n 
1 505 ALA n 
1 506 ASP n 
1 507 ILE n 
1 508 ILE n 
1 509 LYS n 
1 510 LYS n 
1 511 ALA n 
1 512 MET n 
1 513 ILE n 
1 514 ASP n 
1 515 LEU n 
1 516 ASN n 
1 517 ALA n 
1 518 ARG n 
1 519 LEU n 
1 520 LYS n 
1 521 GLU n 
1 522 GLU n 
1 523 ARG n 
1 524 LEU n 
1 525 GLN n 
1 526 ALA n 
1 527 ARG n 
1 528 LEU n 
1 529 LEU n 
1 530 LEU n 
1 531 GLN n 
1 532 VAL n 
1 533 HIS n 
1 534 ASP n 
1 535 GLU n 
1 536 LEU n 
1 537 ILE n 
1 538 LEU n 
1 539 GLU n 
1 540 ALA n 
1 541 PRO n 
1 542 LYS n 
1 543 GLU n 
1 544 GLU n 
1 545 MET n 
1 546 GLU n 
1 547 ARG n 
1 548 LEU n 
1 549 CYS n 
1 550 ARG n 
1 551 LEU n 
1 552 VAL n 
1 553 PRO n 
1 554 GLU n 
1 555 VAL n 
1 556 MET n 
1 557 GLU n 
1 558 GLN n 
1 559 ALA n 
1 560 VAL n 
1 561 THR n 
1 562 LEU n 
1 563 ARG n 
1 564 VAL n 
1 565 PRO n 
1 566 LEU n 
1 567 LYS n 
1 568 VAL n 
1 569 ASP n 
1 570 TYR n 
1 571 HIS n 
1 572 TYR n 
1 573 GLY n 
1 574 SER n 
1 575 THR n 
1 576 TRP n 
1 577 TYR n 
1 578 ASP n 
1 579 ALA n 
1 580 LYS n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DG  n 
2 6   DA  n 
2 7   DC  n 
2 8   DT  n 
2 9   DC  n 
2 10  DG  n 
3 1   SAY n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DG  n 
3 6   DT  n 
3 7   DC  n 
3 8   DA  n 
3 9   DG  n 
3 10  DG  n 
3 11  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'DSM 22' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'GEOBACILLUS STEAROTHERMOPHILUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 12980 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GERMAN COLLECTION OF MICROORGANISMS (DSM)' 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
3 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP E1C9K5_BACST 1 ? ? E1C9K5 ? 
2 PDB 2XY7         2 ? ? 2XY7   ? 
3 PDB 2XY7         3 ? ? 2XY7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2XY7 A 1 ? 580 ? E1C9K5 1  ? 580 ? 297 876 
2 2 2XY7 B 1 ? 10  ? 2XY7   20 ? 29  ? 20  29  
3 3 2XY7 C 1 ? 11  ? 2XY7   3  ? 13  ? 3   13  
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2XY7 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      33 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   E1C9K5 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          33 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            329 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?                                                               'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking'           y ARGININE ?                                                               'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?                                                               'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?                                                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'           y CYSTEINE ?                                                               'C3 H7 N O2 S'    
121.158 
DA  'DNA linking'                 y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'                 y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'                 y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'                 y "THYMIDINE-5'-MONOPHOSPHATE" ?                                                               
'C10 H15 N2 O8 P' 322.208 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ?                                                               
'C6 H12 O6'       180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ?                                                               
'C6 H12 O6'       180.156 
GLN 'L-peptide linking'           y GLUTAMINE ?                                                               'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?                                                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'             y GLYCINE ?                                                               'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking'           y HISTIDINE ?                                                               'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer                   . WATER ?                                                               'H2 O'            18.015 
ILE 'L-peptide linking'           y ISOLEUCINE ?                                                               'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking'           y LEUCINE ?                                                               'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking'           y LYSINE ?                                                               'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking'           y METHIONINE ?                                                               'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ?                                                               'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'           y PROLINE ?                                                               'C5 H9 N O2'      
115.130 
SAY 'DNA linking'                 . 
'[(2R,3S,5R)-3-hydroxy-5-(3-hydroxy-4-methanoyl-phenyl)oxolan-2-yl]methyl dihydrogen phosphate' 
"2'-DEOXY-1'-(3-HYDROXY-4-FORMYLPHENYL)RIBOSE-5'-MONOPHOSPHATE" 'C12 H15 O8 P'    318.216 
SER 'L-peptide linking'           y SERINE ?                                                               'C3 H7 N O3'      
105.093 
SO4 non-polymer                   . 'SULFATE ION' ?                                                               'O4 S -2' 96.063 
THR 'L-peptide linking'           y THREONINE ?                                                               'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?                                                               'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking'           y TYROSINE ?                                                               'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking'           y VALINE ?                                                               'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          2XY7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.27 
_exptl_crystal.density_percent_sol   62.46 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-03-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2XY7 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.40 
_reflns.d_resolution_high            3.05 
_reflns.number_obs                   16829 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.15 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.50 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.05 
_reflns_shell.d_res_low              3.21 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.53 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.00 
_reflns_shell.pdbx_redundancy        3.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2XY7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     15959 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.02 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    98.54 
_refine.ls_R_factor_obs                          0.23853 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23618 
_refine.ls_R_factor_R_free                       0.28373 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  836 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.899 
_refine.correlation_coeff_Fo_to_Fc_free          0.835 
_refine.B_iso_mean                               30.531 
_refine.aniso_B[1][1]                            7.43 
_refine.aniso_B[2][2]                            -3.36 
_refine.aniso_B[3][3]                            -4.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1U45' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.493 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4497 
_refine_hist.pdbx_number_atoms_nucleic_acid   423 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               4961 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        43.02 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 5084 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.000  0.020  ? 3256 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.121  2.083  ? 6992 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            4.121  3.000  ? 7956 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.833  5.000  ? 579  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.644 24.183 ? 208  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.250 15.000 ? 776  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.342 15.000 ? 33   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.055  0.200  ? 809  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 5347 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.003  0.020  ? 952  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.197  1.500  ? 2898 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.000  1.500  ? 1160 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.409  2.000  ? 4641 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.223  3.000  ? 2186 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.277  4.500  ? 2351 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.050 
_refine_ls_shell.d_res_low                        3.129 
_refine_ls_shell.number_reflns_R_work             1153 
_refine_ls_shell.R_factor_R_work                  0.331 
_refine_ls_shell.percent_reflns_obs               98.86 
_refine_ls_shell.R_factor_R_free                  0.430 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             60 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2XY7 
_struct.title                     
;Crystal structure of a salicylic aldehyde base in the pre-insertion site of fragment DNA polymerase I from Bacillus stearothermophilus
;
_struct.pdbx_descriptor           'DNA POLYMERASE I (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2XY7 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX, SYNTHETIC BIOLOGY, METAL BASEPAIR, REPLICATION, SALEN COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 51  ? LEU A 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P2  2  ASP A 58  ? ASP A 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P3  3  ASP A 76  ? TRP A 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P4  4  LEU A 98  ? ASP A 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P5  5  PRO A 107 ? GLY A 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P6  6  ASP A 113 ? MET A 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P7  7  PRO A 128 ? GLY A 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P8  8  LYS A 135 ? ARG A 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P9  9  ASP A 143 ? ASN A 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P10 10 GLN A 174 ? LEU A 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P11 11 LEU A 181 ? GLY A 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P12 12 ASP A 200 ? GLY A 227 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P13 13 SER A 234 ? GLU A 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P14 14 SER A 261 ? ALA A 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P15 15 PRO A 270 ? HIS A 272 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P16 16 GLU A 273 ? THR A 290 ? GLU A 569 THR A 586 1 ? 18 
HELX_P HELX_P17 17 ILE A 292 ? LYS A 297 ? ILE A 588 LYS A 593 1 ? 6  
HELX_P HELX_P18 18 LEU A 334 ? LYS A 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P19 19 ILE A 340 ? ALA A 343 ? ILE A 636 ALA A 639 5 ? 4  
HELX_P HELX_P20 20 GLN A 360 ? GLU A 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P21 21 ASP A 372 ? ARG A 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P22 22 ASP A 384 ? GLN A 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P23 23 THR A 402 ? TYR A 418 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P24 24 SER A 421 ? ASN A 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P25 25 SER A 432 ? PHE A 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P26 26 PHE A 447 ? GLY A 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P27 27 PRO A 478 ? SER A 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P28 28 ASN A 484 ? GLU A 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P29 29 GLU A 544 ? GLN A 558 ? GLU A 840 GLN A 854 1 ? 15 
HELX_P HELX_P30 30 THR A 575 ? ALA A 579 ? THR A 871 ALA A 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale one  ? C SAY 1  "O3'" ? ? ? 1_555 C DC  2  P  ? ? C SAY 3  C DC  4  1_555 ? ? ? ? ? ? ?            1.559 ?    ? 
covale2  covale both ? D GLC .  C1    ? ? ? 1_555 D FRU .  O2 ? ? D GLC 1  D FRU 2  1_555 ? ? ? ? ? ? ?            1.418 sing ? 
hydrog1  hydrog ?    ? B DG  1  N1    ? ? ? 1_555 C DC  11 O2 ? ? B DG  20 C DC  13 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ?    ? 
hydrog2  hydrog ?    ? B DC  2  N3    ? ? ? 1_555 C DG  10 N1 ? ? B DC  21 C DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog3  hydrog ?    ? B DC  2  N4    ? ? ? 1_555 C DG  10 O6 ? ? B DC  21 C DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog4  hydrog ?    ? B DC  2  O2    ? ? ? 1_555 C DG  10 N2 ? ? B DC  21 C DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog5  hydrog ?    ? B DC  3  N3    ? ? ? 1_555 C DG  9  N1 ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog6  hydrog ?    ? B DC  3  N4    ? ? ? 1_555 C DG  9  O6 ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog7  hydrog ?    ? B DC  3  O2    ? ? ? 1_555 C DG  9  N2 ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog8  hydrog ?    ? B DT  4  N3    ? ? ? 1_555 C DA  8  N1 ? ? B DT  23 C DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog9  hydrog ?    ? B DT  4  O4    ? ? ? 1_555 C DA  8  N6 ? ? B DT  23 C DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog10 hydrog ?    ? B DG  5  N1    ? ? ? 1_555 C DC  7  N3 ? ? B DG  24 C DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog11 hydrog ?    ? B DG  5  N2    ? ? ? 1_555 C DC  7  O2 ? ? B DG  24 C DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog12 hydrog ?    ? B DG  5  O6    ? ? ? 1_555 C DC  7  N4 ? ? B DG  24 C DC  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog13 hydrog ?    ? B DA  6  N1    ? ? ? 1_555 C DT  6  N3 ? ? B DA  25 C DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog14 hydrog ?    ? B DA  6  N6    ? ? ? 1_555 C DT  6  O4 ? ? B DA  25 C DT  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog15 hydrog ?    ? B DC  7  N3    ? ? ? 1_555 C DG  5  N1 ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog16 hydrog ?    ? B DC  7  N4    ? ? ? 1_555 C DG  5  O6 ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog17 hydrog ?    ? B DC  7  O2    ? ? ? 1_555 C DG  5  N2 ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog18 hydrog ?    ? B DT  8  N3    ? ? ? 1_555 C DA  4  N1 ? ? B DT  27 C DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog19 hydrog ?    ? B DT  8  O4    ? ? ? 1_555 C DA  4  N6 ? ? B DT  27 C DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog20 hydrog ?    ? B DC  9  N3    ? ? ? 1_555 C DG  3  N1 ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog21 hydrog ?    ? B DC  9  N4    ? ? ? 1_555 C DG  3  O6 ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog22 hydrog ?    ? B DC  9  O2    ? ? ? 1_555 C DG  3  N2 ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog23 hydrog ?    ? B DG  10 N1    ? ? ? 1_555 C DC  2  N3 ? ? B DG  29 C DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog24 hydrog ?    ? B DG  10 N2    ? ? ? 1_555 C DC  2  O2 ? ? B DG  29 C DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog25 hydrog ?    ? B DG  10 O6    ? ? ? 1_555 C DC  2  N4 ? ? B DG  29 C DC  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 6   ? LEU A 7   ? THR A 302 LEU A 303 
AA 2 GLY A 46  ? LEU A 50  ? GLY A 342 LEU A 346 
AA 3 GLY A 38  ? ASN A 43  ? GLY A 334 ASN A 339 
AA 4 LYS A 19  ? GLU A 25  ? LYS A 315 GLU A 321 
AA 5 LYS A 71  ? MET A 74  ? LYS A 367 MET A 370 
AA 6 VAL A 94  ? ASP A 97  ? VAL A 390 ASP A 393 
AB 1 VAL A 197 ? LYS A 198 ? VAL A 493 LYS A 494 
AB 2 LYS A 305 ? VAL A 306 ? LYS A 601 VAL A 602 
AC 1 ILE A 309 ? ASN A 311 ? ILE A 605 ASN A 607 
AC 2 SER A 321 ? THR A 323 ? SER A 617 THR A 619 
AD 1 ARG A 527 ? GLN A 531 ? ARG A 823 GLN A 827 
AD 2 GLU A 535 ? PRO A 541 ? GLU A 831 PRO A 837 
AD 3 TRP A 351 ? TYR A 358 ? TRP A 647 TYR A 654 
AD 4 VAL A 568 ? GLY A 573 ? VAL A 864 GLY A 869 
AE 1 TYR A 466 ? THR A 468 ? TYR A 762 THR A 764 
AE 2 ARG A 474 ? TYR A 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 6   ? N THR A 302 O ARG A 47  ? O ARG A 343 
AA 2 3 N LEU A 50  ? N LEU A 346 O ILE A 39  ? O ILE A 335 
AA 3 4 N VAL A 42  ? N VAL A 338 O ALA A 21  ? O ALA A 317 
AA 4 5 N ALA A 20  ? N ALA A 316 O LYS A 71  ? O LYS A 367 
AA 5 6 O LYS A 72  ? O LYS A 368 N SER A 95  ? N SER A 391 
AB 1 2 N VAL A 197 ? N VAL A 493 O VAL A 306 ? O VAL A 602 
AC 1 2 N ASN A 311 ? N ASN A 607 O SER A 321 ? O SER A 617 
AD 1 2 N LEU A 529 ? N LEU A 825 O ILE A 537 ? O ILE A 833 
AD 2 3 N ALA A 540 ? N ALA A 836 O LEU A 352 ? O LEU A 648 
AD 3 4 N ASP A 357 ? N ASP A 653 O ASP A 569 ? O ASP A 865 
AE 1 2 N VAL A 467 ? N VAL A 763 O ARG A 475 ? O ARG A 771 
# 
_database_PDB_matrix.entry_id          2XY7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2XY7 
_atom_sites.fract_transf_matrix[1][1]   0.011623 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009371 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ALA A 1 1   ? 12.680  42.202  48.887  1.00 37.70 ? 297  ALA A N     1 
ATOM   2    C CA    . ALA A 1 1   ? 11.623  42.192  49.950  1.00 37.66 ? 297  ALA A CA    1 
ATOM   3    C C     . ALA A 1 1   ? 11.439  40.787  50.546  1.00 37.59 ? 297  ALA A C     1 
ATOM   4    O O     . ALA A 1 1   ? 11.112  39.835  49.829  1.00 37.59 ? 297  ALA A O     1 
ATOM   5    C CB    . ALA A 1 1   ? 10.304  42.723  49.391  1.00 37.60 ? 297  ALA A CB    1 
ATOM   6    N N     . LYS A 1 2   ? 11.638  40.684  51.863  1.00 37.50 ? 298  LYS A N     1 
ATOM   7    C CA    . LYS A 1 2   ? 11.679  39.400  52.574  1.00 37.54 ? 298  LYS A CA    1 
ATOM   8    C C     . LYS A 1 2   ? 10.382  38.610  52.464  1.00 37.55 ? 298  LYS A C     1 
ATOM   9    O O     . LYS A 1 2   ? 9.320   39.166  52.177  1.00 37.71 ? 298  LYS A O     1 
ATOM   10   C CB    . LYS A 1 2   ? 11.993  39.621  54.061  1.00 37.38 ? 298  LYS A CB    1 
ATOM   11   N N     . MET A 1 3   ? 10.495  37.303  52.677  1.00 37.49 ? 299  MET A N     1 
ATOM   12   C CA    . MET A 1 3   ? 9.345   36.427  52.853  1.00 37.37 ? 299  MET A CA    1 
ATOM   13   C C     . MET A 1 3   ? 9.460   35.879  54.264  1.00 37.15 ? 299  MET A C     1 
ATOM   14   O O     . MET A 1 3   ? 10.548  35.491  54.689  1.00 37.26 ? 299  MET A O     1 
ATOM   15   C CB    . MET A 1 3   ? 9.380   35.282  51.841  1.00 37.52 ? 299  MET A CB    1 
ATOM   16   C CG    . MET A 1 3   ? 8.056   34.539  51.686  1.00 37.76 ? 299  MET A CG    1 
ATOM   17   S SD    . MET A 1 3   ? 8.121   33.314  50.361  1.00 38.20 ? 299  MET A SD    1 
ATOM   18   C CE    . MET A 1 3   ? 6.717   33.804  49.355  1.00 37.99 ? 299  MET A CE    1 
ATOM   19   N N     . ALA A 1 4   ? 8.353   35.854  54.990  1.00 36.83 ? 300  ALA A N     1 
ATOM   20   C CA    . ALA A 1 4   ? 8.366   35.408  56.384  1.00 36.76 ? 300  ALA A CA    1 
ATOM   21   C C     . ALA A 1 4   ? 8.464   33.890  56.496  1.00 36.72 ? 300  ALA A C     1 
ATOM   22   O O     . ALA A 1 4   ? 7.663   33.173  55.907  1.00 36.85 ? 300  ALA A O     1 
ATOM   23   C CB    . ALA A 1 4   ? 7.117   35.896  57.098  1.00 36.86 ? 300  ALA A CB    1 
ATOM   24   N N     . PHE A 1 5   ? 9.429   33.399  57.265  1.00 36.66 ? 301  PHE A N     1 
ATOM   25   C CA    . PHE A 1 5   ? 9.538   31.960  57.513  1.00 36.66 ? 301  PHE A CA    1 
ATOM   26   C C     . PHE A 1 5   ? 10.345  31.628  58.765  1.00 36.76 ? 301  PHE A C     1 
ATOM   27   O O     . PHE A 1 5   ? 11.202  32.397  59.191  1.00 36.65 ? 301  PHE A O     1 
ATOM   28   C CB    . PHE A 1 5   ? 10.162  31.252  56.309  1.00 36.70 ? 301  PHE A CB    1 
ATOM   29   C CG    . PHE A 1 5   ? 11.615  31.575  56.097  1.00 36.48 ? 301  PHE A CG    1 
ATOM   30   C CD1   . PHE A 1 5   ? 12.609  30.808  56.691  1.00 36.14 ? 301  PHE A CD1   1 
ATOM   31   C CD2   . PHE A 1 5   ? 11.990  32.640  55.294  1.00 36.40 ? 301  PHE A CD2   1 
ATOM   32   C CE1   . PHE A 1 5   ? 13.953  31.105  56.492  1.00 35.95 ? 301  PHE A CE1   1 
ATOM   33   C CE2   . PHE A 1 5   ? 13.333  32.940  55.091  1.00 36.15 ? 301  PHE A CE2   1 
ATOM   34   C CZ    . PHE A 1 5   ? 14.313  32.171  55.692  1.00 35.67 ? 301  PHE A CZ    1 
ATOM   35   N N     . THR A 1 6   ? 10.066  30.456  59.326  1.00 37.01 ? 302  THR A N     1 
ATOM   36   C CA    . THR A 1 6   ? 10.750  29.954  60.520  1.00 37.16 ? 302  THR A CA    1 
ATOM   37   C C     . THR A 1 6   ? 11.941  29.075  60.160  1.00 37.24 ? 302  THR A C     1 
ATOM   38   O O     . THR A 1 6   ? 11.766  28.022  59.545  1.00 37.44 ? 302  THR A O     1 
ATOM   39   C CB    . THR A 1 6   ? 9.799   29.067  61.358  1.00 37.26 ? 302  THR A CB    1 
ATOM   40   O OG1   . THR A 1 6   ? 8.585   29.777  61.637  1.00 37.08 ? 302  THR A OG1   1 
ATOM   41   C CG2   . THR A 1 6   ? 10.473  28.617  62.662  1.00 37.37 ? 302  THR A CG2   1 
ATOM   42   N N     . LEU A 1 7   ? 13.143  29.484  60.552  1.00 37.26 ? 303  LEU A N     1 
ATOM   43   C CA    . LEU A 1 7   ? 14.325  28.633  60.379  1.00 37.35 ? 303  LEU A CA    1 
ATOM   44   C C     . LEU A 1 7   ? 14.423  27.706  61.584  1.00 37.36 ? 303  LEU A C     1 
ATOM   45   O O     . LEU A 1 7   ? 15.101  28.022  62.566  1.00 37.40 ? 303  LEU A O     1 
ATOM   46   C CB    . LEU A 1 7   ? 15.605  29.460  60.242  1.00 37.37 ? 303  LEU A CB    1 
ATOM   47   C CG    . LEU A 1 7   ? 16.893  28.675  59.931  1.00 37.89 ? 303  LEU A CG    1 
ATOM   48   C CD1   . LEU A 1 7   ? 18.103  29.624  59.861  1.00 38.14 ? 303  LEU A CD1   1 
ATOM   49   C CD2   . LEU A 1 7   ? 17.168  27.529  60.919  1.00 37.72 ? 303  LEU A CD2   1 
ATOM   50   N N     . ALA A 1 8   ? 13.750  26.559  61.494  1.00 37.33 ? 304  ALA A N     1 
ATOM   51   C CA    . ALA A 1 8   ? 13.640  25.624  62.620  1.00 37.13 ? 304  ALA A CA    1 
ATOM   52   C C     . ALA A 1 8   ? 14.989  25.032  63.050  1.00 36.96 ? 304  ALA A C     1 
ATOM   53   O O     . ALA A 1 8   ? 15.923  24.905  62.247  1.00 36.77 ? 304  ALA A O     1 
ATOM   54   C CB    . ALA A 1 8   ? 12.648  24.500  62.292  1.00 37.00 ? 304  ALA A CB    1 
ATOM   55   N N     . ASP A 1 9   ? 15.065  24.710  64.341  1.00 36.93 ? 305  ASP A N     1 
ATOM   56   C CA    . ASP A 1 9   ? 16.163  23.931  64.929  1.00 36.80 ? 305  ASP A CA    1 
ATOM   57   C C     . ASP A 1 9   ? 15.656  22.568  65.432  1.00 36.63 ? 305  ASP A C     1 
ATOM   58   O O     . ASP A 1 9   ? 16.435  21.775  65.956  1.00 36.76 ? 305  ASP A O     1 
ATOM   59   C CB    . ASP A 1 9   ? 16.816  24.705  66.083  1.00 36.69 ? 305  ASP A CB    1 
ATOM   60   N N     . ARG A 1 10  ? 14.355  22.310  65.273  1.00 36.44 ? 306  ARG A N     1 
ATOM   61   C CA    . ARG A 1 10  ? 13.751  21.025  65.651  1.00 36.37 ? 306  ARG A CA    1 
ATOM   62   C C     . ARG A 1 10  ? 12.375  20.824  64.989  1.00 36.25 ? 306  ARG A C     1 
ATOM   63   O O     . ARG A 1 10  ? 11.603  21.773  64.836  1.00 36.32 ? 306  ARG A O     1 
ATOM   64   C CB    . ARG A 1 10  ? 13.625  20.929  67.176  1.00 36.38 ? 306  ARG A CB    1 
ATOM   65   N N     . VAL A 1 11  ? 12.075  19.586  64.608  1.00 36.10 ? 307  VAL A N     1 
ATOM   66   C CA    . VAL A 1 11  ? 10.800  19.267  63.952  1.00 36.18 ? 307  VAL A CA    1 
ATOM   67   C C     . VAL A 1 11  ? 9.601   19.493  64.881  1.00 36.13 ? 307  VAL A C     1 
ATOM   68   O O     . VAL A 1 11  ? 9.689   19.231  66.072  1.00 36.32 ? 307  VAL A O     1 
ATOM   69   C CB    . VAL A 1 11  ? 10.765  17.805  63.471  1.00 36.19 ? 307  VAL A CB    1 
ATOM   70   C CG1   . VAL A 1 11  ? 9.444   17.508  62.764  1.00 36.43 ? 307  VAL A CG1   1 
ATOM   71   C CG2   . VAL A 1 11  ? 11.943  17.509  62.551  1.00 36.31 ? 307  VAL A CG2   1 
ATOM   72   N N     . THR A 1 12  ? 8.485   19.965  64.328  1.00 36.10 ? 308  THR A N     1 
ATOM   73   C CA    . THR A 1 12  ? 7.275   20.249  65.115  1.00 36.16 ? 308  THR A CA    1 
ATOM   74   C C     . THR A 1 12  ? 6.012   19.676  64.490  1.00 36.15 ? 308  THR A C     1 
ATOM   75   O O     . THR A 1 12  ? 5.896   19.587  63.270  1.00 36.20 ? 308  THR A O     1 
ATOM   76   C CB    . THR A 1 12  ? 7.072   21.759  65.278  1.00 36.29 ? 308  THR A CB    1 
ATOM   77   O OG1   . THR A 1 12  ? 8.145   22.290  66.066  1.00 36.81 ? 308  THR A OG1   1 
ATOM   78   C CG2   . THR A 1 12  ? 5.730   22.079  65.959  1.00 36.02 ? 308  THR A CG2   1 
ATOM   79   N N     . GLU A 1 13  ? 5.053   19.326  65.345  1.00 36.18 ? 309  GLU A N     1 
ATOM   80   C CA    . GLU A 1 13  ? 3.780   18.724  64.916  1.00 36.25 ? 309  GLU A CA    1 
ATOM   81   C C     . GLU A 1 13  ? 2.972   19.570  63.898  1.00 36.29 ? 309  GLU A C     1 
ATOM   82   O O     . GLU A 1 13  ? 2.119   19.036  63.182  1.00 36.09 ? 309  GLU A O     1 
ATOM   83   C CB    . GLU A 1 13  ? 2.918   18.396  66.143  1.00 36.18 ? 309  GLU A CB    1 
ATOM   84   N N     . GLU A 1 14  ? 3.243   20.873  63.837  1.00 36.45 ? 310  GLU A N     1 
ATOM   85   C CA    . GLU A 1 14  ? 2.636   21.747  62.822  1.00 36.59 ? 310  GLU A CA    1 
ATOM   86   C C     . GLU A 1 14  ? 3.383   21.700  61.473  1.00 36.56 ? 310  GLU A C     1 
ATOM   87   O O     . GLU A 1 14  ? 2.820   22.092  60.449  1.00 36.55 ? 310  GLU A O     1 
ATOM   88   C CB    . GLU A 1 14  ? 2.519   23.190  63.335  1.00 36.64 ? 310  GLU A CB    1 
ATOM   89   C CG    . GLU A 1 14  ? 3.844   23.929  63.493  1.00 37.38 ? 310  GLU A CG    1 
ATOM   90   C CD    . GLU A 1 14  ? 3.705   25.254  64.225  1.00 38.19 ? 310  GLU A CD    1 
ATOM   91   O OE1   . GLU A 1 14  ? 2.560   25.712  64.431  1.00 38.37 ? 310  GLU A OE1   1 
ATOM   92   O OE2   . GLU A 1 14  ? 4.748   25.840  64.591  1.00 38.95 ? 310  GLU A OE2   1 
ATOM   93   N N     . MET A 1 15  ? 4.638   21.231  61.476  1.00 36.41 ? 311  MET A N     1 
ATOM   94   C CA    . MET A 1 15  ? 5.392   20.996  60.229  1.00 36.34 ? 311  MET A CA    1 
ATOM   95   C C     . MET A 1 15  ? 4.929   19.734  59.492  1.00 36.03 ? 311  MET A C     1 
ATOM   96   O O     . MET A 1 15  ? 5.270   19.523  58.325  1.00 36.09 ? 311  MET A O     1 
ATOM   97   C CB    . MET A 1 15  ? 6.885   20.844  60.507  1.00 36.49 ? 311  MET A CB    1 
ATOM   98   C CG    . MET A 1 15  ? 7.520   21.999  61.242  1.00 37.47 ? 311  MET A CG    1 
ATOM   99   S SD    . MET A 1 15  ? 9.263   21.659  61.584  1.00 39.26 ? 311  MET A SD    1 
ATOM   100  C CE    . MET A 1 15  ? 9.791   23.224  62.296  1.00 38.36 ? 311  MET A CE    1 
ATOM   101  N N     . LEU A 1 16  ? 4.160   18.898  60.181  1.00 35.72 ? 312  LEU A N     1 
ATOM   102  C CA    . LEU A 1 16  ? 3.719   17.616  59.646  1.00 35.51 ? 312  LEU A CA    1 
ATOM   103  C C     . LEU A 1 16  ? 2.209   17.610  59.382  1.00 35.33 ? 312  LEU A C     1 
ATOM   104  O O     . LEU A 1 16  ? 1.493   16.690  59.781  1.00 35.05 ? 312  LEU A O     1 
ATOM   105  C CB    . LEU A 1 16  ? 4.095   16.508  60.629  1.00 35.57 ? 312  LEU A CB    1 
ATOM   106  C CG    . LEU A 1 16  ? 5.526   16.579  61.174  1.00 35.60 ? 312  LEU A CG    1 
ATOM   107  C CD1   . LEU A 1 16  ? 5.727   15.557  62.284  1.00 35.32 ? 312  LEU A CD1   1 
ATOM   108  C CD2   . LEU A 1 16  ? 6.553   16.387  60.059  1.00 36.03 ? 312  LEU A CD2   1 
ATOM   109  N N     . ALA A 1 17  ? 1.732   18.646  58.701  1.00 35.25 ? 313  ALA A N     1 
ATOM   110  C CA    . ALA A 1 17  ? 0.336   18.710  58.289  1.00 35.35 ? 313  ALA A CA    1 
ATOM   111  C C     . ALA A 1 17  ? 0.111   17.651  57.225  1.00 35.48 ? 313  ALA A C     1 
ATOM   112  O O     . ALA A 1 17  ? 1.048   17.287  56.509  1.00 35.81 ? 313  ALA A O     1 
ATOM   113  C CB    . ALA A 1 17  ? 0.002   20.082  57.745  1.00 35.36 ? 313  ALA A CB    1 
ATOM   114  N N     . ASP A 1 18  ? -1.117  17.155  57.110  1.00 35.41 ? 314  ASP A N     1 
ATOM   115  C CA    . ASP A 1 18  ? -1.403  16.103  56.126  1.00 35.60 ? 314  ASP A CA    1 
ATOM   116  C C     . ASP A 1 18  ? -1.382  16.590  54.675  1.00 35.42 ? 314  ASP A C     1 
ATOM   117  O O     . ASP A 1 18  ? -1.536  15.788  53.746  1.00 35.67 ? 314  ASP A O     1 
ATOM   118  C CB    . ASP A 1 18  ? -2.721  15.379  56.422  1.00 35.83 ? 314  ASP A CB    1 
ATOM   119  C CG    . ASP A 1 18  ? -3.885  16.322  56.608  1.00 36.98 ? 314  ASP A CG    1 
ATOM   120  O OD1   . ASP A 1 18  ? -3.923  17.381  55.936  1.00 38.88 ? 314  ASP A OD1   1 
ATOM   121  O OD2   . ASP A 1 18  ? -4.771  15.988  57.427  1.00 37.95 ? 314  ASP A OD2   1 
ATOM   122  N N     . LYS A 1 19  ? -1.213  17.895  54.484  1.00 35.07 ? 315  LYS A N     1 
ATOM   123  C CA    . LYS A 1 19  ? -0.950  18.447  53.162  1.00 34.82 ? 315  LYS A CA    1 
ATOM   124  C C     . LYS A 1 19  ? 0.028   19.599  53.241  1.00 34.31 ? 315  LYS A C     1 
ATOM   125  O O     . LYS A 1 19  ? -0.176  20.551  53.991  1.00 34.16 ? 315  LYS A O     1 
ATOM   126  C CB    . LYS A 1 19  ? -2.233  18.926  52.498  1.00 35.04 ? 315  LYS A CB    1 
ATOM   127  C CG    . LYS A 1 19  ? -1.978  19.597  51.147  1.00 35.97 ? 315  LYS A CG    1 
ATOM   128  C CD    . LYS A 1 19  ? -3.177  19.489  50.191  1.00 36.98 ? 315  LYS A CD    1 
ATOM   129  C CE    . LYS A 1 19  ? -2.752  19.483  48.706  1.00 37.72 ? 315  LYS A CE    1 
ATOM   130  N NZ    . LYS A 1 19  ? -1.366  18.944  48.413  1.00 38.06 ? 315  LYS A NZ    1 
ATOM   131  N N     . ALA A 1 20  ? 1.081   19.518  52.442  1.00 33.87 ? 316  ALA A N     1 
ATOM   132  C CA    . ALA A 1 20  ? 2.098   20.555  52.420  1.00 33.46 ? 316  ALA A CA    1 
ATOM   133  C C     . ALA A 1 20  ? 2.833   20.576  51.099  1.00 33.17 ? 316  ALA A C     1 
ATOM   134  O O     . ALA A 1 20  ? 2.898   19.575  50.395  1.00 33.17 ? 316  ALA A O     1 
ATOM   135  C CB    . ALA A 1 20  ? 3.079   20.343  53.546  1.00 33.39 ? 316  ALA A CB    1 
ATOM   136  N N     . ALA A 1 21  ? 3.374   21.741  50.771  1.00 32.96 ? 317  ALA A N     1 
ATOM   137  C CA    . ALA A 1 21  ? 4.313   21.882  49.676  1.00 32.83 ? 317  ALA A CA    1 
ATOM   138  C C     . ALA A 1 21  ? 5.686   21.604  50.260  1.00 32.67 ? 317  ALA A C     1 
ATOM   139  O O     . ALA A 1 21  ? 6.092   22.246  51.226  1.00 32.74 ? 317  ALA A O     1 
ATOM   140  C CB    . ALA A 1 21  ? 4.255   23.275  49.103  1.00 32.84 ? 317  ALA A CB    1 
ATOM   141  N N     . LEU A 1 22  ? 6.387   20.635  49.687  1.00 32.47 ? 318  LEU A N     1 
ATOM   142  C CA    . LEU A 1 22  ? 7.649   20.172  50.244  1.00 32.41 ? 318  LEU A CA    1 
ATOM   143  C C     . LEU A 1 22  ? 8.762   20.379  49.237  1.00 32.33 ? 318  LEU A C     1 
ATOM   144  O O     . LEU A 1 22  ? 8.588   20.112  48.049  1.00 32.35 ? 318  LEU A O     1 
ATOM   145  C CB    . LEU A 1 22  ? 7.540   18.695  50.642  1.00 32.42 ? 318  LEU A CB    1 
ATOM   146  C CG    . LEU A 1 22  ? 8.820   17.864  50.806  1.00 32.50 ? 318  LEU A CG    1 
ATOM   147  C CD1   . LEU A 1 22  ? 9.841   18.570  51.694  1.00 32.59 ? 318  LEU A CD1   1 
ATOM   148  C CD2   . LEU A 1 22  ? 8.493   16.481  51.371  1.00 31.92 ? 318  LEU A CD2   1 
ATOM   149  N N     . VAL A 1 23  ? 9.895   20.878  49.720  1.00 32.28 ? 319  VAL A N     1 
ATOM   150  C CA    . VAL A 1 23  ? 11.106  21.004  48.913  1.00 32.36 ? 319  VAL A CA    1 
ATOM   151  C C     . VAL A 1 23  ? 12.195  20.202  49.585  1.00 32.52 ? 319  VAL A C     1 
ATOM   152  O O     . VAL A 1 23  ? 12.391  20.337  50.784  1.00 32.63 ? 319  VAL A O     1 
ATOM   153  C CB    . VAL A 1 23  ? 11.593  22.468  48.805  1.00 32.22 ? 319  VAL A CB    1 
ATOM   154  C CG1   . VAL A 1 23  ? 12.984  22.524  48.195  1.00 32.07 ? 319  VAL A CG1   1 
ATOM   155  C CG2   . VAL A 1 23  ? 10.634  23.297  47.980  1.00 31.80 ? 319  VAL A CG2   1 
ATOM   156  N N     . VAL A 1 24  ? 12.883  19.359  48.820  1.00 32.75 ? 320  VAL A N     1 
ATOM   157  C CA    . VAL A 1 24  ? 14.072  18.645  49.305  1.00 32.81 ? 320  VAL A CA    1 
ATOM   158  C C     . VAL A 1 24  ? 15.185  18.945  48.339  1.00 33.00 ? 320  VAL A C     1 
ATOM   159  O O     . VAL A 1 24  ? 15.213  18.386  47.250  1.00 32.98 ? 320  VAL A O     1 
ATOM   160  C CB    . VAL A 1 24  ? 13.874  17.121  49.289  1.00 32.78 ? 320  VAL A CB    1 
ATOM   161  C CG1   . VAL A 1 24  ? 14.923  16.445  50.154  1.00 32.12 ? 320  VAL A CG1   1 
ATOM   162  C CG2   . VAL A 1 24  ? 12.470  16.759  49.750  1.00 32.39 ? 320  VAL A CG2   1 
ATOM   163  N N     . GLU A 1 25  ? 16.119  19.799  48.708  1.00 33.36 ? 321  GLU A N     1 
ATOM   164  C CA    . GLU A 1 25  ? 17.022  20.317  47.696  1.00 33.90 ? 321  GLU A CA    1 
ATOM   165  C C     . GLU A 1 25  ? 18.198  19.406  47.388  1.00 34.11 ? 321  GLU A C     1 
ATOM   166  O O     . GLU A 1 25  ? 18.986  19.063  48.272  1.00 34.40 ? 321  GLU A O     1 
ATOM   167  C CB    . GLU A 1 25  ? 17.522  21.699  48.087  1.00 34.10 ? 321  GLU A CB    1 
ATOM   168  C CG    . GLU A 1 25  ? 18.406  22.376  47.047  1.00 34.81 ? 321  GLU A CG    1 
ATOM   169  C CD    . GLU A 1 25  ? 17.650  22.784  45.792  1.00 36.59 ? 321  GLU A CD    1 
ATOM   170  O OE1   . GLU A 1 25  ? 16.401  22.645  45.768  1.00 37.78 ? 321  GLU A OE1   1 
ATOM   171  O OE2   . GLU A 1 25  ? 18.303  23.276  44.826  1.00 37.76 ? 321  GLU A OE2   1 
ATOM   172  N N     . VAL A 1 26  ? 18.295  19.031  46.118  1.00 34.09 ? 322  VAL A N     1 
ATOM   173  C CA    . VAL A 1 26  ? 19.444  18.320  45.597  1.00 34.08 ? 322  VAL A CA    1 
ATOM   174  C C     . VAL A 1 26  ? 19.970  19.186  44.470  1.00 34.24 ? 322  VAL A C     1 
ATOM   175  O O     . VAL A 1 26  ? 19.291  19.406  43.468  1.00 34.16 ? 322  VAL A O     1 
ATOM   176  C CB    . VAL A 1 26  ? 19.082  16.915  45.093  1.00 34.02 ? 322  VAL A CB    1 
ATOM   177  C CG1   . VAL A 1 26  ? 20.253  16.285  44.365  1.00 33.86 ? 322  VAL A CG1   1 
ATOM   178  C CG2   . VAL A 1 26  ? 18.685  16.040  46.253  1.00 33.92 ? 322  VAL A CG2   1 
ATOM   179  N N     . VAL A 1 27  ? 21.178  19.699  44.665  1.00 34.46 ? 323  VAL A N     1 
ATOM   180  C CA    . VAL A 1 27  ? 21.804  20.602  43.720  1.00 34.44 ? 323  VAL A CA    1 
ATOM   181  C C     . VAL A 1 27  ? 22.629  19.833  42.716  1.00 34.62 ? 323  VAL A C     1 
ATOM   182  O O     . VAL A 1 27  ? 22.768  20.265  41.582  1.00 34.60 ? 323  VAL A O     1 
ATOM   183  C CB    . VAL A 1 27  ? 22.705  21.611  44.441  1.00 34.45 ? 323  VAL A CB    1 
ATOM   184  C CG1   . VAL A 1 27  ? 23.536  22.407  43.443  1.00 34.73 ? 323  VAL A CG1   1 
ATOM   185  C CG2   . VAL A 1 27  ? 21.869  22.542  45.296  1.00 34.12 ? 323  VAL A CG2   1 
ATOM   186  N N     . GLU A 1 28  ? 23.186  18.701  43.124  1.00 35.01 ? 324  GLU A N     1 
ATOM   187  C CA    . GLU A 1 28  ? 23.952  17.879  42.201  1.00 35.57 ? 324  GLU A CA    1 
ATOM   188  C C     . GLU A 1 28  ? 23.103  17.600  40.975  1.00 35.84 ? 324  GLU A C     1 
ATOM   189  O O     . GLU A 1 28  ? 21.923  17.272  41.101  1.00 36.06 ? 324  GLU A O     1 
ATOM   190  C CB    . GLU A 1 28  ? 24.343  16.565  42.861  1.00 35.72 ? 324  GLU A CB    1 
ATOM   191  C CG    . GLU A 1 28  ? 25.416  16.724  43.929  1.00 36.83 ? 324  GLU A CG    1 
ATOM   192  C CD    . GLU A 1 28  ? 26.839  16.760  43.370  1.00 38.20 ? 324  GLU A CD    1 
ATOM   193  O OE1   . GLU A 1 28  ? 27.032  16.498  42.156  1.00 38.96 ? 324  GLU A OE1   1 
ATOM   194  O OE2   . GLU A 1 28  ? 27.771  17.042  44.163  1.00 38.46 ? 324  GLU A OE2   1 
ATOM   195  N N     . GLU A 1 29  ? 23.683  17.744  39.792  1.00 36.07 ? 325  GLU A N     1 
ATOM   196  C CA    . GLU A 1 29  ? 22.932  17.465  38.582  1.00 36.37 ? 325  GLU A CA    1 
ATOM   197  C C     . GLU A 1 29  ? 22.521  15.995  38.600  1.00 36.31 ? 325  GLU A C     1 
ATOM   198  O O     . GLU A 1 29  ? 21.341  15.670  38.457  1.00 36.32 ? 325  GLU A O     1 
ATOM   199  C CB    . GLU A 1 29  ? 23.744  17.788  37.331  1.00 36.70 ? 325  GLU A CB    1 
ATOM   200  C CG    . GLU A 1 29  ? 22.962  18.614  36.314  1.00 37.82 ? 325  GLU A CG    1 
ATOM   201  C CD    . GLU A 1 29  ? 23.382  18.356  34.880  1.00 39.78 ? 325  GLU A CD    1 
ATOM   202  O OE1   . GLU A 1 29  ? 24.339  17.585  34.642  1.00 41.14 ? 325  GLU A OE1   1 
ATOM   203  O OE2   . GLU A 1 29  ? 22.748  18.934  33.975  1.00 41.31 ? 325  GLU A OE2   1 
ATOM   204  N N     . ASN A 1 30  ? 23.501  15.117  38.802  1.00 36.20 ? 326  ASN A N     1 
ATOM   205  C CA    . ASN A 1 30  ? 23.236  13.698  38.997  1.00 36.11 ? 326  ASN A CA    1 
ATOM   206  C C     . ASN A 1 30  ? 22.977  13.411  40.470  1.00 35.95 ? 326  ASN A C     1 
ATOM   207  O O     . ASN A 1 30  ? 23.899  13.465  41.287  1.00 35.91 ? 326  ASN A O     1 
ATOM   208  C CB    . ASN A 1 30  ? 24.410  12.863  38.514  1.00 36.15 ? 326  ASN A CB    1 
ATOM   209  C CG    . ASN A 1 30  ? 24.100  11.379  38.496  1.00 36.74 ? 326  ASN A CG    1 
ATOM   210  O OD1   . ASN A 1 30  ? 22.944  10.969  38.594  1.00 37.60 ? 326  ASN A OD1   1 
ATOM   211  N ND2   . ASN A 1 30  ? 25.136  10.564  38.369  1.00 37.55 ? 326  ASN A ND2   1 
ATOM   212  N N     . TYR A 1 31  ? 21.727  13.077  40.794  1.00 35.68 ? 327  TYR A N     1 
ATOM   213  C CA    . TYR A 1 31  ? 21.286  12.986  42.190  1.00 35.58 ? 327  TYR A CA    1 
ATOM   214  C C     . TYR A 1 31  ? 21.516  11.628  42.852  1.00 35.39 ? 327  TYR A C     1 
ATOM   215  O O     . TYR A 1 31  ? 21.062  11.385  43.973  1.00 35.25 ? 327  TYR A O     1 
ATOM   216  C CB    . TYR A 1 31  ? 19.814  13.396  42.318  1.00 35.65 ? 327  TYR A CB    1 
ATOM   217  C CG    . TYR A 1 31  ? 18.868  12.741  41.343  1.00 35.70 ? 327  TYR A CG    1 
ATOM   218  C CD1   . TYR A 1 31  ? 18.506  11.399  41.465  1.00 35.83 ? 327  TYR A CD1   1 
ATOM   219  C CD2   . TYR A 1 31  ? 18.313  13.472  40.311  1.00 36.04 ? 327  TYR A CD2   1 
ATOM   220  C CE1   . TYR A 1 31  ? 17.622  10.803  40.561  1.00 35.53 ? 327  TYR A CE1   1 
ATOM   221  C CE2   . TYR A 1 31  ? 17.430  12.891  39.411  1.00 36.39 ? 327  TYR A CE2   1 
ATOM   222  C CZ    . TYR A 1 31  ? 17.088  11.560  39.536  1.00 35.91 ? 327  TYR A CZ    1 
ATOM   223  O OH    . TYR A 1 31  ? 16.205  11.016  38.625  1.00 35.89 ? 327  TYR A OH    1 
ATOM   224  N N     . HIS A 1 32  ? 22.223  10.744  42.167  1.00 35.33 ? 328  HIS A N     1 
ATOM   225  C CA    . HIS A 1 32  ? 22.529  9.439   42.728  1.00 35.25 ? 328  HIS A CA    1 
ATOM   226  C C     . HIS A 1 32  ? 23.673  9.574   43.732  1.00 35.27 ? 328  HIS A C     1 
ATOM   227  O O     . HIS A 1 32  ? 24.757  10.046  43.389  1.00 35.13 ? 328  HIS A O     1 
ATOM   228  C CB    . HIS A 1 32  ? 22.869  8.445   41.622  1.00 35.14 ? 328  HIS A CB    1 
ATOM   229  C CG    . HIS A 1 32  ? 21.672  7.951   40.873  1.00 34.88 ? 328  HIS A CG    1 
ATOM   230  N ND1   . HIS A 1 32  ? 20.606  7.344   41.497  1.00 34.47 ? 328  HIS A ND1   1 
ATOM   231  C CD2   . HIS A 1 32  ? 21.372  7.971   39.554  1.00 34.89 ? 328  HIS A CD2   1 
ATOM   232  C CE1   . HIS A 1 32  ? 19.701  7.007   40.597  1.00 34.10 ? 328  HIS A CE1   1 
ATOM   233  N NE2   . HIS A 1 32  ? 20.140  7.377   39.409  1.00 34.22 ? 328  HIS A NE2   1 
ATOM   234  N N     . ALA A 1 33  ? 23.397  9.187   44.978  1.00 35.37 ? 329  ALA A N     1 
ATOM   235  C CA    . ALA A 1 33  ? 24.364  9.255   46.082  1.00 35.45 ? 329  ALA A CA    1 
ATOM   236  C C     . ALA A 1 33  ? 24.888  10.677  46.315  1.00 35.47 ? 329  ALA A C     1 
ATOM   237  O O     . ALA A 1 33  ? 26.038  10.868  46.734  1.00 35.61 ? 329  ALA A O     1 
ATOM   238  C CB    . ALA A 1 33  ? 25.527  8.285   45.840  1.00 35.53 ? 329  ALA A CB    1 
ATOM   239  N N     . ALA A 1 34  ? 24.029  11.663  46.051  1.00 35.27 ? 330  ALA A N     1 
ATOM   240  C CA    . ALA A 1 34  ? 24.386  13.076  46.154  1.00 35.00 ? 330  ALA A CA    1 
ATOM   241  C C     . ALA A 1 34  ? 23.733  13.717  47.388  1.00 34.70 ? 330  ALA A C     1 
ATOM   242  O O     . ALA A 1 34  ? 22.653  13.297  47.809  1.00 34.56 ? 330  ALA A O     1 
ATOM   243  C CB    . ALA A 1 34  ? 23.971  13.804  44.887  1.00 34.90 ? 330  ALA A CB    1 
ATOM   244  N N     . PRO A 1 35  ? 24.378  14.751  47.959  1.00 34.40 ? 331  PRO A N     1 
ATOM   245  C CA    . PRO A 1 35  ? 23.886  15.345  49.192  1.00 34.29 ? 331  PRO A CA    1 
ATOM   246  C C     . PRO A 1 35  ? 22.533  16.031  49.048  1.00 34.09 ? 331  PRO A C     1 
ATOM   247  O O     . PRO A 1 35  ? 22.112  16.378  47.942  1.00 33.89 ? 331  PRO A O     1 
ATOM   248  C CB    . PRO A 1 35  ? 24.958  16.396  49.540  1.00 34.37 ? 331  PRO A CB    1 
ATOM   249  C CG    . PRO A 1 35  ? 26.084  16.154  48.628  1.00 34.28 ? 331  PRO A CG    1 
ATOM   250  C CD    . PRO A 1 35  ? 25.519  15.508  47.421  1.00 34.38 ? 331  PRO A CD    1 
ATOM   251  N N     . ILE A 1 36  ? 21.876  16.208  50.187  1.00 33.97 ? 332  ILE A N     1 
ATOM   252  C CA    . ILE A 1 36  ? 20.657  16.990  50.289  1.00 33.93 ? 332  ILE A CA    1 
ATOM   253  C C     . ILE A 1 36  ? 20.997  18.270  51.043  1.00 34.03 ? 332  ILE A C     1 
ATOM   254  O O     . ILE A 1 36  ? 21.329  18.220  52.231  1.00 34.31 ? 332  ILE A O     1 
ATOM   255  C CB    . ILE A 1 36  ? 19.575  16.232  51.055  1.00 33.78 ? 332  ILE A CB    1 
ATOM   256  C CG1   . ILE A 1 36  ? 19.299  14.889  50.375  1.00 33.56 ? 332  ILE A CG1   1 
ATOM   257  C CG2   . ILE A 1 36  ? 18.336  17.097  51.173  1.00 33.52 ? 332  ILE A CG2   1 
ATOM   258  C CD1   . ILE A 1 36  ? 17.863  14.442  50.448  1.00 34.09 ? 332  ILE A CD1   1 
ATOM   259  N N     . VAL A 1 37  ? 20.924  19.412  50.358  1.00 33.88 ? 333  VAL A N     1 
ATOM   260  C CA    . VAL A 1 37  ? 21.391  20.696  50.930  1.00 33.56 ? 333  VAL A CA    1 
ATOM   261  C C     . VAL A 1 37  ? 20.389  21.391  51.856  1.00 33.15 ? 333  VAL A C     1 
ATOM   262  O O     . VAL A 1 37  ? 20.789  22.202  52.691  1.00 33.26 ? 333  VAL A O     1 
ATOM   263  C CB    . VAL A 1 37  ? 21.821  21.707  49.849  1.00 33.50 ? 333  VAL A CB    1 
ATOM   264  C CG1   . VAL A 1 37  ? 23.136  21.287  49.217  1.00 33.71 ? 333  VAL A CG1   1 
ATOM   265  C CG2   . VAL A 1 37  ? 20.757  21.850  48.810  1.00 33.71 ? 333  VAL A CG2   1 
ATOM   266  N N     . GLY A 1 38  ? 19.102  21.092  51.717  1.00 32.55 ? 334  GLY A N     1 
ATOM   267  C CA    . GLY A 1 38  ? 18.111  21.657  52.630  1.00 32.08 ? 334  GLY A CA    1 
ATOM   268  C C     . GLY A 1 38  ? 16.694  21.179  52.410  1.00 31.63 ? 334  GLY A C     1 
ATOM   269  O O     . GLY A 1 38  ? 16.355  20.666  51.352  1.00 31.66 ? 334  GLY A O     1 
ATOM   270  N N     . ILE A 1 39  ? 15.863  21.354  53.427  1.00 31.19 ? 335  ILE A N     1 
ATOM   271  C CA    . ILE A 1 39  ? 14.450  21.029  53.328  1.00 31.07 ? 335  ILE A CA    1 
ATOM   272  C C     . ILE A 1 39  ? 13.598  22.232  53.665  1.00 31.00 ? 335  ILE A C     1 
ATOM   273  O O     . ILE A 1 39  ? 14.007  23.102  54.422  1.00 31.12 ? 335  ILE A O     1 
ATOM   274  C CB    . ILE A 1 39  ? 14.068  19.888  54.274  1.00 31.08 ? 335  ILE A CB    1 
ATOM   275  C CG1   . ILE A 1 39  ? 14.709  18.578  53.810  1.00 31.27 ? 335  ILE A CG1   1 
ATOM   276  C CG2   . ILE A 1 39  ? 12.550  19.725  54.355  1.00 30.85 ? 335  ILE A CG2   1 
ATOM   277  C CD1   . ILE A 1 39  ? 16.019  18.273  54.470  1.00 31.39 ? 335  ILE A CD1   1 
ATOM   278  N N     . ALA A 1 40  ? 12.403  22.273  53.099  1.00 30.94 ? 336  ALA A N     1 
ATOM   279  C CA    . ALA A 1 40  ? 11.486  23.354  53.370  1.00 31.08 ? 336  ALA A CA    1 
ATOM   280  C C     . ALA A 1 40  ? 10.043  22.883  53.235  1.00 31.25 ? 336  ALA A C     1 
ATOM   281  O O     . ALA A 1 40  ? 9.673   22.244  52.252  1.00 31.32 ? 336  ALA A O     1 
ATOM   282  C CB    . ALA A 1 40  ? 11.765  24.512  52.437  1.00 31.06 ? 336  ALA A CB    1 
ATOM   283  N N     . VAL A 1 41  ? 9.238   23.204  54.238  1.00 31.47 ? 337  VAL A N     1 
ATOM   284  C CA    . VAL A 1 41  ? 7.827   22.842  54.259  1.00 31.69 ? 337  VAL A CA    1 
ATOM   285  C C     . VAL A 1 41  ? 6.974   24.103  54.247  1.00 31.86 ? 337  VAL A C     1 
ATOM   286  O O     . VAL A 1 41  ? 7.318   25.101  54.871  1.00 31.59 ? 337  VAL A O     1 
ATOM   287  C CB    . VAL A 1 41  ? 7.490   22.017  55.520  1.00 31.71 ? 337  VAL A CB    1 
ATOM   288  C CG1   . VAL A 1 41  ? 6.010   21.636  55.558  1.00 31.66 ? 337  VAL A CG1   1 
ATOM   289  C CG2   . VAL A 1 41  ? 8.361   20.774  55.581  1.00 32.02 ? 337  VAL A CG2   1 
ATOM   290  N N     . VAL A 1 42  ? 5.865   24.053  53.524  1.00 32.31 ? 338  VAL A N     1 
ATOM   291  C CA    . VAL A 1 42  ? 4.878   25.121  53.568  1.00 32.73 ? 338  VAL A CA    1 
ATOM   292  C C     . VAL A 1 42  ? 3.518   24.481  53.702  1.00 33.25 ? 338  VAL A C     1 
ATOM   293  O O     . VAL A 1 42  ? 3.177   23.594  52.929  1.00 33.16 ? 338  VAL A O     1 
ATOM   294  C CB    . VAL A 1 42  ? 4.930   26.021  52.310  1.00 32.82 ? 338  VAL A CB    1 
ATOM   295  C CG1   . VAL A 1 42  ? 3.574   26.698  52.046  1.00 32.45 ? 338  VAL A CG1   1 
ATOM   296  C CG2   . VAL A 1 42  ? 6.039   27.069  52.454  1.00 32.46 ? 338  VAL A CG2   1 
ATOM   297  N N     . ASN A 1 43  ? 2.759   24.925  54.700  1.00 34.02 ? 339  ASN A N     1 
ATOM   298  C CA    . ASN A 1 43  ? 1.398   24.444  54.915  1.00 34.73 ? 339  ASN A CA    1 
ATOM   299  C C     . ASN A 1 43  ? 0.533   25.475  55.643  1.00 35.20 ? 339  ASN A C     1 
ATOM   300  O O     . ASN A 1 43  ? 1.002   26.567  55.975  1.00 35.10 ? 339  ASN A O     1 
ATOM   301  C CB    . ASN A 1 43  ? 1.435   23.135  55.701  1.00 34.87 ? 339  ASN A CB    1 
ATOM   302  C CG    . ASN A 1 43  ? 1.898   23.330  57.130  1.00 35.47 ? 339  ASN A CG    1 
ATOM   303  O OD1   . ASN A 1 43  ? 1.136   23.797  57.980  1.00 37.16 ? 339  ASN A OD1   1 
ATOM   304  N ND2   . ASN A 1 43  ? 3.148   22.967  57.407  1.00 34.68 ? 339  ASN A ND2   1 
ATOM   305  N N     . GLU A 1 44  ? -0.721  25.101  55.902  1.00 35.92 ? 340  GLU A N     1 
ATOM   306  C CA    . GLU A 1 44  ? -1.708  25.968  56.574  1.00 36.56 ? 340  GLU A CA    1 
ATOM   307  C C     . GLU A 1 44  ? -1.191  26.653  57.846  1.00 36.66 ? 340  GLU A C     1 
ATOM   308  O O     . GLU A 1 44  ? -1.697  27.713  58.220  1.00 36.90 ? 340  GLU A O     1 
ATOM   309  C CB    . GLU A 1 44  ? -3.001  25.193  56.897  1.00 36.76 ? 340  GLU A CB    1 
ATOM   310  C CG    . GLU A 1 44  ? -2.790  23.767  57.459  1.00 38.55 ? 340  GLU A CG    1 
ATOM   311  C CD    . GLU A 1 44  ? -4.032  23.173  58.172  1.00 40.44 ? 340  GLU A CD    1 
ATOM   312  O OE1   . GLU A 1 44  ? -4.780  23.939  58.828  1.00 40.95 ? 340  GLU A OE1   1 
ATOM   313  O OE2   . GLU A 1 44  ? -4.245  21.931  58.090  1.00 40.74 ? 340  GLU A OE2   1 
ATOM   314  N N     . HIS A 1 45  ? -0.196  26.053  58.499  1.00 36.71 ? 341  HIS A N     1 
ATOM   315  C CA    . HIS A 1 45  ? 0.355   26.576  59.757  1.00 36.75 ? 341  HIS A CA    1 
ATOM   316  C C     . HIS A 1 45  ? 1.501   27.557  59.555  1.00 36.28 ? 341  HIS A C     1 
ATOM   317  O O     . HIS A 1 45  ? 1.756   28.393  60.415  1.00 36.21 ? 341  HIS A O     1 
ATOM   318  C CB    . HIS A 1 45  ? 0.808   25.425  60.666  1.00 37.02 ? 341  HIS A CB    1 
ATOM   319  C CG    . HIS A 1 45  ? -0.260  24.403  60.905  1.00 38.14 ? 341  HIS A CG    1 
ATOM   320  N ND1   . HIS A 1 45  ? -1.547  24.749  61.258  1.00 39.11 ? 341  HIS A ND1   1 
ATOM   321  C CD2   . HIS A 1 45  ? -0.240  23.051  60.829  1.00 39.05 ? 341  HIS A CD2   1 
ATOM   322  C CE1   . HIS A 1 45  ? -2.273  23.653  61.391  1.00 39.70 ? 341  HIS A CE1   1 
ATOM   323  N NE2   . HIS A 1 45  ? -1.504  22.609  61.137  1.00 39.43 ? 341  HIS A NE2   1 
ATOM   324  N N     . GLY A 1 46  ? 2.190   27.461  58.427  1.00 35.92 ? 342  GLY A N     1 
ATOM   325  C CA    . GLY A 1 46  ? 3.268   28.398  58.132  1.00 35.72 ? 342  GLY A CA    1 
ATOM   326  C C     . GLY A 1 46  ? 4.302   27.824  57.198  1.00 35.49 ? 342  GLY A C     1 
ATOM   327  O O     . GLY A 1 46  ? 4.102   26.760  56.613  1.00 35.51 ? 342  GLY A O     1 
ATOM   328  N N     . ARG A 1 47  ? 5.416   28.538  57.075  1.00 35.28 ? 343  ARG A N     1 
ATOM   329  C CA    . ARG A 1 47  ? 6.541   28.141  56.252  1.00 35.26 ? 343  ARG A CA    1 
ATOM   330  C C     . ARG A 1 47  ? 7.734   27.931  57.128  1.00 35.19 ? 343  ARG A C     1 
ATOM   331  O O     . ARG A 1 47  ? 8.081   28.806  57.874  1.00 35.10 ? 343  ARG A O     1 
ATOM   332  C CB    . ARG A 1 47  ? 6.908   29.254  55.302  1.00 35.25 ? 343  ARG A CB    1 
ATOM   333  C CG    . ARG A 1 47  ? 5.840   29.655  54.370  1.00 35.57 ? 343  ARG A CG    1 
ATOM   334  C CD    . ARG A 1 47  ? 6.329   30.774  53.513  1.00 35.95 ? 343  ARG A CD    1 
ATOM   335  N NE    . ARG A 1 47  ? 5.272   31.700  53.148  1.00 36.28 ? 343  ARG A NE    1 
ATOM   336  C CZ    . ARG A 1 47  ? 5.196   32.937  53.592  1.00 36.86 ? 343  ARG A CZ    1 
ATOM   337  N NH1   . ARG A 1 47  ? 6.102   33.388  54.431  1.00 37.14 ? 343  ARG A NH1   1 
ATOM   338  N NH2   . ARG A 1 47  ? 4.208   33.710  53.214  1.00 37.23 ? 343  ARG A NH2   1 
ATOM   339  N N     . PHE A 1 48  ? 8.380   26.778  57.010  1.00 35.35 ? 344  PHE A N     1 
ATOM   340  C CA    . PHE A 1 48  ? 9.556   26.455  57.806  1.00 35.33 ? 344  PHE A CA    1 
ATOM   341  C C     . PHE A 1 48  ? 10.717  25.949  56.985  1.00 35.37 ? 344  PHE A C     1 
ATOM   342  O O     . PHE A 1 48  ? 10.532  25.286  55.999  1.00 35.04 ? 344  PHE A O     1 
ATOM   343  C CB    . PHE A 1 48  ? 9.213   25.380  58.821  1.00 35.32 ? 344  PHE A CB    1 
ATOM   344  C CG    . PHE A 1 48  ? 7.782   25.383  59.249  1.00 35.60 ? 344  PHE A CG    1 
ATOM   345  C CD1   . PHE A 1 48  ? 6.828   24.712  58.533  1.00 35.40 ? 344  PHE A CD1   1 
ATOM   346  C CD2   . PHE A 1 48  ? 7.398   26.042  60.384  1.00 35.56 ? 344  PHE A CD2   1 
ATOM   347  C CE1   . PHE A 1 48  ? 5.540   24.714  58.937  1.00 35.21 ? 344  PHE A CE1   1 
ATOM   348  C CE2   . PHE A 1 48  ? 6.111   26.039  60.776  1.00 35.30 ? 344  PHE A CE2   1 
ATOM   349  C CZ    . PHE A 1 48  ? 5.187   25.378  60.057  1.00 35.39 ? 344  PHE A CZ    1 
ATOM   350  N N     . PHE A 1 49  ? 11.927  26.257  57.418  1.00 35.86 ? 345  PHE A N     1 
ATOM   351  C CA    . PHE A 1 49  ? 13.121  25.752  56.769  1.00 36.19 ? 345  PHE A CA    1 
ATOM   352  C C     . PHE A 1 49  ? 13.797  24.845  57.750  1.00 36.36 ? 345  PHE A C     1 
ATOM   353  O O     . PHE A 1 49  ? 14.004  25.210  58.878  1.00 36.15 ? 345  PHE A O     1 
ATOM   354  C CB    . PHE A 1 49  ? 14.078  26.871  56.395  1.00 36.30 ? 345  PHE A CB    1 
ATOM   355  C CG    . PHE A 1 49  ? 15.424  26.389  55.961  1.00 37.16 ? 345  PHE A CG    1 
ATOM   356  C CD1   . PHE A 1 49  ? 15.618  25.891  54.699  1.00 37.96 ? 345  PHE A CD1   1 
ATOM   357  C CD2   . PHE A 1 49  ? 16.494  26.422  56.817  1.00 37.78 ? 345  PHE A CD2   1 
ATOM   358  C CE1   . PHE A 1 49  ? 16.845  25.443  54.308  1.00 38.09 ? 345  PHE A CE1   1 
ATOM   359  C CE2   . PHE A 1 49  ? 17.719  25.970  56.422  1.00 38.04 ? 345  PHE A CE2   1 
ATOM   360  C CZ    . PHE A 1 49  ? 17.893  25.482  55.171  1.00 38.19 ? 345  PHE A CZ    1 
ATOM   361  N N     . LEU A 1 50  ? 14.130  23.648  57.311  1.00 36.82 ? 346  LEU A N     1 
ATOM   362  C CA    . LEU A 1 50  ? 14.818  22.673  58.146  1.00 37.26 ? 346  LEU A CA    1 
ATOM   363  C C     . LEU A 1 50  ? 16.194  22.394  57.553  1.00 37.65 ? 346  LEU A C     1 
ATOM   364  O O     . LEU A 1 50  ? 16.372  22.395  56.333  1.00 37.77 ? 346  LEU A O     1 
ATOM   365  C CB    . LEU A 1 50  ? 14.002  21.383  58.240  1.00 37.25 ? 346  LEU A CB    1 
ATOM   366  C CG    . LEU A 1 50  ? 13.082  21.302  59.459  1.00 37.56 ? 346  LEU A CG    1 
ATOM   367  C CD1   . LEU A 1 50  ? 11.916  20.344  59.244  1.00 37.42 ? 346  LEU A CD1   1 
ATOM   368  C CD2   . LEU A 1 50  ? 13.897  20.899  60.669  1.00 38.91 ? 346  LEU A CD2   1 
ATOM   369  N N     . ARG A 1 51  ? 17.175  22.191  58.421  1.00 38.02 ? 347  ARG A N     1 
ATOM   370  C CA    . ARG A 1 51  ? 18.463  21.684  57.981  1.00 38.32 ? 347  ARG A CA    1 
ATOM   371  C C     . ARG A 1 51  ? 18.331  20.170  57.854  1.00 38.24 ? 347  ARG A C     1 
ATOM   372  O O     . ARG A 1 51  ? 17.644  19.530  58.655  1.00 38.29 ? 347  ARG A O     1 
ATOM   373  C CB    . ARG A 1 51  ? 19.567  22.039  58.970  1.00 38.66 ? 347  ARG A CB    1 
ATOM   374  C CG    . ARG A 1 51  ? 20.049  23.474  58.875  1.00 39.89 ? 347  ARG A CG    1 
ATOM   375  C CD    . ARG A 1 51  ? 21.099  23.795  59.940  1.00 41.57 ? 347  ARG A CD    1 
ATOM   376  N NE    . ARG A 1 51  ? 20.805  25.055  60.630  1.00 43.06 ? 347  ARG A NE    1 
ATOM   377  C CZ    . ARG A 1 51  ? 20.031  25.175  61.712  1.00 44.05 ? 347  ARG A CZ    1 
ATOM   378  N NH1   . ARG A 1 51  ? 19.450  24.109  62.266  1.00 44.54 ? 347  ARG A NH1   1 
ATOM   379  N NH2   . ARG A 1 51  ? 19.836  26.378  62.249  1.00 44.18 ? 347  ARG A NH2   1 
ATOM   380  N N     . PRO A 1 52  ? 18.992  19.584  56.850  1.00 38.22 ? 348  PRO A N     1 
ATOM   381  C CA    . PRO A 1 52  ? 18.834  18.150  56.582  1.00 38.14 ? 348  PRO A CA    1 
ATOM   382  C C     . PRO A 1 52  ? 19.198  17.271  57.779  1.00 38.06 ? 348  PRO A C     1 
ATOM   383  O O     . PRO A 1 52  ? 18.472  16.319  58.089  1.00 37.97 ? 348  PRO A O     1 
ATOM   384  C CB    . PRO A 1 52  ? 19.785  17.902  55.400  1.00 38.14 ? 348  PRO A CB    1 
ATOM   385  C CG    . PRO A 1 52  ? 20.751  19.042  55.419  1.00 38.29 ? 348  PRO A CG    1 
ATOM   386  C CD    . PRO A 1 52  ? 20.007  20.210  55.985  1.00 38.35 ? 348  PRO A CD    1 
ATOM   387  N N     . GLU A 1 53  ? 20.297  17.614  58.454  1.00 38.01 ? 349  GLU A N     1 
ATOM   388  C CA    . GLU A 1 53  ? 20.770  16.855  59.619  1.00 37.98 ? 349  GLU A CA    1 
ATOM   389  C C     . GLU A 1 53  ? 19.699  16.773  60.702  1.00 37.81 ? 349  GLU A C     1 
ATOM   390  O O     . GLU A 1 53  ? 19.521  15.731  61.343  1.00 37.82 ? 349  GLU A O     1 
ATOM   391  C CB    . GLU A 1 53  ? 22.070  17.446  60.194  1.00 38.07 ? 349  GLU A CB    1 
ATOM   392  C CG    . GLU A 1 53  ? 21.990  18.892  60.740  1.00 38.90 ? 349  GLU A CG    1 
ATOM   393  C CD    . GLU A 1 53  ? 22.446  19.967  59.746  1.00 40.08 ? 349  GLU A CD    1 
ATOM   394  O OE1   . GLU A 1 53  ? 22.394  19.737  58.508  1.00 39.93 ? 349  GLU A OE1   1 
ATOM   395  O OE2   . GLU A 1 53  ? 22.850  21.056  60.221  1.00 40.65 ? 349  GLU A OE2   1 
ATOM   396  N N     . THR A 1 54  ? 18.979  17.874  60.882  1.00 37.59 ? 350  THR A N     1 
ATOM   397  C CA    . THR A 1 54  ? 17.917  17.941  61.865  1.00 37.61 ? 350  THR A CA    1 
ATOM   398  C C     . THR A 1 54  ? 16.726  17.121  61.382  1.00 37.46 ? 350  THR A C     1 
ATOM   399  O O     . THR A 1 54  ? 16.295  16.181  62.049  1.00 37.47 ? 350  THR A O     1 
ATOM   400  C CB    . THR A 1 54  ? 17.487  19.395  62.114  1.00 37.64 ? 350  THR A CB    1 
ATOM   401  O OG1   . THR A 1 54  ? 18.650  20.207  62.327  1.00 37.83 ? 350  THR A OG1   1 
ATOM   402  C CG2   . THR A 1 54  ? 16.576  19.483  63.331  1.00 37.86 ? 350  THR A CG2   1 
ATOM   403  N N     . ALA A 1 55  ? 16.226  17.468  60.204  1.00 37.38 ? 351  ALA A N     1 
ATOM   404  C CA    . ALA A 1 55  ? 15.026  16.840  59.655  1.00 37.42 ? 351  ALA A CA    1 
ATOM   405  C C     . ALA A 1 55  ? 15.207  15.341  59.483  1.00 37.46 ? 351  ALA A C     1 
ATOM   406  O O     . ALA A 1 55  ? 14.460  14.539  60.055  1.00 37.51 ? 351  ALA A O     1 
ATOM   407  C CB    . ALA A 1 55  ? 14.670  17.465  58.321  1.00 37.44 ? 351  ALA A CB    1 
ATOM   408  N N     . LEU A 1 56  ? 16.214  14.967  58.700  1.00 37.47 ? 352  LEU A N     1 
ATOM   409  C CA    . LEU A 1 56  ? 16.410  13.567  58.325  1.00 37.47 ? 352  LEU A CA    1 
ATOM   410  C C     . LEU A 1 56  ? 17.058  12.724  59.435  1.00 37.52 ? 352  LEU A C     1 
ATOM   411  O O     . LEU A 1 56  ? 17.587  11.652  59.161  1.00 37.66 ? 352  LEU A O     1 
ATOM   412  C CB    . LEU A 1 56  ? 17.227  13.474  57.031  1.00 37.35 ? 352  LEU A CB    1 
ATOM   413  N N     . ALA A 1 57  ? 17.027  13.216  60.673  1.00 37.53 ? 353  ALA A N     1 
ATOM   414  C CA    . ALA A 1 57  ? 17.363  12.409  61.853  1.00 37.50 ? 353  ALA A CA    1 
ATOM   415  C C     . ALA A 1 57  ? 16.114  12.064  62.683  1.00 37.42 ? 353  ALA A C     1 
ATOM   416  O O     . ALA A 1 57  ? 16.094  11.078  63.418  1.00 37.25 ? 353  ALA A O     1 
ATOM   417  C CB    . ALA A 1 57  ? 18.389  13.145  62.713  1.00 37.52 ? 353  ALA A CB    1 
ATOM   418  N N     . ASP A 1 58  ? 15.067  12.870  62.545  1.00 37.51 ? 354  ASP A N     1 
ATOM   419  C CA    . ASP A 1 58  ? 13.875  12.744  63.379  1.00 37.67 ? 354  ASP A CA    1 
ATOM   420  C C     . ASP A 1 58  ? 12.858  11.707  62.862  1.00 37.68 ? 354  ASP A C     1 
ATOM   421  O O     . ASP A 1 58  ? 12.471  11.743  61.691  1.00 37.51 ? 354  ASP A O     1 
ATOM   422  C CB    . ASP A 1 58  ? 13.202  14.107  63.503  1.00 37.71 ? 354  ASP A CB    1 
ATOM   423  C CG    . ASP A 1 58  ? 11.945  14.060  64.335  1.00 38.51 ? 354  ASP A CG    1 
ATOM   424  O OD1   . ASP A 1 58  ? 11.101  13.164  64.125  1.00 39.03 ? 354  ASP A OD1   1 
ATOM   425  O OD2   . ASP A 1 58  ? 11.801  14.929  65.214  1.00 40.26 ? 354  ASP A OD2   1 
ATOM   426  N N     . PRO A 1 59  ? 12.395  10.806  63.752  1.00 37.85 ? 355  PRO A N     1 
ATOM   427  C CA    . PRO A 1 59  ? 11.374  9.800   63.415  1.00 37.94 ? 355  PRO A CA    1 
ATOM   428  C C     . PRO A 1 59  ? 10.053  10.384  62.916  1.00 37.88 ? 355  PRO A C     1 
ATOM   429  O O     . PRO A 1 59  ? 9.483   9.878   61.952  1.00 38.07 ? 355  PRO A O     1 
ATOM   430  C CB    . PRO A 1 59  ? 11.130  9.073   64.750  1.00 37.97 ? 355  PRO A CB    1 
ATOM   431  C CG    . PRO A 1 59  ? 12.315  9.356   65.578  1.00 38.11 ? 355  PRO A CG    1 
ATOM   432  C CD    . PRO A 1 59  ? 12.808  10.705  65.165  1.00 37.95 ? 355  PRO A CD    1 
ATOM   433  N N     . GLN A 1 60  ? 9.565   11.422  63.585  1.00 37.68 ? 356  GLN A N     1 
ATOM   434  C CA    . GLN A 1 60  ? 8.309   12.062  63.195  1.00 37.53 ? 356  GLN A CA    1 
ATOM   435  C C     . GLN A 1 60  ? 8.385   12.557  61.745  1.00 37.41 ? 356  GLN A C     1 
ATOM   436  O O     . GLN A 1 60  ? 7.502   12.268  60.939  1.00 37.21 ? 356  GLN A O     1 
ATOM   437  C CB    . GLN A 1 60  ? 7.970   13.216  64.147  1.00 37.61 ? 356  GLN A CB    1 
ATOM   438  C CG    . GLN A 1 60  ? 7.876   12.810  65.622  1.00 37.65 ? 356  GLN A CG    1 
ATOM   439  N N     . PHE A 1 61  ? 9.453   13.281  61.413  1.00 37.44 ? 357  PHE A N     1 
ATOM   440  C CA    . PHE A 1 61  ? 9.640   13.799  60.048  1.00 37.30 ? 357  PHE A CA    1 
ATOM   441  C C     . PHE A 1 61  ? 9.851   12.678  59.041  1.00 36.67 ? 357  PHE A C     1 
ATOM   442  O O     . PHE A 1 61  ? 9.105   12.551  58.073  1.00 36.56 ? 357  PHE A O     1 
ATOM   443  C CB    . PHE A 1 61  ? 10.821  14.772  59.966  1.00 37.53 ? 357  PHE A CB    1 
ATOM   444  C CG    . PHE A 1 61  ? 10.970  15.410  58.615  1.00 38.60 ? 357  PHE A CG    1 
ATOM   445  C CD1   . PHE A 1 61  ? 9.893   16.073  58.031  1.00 39.95 ? 357  PHE A CD1   1 
ATOM   446  C CD2   . PHE A 1 61  ? 12.167  15.342  57.922  1.00 39.26 ? 357  PHE A CD2   1 
ATOM   447  C CE1   . PHE A 1 61  ? 10.010  16.659  56.783  1.00 40.40 ? 357  PHE A CE1   1 
ATOM   448  C CE2   . PHE A 1 61  ? 12.294  15.925  56.674  1.00 40.15 ? 357  PHE A CE2   1 
ATOM   449  C CZ    . PHE A 1 61  ? 11.214  16.586  56.102  1.00 40.57 ? 357  PHE A CZ    1 
ATOM   450  N N     . VAL A 1 62  ? 10.870  11.863  59.282  1.00 36.03 ? 358  VAL A N     1 
ATOM   451  C CA    . VAL A 1 62  ? 11.138  10.710  58.429  1.00 35.55 ? 358  VAL A CA    1 
ATOM   452  C C     . VAL A 1 62  ? 9.891   9.831   58.294  1.00 35.30 ? 358  VAL A C     1 
ATOM   453  O O     . VAL A 1 62  ? 9.675   9.212   57.259  1.00 35.39 ? 358  VAL A O     1 
ATOM   454  C CB    . VAL A 1 62  ? 12.327  9.874   58.963  1.00 35.47 ? 358  VAL A CB    1 
ATOM   455  C CG1   . VAL A 1 62  ? 12.356  8.496   58.323  1.00 34.97 ? 358  VAL A CG1   1 
ATOM   456  C CG2   . VAL A 1 62  ? 13.643  10.604  58.721  1.00 35.34 ? 358  VAL A CG2   1 
ATOM   457  N N     . ALA A 1 63  ? 9.068   9.787   59.335  1.00 35.01 ? 359  ALA A N     1 
ATOM   458  C CA    . ALA A 1 63  ? 7.832   9.018   59.291  1.00 34.86 ? 359  ALA A CA    1 
ATOM   459  C C     . ALA A 1 63  ? 6.789   9.727   58.437  1.00 34.92 ? 359  ALA A C     1 
ATOM   460  O O     . ALA A 1 63  ? 6.044   9.082   57.701  1.00 35.06 ? 359  ALA A O     1 
ATOM   461  C CB    . ALA A 1 63  ? 7.301   8.784   60.684  1.00 34.79 ? 359  ALA A CB    1 
ATOM   462  N N     . TRP A 1 64  ? 6.736   11.052  58.537  1.00 34.95 ? 360  TRP A N     1 
ATOM   463  C CA    . TRP A 1 64  ? 5.785   11.848  57.757  1.00 34.91 ? 360  TRP A CA    1 
ATOM   464  C C     . TRP A 1 64  ? 6.072   11.718  56.257  1.00 34.82 ? 360  TRP A C     1 
ATOM   465  O O     . TRP A 1 64  ? 5.154   11.526  55.460  1.00 34.88 ? 360  TRP A O     1 
ATOM   466  C CB    . TRP A 1 64  ? 5.824   13.316  58.204  1.00 34.91 ? 360  TRP A CB    1 
ATOM   467  C CG    . TRP A 1 64  ? 4.961   14.232  57.392  1.00 35.25 ? 360  TRP A CG    1 
ATOM   468  C CD1   . TRP A 1 64  ? 3.607   14.376  57.472  1.00 35.44 ? 360  TRP A CD1   1 
ATOM   469  C CD2   . TRP A 1 64  ? 5.401   15.138  56.382  1.00 35.47 ? 360  TRP A CD2   1 
ATOM   470  N NE1   . TRP A 1 64  ? 3.171   15.314  56.567  1.00 35.63 ? 360  TRP A NE1   1 
ATOM   471  C CE2   . TRP A 1 64  ? 4.256   15.797  55.883  1.00 36.17 ? 360  TRP A CE2   1 
ATOM   472  C CE3   . TRP A 1 64  ? 6.653   15.454  55.848  1.00 34.91 ? 360  TRP A CE3   1 
ATOM   473  C CZ2   . TRP A 1 64  ? 4.330   16.754  54.874  1.00 36.55 ? 360  TRP A CZ2   1 
ATOM   474  C CZ3   . TRP A 1 64  ? 6.727   16.398  54.853  1.00 35.74 ? 360  TRP A CZ3   1 
ATOM   475  C CH2   . TRP A 1 64  ? 5.573   17.042  54.373  1.00 36.36 ? 360  TRP A CH2   1 
ATOM   476  N N     . LEU A 1 65  ? 7.347   11.806  55.887  1.00 34.74 ? 361  LEU A N     1 
ATOM   477  C CA    . LEU A 1 65  ? 7.764   11.645  54.495  1.00 34.72 ? 361  LEU A CA    1 
ATOM   478  C C     . LEU A 1 65  ? 7.222   10.354  53.933  1.00 34.80 ? 361  LEU A C     1 
ATOM   479  O O     . LEU A 1 65  ? 6.587   10.330  52.878  1.00 34.84 ? 361  LEU A O     1 
ATOM   480  C CB    . LEU A 1 65  ? 9.288   11.600  54.383  1.00 34.69 ? 361  LEU A CB    1 
ATOM   481  C CG    . LEU A 1 65  ? 10.066  12.866  54.721  1.00 35.01 ? 361  LEU A CG    1 
ATOM   482  C CD1   . LEU A 1 65  ? 11.399  12.823  54.008  1.00 35.69 ? 361  LEU A CD1   1 
ATOM   483  C CD2   . LEU A 1 65  ? 9.313   14.126  54.324  1.00 35.42 ? 361  LEU A CD2   1 
ATOM   484  N N     . GLY A 1 66  ? 7.489   9.279   54.660  1.00 34.98 ? 362  GLY A N     1 
ATOM   485  C CA    . GLY A 1 66  ? 7.102   7.952   54.248  1.00 35.23 ? 362  GLY A CA    1 
ATOM   486  C C     . GLY A 1 66  ? 5.619   7.726   54.365  1.00 35.61 ? 362  GLY A C     1 
ATOM   487  O O     . GLY A 1 66  ? 5.094   6.760   53.799  1.00 35.71 ? 362  GLY A O     1 
ATOM   488  N N     . ASP A 1 67  ? 4.918   8.589   55.088  1.00 36.03 ? 363  ASP A N     1 
ATOM   489  C CA    . ASP A 1 67  ? 3.519   8.336   55.233  1.00 36.39 ? 363  ASP A CA    1 
ATOM   490  C C     . ASP A 1 67  ? 2.772   8.770   53.995  1.00 36.70 ? 363  ASP A C     1 
ATOM   491  O O     . ASP A 1 67  ? 2.781   9.939   53.610  1.00 36.70 ? 363  ASP A O     1 
ATOM   492  C CB    . ASP A 1 67  ? 2.921   8.997   56.445  1.00 36.46 ? 363  ASP A CB    1 
ATOM   493  C CG    . ASP A 1 67  ? 1.519   8.518   56.694  1.00 37.09 ? 363  ASP A CG    1 
ATOM   494  O OD1   . ASP A 1 67  ? 0.994   7.756   55.841  1.00 38.20 ? 363  ASP A OD1   1 
ATOM   495  O OD2   . ASP A 1 67  ? 0.927   8.882   57.733  1.00 37.67 ? 363  ASP A OD2   1 
ATOM   496  N N     . GLU A 1 68  ? 2.104   7.784   53.410  1.00 37.16 ? 364  GLU A N     1 
ATOM   497  C CA    . GLU A 1 68  ? 1.291   7.937   52.217  1.00 37.53 ? 364  GLU A CA    1 
ATOM   498  C C     . GLU A 1 68  ? 0.025   8.740   52.459  1.00 37.41 ? 364  GLU A C     1 
ATOM   499  O O     . GLU A 1 68  ? -0.604  9.228   51.517  1.00 37.55 ? 364  GLU A O     1 
ATOM   500  C CB    . GLU A 1 68  ? 0.863   6.555   51.737  1.00 37.80 ? 364  GLU A CB    1 
ATOM   501  C CG    . GLU A 1 68  ? -0.265  5.919   52.593  1.00 39.12 ? 364  GLU A CG    1 
ATOM   502  C CD    . GLU A 1 68  ? 0.222   4.852   53.583  1.00 41.18 ? 364  GLU A CD    1 
ATOM   503  O OE1   . GLU A 1 68  ? 0.947   3.914   53.168  1.00 42.24 ? 364  GLU A OE1   1 
ATOM   504  O OE2   . GLU A 1 68  ? -0.147  4.933   54.778  1.00 42.28 ? 364  GLU A OE2   1 
ATOM   505  N N     . THR A 1 69  ? -0.377  8.839   53.715  1.00 37.22 ? 365  THR A N     1 
ATOM   506  C CA    . THR A 1 69  ? -1.609  9.512   54.055  1.00 37.23 ? 365  THR A CA    1 
ATOM   507  C C     . THR A 1 69  ? -1.392  10.999  54.181  1.00 37.16 ? 365  THR A C     1 
ATOM   508  O O     . THR A 1 69  ? -2.341  11.755  54.387  1.00 37.18 ? 365  THR A O     1 
ATOM   509  C CB    . THR A 1 69  ? -2.127  9.014   55.384  1.00 37.33 ? 365  THR A CB    1 
ATOM   510  O OG1   . THR A 1 69  ? -1.017  8.787   56.261  1.00 37.40 ? 365  THR A OG1   1 
ATOM   511  C CG2   . THR A 1 69  ? -2.899  7.718   55.189  1.00 37.53 ? 365  THR A CG2   1 
ATOM   512  N N     . LYS A 1 70  ? -0.135  11.407  54.075  1.00 37.03 ? 366  LYS A N     1 
ATOM   513  C CA    . LYS A 1 70  ? 0.233   12.803  54.148  1.00 36.94 ? 366  LYS A CA    1 
ATOM   514  C C     . LYS A 1 70  ? 0.620   13.173  52.743  1.00 36.70 ? 366  LYS A C     1 
ATOM   515  O O     . LYS A 1 70  ? 1.413   12.476  52.107  1.00 36.63 ? 366  LYS A O     1 
ATOM   516  C CB    . LYS A 1 70  ? 1.420   13.011  55.081  1.00 37.02 ? 366  LYS A CB    1 
ATOM   517  C CG    . LYS A 1 70  ? 1.368   12.170  56.339  1.00 37.16 ? 366  LYS A CG    1 
ATOM   518  C CD    . LYS A 1 70  ? 0.628   12.862  57.460  1.00 37.36 ? 366  LYS A CD    1 
ATOM   519  C CE    . LYS A 1 70  ? -0.301  11.909  58.182  1.00 37.19 ? 366  LYS A CE    1 
ATOM   520  N NZ    . LYS A 1 70  ? -1.147  12.605  59.189  1.00 37.06 ? 366  LYS A NZ    1 
ATOM   521  N N     . LYS A 1 71  ? 0.054   14.272  52.267  1.00 36.32 ? 367  LYS A N     1 
ATOM   522  C CA    . LYS A 1 71  ? 0.135   14.642  50.871  1.00 36.00 ? 367  LYS A CA    1 
ATOM   523  C C     . LYS A 1 71  ? 1.171   15.705  50.650  1.00 35.59 ? 367  LYS A C     1 
ATOM   524  O O     . LYS A 1 71  ? 1.142   16.746  51.300  1.00 35.84 ? 367  LYS A O     1 
ATOM   525  C CB    . LYS A 1 71  ? -1.234  15.128  50.394  1.00 36.11 ? 367  LYS A CB    1 
ATOM   526  C CG    . LYS A 1 71  ? -2.321  14.073  50.542  1.00 36.15 ? 367  LYS A CG    1 
ATOM   527  C CD    . LYS A 1 71  ? -1.908  12.777  49.863  1.00 36.48 ? 367  LYS A CD    1 
ATOM   528  C CE    . LYS A 1 71  ? -2.895  11.674  50.091  1.00 37.07 ? 367  LYS A CE    1 
ATOM   529  N NZ    . LYS A 1 71  ? -2.359  10.371  49.590  1.00 37.78 ? 367  LYS A NZ    1 
ATOM   530  N N     . LYS A 1 72  ? 2.084   15.435  49.723  1.00 34.97 ? 368  LYS A N     1 
ATOM   531  C CA    . LYS A 1 72  ? 3.124   16.382  49.366  1.00 34.46 ? 368  LYS A CA    1 
ATOM   532  C C     . LYS A 1 72  ? 2.880   16.904  47.968  1.00 34.05 ? 368  LYS A C     1 
ATOM   533  O O     . LYS A 1 72  ? 2.471   16.165  47.074  1.00 33.91 ? 368  LYS A O     1 
ATOM   534  C CB    . LYS A 1 72  ? 4.506   15.736  49.423  1.00 34.46 ? 368  LYS A CB    1 
ATOM   535  C CG    . LYS A 1 72  ? 5.027   15.479  50.826  1.00 34.25 ? 368  LYS A CG    1 
ATOM   536  C CD    . LYS A 1 72  ? 4.244   14.361  51.523  1.00 34.29 ? 368  LYS A CD    1 
ATOM   537  C CE    . LYS A 1 72  ? 5.148   13.399  52.287  1.00 33.96 ? 368  LYS A CE    1 
ATOM   538  N NZ    . LYS A 1 72  ? 4.365   12.332  52.983  1.00 32.53 ? 368  LYS A NZ    1 
ATOM   539  N N     . SER A 1 73  ? 3.128   18.194  47.806  1.00 33.66 ? 369  SER A N     1 
ATOM   540  C CA    . SER A 1 73  ? 3.200   18.819  46.504  1.00 33.34 ? 369  SER A CA    1 
ATOM   541  C C     . SER A 1 73  ? 4.657   19.196  46.312  1.00 33.03 ? 369  SER A C     1 
ATOM   542  O O     . SER A 1 73  ? 5.274   19.734  47.221  1.00 32.76 ? 369  SER A O     1 
ATOM   543  C CB    . SER A 1 73  ? 2.295   20.043  46.464  1.00 33.38 ? 369  SER A CB    1 
ATOM   544  O OG    . SER A 1 73  ? 0.972   19.678  46.833  1.00 33.19 ? 369  SER A OG    1 
ATOM   545  N N     . MET A 1 74  ? 5.213   18.870  45.152  1.00 32.96 ? 370  MET A N     1 
ATOM   546  C CA    . MET A 1 74  ? 6.639   19.081  44.887  1.00 32.98 ? 370  MET A CA    1 
ATOM   547  C C     . MET A 1 74  ? 6.910   19.447  43.437  1.00 33.06 ? 370  MET A C     1 
ATOM   548  O O     . MET A 1 74  ? 6.027   19.395  42.584  1.00 33.09 ? 370  MET A O     1 
ATOM   549  C CB    . MET A 1 74  ? 7.433   17.817  45.208  1.00 32.94 ? 370  MET A CB    1 
ATOM   550  C CG    . MET A 1 74  ? 7.218   17.257  46.599  1.00 32.97 ? 370  MET A CG    1 
ATOM   551  S SD    . MET A 1 74  ? 8.414   15.974  47.040  1.00 32.59 ? 370  MET A SD    1 
ATOM   552  C CE    . MET A 1 74  ? 9.949   16.899  47.127  1.00 32.95 ? 370  MET A CE    1 
ATOM   553  N N     . PHE A 1 75  ? 8.154   19.823  43.174  1.00 33.12 ? 371  PHE A N     1 
ATOM   554  C CA    . PHE A 1 75  ? 8.646   20.001  41.813  1.00 33.14 ? 371  PHE A CA    1 
ATOM   555  C C     . PHE A 1 75  ? 9.802   19.024  41.624  1.00 33.11 ? 371  PHE A C     1 
ATOM   556  O O     . PHE A 1 75  ? 10.801  19.098  42.334  1.00 32.88 ? 371  PHE A O     1 
ATOM   557  C CB    . PHE A 1 75  ? 9.099   21.450  41.598  1.00 33.11 ? 371  PHE A CB    1 
ATOM   558  C CG    . PHE A 1 75  ? 9.689   21.725  40.231  1.00 32.88 ? 371  PHE A CG    1 
ATOM   559  C CD1   . PHE A 1 75  ? 11.040  21.489  39.979  1.00 32.97 ? 371  PHE A CD1   1 
ATOM   560  C CD2   . PHE A 1 75  ? 8.909   22.251  39.213  1.00 31.91 ? 371  PHE A CD2   1 
ATOM   561  C CE1   . PHE A 1 75  ? 11.591  21.753  38.733  1.00 32.33 ? 371  PHE A CE1   1 
ATOM   562  C CE2   . PHE A 1 75  ? 9.456   22.520  37.973  1.00 31.84 ? 371  PHE A CE2   1 
ATOM   563  C CZ    . PHE A 1 75  ? 10.799  22.267  37.733  1.00 32.18 ? 371  PHE A CZ    1 
ATOM   564  N N     . ASP A 1 76  ? 9.648   18.111  40.669  1.00 33.21 ? 372  ASP A N     1 
ATOM   565  C CA    . ASP A 1 76  ? 10.648  17.086  40.379  1.00 33.43 ? 372  ASP A CA    1 
ATOM   566  C C     . ASP A 1 76  ? 10.897  16.228  41.603  1.00 33.34 ? 372  ASP A C     1 
ATOM   567  O O     . ASP A 1 76  ? 11.980  16.250  42.194  1.00 33.01 ? 372  ASP A O     1 
ATOM   568  C CB    . ASP A 1 76  ? 11.967  17.696  39.890  1.00 33.71 ? 372  ASP A CB    1 
ATOM   569  C CG    . ASP A 1 76  ? 12.951  16.640  39.386  1.00 34.18 ? 372  ASP A CG    1 
ATOM   570  O OD1   . ASP A 1 76  ? 12.575  15.449  39.288  1.00 34.51 ? 372  ASP A OD1   1 
ATOM   571  O OD2   . ASP A 1 76  ? 14.108  17.004  39.086  1.00 35.15 ? 372  ASP A OD2   1 
ATOM   572  N N     . SER A 1 77  ? 9.872   15.470  41.967  1.00 33.39 ? 373  SER A N     1 
ATOM   573  C CA    . SER A 1 77  ? 9.915   14.609  43.149  1.00 33.40 ? 373  SER A CA    1 
ATOM   574  C C     . SER A 1 77  ? 10.827  13.412  42.964  1.00 33.40 ? 373  SER A C     1 
ATOM   575  O O     . SER A 1 77  ? 11.445  12.941  43.914  1.00 33.31 ? 373  SER A O     1 
ATOM   576  C CB    . SER A 1 77  ? 8.514   14.109  43.498  1.00 33.32 ? 373  SER A CB    1 
ATOM   577  O OG    . SER A 1 77  ? 7.858   13.624  42.350  1.00 32.98 ? 373  SER A OG    1 
ATOM   578  N N     . LYS A 1 78  ? 10.885  12.903  41.744  1.00 33.56 ? 374  LYS A N     1 
ATOM   579  C CA    . LYS A 1 78  ? 11.744  11.769  41.437  1.00 33.80 ? 374  LYS A CA    1 
ATOM   580  C C     . LYS A 1 78  ? 13.166  12.050  41.908  1.00 33.59 ? 374  LYS A C     1 
ATOM   581  O O     . LYS A 1 78  ? 13.816  11.189  42.492  1.00 33.55 ? 374  LYS A O     1 
ATOM   582  C CB    . LYS A 1 78  ? 11.715  11.463  39.934  1.00 34.08 ? 374  LYS A CB    1 
ATOM   583  C CG    . LYS A 1 78  ? 12.833  10.532  39.464  1.00 34.92 ? 374  LYS A CG    1 
ATOM   584  C CD    . LYS A 1 78  ? 12.457  9.729   38.216  1.00 35.62 ? 374  LYS A CD    1 
ATOM   585  C CE    . LYS A 1 78  ? 12.536  10.569  36.953  1.00 36.13 ? 374  LYS A CE    1 
ATOM   586  N NZ    . LYS A 1 78  ? 13.929  11.079  36.700  1.00 36.21 ? 374  LYS A NZ    1 
ATOM   587  N N     . ARG A 1 79  ? 13.633  13.264  41.653  1.00 33.47 ? 375  ARG A N     1 
ATOM   588  C CA    . ARG A 1 79  ? 14.936  13.708  42.127  1.00 33.43 ? 375  ARG A CA    1 
ATOM   589  C C     . ARG A 1 79  ? 15.081  13.426  43.612  1.00 33.11 ? 375  ARG A C     1 
ATOM   590  O O     . ARG A 1 79  ? 15.994  12.724  44.028  1.00 33.10 ? 375  ARG A O     1 
ATOM   591  C CB    . ARG A 1 79  ? 15.097  15.204  41.853  1.00 33.72 ? 375  ARG A CB    1 
ATOM   592  C CG    . ARG A 1 79  ? 16.384  15.849  42.356  1.00 34.00 ? 375  ARG A CG    1 
ATOM   593  C CD    . ARG A 1 79  ? 16.575  17.208  41.694  1.00 34.34 ? 375  ARG A CD    1 
ATOM   594  N NE    . ARG A 1 79  ? 17.262  17.075  40.415  1.00 34.90 ? 375  ARG A NE    1 
ATOM   595  C CZ    . ARG A 1 79  ? 18.580  17.157  40.249  1.00 36.18 ? 375  ARG A CZ    1 
ATOM   596  N NH1   . ARG A 1 79  ? 19.387  17.383  41.282  1.00 36.74 ? 375  ARG A NH1   1 
ATOM   597  N NH2   . ARG A 1 79  ? 19.101  17.011  39.038  1.00 36.60 ? 375  ARG A NH2   1 
ATOM   598  N N     . ALA A 1 80  ? 14.157  13.969  44.397  1.00 32.91 ? 376  ALA A N     1 
ATOM   599  C CA    . ALA A 1 80  ? 14.181  13.825  45.857  1.00 32.70 ? 376  ALA A CA    1 
ATOM   600  C C     . ALA A 1 80  ? 14.103  12.372  46.247  1.00 32.41 ? 376  ALA A C     1 
ATOM   601  O O     . ALA A 1 80  ? 14.984  11.857  46.932  1.00 32.40 ? 376  ALA A O     1 
ATOM   602  C CB    . ALA A 1 80  ? 13.022  14.583  46.498  1.00 32.73 ? 376  ALA A CB    1 
ATOM   603  N N     . ALA A 1 81  ? 13.075  11.690  45.797  1.00 32.18 ? 377  ALA A N     1 
ATOM   604  C CA    . ALA A 1 81  ? 12.865  10.340  46.244  1.00 31.98 ? 377  ALA A CA    1 
ATOM   605  C C     . ALA A 1 81  ? 14.030  9.449   45.930  1.00 31.68 ? 377  ALA A C     1 
ATOM   606  O O     . ALA A 1 81  ? 14.445  8.689   46.760  1.00 31.55 ? 377  ALA A O     1 
ATOM   607  C CB    . ALA A 1 81  ? 11.616  9.799   45.625  1.00 31.89 ? 377  ALA A CB    1 
ATOM   608  N N     . VAL A 1 82  ? 14.586  9.546   44.750  1.00 31.44 ? 378  VAL A N     1 
ATOM   609  C CA    . VAL A 1 82  ? 15.706  8.697   44.441  1.00 31.51 ? 378  VAL A CA    1 
ATOM   610  C C     . VAL A 1 82  ? 16.858  9.021   45.353  1.00 31.79 ? 378  VAL A C     1 
ATOM   611  O O     . VAL A 1 82  ? 17.614  8.165   45.750  1.00 31.86 ? 378  VAL A O     1 
ATOM   612  C CB    . VAL A 1 82  ? 16.159  8.868   43.037  1.00 31.40 ? 378  VAL A CB    1 
ATOM   613  C CG1   . VAL A 1 82  ? 17.615  9.109   43.023  1.00 31.51 ? 378  VAL A CG1   1 
ATOM   614  C CG2   . VAL A 1 82  ? 15.853  7.649   42.270  1.00 31.26 ? 378  VAL A CG2   1 
ATOM   615  N N     . ALA A 1 83  ? 17.020  10.295  45.634  1.00 32.11 ? 379  ALA A N     1 
ATOM   616  C CA    . ALA A 1 83  ? 18.077  10.758  46.504  1.00 32.13 ? 379  ALA A CA    1 
ATOM   617  C C     . ALA A 1 83  ? 17.888  10.241  47.901  1.00 32.16 ? 379  ALA A C     1 
ATOM   618  O O     . ALA A 1 83  ? 18.834  9.885   48.559  1.00 32.25 ? 379  ALA A O     1 
ATOM   619  C CB    . ALA A 1 83  ? 18.103  12.228  46.508  1.00 32.15 ? 379  ALA A CB    1 
ATOM   620  N N     . LEU A 1 84  ? 16.651  10.240  48.360  1.00 32.20 ? 380  LEU A N     1 
ATOM   621  C CA    . LEU A 1 84  ? 16.315  9.717   49.668  1.00 32.43 ? 380  LEU A CA    1 
ATOM   622  C C     . LEU A 1 84  ? 16.550  8.220   49.774  1.00 32.68 ? 380  LEU A C     1 
ATOM   623  O O     . LEU A 1 84  ? 17.053  7.753   50.758  1.00 32.54 ? 380  LEU A O     1 
ATOM   624  C CB    . LEU A 1 84  ? 14.869  10.058  50.021  1.00 32.48 ? 380  LEU A CB    1 
ATOM   625  C CG    . LEU A 1 84  ? 14.531  11.525  50.262  1.00 32.07 ? 380  LEU A CG    1 
ATOM   626  C CD1   . LEU A 1 84  ? 13.579  12.000  49.228  1.00 31.81 ? 380  LEU A CD1   1 
ATOM   627  C CD2   . LEU A 1 84  ? 13.943  11.711  51.592  1.00 30.92 ? 380  LEU A CD2   1 
ATOM   628  N N     . LYS A 1 85  ? 16.184  7.467   48.751  1.00 33.07 ? 381  LYS A N     1 
ATOM   629  C CA    . LYS A 1 85  ? 16.434  6.020   48.719  1.00 33.38 ? 381  LYS A CA    1 
ATOM   630  C C     . LYS A 1 85  ? 17.904  5.688   48.973  1.00 33.54 ? 381  LYS A C     1 
ATOM   631  O O     . LYS A 1 85  ? 18.214  4.674   49.585  1.00 33.66 ? 381  LYS A O     1 
ATOM   632  C CB    . LYS A 1 85  ? 16.039  5.413   47.374  1.00 33.53 ? 381  LYS A CB    1 
ATOM   633  C CG    . LYS A 1 85  ? 14.553  5.375   47.087  1.00 34.12 ? 381  LYS A CG    1 
ATOM   634  C CD    . LYS A 1 85  ? 14.269  4.591   45.805  1.00 34.53 ? 381  LYS A CD    1 
ATOM   635  C CE    . LYS A 1 85  ? 12.791  4.280   45.646  1.00 35.08 ? 381  LYS A CE    1 
ATOM   636  N NZ    . LYS A 1 85  ? 12.579  2.863   45.233  1.00 35.57 ? 381  LYS A NZ    1 
ATOM   637  N N     . TRP A 1 86  ? 18.811  6.537   48.502  1.00 33.72 ? 382  TRP A N     1 
ATOM   638  C CA    . TRP A 1 86  ? 20.241  6.348   48.778  1.00 33.88 ? 382  TRP A CA    1 
ATOM   639  C C     . TRP A 1 86  ? 20.609  6.541   50.250  1.00 33.79 ? 382  TRP A C     1 
ATOM   640  O O     . TRP A 1 86  ? 21.748  6.300   50.633  1.00 33.89 ? 382  TRP A O     1 
ATOM   641  C CB    . TRP A 1 86  ? 21.104  7.274   47.909  1.00 34.00 ? 382  TRP A CB    1 
ATOM   642  C CG    . TRP A 1 86  ? 21.222  6.803   46.504  1.00 34.15 ? 382  TRP A CG    1 
ATOM   643  C CD1   . TRP A 1 86  ? 20.435  7.163   45.466  1.00 34.42 ? 382  TRP A CD1   1 
ATOM   644  C CD2   . TRP A 1 86  ? 22.168  5.863   45.983  1.00 34.40 ? 382  TRP A CD2   1 
ATOM   645  N NE1   . TRP A 1 86  ? 20.827  6.519   44.327  1.00 34.33 ? 382  TRP A NE1   1 
ATOM   646  C CE2   . TRP A 1 86  ? 21.890  5.712   44.616  1.00 33.95 ? 382  TRP A CE2   1 
ATOM   647  C CE3   . TRP A 1 86  ? 23.226  5.137   46.541  1.00 35.09 ? 382  TRP A CE3   1 
ATOM   648  C CZ2   . TRP A 1 86  ? 22.624  4.870   43.792  1.00 34.28 ? 382  TRP A CZ2   1 
ATOM   649  C CZ3   . TRP A 1 86  ? 23.964  4.297   45.717  1.00 35.12 ? 382  TRP A CZ3   1 
ATOM   650  C CH2   . TRP A 1 86  ? 23.658  4.174   44.358  1.00 34.88 ? 382  TRP A CH2   1 
ATOM   651  N N     . LYS A 1 87  ? 19.657  6.993   51.059  1.00 33.77 ? 383  LYS A N     1 
ATOM   652  C CA    . LYS A 1 87  ? 19.839  7.125   52.506  1.00 33.77 ? 383  LYS A CA    1 
ATOM   653  C C     . LYS A 1 87  ? 18.898  6.210   53.308  1.00 33.59 ? 383  LYS A C     1 
ATOM   654  O O     . LYS A 1 87  ? 18.813  6.314   54.525  1.00 33.44 ? 383  LYS A O     1 
ATOM   655  C CB    . LYS A 1 87  ? 19.610  8.582   52.907  1.00 33.85 ? 383  LYS A CB    1 
ATOM   656  C CG    . LYS A 1 87  ? 20.668  9.536   52.379  1.00 34.34 ? 383  LYS A CG    1 
ATOM   657  C CD    . LYS A 1 87  ? 20.240  10.995  52.532  1.00 34.87 ? 383  LYS A CD    1 
ATOM   658  C CE    . LYS A 1 87  ? 21.430  11.918  52.766  1.00 35.14 ? 383  LYS A CE    1 
ATOM   659  N NZ    . LYS A 1 87  ? 22.520  11.722  51.766  1.00 35.58 ? 383  LYS A NZ    1 
ATOM   660  N N     . GLY A 1 88  ? 18.192  5.322   52.618  1.00 33.51 ? 384  GLY A N     1 
ATOM   661  C CA    . GLY A 1 88  ? 17.256  4.400   53.250  1.00 33.43 ? 384  GLY A CA    1 
ATOM   662  C C     . GLY A 1 88  ? 15.964  5.042   53.708  1.00 33.46 ? 384  GLY A C     1 
ATOM   663  O O     . GLY A 1 88  ? 15.473  4.736   54.787  1.00 33.58 ? 384  GLY A O     1 
ATOM   664  N N     . ILE A 1 89  ? 15.395  5.925   52.893  1.00 33.52 ? 385  ILE A N     1 
ATOM   665  C CA    . ILE A 1 89  ? 14.151  6.607   53.257  1.00 33.48 ? 385  ILE A CA    1 
ATOM   666  C C     . ILE A 1 89  ? 13.132  6.600   52.126  1.00 33.54 ? 385  ILE A C     1 
ATOM   667  O O     . ILE A 1 89  ? 13.447  7.002   51.011  1.00 33.33 ? 385  ILE A O     1 
ATOM   668  C CB    . ILE A 1 89  ? 14.416  8.069   53.640  1.00 33.46 ? 385  ILE A CB    1 
ATOM   669  C CG1   . ILE A 1 89  ? 15.444  8.157   54.782  1.00 33.25 ? 385  ILE A CG1   1 
ATOM   670  C CG2   . ILE A 1 89  ? 13.099  8.757   54.017  1.00 33.32 ? 385  ILE A CG2   1 
ATOM   671  C CD1   . ILE A 1 89  ? 16.442  9.271   54.619  1.00 32.84 ? 385  ILE A CD1   1 
ATOM   672  N N     . GLU A 1 90  ? 11.911  6.161   52.432  1.00 33.90 ? 386  GLU A N     1 
ATOM   673  C CA    . GLU A 1 90  ? 10.795  6.211   51.480  1.00 34.31 ? 386  GLU A CA    1 
ATOM   674  C C     . GLU A 1 90  ? 10.176  7.598   51.475  1.00 34.21 ? 386  GLU A C     1 
ATOM   675  O O     . GLU A 1 90  ? 9.962   8.190   52.534  1.00 34.40 ? 386  GLU A O     1 
ATOM   676  C CB    . GLU A 1 90  ? 9.692   5.200   51.832  1.00 34.48 ? 386  GLU A CB    1 
ATOM   677  C CG    . GLU A 1 90  ? 10.041  3.726   51.594  1.00 35.94 ? 386  GLU A CG    1 
ATOM   678  C CD    . GLU A 1 90  ? 10.507  3.426   50.170  1.00 37.81 ? 386  GLU A CD    1 
ATOM   679  O OE1   . GLU A 1 90  ? 9.726   3.655   49.217  1.00 38.72 ? 386  GLU A OE1   1 
ATOM   680  O OE2   . GLU A 1 90  ? 11.656  2.947   50.012  1.00 38.94 ? 386  GLU A OE2   1 
ATOM   681  N N     . LEU A 1 91  ? 9.907   8.115   50.281  1.00 34.00 ? 387  LEU A N     1 
ATOM   682  C CA    . LEU A 1 91  ? 9.127   9.330   50.122  1.00 33.84 ? 387  LEU A CA    1 
ATOM   683  C C     . LEU A 1 91  ? 7.831   8.910   49.470  1.00 33.72 ? 387  LEU A C     1 
ATOM   684  O O     . LEU A 1 91  ? 7.828   8.452   48.330  1.00 33.68 ? 387  LEU A O     1 
ATOM   685  C CB    . LEU A 1 91  ? 9.855   10.357  49.253  1.00 33.92 ? 387  LEU A CB    1 
ATOM   686  C CG    . LEU A 1 91  ? 9.089   11.641  48.880  1.00 33.89 ? 387  LEU A CG    1 
ATOM   687  C CD1   . LEU A 1 91  ? 8.497   12.340  50.092  1.00 33.68 ? 387  LEU A CD1   1 
ATOM   688  C CD2   . LEU A 1 91  ? 9.995   12.590  48.118  1.00 34.08 ? 387  LEU A CD2   1 
ATOM   689  N N     . CYS A 1 92  ? 6.736   9.046   50.207  1.00 33.52 ? 388  CYS A N     1 
ATOM   690  C CA    . CYS A 1 92  ? 5.429   8.663   49.714  1.00 33.37 ? 388  CYS A CA    1 
ATOM   691  C C     . CYS A 1 92  ? 4.446   9.801   49.884  1.00 33.16 ? 388  CYS A C     1 
ATOM   692  O O     . CYS A 1 92  ? 4.765   10.841  50.456  1.00 33.04 ? 388  CYS A O     1 
ATOM   693  C CB    . CYS A 1 92  ? 4.930   7.426   50.455  1.00 33.42 ? 388  CYS A CB    1 
ATOM   694  S SG    . CYS A 1 92  ? 6.057   6.026   50.353  1.00 33.77 ? 388  CYS A SG    1 
ATOM   695  N N     . GLY A 1 93  ? 3.250   9.592   49.351  1.00 33.07 ? 389  GLY A N     1 
ATOM   696  C CA    . GLY A 1 93  ? 2.162   10.548  49.480  1.00 32.94 ? 389  GLY A CA    1 
ATOM   697  C C     . GLY A 1 93  ? 2.255   11.732  48.542  1.00 32.75 ? 389  GLY A C     1 
ATOM   698  O O     . GLY A 1 93  ? 1.393   12.601  48.573  1.00 32.88 ? 389  GLY A O     1 
ATOM   699  N N     . VAL A 1 94  ? 3.286   11.775  47.702  1.00 32.60 ? 390  VAL A N     1 
ATOM   700  C CA    . VAL A 1 94  ? 3.431   12.870  46.745  1.00 32.50 ? 390  VAL A CA    1 
ATOM   701  C C     . VAL A 1 94  ? 2.267   12.765  45.767  1.00 32.41 ? 390  VAL A C     1 
ATOM   702  O O     . VAL A 1 94  ? 2.115   11.763  45.075  1.00 32.39 ? 390  VAL A O     1 
ATOM   703  C CB    . VAL A 1 94  ? 4.778   12.825  45.982  1.00 32.42 ? 390  VAL A CB    1 
ATOM   704  C CG1   . VAL A 1 94  ? 4.894   14.010  45.055  1.00 32.46 ? 390  VAL A CG1   1 
ATOM   705  C CG2   . VAL A 1 94  ? 5.945   12.821  46.944  1.00 32.47 ? 390  VAL A CG2   1 
ATOM   706  N N     . SER A 1 95  ? 1.429   13.788  45.744  1.00 32.34 ? 391  SER A N     1 
ATOM   707  C CA    . SER A 1 95  ? 0.224   13.751  44.945  1.00 32.43 ? 391  SER A CA    1 
ATOM   708  C C     . SER A 1 95  ? 0.161   14.871  43.930  1.00 32.59 ? 391  SER A C     1 
ATOM   709  O O     . SER A 1 95  ? -0.836  14.991  43.230  1.00 32.82 ? 391  SER A O     1 
ATOM   710  C CB    . SER A 1 95  ? -0.996  13.823  45.854  1.00 32.45 ? 391  SER A CB    1 
ATOM   711  O OG    . SER A 1 95  ? -1.043  15.065  46.531  1.00 32.64 ? 391  SER A OG    1 
ATOM   712  N N     . PHE A 1 96  ? 1.196   15.702  43.851  1.00 32.72 ? 392  PHE A N     1 
ATOM   713  C CA    . PHE A 1 96  ? 1.256   16.731  42.811  1.00 32.84 ? 392  PHE A CA    1 
ATOM   714  C C     . PHE A 1 96  ? 2.677   17.147  42.490  1.00 32.66 ? 392  PHE A C     1 
ATOM   715  O O     . PHE A 1 96  ? 3.307   17.863  43.262  1.00 32.38 ? 392  PHE A O     1 
ATOM   716  C CB    . PHE A 1 96  ? 0.444   17.969  43.199  1.00 33.04 ? 392  PHE A CB    1 
ATOM   717  C CG    . PHE A 1 96  ? 0.560   19.102  42.207  1.00 33.52 ? 392  PHE A CG    1 
ATOM   718  C CD1   . PHE A 1 96  ? -0.141  19.069  41.009  1.00 33.46 ? 392  PHE A CD1   1 
ATOM   719  C CD2   . PHE A 1 96  ? 1.384   20.194  42.467  1.00 34.04 ? 392  PHE A CD2   1 
ATOM   720  C CE1   . PHE A 1 96  ? -0.024  20.105  40.091  1.00 33.57 ? 392  PHE A CE1   1 
ATOM   721  C CE2   . PHE A 1 96  ? 1.505   21.233  41.551  1.00 33.88 ? 392  PHE A CE2   1 
ATOM   722  C CZ    . PHE A 1 96  ? 0.801   21.188  40.364  1.00 33.75 ? 392  PHE A CZ    1 
ATOM   723  N N     . ASP A 1 97  ? 3.161   16.713  41.331  1.00 32.72 ? 393  ASP A N     1 
ATOM   724  C CA    . ASP A 1 97  ? 4.467   17.134  40.846  1.00 32.83 ? 393  ASP A CA    1 
ATOM   725  C C     . ASP A 1 97  ? 4.317   18.276  39.836  1.00 32.73 ? 393  ASP A C     1 
ATOM   726  O O     . ASP A 1 97  ? 3.873   18.068  38.707  1.00 32.69 ? 393  ASP A O     1 
ATOM   727  C CB    . ASP A 1 97  ? 5.229   15.959  40.239  1.00 32.86 ? 393  ASP A CB    1 
ATOM   728  C CG    . ASP A 1 97  ? 6.708   16.248  40.099  1.00 33.20 ? 393  ASP A CG    1 
ATOM   729  O OD1   . ASP A 1 97  ? 7.049   17.402  39.761  1.00 32.91 ? 393  ASP A OD1   1 
ATOM   730  O OD2   . ASP A 1 97  ? 7.528   15.329  40.336  1.00 33.98 ? 393  ASP A OD2   1 
ATOM   731  N N     . LEU A 1 98  ? 4.698   19.481  40.259  1.00 32.63 ? 394  LEU A N     1 
ATOM   732  C CA    . LEU A 1 98  ? 4.554   20.692  39.441  1.00 32.41 ? 394  LEU A CA    1 
ATOM   733  C C     . LEU A 1 98  ? 5.357   20.642  38.153  1.00 32.31 ? 394  LEU A C     1 
ATOM   734  O O     . LEU A 1 98  ? 4.886   21.092  37.118  1.00 32.09 ? 394  LEU A O     1 
ATOM   735  C CB    . LEU A 1 98  ? 4.986   21.929  40.227  1.00 32.38 ? 394  LEU A CB    1 
ATOM   736  C CG    . LEU A 1 98  ? 4.913   23.265  39.477  1.00 32.06 ? 394  LEU A CG    1 
ATOM   737  C CD1   . LEU A 1 98  ? 3.485   23.557  39.057  1.00 32.09 ? 394  LEU A CD1   1 
ATOM   738  C CD2   . LEU A 1 98  ? 5.468   24.398  40.326  1.00 31.31 ? 394  LEU A CD2   1 
ATOM   739  N N     . LEU A 1 99  ? 6.582   20.131  38.227  1.00 32.34 ? 395  LEU A N     1 
ATOM   740  C CA    . LEU A 1 99  ? 7.409   19.961  37.035  1.00 32.26 ? 395  LEU A CA    1 
ATOM   741  C C     . LEU A 1 99  ? 6.660   19.177  35.983  1.00 32.18 ? 395  LEU A C     1 
ATOM   742  O O     . LEU A 1 99  ? 6.645   19.562  34.817  1.00 32.19 ? 395  LEU A O     1 
ATOM   743  C CB    . LEU A 1 99  ? 8.701   19.207  37.344  1.00 32.28 ? 395  LEU A CB    1 
ATOM   744  C CG    . LEU A 1 99  ? 9.489   18.793  36.093  1.00 32.13 ? 395  LEU A CG    1 
ATOM   745  C CD1   . LEU A 1 99  ? 9.869   20.024  35.294  1.00 31.72 ? 395  LEU A CD1   1 
ATOM   746  C CD2   . LEU A 1 99  ? 10.724  17.989  36.437  1.00 32.31 ? 395  LEU A CD2   1 
ATOM   747  N N     . LEU A 1 100 ? 6.070   18.059  36.396  1.00 32.05 ? 396  LEU A N     1 
ATOM   748  C CA    . LEU A 1 100 ? 5.286   17.229  35.483  1.00 31.94 ? 396  LEU A CA    1 
ATOM   749  C C     . LEU A 1 100 ? 4.071   17.997  34.944  1.00 31.82 ? 396  LEU A C     1 
ATOM   750  O O     . LEU A 1 100 ? 3.767   17.919  33.754  1.00 31.56 ? 396  LEU A O     1 
ATOM   751  C CB    . LEU A 1 100 ? 4.865   15.914  36.158  1.00 31.92 ? 396  LEU A CB    1 
ATOM   752  C CG    . LEU A 1 100 ? 6.002   14.943  36.536  1.00 31.85 ? 396  LEU A CG    1 
ATOM   753  C CD1   . LEU A 1 100 ? 5.462   13.623  37.075  1.00 31.53 ? 396  LEU A CD1   1 
ATOM   754  C CD2   . LEU A 1 100 ? 6.936   14.671  35.365  1.00 31.60 ? 396  LEU A CD2   1 
ATOM   755  N N     . ALA A 1 101 ? 3.414   18.762  35.815  1.00 31.77 ? 397  ALA A N     1 
ATOM   756  C CA    . ALA A 1 101 ? 2.271   19.593  35.423  1.00 31.75 ? 397  ALA A CA    1 
ATOM   757  C C     . ALA A 1 101 ? 2.634   20.635  34.365  1.00 31.87 ? 397  ALA A C     1 
ATOM   758  O O     . ALA A 1 101 ? 1.834   20.917  33.491  1.00 31.93 ? 397  ALA A O     1 
ATOM   759  C CB    . ALA A 1 101 ? 1.670   20.270  36.639  1.00 31.69 ? 397  ALA A CB    1 
ATOM   760  N N     . ALA A 1 102 ? 3.834   21.205  34.455  1.00 32.18 ? 398  ALA A N     1 
ATOM   761  C CA    . ALA A 1 102 ? 4.329   22.180  33.468  1.00 32.30 ? 398  ALA A CA    1 
ATOM   762  C C     . ALA A 1 102 ? 4.671   21.512  32.143  1.00 32.58 ? 398  ALA A C     1 
ATOM   763  O O     . ALA A 1 102 ? 4.293   21.984  31.075  1.00 32.63 ? 398  ALA A O     1 
ATOM   764  C CB    . ALA A 1 102 ? 5.550   22.894  34.006  1.00 32.26 ? 398  ALA A CB    1 
ATOM   765  N N     . TYR A 1 103 ? 5.403   20.412  32.222  1.00 32.99 ? 399  TYR A N     1 
ATOM   766  C CA    . TYR A 1 103 ? 5.786   19.646  31.037  1.00 33.26 ? 399  TYR A CA    1 
ATOM   767  C C     . TYR A 1 103 ? 4.593   19.223  30.184  1.00 33.17 ? 399  TYR A C     1 
ATOM   768  O O     . TYR A 1 103 ? 4.649   19.304  28.962  1.00 33.26 ? 399  TYR A O     1 
ATOM   769  C CB    . TYR A 1 103 ? 6.577   18.412  31.455  1.00 33.37 ? 399  TYR A CB    1 
ATOM   770  C CG    . TYR A 1 103 ? 6.795   17.413  30.352  1.00 33.65 ? 399  TYR A CG    1 
ATOM   771  C CD1   . TYR A 1 103 ? 7.694   17.671  29.329  1.00 33.98 ? 399  TYR A CD1   1 
ATOM   772  C CD2   . TYR A 1 103 ? 6.114   16.203  30.340  1.00 34.46 ? 399  TYR A CD2   1 
ATOM   773  C CE1   . TYR A 1 103 ? 7.912   16.754  28.318  1.00 34.34 ? 399  TYR A CE1   1 
ATOM   774  C CE2   . TYR A 1 103 ? 6.322   15.275  29.328  1.00 34.86 ? 399  TYR A CE2   1 
ATOM   775  C CZ    . TYR A 1 103 ? 7.224   15.558  28.319  1.00 34.40 ? 399  TYR A CZ    1 
ATOM   776  O OH    . TYR A 1 103 ? 7.446   14.650  27.316  1.00 33.69 ? 399  TYR A OH    1 
ATOM   777  N N     . LEU A 1 104 ? 3.529   18.759  30.825  1.00 33.18 ? 400  LEU A N     1 
ATOM   778  C CA    . LEU A 1 104 ? 2.315   18.379  30.103  1.00 33.27 ? 400  LEU A CA    1 
ATOM   779  C C     . LEU A 1 104 ? 1.642   19.572  29.415  1.00 33.34 ? 400  LEU A C     1 
ATOM   780  O O     . LEU A 1 104 ? 1.189   19.449  28.273  1.00 33.40 ? 400  LEU A O     1 
ATOM   781  C CB    . LEU A 1 104 ? 1.317   17.682  31.034  1.00 33.24 ? 400  LEU A CB    1 
ATOM   782  C CG    . LEU A 1 104 ? 1.708   16.285  31.520  1.00 33.22 ? 400  LEU A CG    1 
ATOM   783  C CD1   . LEU A 1 104 ? 0.629   15.734  32.419  1.00 33.21 ? 400  LEU A CD1   1 
ATOM   784  C CD2   . LEU A 1 104 ? 1.957   15.335  30.369  1.00 33.38 ? 400  LEU A CD2   1 
ATOM   785  N N     . LEU A 1 105 ? 1.585   20.713  30.104  1.00 33.33 ? 401  LEU A N     1 
ATOM   786  C CA    . LEU A 1 105 ? 0.948   21.922  29.563  1.00 33.33 ? 401  LEU A CA    1 
ATOM   787  C C     . LEU A 1 105 ? 1.645   22.414  28.300  1.00 33.35 ? 401  LEU A C     1 
ATOM   788  O O     . LEU A 1 105 ? 0.998   22.684  27.297  1.00 33.23 ? 401  LEU A O     1 
ATOM   789  C CB    . LEU A 1 105 ? 0.928   23.050  30.601  1.00 33.22 ? 401  LEU A CB    1 
ATOM   790  C CG    . LEU A 1 105 ? -0.033  22.915  31.783  1.00 32.90 ? 401  LEU A CG    1 
ATOM   791  C CD1   . LEU A 1 105 ? -0.196  24.264  32.454  1.00 32.79 ? 401  LEU A CD1   1 
ATOM   792  C CD2   . LEU A 1 105 ? -1.388  22.372  31.362  1.00 32.97 ? 401  LEU A CD2   1 
ATOM   793  N N     . ASP A 1 106 ? 2.962   22.551  28.365  1.00 33.47 ? 402  ASP A N     1 
ATOM   794  C CA    . ASP A 1 106 ? 3.745   22.908  27.186  1.00 33.70 ? 402  ASP A CA    1 
ATOM   795  C C     . ASP A 1 106 ? 5.160   22.338  27.254  1.00 33.79 ? 402  ASP A C     1 
ATOM   796  O O     . ASP A 1 106 ? 6.037   22.926  27.886  1.00 33.83 ? 402  ASP A O     1 
ATOM   797  C CB    . ASP A 1 106 ? 3.807   24.425  27.000  1.00 33.66 ? 402  ASP A CB    1 
ATOM   798  C CG    . ASP A 1 106 ? 4.481   24.829  25.691  1.00 33.64 ? 402  ASP A CG    1 
ATOM   799  O OD1   . ASP A 1 106 ? 4.909   23.937  24.920  1.00 33.90 ? 402  ASP A OD1   1 
ATOM   800  O OD2   . ASP A 1 106 ? 4.570   26.045  25.424  1.00 33.36 ? 402  ASP A OD2   1 
ATOM   801  N N     . PRO A 1 107 ? 5.393   21.207  26.569  1.00 33.89 ? 403  PRO A N     1 
ATOM   802  C CA    . PRO A 1 107 ? 6.729   20.630  26.515  1.00 34.03 ? 403  PRO A CA    1 
ATOM   803  C C     . PRO A 1 107 ? 7.787   21.612  25.991  1.00 34.16 ? 403  PRO A C     1 
ATOM   804  O O     . PRO A 1 107 ? 8.965   21.500  26.340  1.00 34.11 ? 403  PRO A O     1 
ATOM   805  C CB    . PRO A 1 107 ? 6.561   19.457  25.542  1.00 34.13 ? 403  PRO A CB    1 
ATOM   806  C CG    . PRO A 1 107 ? 5.111   19.153  25.541  1.00 33.95 ? 403  PRO A CG    1 
ATOM   807  C CD    . PRO A 1 107 ? 4.428   20.442  25.760  1.00 33.90 ? 403  PRO A CD    1 
ATOM   808  N N     . ALA A 1 108 ? 7.358   22.567  25.169  1.00 34.19 ? 404  ALA A N     1 
ATOM   809  C CA    . ALA A 1 108 ? 8.269   23.537  24.560  1.00 34.20 ? 404  ALA A CA    1 
ATOM   810  C C     . ALA A 1 108 ? 8.882   24.540  25.550  1.00 34.29 ? 404  ALA A C     1 
ATOM   811  O O     . ALA A 1 108 ? 10.015  24.970  25.351  1.00 34.35 ? 404  ALA A O     1 
ATOM   812  C CB    . ALA A 1 108 ? 7.565   24.281  23.423  1.00 34.09 ? 404  ALA A CB    1 
ATOM   813  N N     . GLN A 1 109 ? 8.160   24.903  26.613  1.00 34.35 ? 405  GLN A N     1 
ATOM   814  C CA    . GLN A 1 109 ? 8.642   25.926  27.567  1.00 34.43 ? 405  GLN A CA    1 
ATOM   815  C C     . GLN A 1 109 ? 10.001  25.614  28.206  1.00 34.30 ? 405  GLN A C     1 
ATOM   816  O O     . GLN A 1 109 ? 10.599  26.481  28.841  1.00 34.24 ? 405  GLN A O     1 
ATOM   817  C CB    . GLN A 1 109 ? 7.628   26.151  28.700  1.00 34.52 ? 405  GLN A CB    1 
ATOM   818  C CG    . GLN A 1 109 ? 6.353   26.860  28.299  1.00 34.88 ? 405  GLN A CG    1 
ATOM   819  C CD    . GLN A 1 109 ? 6.582   28.272  27.777  1.00 35.78 ? 405  GLN A CD    1 
ATOM   820  O OE1   . GLN A 1 109 ? 7.190   29.116  28.445  1.00 36.06 ? 405  GLN A OE1   1 
ATOM   821  N NE2   . GLN A 1 109 ? 6.081   28.539  26.575  1.00 36.44 ? 405  GLN A NE2   1 
ATOM   822  N N     . GLY A 1 110 ? 10.459  24.371  28.075  1.00 34.16 ? 406  GLY A N     1 
ATOM   823  C CA    . GLY A 1 110 ? 11.715  23.941  28.675  1.00 34.01 ? 406  GLY A CA    1 
ATOM   824  C C     . GLY A 1 110 ? 11.757  24.173  30.173  1.00 33.84 ? 406  GLY A C     1 
ATOM   825  O O     . GLY A 1 110 ? 12.826  24.411  30.736  1.00 34.08 ? 406  GLY A O     1 
ATOM   826  N N     . VAL A 1 111 ? 10.596  24.111  30.818  1.00 33.54 ? 407  VAL A N     1 
ATOM   827  C CA    . VAL A 1 111 ? 10.516  24.296  32.256  1.00 33.56 ? 407  VAL A CA    1 
ATOM   828  C C     . VAL A 1 111 ? 11.494  23.344  32.914  1.00 33.62 ? 407  VAL A C     1 
ATOM   829  O O     . VAL A 1 111 ? 11.381  22.138  32.740  1.00 33.71 ? 407  VAL A O     1 
ATOM   830  C CB    . VAL A 1 111 ? 9.105   23.983  32.796  1.00 33.63 ? 407  VAL A CB    1 
ATOM   831  C CG1   . VAL A 1 111 ? 9.106   23.942  34.325  1.00 33.23 ? 407  VAL A CG1   1 
ATOM   832  C CG2   . VAL A 1 111 ? 8.099   24.998  32.283  1.00 33.67 ? 407  VAL A CG2   1 
ATOM   833  N N     . ASP A 1 112 ? 12.467  23.886  33.637  1.00 33.75 ? 408  ASP A N     1 
ATOM   834  C CA    . ASP A 1 112 ? 13.441  23.054  34.355  1.00 33.95 ? 408  ASP A CA    1 
ATOM   835  C C     . ASP A 1 112 ? 13.749  23.552  35.766  1.00 33.82 ? 408  ASP A C     1 
ATOM   836  O O     . ASP A 1 112 ? 14.706  23.107  36.393  1.00 33.69 ? 408  ASP A O     1 
ATOM   837  C CB    . ASP A 1 112 ? 14.732  22.911  33.536  1.00 34.00 ? 408  ASP A CB    1 
ATOM   838  C CG    . ASP A 1 112 ? 15.353  24.246  33.160  1.00 34.53 ? 408  ASP A CG    1 
ATOM   839  O OD1   . ASP A 1 112 ? 15.086  25.277  33.821  1.00 34.24 ? 408  ASP A OD1   1 
ATOM   840  O OD2   . ASP A 1 112 ? 16.128  24.252  32.183  1.00 35.91 ? 408  ASP A OD2   1 
ATOM   841  N N     . ASP A 1 113 ? 12.933  24.478  36.249  1.00 33.81 ? 409  ASP A N     1 
ATOM   842  C CA    . ASP A 1 113 ? 13.033  24.964  37.616  1.00 33.88 ? 409  ASP A CA    1 
ATOM   843  C C     . ASP A 1 113 ? 11.665  25.491  38.048  1.00 33.48 ? 409  ASP A C     1 
ATOM   844  O O     . ASP A 1 113 ? 10.710  25.483  37.269  1.00 33.35 ? 409  ASP A O     1 
ATOM   845  C CB    . ASP A 1 113 ? 14.149  26.021  37.754  1.00 34.09 ? 409  ASP A CB    1 
ATOM   846  C CG    . ASP A 1 113 ? 13.751  27.398  37.231  1.00 35.19 ? 409  ASP A CG    1 
ATOM   847  O OD1   . ASP A 1 113 ? 12.716  27.528  36.543  1.00 37.01 ? 409  ASP A OD1   1 
ATOM   848  O OD2   . ASP A 1 113 ? 14.487  28.366  37.516  1.00 36.62 ? 409  ASP A OD2   1 
ATOM   849  N N     . VAL A 1 114 ? 11.570  25.948  39.284  1.00 33.10 ? 410  VAL A N     1 
ATOM   850  C CA    . VAL A 1 114 ? 10.286  26.395  39.804  1.00 32.82 ? 410  VAL A CA    1 
ATOM   851  C C     . VAL A 1 114 ? 9.899   27.745  39.199  1.00 32.50 ? 410  VAL A C     1 
ATOM   852  O O     . VAL A 1 114 ? 8.731   27.991  38.897  1.00 32.58 ? 410  VAL A O     1 
ATOM   853  C CB    . VAL A 1 114 ? 10.296  26.479  41.330  1.00 32.81 ? 410  VAL A CB    1 
ATOM   854  C CG1   . VAL A 1 114 ? 8.867   26.549  41.852  1.00 32.79 ? 410  VAL A CG1   1 
ATOM   855  C CG2   . VAL A 1 114 ? 10.998  25.255  41.914  1.00 33.17 ? 410  VAL A CG2   1 
ATOM   856  N N     . ALA A 1 115 ? 10.892  28.608  39.015  1.00 32.14 ? 411  ALA A N     1 
ATOM   857  C CA    . ALA A 1 115 ? 10.687  29.922  38.414  1.00 31.78 ? 411  ALA A CA    1 
ATOM   858  C C     . ALA A 1 115 ? 10.108  29.800  37.012  1.00 31.54 ? 411  ALA A C     1 
ATOM   859  O O     . ALA A 1 115 ? 9.141   30.480  36.670  1.00 31.60 ? 411  ALA A O     1 
ATOM   860  C CB    . ALA A 1 115 ? 11.995  30.680  38.371  1.00 31.77 ? 411  ALA A CB    1 
ATOM   861  N N     . ALA A 1 116 ? 10.700  28.921  36.210  1.00 31.26 ? 412  ALA A N     1 
ATOM   862  C CA    . ALA A 1 116 ? 10.255  28.697  34.831  1.00 31.11 ? 412  ALA A CA    1 
ATOM   863  C C     . ALA A 1 116 ? 8.795   28.271  34.806  1.00 31.02 ? 412  ALA A C     1 
ATOM   864  O O     . ALA A 1 116 ? 8.000   28.773  34.014  1.00 30.87 ? 412  ALA A O     1 
ATOM   865  C CB    . ALA A 1 116 ? 11.116  27.650  34.149  1.00 30.97 ? 412  ALA A CB    1 
ATOM   866  N N     . ALA A 1 117 ? 8.454   27.344  35.690  1.00 31.07 ? 413  ALA A N     1 
ATOM   867  C CA    . ALA A 1 117 ? 7.077   26.897  35.839  1.00 31.12 ? 413  ALA A CA    1 
ATOM   868  C C     . ALA A 1 117 ? 6.200   28.047  36.307  1.00 31.18 ? 413  ALA A C     1 
ATOM   869  O O     . ALA A 1 117 ? 5.068   28.196  35.854  1.00 30.85 ? 413  ALA A O     1 
ATOM   870  C CB    . ALA A 1 117 ? 7.010   25.754  36.833  1.00 31.13 ? 413  ALA A CB    1 
ATOM   871  N N     . ALA A 1 118 ? 6.748   28.849  37.219  1.00 31.47 ? 414  ALA A N     1 
ATOM   872  C CA    . ALA A 1 118 ? 6.036   29.970  37.841  1.00 31.73 ? 414  ALA A CA    1 
ATOM   873  C C     . ALA A 1 118 ? 5.683   31.056  36.832  1.00 31.99 ? 414  ALA A C     1 
ATOM   874  O O     . ALA A 1 118 ? 4.520   31.449  36.713  1.00 31.99 ? 414  ALA A O     1 
ATOM   875  C CB    . ALA A 1 118 ? 6.865   30.561  38.968  1.00 31.58 ? 414  ALA A CB    1 
ATOM   876  N N     . LYS A 1 119 ? 6.686   31.530  36.098  1.00 32.33 ? 415  LYS A N     1 
ATOM   877  C CA    . LYS A 1 119 ? 6.468   32.561  35.074  1.00 32.69 ? 415  LYS A CA    1 
ATOM   878  C C     . LYS A 1 119 ? 5.258   32.270  34.192  1.00 33.16 ? 415  LYS A C     1 
ATOM   879  O O     . LYS A 1 119 ? 4.565   33.192  33.773  1.00 33.30 ? 415  LYS A O     1 
ATOM   880  C CB    . LYS A 1 119 ? 7.700   32.744  34.176  1.00 32.58 ? 415  LYS A CB    1 
ATOM   881  C CG    . LYS A 1 119 ? 8.375   34.102  34.320  1.00 32.56 ? 415  LYS A CG    1 
ATOM   882  C CD    . LYS A 1 119 ? 9.158   34.487  33.067  1.00 32.37 ? 415  LYS A CD    1 
ATOM   883  N N     . MET A 1 120 ? 5.025   30.990  33.907  1.00 33.69 ? 416  MET A N     1 
ATOM   884  C CA    . MET A 1 120 ? 3.877   30.559  33.110  1.00 34.04 ? 416  MET A CA    1 
ATOM   885  C C     . MET A 1 120 ? 2.548   31.027  33.685  1.00 34.05 ? 416  MET A C     1 
ATOM   886  O O     . MET A 1 120 ? 1.575   31.129  32.954  1.00 34.13 ? 416  MET A O     1 
ATOM   887  C CB    . MET A 1 120 ? 3.830   29.036  32.995  1.00 34.39 ? 416  MET A CB    1 
ATOM   888  C CG    . MET A 1 120 ? 5.023   28.390  32.295  1.00 35.33 ? 416  MET A CG    1 
ATOM   889  S SD    . MET A 1 120 ? 4.826   26.588  32.110  1.00 37.57 ? 416  MET A SD    1 
ATOM   890  C CE    . MET A 1 120 ? 3.156   26.463  31.444  1.00 36.40 ? 416  MET A CE    1 
ATOM   891  N N     . LYS A 1 121 ? 2.497   31.279  34.987  1.00 34.18 ? 417  LYS A N     1 
ATOM   892  C CA    . LYS A 1 121 ? 1.291   31.815  35.613  1.00 34.49 ? 417  LYS A CA    1 
ATOM   893  C C     . LYS A 1 121 ? 1.564   33.152  36.304  1.00 34.66 ? 417  LYS A C     1 
ATOM   894  O O     . LYS A 1 121 ? 1.037   33.434  37.382  1.00 34.49 ? 417  LYS A O     1 
ATOM   895  C CB    . LYS A 1 121 ? 0.718   30.802  36.603  1.00 34.64 ? 417  LYS A CB    1 
ATOM   896  C CG    . LYS A 1 121 ? 0.103   29.565  35.958  1.00 34.77 ? 417  LYS A CG    1 
ATOM   897  C CD    . LYS A 1 121 ? -1.388  29.719  35.691  1.00 35.38 ? 417  LYS A CD    1 
ATOM   898  C CE    . LYS A 1 121 ? -2.080  28.355  35.597  1.00 35.90 ? 417  LYS A CE    1 
ATOM   899  N NZ    . LYS A 1 121 ? -1.638  27.568  34.409  1.00 35.87 ? 417  LYS A NZ    1 
ATOM   900  N N     . GLN A 1 122 ? 2.398   33.970  35.666  1.00 35.05 ? 418  GLN A N     1 
ATOM   901  C CA    . GLN A 1 122 ? 2.669   35.350  36.103  1.00 35.35 ? 418  GLN A CA    1 
ATOM   902  C C     . GLN A 1 122 ? 3.062   35.442  37.576  1.00 35.38 ? 418  GLN A C     1 
ATOM   903  O O     . GLN A 1 122 ? 2.755   36.428  38.248  1.00 35.24 ? 418  GLN A O     1 
ATOM   904  C CB    . GLN A 1 122 ? 1.453   36.245  35.847  1.00 35.58 ? 418  GLN A CB    1 
ATOM   905  C CG    . GLN A 1 122 ? 0.712   35.982  34.527  1.00 36.26 ? 418  GLN A CG    1 
ATOM   906  C CD    . GLN A 1 122 ? 1.566   36.228  33.303  1.00 36.76 ? 418  GLN A CD    1 
ATOM   907  O OE1   . GLN A 1 122 ? 2.390   37.151  33.277  1.00 37.42 ? 418  GLN A OE1   1 
ATOM   908  N NE2   . GLN A 1 122 ? 1.363   35.409  32.270  1.00 36.44 ? 418  GLN A NE2   1 
ATOM   909  N N     . TYR A 1 123 ? 3.736   34.400  38.059  1.00 35.55 ? 419  TYR A N     1 
ATOM   910  C CA    . TYR A 1 123 ? 4.269   34.341  39.411  1.00 35.62 ? 419  TYR A CA    1 
ATOM   911  C C     . TYR A 1 123 ? 5.782   34.542  39.300  1.00 35.85 ? 419  TYR A C     1 
ATOM   912  O O     . TYR A 1 123 ? 6.490   33.688  38.759  1.00 35.87 ? 419  TYR A O     1 
ATOM   913  C CB    . TYR A 1 123 ? 3.938   32.992  40.052  1.00 35.58 ? 419  TYR A CB    1 
ATOM   914  C CG    . TYR A 1 123 ? 4.216   32.903  41.541  1.00 35.65 ? 419  TYR A CG    1 
ATOM   915  C CD1   . TYR A 1 123 ? 5.519   32.903  42.024  1.00 35.88 ? 419  TYR A CD1   1 
ATOM   916  C CD2   . TYR A 1 123 ? 3.177   32.787  42.466  1.00 35.29 ? 419  TYR A CD2   1 
ATOM   917  C CE1   . TYR A 1 123 ? 5.786   32.813  43.384  1.00 36.05 ? 419  TYR A CE1   1 
ATOM   918  C CE2   . TYR A 1 123 ? 3.436   32.695  43.834  1.00 35.09 ? 419  TYR A CE2   1 
ATOM   919  C CZ    . TYR A 1 123 ? 4.746   32.709  44.285  1.00 35.43 ? 419  TYR A CZ    1 
ATOM   920  O OH    . TYR A 1 123 ? 5.039   32.618  45.628  1.00 35.32 ? 419  TYR A OH    1 
ATOM   921  N N     . GLU A 1 124 ? 6.260   35.678  39.807  1.00 36.07 ? 420  GLU A N     1 
ATOM   922  C CA    . GLU A 1 124 ? 7.677   36.058  39.738  1.00 36.19 ? 420  GLU A CA    1 
ATOM   923  C C     . GLU A 1 124 ? 8.355   36.137  41.110  1.00 35.89 ? 420  GLU A C     1 
ATOM   924  O O     . GLU A 1 124 ? 9.471   36.634  41.222  1.00 35.76 ? 420  GLU A O     1 
ATOM   925  C CB    . GLU A 1 124 ? 7.811   37.425  39.076  1.00 36.44 ? 420  GLU A CB    1 
ATOM   926  C CG    . GLU A 1 124 ? 7.039   37.595  37.788  1.00 37.62 ? 420  GLU A CG    1 
ATOM   927  C CD    . GLU A 1 124 ? 7.872   37.421  36.532  1.00 39.87 ? 420  GLU A CD    1 
ATOM   928  O OE1   . GLU A 1 124 ? 9.072   37.794  36.538  1.00 41.19 ? 420  GLU A OE1   1 
ATOM   929  O OE2   . GLU A 1 124 ? 7.308   36.938  35.523  1.00 41.23 ? 420  GLU A OE2   1 
ATOM   930  N N     . ALA A 1 125 ? 7.690   35.647  42.149  1.00 35.79 ? 421  ALA A N     1 
ATOM   931  C CA    . ALA A 1 125 ? 8.208   35.759  43.522  1.00 35.88 ? 421  ALA A CA    1 
ATOM   932  C C     . ALA A 1 125 ? 9.501   34.972  43.795  1.00 36.05 ? 421  ALA A C     1 
ATOM   933  O O     . ALA A 1 125 ? 10.232  35.294  44.729  1.00 36.17 ? 421  ALA A O     1 
ATOM   934  C CB    . ALA A 1 125 ? 7.143   35.359  44.523  1.00 35.64 ? 421  ALA A CB    1 
ATOM   935  N N     . VAL A 1 126 ? 9.786   33.958  42.985  1.00 36.16 ? 422  VAL A N     1 
ATOM   936  C CA    . VAL A 1 126 ? 10.930  33.072  43.220  1.00 36.18 ? 422  VAL A CA    1 
ATOM   937  C C     . VAL A 1 126 ? 11.993  33.239  42.150  1.00 36.33 ? 422  VAL A C     1 
ATOM   938  O O     . VAL A 1 126 ? 11.681  33.398  40.978  1.00 36.55 ? 422  VAL A O     1 
ATOM   939  C CB    . VAL A 1 126 ? 10.490  31.584  43.278  1.00 36.22 ? 422  VAL A CB    1 
ATOM   940  C CG1   . VAL A 1 126 ? 9.507   31.260  42.161  1.00 35.77 ? 422  VAL A CG1   1 
ATOM   941  C CG2   . VAL A 1 126 ? 11.694  30.656  43.218  1.00 36.32 ? 422  VAL A CG2   1 
ATOM   942  N N     . ARG A 1 127 ? 13.252  33.182  42.562  1.00 36.58 ? 423  ARG A N     1 
ATOM   943  C CA    . ARG A 1 127 ? 14.372  33.314  41.641  1.00 36.90 ? 423  ARG A CA    1 
ATOM   944  C C     . ARG A 1 127 ? 14.607  31.992  40.905  1.00 36.73 ? 423  ARG A C     1 
ATOM   945  O O     . ARG A 1 127 ? 14.172  30.935  41.370  1.00 36.73 ? 423  ARG A O     1 
ATOM   946  C CB    . ARG A 1 127 ? 15.637  33.719  42.401  1.00 37.23 ? 423  ARG A CB    1 
ATOM   947  C CG    . ARG A 1 127 ? 15.485  34.989  43.249  1.00 38.58 ? 423  ARG A CG    1 
ATOM   948  C CD    . ARG A 1 127 ? 16.740  35.266  44.063  1.00 40.39 ? 423  ARG A CD    1 
ATOM   949  N NE    . ARG A 1 127 ? 17.863  35.679  43.216  1.00 41.90 ? 423  ARG A NE    1 
ATOM   950  C CZ    . ARG A 1 127 ? 19.146  35.388  43.443  1.00 43.56 ? 423  ARG A CZ    1 
ATOM   951  N NH1   . ARG A 1 127 ? 19.513  34.659  44.497  1.00 43.67 ? 423  ARG A NH1   1 
ATOM   952  N NH2   . ARG A 1 127 ? 20.076  35.819  42.593  1.00 44.42 ? 423  ARG A NH2   1 
ATOM   953  N N     . PRO A 1 128 ? 15.277  32.045  39.738  1.00 36.41 ? 424  PRO A N     1 
ATOM   954  C CA    . PRO A 1 128 ? 15.715  30.816  39.109  1.00 36.23 ? 424  PRO A CA    1 
ATOM   955  C C     . PRO A 1 128 ? 16.878  30.201  39.859  1.00 36.17 ? 424  PRO A C     1 
ATOM   956  O O     . PRO A 1 128 ? 17.598  30.897  40.567  1.00 35.94 ? 424  PRO A O     1 
ATOM   957  C CB    . PRO A 1 128 ? 16.162  31.272  37.720  1.00 36.13 ? 424  PRO A CB    1 
ATOM   958  C CG    . PRO A 1 128 ? 15.444  32.520  37.491  1.00 36.27 ? 424  PRO A CG    1 
ATOM   959  C CD    . PRO A 1 128 ? 15.411  33.183  38.820  1.00 36.40 ? 424  PRO A CD    1 
ATOM   960  N N     . ASP A 1 129 ? 17.047  28.897  39.694  1.00 36.35 ? 425  ASP A N     1 
ATOM   961  C CA    . ASP A 1 129 ? 18.068  28.160  40.420  1.00 36.58 ? 425  ASP A CA    1 
ATOM   962  C C     . ASP A 1 129 ? 19.453  28.544  39.889  1.00 36.79 ? 425  ASP A C     1 
ATOM   963  O O     . ASP A 1 129 ? 20.378  28.794  40.668  1.00 36.87 ? 425  ASP A O     1 
ATOM   964  C CB    . ASP A 1 129 ? 17.834  26.637  40.314  1.00 36.64 ? 425  ASP A CB    1 
ATOM   965  C CG    . ASP A 1 129 ? 16.502  26.171  40.967  1.00 36.49 ? 425  ASP A CG    1 
ATOM   966  O OD1   . ASP A 1 129 ? 15.978  26.848  41.873  1.00 36.68 ? 425  ASP A OD1   1 
ATOM   967  O OD2   . ASP A 1 129 ? 15.979  25.102  40.580  1.00 35.66 ? 425  ASP A OD2   1 
ATOM   968  N N     . GLU A 1 130 ? 19.585  28.622  38.565  1.00 36.97 ? 426  GLU A N     1 
ATOM   969  C CA    . GLU A 1 130 ? 20.857  29.018  37.929  1.00 37.19 ? 426  GLU A CA    1 
ATOM   970  C C     . GLU A 1 130 ? 21.368  30.353  38.481  1.00 36.91 ? 426  GLU A C     1 
ATOM   971  O O     . GLU A 1 130 ? 22.578  30.609  38.532  1.00 37.00 ? 426  GLU A O     1 
ATOM   972  C CB    . GLU A 1 130 ? 20.687  29.113  36.403  1.00 37.49 ? 426  GLU A CB    1 
ATOM   973  C CG    . GLU A 1 130 ? 21.985  29.415  35.632  1.00 38.58 ? 426  GLU A CG    1 
ATOM   974  C CD    . GLU A 1 130 ? 21.803  29.382  34.113  1.00 39.94 ? 426  GLU A CD    1 
ATOM   975  O OE1   . GLU A 1 130 ? 21.930  28.283  33.516  1.00 40.18 ? 426  GLU A OE1   1 
ATOM   976  O OE2   . GLU A 1 130 ? 21.555  30.463  33.521  1.00 40.43 ? 426  GLU A OE2   1 
ATOM   977  N N     . ALA A 1 131 ? 20.416  31.193  38.875  1.00 36.53 ? 427  ALA A N     1 
ATOM   978  C CA    . ALA A 1 131 ? 20.685  32.479  39.491  1.00 36.32 ? 427  ALA A CA    1 
ATOM   979  C C     . ALA A 1 131 ? 21.231  32.321  40.898  1.00 36.19 ? 427  ALA A C     1 
ATOM   980  O O     . ALA A 1 131 ? 22.131  33.050  41.304  1.00 36.40 ? 427  ALA A O     1 
ATOM   981  C CB    . ALA A 1 131 ? 19.413  33.301  39.527  1.00 36.35 ? 427  ALA A CB    1 
ATOM   982  N N     . VAL A 1 132 ? 20.665  31.391  41.651  1.00 35.94 ? 428  VAL A N     1 
ATOM   983  C CA    . VAL A 1 132 ? 21.093  31.180  43.027  1.00 35.80 ? 428  VAL A CA    1 
ATOM   984  C C     . VAL A 1 132 ? 22.419  30.437  43.146  1.00 35.94 ? 428  VAL A C     1 
ATOM   985  O O     . VAL A 1 132 ? 23.289  30.860  43.911  1.00 36.02 ? 428  VAL A O     1 
ATOM   986  C CB    . VAL A 1 132 ? 20.021  30.443  43.823  1.00 35.78 ? 428  VAL A CB    1 
ATOM   987  C CG1   . VAL A 1 132 ? 20.564  29.996  45.164  1.00 35.68 ? 428  VAL A CG1   1 
ATOM   988  C CG2   . VAL A 1 132 ? 18.816  31.348  44.023  1.00 35.73 ? 428  VAL A CG2   1 
ATOM   989  N N     . TYR A 1 133 ? 22.580  29.344  42.406  1.00 36.05 ? 429  TYR A N     1 
ATOM   990  C CA    . TYR A 1 133 ? 23.773  28.499  42.566  1.00 36.14 ? 429  TYR A CA    1 
ATOM   991  C C     . TYR A 1 133 ? 24.879  28.771  41.549  1.00 36.39 ? 429  TYR A C     1 
ATOM   992  O O     . TYR A 1 133 ? 25.938  28.148  41.610  1.00 36.18 ? 429  TYR A O     1 
ATOM   993  C CB    . TYR A 1 133 ? 23.396  27.023  42.498  1.00 36.07 ? 429  TYR A CB    1 
ATOM   994  C CG    . TYR A 1 133 ? 22.228  26.632  43.360  1.00 35.75 ? 429  TYR A CG    1 
ATOM   995  C CD1   . TYR A 1 133 ? 22.366  26.490  44.737  1.00 35.77 ? 429  TYR A CD1   1 
ATOM   996  C CD2   . TYR A 1 133 ? 20.988  26.381  42.794  1.00 35.43 ? 429  TYR A CD2   1 
ATOM   997  C CE1   . TYR A 1 133 ? 21.289  26.118  45.529  1.00 35.54 ? 429  TYR A CE1   1 
ATOM   998  C CE2   . TYR A 1 133 ? 19.912  26.011  43.568  1.00 35.43 ? 429  TYR A CE2   1 
ATOM   999  C CZ    . TYR A 1 133 ? 20.062  25.879  44.938  1.00 35.51 ? 429  TYR A CZ    1 
ATOM   1000 O OH    . TYR A 1 133 ? 18.981  25.506  45.709  1.00 34.12 ? 429  TYR A OH    1 
ATOM   1001 N N     . GLY A 1 134 ? 24.634  29.693  40.622  1.00 36.74 ? 430  GLY A N     1 
ATOM   1002 C CA    . GLY A 1 134 ? 25.616  30.020  39.594  1.00 37.10 ? 430  GLY A CA    1 
ATOM   1003 C C     . GLY A 1 134 ? 25.684  28.942  38.535  1.00 37.34 ? 430  GLY A C     1 
ATOM   1004 O O     . GLY A 1 134 ? 24.801  28.088  38.462  1.00 37.46 ? 430  GLY A O     1 
ATOM   1005 N N     . LYS A 1 135 ? 26.726  28.987  37.710  1.00 37.74 ? 431  LYS A N     1 
ATOM   1006 C CA    . LYS A 1 135 ? 26.926  27.974  36.663  1.00 38.13 ? 431  LYS A CA    1 
ATOM   1007 C C     . LYS A 1 135 ? 28.398  27.569  36.513  1.00 38.49 ? 431  LYS A C     1 
ATOM   1008 O O     . LYS A 1 135 ? 29.309  28.380  36.742  1.00 38.73 ? 431  LYS A O     1 
ATOM   1009 C CB    . LYS A 1 135 ? 26.384  28.478  35.318  1.00 37.97 ? 431  LYS A CB    1 
ATOM   1010 N N     . GLY A 1 136 ? 28.618  26.312  36.128  1.00 38.79 ? 432  GLY A N     1 
ATOM   1011 C CA    . GLY A 1 136 ? 29.968  25.807  35.829  1.00 39.03 ? 432  GLY A CA    1 
ATOM   1012 C C     . GLY A 1 136 ? 30.957  25.764  36.996  1.00 39.16 ? 432  GLY A C     1 
ATOM   1013 O O     . GLY A 1 136 ? 30.671  25.165  38.039  1.00 39.36 ? 432  GLY A O     1 
ATOM   1014 N N     . ALA A 1 137 ? 32.125  26.391  36.803  1.00 39.22 ? 433  ALA A N     1 
ATOM   1015 C CA    . ALA A 1 137 ? 33.235  26.362  37.780  1.00 39.21 ? 433  ALA A CA    1 
ATOM   1016 C C     . ALA A 1 137 ? 32.927  27.120  39.077  1.00 39.23 ? 433  ALA A C     1 
ATOM   1017 O O     . ALA A 1 137 ? 33.270  26.657  40.166  1.00 39.23 ? 433  ALA A O     1 
ATOM   1018 C CB    . ALA A 1 137 ? 34.522  26.912  37.142  1.00 39.15 ? 433  ALA A CB    1 
ATOM   1019 N N     . LYS A 1 138 ? 32.278  28.279  38.955  1.00 39.29 ? 434  LYS A N     1 
ATOM   1020 C CA    . LYS A 1 138 ? 31.938  29.109  40.124  1.00 39.51 ? 434  LYS A CA    1 
ATOM   1021 C C     . LYS A 1 138 ? 30.609  28.701  40.809  1.00 39.69 ? 434  LYS A C     1 
ATOM   1022 O O     . LYS A 1 138 ? 30.155  29.363  41.757  1.00 39.67 ? 434  LYS A O     1 
ATOM   1023 C CB    . LYS A 1 138 ? 31.898  30.589  39.717  1.00 39.45 ? 434  LYS A CB    1 
ATOM   1024 N N     . ARG A 1 139 ? 29.999  27.616  40.324  1.00 39.77 ? 435  ARG A N     1 
ATOM   1025 C CA    . ARG A 1 139 ? 28.772  27.074  40.904  1.00 39.87 ? 435  ARG A CA    1 
ATOM   1026 C C     . ARG A 1 139 ? 29.023  26.653  42.343  1.00 39.53 ? 435  ARG A C     1 
ATOM   1027 O O     . ARG A 1 139 ? 29.992  25.945  42.625  1.00 39.54 ? 435  ARG A O     1 
ATOM   1028 C CB    . ARG A 1 139 ? 28.296  25.877  40.086  1.00 40.18 ? 435  ARG A CB    1 
ATOM   1029 C CG    . ARG A 1 139 ? 26.914  25.353  40.426  1.00 41.17 ? 435  ARG A CG    1 
ATOM   1030 C CD    . ARG A 1 139 ? 26.432  24.438  39.311  1.00 42.70 ? 435  ARG A CD    1 
ATOM   1031 N NE    . ARG A 1 139 ? 25.942  23.168  39.833  1.00 44.64 ? 435  ARG A NE    1 
ATOM   1032 C CZ    . ARG A 1 139 ? 24.666  22.781  39.864  1.00 46.81 ? 435  ARG A CZ    1 
ATOM   1033 N NH1   . ARG A 1 139 ? 23.689  23.552  39.381  1.00 47.54 ? 435  ARG A NH1   1 
ATOM   1034 N NH2   . ARG A 1 139 ? 24.363  21.592  40.377  1.00 47.53 ? 435  ARG A NH2   1 
ATOM   1035 N N     . ALA A 1 140 ? 28.153  27.098  43.245  1.00 39.26 ? 436  ALA A N     1 
ATOM   1036 C CA    . ALA A 1 140 ? 28.330  26.843  44.675  1.00 39.04 ? 436  ALA A CA    1 
ATOM   1037 C C     . ALA A 1 140 ? 27.024  26.985  45.460  1.00 38.82 ? 436  ALA A C     1 
ATOM   1038 O O     . ALA A 1 140 ? 26.062  27.609  44.992  1.00 38.80 ? 436  ALA A O     1 
ATOM   1039 C CB    . ALA A 1 140 ? 29.405  27.779  45.247  1.00 38.93 ? 436  ALA A CB    1 
ATOM   1040 N N     . VAL A 1 141 ? 27.014  26.384  46.650  1.00 38.55 ? 437  VAL A N     1 
ATOM   1041 C CA    . VAL A 1 141 ? 25.894  26.483  47.580  1.00 38.35 ? 437  VAL A CA    1 
ATOM   1042 C C     . VAL A 1 141 ? 26.144  27.692  48.452  1.00 38.33 ? 437  VAL A C     1 
ATOM   1043 O O     . VAL A 1 141 ? 27.222  27.819  49.023  1.00 38.53 ? 437  VAL A O     1 
ATOM   1044 C CB    . VAL A 1 141 ? 25.788  25.256  48.501  1.00 38.31 ? 437  VAL A CB    1 
ATOM   1045 C CG1   . VAL A 1 141 ? 24.507  25.322  49.308  1.00 38.26 ? 437  VAL A CG1   1 
ATOM   1046 C CG2   . VAL A 1 141 ? 25.842  23.965  47.691  1.00 38.49 ? 437  VAL A CG2   1 
ATOM   1047 N N     . PRO A 1 142 ? 25.154  28.587  48.568  1.00 38.34 ? 438  PRO A N     1 
ATOM   1048 C CA    . PRO A 1 142 ? 25.381  29.797  49.345  1.00 38.38 ? 438  PRO A CA    1 
ATOM   1049 C C     . PRO A 1 142 ? 25.199  29.569  50.839  1.00 38.30 ? 438  PRO A C     1 
ATOM   1050 O O     . PRO A 1 142 ? 24.875  28.464  51.263  1.00 38.28 ? 438  PRO A O     1 
ATOM   1051 C CB    . PRO A 1 142 ? 24.307  30.744  48.816  1.00 38.50 ? 438  PRO A CB    1 
ATOM   1052 C CG    . PRO A 1 142 ? 23.172  29.835  48.467  1.00 38.54 ? 438  PRO A CG    1 
ATOM   1053 C CD    . PRO A 1 142 ? 23.802  28.557  47.979  1.00 38.38 ? 438  PRO A CD    1 
ATOM   1054 N N     . ASP A 1 143 ? 25.402  30.625  51.619  1.00 38.41 ? 439  ASP A N     1 
ATOM   1055 C CA    . ASP A 1 143 ? 25.275  30.553  53.081  1.00 38.52 ? 439  ASP A CA    1 
ATOM   1056 C C     . ASP A 1 143 ? 23.808  30.375  53.484  1.00 38.07 ? 439  ASP A C     1 
ATOM   1057 O O     . ASP A 1 143 ? 22.902  30.848  52.794  1.00 38.17 ? 439  ASP A O     1 
ATOM   1058 C CB    . ASP A 1 143 ? 25.872  31.803  53.745  1.00 38.78 ? 439  ASP A CB    1 
ATOM   1059 C CG    . ASP A 1 143 ? 27.296  32.100  53.271  1.00 39.92 ? 439  ASP A CG    1 
ATOM   1060 O OD1   . ASP A 1 143 ? 27.934  31.219  52.648  1.00 41.41 ? 439  ASP A OD1   1 
ATOM   1061 O OD2   . ASP A 1 143 ? 27.776  33.228  53.509  1.00 41.70 ? 439  ASP A OD2   1 
ATOM   1062 N N     . GLU A 1 144 ? 23.592  29.701  54.609  1.00 37.48 ? 440  GLU A N     1 
ATOM   1063 C CA    . GLU A 1 144 ? 22.250  29.316  55.067  1.00 37.12 ? 440  GLU A CA    1 
ATOM   1064 C C     . GLU A 1 144 ? 21.144  30.345  54.805  1.00 36.88 ? 440  GLU A C     1 
ATOM   1065 O O     . GLU A 1 144 ? 20.084  29.975  54.316  1.00 36.88 ? 440  GLU A O     1 
ATOM   1066 C CB    . GLU A 1 144 ? 22.277  28.963  56.557  1.00 37.02 ? 440  GLU A CB    1 
ATOM   1067 N N     . PRO A 1 145 ? 21.381  31.631  55.132  1.00 36.71 ? 441  PRO A N     1 
ATOM   1068 C CA    . PRO A 1 145 ? 20.345  32.664  54.955  1.00 36.56 ? 441  PRO A CA    1 
ATOM   1069 C C     . PRO A 1 145 ? 19.849  32.835  53.511  1.00 36.37 ? 441  PRO A C     1 
ATOM   1070 O O     . PRO A 1 145 ? 18.635  32.903  53.271  1.00 36.16 ? 441  PRO A O     1 
ATOM   1071 C CB    . PRO A 1 145 ? 21.048  33.946  55.423  1.00 36.54 ? 441  PRO A CB    1 
ATOM   1072 C CG    . PRO A 1 145 ? 22.133  33.478  56.319  1.00 36.76 ? 441  PRO A CG    1 
ATOM   1073 C CD    . PRO A 1 145 ? 22.608  32.198  55.724  1.00 36.82 ? 441  PRO A CD    1 
ATOM   1074 N N     . VAL A 1 146 ? 20.789  32.917  52.573  1.00 36.20 ? 442  VAL A N     1 
ATOM   1075 C CA    . VAL A 1 146 ? 20.467  33.043  51.151  1.00 36.10 ? 442  VAL A CA    1 
ATOM   1076 C C     . VAL A 1 146 ? 19.711  31.813  50.661  1.00 36.14 ? 442  VAL A C     1 
ATOM   1077 O O     . VAL A 1 146 ? 18.653  31.934  50.042  1.00 36.44 ? 442  VAL A O     1 
ATOM   1078 C CB    . VAL A 1 146 ? 21.733  33.206  50.282  1.00 36.07 ? 442  VAL A CB    1 
ATOM   1079 C CG1   . VAL A 1 146 ? 21.365  33.218  48.796  1.00 35.98 ? 442  VAL A CG1   1 
ATOM   1080 C CG2   . VAL A 1 146 ? 22.479  34.473  50.649  1.00 35.70 ? 442  VAL A CG2   1 
ATOM   1081 N N     . LEU A 1 147 ? 20.271  30.637  50.940  1.00 36.01 ? 443  LEU A N     1 
ATOM   1082 C CA    . LEU A 1 147 ? 19.649  29.355  50.582  1.00 35.89 ? 443  LEU A CA    1 
ATOM   1083 C C     . LEU A 1 147 ? 18.237  29.209  51.154  1.00 35.59 ? 443  LEU A C     1 
ATOM   1084 O O     . LEU A 1 147 ? 17.287  28.905  50.435  1.00 35.17 ? 443  LEU A O     1 
ATOM   1085 C CB    . LEU A 1 147 ? 20.520  28.198  51.093  1.00 36.05 ? 443  LEU A CB    1 
ATOM   1086 C CG    . LEU A 1 147 ? 19.928  26.781  51.045  1.00 36.22 ? 443  LEU A CG    1 
ATOM   1087 C CD1   . LEU A 1 147 ? 19.775  26.301  49.614  1.00 37.00 ? 443  LEU A CD1   1 
ATOM   1088 C CD2   . LEU A 1 147 ? 20.800  25.833  51.842  1.00 36.79 ? 443  LEU A CD2   1 
ATOM   1089 N N     . ALA A 1 148 ? 18.124  29.423  52.458  1.00 35.52 ? 444  ALA A N     1 
ATOM   1090 C CA    . ALA A 1 148 ? 16.874  29.195  53.171  1.00 35.55 ? 444  ALA A CA    1 
ATOM   1091 C C     . ALA A 1 148 ? 15.737  29.982  52.545  1.00 35.61 ? 444  ALA A C     1 
ATOM   1092 O O     . ALA A 1 148 ? 14.637  29.451  52.368  1.00 35.63 ? 444  ALA A O     1 
ATOM   1093 C CB    . ALA A 1 148 ? 17.016  29.547  54.644  1.00 35.49 ? 444  ALA A CB    1 
ATOM   1094 N N     . GLU A 1 149 ? 15.996  31.236  52.193  1.00 35.62 ? 445  GLU A N     1 
ATOM   1095 C CA    . GLU A 1 149 ? 14.942  32.056  51.610  1.00 35.91 ? 445  GLU A CA    1 
ATOM   1096 C C     . GLU A 1 149 ? 14.472  31.441  50.302  1.00 35.86 ? 445  GLU A C     1 
ATOM   1097 O O     . GLU A 1 149 ? 13.270  31.300  50.069  1.00 35.95 ? 445  GLU A O     1 
ATOM   1098 C CB    . GLU A 1 149 ? 15.400  33.492  51.367  1.00 36.08 ? 445  GLU A CB    1 
ATOM   1099 C CG    . GLU A 1 149 ? 14.232  34.477  51.249  1.00 36.72 ? 445  GLU A CG    1 
ATOM   1100 C CD    . GLU A 1 149 ? 14.627  35.806  50.626  1.00 38.02 ? 445  GLU A CD    1 
ATOM   1101 O OE1   . GLU A 1 149 ? 15.840  36.034  50.424  1.00 39.20 ? 445  GLU A OE1   1 
ATOM   1102 O OE2   . GLU A 1 149 ? 13.726  36.631  50.340  1.00 38.87 ? 445  GLU A OE2   1 
ATOM   1103 N N     . HIS A 1 150 ? 15.433  31.055  49.471  1.00 35.74 ? 446  HIS A N     1 
ATOM   1104 C CA    . HIS A 1 150 ? 15.149  30.477  48.162  1.00 35.62 ? 446  HIS A CA    1 
ATOM   1105 C C     . HIS A 1 150 ? 14.265  29.225  48.260  1.00 35.27 ? 446  HIS A C     1 
ATOM   1106 O O     . HIS A 1 150 ? 13.249  29.134  47.575  1.00 34.88 ? 446  HIS A O     1 
ATOM   1107 C CB    . HIS A 1 150 ? 16.469  30.168  47.441  1.00 35.82 ? 446  HIS A CB    1 
ATOM   1108 C CG    . HIS A 1 150 ? 16.293  29.647  46.050  1.00 36.38 ? 446  HIS A CG    1 
ATOM   1109 N ND1   . HIS A 1 150 ? 15.305  30.106  45.206  1.00 37.07 ? 446  HIS A ND1   1 
ATOM   1110 C CD2   . HIS A 1 150 ? 16.985  28.716  45.352  1.00 36.70 ? 446  HIS A CD2   1 
ATOM   1111 C CE1   . HIS A 1 150 ? 15.392  29.473  44.051  1.00 37.24 ? 446  HIS A CE1   1 
ATOM   1112 N NE2   . HIS A 1 150 ? 16.402  28.624  44.112  1.00 37.03 ? 446  HIS A NE2   1 
ATOM   1113 N N     . LEU A 1 151 ? 14.646  28.282  49.123  1.00 35.09 ? 447  LEU A N     1 
ATOM   1114 C CA    . LEU A 1 151 ? 13.921  27.015  49.258  1.00 34.94 ? 447  LEU A CA    1 
ATOM   1115 C C     . LEU A 1 151 ? 12.496  27.236  49.698  1.00 34.84 ? 447  LEU A C     1 
ATOM   1116 O O     . LEU A 1 151 ? 11.587  26.570  49.218  1.00 34.86 ? 447  LEU A O     1 
ATOM   1117 C CB    . LEU A 1 151 ? 14.606  26.081  50.253  1.00 34.96 ? 447  LEU A CB    1 
ATOM   1118 C CG    . LEU A 1 151 ? 16.036  25.648  49.922  1.00 35.05 ? 447  LEU A CG    1 
ATOM   1119 C CD1   . LEU A 1 151 ? 16.327  24.314  50.579  1.00 35.17 ? 447  LEU A CD1   1 
ATOM   1120 C CD2   . LEU A 1 151 ? 16.282  25.557  48.421  1.00 34.91 ? 447  LEU A CD2   1 
ATOM   1121 N N     . VAL A 1 152 ? 12.308  28.173  50.619  1.00 34.87 ? 448  VAL A N     1 
ATOM   1122 C CA    . VAL A 1 152 ? 10.966  28.549  51.076  1.00 34.74 ? 448  VAL A CA    1 
ATOM   1123 C C     . VAL A 1 152 ? 10.159  29.190  49.954  1.00 34.61 ? 448  VAL A C     1 
ATOM   1124 O O     . VAL A 1 152 ? 8.956   28.967  49.849  1.00 34.69 ? 448  VAL A O     1 
ATOM   1125 C CB    . VAL A 1 152 ? 11.017  29.540  52.251  1.00 34.71 ? 448  VAL A CB    1 
ATOM   1126 C CG1   . VAL A 1 152 ? 9.611   29.885  52.716  1.00 34.38 ? 448  VAL A CG1   1 
ATOM   1127 C CG2   . VAL A 1 152 ? 11.828  28.959  53.405  1.00 34.81 ? 448  VAL A CG2   1 
ATOM   1128 N N     . ARG A 1 153 ? 10.826  29.992  49.130  1.00 34.51 ? 449  ARG A N     1 
ATOM   1129 C CA    . ARG A 1 153 ? 10.168  30.676  48.018  1.00 34.50 ? 449  ARG A CA    1 
ATOM   1130 C C     . ARG A 1 153 ? 9.635   29.708  46.965  1.00 34.12 ? 449  ARG A C     1 
ATOM   1131 O O     . ARG A 1 153 ? 8.600   29.975  46.343  1.00 34.34 ? 449  ARG A O     1 
ATOM   1132 C CB    . ARG A 1 153 ? 11.112  31.682  47.358  1.00 34.68 ? 449  ARG A CB    1 
ATOM   1133 C CG    . ARG A 1 153 ? 11.332  32.954  48.163  1.00 35.32 ? 449  ARG A CG    1 
ATOM   1134 C CD    . ARG A 1 153 ? 11.508  34.129  47.234  1.00 36.34 ? 449  ARG A CD    1 
ATOM   1135 N NE    . ARG A 1 153 ? 11.764  35.384  47.936  1.00 37.22 ? 449  ARG A NE    1 
ATOM   1136 C CZ    . ARG A 1 153 ? 10.843  36.298  48.237  1.00 38.12 ? 449  ARG A CZ    1 
ATOM   1137 N NH1   . ARG A 1 153 ? 9.566   36.120  47.915  1.00 38.33 ? 449  ARG A NH1   1 
ATOM   1138 N NH2   . ARG A 1 153 ? 11.205  37.406  48.875  1.00 38.89 ? 449  ARG A NH2   1 
ATOM   1139 N N     . LYS A 1 154 ? 10.343  28.597  46.767  1.00 33.54 ? 450  LYS A N     1 
ATOM   1140 C CA    . LYS A 1 154 ? 9.913   27.567  45.819  1.00 33.05 ? 450  LYS A CA    1 
ATOM   1141 C C     . LYS A 1 154 ? 8.738   26.825  46.409  1.00 32.43 ? 450  LYS A C     1 
ATOM   1142 O O     . LYS A 1 154 ? 7.711   26.682  45.766  1.00 32.39 ? 450  LYS A O     1 
ATOM   1143 C CB    . LYS A 1 154 ? 11.036  26.570  45.499  1.00 33.16 ? 450  LYS A CB    1 
ATOM   1144 C CG    . LYS A 1 154 ? 12.375  27.209  45.156  1.00 33.23 ? 450  LYS A CG    1 
ATOM   1145 C CD    . LYS A 1 154 ? 13.157  26.444  44.085  1.00 33.53 ? 450  LYS A CD    1 
ATOM   1146 C CE    . LYS A 1 154 ? 13.946  25.250  44.625  1.00 33.85 ? 450  LYS A CE    1 
ATOM   1147 N NZ    . LYS A 1 154 ? 15.044  24.833  43.690  1.00 33.45 ? 450  LYS A NZ    1 
ATOM   1148 N N     . ALA A 1 155 ? 8.902   26.358  47.641  1.00 31.97 ? 451  ALA A N     1 
ATOM   1149 C CA    . ALA A 1 155 ? 7.828   25.691  48.373  1.00 31.75 ? 451  ALA A CA    1 
ATOM   1150 C C     . ALA A 1 155 ? 6.573   26.556  48.322  1.00 31.61 ? 451  ALA A C     1 
ATOM   1151 O O     . ALA A 1 155 ? 5.470   26.086  48.032  1.00 31.54 ? 451  ALA A O     1 
ATOM   1152 C CB    . ALA A 1 155 ? 8.247   25.449  49.816  1.00 31.55 ? 451  ALA A CB    1 
ATOM   1153 N N     . ALA A 1 156 ? 6.776   27.837  48.593  1.00 31.45 ? 452  ALA A N     1 
ATOM   1154 C CA    . ALA A 1 156 ? 5.719   28.819  48.548  1.00 31.38 ? 452  ALA A CA    1 
ATOM   1155 C C     . ALA A 1 156 ? 5.034   28.808  47.186  1.00 31.46 ? 452  ALA A C     1 
ATOM   1156 O O     . ALA A 1 156 ? 3.804   28.758  47.101  1.00 31.48 ? 452  ALA A O     1 
ATOM   1157 C CB    . ALA A 1 156 ? 6.283   30.188  48.848  1.00 31.25 ? 452  ALA A CB    1 
ATOM   1158 N N     . ALA A 1 157 ? 5.835   28.857  46.127  1.00 31.51 ? 453  ALA A N     1 
ATOM   1159 C CA    . ALA A 1 157 ? 5.306   28.813  44.766  1.00 31.71 ? 453  ALA A CA    1 
ATOM   1160 C C     . ALA A 1 157 ? 4.477   27.549  44.568  1.00 31.91 ? 453  ALA A C     1 
ATOM   1161 O O     . ALA A 1 157 ? 3.293   27.624  44.239  1.00 32.18 ? 453  ALA A O     1 
ATOM   1162 C CB    . ALA A 1 157 ? 6.429   28.871  43.750  1.00 31.53 ? 453  ALA A CB    1 
ATOM   1163 N N     . ILE A 1 158 ? 5.099   26.398  44.800  1.00 31.98 ? 454  ILE A N     1 
ATOM   1164 C CA    . ILE A 1 158 ? 4.455   25.103  44.585  1.00 32.10 ? 454  ILE A CA    1 
ATOM   1165 C C     . ILE A 1 158 ? 3.107   25.050  45.281  1.00 32.54 ? 454  ILE A C     1 
ATOM   1166 O O     . ILE A 1 158 ? 2.124   24.572  44.726  1.00 32.68 ? 454  ILE A O     1 
ATOM   1167 C CB    . ILE A 1 158 ? 5.322   23.943  45.109  1.00 31.99 ? 454  ILE A CB    1 
ATOM   1168 C CG1   . ILE A 1 158 ? 6.584   23.793  44.257  1.00 31.88 ? 454  ILE A CG1   1 
ATOM   1169 C CG2   . ILE A 1 158 ? 4.538   22.634  45.092  1.00 31.47 ? 454  ILE A CG2   1 
ATOM   1170 C CD1   . ILE A 1 158 ? 7.593   22.837  44.837  1.00 31.60 ? 454  ILE A CD1   1 
ATOM   1171 N N     . TRP A 1 159 ? 3.080   25.548  46.508  1.00 33.03 ? 455  TRP A N     1 
ATOM   1172 C CA    . TRP A 1 159 ? 1.855   25.634  47.295  1.00 33.53 ? 455  TRP A CA    1 
ATOM   1173 C C     . TRP A 1 159 ? 0.804   26.501  46.606  1.00 33.59 ? 455  TRP A C     1 
ATOM   1174 O O     . TRP A 1 159 ? -0.363  26.123  46.491  1.00 33.60 ? 455  TRP A O     1 
ATOM   1175 C CB    . TRP A 1 159 ? 2.195   26.244  48.649  1.00 33.71 ? 455  TRP A CB    1 
ATOM   1176 C CG    . TRP A 1 159 ? 1.078   26.278  49.638  1.00 34.68 ? 455  TRP A CG    1 
ATOM   1177 C CD1   . TRP A 1 159 ? 0.488   27.387  50.165  1.00 35.22 ? 455  TRP A CD1   1 
ATOM   1178 C CD2   . TRP A 1 159 ? 0.436   25.154  50.246  1.00 35.59 ? 455  TRP A CD2   1 
ATOM   1179 N NE1   . TRP A 1 159 ? -0.481  27.025  51.062  1.00 35.45 ? 455  TRP A NE1   1 
ATOM   1180 C CE2   . TRP A 1 159 ? -0.532  25.658  51.132  1.00 35.77 ? 455  TRP A CE2   1 
ATOM   1181 C CE3   . TRP A 1 159 ? 0.587   23.769  50.127  1.00 36.03 ? 455  TRP A CE3   1 
ATOM   1182 C CZ2   . TRP A 1 159 ? -1.350  24.828  51.892  1.00 36.29 ? 455  TRP A CZ2   1 
ATOM   1183 C CZ3   . TRP A 1 159 ? -0.221  22.945  50.888  1.00 36.16 ? 455  TRP A CZ3   1 
ATOM   1184 C CH2   . TRP A 1 159 ? -1.179  23.477  51.757  1.00 36.32 ? 455  TRP A CH2   1 
ATOM   1185 N N     . ALA A 1 160 ? 1.247   27.670  46.155  1.00 33.74 ? 456  ALA A N     1 
ATOM   1186 C CA    . ALA A 1 160 ? 0.372   28.682  45.557  1.00 33.75 ? 456  ALA A CA    1 
ATOM   1187 C C     . ALA A 1 160 ? -0.134  28.300  44.171  1.00 33.82 ? 456  ALA A C     1 
ATOM   1188 O O     . ALA A 1 160 ? -1.242  28.669  43.785  1.00 33.65 ? 456  ALA A O     1 
ATOM   1189 C CB    . ALA A 1 160 ? 1.106   29.998  45.482  1.00 33.81 ? 456  ALA A CB    1 
ATOM   1190 N N     . LEU A 1 161 ? 0.694   27.563  43.435  1.00 34.03 ? 457  LEU A N     1 
ATOM   1191 C CA    . LEU A 1 161 ? 0.436   27.237  42.036  1.00 34.18 ? 457  LEU A CA    1 
ATOM   1192 C C     . LEU A 1 161 ? -0.291  25.901  41.791  1.00 34.49 ? 457  LEU A C     1 
ATOM   1193 O O     . LEU A 1 161 ? -0.792  25.665  40.689  1.00 34.41 ? 457  LEU A O     1 
ATOM   1194 C CB    . LEU A 1 161 ? 1.755   27.246  41.264  1.00 34.11 ? 457  LEU A CB    1 
ATOM   1195 C CG    . LEU A 1 161 ? 2.470   28.599  41.194  1.00 33.84 ? 457  LEU A CG    1 
ATOM   1196 C CD1   . LEU A 1 161 ? 3.828   28.423  40.559  1.00 34.20 ? 457  LEU A CD1   1 
ATOM   1197 C CD2   . LEU A 1 161 ? 1.663   29.625  40.416  1.00 33.45 ? 457  LEU A CD2   1 
ATOM   1198 N N     . GLU A 1 162 ? -0.352  25.031  42.797  1.00 34.82 ? 458  GLU A N     1 
ATOM   1199 C CA    . GLU A 1 162 ? -0.975  23.713  42.625  1.00 35.12 ? 458  GLU A CA    1 
ATOM   1200 C C     . GLU A 1 162 ? -2.364  23.834  42.014  1.00 34.97 ? 458  GLU A C     1 
ATOM   1201 O O     . GLU A 1 162 ? -2.598  23.351  40.910  1.00 34.84 ? 458  GLU A O     1 
ATOM   1202 C CB    . GLU A 1 162 ? -1.030  22.936  43.954  1.00 35.45 ? 458  GLU A CB    1 
ATOM   1203 C CG    . GLU A 1 162 ? -2.230  21.951  44.085  1.00 36.66 ? 458  GLU A CG    1 
ATOM   1204 C CD    . GLU A 1 162 ? -2.065  20.894  45.186  1.00 38.07 ? 458  GLU A CD    1 
ATOM   1205 O OE1   . GLU A 1 162 ? -1.078  20.956  45.957  1.00 39.29 ? 458  GLU A OE1   1 
ATOM   1206 O OE2   . GLU A 1 162 ? -2.940  19.998  45.279  1.00 38.34 ? 458  GLU A OE2   1 
ATOM   1207 N N     . ARG A 1 163 ? -3.274  24.484  42.736  1.00 35.01 ? 459  ARG A N     1 
ATOM   1208 C CA    . ARG A 1 163 ? -4.665  24.621  42.292  1.00 35.02 ? 459  ARG A CA    1 
ATOM   1209 C C     . ARG A 1 163 ? -4.747  25.181  40.873  1.00 35.07 ? 459  ARG A C     1 
ATOM   1210 O O     . ARG A 1 163 ? -5.386  24.585  40.015  1.00 35.14 ? 459  ARG A O     1 
ATOM   1211 C CB    . ARG A 1 163 ? -5.472  25.499  43.253  1.00 34.93 ? 459  ARG A CB    1 
ATOM   1212 N N     . PRO A 1 164 ? -4.077  26.314  40.610  1.00 35.13 ? 460  PRO A N     1 
ATOM   1213 C CA    . PRO A 1 164 ? -4.174  26.879  39.264  1.00 35.22 ? 460  PRO A CA    1 
ATOM   1214 C C     . PRO A 1 164 ? -3.775  25.938  38.128  1.00 35.28 ? 460  PRO A C     1 
ATOM   1215 O O     . PRO A 1 164 ? -4.455  25.896  37.111  1.00 35.31 ? 460  PRO A O     1 
ATOM   1216 C CB    . PRO A 1 164 ? -3.223  28.087  39.299  1.00 35.27 ? 460  PRO A CB    1 
ATOM   1217 C CG    . PRO A 1 164 ? -2.653  28.153  40.655  1.00 35.18 ? 460  PRO A CG    1 
ATOM   1218 C CD    . PRO A 1 164 ? -3.404  27.228  41.547  1.00 35.15 ? 460  PRO A CD    1 
ATOM   1219 N N     . PHE A 1 165 ? -2.677  25.209  38.283  1.00 35.47 ? 461  PHE A N     1 
ATOM   1220 C CA    . PHE A 1 165 ? -2.235  24.303  37.223  1.00 35.45 ? 461  PHE A CA    1 
ATOM   1221 C C     . PHE A 1 165 ? -3.256  23.194  37.040  1.00 35.66 ? 461  PHE A C     1 
ATOM   1222 O O     . PHE A 1 165 ? -3.699  22.947  35.924  1.00 35.86 ? 461  PHE A O     1 
ATOM   1223 C CB    . PHE A 1 165 ? -0.849  23.723  37.508  1.00 35.32 ? 461  PHE A CB    1 
ATOM   1224 C CG    . PHE A 1 165 ? 0.270   24.602  37.052  1.00 34.85 ? 461  PHE A CG    1 
ATOM   1225 C CD1   . PHE A 1 165 ? 0.445   25.852  37.607  1.00 34.41 ? 461  PHE A CD1   1 
ATOM   1226 C CD2   . PHE A 1 165 ? 1.145   24.184  36.066  1.00 34.47 ? 461  PHE A CD2   1 
ATOM   1227 C CE1   . PHE A 1 165 ? 1.471   26.664  37.193  1.00 34.50 ? 461  PHE A CE1   1 
ATOM   1228 C CE2   . PHE A 1 165 ? 2.175   24.998  35.647  1.00 34.40 ? 461  PHE A CE2   1 
ATOM   1229 C CZ    . PHE A 1 165 ? 2.336   26.239  36.210  1.00 34.44 ? 461  PHE A CZ    1 
ATOM   1230 N N     . LEU A 1 166 ? -3.648  22.552  38.141  1.00 35.84 ? 462  LEU A N     1 
ATOM   1231 C CA    . LEU A 1 166 ? -4.628  21.461  38.095  1.00 35.95 ? 462  LEU A CA    1 
ATOM   1232 C C     . LEU A 1 166 ? -5.910  21.890  37.390  1.00 36.11 ? 462  LEU A C     1 
ATOM   1233 O O     . LEU A 1 166 ? -6.530  21.094  36.687  1.00 36.16 ? 462  LEU A O     1 
ATOM   1234 C CB    . LEU A 1 166 ? -4.960  20.940  39.503  1.00 35.99 ? 462  LEU A CB    1 
ATOM   1235 C CG    . LEU A 1 166 ? -3.947  19.995  40.171  1.00 35.91 ? 462  LEU A CG    1 
ATOM   1236 C CD1   . LEU A 1 166 ? -4.518  19.409  41.447  1.00 36.04 ? 462  LEU A CD1   1 
ATOM   1237 C CD2   . LEU A 1 166 ? -3.534  18.866  39.252  1.00 35.85 ? 462  LEU A CD2   1 
ATOM   1238 N N     . ASP A 1 167 ? -6.294  23.149  37.575  1.00 36.24 ? 463  ASP A N     1 
ATOM   1239 C CA    . ASP A 1 167 ? -7.448  23.704  36.873  1.00 36.34 ? 463  ASP A CA    1 
ATOM   1240 C C     . ASP A 1 167 ? -7.251  23.632  35.350  1.00 36.39 ? 463  ASP A C     1 
ATOM   1241 O O     . ASP A 1 167 ? -8.159  23.207  34.636  1.00 36.32 ? 463  ASP A O     1 
ATOM   1242 C CB    . ASP A 1 167 ? -7.735  25.148  37.329  1.00 36.40 ? 463  ASP A CB    1 
ATOM   1243 C CG    . ASP A 1 167 ? -8.038  25.255  38.834  1.00 36.52 ? 463  ASP A CG    1 
ATOM   1244 O OD1   . ASP A 1 167 ? -8.491  24.257  39.444  1.00 35.79 ? 463  ASP A OD1   1 
ATOM   1245 O OD2   . ASP A 1 167 ? -7.810  26.346  39.409  1.00 36.94 ? 463  ASP A OD2   1 
ATOM   1246 N N     . GLU A 1 168 ? -6.067  24.018  34.865  1.00 36.50 ? 464  GLU A N     1 
ATOM   1247 C CA    . GLU A 1 168 ? -5.781  23.995  33.417  1.00 36.67 ? 464  GLU A CA    1 
ATOM   1248 C C     . GLU A 1 168 ? -5.762  22.590  32.857  1.00 36.76 ? 464  GLU A C     1 
ATOM   1249 O O     . GLU A 1 168 ? -6.437  22.294  31.874  1.00 36.79 ? 464  GLU A O     1 
ATOM   1250 C CB    . GLU A 1 168 ? -4.465  24.696  33.067  1.00 36.64 ? 464  GLU A CB    1 
ATOM   1251 C CG    . GLU A 1 168 ? -4.687  25.875  32.147  1.00 37.49 ? 464  GLU A CG    1 
ATOM   1252 C CD    . GLU A 1 168 ? -3.442  26.708  31.899  1.00 39.07 ? 464  GLU A CD    1 
ATOM   1253 O OE1   . GLU A 1 168 ? -2.477  26.191  31.288  1.00 39.59 ? 464  GLU A OE1   1 
ATOM   1254 O OE2   . GLU A 1 168 ? -3.438  27.894  32.315  1.00 40.13 ? 464  GLU A OE2   1 
ATOM   1255 N N     . LEU A 1 169 ? -4.977  21.730  33.485  1.00 37.01 ? 465  LEU A N     1 
ATOM   1256 C CA    . LEU A 1 169 ? -4.900  20.328  33.090  1.00 37.26 ? 465  LEU A CA    1 
ATOM   1257 C C     . LEU A 1 169 ? -6.294  19.742  32.918  1.00 37.70 ? 465  LEU A C     1 
ATOM   1258 O O     . LEU A 1 169 ? -6.564  19.035  31.945  1.00 37.83 ? 465  LEU A O     1 
ATOM   1259 C CB    . LEU A 1 169 ? -4.109  19.526  34.120  1.00 37.12 ? 465  LEU A CB    1 
ATOM   1260 C CG    . LEU A 1 169 ? -2.614  19.857  34.114  1.00 36.70 ? 465  LEU A CG    1 
ATOM   1261 C CD1   . LEU A 1 169 ? -2.000  19.579  35.467  1.00 36.88 ? 465  LEU A CD1   1 
ATOM   1262 C CD2   . LEU A 1 169 ? -1.886  19.095  33.017  1.00 36.20 ? 465  LEU A CD2   1 
ATOM   1263 N N     . ARG A 1 170 ? -7.174  20.051  33.862  1.00 38.17 ? 466  ARG A N     1 
ATOM   1264 C CA    . ARG A 1 170 ? -8.579  19.678  33.744  1.00 38.52 ? 466  ARG A CA    1 
ATOM   1265 C C     . ARG A 1 170 ? -9.124  20.194  32.426  1.00 38.54 ? 466  ARG A C     1 
ATOM   1266 O O     . ARG A 1 170 ? -9.543  19.418  31.562  1.00 38.45 ? 466  ARG A O     1 
ATOM   1267 C CB    . ARG A 1 170 ? -9.406  20.304  34.870  1.00 38.64 ? 466  ARG A CB    1 
ATOM   1268 C CG    . ARG A 1 170 ? -10.465 19.393  35.445  1.00 39.07 ? 466  ARG A CG    1 
ATOM   1269 C CD    . ARG A 1 170 ? -10.066 18.845  36.827  1.00 39.36 ? 466  ARG A CD    1 
ATOM   1270 N N     . ARG A 1 171 ? -9.100  21.517  32.272  1.00 38.55 ? 467  ARG A N     1 
ATOM   1271 C CA    . ARG A 1 171 ? -9.685  22.132  31.094  1.00 38.66 ? 467  ARG A CA    1 
ATOM   1272 C C     . ARG A 1 171 ? -9.187  21.433  29.833  1.00 38.31 ? 467  ARG A C     1 
ATOM   1273 O O     . ARG A 1 171 ? -9.961  21.185  28.913  1.00 38.69 ? 467  ARG A O     1 
ATOM   1274 C CB    . ARG A 1 171 ? -9.379  23.627  31.028  1.00 38.92 ? 467  ARG A CB    1 
ATOM   1275 C CG    . ARG A 1 171 ? -9.906  24.433  32.216  1.00 40.27 ? 467  ARG A CG    1 
ATOM   1276 C CD    . ARG A 1 171 ? -10.127 25.914  31.874  1.00 42.07 ? 467  ARG A CD    1 
ATOM   1277 N NE    . ARG A 1 171 ? -8.885  26.692  31.769  1.00 43.58 ? 467  ARG A NE    1 
ATOM   1278 C CZ    . ARG A 1 171 ? -8.279  27.319  32.783  1.00 44.59 ? 467  ARG A CZ    1 
ATOM   1279 N NH1   . ARG A 1 171 ? -8.772  27.271  34.016  1.00 45.26 ? 467  ARG A NH1   1 
ATOM   1280 N NH2   . ARG A 1 171 ? -7.162  28.004  32.564  1.00 44.76 ? 467  ARG A NH2   1 
ATOM   1281 N N     . ASN A 1 172 ? -7.907  21.083  29.803  1.00 37.81 ? 468  ASN A N     1 
ATOM   1282 C CA    . ASN A 1 172 ? -7.338  20.389  28.645  1.00 37.47 ? 468  ASN A CA    1 
ATOM   1283 C C     . ASN A 1 172 ? -7.719  18.921  28.527  1.00 37.15 ? 468  ASN A C     1 
ATOM   1284 O O     . ASN A 1 172 ? -7.438  18.292  27.509  1.00 36.95 ? 468  ASN A O     1 
ATOM   1285 C CB    . ASN A 1 172 ? -5.822  20.487  28.674  1.00 37.44 ? 468  ASN A CB    1 
ATOM   1286 C CG    . ASN A 1 172 ? -5.342  21.894  28.493  1.00 37.54 ? 468  ASN A CG    1 
ATOM   1287 O OD1   . ASN A 1 172 ? -6.141  22.822  28.391  1.00 37.35 ? 468  ASN A OD1   1 
ATOM   1288 N ND2   . ASN A 1 172 ? -4.028  22.071  28.447  1.00 38.59 ? 468  ASN A ND2   1 
ATOM   1289 N N     . GLU A 1 173 ? -8.360  18.381  29.556  1.00 36.88 ? 469  GLU A N     1 
ATOM   1290 C CA    . GLU A 1 173 ? -8.593  16.942  29.654  1.00 36.57 ? 469  GLU A CA    1 
ATOM   1291 C C     . GLU A 1 173 ? -7.238  16.226  29.774  1.00 36.16 ? 469  GLU A C     1 
ATOM   1292 O O     . GLU A 1 173 ? -6.983  15.236  29.100  1.00 35.91 ? 469  GLU A O     1 
ATOM   1293 C CB    . GLU A 1 173 ? -9.427  16.433  28.463  1.00 36.55 ? 469  GLU A CB    1 
ATOM   1294 C CG    . GLU A 1 173 ? -10.925 16.730  28.575  1.00 36.23 ? 469  GLU A CG    1 
ATOM   1295 N N     . GLN A 1 174 ? -6.380  16.775  30.636  1.00 35.85 ? 470  GLN A N     1 
ATOM   1296 C CA    . GLN A 1 174 ? -5.066  16.209  30.968  1.00 35.75 ? 470  GLN A CA    1 
ATOM   1297 C C     . GLN A 1 174 ? -4.921  15.884  32.461  1.00 35.44 ? 470  GLN A C     1 
ATOM   1298 O O     . GLN A 1 174 ? -3.860  15.449  32.901  1.00 35.37 ? 470  GLN A O     1 
ATOM   1299 C CB    . GLN A 1 174 ? -3.958  17.198  30.578  1.00 35.86 ? 470  GLN A CB    1 
ATOM   1300 C CG    . GLN A 1 174 ? -3.546  17.161  29.112  1.00 36.06 ? 470  GLN A CG    1 
ATOM   1301 C CD    . GLN A 1 174 ? -2.732  18.380  28.697  1.00 35.94 ? 470  GLN A CD    1 
ATOM   1302 O OE1   . GLN A 1 174 ? -3.158  19.154  27.851  1.00 37.44 ? 470  GLN A OE1   1 
ATOM   1303 N NE2   . GLN A 1 174 ? -1.566  18.555  29.296  1.00 35.29 ? 470  GLN A NE2   1 
ATOM   1304 N N     . ASP A 1 175 ? -5.974  16.116  33.239  1.00 35.10 ? 471  ASP A N     1 
ATOM   1305 C CA    . ASP A 1 175 ? -5.942  15.838  34.675  1.00 34.82 ? 471  ASP A CA    1 
ATOM   1306 C C     . ASP A 1 175 ? -5.680  14.354  34.965  1.00 34.56 ? 471  ASP A C     1 
ATOM   1307 O O     . ASP A 1 175 ? -4.862  14.021  35.813  1.00 34.31 ? 471  ASP A O     1 
ATOM   1308 C CB    . ASP A 1 175 ? -7.233  16.324  35.357  1.00 34.90 ? 471  ASP A CB    1 
ATOM   1309 C CG    . ASP A 1 175 ? -8.493  15.688  34.777  1.00 34.87 ? 471  ASP A CG    1 
ATOM   1310 O OD1   . ASP A 1 175 ? -8.677  15.735  33.546  1.00 35.16 ? 471  ASP A OD1   1 
ATOM   1311 O OD2   . ASP A 1 175 ? -9.303  15.150  35.555  1.00 34.54 ? 471  ASP A OD2   1 
ATOM   1312 N N     . ARG A 1 176 ? -6.356  13.470  34.240  1.00 34.50 ? 472  ARG A N     1 
ATOM   1313 C CA    . ARG A 1 176 ? -6.161  12.022  34.393  1.00 34.39 ? 472  ARG A CA    1 
ATOM   1314 C C     . ARG A 1 176 ? -4.766  11.589  33.925  1.00 33.96 ? 472  ARG A C     1 
ATOM   1315 O O     . ARG A 1 176 ? -4.130  10.738  34.536  1.00 33.57 ? 472  ARG A O     1 
ATOM   1316 C CB    . ARG A 1 176 ? -7.247  11.236  33.631  1.00 34.55 ? 472  ARG A CB    1 
ATOM   1317 C CG    . ARG A 1 176 ? -8.621  11.232  34.296  1.00 34.77 ? 472  ARG A CG    1 
ATOM   1318 C CD    . ARG A 1 176 ? -9.481  10.076  33.792  1.00 35.59 ? 472  ARG A CD    1 
ATOM   1319 N N     . LEU A 1 177 ? -4.300  12.177  32.832  1.00 33.80 ? 473  LEU A N     1 
ATOM   1320 C CA    . LEU A 1 177 ? -2.966  11.872  32.313  1.00 33.83 ? 473  LEU A CA    1 
ATOM   1321 C C     . LEU A 1 177 ? -1.877  12.130  33.346  1.00 33.76 ? 473  LEU A C     1 
ATOM   1322 O O     . LEU A 1 177 ? -0.981  11.316  33.526  1.00 33.77 ? 473  LEU A O     1 
ATOM   1323 C CB    . LEU A 1 177 ? -2.664  12.698  31.063  1.00 33.82 ? 473  LEU A CB    1 
ATOM   1324 C CG    . LEU A 1 177 ? -1.216  12.613  30.556  1.00 33.67 ? 473  LEU A CG    1 
ATOM   1325 C CD1   . LEU A 1 177 ? -0.976  11.288  29.851  1.00 33.54 ? 473  LEU A CD1   1 
ATOM   1326 C CD2   . LEU A 1 177 ? -0.878  13.768  29.625  1.00 33.75 ? 473  LEU A CD2   1 
ATOM   1327 N N     . LEU A 1 178 ? -1.941  13.280  33.999  1.00 33.81 ? 474  LEU A N     1 
ATOM   1328 C CA    . LEU A 1 178 ? -0.970  13.617  35.027  1.00 33.94 ? 474  LEU A CA    1 
ATOM   1329 C C     . LEU A 1 178 ? -1.144  12.678  36.208  1.00 34.11 ? 474  LEU A C     1 
ATOM   1330 O O     . LEU A 1 178 ? -0.206  12.000  36.631  1.00 34.14 ? 474  LEU A O     1 
ATOM   1331 C CB    . LEU A 1 178 ? -1.147  15.067  35.491  1.00 33.91 ? 474  LEU A CB    1 
ATOM   1332 C CG    . LEU A 1 178 ? -0.340  15.527  36.720  1.00 33.84 ? 474  LEU A CG    1 
ATOM   1333 C CD1   . LEU A 1 178 ? 1.156   15.615  36.406  1.00 33.48 ? 474  LEU A CD1   1 
ATOM   1334 C CD2   . LEU A 1 178 ? -0.862  16.865  37.230  1.00 33.12 ? 474  LEU A CD2   1 
ATOM   1335 N N     . VAL A 1 179 ? -2.363  12.635  36.723  1.00 34.39 ? 475  VAL A N     1 
ATOM   1336 C CA    . VAL A 1 179 ? -2.634  11.975  37.999  1.00 34.77 ? 475  VAL A CA    1 
ATOM   1337 C C     . VAL A 1 179 ? -2.557  10.461  37.927  1.00 35.02 ? 475  VAL A C     1 
ATOM   1338 O O     . VAL A 1 179 ? -2.135  9.819   38.884  1.00 35.14 ? 475  VAL A O     1 
ATOM   1339 C CB    . VAL A 1 179 ? -4.024  12.346  38.553  1.00 34.79 ? 475  VAL A CB    1 
ATOM   1340 C CG1   . VAL A 1 179 ? -4.238  11.712  39.917  1.00 34.66 ? 475  VAL A CG1   1 
ATOM   1341 C CG2   . VAL A 1 179 ? -4.175  13.854  38.655  1.00 35.13 ? 475  VAL A CG2   1 
ATOM   1342 N N     . GLU A 1 180 ? -2.976  9.890   36.807  1.00 35.42 ? 476  GLU A N     1 
ATOM   1343 C CA    . GLU A 1 180 ? -3.056  8.441   36.689  1.00 35.78 ? 476  GLU A CA    1 
ATOM   1344 C C     . GLU A 1 180 ? -1.991  7.819   35.804  1.00 35.86 ? 476  GLU A C     1 
ATOM   1345 O O     . GLU A 1 180 ? -1.925  6.598   35.719  1.00 36.02 ? 476  GLU A O     1 
ATOM   1346 C CB    . GLU A 1 180 ? -4.423  8.036   36.165  1.00 35.98 ? 476  GLU A CB    1 
ATOM   1347 C CG    . GLU A 1 180 ? -5.574  8.578   36.978  1.00 37.04 ? 476  GLU A CG    1 
ATOM   1348 C CD    . GLU A 1 180 ? -6.906  8.246   36.355  1.00 39.26 ? 476  GLU A CD    1 
ATOM   1349 O OE1   . GLU A 1 180 ? -6.968  7.288   35.551  1.00 40.67 ? 476  GLU A OE1   1 
ATOM   1350 O OE2   . GLU A 1 180 ? -7.895  8.946   36.659  1.00 41.55 ? 476  GLU A OE2   1 
ATOM   1351 N N     . LEU A 1 181 ? -1.164  8.631   35.146  1.00 36.00 ? 477  LEU A N     1 
ATOM   1352 C CA    . LEU A 1 181 ? -0.120  8.094   34.270  1.00 35.96 ? 477  LEU A CA    1 
ATOM   1353 C C     . LEU A 1 181 ? 1.259   8.624   34.609  1.00 35.99 ? 477  LEU A C     1 
ATOM   1354 O O     . LEU A 1 181 ? 2.135   7.866   35.027  1.00 36.29 ? 477  LEU A O     1 
ATOM   1355 C CB    . LEU A 1 181 ? -0.415  8.379   32.798  1.00 35.87 ? 477  LEU A CB    1 
ATOM   1356 C CG    . LEU A 1 181 ? 0.319   7.415   31.857  1.00 36.10 ? 477  LEU A CG    1 
ATOM   1357 C CD1   . LEU A 1 181 ? -0.666  6.407   31.262  1.00 36.31 ? 477  LEU A CD1   1 
ATOM   1358 C CD2   . LEU A 1 181 ? 1.078   8.147   30.749  1.00 36.13 ? 477  LEU A CD2   1 
ATOM   1359 N N     . GLU A 1 182 ? 1.457   9.921   34.431  1.00 35.91 ? 478  GLU A N     1 
ATOM   1360 C CA    . GLU A 1 182 ? 2.796   10.483  34.535  1.00 35.94 ? 478  GLU A CA    1 
ATOM   1361 C C     . GLU A 1 182 ? 3.333   10.407  35.954  1.00 35.72 ? 478  GLU A C     1 
ATOM   1362 O O     . GLU A 1 182 ? 4.500   10.086  36.163  1.00 35.66 ? 478  GLU A O     1 
ATOM   1363 C CB    . GLU A 1 182 ? 2.817   11.919  34.019  1.00 36.07 ? 478  GLU A CB    1 
ATOM   1364 C CG    . GLU A 1 182 ? 2.756   12.001  32.496  1.00 37.00 ? 478  GLU A CG    1 
ATOM   1365 C CD    . GLU A 1 182 ? 4.020   11.473  31.811  1.00 38.34 ? 478  GLU A CD    1 
ATOM   1366 O OE1   . GLU A 1 182 ? 4.989   11.095  32.505  1.00 39.04 ? 478  GLU A OE1   1 
ATOM   1367 O OE2   . GLU A 1 182 ? 4.046   11.436  30.565  1.00 38.89 ? 478  GLU A OE2   1 
ATOM   1368 N N     . GLN A 1 183 ? 2.472   10.678  36.925  1.00 35.57 ? 479  GLN A N     1 
ATOM   1369 C CA    . GLN A 1 183 ? 2.885   10.643  38.322  1.00 35.47 ? 479  GLN A CA    1 
ATOM   1370 C C     . GLN A 1 183 ? 3.249   9.241   38.806  1.00 35.29 ? 479  GLN A C     1 
ATOM   1371 O O     . GLN A 1 183 ? 4.324   9.057   39.376  1.00 35.34 ? 479  GLN A O     1 
ATOM   1372 C CB    . GLN A 1 183 ? 1.847   11.311  39.228  1.00 35.51 ? 479  GLN A CB    1 
ATOM   1373 C CG    . GLN A 1 183 ? 2.309   12.699  39.663  1.00 36.01 ? 479  GLN A CG    1 
ATOM   1374 C CD    . GLN A 1 183 ? 1.190   13.621  40.073  1.00 36.34 ? 479  GLN A CD    1 
ATOM   1375 O OE1   . GLN A 1 183 ? 1.317   14.842  39.950  1.00 36.39 ? 479  GLN A OE1   1 
ATOM   1376 N NE2   . GLN A 1 183 ? 0.090   13.052  40.565  1.00 36.20 ? 479  GLN A NE2   1 
ATOM   1377 N N     . PRO A 1 184 ? 2.369   8.244   38.580  1.00 34.96 ? 480  PRO A N     1 
ATOM   1378 C CA    . PRO A 1 184 ? 2.753   6.881   38.940  1.00 34.62 ? 480  PRO A CA    1 
ATOM   1379 C C     . PRO A 1 184 ? 4.018   6.412   38.222  1.00 34.29 ? 480  PRO A C     1 
ATOM   1380 O O     . PRO A 1 184 ? 4.951   5.960   38.877  1.00 34.21 ? 480  PRO A O     1 
ATOM   1381 C CB    . PRO A 1 184 ? 1.537   6.049   38.518  1.00 34.64 ? 480  PRO A CB    1 
ATOM   1382 C CG    . PRO A 1 184 ? 0.408   6.980   38.559  1.00 34.61 ? 480  PRO A CG    1 
ATOM   1383 C CD    . PRO A 1 184 ? 0.959   8.311   38.152  1.00 34.99 ? 480  PRO A CD    1 
ATOM   1384 N N     . LEU A 1 185 ? 4.060   6.539   36.898  1.00 33.91 ? 481  LEU A N     1 
ATOM   1385 C CA    . LEU A 1 185 ? 5.256   6.161   36.143  1.00 33.83 ? 481  LEU A CA    1 
ATOM   1386 C C     . LEU A 1 185 ? 6.513   6.732   36.789  1.00 33.85 ? 481  LEU A C     1 
ATOM   1387 O O     . LEU A 1 185 ? 7.580   6.119   36.742  1.00 33.82 ? 481  LEU A O     1 
ATOM   1388 C CB    . LEU A 1 185 ? 5.178   6.642   34.690  1.00 33.83 ? 481  LEU A CB    1 
ATOM   1389 C CG    . LEU A 1 185 ? 6.526   6.713   33.945  1.00 33.48 ? 481  LEU A CG    1 
ATOM   1390 C CD1   . LEU A 1 185 ? 7.220   5.366   33.931  1.00 33.52 ? 481  LEU A CD1   1 
ATOM   1391 C CD2   . LEU A 1 185 ? 6.345   7.200   32.536  1.00 33.08 ? 481  LEU A CD2   1 
ATOM   1392 N N     . SER A 1 186 ? 6.388   7.918   37.375  1.00 33.80 ? 482  SER A N     1 
ATOM   1393 C CA    . SER A 1 186 ? 7.531   8.564   38.009  1.00 33.68 ? 482  SER A CA    1 
ATOM   1394 C C     . SER A 1 186 ? 8.067   7.738   39.171  1.00 33.47 ? 482  SER A C     1 
ATOM   1395 O O     . SER A 1 186 ? 9.274   7.668   39.382  1.00 33.33 ? 482  SER A O     1 
ATOM   1396 C CB    . SER A 1 186 ? 7.173   9.964   38.498  1.00 33.73 ? 482  SER A CB    1 
ATOM   1397 O OG    . SER A 1 186 ? 8.323   10.581  39.054  1.00 33.70 ? 482  SER A OG    1 
ATOM   1398 N N     . SER A 1 187 ? 7.158   7.123   39.921  1.00 33.33 ? 483  SER A N     1 
ATOM   1399 C CA    . SER A 1 187 ? 7.529   6.251   41.036  1.00 33.22 ? 483  SER A CA    1 
ATOM   1400 C C     . SER A 1 187 ? 8.334   5.063   40.526  1.00 33.10 ? 483  SER A C     1 
ATOM   1401 O O     . SER A 1 187 ? 9.366   4.693   41.098  1.00 33.09 ? 483  SER A O     1 
ATOM   1402 C CB    . SER A 1 187 ? 6.279   5.733   41.759  1.00 33.18 ? 483  SER A CB    1 
ATOM   1403 O OG    . SER A 1 187 ? 5.428   6.792   42.156  1.00 33.15 ? 483  SER A OG    1 
ATOM   1404 N N     . ILE A 1 188 ? 7.842   4.478   39.439  1.00 32.82 ? 484  ILE A N     1 
ATOM   1405 C CA    . ILE A 1 188 ? 8.447   3.300   38.848  1.00 32.57 ? 484  ILE A CA    1 
ATOM   1406 C C     . ILE A 1 188 ? 9.835   3.634   38.360  1.00 32.44 ? 484  ILE A C     1 
ATOM   1407 O O     . ILE A 1 188 ? 10.776  2.939   38.700  1.00 32.55 ? 484  ILE A O     1 
ATOM   1408 C CB    . ILE A 1 188 ? 7.610   2.750   37.687  1.00 32.55 ? 484  ILE A CB    1 
ATOM   1409 C CG1   . ILE A 1 188 ? 6.195   2.431   38.178  1.00 32.67 ? 484  ILE A CG1   1 
ATOM   1410 C CG2   . ILE A 1 188 ? 8.264   1.510   37.097  1.00 32.46 ? 484  ILE A CG2   1 
ATOM   1411 C CD1   . ILE A 1 188 ? 5.463   1.405   37.353  1.00 32.82 ? 484  ILE A CD1   1 
ATOM   1412 N N     . LEU A 1 189 ? 9.963   4.705   37.583  1.00 32.46 ? 485  LEU A N     1 
ATOM   1413 C CA    . LEU A 1 189 ? 11.282  5.182   37.125  1.00 32.54 ? 485  LEU A CA    1 
ATOM   1414 C C     . LEU A 1 189 ? 12.269  5.332   38.288  1.00 32.58 ? 485  LEU A C     1 
ATOM   1415 O O     . LEU A 1 189 ? 13.436  4.989   38.171  1.00 32.23 ? 485  LEU A O     1 
ATOM   1416 C CB    . LEU A 1 189 ? 11.168  6.526   36.392  1.00 32.53 ? 485  LEU A CB    1 
ATOM   1417 C CG    . LEU A 1 189 ? 10.323  6.619   35.122  1.00 32.05 ? 485  LEU A CG    1 
ATOM   1418 C CD1   . LEU A 1 189 ? 10.630  7.925   34.411  1.00 31.49 ? 485  LEU A CD1   1 
ATOM   1419 C CD2   . LEU A 1 189 ? 10.600  5.447   34.209  1.00 31.80 ? 485  LEU A CD2   1 
ATOM   1420 N N     . ALA A 1 190 ? 11.775  5.851   39.407  1.00 32.90 ? 486  ALA A N     1 
ATOM   1421 C CA    . ALA A 1 190 ? 12.567  6.005   40.620  1.00 33.06 ? 486  ALA A CA    1 
ATOM   1422 C C     . ALA A 1 190 ? 13.102  4.664   41.120  1.00 33.31 ? 486  ALA A C     1 
ATOM   1423 O O     . ALA A 1 190 ? 14.246  4.580   41.550  1.00 33.36 ? 486  ALA A O     1 
ATOM   1424 C CB    . ALA A 1 190 ? 11.739  6.679   41.696  1.00 33.02 ? 486  ALA A CB    1 
ATOM   1425 N N     . GLU A 1 191 ? 12.273  3.625   41.061  1.00 33.67 ? 487  GLU A N     1 
ATOM   1426 C CA    . GLU A 1 191 ? 12.697  2.266   41.422  1.00 34.06 ? 487  GLU A CA    1 
ATOM   1427 C C     . GLU A 1 191 ? 13.686  1.675   40.411  1.00 33.75 ? 487  GLU A C     1 
ATOM   1428 O O     . GLU A 1 191 ? 14.623  0.983   40.790  1.00 33.62 ? 487  GLU A O     1 
ATOM   1429 C CB    . GLU A 1 191 ? 11.477  1.341   41.584  1.00 34.45 ? 487  GLU A CB    1 
ATOM   1430 C CG    . GLU A 1 191 ? 10.907  1.309   43.010  1.00 35.87 ? 487  GLU A CG    1 
ATOM   1431 C CD    . GLU A 1 191 ? 9.391   1.114   43.067  1.00 38.34 ? 487  GLU A CD    1 
ATOM   1432 O OE1   . GLU A 1 191 ? 8.855   0.237   42.351  1.00 40.30 ? 487  GLU A OE1   1 
ATOM   1433 O OE2   . GLU A 1 191 ? 8.730   1.837   43.847  1.00 39.78 ? 487  GLU A OE2   1 
ATOM   1434 N N     . MET A 1 192 ? 13.472  1.957   39.131  1.00 33.70 ? 488  MET A N     1 
ATOM   1435 C CA    . MET A 1 192 ? 14.328  1.424   38.059  1.00 33.82 ? 488  MET A CA    1 
ATOM   1436 C C     . MET A 1 192 ? 15.719  2.065   38.102  1.00 33.54 ? 488  MET A C     1 
ATOM   1437 O O     . MET A 1 192 ? 16.735  1.390   37.935  1.00 33.54 ? 488  MET A O     1 
ATOM   1438 C CB    . MET A 1 192 ? 13.700  1.639   36.661  1.00 33.94 ? 488  MET A CB    1 
ATOM   1439 C CG    . MET A 1 192 ? 12.163  1.496   36.586  1.00 34.59 ? 488  MET A CG    1 
ATOM   1440 S SD    . MET A 1 192 ? 11.387  1.125   34.982  1.00 36.05 ? 488  MET A SD    1 
ATOM   1441 C CE    . MET A 1 192 ? 12.469  1.938   33.803  1.00 35.82 ? 488  MET A CE    1 
ATOM   1442 N N     . GLU A 1 193 ? 15.747  3.375   38.318  1.00 33.25 ? 489  GLU A N     1 
ATOM   1443 C CA    . GLU A 1 193 ? 16.997  4.122   38.425  1.00 32.93 ? 489  GLU A CA    1 
ATOM   1444 C C     . GLU A 1 193 ? 17.821  3.636   39.610  1.00 32.71 ? 489  GLU A C     1 
ATOM   1445 O O     . GLU A 1 193 ? 19.007  3.348   39.473  1.00 32.32 ? 489  GLU A O     1 
ATOM   1446 C CB    . GLU A 1 193 ? 16.716  5.620   38.585  1.00 32.89 ? 489  GLU A CB    1 
ATOM   1447 C CG    . GLU A 1 193 ? 16.041  6.282   37.384  1.00 32.81 ? 489  GLU A CG    1 
ATOM   1448 C CD    . GLU A 1 193 ? 15.956  7.795   37.517  1.00 32.70 ? 489  GLU A CD    1 
ATOM   1449 O OE1   . GLU A 1 193 ? 16.356  8.322   38.572  1.00 32.73 ? 489  GLU A OE1   1 
ATOM   1450 O OE2   . GLU A 1 193 ? 15.496  8.467   36.569  1.00 32.78 ? 489  GLU A OE2   1 
ATOM   1451 N N     . PHE A 1 194 ? 17.172  3.559   40.769  1.00 32.64 ? 490  PHE A N     1 
ATOM   1452 C CA    . PHE A 1 194 ? 17.819  3.144   42.011  1.00 32.64 ? 490  PHE A CA    1 
ATOM   1453 C C     . PHE A 1 194 ? 18.298  1.698   41.954  1.00 32.56 ? 490  PHE A C     1 
ATOM   1454 O O     . PHE A 1 194 ? 19.339  1.363   42.516  1.00 32.51 ? 490  PHE A O     1 
ATOM   1455 C CB    . PHE A 1 194 ? 16.868  3.319   43.198  1.00 32.66 ? 490  PHE A CB    1 
ATOM   1456 C CG    . PHE A 1 194 ? 17.484  2.968   44.525  1.00 33.06 ? 490  PHE A CG    1 
ATOM   1457 C CD1   . PHE A 1 194 ? 18.629  3.618   44.964  1.00 33.91 ? 490  PHE A CD1   1 
ATOM   1458 C CD2   . PHE A 1 194 ? 16.919  1.997   45.340  1.00 33.08 ? 490  PHE A CD2   1 
ATOM   1459 C CE1   . PHE A 1 194 ? 19.205  3.302   46.185  1.00 34.04 ? 490  PHE A CE1   1 
ATOM   1460 C CE2   . PHE A 1 194 ? 17.490  1.675   46.561  1.00 33.34 ? 490  PHE A CE2   1 
ATOM   1461 C CZ    . PHE A 1 194 ? 18.636  2.327   46.983  1.00 33.74 ? 490  PHE A CZ    1 
ATOM   1462 N N     . ALA A 1 195 ? 17.527  0.846   41.287  1.00 32.51 ? 491  ALA A N     1 
ATOM   1463 C CA    . ALA A 1 195 ? 17.895  -0.555  41.119  1.00 32.40 ? 491  ALA A CA    1 
ATOM   1464 C C     . ALA A 1 195 ? 19.219  -0.653  40.375  1.00 32.43 ? 491  ALA A C     1 
ATOM   1465 O O     . ALA A 1 195 ? 20.138  -1.346  40.803  1.00 32.69 ? 491  ALA A O     1 
ATOM   1466 C CB    . ALA A 1 195 ? 16.814  -1.299  40.370  1.00 32.38 ? 491  ALA A CB    1 
ATOM   1467 N N     . GLY A 1 196 ? 19.317  0.053   39.259  1.00 32.42 ? 492  GLY A N     1 
ATOM   1468 C CA    . GLY A 1 196 ? 20.557  0.083   38.487  1.00 32.41 ? 492  GLY A CA    1 
ATOM   1469 C C     . GLY A 1 196 ? 20.773  -1.192  37.695  1.00 32.41 ? 492  GLY A C     1 
ATOM   1470 O O     . GLY A 1 196 ? 20.100  -2.202  37.924  1.00 32.35 ? 492  GLY A O     1 
ATOM   1471 N N     . VAL A 1 197 ? 21.715  -1.140  36.758  1.00 32.36 ? 493  VAL A N     1 
ATOM   1472 C CA    . VAL A 1 197 ? 22.019  -2.285  35.906  1.00 32.39 ? 493  VAL A CA    1 
ATOM   1473 C C     . VAL A 1 197 ? 23.455  -2.763  36.109  1.00 32.50 ? 493  VAL A C     1 
ATOM   1474 O O     . VAL A 1 197 ? 24.407  -2.006  35.940  1.00 32.57 ? 493  VAL A O     1 
ATOM   1475 C CB    . VAL A 1 197 ? 21.760  -1.952  34.431  1.00 32.40 ? 493  VAL A CB    1 
ATOM   1476 C CG1   . VAL A 1 197 ? 22.574  -2.848  33.526  1.00 32.53 ? 493  VAL A CG1   1 
ATOM   1477 C CG2   . VAL A 1 197 ? 20.271  -2.082  34.119  1.00 32.27 ? 493  VAL A CG2   1 
ATOM   1478 N N     . LYS A 1 198 ? 23.592  -4.032  36.471  1.00 32.69 ? 494  LYS A N     1 
ATOM   1479 C CA    . LYS A 1 198 ? 24.888  -4.614  36.806  1.00 33.01 ? 494  LYS A CA    1 
ATOM   1480 C C     . LYS A 1 198 ? 25.792  -4.734  35.577  1.00 32.94 ? 494  LYS A C     1 
ATOM   1481 O O     . LYS A 1 198 ? 25.392  -5.266  34.542  1.00 32.79 ? 494  LYS A O     1 
ATOM   1482 C CB    . LYS A 1 198 ? 24.683  -5.982  37.482  1.00 33.24 ? 494  LYS A CB    1 
ATOM   1483 C CG    . LYS A 1 198 ? 25.945  -6.704  37.982  1.00 33.73 ? 494  LYS A CG    1 
ATOM   1484 C CD    . LYS A 1 198 ? 26.757  -5.847  38.946  1.00 34.93 ? 494  LYS A CD    1 
ATOM   1485 C CE    . LYS A 1 198 ? 27.065  -6.569  40.250  1.00 35.83 ? 494  LYS A CE    1 
ATOM   1486 N NZ    . LYS A 1 198 ? 25.847  -6.648  41.132  1.00 36.70 ? 494  LYS A NZ    1 
ATOM   1487 N N     . VAL A 1 199 ? 27.013  -4.228  35.709  1.00 33.01 ? 495  VAL A N     1 
ATOM   1488 C CA    . VAL A 1 199 ? 27.997  -4.274  34.636  1.00 33.17 ? 495  VAL A CA    1 
ATOM   1489 C C     . VAL A 1 199 ? 29.174  -5.174  34.983  1.00 33.37 ? 495  VAL A C     1 
ATOM   1490 O O     . VAL A 1 199 ? 29.773  -5.047  36.045  1.00 33.23 ? 495  VAL A O     1 
ATOM   1491 C CB    . VAL A 1 199 ? 28.547  -2.870  34.326  1.00 33.22 ? 495  VAL A CB    1 
ATOM   1492 C CG1   . VAL A 1 199 ? 29.846  -2.950  33.511  1.00 32.81 ? 495  VAL A CG1   1 
ATOM   1493 C CG2   . VAL A 1 199 ? 27.500  -2.057  33.600  1.00 33.47 ? 495  VAL A CG2   1 
ATOM   1494 N N     . ASP A 1 200 ? 29.501  -6.076  34.067  1.00 33.81 ? 496  ASP A N     1 
ATOM   1495 C CA    . ASP A 1 200 ? 30.727  -6.861  34.148  1.00 34.26 ? 496  ASP A CA    1 
ATOM   1496 C C     . ASP A 1 200 ? 31.901  -6.021  33.623  1.00 34.39 ? 496  ASP A C     1 
ATOM   1497 O O     . ASP A 1 200 ? 32.129  -5.923  32.416  1.00 34.19 ? 496  ASP A O     1 
ATOM   1498 C CB    . ASP A 1 200 ? 30.568  -8.164  33.357  1.00 34.39 ? 496  ASP A CB    1 
ATOM   1499 C CG    . ASP A 1 200 ? 31.853  -8.994  33.310  1.00 35.11 ? 496  ASP A CG    1 
ATOM   1500 O OD1   . ASP A 1 200 ? 32.878  -8.600  33.927  1.00 35.68 ? 496  ASP A OD1   1 
ATOM   1501 O OD2   . ASP A 1 200 ? 31.829  -10.055 32.647  1.00 36.10 ? 496  ASP A OD2   1 
ATOM   1502 N N     . THR A 1 201 ? 32.649  -5.426  34.545  1.00 34.78 ? 497  THR A N     1 
ATOM   1503 C CA    . THR A 1 201 ? 33.684  -4.461  34.178  1.00 35.15 ? 497  THR A CA    1 
ATOM   1504 C C     . THR A 1 201 ? 34.889  -5.139  33.524  1.00 35.48 ? 497  THR A C     1 
ATOM   1505 O O     . THR A 1 201 ? 35.463  -4.595  32.580  1.00 35.66 ? 497  THR A O     1 
ATOM   1506 C CB    . THR A 1 201 ? 34.176  -3.616  35.379  1.00 35.05 ? 497  THR A CB    1 
ATOM   1507 O OG1   . THR A 1 201 ? 35.278  -4.266  36.017  1.00 35.48 ? 497  THR A OG1   1 
ATOM   1508 C CG2   . THR A 1 201 ? 33.063  -3.375  36.384  1.00 35.17 ? 497  THR A CG2   1 
ATOM   1509 N N     . LYS A 1 202 ? 35.268  -6.316  34.028  1.00 35.78 ? 498  LYS A N     1 
ATOM   1510 C CA    . LYS A 1 202 ? 36.423  -7.056  33.489  1.00 35.84 ? 498  LYS A CA    1 
ATOM   1511 C C     . LYS A 1 202 ? 36.201  -7.438  32.026  1.00 35.90 ? 498  LYS A C     1 
ATOM   1512 O O     . LYS A 1 202 ? 37.126  -7.383  31.218  1.00 36.07 ? 498  LYS A O     1 
ATOM   1513 C CB    . LYS A 1 202 ? 36.720  -8.308  34.319  1.00 35.81 ? 498  LYS A CB    1 
ATOM   1514 N N     . ARG A 1 203 ? 34.977  -7.821  31.689  1.00 35.95 ? 499  ARG A N     1 
ATOM   1515 C CA    . ARG A 1 203 ? 34.617  -8.054  30.298  1.00 36.17 ? 499  ARG A CA    1 
ATOM   1516 C C     . ARG A 1 203 ? 34.965  -6.818  29.466  1.00 36.03 ? 499  ARG A C     1 
ATOM   1517 O O     . ARG A 1 203 ? 35.694  -6.917  28.485  1.00 35.90 ? 499  ARG A O     1 
ATOM   1518 C CB    . ARG A 1 203 ? 33.128  -8.411  30.179  1.00 36.34 ? 499  ARG A CB    1 
ATOM   1519 C CG    . ARG A 1 203 ? 32.525  -8.247  28.789  1.00 37.71 ? 499  ARG A CG    1 
ATOM   1520 C CD    . ARG A 1 203 ? 33.104  -9.230  27.776  1.00 39.41 ? 499  ARG A CD    1 
ATOM   1521 N NE    . ARG A 1 203 ? 32.454  -10.536 27.852  1.00 40.50 ? 499  ARG A NE    1 
ATOM   1522 C CZ    . ARG A 1 203 ? 32.495  -11.466 26.898  1.00 41.93 ? 499  ARG A CZ    1 
ATOM   1523 N NH1   . ARG A 1 203 ? 33.157  -11.257 25.756  1.00 42.42 ? 499  ARG A NH1   1 
ATOM   1524 N NH2   . ARG A 1 203 ? 31.860  -12.620 27.084  1.00 42.53 ? 499  ARG A NH2   1 
ATOM   1525 N N     . LEU A 1 204 ? 34.451  -5.660  29.878  1.00 36.16 ? 500  LEU A N     1 
ATOM   1526 C CA    . LEU A 1 204 ? 34.664  -4.395  29.151  1.00 36.30 ? 500  LEU A CA    1 
ATOM   1527 C C     . LEU A 1 204 ? 36.138  -4.025  28.992  1.00 36.29 ? 500  LEU A C     1 
ATOM   1528 O O     . LEU A 1 204 ? 36.593  -3.682  27.900  1.00 36.30 ? 500  LEU A O     1 
ATOM   1529 C CB    . LEU A 1 204 ? 33.942  -3.230  29.850  1.00 36.31 ? 500  LEU A CB    1 
ATOM   1530 C CG    . LEU A 1 204 ? 32.461  -2.995  29.540  1.00 36.52 ? 500  LEU A CG    1 
ATOM   1531 C CD1   . LEU A 1 204 ? 32.101  -1.546  29.848  1.00 36.68 ? 500  LEU A CD1   1 
ATOM   1532 C CD2   . LEU A 1 204 ? 32.117  -3.323  28.088  1.00 36.75 ? 500  LEU A CD2   1 
ATOM   1533 N N     . GLU A 1 205 ? 36.862  -4.067  30.101  1.00 36.29 ? 501  GLU A N     1 
ATOM   1534 C CA    . GLU A 1 205 ? 38.294  -3.775  30.113  1.00 36.42 ? 501  GLU A CA    1 
ATOM   1535 C C     . GLU A 1 205 ? 39.068  -4.672  29.152  1.00 36.12 ? 501  GLU A C     1 
ATOM   1536 O O     . GLU A 1 205 ? 39.995  -4.208  28.479  1.00 36.17 ? 501  GLU A O     1 
ATOM   1537 C CB    . GLU A 1 205 ? 38.859  -3.923  31.528  1.00 36.71 ? 501  GLU A CB    1 
ATOM   1538 C CG    . GLU A 1 205 ? 38.664  -2.688  32.404  1.00 38.04 ? 501  GLU A CG    1 
ATOM   1539 C CD    . GLU A 1 205 ? 38.526  -3.019  33.888  1.00 40.46 ? 501  GLU A CD    1 
ATOM   1540 O OE1   . GLU A 1 205 ? 38.814  -4.173  34.289  1.00 41.88 ? 501  GLU A OE1   1 
ATOM   1541 O OE2   . GLU A 1 205 ? 38.107  -2.122  34.657  1.00 41.95 ? 501  GLU A OE2   1 
ATOM   1542 N N     . GLN A 1 206 ? 38.692  -5.950  29.096  1.00 35.73 ? 502  GLN A N     1 
ATOM   1543 C CA    . GLN A 1 206 ? 39.249  -6.873  28.103  1.00 35.58 ? 502  GLN A CA    1 
ATOM   1544 C C     . GLN A 1 206 ? 38.948  -6.353  26.697  1.00 35.41 ? 502  GLN A C     1 
ATOM   1545 O O     . GLN A 1 206 ? 39.866  -6.086  25.919  1.00 35.51 ? 502  GLN A O     1 
ATOM   1546 C CB    . GLN A 1 206 ? 38.679  -8.285  28.280  1.00 35.58 ? 502  GLN A CB    1 
ATOM   1547 N N     . MET A 1 207 ? 37.664  -6.169  26.397  1.00 35.16 ? 503  MET A N     1 
ATOM   1548 C CA    . MET A 1 207 ? 37.239  -5.576  25.126  1.00 34.98 ? 503  MET A CA    1 
ATOM   1549 C C     . MET A 1 207 ? 38.012  -4.291  24.841  1.00 34.81 ? 503  MET A C     1 
ATOM   1550 O O     . MET A 1 207 ? 38.389  -4.024  23.703  1.00 34.83 ? 503  MET A O     1 
ATOM   1551 C CB    . MET A 1 207 ? 35.736  -5.285  25.137  1.00 35.00 ? 503  MET A CB    1 
ATOM   1552 C CG    . MET A 1 207 ? 34.853  -6.528  25.062  1.00 35.46 ? 503  MET A CG    1 
ATOM   1553 S SD    . MET A 1 207 ? 33.070  -6.162  25.102  1.00 36.89 ? 503  MET A SD    1 
ATOM   1554 C CE    . MET A 1 207 ? 32.366  -7.763  24.684  1.00 35.97 ? 503  MET A CE    1 
ATOM   1555 N N     . GLY A 1 208 ? 38.247  -3.507  25.888  1.00 34.73 ? 504  GLY A N     1 
ATOM   1556 C CA    . GLY A 1 208 ? 39.049  -2.291  25.797  1.00 34.73 ? 504  GLY A CA    1 
ATOM   1557 C C     . GLY A 1 208 ? 40.395  -2.537  25.154  1.00 34.78 ? 504  GLY A C     1 
ATOM   1558 O O     . GLY A 1 208 ? 40.730  -1.901  24.147  1.00 34.89 ? 504  GLY A O     1 
ATOM   1559 N N     . GLU A 1 209 ? 41.151  -3.476  25.726  1.00 34.80 ? 505  GLU A N     1 
ATOM   1560 C CA    . GLU A 1 209 ? 42.494  -3.823  25.234  1.00 34.84 ? 505  GLU A CA    1 
ATOM   1561 C C     . GLU A 1 209 ? 42.473  -4.294  23.771  1.00 34.79 ? 505  GLU A C     1 
ATOM   1562 O O     . GLU A 1 209 ? 43.326  -3.891  22.977  1.00 34.79 ? 505  GLU A O     1 
ATOM   1563 C CB    . GLU A 1 209 ? 43.132  -4.893  26.131  1.00 34.81 ? 505  GLU A CB    1 
ATOM   1564 N N     . GLU A 1 210 ? 41.494  -5.137  23.435  1.00 34.74 ? 506  GLU A N     1 
ATOM   1565 C CA    . GLU A 1 210 ? 41.296  -5.620  22.063  1.00 34.75 ? 506  GLU A CA    1 
ATOM   1566 C C     . GLU A 1 210 ? 41.046  -4.458  21.100  1.00 34.82 ? 506  GLU A C     1 
ATOM   1567 O O     . GLU A 1 210 ? 41.783  -4.288  20.129  1.00 34.78 ? 506  GLU A O     1 
ATOM   1568 C CB    . GLU A 1 210 ? 40.135  -6.617  22.002  1.00 34.74 ? 506  GLU A CB    1 
ATOM   1569 N N     . LEU A 1 211 ? 40.016  -3.662  21.386  1.00 34.97 ? 507  LEU A N     1 
ATOM   1570 C CA    . LEU A 1 211 ? 39.671  -2.484  20.571  1.00 35.16 ? 507  LEU A CA    1 
ATOM   1571 C C     . LEU A 1 211 ? 40.834  -1.516  20.420  1.00 35.38 ? 507  LEU A C     1 
ATOM   1572 O O     . LEU A 1 211 ? 41.089  -1.003  19.330  1.00 35.45 ? 507  LEU A O     1 
ATOM   1573 C CB    . LEU A 1 211 ? 38.479  -1.734  21.174  1.00 35.20 ? 507  LEU A CB    1 
ATOM   1574 C CG    . LEU A 1 211 ? 37.119  -2.164  20.625  1.00 35.16 ? 507  LEU A CG    1 
ATOM   1575 C CD1   . LEU A 1 211 ? 35.999  -1.832  21.597  1.00 35.45 ? 507  LEU A CD1   1 
ATOM   1576 C CD2   . LEU A 1 211 ? 36.870  -1.513  19.276  1.00 35.12 ? 507  LEU A CD2   1 
ATOM   1577 N N     . ALA A 1 212 ? 41.513  -1.252  21.531  1.00 35.68 ? 508  ALA A N     1 
ATOM   1578 C CA    . ALA A 1 212 ? 42.718  -0.423  21.534  1.00 35.94 ? 508  ALA A CA    1 
ATOM   1579 C C     . ALA A 1 212 ? 43.727  -0.942  20.511  1.00 36.22 ? 508  ALA A C     1 
ATOM   1580 O O     . ALA A 1 212 ? 44.188  -0.206  19.644  1.00 36.06 ? 508  ALA A O     1 
ATOM   1581 C CB    . ALA A 1 212 ? 43.338  -0.414  22.920  1.00 35.87 ? 508  ALA A CB    1 
ATOM   1582 N N     . GLU A 1 213 ? 44.046  -2.223  20.618  1.00 36.71 ? 509  GLU A N     1 
ATOM   1583 C CA    . GLU A 1 213 ? 44.996  -2.854  19.718  1.00 37.28 ? 509  GLU A CA    1 
ATOM   1584 C C     . GLU A 1 213 ? 44.617  -2.588  18.259  1.00 37.25 ? 509  GLU A C     1 
ATOM   1585 O O     . GLU A 1 213 ? 45.405  -2.006  17.510  1.00 37.58 ? 509  GLU A O     1 
ATOM   1586 C CB    . GLU A 1 213 ? 45.074  -4.359  19.992  1.00 37.61 ? 509  GLU A CB    1 
ATOM   1587 C CG    . GLU A 1 213 ? 46.402  -5.005  19.570  1.00 39.19 ? 509  GLU A CG    1 
ATOM   1588 C CD    . GLU A 1 213 ? 46.768  -6.243  20.408  1.00 41.27 ? 509  GLU A CD    1 
ATOM   1589 O OE1   . GLU A 1 213 ? 45.961  -6.644  21.288  1.00 41.98 ? 509  GLU A OE1   1 
ATOM   1590 O OE2   . GLU A 1 213 ? 47.873  -6.806  20.189  1.00 42.04 ? 509  GLU A OE2   1 
ATOM   1591 N N     . GLN A 1 214 ? 43.406  -2.986  17.872  1.00 37.00 ? 510  GLN A N     1 
ATOM   1592 C CA    . GLN A 1 214 ? 42.942  -2.823  16.488  1.00 36.84 ? 510  GLN A CA    1 
ATOM   1593 C C     . GLN A 1 214 ? 43.025  -1.375  16.019  1.00 36.66 ? 510  GLN A C     1 
ATOM   1594 O O     . GLN A 1 214 ? 43.301  -1.117  14.848  1.00 36.81 ? 510  GLN A O     1 
ATOM   1595 C CB    . GLN A 1 214 ? 41.499  -3.295  16.315  1.00 36.89 ? 510  GLN A CB    1 
ATOM   1596 C CG    . GLN A 1 214 ? 41.200  -4.646  16.929  1.00 37.34 ? 510  GLN A CG    1 
ATOM   1597 C CD    . GLN A 1 214 ? 40.235  -5.477  16.109  1.00 38.24 ? 510  GLN A CD    1 
ATOM   1598 O OE1   . GLN A 1 214 ? 40.220  -6.706  16.216  1.00 39.07 ? 510  GLN A OE1   1 
ATOM   1599 N NE2   . GLN A 1 214 ? 39.426  -4.818  15.281  1.00 38.45 ? 510  GLN A NE2   1 
ATOM   1600 N N     . LEU A 1 215 ? 42.762  -0.435  16.923  1.00 36.41 ? 511  LEU A N     1 
ATOM   1601 C CA    . LEU A 1 215 ? 42.816  0.986   16.572  1.00 36.20 ? 511  LEU A CA    1 
ATOM   1602 C C     . LEU A 1 215 ? 44.213  1.388   16.131  1.00 36.08 ? 511  LEU A C     1 
ATOM   1603 O O     . LEU A 1 215 ? 44.379  1.960   15.058  1.00 36.24 ? 511  LEU A O     1 
ATOM   1604 C CB    . LEU A 1 215 ? 42.354  1.886   17.725  1.00 36.15 ? 511  LEU A CB    1 
ATOM   1605 C CG    . LEU A 1 215 ? 40.861  2.230   17.761  1.00 35.95 ? 511  LEU A CG    1 
ATOM   1606 C CD1   . LEU A 1 215 ? 40.606  3.418   18.675  1.00 36.09 ? 511  LEU A CD1   1 
ATOM   1607 C CD2   . LEU A 1 215 ? 40.320  2.527   16.376  1.00 35.81 ? 511  LEU A CD2   1 
ATOM   1608 N N     . ARG A 1 216 ? 45.212  1.083   16.953  1.00 35.86 ? 512  ARG A N     1 
ATOM   1609 C CA    . ARG A 1 216 ? 46.600  1.390   16.606  1.00 35.63 ? 512  ARG A CA    1 
ATOM   1610 C C     . ARG A 1 216 ? 46.972  0.741   15.264  1.00 35.45 ? 512  ARG A C     1 
ATOM   1611 O O     . ARG A 1 216 ? 47.666  1.348   14.446  1.00 35.30 ? 512  ARG A O     1 
ATOM   1612 C CB    . ARG A 1 216 ? 47.556  0.942   17.717  1.00 35.52 ? 512  ARG A CB    1 
ATOM   1613 N N     . THR A 1 217 ? 46.492  -0.482  15.041  1.00 35.27 ? 513  THR A N     1 
ATOM   1614 C CA    . THR A 1 217 ? 46.675  -1.158  13.753  1.00 35.40 ? 513  THR A CA    1 
ATOM   1615 C C     . THR A 1 217 ? 46.053  -0.322  12.622  1.00 35.50 ? 513  THR A C     1 
ATOM   1616 O O     . THR A 1 217 ? 46.750  0.074   11.683  1.00 35.57 ? 513  THR A O     1 
ATOM   1617 C CB    . THR A 1 217 ? 46.056  -2.596  13.748  1.00 35.42 ? 513  THR A CB    1 
ATOM   1618 O OG1   . THR A 1 217 ? 46.532  -3.347  14.875  1.00 35.48 ? 513  THR A OG1   1 
ATOM   1619 C CG2   . THR A 1 217 ? 46.395  -3.346  12.458  1.00 35.20 ? 513  THR A CG2   1 
ATOM   1620 N N     . VAL A 1 218 ? 44.755  -0.037  12.740  1.00 35.52 ? 514  VAL A N     1 
ATOM   1621 C CA    . VAL A 1 218 ? 44.011  0.709   11.713  1.00 35.45 ? 514  VAL A CA    1 
ATOM   1622 C C     . VAL A 1 218 ? 44.554  2.122   11.541  1.00 35.55 ? 514  VAL A C     1 
ATOM   1623 O O     . VAL A 1 218 ? 44.857  2.530   10.431  1.00 35.50 ? 514  VAL A O     1 
ATOM   1624 C CB    . VAL A 1 218 ? 42.469  0.743   12.006  1.00 35.47 ? 514  VAL A CB    1 
ATOM   1625 C CG1   . VAL A 1 218 ? 41.794  1.990   11.413  1.00 34.96 ? 514  VAL A CG1   1 
ATOM   1626 C CG2   . VAL A 1 218 ? 41.810  -0.513  11.470  1.00 35.38 ? 514  VAL A CG2   1 
ATOM   1627 N N     . GLU A 1 219 ? 44.696  2.861   12.633  1.00 35.87 ? 515  GLU A N     1 
ATOM   1628 C CA    . GLU A 1 219 ? 45.150  4.254   12.544  1.00 36.32 ? 515  GLU A CA    1 
ATOM   1629 C C     . GLU A 1 219 ? 46.499  4.339   11.825  1.00 36.62 ? 515  GLU A C     1 
ATOM   1630 O O     . GLU A 1 219 ? 46.692  5.190   10.954  1.00 36.54 ? 515  GLU A O     1 
ATOM   1631 C CB    . GLU A 1 219 ? 45.202  4.923   13.933  1.00 36.44 ? 515  GLU A CB    1 
ATOM   1632 C CG    . GLU A 1 219 ? 46.577  5.319   14.477  1.00 37.12 ? 515  GLU A CG    1 
ATOM   1633 C CD    . GLU A 1 219 ? 46.496  5.843   15.914  1.00 38.26 ? 515  GLU A CD    1 
ATOM   1634 O OE1   . GLU A 1 219 ? 46.171  5.039   16.819  1.00 38.35 ? 515  GLU A OE1   1 
ATOM   1635 O OE2   . GLU A 1 219 ? 46.758  7.049   16.139  1.00 38.67 ? 515  GLU A OE2   1 
ATOM   1636 N N     . GLN A 1 220 ? 47.406  3.427   12.183  1.00 37.10 ? 516  GLN A N     1 
ATOM   1637 C CA    . GLN A 1 220 ? 48.761  3.369   11.619  1.00 37.30 ? 516  GLN A CA    1 
ATOM   1638 C C     . GLN A 1 220 ? 48.723  3.139   10.114  1.00 37.55 ? 516  GLN A C     1 
ATOM   1639 O O     . GLN A 1 220 ? 49.515  3.722   9.362   1.00 37.52 ? 516  GLN A O     1 
ATOM   1640 C CB    . GLN A 1 220 ? 49.567  2.254   12.287  1.00 37.39 ? 516  GLN A CB    1 
ATOM   1641 N N     . ARG A 1 221 ? 47.797  2.283   9.688   1.00 37.86 ? 517  ARG A N     1 
ATOM   1642 C CA    . ARG A 1 221 ? 47.535  2.065   8.267   1.00 38.15 ? 517  ARG A CA    1 
ATOM   1643 C C     . ARG A 1 221 ? 47.164  3.371   7.567   1.00 38.00 ? 517  ARG A C     1 
ATOM   1644 O O     . ARG A 1 221 ? 47.582  3.612   6.433   1.00 38.11 ? 517  ARG A O     1 
ATOM   1645 C CB    . ARG A 1 221 ? 46.417  1.029   8.067   1.00 38.31 ? 517  ARG A CB    1 
ATOM   1646 C CG    . ARG A 1 221 ? 46.190  0.611   6.626   1.00 39.75 ? 517  ARG A CG    1 
ATOM   1647 C CD    . ARG A 1 221 ? 47.474  0.095   5.989   1.00 42.23 ? 517  ARG A CD    1 
ATOM   1648 N NE    . ARG A 1 221 ? 47.397  -0.053  4.534   1.00 43.99 ? 517  ARG A NE    1 
ATOM   1649 C CZ    . ARG A 1 221 ? 48.458  -0.100  3.724   1.00 45.46 ? 517  ARG A CZ    1 
ATOM   1650 N NH1   . ARG A 1 221 ? 49.700  -0.003  4.212   1.00 45.64 ? 517  ARG A NH1   1 
ATOM   1651 N NH2   . ARG A 1 221 ? 48.279  -0.238  2.414   1.00 45.97 ? 517  ARG A NH2   1 
ATOM   1652 N N     . ILE A 1 222 ? 46.388  4.212   8.247   1.00 37.88 ? 518  ILE A N     1 
ATOM   1653 C CA    . ILE A 1 222 ? 45.929  5.459   7.654   1.00 37.86 ? 518  ILE A CA    1 
ATOM   1654 C C     . ILE A 1 222 ? 47.116  6.380   7.406   1.00 37.96 ? 518  ILE A C     1 
ATOM   1655 O O     . ILE A 1 222 ? 47.292  6.865   6.293   1.00 38.12 ? 518  ILE A O     1 
ATOM   1656 C CB    . ILE A 1 222 ? 44.817  6.143   8.491   1.00 37.85 ? 518  ILE A CB    1 
ATOM   1657 C CG1   . ILE A 1 222 ? 43.576  5.240   8.538   1.00 37.67 ? 518  ILE A CG1   1 
ATOM   1658 C CG2   . ILE A 1 222 ? 44.432  7.494   7.882   1.00 37.59 ? 518  ILE A CG2   1 
ATOM   1659 C CD1   . ILE A 1 222 ? 42.437  5.770   9.402   1.00 37.34 ? 518  ILE A CD1   1 
ATOM   1660 N N     . TYR A 1 223 ? 47.953  6.583   8.414   1.00 38.11 ? 519  TYR A N     1 
ATOM   1661 C CA    . TYR A 1 223 ? 49.131  7.440   8.247   1.00 38.30 ? 519  TYR A CA    1 
ATOM   1662 C C     . TYR A 1 223 ? 50.014  6.971   7.100   1.00 38.06 ? 519  TYR A C     1 
ATOM   1663 O O     . TYR A 1 223 ? 50.556  7.789   6.355   1.00 37.93 ? 519  TYR A O     1 
ATOM   1664 C CB    . TYR A 1 223 ? 49.950  7.520   9.538   1.00 38.48 ? 519  TYR A CB    1 
ATOM   1665 C CG    . TYR A 1 223 ? 49.166  8.045   10.716  1.00 39.83 ? 519  TYR A CG    1 
ATOM   1666 C CD1   . TYR A 1 223 ? 48.165  9.005   10.542  1.00 41.14 ? 519  TYR A CD1   1 
ATOM   1667 C CD2   . TYR A 1 223 ? 49.417  7.582   12.008  1.00 41.07 ? 519  TYR A CD2   1 
ATOM   1668 C CE1   . TYR A 1 223 ? 47.439  9.486   11.617  1.00 41.98 ? 519  TYR A CE1   1 
ATOM   1669 C CE2   . TYR A 1 223 ? 48.695  8.065   13.099  1.00 41.95 ? 519  TYR A CE2   1 
ATOM   1670 C CZ    . TYR A 1 223 ? 47.707  9.018   12.897  1.00 42.56 ? 519  TYR A CZ    1 
ATOM   1671 O OH    . TYR A 1 223 ? 46.984  9.504   13.968  1.00 43.54 ? 519  TYR A OH    1 
ATOM   1672 N N     . GLU A 1 224 ? 50.146  5.653   6.969   1.00 37.90 ? 520  GLU A N     1 
ATOM   1673 C CA    . GLU A 1 224 ? 50.835  5.044   5.834   1.00 37.82 ? 520  GLU A CA    1 
ATOM   1674 C C     . GLU A 1 224 ? 50.188  5.464   4.511   1.00 37.66 ? 520  GLU A C     1 
ATOM   1675 O O     . GLU A 1 224 ? 50.870  5.956   3.619   1.00 37.77 ? 520  GLU A O     1 
ATOM   1676 C CB    . GLU A 1 224 ? 50.816  3.516   5.961   1.00 37.81 ? 520  GLU A CB    1 
ATOM   1677 N N     . LEU A 1 225 ? 48.874  5.286   4.405   1.00 37.46 ? 521  LEU A N     1 
ATOM   1678 C CA    . LEU A 1 225 ? 48.131  5.631   3.185   1.00 37.39 ? 521  LEU A CA    1 
ATOM   1679 C C     . LEU A 1 225 ? 48.052  7.143   2.940   1.00 37.39 ? 521  LEU A C     1 
ATOM   1680 O O     . LEU A 1 225 ? 48.242  7.608   1.814   1.00 37.46 ? 521  LEU A O     1 
ATOM   1681 C CB    . LEU A 1 225 ? 46.721  5.030   3.234   1.00 37.44 ? 521  LEU A CB    1 
ATOM   1682 C CG    . LEU A 1 225 ? 46.629  3.555   2.805   1.00 37.41 ? 521  LEU A CG    1 
ATOM   1683 C CD1   . LEU A 1 225 ? 45.835  2.718   3.787   1.00 37.63 ? 521  LEU A CD1   1 
ATOM   1684 C CD2   . LEU A 1 225 ? 46.023  3.431   1.418   1.00 37.30 ? 521  LEU A CD2   1 
ATOM   1685 N N     . ALA A 1 226 ? 47.776  7.897   4.000   1.00 37.39 ? 522  ALA A N     1 
ATOM   1686 C CA    . ALA A 1 226 ? 47.723  9.369   3.947   1.00 37.40 ? 522  ALA A CA    1 
ATOM   1687 C C     . ALA A 1 226 ? 49.066  10.036  3.584   1.00 37.41 ? 522  ALA A C     1 
ATOM   1688 O O     . ALA A 1 226 ? 49.107  11.228  3.257   1.00 37.46 ? 522  ALA A O     1 
ATOM   1689 C CB    . ALA A 1 226 ? 47.209  9.924   5.280   1.00 37.34 ? 522  ALA A CB    1 
ATOM   1690 N N     . GLY A 1 227 ? 50.156  9.277   3.666   1.00 37.41 ? 523  GLY A N     1 
ATOM   1691 C CA    . GLY A 1 227 ? 51.483  9.785   3.308   1.00 37.41 ? 523  GLY A CA    1 
ATOM   1692 C C     . GLY A 1 227 ? 52.090  10.661  4.385   1.00 37.40 ? 523  GLY A C     1 
ATOM   1693 O O     . GLY A 1 227 ? 53.139  11.258  4.176   1.00 37.29 ? 523  GLY A O     1 
ATOM   1694 N N     . GLN A 1 228 ? 51.419  10.737  5.532   1.00 37.64 ? 524  GLN A N     1 
ATOM   1695 C CA    . GLN A 1 228 ? 51.912  11.475  6.699   1.00 38.01 ? 524  GLN A CA    1 
ATOM   1696 C C     . GLN A 1 228 ? 51.018  11.190  7.919   1.00 38.19 ? 524  GLN A C     1 
ATOM   1697 O O     . GLN A 1 228 ? 50.113  10.361  7.843   1.00 38.60 ? 524  GLN A O     1 
ATOM   1698 C CB    . GLN A 1 228 ? 51.978  12.983  6.407   1.00 38.04 ? 524  GLN A CB    1 
ATOM   1699 C CG    . GLN A 1 228 ? 50.631  13.660  6.194   1.00 38.38 ? 524  GLN A CG    1 
ATOM   1700 C CD    . GLN A 1 228 ? 50.762  15.166  6.084   1.00 38.55 ? 524  GLN A CD    1 
ATOM   1701 O OE1   . GLN A 1 228 ? 51.240  15.690  5.076   1.00 39.22 ? 524  GLN A OE1   1 
ATOM   1702 N NE2   . GLN A 1 228 ? 50.343  15.869  7.124   1.00 38.35 ? 524  GLN A NE2   1 
ATOM   1703 N N     . GLU A 1 229 ? 51.282  11.862  9.038   1.00 38.29 ? 525  GLU A N     1 
ATOM   1704 C CA    . GLU A 1 229 ? 50.433  11.752  10.232  1.00 38.41 ? 525  GLU A CA    1 
ATOM   1705 C C     . GLU A 1 229 ? 49.565  12.992  10.417  1.00 38.15 ? 525  GLU A C     1 
ATOM   1706 O O     . GLU A 1 229 ? 49.926  14.088  9.980   1.00 38.22 ? 525  GLU A O     1 
ATOM   1707 C CB    . GLU A 1 229 ? 51.278  11.563  11.494  1.00 38.68 ? 525  GLU A CB    1 
ATOM   1708 C CG    . GLU A 1 229 ? 52.371  10.504  11.389  1.00 39.58 ? 525  GLU A CG    1 
ATOM   1709 C CD    . GLU A 1 229 ? 53.022  10.196  12.736  1.00 40.45 ? 525  GLU A CD    1 
ATOM   1710 O OE1   . GLU A 1 229 ? 52.995  11.073  13.635  1.00 40.12 ? 525  GLU A OE1   1 
ATOM   1711 O OE2   . GLU A 1 229 ? 53.553  9.069   12.890  1.00 41.27 ? 525  GLU A OE2   1 
ATOM   1712 N N     . PHE A 1 230 ? 48.430  12.806  11.088  1.00 37.89 ? 526  PHE A N     1 
ATOM   1713 C CA    . PHE A 1 230 ? 47.473  13.891  11.376  1.00 37.71 ? 526  PHE A CA    1 
ATOM   1714 C C     . PHE A 1 230 ? 46.435  13.446  12.417  1.00 37.38 ? 526  PHE A C     1 
ATOM   1715 O O     . PHE A 1 230 ? 46.290  12.255  12.682  1.00 37.42 ? 526  PHE A O     1 
ATOM   1716 C CB    . PHE A 1 230 ? 46.782  14.390  10.086  1.00 37.75 ? 526  PHE A CB    1 
ATOM   1717 C CG    . PHE A 1 230 ? 45.860  13.382  9.442   1.00 37.81 ? 526  PHE A CG    1 
ATOM   1718 C CD1   . PHE A 1 230 ? 46.354  12.195  8.921   1.00 38.02 ? 526  PHE A CD1   1 
ATOM   1719 C CD2   . PHE A 1 230 ? 44.498  13.639  9.330   1.00 38.09 ? 526  PHE A CD2   1 
ATOM   1720 C CE1   . PHE A 1 230 ? 45.506  11.275  8.325   1.00 38.24 ? 526  PHE A CE1   1 
ATOM   1721 C CE2   . PHE A 1 230 ? 43.646  12.722  8.731   1.00 37.83 ? 526  PHE A CE2   1 
ATOM   1722 C CZ    . PHE A 1 230 ? 44.148  11.542  8.230   1.00 37.81 ? 526  PHE A CZ    1 
ATOM   1723 N N     . ASN A 1 231 ? 45.734  14.401  13.022  1.00 37.08 ? 527  ASN A N     1 
ATOM   1724 C CA    . ASN A 1 231 ? 44.641  14.068  13.952  1.00 36.82 ? 527  ASN A CA    1 
ATOM   1725 C C     . ASN A 1 231 ? 43.342  13.712  13.231  1.00 36.41 ? 527  ASN A C     1 
ATOM   1726 O O     . ASN A 1 231 ? 42.595  14.585  12.774  1.00 36.15 ? 527  ASN A O     1 
ATOM   1727 C CB    . ASN A 1 231 ? 44.379  15.186  14.957  1.00 36.93 ? 527  ASN A CB    1 
ATOM   1728 C CG    . ASN A 1 231 ? 43.414  14.760  16.039  1.00 36.83 ? 527  ASN A CG    1 
ATOM   1729 O OD1   . ASN A 1 231 ? 42.292  14.357  15.749  1.00 37.06 ? 527  ASN A OD1   1 
ATOM   1730 N ND2   . ASN A 1 231 ? 43.853  14.825  17.292  1.00 36.85 ? 527  ASN A ND2   1 
ATOM   1731 N N     . ILE A 1 232 ? 43.072  12.414  13.184  1.00 36.04 ? 528  ILE A N     1 
ATOM   1732 C CA    . ILE A 1 232 ? 41.969  11.859  12.395  1.00 35.94 ? 528  ILE A CA    1 
ATOM   1733 C C     . ILE A 1 232 ? 40.595  12.263  12.945  1.00 35.83 ? 528  ILE A C     1 
ATOM   1734 O O     . ILE A 1 232 ? 39.598  12.305  12.214  1.00 35.57 ? 528  ILE A O     1 
ATOM   1735 C CB    . ILE A 1 232 ? 42.078  10.320  12.345  1.00 35.93 ? 528  ILE A CB    1 
ATOM   1736 C CG1   . ILE A 1 232 ? 43.437  9.903   11.763  1.00 35.95 ? 528  ILE A CG1   1 
ATOM   1737 C CG2   . ILE A 1 232 ? 40.942  9.725   11.521  1.00 35.73 ? 528  ILE A CG2   1 
ATOM   1738 C CD1   . ILE A 1 232 ? 44.176  8.885   12.606  1.00 35.61 ? 528  ILE A CD1   1 
ATOM   1739 N N     . ASN A 1 233 ? 40.562  12.572  14.237  1.00 35.76 ? 529  ASN A N     1 
ATOM   1740 C CA    . ASN A 1 233 ? 39.340  13.014  14.907  1.00 35.69 ? 529  ASN A CA    1 
ATOM   1741 C C     . ASN A 1 233 ? 38.999  14.487  14.640  1.00 35.64 ? 529  ASN A C     1 
ATOM   1742 O O     . ASN A 1 233 ? 37.908  14.952  14.970  1.00 35.31 ? 529  ASN A O     1 
ATOM   1743 C CB    . ASN A 1 233 ? 39.462  12.751  16.409  1.00 35.68 ? 529  ASN A CB    1 
ATOM   1744 C CG    . ASN A 1 233 ? 39.652  11.278  16.723  1.00 35.93 ? 529  ASN A CG    1 
ATOM   1745 O OD1   . ASN A 1 233 ? 40.592  10.897  17.422  1.00 36.82 ? 529  ASN A OD1   1 
ATOM   1746 N ND2   . ASN A 1 233 ? 38.765  10.440  16.194  1.00 35.81 ? 529  ASN A ND2   1 
ATOM   1747 N N     . SER A 1 234 ? 39.938  15.211  14.038  1.00 35.85 ? 530  SER A N     1 
ATOM   1748 C CA    . SER A 1 234 ? 39.746  16.618  13.704  1.00 36.04 ? 530  SER A CA    1 
ATOM   1749 C C     . SER A 1 234 ? 39.058  16.707  12.351  1.00 36.12 ? 530  SER A C     1 
ATOM   1750 O O     . SER A 1 234 ? 39.578  16.198  11.363  1.00 36.22 ? 530  SER A O     1 
ATOM   1751 C CB    . SER A 1 234 ? 41.100  17.347  13.685  1.00 36.02 ? 530  SER A CB    1 
ATOM   1752 O OG    . SER A 1 234 ? 41.023  18.613  13.043  1.00 36.33 ? 530  SER A OG    1 
ATOM   1753 N N     . PRO A 1 235 ? 37.881  17.348  12.295  1.00 36.28 ? 531  PRO A N     1 
ATOM   1754 C CA    . PRO A 1 235 ? 37.212  17.422  10.996  1.00 36.33 ? 531  PRO A CA    1 
ATOM   1755 C C     . PRO A 1 235 ? 38.020  18.251  9.985   1.00 36.15 ? 531  PRO A C     1 
ATOM   1756 O O     . PRO A 1 235 ? 38.301  17.776  8.880   1.00 36.09 ? 531  PRO A O     1 
ATOM   1757 C CB    . PRO A 1 235 ? 35.851  18.056  11.323  1.00 36.42 ? 531  PRO A CB    1 
ATOM   1758 C CG    . PRO A 1 235 ? 36.038  18.761  12.635  1.00 36.56 ? 531  PRO A CG    1 
ATOM   1759 C CD    . PRO A 1 235 ? 37.191  18.119  13.346  1.00 36.36 ? 531  PRO A CD    1 
ATOM   1760 N N     . LYS A 1 236 ? 38.411  19.458  10.385  1.00 35.94 ? 532  LYS A N     1 
ATOM   1761 C CA    . LYS A 1 236 ? 39.202  20.345  9.531   1.00 35.93 ? 532  LYS A CA    1 
ATOM   1762 C C     . LYS A 1 236 ? 40.480  19.661  9.009   1.00 35.80 ? 532  LYS A C     1 
ATOM   1763 O O     . LYS A 1 236 ? 40.755  19.687  7.804   1.00 35.55 ? 532  LYS A O     1 
ATOM   1764 C CB    . LYS A 1 236 ? 39.556  21.636  10.285  1.00 35.90 ? 532  LYS A CB    1 
ATOM   1765 N N     . GLN A 1 237 ? 41.241  19.046  9.917   1.00 35.70 ? 533  GLN A N     1 
ATOM   1766 C CA    . GLN A 1 237 ? 42.497  18.353  9.560   1.00 35.82 ? 533  GLN A CA    1 
ATOM   1767 C C     . GLN A 1 237 ? 42.308  17.250  8.517   1.00 35.81 ? 533  GLN A C     1 
ATOM   1768 O O     . GLN A 1 237 ? 42.999  17.211  7.498   1.00 35.77 ? 533  GLN A O     1 
ATOM   1769 C CB    . GLN A 1 237 ? 43.149  17.719  10.794  1.00 35.90 ? 533  GLN A CB    1 
ATOM   1770 C CG    . GLN A 1 237 ? 44.172  18.598  11.510  1.00 36.24 ? 533  GLN A CG    1 
ATOM   1771 C CD    . GLN A 1 237 ? 45.105  17.800  12.411  1.00 36.11 ? 533  GLN A CD    1 
ATOM   1772 O OE1   . GLN A 1 237 ? 45.592  16.732  12.036  1.00 35.31 ? 533  GLN A OE1   1 
ATOM   1773 N NE2   . GLN A 1 237 ? 45.366  18.325  13.603  1.00 36.22 ? 533  GLN A NE2   1 
ATOM   1774 N N     . LEU A 1 238 ? 41.386  16.339  8.807   1.00 35.84 ? 534  LEU A N     1 
ATOM   1775 C CA    . LEU A 1 238 ? 41.050  15.231  7.909   1.00 35.66 ? 534  LEU A CA    1 
ATOM   1776 C C     . LEU A 1 238 ? 40.638  15.746  6.536   1.00 35.41 ? 534  LEU A C     1 
ATOM   1777 O O     . LEU A 1 238 ? 41.127  15.267  5.514   1.00 35.45 ? 534  LEU A O     1 
ATOM   1778 C CB    . LEU A 1 238 ? 39.903  14.407  8.508   1.00 35.75 ? 534  LEU A CB    1 
ATOM   1779 C CG    . LEU A 1 238 ? 39.337  13.229  7.703   1.00 35.76 ? 534  LEU A CG    1 
ATOM   1780 C CD1   . LEU A 1 238 ? 40.159  11.975  7.936   1.00 35.62 ? 534  LEU A CD1   1 
ATOM   1781 C CD2   . LEU A 1 238 ? 37.877  12.977  8.071   1.00 35.61 ? 534  LEU A CD2   1 
ATOM   1782 N N     . GLY A 1 239 ? 39.729  16.718  6.526   1.00 35.09 ? 535  GLY A N     1 
ATOM   1783 C CA    . GLY A 1 239 ? 39.278  17.355  5.285   1.00 34.86 ? 535  GLY A CA    1 
ATOM   1784 C C     . GLY A 1 239 ? 40.414  17.809  4.382   1.00 34.66 ? 535  GLY A C     1 
ATOM   1785 O O     . GLY A 1 239 ? 40.332  17.682  3.162   1.00 34.39 ? 535  GLY A O     1 
ATOM   1786 N N     . VAL A 1 240 ? 41.473  18.337  4.996   1.00 34.68 ? 536  VAL A N     1 
ATOM   1787 C CA    . VAL A 1 240 ? 42.693  18.742  4.288   1.00 34.64 ? 536  VAL A CA    1 
ATOM   1788 C C     . VAL A 1 240 ? 43.371  17.545  3.633   1.00 34.60 ? 536  VAL A C     1 
ATOM   1789 O O     . VAL A 1 240 ? 43.764  17.614  2.472   1.00 34.53 ? 536  VAL A O     1 
ATOM   1790 C CB    . VAL A 1 240 ? 43.712  19.430  5.239   1.00 34.69 ? 536  VAL A CB    1 
ATOM   1791 C CG1   . VAL A 1 240 ? 45.017  19.760  4.504   1.00 34.66 ? 536  VAL A CG1   1 
ATOM   1792 C CG2   . VAL A 1 240 ? 43.107  20.687  5.859   1.00 34.64 ? 536  VAL A CG2   1 
ATOM   1793 N N     . ILE A 1 241 ? 43.505  16.452  4.377   1.00 34.63 ? 537  ILE A N     1 
ATOM   1794 C CA    . ILE A 1 241 ? 44.102  15.242  3.825   1.00 34.89 ? 537  ILE A CA    1 
ATOM   1795 C C     . ILE A 1 241 ? 43.256  14.689  2.673   1.00 35.06 ? 537  ILE A C     1 
ATOM   1796 O O     . ILE A 1 241 ? 43.776  14.415  1.602   1.00 35.30 ? 537  ILE A O     1 
ATOM   1797 C CB    . ILE A 1 241 ? 44.313  14.143  4.893   1.00 35.02 ? 537  ILE A CB    1 
ATOM   1798 C CG1   . ILE A 1 241 ? 45.209  14.638  6.038   1.00 35.43 ? 537  ILE A CG1   1 
ATOM   1799 C CG2   . ILE A 1 241 ? 44.941  12.896  4.268   1.00 35.03 ? 537  ILE A CG2   1 
ATOM   1800 C CD1   . ILE A 1 241 ? 46.533  15.276  5.594   1.00 35.99 ? 537  ILE A CD1   1 
ATOM   1801 N N     . LEU A 1 242 ? 41.956  14.538  2.876   1.00 35.26 ? 538  LEU A N     1 
ATOM   1802 C CA    . LEU A 1 242 ? 41.104  13.956  1.837   1.00 35.55 ? 538  LEU A CA    1 
ATOM   1803 C C     . LEU A 1 242 ? 40.905  14.857  0.624   1.00 35.82 ? 538  LEU A C     1 
ATOM   1804 O O     . LEU A 1 242 ? 41.281  14.511  -0.500  1.00 35.89 ? 538  LEU A O     1 
ATOM   1805 C CB    . LEU A 1 242 ? 39.735  13.602  2.409   1.00 35.59 ? 538  LEU A CB    1 
ATOM   1806 C CG    . LEU A 1 242 ? 39.759  12.564  3.523   1.00 35.64 ? 538  LEU A CG    1 
ATOM   1807 C CD1   . LEU A 1 242 ? 38.346  12.041  3.757   1.00 35.27 ? 538  LEU A CD1   1 
ATOM   1808 C CD2   . LEU A 1 242 ? 40.730  11.424  3.187   1.00 35.85 ? 538  LEU A CD2   1 
ATOM   1809 N N     . PHE A 1 243 ? 40.312  16.016  0.864   1.00 36.09 ? 539  PHE A N     1 
ATOM   1810 C CA    . PHE A 1 243 ? 39.814  16.850  -0.222  1.00 36.41 ? 539  PHE A CA    1 
ATOM   1811 C C     . PHE A 1 243 ? 40.856  17.722  -0.877  1.00 36.47 ? 539  PHE A C     1 
ATOM   1812 O O     . PHE A 1 243 ? 40.673  18.118  -2.020  1.00 36.41 ? 539  PHE A O     1 
ATOM   1813 C CB    . PHE A 1 243 ? 38.642  17.688  0.264   1.00 36.55 ? 539  PHE A CB    1 
ATOM   1814 C CG    . PHE A 1 243 ? 37.529  16.863  0.843   1.00 37.23 ? 539  PHE A CG    1 
ATOM   1815 C CD1   . PHE A 1 243 ? 37.164  15.656  0.265   1.00 37.72 ? 539  PHE A CD1   1 
ATOM   1816 C CD2   . PHE A 1 243 ? 36.851  17.282  1.970   1.00 37.71 ? 539  PHE A CD2   1 
ATOM   1817 C CE1   . PHE A 1 243 ? 36.139  14.895  0.804   1.00 38.29 ? 539  PHE A CE1   1 
ATOM   1818 C CE2   . PHE A 1 243 ? 35.821  16.516  2.509   1.00 37.91 ? 539  PHE A CE2   1 
ATOM   1819 C CZ    . PHE A 1 243 ? 35.468  15.332  1.926   1.00 38.09 ? 539  PHE A CZ    1 
ATOM   1820 N N     . GLU A 1 244 ? 41.936  18.027  -0.166  1.00 36.81 ? 540  GLU A N     1 
ATOM   1821 C CA    . GLU A 1 244 ? 43.046  18.777  -0.753  1.00 37.10 ? 540  GLU A CA    1 
ATOM   1822 C C     . GLU A 1 244 ? 44.208  17.865  -1.125  1.00 37.04 ? 540  GLU A C     1 
ATOM   1823 O O     . GLU A 1 244 ? 44.615  17.823  -2.283  1.00 37.16 ? 540  GLU A O     1 
ATOM   1824 C CB    . GLU A 1 244 ? 43.511  19.884  0.186   1.00 37.23 ? 540  GLU A CB    1 
ATOM   1825 C CG    . GLU A 1 244 ? 42.470  20.984  0.352   1.00 38.47 ? 540  GLU A CG    1 
ATOM   1826 C CD    . GLU A 1 244 ? 42.881  22.056  1.351   1.00 40.13 ? 540  GLU A CD    1 
ATOM   1827 O OE1   . GLU A 1 244 ? 44.081  22.433  1.371   1.00 40.85 ? 540  GLU A OE1   1 
ATOM   1828 O OE2   . GLU A 1 244 ? 41.994  22.525  2.109   1.00 40.87 ? 540  GLU A OE2   1 
ATOM   1829 N N     . LYS A 1 245 ? 44.722  17.123  -0.153  1.00 36.98 ? 541  LYS A N     1 
ATOM   1830 C CA    . LYS A 1 245 ? 45.943  16.329  -0.349  1.00 37.01 ? 541  LYS A CA    1 
ATOM   1831 C C     . LYS A 1 245 ? 45.748  15.195  -1.353  1.00 36.78 ? 541  LYS A C     1 
ATOM   1832 O O     . LYS A 1 245 ? 46.496  15.078  -2.321  1.00 36.71 ? 541  LYS A O     1 
ATOM   1833 C CB    . LYS A 1 245 ? 46.410  15.757  0.989   1.00 37.17 ? 541  LYS A CB    1 
ATOM   1834 C CG    . LYS A 1 245 ? 47.586  14.788  0.933   1.00 37.75 ? 541  LYS A CG    1 
ATOM   1835 C CD    . LYS A 1 245 ? 48.892  15.451  1.370   1.00 38.60 ? 541  LYS A CD    1 
ATOM   1836 C CE    . LYS A 1 245 ? 49.850  14.435  1.983   1.00 38.81 ? 541  LYS A CE    1 
ATOM   1837 N NZ    . LYS A 1 245 ? 50.068  13.258  1.094   1.00 38.86 ? 541  LYS A NZ    1 
ATOM   1838 N N     . LEU A 1 246 ? 44.748  14.359  -1.103  1.00 36.61 ? 542  LEU A N     1 
ATOM   1839 C CA    . LEU A 1 246 ? 44.470  13.194  -1.947  1.00 36.39 ? 542  LEU A CA    1 
ATOM   1840 C C     . LEU A 1 246 ? 43.497  13.528  -3.076  1.00 36.29 ? 542  LEU A C     1 
ATOM   1841 O O     . LEU A 1 246 ? 43.241  12.699  -3.959  1.00 36.22 ? 542  LEU A O     1 
ATOM   1842 C CB    . LEU A 1 246 ? 43.927  12.047  -1.098  1.00 36.28 ? 542  LEU A CB    1 
ATOM   1843 C CG    . LEU A 1 246 ? 44.850  11.621  0.046   1.00 36.11 ? 542  LEU A CG    1 
ATOM   1844 C CD1   . LEU A 1 246 ? 44.269  10.429  0.781   1.00 36.62 ? 542  LEU A CD1   1 
ATOM   1845 C CD2   . LEU A 1 246 ? 46.247  11.300  -0.464  1.00 36.16 ? 542  LEU A CD2   1 
ATOM   1846 N N     . GLN A 1 247 ? 42.954  14.742  -3.033  1.00 36.09 ? 543  GLN A N     1 
ATOM   1847 C CA    . GLN A 1 247 ? 42.190  15.306  -4.148  1.00 35.98 ? 543  GLN A CA    1 
ATOM   1848 C C     . GLN A 1 247 ? 40.893  14.556  -4.420  1.00 35.88 ? 543  GLN A C     1 
ATOM   1849 O O     . GLN A 1 247 ? 40.470  14.435  -5.564  1.00 36.02 ? 543  GLN A O     1 
ATOM   1850 C CB    . GLN A 1 247 ? 43.042  15.359  -5.429  1.00 35.87 ? 543  GLN A CB    1 
ATOM   1851 C CG    . GLN A 1 247 ? 44.026  16.510  -5.472  1.00 35.58 ? 543  GLN A CG    1 
ATOM   1852 C CD    . GLN A 1 247 ? 43.346  17.840  -5.714  1.00 34.66 ? 543  GLN A CD    1 
ATOM   1853 O OE1   . GLN A 1 247 ? 42.530  17.969  -6.625  1.00 35.04 ? 543  GLN A OE1   1 
ATOM   1854 N NE2   . GLN A 1 247 ? 43.679  18.839  -4.902  1.00 33.27 ? 543  GLN A NE2   1 
ATOM   1855 N N     . LEU A 1 248 ? 40.242  14.074  -3.374  1.00 35.65 ? 544  LEU A N     1 
ATOM   1856 C CA    . LEU A 1 248 ? 38.967  13.398  -3.561  1.00 35.53 ? 544  LEU A CA    1 
ATOM   1857 C C     . LEU A 1 248 ? 37.889  14.443  -3.848  1.00 35.28 ? 544  LEU A C     1 
ATOM   1858 O O     . LEU A 1 248 ? 38.050  15.605  -3.487  1.00 35.25 ? 544  LEU A O     1 
ATOM   1859 C CB    . LEU A 1 248 ? 38.603  12.567  -2.334  1.00 35.65 ? 544  LEU A CB    1 
ATOM   1860 C CG    . LEU A 1 248 ? 39.747  11.785  -1.683  1.00 35.73 ? 544  LEU A CG    1 
ATOM   1861 C CD1   . LEU A 1 248 ? 39.171  10.629  -0.895  1.00 35.85 ? 544  LEU A CD1   1 
ATOM   1862 C CD2   . LEU A 1 248 ? 40.738  11.282  -2.716  1.00 35.78 ? 544  LEU A CD2   1 
ATOM   1863 N N     . PRO A 1 249 ? 36.795  14.041  -4.509  1.00 35.16 ? 545  PRO A N     1 
ATOM   1864 C CA    . PRO A 1 249 ? 35.714  14.978  -4.831  1.00 35.26 ? 545  PRO A CA    1 
ATOM   1865 C C     . PRO A 1 249 ? 34.916  15.452  -3.621  1.00 35.40 ? 545  PRO A C     1 
ATOM   1866 O O     . PRO A 1 249 ? 34.665  14.680  -2.687  1.00 35.66 ? 545  PRO A O     1 
ATOM   1867 C CB    . PRO A 1 249 ? 34.786  14.179  -5.753  1.00 35.17 ? 545  PRO A CB    1 
ATOM   1868 C CG    . PRO A 1 249 ? 35.432  12.894  -5.999  1.00 35.38 ? 545  PRO A CG    1 
ATOM   1869 C CD    . PRO A 1 249 ? 36.540  12.693  -5.031  1.00 35.25 ? 545  PRO A CD    1 
ATOM   1870 N N     . VAL A 1 250 ? 34.497  16.712  -3.660  1.00 35.39 ? 546  VAL A N     1 
ATOM   1871 C CA    . VAL A 1 250 ? 33.723  17.294  -2.572  1.00 35.29 ? 546  VAL A CA    1 
ATOM   1872 C C     . VAL A 1 250 ? 32.240  17.135  -2.895  1.00 35.30 ? 546  VAL A C     1 
ATOM   1873 O O     . VAL A 1 250 ? 31.650  17.966  -3.577  1.00 35.18 ? 546  VAL A O     1 
ATOM   1874 C CB    . VAL A 1 250 ? 34.099  18.773  -2.344  1.00 35.33 ? 546  VAL A CB    1 
ATOM   1875 C CG1   . VAL A 1 250 ? 33.420  19.306  -1.086  1.00 35.34 ? 546  VAL A CG1   1 
ATOM   1876 C CG2   . VAL A 1 250 ? 35.624  18.930  -2.250  1.00 34.64 ? 546  VAL A CG2   1 
ATOM   1877 N N     . LEU A 1 251 ? 31.656  16.044  -2.409  1.00 35.44 ? 547  LEU A N     1 
ATOM   1878 C CA    . LEU A 1 251 ? 30.254  15.705  -2.694  1.00 35.52 ? 547  LEU A CA    1 
ATOM   1879 C C     . LEU A 1 251 ? 29.287  16.535  -1.850  1.00 35.63 ? 547  LEU A C     1 
ATOM   1880 O O     . LEU A 1 251 ? 28.190  16.862  -2.303  1.00 35.88 ? 547  LEU A O     1 
ATOM   1881 C CB    . LEU A 1 251 ? 30.002  14.209  -2.466  1.00 35.52 ? 547  LEU A CB    1 
ATOM   1882 C CG    . LEU A 1 251 ? 31.053  13.268  -3.081  1.00 35.70 ? 547  LEU A CG    1 
ATOM   1883 C CD1   . LEU A 1 251 ? 30.650  11.811  -2.960  1.00 35.90 ? 547  LEU A CD1   1 
ATOM   1884 C CD2   . LEU A 1 251 ? 31.328  13.621  -4.537  1.00 35.57 ? 547  LEU A CD2   1 
ATOM   1885 N N     . LYS A 1 252 ? 29.689  16.856  -0.620  1.00 35.69 ? 548  LYS A N     1 
ATOM   1886 C CA    . LYS A 1 252 ? 28.934  17.777  0.242   1.00 35.63 ? 548  LYS A CA    1 
ATOM   1887 C C     . LYS A 1 252 ? 29.872  18.582  1.134   1.00 35.59 ? 548  LYS A C     1 
ATOM   1888 O O     . LYS A 1 252 ? 30.950  18.123  1.518   1.00 35.64 ? 548  LYS A O     1 
ATOM   1889 C CB    . LYS A 1 252 ? 27.913  17.032  1.109   1.00 35.62 ? 548  LYS A CB    1 
ATOM   1890 N N     . LYS A 1 253 ? 29.437  19.793  1.449   1.00 35.65 ? 549  LYS A N     1 
ATOM   1891 C CA    . LYS A 1 253 ? 30.180  20.707  2.301   1.00 35.75 ? 549  LYS A CA    1 
ATOM   1892 C C     . LYS A 1 253 ? 29.327  20.999  3.542   1.00 35.84 ? 549  LYS A C     1 
ATOM   1893 O O     . LYS A 1 253 ? 28.146  21.332  3.415   1.00 35.95 ? 549  LYS A O     1 
ATOM   1894 C CB    . LYS A 1 253 ? 30.490  21.999  1.534   1.00 35.57 ? 549  LYS A CB    1 
ATOM   1895 N N     . SER A 1 254 ? 29.901  20.850  4.736   1.00 35.85 ? 550  SER A N     1 
ATOM   1896 C CA    . SER A 1 254 ? 29.192  21.220  5.963   1.00 35.92 ? 550  SER A CA    1 
ATOM   1897 C C     . SER A 1 254 ? 29.072  22.746  6.013   1.00 35.93 ? 550  SER A C     1 
ATOM   1898 O O     . SER A 1 254 ? 29.669  23.441  5.188   1.00 35.89 ? 550  SER A O     1 
ATOM   1899 C CB    . SER A 1 254 ? 29.930  20.708  7.201   1.00 35.94 ? 550  SER A CB    1 
ATOM   1900 O OG    . SER A 1 254 ? 31.167  21.386  7.387   1.00 36.43 ? 550  SER A OG    1 
ATOM   1901 N N     . LYS A 1 255 ? 28.310  23.265  6.974   1.00 35.93 ? 551  LYS A N     1 
ATOM   1902 C CA    . LYS A 1 255 ? 28.159  24.722  7.134   1.00 35.95 ? 551  LYS A CA    1 
ATOM   1903 C C     . LYS A 1 255 ? 29.511  25.438  7.283   1.00 36.11 ? 551  LYS A C     1 
ATOM   1904 O O     . LYS A 1 255 ? 29.717  26.508  6.709   1.00 36.04 ? 551  LYS A O     1 
ATOM   1905 C CB    . LYS A 1 255 ? 27.274  25.047  8.337   1.00 35.85 ? 551  LYS A CB    1 
ATOM   1906 N N     . THR A 1 256 ? 30.424  24.833  8.044   1.00 36.33 ? 552  THR A N     1 
ATOM   1907 C CA    . THR A 1 256 ? 31.747  25.412  8.322   1.00 36.58 ? 552  THR A CA    1 
ATOM   1908 C C     . THR A 1 256 ? 32.887  24.919  7.414   1.00 36.61 ? 552  THR A C     1 
ATOM   1909 O O     . THR A 1 256 ? 33.981  25.494  7.432   1.00 36.60 ? 552  THR A O     1 
ATOM   1910 C CB    . THR A 1 256 ? 32.187  25.105  9.765   1.00 36.71 ? 552  THR A CB    1 
ATOM   1911 O OG1   . THR A 1 256 ? 33.341  25.894  10.096  1.00 37.46 ? 552  THR A OG1   1 
ATOM   1912 C CG2   . THR A 1 256 ? 32.539  23.617  9.911   1.00 36.72 ? 552  THR A CG2   1 
ATOM   1913 N N     . GLY A 1 257 ? 32.658  23.853  6.651   1.00 36.65 ? 553  GLY A N     1 
ATOM   1914 C CA    . GLY A 1 257 ? 33.716  23.300  5.797   1.00 36.65 ? 553  GLY A CA    1 
ATOM   1915 C C     . GLY A 1 257 ? 33.245  22.198  4.869   1.00 36.63 ? 553  GLY A C     1 
ATOM   1916 O O     . GLY A 1 257 ? 32.281  22.372  4.126   1.00 36.86 ? 553  GLY A O     1 
ATOM   1917 N N     . TYR A 1 258 ? 33.941  21.067  4.900   1.00 36.53 ? 554  TYR A N     1 
ATOM   1918 C CA    . TYR A 1 258 ? 33.555  19.905  4.111   1.00 36.40 ? 554  TYR A CA    1 
ATOM   1919 C C     . TYR A 1 258 ? 32.948  18.820  5.000   1.00 35.95 ? 554  TYR A C     1 
ATOM   1920 O O     . TYR A 1 258 ? 33.417  18.598  6.116   1.00 35.94 ? 554  TYR A O     1 
ATOM   1921 C CB    . TYR A 1 258 ? 34.760  19.287  3.436   1.00 36.61 ? 554  TYR A CB    1 
ATOM   1922 C CG    . TYR A 1 258 ? 35.781  20.203  2.799   1.00 38.01 ? 554  TYR A CG    1 
ATOM   1923 C CD1   . TYR A 1 258 ? 35.489  20.914  1.637   1.00 39.28 ? 554  TYR A CD1   1 
ATOM   1924 C CD2   . TYR A 1 258 ? 37.083  20.275  3.311   1.00 39.17 ? 554  TYR A CD2   1 
ATOM   1925 C CE1   . TYR A 1 258 ? 36.456  21.716  1.030   1.00 40.05 ? 554  TYR A CE1   1 
ATOM   1926 C CE2   . TYR A 1 258 ? 38.053  21.063  2.714   1.00 39.98 ? 554  TYR A CE2   1 
ATOM   1927 C CZ    . TYR A 1 258 ? 37.739  21.783  1.576   1.00 40.60 ? 554  TYR A CZ    1 
ATOM   1928 O OH    . TYR A 1 258 ? 38.718  22.562  0.995   1.00 41.48 ? 554  TYR A OH    1 
ATOM   1929 N N     . SER A 1 259 ? 31.930  18.128  4.490   1.00 35.44 ? 555  SER A N     1 
ATOM   1930 C CA    . SER A 1 259 ? 31.322  16.999  5.199   1.00 34.95 ? 555  SER A CA    1 
ATOM   1931 C C     . SER A 1 259 ? 32.158  15.738  4.997   1.00 34.34 ? 555  SER A C     1 
ATOM   1932 O O     . SER A 1 259 ? 32.519  15.408  3.868   1.00 34.20 ? 555  SER A O     1 
ATOM   1933 C CB    . SER A 1 259 ? 29.894  16.748  4.700   1.00 35.11 ? 555  SER A CB    1 
ATOM   1934 O OG    . SER A 1 259 ? 29.182  15.880  5.577   1.00 35.43 ? 555  SER A OG    1 
ATOM   1935 N N     . THR A 1 260 ? 32.469  15.056  6.095   1.00 33.74 ? 556  THR A N     1 
ATOM   1936 C CA    . THR A 1 260 ? 33.144  13.760  6.065   1.00 33.36 ? 556  THR A CA    1 
ATOM   1937 C C     . THR A 1 260 ? 32.243  12.669  6.641   1.00 33.23 ? 556  THR A C     1 
ATOM   1938 O O     . THR A 1 260 ? 32.707  11.591  7.005   1.00 33.04 ? 556  THR A O     1 
ATOM   1939 C CB    . THR A 1 260 ? 34.474  13.803  6.848   1.00 33.40 ? 556  THR A CB    1 
ATOM   1940 O OG1   . THR A 1 260 ? 34.236  14.245  8.191   1.00 33.02 ? 556  THR A OG1   1 
ATOM   1941 C CG2   . THR A 1 260 ? 35.463  14.748  6.167   1.00 33.24 ? 556  THR A CG2   1 
ATOM   1942 N N     . SER A 1 261 ? 30.949  12.955  6.709   1.00 33.27 ? 557  SER A N     1 
ATOM   1943 C CA    . SER A 1 261 ? 29.977  12.017  7.247   1.00 33.34 ? 557  SER A CA    1 
ATOM   1944 C C     . SER A 1 261 ? 29.996  10.721  6.443   1.00 33.41 ? 557  SER A C     1 
ATOM   1945 O O     . SER A 1 261 ? 30.128  10.749  5.222   1.00 33.37 ? 557  SER A O     1 
ATOM   1946 C CB    . SER A 1 261 ? 28.593  12.646  7.216   1.00 33.39 ? 557  SER A CB    1 
ATOM   1947 O OG    . SER A 1 261 ? 28.373  13.269  5.959   1.00 33.78 ? 557  SER A OG    1 
ATOM   1948 N N     . ALA A 1 262 ? 29.864  9.593   7.141   1.00 33.54 ? 558  ALA A N     1 
ATOM   1949 C CA    . ALA A 1 262 ? 29.971  8.264   6.533   1.00 33.66 ? 558  ALA A CA    1 
ATOM   1950 C C     . ALA A 1 262 ? 29.307  8.185   5.161   1.00 34.06 ? 558  ALA A C     1 
ATOM   1951 O O     . ALA A 1 262 ? 29.943  7.777   4.190   1.00 34.20 ? 558  ALA A O     1 
ATOM   1952 C CB    . ALA A 1 262 ? 29.386  7.225   7.451   1.00 33.49 ? 558  ALA A CB    1 
ATOM   1953 N N     . ASP A 1 263 ? 28.042  8.589   5.077   1.00 34.51 ? 559  ASP A N     1 
ATOM   1954 C CA    . ASP A 1 263 ? 27.313  8.589   3.798   1.00 35.01 ? 559  ASP A CA    1 
ATOM   1955 C C     . ASP A 1 263 ? 28.160  9.114   2.632   1.00 35.15 ? 559  ASP A C     1 
ATOM   1956 O O     . ASP A 1 263 ? 28.177  8.524   1.552   1.00 35.36 ? 559  ASP A O     1 
ATOM   1957 C CB    . ASP A 1 263 ? 26.025  9.404   3.896   1.00 35.19 ? 559  ASP A CB    1 
ATOM   1958 C CG    . ASP A 1 263 ? 26.269  10.814  4.370   1.00 36.19 ? 559  ASP A CG    1 
ATOM   1959 O OD1   . ASP A 1 263 ? 26.636  10.976  5.556   1.00 37.04 ? 559  ASP A OD1   1 
ATOM   1960 O OD2   . ASP A 1 263 ? 26.101  11.752  3.560   1.00 37.62 ? 559  ASP A OD2   1 
ATOM   1961 N N     . VAL A 1 264 ? 28.864  10.217  2.862   1.00 35.29 ? 560  VAL A N     1 
ATOM   1962 C CA    . VAL A 1 264 ? 29.778  10.774  1.867   1.00 35.52 ? 560  VAL A CA    1 
ATOM   1963 C C     . VAL A 1 264 ? 31.000  9.875   1.653   1.00 35.71 ? 560  VAL A C     1 
ATOM   1964 O O     . VAL A 1 264 ? 31.411  9.620   0.518   1.00 35.65 ? 560  VAL A O     1 
ATOM   1965 C CB    . VAL A 1 264 ? 30.298  12.153  2.301   1.00 35.55 ? 560  VAL A CB    1 
ATOM   1966 C CG1   . VAL A 1 264 ? 31.242  12.711  1.249   1.00 35.43 ? 560  VAL A CG1   1 
ATOM   1967 C CG2   . VAL A 1 264 ? 29.142  13.110  2.568   1.00 35.49 ? 560  VAL A CG2   1 
ATOM   1968 N N     . LEU A 1 265 ? 31.581  9.406   2.750   1.00 35.91 ? 561  LEU A N     1 
ATOM   1969 C CA    . LEU A 1 265 ? 32.777  8.578   2.675   1.00 36.34 ? 561  LEU A CA    1 
ATOM   1970 C C     . LEU A 1 265 ? 32.530  7.291   1.897   1.00 36.69 ? 561  LEU A C     1 
ATOM   1971 O O     . LEU A 1 265 ? 33.444  6.762   1.264   1.00 37.04 ? 561  LEU A O     1 
ATOM   1972 C CB    . LEU A 1 265 ? 33.294  8.241   4.074   1.00 36.41 ? 561  LEU A CB    1 
ATOM   1973 C CG    . LEU A 1 265 ? 33.862  9.419   4.865   1.00 36.49 ? 561  LEU A CG    1 
ATOM   1974 C CD1   . LEU A 1 265 ? 34.208  8.969   6.280   1.00 37.02 ? 561  LEU A CD1   1 
ATOM   1975 C CD2   . LEU A 1 265 ? 35.072  10.031  4.164   1.00 35.70 ? 561  LEU A CD2   1 
ATOM   1976 N N     . GLU A 1 266 ? 31.302  6.786   1.953   1.00 36.92 ? 562  GLU A N     1 
ATOM   1977 C CA    . GLU A 1 266 ? 30.924  5.594   1.187   1.00 37.22 ? 562  GLU A CA    1 
ATOM   1978 C C     . GLU A 1 266 ? 31.129  5.795   -0.317  1.00 37.08 ? 562  GLU A C     1 
ATOM   1979 O O     . GLU A 1 266 ? 31.676  4.931   -0.997  1.00 37.17 ? 562  GLU A O     1 
ATOM   1980 C CB    . GLU A 1 266 ? 29.460  5.209   1.460   1.00 37.46 ? 562  GLU A CB    1 
ATOM   1981 C CG    . GLU A 1 266 ? 29.255  4.418   2.753   1.00 38.27 ? 562  GLU A CG    1 
ATOM   1982 C CD    . GLU A 1 266 ? 27.792  4.088   3.027   1.00 38.77 ? 562  GLU A CD    1 
ATOM   1983 O OE1   . GLU A 1 266 ? 27.117  3.594   2.095   1.00 38.61 ? 562  GLU A OE1   1 
ATOM   1984 O OE2   . GLU A 1 266 ? 27.326  4.308   4.174   1.00 39.23 ? 562  GLU A OE2   1 
ATOM   1985 N N     . LYS A 1 267 ? 30.692  6.942   -0.821  1.00 36.86 ? 563  LYS A N     1 
ATOM   1986 C CA    . LYS A 1 267 ? 30.747  7.224   -2.253  1.00 36.81 ? 563  LYS A CA    1 
ATOM   1987 C C     . LYS A 1 267 ? 32.180  7.476   -2.707  1.00 36.64 ? 563  LYS A C     1 
ATOM   1988 O O     . LYS A 1 267 ? 32.537  7.192   -3.850  1.00 36.82 ? 563  LYS A O     1 
ATOM   1989 C CB    . LYS A 1 267 ? 29.875  8.431   -2.601  1.00 36.89 ? 563  LYS A CB    1 
ATOM   1990 C CG    . LYS A 1 267 ? 28.501  8.392   -1.946  1.00 37.29 ? 563  LYS A CG    1 
ATOM   1991 C CD    . LYS A 1 267 ? 27.550  9.447   -2.480  1.00 37.75 ? 563  LYS A CD    1 
ATOM   1992 C CE    . LYS A 1 267 ? 26.103  9.032   -2.244  1.00 37.96 ? 563  LYS A CE    1 
ATOM   1993 N NZ    . LYS A 1 267 ? 25.259  10.180  -1.821  1.00 38.72 ? 563  LYS A NZ    1 
ATOM   1994 N N     . LEU A 1 268 ? 32.991  8.021   -1.806  1.00 36.36 ? 564  LEU A N     1 
ATOM   1995 C CA    . LEU A 1 268 ? 34.408  8.301   -2.083  1.00 36.12 ? 564  LEU A CA    1 
ATOM   1996 C C     . LEU A 1 268 ? 35.290  7.044   -2.038  1.00 35.94 ? 564  LEU A C     1 
ATOM   1997 O O     . LEU A 1 268 ? 36.418  7.043   -2.552  1.00 35.78 ? 564  LEU A O     1 
ATOM   1998 C CB    . LEU A 1 268 ? 34.936  9.336   -1.081  1.00 36.10 ? 564  LEU A CB    1 
ATOM   1999 C CG    . LEU A 1 268 ? 34.271  10.718  -1.120  1.00 35.94 ? 564  LEU A CG    1 
ATOM   2000 C CD1   . LEU A 1 268 ? 34.682  11.569  0.080   1.00 35.20 ? 564  LEU A CD1   1 
ATOM   2001 C CD2   . LEU A 1 268 ? 34.608  11.422  -2.420  1.00 35.34 ? 564  LEU A CD2   1 
ATOM   2002 N N     . ALA A 1 269 ? 34.763  5.982   -1.427  1.00 35.71 ? 565  ALA A N     1 
ATOM   2003 C CA    . ALA A 1 269 ? 35.483  4.713   -1.243  1.00 35.47 ? 565  ALA A CA    1 
ATOM   2004 C C     . ALA A 1 269 ? 36.195  4.203   -2.504  1.00 35.32 ? 565  ALA A C     1 
ATOM   2005 O O     . ALA A 1 269 ? 37.376  3.846   -2.455  1.00 35.09 ? 565  ALA A O     1 
ATOM   2006 C CB    . ALA A 1 269 ? 34.534  3.652   -0.716  1.00 35.36 ? 565  ALA A CB    1 
ATOM   2007 N N     . PRO A 1 270 ? 35.485  4.176   -3.641  1.00 35.18 ? 566  PRO A N     1 
ATOM   2008 C CA    . PRO A 1 270 ? 36.089  3.656   -4.858  1.00 35.18 ? 566  PRO A CA    1 
ATOM   2009 C C     . PRO A 1 270 ? 37.380  4.357   -5.282  1.00 35.31 ? 566  PRO A C     1 
ATOM   2010 O O     . PRO A 1 270 ? 38.183  3.755   -5.990  1.00 35.29 ? 566  PRO A O     1 
ATOM   2011 C CB    . PRO A 1 270 ? 34.997  3.883   -5.909  1.00 35.21 ? 566  PRO A CB    1 
ATOM   2012 C CG    . PRO A 1 270 ? 33.728  3.959   -5.138  1.00 35.11 ? 566  PRO A CG    1 
ATOM   2013 C CD    . PRO A 1 270 ? 34.097  4.615   -3.864  1.00 35.07 ? 566  PRO A CD    1 
ATOM   2014 N N     . TYR A 1 271 ? 37.579  5.606   -4.861  1.00 35.54 ? 567  TYR A N     1 
ATOM   2015 C CA    . TYR A 1 271 ? 38.709  6.418   -5.346  1.00 35.89 ? 567  TYR A CA    1 
ATOM   2016 C C     . TYR A 1 271 ? 40.030  6.154   -4.627  1.00 35.86 ? 567  TYR A C     1 
ATOM   2017 O O     . TYR A 1 271 ? 41.094  6.209   -5.236  1.00 35.51 ? 567  TYR A O     1 
ATOM   2018 C CB    . TYR A 1 271 ? 38.377  7.905   -5.244  1.00 36.05 ? 567  TYR A CB    1 
ATOM   2019 C CG    . TYR A 1 271 ? 37.255  8.338   -6.159  1.00 37.20 ? 567  TYR A CG    1 
ATOM   2020 C CD1   . TYR A 1 271 ? 37.512  8.754   -7.463  1.00 38.14 ? 567  TYR A CD1   1 
ATOM   2021 C CD2   . TYR A 1 271 ? 35.928  8.330   -5.721  1.00 38.13 ? 567  TYR A CD2   1 
ATOM   2022 C CE1   . TYR A 1 271 ? 36.471  9.154   -8.306  1.00 38.54 ? 567  TYR A CE1   1 
ATOM   2023 C CE2   . TYR A 1 271 ? 34.886  8.728   -6.557  1.00 38.11 ? 567  TYR A CE2   1 
ATOM   2024 C CZ    . TYR A 1 271 ? 35.165  9.139   -7.840  1.00 38.31 ? 567  TYR A CZ    1 
ATOM   2025 O OH    . TYR A 1 271 ? 34.132  9.527   -8.658  1.00 38.42 ? 567  TYR A OH    1 
ATOM   2026 N N     . HIS A 1 272 ? 39.954  5.898   -3.327  1.00 36.14 ? 568  HIS A N     1 
ATOM   2027 C CA    . HIS A 1 272 ? 41.146  5.678   -2.509  1.00 36.32 ? 568  HIS A CA    1 
ATOM   2028 C C     . HIS A 1 272 ? 40.863  4.638   -1.419  1.00 36.44 ? 568  HIS A C     1 
ATOM   2029 O O     . HIS A 1 272 ? 39.748  4.550   -0.891  1.00 36.59 ? 568  HIS A O     1 
ATOM   2030 C CB    . HIS A 1 272 ? 41.610  6.998   -1.878  1.00 36.30 ? 568  HIS A CB    1 
ATOM   2031 C CG    . HIS A 1 272 ? 43.087  7.066   -1.612  1.00 36.81 ? 568  HIS A CG    1 
ATOM   2032 N ND1   . HIS A 1 272 ? 43.751  6.155   -0.814  1.00 37.03 ? 568  HIS A ND1   1 
ATOM   2033 C CD2   . HIS A 1 272 ? 44.027  7.949   -2.029  1.00 36.93 ? 568  HIS A CD2   1 
ATOM   2034 C CE1   . HIS A 1 272 ? 45.033  6.472   -0.757  1.00 36.73 ? 568  HIS A CE1   1 
ATOM   2035 N NE2   . HIS A 1 272 ? 45.227  7.555   -1.486  1.00 36.68 ? 568  HIS A NE2   1 
ATOM   2036 N N     . GLU A 1 273 ? 41.883  3.850   -1.093  1.00 36.52 ? 569  GLU A N     1 
ATOM   2037 C CA    . GLU A 1 273 ? 41.785  2.826   -0.039  1.00 36.66 ? 569  GLU A CA    1 
ATOM   2038 C C     . GLU A 1 273 ? 41.489  3.421   1.354   1.00 36.55 ? 569  GLU A C     1 
ATOM   2039 O O     . GLU A 1 273 ? 40.740  2.826   2.146   1.00 36.57 ? 569  GLU A O     1 
ATOM   2040 C CB    . GLU A 1 273 ? 43.068  1.962   -0.015  1.00 36.77 ? 569  GLU A CB    1 
ATOM   2041 C CG    . GLU A 1 273 ? 43.287  1.137   1.274   1.00 37.02 ? 569  GLU A CG    1 
ATOM   2042 C CD    . GLU A 1 273 ? 43.951  -0.221  1.050   1.00 37.22 ? 569  GLU A CD    1 
ATOM   2043 O OE1   . GLU A 1 273 ? 44.003  -0.699  -0.102  1.00 36.67 ? 569  GLU A OE1   1 
ATOM   2044 O OE2   . GLU A 1 273 ? 44.413  -0.818  2.051   1.00 37.66 ? 569  GLU A OE2   1 
ATOM   2045 N N     . ILE A 1 274 ? 42.068  4.594   1.626   1.00 36.24 ? 570  ILE A N     1 
ATOM   2046 C CA    . ILE A 1 274 ? 41.981  5.270   2.931   1.00 35.92 ? 570  ILE A CA    1 
ATOM   2047 C C     . ILE A 1 274 ? 40.559  5.486   3.442   1.00 35.62 ? 570  ILE A C     1 
ATOM   2048 O O     . ILE A 1 274 ? 40.309  5.386   4.638   1.00 35.44 ? 570  ILE A O     1 
ATOM   2049 C CB    . ILE A 1 274 ? 42.676  6.652   2.883   1.00 36.01 ? 570  ILE A CB    1 
ATOM   2050 C CG1   . ILE A 1 274 ? 42.887  7.212   4.286   1.00 36.25 ? 570  ILE A CG1   1 
ATOM   2051 C CG2   . ILE A 1 274 ? 41.853  7.656   2.084   1.00 35.96 ? 570  ILE A CG2   1 
ATOM   2052 C CD1   . ILE A 1 274 ? 44.115  8.094   4.401   1.00 36.52 ? 570  ILE A CD1   1 
ATOM   2053 N N     . VAL A 1 275 ? 39.635  5.782   2.535   1.00 35.41 ? 571  VAL A N     1 
ATOM   2054 C CA    . VAL A 1 275 ? 38.257  6.075   2.918   1.00 35.14 ? 571  VAL A CA    1 
ATOM   2055 C C     . VAL A 1 275 ? 37.662  4.924   3.721   1.00 35.06 ? 571  VAL A C     1 
ATOM   2056 O O     . VAL A 1 275 ? 37.096  5.143   4.787   1.00 35.12 ? 571  VAL A O     1 
ATOM   2057 C CB    . VAL A 1 275 ? 37.362  6.344   1.703   1.00 35.20 ? 571  VAL A CB    1 
ATOM   2058 C CG1   . VAL A 1 275 ? 35.970  6.753   2.163   1.00 34.76 ? 571  VAL A CG1   1 
ATOM   2059 C CG2   . VAL A 1 275 ? 37.974  7.420   0.805   1.00 35.02 ? 571  VAL A CG2   1 
ATOM   2060 N N     . GLU A 1 276 ? 37.805  3.701   3.220   1.00 35.03 ? 572  GLU A N     1 
ATOM   2061 C CA    . GLU A 1 276 ? 37.287  2.520   3.919   1.00 35.12 ? 572  GLU A CA    1 
ATOM   2062 C C     . GLU A 1 276 ? 37.859  2.408   5.334   1.00 35.25 ? 572  GLU A C     1 
ATOM   2063 O O     . GLU A 1 276 ? 37.134  2.087   6.274   1.00 35.40 ? 572  GLU A O     1 
ATOM   2064 C CB    . GLU A 1 276 ? 37.595  1.237   3.137   1.00 35.14 ? 572  GLU A CB    1 
ATOM   2065 N N     . ASN A 1 277 ? 39.153  2.687   5.484   1.00 35.25 ? 573  ASN A N     1 
ATOM   2066 C CA    . ASN A 1 277 ? 39.810  2.596   6.791   1.00 35.30 ? 573  ASN A CA    1 
ATOM   2067 C C     . ASN A 1 277 ? 39.301  3.632   7.796   1.00 35.26 ? 573  ASN A C     1 
ATOM   2068 O O     . ASN A 1 277 ? 39.117  3.308   8.969   1.00 35.22 ? 573  ASN A O     1 
ATOM   2069 C CB    . ASN A 1 277 ? 41.330  2.720   6.654   1.00 35.51 ? 573  ASN A CB    1 
ATOM   2070 C CG    . ASN A 1 277 ? 41.976  1.468   6.066   1.00 36.29 ? 573  ASN A CG    1 
ATOM   2071 O OD1   . ASN A 1 277 ? 43.002  0.985   6.564   1.00 36.45 ? 573  ASN A OD1   1 
ATOM   2072 N ND2   . ASN A 1 277 ? 41.378  0.939   5.000   1.00 37.38 ? 573  ASN A ND2   1 
ATOM   2073 N N     . ILE A 1 278 ? 39.088  4.870   7.341   1.00 35.28 ? 574  ILE A N     1 
ATOM   2074 C CA    . ILE A 1 278 ? 38.544  5.936   8.202   1.00 35.24 ? 574  ILE A CA    1 
ATOM   2075 C C     . ILE A 1 278 ? 37.190  5.529   8.765   1.00 35.42 ? 574  ILE A C     1 
ATOM   2076 O O     . ILE A 1 278 ? 36.903  5.751   9.940   1.00 35.42 ? 574  ILE A O     1 
ATOM   2077 C CB    . ILE A 1 278 ? 38.357  7.278   7.453   1.00 35.18 ? 574  ILE A CB    1 
ATOM   2078 C CG1   . ILE A 1 278 ? 39.692  7.986   7.269   1.00 34.81 ? 574  ILE A CG1   1 
ATOM   2079 C CG2   . ILE A 1 278 ? 37.400  8.200   8.201   1.00 34.90 ? 574  ILE A CG2   1 
ATOM   2080 C CD1   . ILE A 1 278 ? 40.345  7.640   5.998   1.00 34.77 ? 574  ILE A CD1   1 
ATOM   2081 N N     . LEU A 1 279 ? 36.354  4.951   7.915   1.00 35.58 ? 575  LEU A N     1 
ATOM   2082 C CA    . LEU A 1 279 ? 35.067  4.427   8.354   1.00 35.92 ? 575  LEU A CA    1 
ATOM   2083 C C     . LEU A 1 279 ? 35.253  3.385   9.461   1.00 36.12 ? 575  LEU A C     1 
ATOM   2084 O O     . LEU A 1 279 ? 34.624  3.467   10.525  1.00 36.17 ? 575  LEU A O     1 
ATOM   2085 C CB    . LEU A 1 279 ? 34.328  3.793   7.177   1.00 36.04 ? 575  LEU A CB    1 
ATOM   2086 C CG    . LEU A 1 279 ? 33.682  4.760   6.187   1.00 36.18 ? 575  LEU A CG    1 
ATOM   2087 C CD1   . LEU A 1 279 ? 33.480  4.073   4.844   1.00 36.66 ? 575  LEU A CD1   1 
ATOM   2088 C CD2   . LEU A 1 279 ? 32.371  5.305   6.731   1.00 36.32 ? 575  LEU A CD2   1 
ATOM   2089 N N     . HIS A 1 280 ? 36.112  2.403   9.188   1.00 36.26 ? 576  HIS A N     1 
ATOM   2090 C CA    . HIS A 1 280 ? 36.465  1.360   10.160  1.00 36.44 ? 576  HIS A CA    1 
ATOM   2091 C C     . HIS A 1 280 ? 36.943  1.994   11.462  1.00 36.38 ? 576  HIS A C     1 
ATOM   2092 O O     . HIS A 1 280 ? 36.591  1.549   12.550  1.00 35.95 ? 576  HIS A O     1 
ATOM   2093 C CB    . HIS A 1 280 ? 37.564  0.461   9.579   1.00 36.65 ? 576  HIS A CB    1 
ATOM   2094 C CG    . HIS A 1 280 ? 37.768  -0.822  10.324  1.00 37.25 ? 576  HIS A CG    1 
ATOM   2095 N ND1   . HIS A 1 280 ? 36.767  -1.438  11.045  1.00 37.79 ? 576  HIS A ND1   1 
ATOM   2096 C CD2   . HIS A 1 280 ? 38.853  -1.627  10.427  1.00 37.99 ? 576  HIS A CD2   1 
ATOM   2097 C CE1   . HIS A 1 280 ? 37.231  -2.555  11.576  1.00 37.95 ? 576  HIS A CE1   1 
ATOM   2098 N NE2   . HIS A 1 280 ? 38.494  -2.693  11.217  1.00 38.31 ? 576  HIS A NE2   1 
ATOM   2099 N N     . TYR A 1 281 ? 37.749  3.043   11.320  1.00 36.61 ? 577  TYR A N     1 
ATOM   2100 C CA    . TYR A 1 281 ? 38.286  3.793   12.453  1.00 36.77 ? 577  TYR A CA    1 
ATOM   2101 C C     . TYR A 1 281 ? 37.177  4.401   13.294  1.00 36.84 ? 577  TYR A C     1 
ATOM   2102 O O     . TYR A 1 281 ? 37.144  4.214   14.505  1.00 36.76 ? 577  TYR A O     1 
ATOM   2103 C CB    . TYR A 1 281 ? 39.211  4.906   11.957  1.00 36.82 ? 577  TYR A CB    1 
ATOM   2104 C CG    . TYR A 1 281 ? 39.906  5.665   13.060  1.00 37.05 ? 577  TYR A CG    1 
ATOM   2105 C CD1   . TYR A 1 281 ? 39.268  6.710   13.724  1.00 37.29 ? 577  TYR A CD1   1 
ATOM   2106 C CD2   . TYR A 1 281 ? 41.204  5.340   13.440  1.00 37.37 ? 577  TYR A CD2   1 
ATOM   2107 C CE1   . TYR A 1 281 ? 39.906  7.411   14.739  1.00 37.75 ? 577  TYR A CE1   1 
ATOM   2108 C CE2   . TYR A 1 281 ? 41.851  6.035   14.455  1.00 37.52 ? 577  TYR A CE2   1 
ATOM   2109 C CZ    . TYR A 1 281 ? 41.199  7.070   15.099  1.00 37.91 ? 577  TYR A CZ    1 
ATOM   2110 O OH    . TYR A 1 281 ? 41.834  7.757   16.108  1.00 38.09 ? 577  TYR A OH    1 
ATOM   2111 N N     . ARG A 1 282 ? 36.285  5.144   12.646  1.00 37.08 ? 578  ARG A N     1 
ATOM   2112 C CA    . ARG A 1 282 ? 35.219  5.857   13.347  1.00 37.23 ? 578  ARG A CA    1 
ATOM   2113 C C     . ARG A 1 282 ? 34.386  4.922   14.216  1.00 37.32 ? 578  ARG A C     1 
ATOM   2114 O O     . ARG A 1 282 ? 34.212  5.183   15.404  1.00 37.58 ? 578  ARG A O     1 
ATOM   2115 C CB    . ARG A 1 282 ? 34.322  6.627   12.369  1.00 37.26 ? 578  ARG A CB    1 
ATOM   2116 C CG    . ARG A 1 282 ? 34.905  7.959   11.946  1.00 37.31 ? 578  ARG A CG    1 
ATOM   2117 C CD    . ARG A 1 282 ? 33.857  8.935   11.443  1.00 37.39 ? 578  ARG A CD    1 
ATOM   2118 N NE    . ARG A 1 282 ? 34.391  10.298  11.458  1.00 37.79 ? 578  ARG A NE    1 
ATOM   2119 C CZ    . ARG A 1 282 ? 34.929  10.939  10.417  1.00 37.65 ? 578  ARG A CZ    1 
ATOM   2120 N NH1   . ARG A 1 282 ? 35.003  10.374  9.217   1.00 37.64 ? 578  ARG A NH1   1 
ATOM   2121 N NH2   . ARG A 1 282 ? 35.393  12.174  10.578  1.00 37.51 ? 578  ARG A NH2   1 
ATOM   2122 N N     . GLN A 1 283 ? 33.888  3.832   13.642  1.00 37.26 ? 579  GLN A N     1 
ATOM   2123 C CA    . GLN A 1 283 ? 33.110  2.869   14.428  1.00 37.35 ? 579  GLN A CA    1 
ATOM   2124 C C     . GLN A 1 283 ? 33.943  2.261   15.572  1.00 36.82 ? 579  GLN A C     1 
ATOM   2125 O O     . GLN A 1 283 ? 33.436  2.066   16.675  1.00 36.75 ? 579  GLN A O     1 
ATOM   2126 C CB    . GLN A 1 283 ? 32.538  1.767   13.540  1.00 37.55 ? 579  GLN A CB    1 
ATOM   2127 C CG    . GLN A 1 283 ? 33.588  0.844   12.966  1.00 39.13 ? 579  GLN A CG    1 
ATOM   2128 C CD    . GLN A 1 283 ? 33.007  -0.331  12.219  1.00 41.03 ? 579  GLN A CD    1 
ATOM   2129 O OE1   . GLN A 1 283 ? 31.906  -0.254  11.664  1.00 43.06 ? 579  GLN A OE1   1 
ATOM   2130 N NE2   . GLN A 1 283 ? 33.750  -1.437  12.194  1.00 41.30 ? 579  GLN A NE2   1 
ATOM   2131 N N     . LEU A 1 284 ? 35.216  1.973   15.305  1.00 36.34 ? 580  LEU A N     1 
ATOM   2132 C CA    . LEU A 1 284 ? 36.118  1.454   16.337  1.00 36.00 ? 580  LEU A CA    1 
ATOM   2133 C C     . LEU A 1 284 ? 36.394  2.516   17.387  1.00 35.66 ? 580  LEU A C     1 
ATOM   2134 O O     . LEU A 1 284 ? 36.442  2.219   18.577  1.00 35.47 ? 580  LEU A O     1 
ATOM   2135 C CB    . LEU A 1 284 ? 37.459  1.009   15.749  1.00 36.12 ? 580  LEU A CB    1 
ATOM   2136 C CG    . LEU A 1 284 ? 37.626  -0.381  15.129  1.00 36.40 ? 580  LEU A CG    1 
ATOM   2137 C CD1   . LEU A 1 284 ? 39.114  -0.795  15.210  1.00 36.02 ? 580  LEU A CD1   1 
ATOM   2138 C CD2   . LEU A 1 284 ? 36.725  -1.423  15.792  1.00 35.92 ? 580  LEU A CD2   1 
ATOM   2139 N N     . GLY A 1 285 ? 36.604  3.747   16.930  1.00 35.41 ? 581  GLY A N     1 
ATOM   2140 C CA    . GLY A 1 285 ? 36.822  4.879   17.818  1.00 35.23 ? 581  GLY A CA    1 
ATOM   2141 C C     . GLY A 1 285 ? 35.603  5.149   18.676  1.00 35.21 ? 581  GLY A C     1 
ATOM   2142 O O     . GLY A 1 285 ? 35.720  5.405   19.870  1.00 34.97 ? 581  GLY A O     1 
ATOM   2143 N N     . LYS A 1 286 ? 34.428  5.070   18.062  1.00 35.38 ? 582  LYS A N     1 
ATOM   2144 C CA    . LYS A 1 286 ? 33.174  5.357   18.746  1.00 35.66 ? 582  LYS A CA    1 
ATOM   2145 C C     . LYS A 1 286 ? 32.893  4.355   19.851  1.00 35.61 ? 582  LYS A C     1 
ATOM   2146 O O     . LYS A 1 286 ? 32.552  4.743   20.964  1.00 35.53 ? 582  LYS A O     1 
ATOM   2147 C CB    . LYS A 1 286 ? 32.012  5.350   17.751  1.00 35.99 ? 582  LYS A CB    1 
ATOM   2148 C CG    . LYS A 1 286 ? 30.664  5.782   18.334  1.00 36.80 ? 582  LYS A CG    1 
ATOM   2149 C CD    . LYS A 1 286 ? 30.765  7.134   19.031  1.00 37.81 ? 582  LYS A CD    1 
ATOM   2150 C CE    . LYS A 1 286 ? 29.400  7.738   19.327  1.00 38.62 ? 582  LYS A CE    1 
ATOM   2151 N NZ    . LYS A 1 286 ? 29.505  8.815   20.372  1.00 38.42 ? 582  LYS A NZ    1 
ATOM   2152 N N     . LEU A 1 287 ? 33.018  3.071   19.529  1.00 35.66 ? 583  LEU A N     1 
ATOM   2153 C CA    . LEU A 1 287 ? 32.840  2.005   20.521  1.00 35.89 ? 583  LEU A CA    1 
ATOM   2154 C C     . LEU A 1 287 ? 33.771  2.177   21.706  1.00 36.12 ? 583  LEU A C     1 
ATOM   2155 O O     . LEU A 1 287 ? 33.369  2.012   22.856  1.00 36.09 ? 583  LEU A O     1 
ATOM   2156 C CB    . LEU A 1 287 ? 33.120  0.636   19.907  1.00 35.85 ? 583  LEU A CB    1 
ATOM   2157 C CG    . LEU A 1 287 ? 32.103  0.100   18.904  1.00 36.24 ? 583  LEU A CG    1 
ATOM   2158 C CD1   . LEU A 1 287 ? 32.628  -1.217  18.340  1.00 35.85 ? 583  LEU A CD1   1 
ATOM   2159 C CD2   . LEU A 1 287 ? 30.711  -0.067  19.547  1.00 36.54 ? 583  LEU A CD2   1 
ATOM   2160 N N     . GLN A 1 288 ? 35.025  2.492   21.408  1.00 36.49 ? 584  GLN A N     1 
ATOM   2161 C CA    . GLN A 1 288 ? 36.062  2.603   22.426  1.00 36.71 ? 584  GLN A CA    1 
ATOM   2162 C C     . GLN A 1 288 ? 35.848  3.836   23.290  1.00 36.45 ? 584  GLN A C     1 
ATOM   2163 O O     . GLN A 1 288 ? 35.715  3.724   24.502  1.00 36.66 ? 584  GLN A O     1 
ATOM   2164 C CB    . GLN A 1 288 ? 37.447  2.637   21.767  1.00 37.04 ? 584  GLN A CB    1 
ATOM   2165 C CG    . GLN A 1 288 ? 38.619  3.031   22.684  1.00 38.32 ? 584  GLN A CG    1 
ATOM   2166 C CD    . GLN A 1 288 ? 39.198  1.862   23.476  1.00 40.10 ? 584  GLN A CD    1 
ATOM   2167 O OE1   . GLN A 1 288 ? 38.521  0.859   23.738  1.00 40.69 ? 584  GLN A OE1   1 
ATOM   2168 N NE2   . GLN A 1 288 ? 40.466  1.994   23.865  1.00 41.29 ? 584  GLN A NE2   1 
ATOM   2169 N N     . SER A 1 289 ? 35.812  5.010   22.674  1.00 36.22 ? 585  SER A N     1 
ATOM   2170 C CA    . SER A 1 289 ? 35.809  6.252   23.453  1.00 36.18 ? 585  SER A CA    1 
ATOM   2171 C C     . SER A 1 289 ? 34.543  6.393   24.291  1.00 35.98 ? 585  SER A C     1 
ATOM   2172 O O     . SER A 1 289 ? 34.610  6.784   25.454  1.00 36.12 ? 585  SER A O     1 
ATOM   2173 C CB    . SER A 1 289 ? 35.973  7.485   22.559  1.00 36.21 ? 585  SER A CB    1 
ATOM   2174 O OG    . SER A 1 289 ? 34.716  8.068   22.264  1.00 36.57 ? 585  SER A OG    1 
ATOM   2175 N N     . THR A 1 290 ? 33.401  6.060   23.697  1.00 35.75 ? 586  THR A N     1 
ATOM   2176 C CA    . THR A 1 290 ? 32.104  6.303   24.320  1.00 35.75 ? 586  THR A CA    1 
ATOM   2177 C C     . THR A 1 290 ? 31.557  5.098   25.077  1.00 35.83 ? 586  THR A C     1 
ATOM   2178 O O     . THR A 1 290 ? 31.167  5.210   26.241  1.00 36.00 ? 586  THR A O     1 
ATOM   2179 C CB    . THR A 1 290 ? 31.065  6.703   23.263  1.00 35.79 ? 586  THR A CB    1 
ATOM   2180 O OG1   . THR A 1 290 ? 31.583  7.777   22.466  1.00 36.01 ? 586  THR A OG1   1 
ATOM   2181 C CG2   . THR A 1 290 ? 29.746  7.122   23.922  1.00 35.42 ? 586  THR A CG2   1 
ATOM   2182 N N     . TYR A 1 291 ? 31.514  3.952   24.411  1.00 35.78 ? 587  TYR A N     1 
ATOM   2183 C CA    . TYR A 1 291 ? 30.813  2.787   24.952  1.00 35.68 ? 587  TYR A CA    1 
ATOM   2184 C C     . TYR A 1 291 ? 31.650  1.899   25.868  1.00 35.81 ? 587  TYR A C     1 
ATOM   2185 O O     . TYR A 1 291 ? 31.105  1.242   26.752  1.00 35.99 ? 587  TYR A O     1 
ATOM   2186 C CB    . TYR A 1 291 ? 30.188  1.979   23.818  1.00 35.58 ? 587  TYR A CB    1 
ATOM   2187 C CG    . TYR A 1 291 ? 29.045  2.725   23.176  1.00 35.26 ? 587  TYR A CG    1 
ATOM   2188 C CD1   . TYR A 1 291 ? 27.918  3.049   23.920  1.00 34.57 ? 587  TYR A CD1   1 
ATOM   2189 C CD2   . TYR A 1 291 ? 29.094  3.125   21.840  1.00 34.92 ? 587  TYR A CD2   1 
ATOM   2190 C CE1   . TYR A 1 291 ? 26.870  3.742   23.366  1.00 34.55 ? 587  TYR A CE1   1 
ATOM   2191 C CE2   . TYR A 1 291 ? 28.041  3.823   21.272  1.00 34.74 ? 587  TYR A CE2   1 
ATOM   2192 C CZ    . TYR A 1 291 ? 26.929  4.126   22.047  1.00 34.54 ? 587  TYR A CZ    1 
ATOM   2193 O OH    . TYR A 1 291 ? 25.863  4.814   21.520  1.00 34.39 ? 587  TYR A OH    1 
ATOM   2194 N N     . ILE A 1 292 ? 32.960  1.865   25.670  1.00 35.82 ? 588  ILE A N     1 
ATOM   2195 C CA    . ILE A 1 292 ? 33.821  1.156   26.606  1.00 35.84 ? 588  ILE A CA    1 
ATOM   2196 C C     . ILE A 1 292 ? 34.269  2.111   27.701  1.00 35.91 ? 588  ILE A C     1 
ATOM   2197 O O     . ILE A 1 292 ? 33.939  1.911   28.863  1.00 36.12 ? 588  ILE A O     1 
ATOM   2198 C CB    . ILE A 1 292 ? 35.040  0.526   25.918  1.00 35.87 ? 588  ILE A CB    1 
ATOM   2199 C CG1   . ILE A 1 292 ? 34.630  -0.765  25.204  1.00 36.02 ? 588  ILE A CG1   1 
ATOM   2200 C CG2   . ILE A 1 292 ? 36.140  0.245   26.943  1.00 35.98 ? 588  ILE A CG2   1 
ATOM   2201 C CD1   . ILE A 1 292 ? 35.793  -1.689  24.887  1.00 36.43 ? 588  ILE A CD1   1 
ATOM   2202 N N     . GLU A 1 293 ? 34.997  3.157   27.319  1.00 35.96 ? 589  GLU A N     1 
ATOM   2203 C CA    . GLU A 1 293 ? 35.590  4.098   28.282  1.00 36.11 ? 589  GLU A CA    1 
ATOM   2204 C C     . GLU A 1 293 ? 34.571  4.989   28.978  1.00 35.88 ? 589  GLU A C     1 
ATOM   2205 O O     . GLU A 1 293 ? 34.570  5.104   30.205  1.00 35.95 ? 589  GLU A O     1 
ATOM   2206 C CB    . GLU A 1 293 ? 36.642  4.977   27.601  1.00 36.32 ? 589  GLU A CB    1 
ATOM   2207 C CG    . GLU A 1 293 ? 38.066  4.593   27.978  1.00 37.66 ? 589  GLU A CG    1 
ATOM   2208 C CD    . GLU A 1 293 ? 39.101  4.964   26.931  1.00 39.45 ? 589  GLU A CD    1 
ATOM   2209 O OE1   . GLU A 1 293 ? 38.719  5.327   25.793  1.00 40.40 ? 589  GLU A OE1   1 
ATOM   2210 O OE2   . GLU A 1 293 ? 40.309  4.873   27.256  1.00 40.61 ? 589  GLU A OE2   1 
ATOM   2211 N N     . GLY A 1 294 ? 33.716  5.628   28.186  1.00 35.63 ? 590  GLY A N     1 
ATOM   2212 C CA    . GLY A 1 294 ? 32.675  6.496   28.720  1.00 35.37 ? 590  GLY A CA    1 
ATOM   2213 C C     . GLY A 1 294 ? 31.790  5.762   29.704  1.00 35.25 ? 590  GLY A C     1 
ATOM   2214 O O     . GLY A 1 294 ? 31.309  6.340   30.677  1.00 35.32 ? 590  GLY A O     1 
ATOM   2215 N N     . LEU A 1 295 ? 31.585  4.477   29.448  1.00 35.15 ? 591  LEU A N     1 
ATOM   2216 C CA    . LEU A 1 295 ? 30.769  3.638   30.317  1.00 35.18 ? 591  LEU A CA    1 
ATOM   2217 C C     . LEU A 1 295 ? 31.469  3.312   31.631  1.00 35.21 ? 591  LEU A C     1 
ATOM   2218 O O     . LEU A 1 295 ? 30.842  3.323   32.685  1.00 35.34 ? 591  LEU A O     1 
ATOM   2219 C CB    . LEU A 1 295 ? 30.392  2.345   29.592  1.00 35.13 ? 591  LEU A CB    1 
ATOM   2220 C CG    . LEU A 1 295 ? 29.046  1.705   29.947  1.00 35.05 ? 591  LEU A CG    1 
ATOM   2221 C CD1   . LEU A 1 295 ? 27.935  2.734   30.066  1.00 34.21 ? 591  LEU A CD1   1 
ATOM   2222 C CD2   . LEU A 1 295 ? 28.678  0.674   28.889  1.00 35.32 ? 591  LEU A CD2   1 
ATOM   2223 N N     . LEU A 1 296 ? 32.764  3.022   31.565  1.00 35.32 ? 592  LEU A N     1 
ATOM   2224 C CA    . LEU A 1 296 ? 33.531  2.596   32.747  1.00 35.30 ? 592  LEU A CA    1 
ATOM   2225 C C     . LEU A 1 296 ? 33.555  3.618   33.875  1.00 35.54 ? 592  LEU A C     1 
ATOM   2226 O O     . LEU A 1 296 ? 33.327  3.270   35.032  1.00 35.66 ? 592  LEU A O     1 
ATOM   2227 C CB    . LEU A 1 296 ? 34.968  2.245   32.367  1.00 35.18 ? 592  LEU A CB    1 
ATOM   2228 C CG    . LEU A 1 296 ? 35.159  0.854   31.776  1.00 34.90 ? 592  LEU A CG    1 
ATOM   2229 C CD1   . LEU A 1 296 ? 36.569  0.718   31.230  1.00 35.07 ? 592  LEU A CD1   1 
ATOM   2230 C CD2   . LEU A 1 296 ? 34.883  -0.209  32.814  1.00 34.65 ? 592  LEU A CD2   1 
ATOM   2231 N N     . LYS A 1 297 ? 33.826  4.874   33.542  1.00 35.79 ? 593  LYS A N     1 
ATOM   2232 C CA    . LYS A 1 297 ? 33.943  5.925   34.561  1.00 36.15 ? 593  LYS A CA    1 
ATOM   2233 C C     . LYS A 1 297 ? 32.608  6.373   35.195  1.00 36.24 ? 593  LYS A C     1 
ATOM   2234 O O     . LYS A 1 297 ? 32.618  7.143   36.159  1.00 36.47 ? 593  LYS A O     1 
ATOM   2235 C CB    . LYS A 1 297 ? 34.684  7.141   33.996  1.00 36.22 ? 593  LYS A CB    1 
ATOM   2236 C CG    . LYS A 1 297 ? 33.956  7.861   32.876  1.00 36.57 ? 593  LYS A CG    1 
ATOM   2237 C CD    . LYS A 1 297 ? 34.625  9.178   32.542  1.00 37.14 ? 593  LYS A CD    1 
ATOM   2238 C CE    . LYS A 1 297 ? 33.805  9.988   31.552  1.00 37.31 ? 593  LYS A CE    1 
ATOM   2239 N NZ    . LYS A 1 297 ? 33.707  9.316   30.241  1.00 37.26 ? 593  LYS A NZ    1 
ATOM   2240 N N     . VAL A 1 298 ? 31.480  5.912   34.651  1.00 36.17 ? 594  VAL A N     1 
ATOM   2241 C CA    . VAL A 1 298 ? 30.164  6.157   35.251  1.00 36.25 ? 594  VAL A CA    1 
ATOM   2242 C C     . VAL A 1 298 ? 29.588  4.912   35.936  1.00 36.42 ? 594  VAL A C     1 
ATOM   2243 O O     . VAL A 1 298 ? 28.366  4.788   36.097  1.00 36.22 ? 594  VAL A O     1 
ATOM   2244 C CB    . VAL A 1 298 ? 29.151  6.682   34.217  1.00 36.27 ? 594  VAL A CB    1 
ATOM   2245 C CG1   . VAL A 1 298 ? 29.690  7.930   33.561  1.00 36.73 ? 594  VAL A CG1   1 
ATOM   2246 C CG2   . VAL A 1 298 ? 28.823  5.622   33.171  1.00 36.11 ? 594  VAL A CG2   1 
ATOM   2247 N N     . VAL A 1 299 ? 30.466  3.992   36.333  1.00 36.69 ? 595  VAL A N     1 
ATOM   2248 C CA    . VAL A 1 299 ? 30.065  2.881   37.193  1.00 37.00 ? 595  VAL A CA    1 
ATOM   2249 C C     . VAL A 1 299 ? 30.525  3.169   38.607  1.00 37.20 ? 595  VAL A C     1 
ATOM   2250 O O     . VAL A 1 299 ? 31.663  3.588   38.830  1.00 37.39 ? 595  VAL A O     1 
ATOM   2251 C CB    . VAL A 1 299 ? 30.662  1.537   36.762  1.00 37.01 ? 595  VAL A CB    1 
ATOM   2252 C CG1   . VAL A 1 299 ? 30.030  0.407   37.576  1.00 36.87 ? 595  VAL A CG1   1 
ATOM   2253 C CG2   . VAL A 1 299 ? 30.443  1.310   35.281  1.00 37.35 ? 595  VAL A CG2   1 
ATOM   2254 N N     . ARG A 1 300 ? 29.634  2.945   39.559  1.00 37.39 ? 596  ARG A N     1 
ATOM   2255 C CA    . ARG A 1 300 ? 29.965  3.146   40.955  1.00 37.64 ? 596  ARG A CA    1 
ATOM   2256 C C     . ARG A 1 300 ? 30.773  1.959   41.439  1.00 37.45 ? 596  ARG A C     1 
ATOM   2257 O O     . ARG A 1 300 ? 30.325  0.816   41.305  1.00 37.51 ? 596  ARG A O     1 
ATOM   2258 C CB    . ARG A 1 300 ? 28.701  3.307   41.777  1.00 37.84 ? 596  ARG A CB    1 
ATOM   2259 C CG    . ARG A 1 300 ? 27.970  4.533   41.382  1.00 39.01 ? 596  ARG A CG    1 
ATOM   2260 C CD    . ARG A 1 300 ? 26.792  4.845   42.250  1.00 40.77 ? 596  ARG A CD    1 
ATOM   2261 N NE    . ARG A 1 300 ? 26.271  6.133   41.812  1.00 41.81 ? 596  ARG A NE    1 
ATOM   2262 C CZ    . ARG A 1 300 ? 26.762  7.317   42.181  1.00 42.89 ? 596  ARG A CZ    1 
ATOM   2263 N NH1   . ARG A 1 300 ? 27.776  7.404   43.041  1.00 43.17 ? 596  ARG A NH1   1 
ATOM   2264 N NH2   . ARG A 1 300 ? 26.224  8.430   41.693  1.00 43.60 ? 596  ARG A NH2   1 
ATOM   2265 N N     . PRO A 1 301 ? 31.964  2.223   42.007  1.00 37.16 ? 597  PRO A N     1 
ATOM   2266 C CA    . PRO A 1 301 ? 32.863  1.132   42.379  1.00 37.07 ? 597  PRO A CA    1 
ATOM   2267 C C     . PRO A 1 301 ? 32.267  0.222   43.460  1.00 36.92 ? 597  PRO A C     1 
ATOM   2268 O O     . PRO A 1 301 ? 32.670  -0.946  43.583  1.00 36.96 ? 597  PRO A O     1 
ATOM   2269 C CB    . PRO A 1 301 ? 34.108  1.865   42.892  1.00 37.02 ? 597  PRO A CB    1 
ATOM   2270 C CG    . PRO A 1 301 ? 33.593  3.161   43.373  1.00 37.11 ? 597  PRO A CG    1 
ATOM   2271 C CD    . PRO A 1 301 ? 32.457  3.527   42.483  1.00 37.04 ? 597  PRO A CD    1 
ATOM   2272 N N     . ASP A 1 302 ? 31.313  0.760   44.222  1.00 36.58 ? 598  ASP A N     1 
ATOM   2273 C CA    . ASP A 1 302 ? 30.640  -0.001  45.271  1.00 36.44 ? 598  ASP A CA    1 
ATOM   2274 C C     . ASP A 1 302 ? 29.677  -1.025  44.692  1.00 36.22 ? 598  ASP A C     1 
ATOM   2275 O O     . ASP A 1 302 ? 29.903  -2.232  44.823  1.00 36.41 ? 598  ASP A O     1 
ATOM   2276 C CB    . ASP A 1 302 ? 29.923  0.920   46.275  1.00 36.50 ? 598  ASP A CB    1 
ATOM   2277 C CG    . ASP A 1 302 ? 29.039  1.957   45.611  1.00 36.73 ? 598  ASP A CG    1 
ATOM   2278 O OD1   . ASP A 1 302 ? 29.422  2.455   44.538  1.00 37.38 ? 598  ASP A OD1   1 
ATOM   2279 O OD2   . ASP A 1 302 ? 27.967  2.280   46.166  1.00 37.01 ? 598  ASP A OD2   1 
ATOM   2280 N N     . THR A 1 303 ? 28.633  -0.549  44.024  1.00 35.86 ? 599  THR A N     1 
ATOM   2281 C CA    . THR A 1 303 ? 27.568  -1.422  43.529  1.00 35.57 ? 599  THR A CA    1 
ATOM   2282 C C     . THR A 1 303 ? 27.969  -2.141  42.250  1.00 35.30 ? 599  THR A C     1 
ATOM   2283 O O     . THR A 1 303 ? 27.387  -3.162  41.900  1.00 35.28 ? 599  THR A O     1 
ATOM   2284 C CB    . THR A 1 303 ? 26.299  -0.629  43.209  1.00 35.51 ? 599  THR A CB    1 
ATOM   2285 O OG1   . THR A 1 303 ? 26.526  0.164   42.035  1.00 35.36 ? 599  THR A OG1   1 
ATOM   2286 C CG2   . THR A 1 303 ? 25.912  0.271   44.377  1.00 35.33 ? 599  THR A CG2   1 
ATOM   2287 N N     . LYS A 1 304 ? 28.946  -1.590  41.544  1.00 35.11 ? 600  LYS A N     1 
ATOM   2288 C CA    . LYS A 1 304 ? 29.357  -2.134  40.260  1.00 35.09 ? 600  LYS A CA    1 
ATOM   2289 C C     . LYS A 1 304 ? 28.163  -2.079  39.296  1.00 34.99 ? 600  LYS A C     1 
ATOM   2290 O O     . LYS A 1 304 ? 27.998  -2.938  38.436  1.00 35.09 ? 600  LYS A O     1 
ATOM   2291 C CB    . LYS A 1 304 ? 29.893  -3.566  40.430  1.00 35.09 ? 600  LYS A CB    1 
ATOM   2292 C CG    . LYS A 1 304 ? 31.056  -3.908  39.512  1.00 34.94 ? 600  LYS A CG    1 
ATOM   2293 N N     . LYS A 1 305 ? 27.337  -1.049  39.449  1.00 34.87 ? 601  LYS A N     1 
ATOM   2294 C CA    . LYS A 1 305 ? 26.175  -0.857  38.594  1.00 34.71 ? 601  LYS A CA    1 
ATOM   2295 C C     . LYS A 1 305 ? 26.215  0.508   37.922  1.00 34.30 ? 601  LYS A C     1 
ATOM   2296 O O     . LYS A 1 305 ? 26.949  1.403   38.348  1.00 34.13 ? 601  LYS A O     1 
ATOM   2297 C CB    . LYS A 1 305 ? 24.892  -0.964  39.408  1.00 34.87 ? 601  LYS A CB    1 
ATOM   2298 C CG    . LYS A 1 305 ? 24.562  -2.352  39.911  1.00 35.43 ? 601  LYS A CG    1 
ATOM   2299 C CD    . LYS A 1 305 ? 23.144  -2.371  40.494  1.00 36.39 ? 601  LYS A CD    1 
ATOM   2300 C CE    . LYS A 1 305 ? 23.035  -3.271  41.713  1.00 37.15 ? 601  LYS A CE    1 
ATOM   2301 N NZ    . LYS A 1 305 ? 23.201  -4.720  41.381  1.00 37.86 ? 601  LYS A NZ    1 
ATOM   2302 N N     . VAL A 1 306 ? 25.422  0.642   36.861  1.00 33.91 ? 602  VAL A N     1 
ATOM   2303 C CA    . VAL A 1 306 ? 25.160  1.937   36.236  1.00 33.65 ? 602  VAL A CA    1 
ATOM   2304 C C     . VAL A 1 306 ? 23.740  2.379   36.559  1.00 33.53 ? 602  VAL A C     1 
ATOM   2305 O O     . VAL A 1 306 ? 22.774  1.637   36.348  1.00 33.45 ? 602  VAL A O     1 
ATOM   2306 C CB    . VAL A 1 306 ? 25.349  1.926   34.708  1.00 33.51 ? 602  VAL A CB    1 
ATOM   2307 C CG1   . VAL A 1 306 ? 26.816  1.854   34.367  1.00 33.52 ? 602  VAL A CG1   1 
ATOM   2308 C CG2   . VAL A 1 306 ? 24.590  0.791   34.073  1.00 33.45 ? 602  VAL A CG2   1 
ATOM   2309 N N     . HIS A 1 307 ? 23.638  3.592   37.091  1.00 33.34 ? 603  HIS A N     1 
ATOM   2310 C CA    . HIS A 1 307 ? 22.371  4.169   37.484  1.00 33.32 ? 603  HIS A CA    1 
ATOM   2311 C C     . HIS A 1 307 ? 22.177  5.413   36.645  1.00 33.38 ? 603  HIS A C     1 
ATOM   2312 O O     . HIS A 1 307 ? 22.784  6.457   36.894  1.00 33.35 ? 603  HIS A O     1 
ATOM   2313 C CB    . HIS A 1 307 ? 22.359  4.507   38.978  1.00 33.35 ? 603  HIS A CB    1 
ATOM   2314 C CG    . HIS A 1 307 ? 22.704  3.346   39.865  1.00 33.29 ? 603  HIS A CG    1 
ATOM   2315 N ND1   . HIS A 1 307 ? 21.749  2.574   40.496  1.00 33.25 ? 603  HIS A ND1   1 
ATOM   2316 C CD2   . HIS A 1 307 ? 23.901  2.826   40.226  1.00 32.60 ? 603  HIS A CD2   1 
ATOM   2317 C CE1   . HIS A 1 307 ? 22.343  1.631   41.204  1.00 32.21 ? 603  HIS A CE1   1 
ATOM   2318 N NE2   . HIS A 1 307 ? 23.648  1.760   41.053  1.00 32.37 ? 603  HIS A NE2   1 
ATOM   2319 N N     . THR A 1 308 ? 21.345  5.268   35.623  1.00 33.45 ? 604  THR A N     1 
ATOM   2320 C CA    . THR A 1 308 ? 21.015  6.353   34.727  1.00 33.37 ? 604  THR A CA    1 
ATOM   2321 C C     . THR A 1 308 ? 19.910  7.185   35.342  1.00 33.34 ? 604  THR A C     1 
ATOM   2322 O O     . THR A 1 308 ? 19.237  6.746   36.271  1.00 33.32 ? 604  THR A O     1 
ATOM   2323 C CB    . THR A 1 308 ? 20.524  5.808   33.385  1.00 33.37 ? 604  THR A CB    1 
ATOM   2324 O OG1   . THR A 1 308 ? 20.462  6.876   32.432  1.00 33.96 ? 604  THR A OG1   1 
ATOM   2325 C CG2   . THR A 1 308 ? 19.146  5.163   33.535  1.00 33.05 ? 604  THR A CG2   1 
ATOM   2326 N N     . ILE A 1 309 ? 19.737  8.395   34.831  1.00 33.38 ? 605  ILE A N     1 
ATOM   2327 C CA    . ILE A 1 309 ? 18.571  9.197   35.163  1.00 33.24 ? 605  ILE A CA    1 
ATOM   2328 C C     . ILE A 1 309 ? 17.708  9.214   33.929  1.00 33.13 ? 605  ILE A C     1 
ATOM   2329 O O     . ILE A 1 309 ? 18.192  9.496   32.836  1.00 33.12 ? 605  ILE A O     1 
ATOM   2330 C CB    . ILE A 1 309 ? 18.935  10.634  35.533  1.00 33.22 ? 605  ILE A CB    1 
ATOM   2331 C CG1   . ILE A 1 309 ? 19.769  10.665  36.813  1.00 33.30 ? 605  ILE A CG1   1 
ATOM   2332 C CG2   . ILE A 1 309 ? 17.680  11.457  35.727  1.00 33.41 ? 605  ILE A CG2   1 
ATOM   2333 C CD1   . ILE A 1 309 ? 20.824  11.756  36.807  1.00 33.59 ? 605  ILE A CD1   1 
ATOM   2334 N N     . PHE A 1 310 ? 16.437  8.885   34.100  1.00 33.01 ? 606  PHE A N     1 
ATOM   2335 C CA    . PHE A 1 310 ? 15.478  8.996   33.024  1.00 32.91 ? 606  PHE A CA    1 
ATOM   2336 C C     . PHE A 1 310 ? 14.846  10.373  33.098  1.00 32.70 ? 606  PHE A C     1 
ATOM   2337 O O     . PHE A 1 310 ? 14.095  10.654  34.022  1.00 32.79 ? 606  PHE A O     1 
ATOM   2338 C CB    . PHE A 1 310 ? 14.411  7.911   33.137  1.00 32.95 ? 606  PHE A CB    1 
ATOM   2339 C CG    . PHE A 1 310 ? 14.878  6.562   32.695  1.00 33.37 ? 606  PHE A CG    1 
ATOM   2340 C CD1   . PHE A 1 310 ? 15.207  6.336   31.367  1.00 34.49 ? 606  PHE A CD1   1 
ATOM   2341 C CD2   . PHE A 1 310 ? 14.989  5.514   33.595  1.00 33.75 ? 606  PHE A CD2   1 
ATOM   2342 C CE1   . PHE A 1 310 ? 15.651  5.087   30.943  1.00 34.88 ? 606  PHE A CE1   1 
ATOM   2343 C CE2   . PHE A 1 310 ? 15.433  4.262   33.181  1.00 33.91 ? 606  PHE A CE2   1 
ATOM   2344 C CZ    . PHE A 1 310 ? 15.766  4.048   31.855  1.00 34.38 ? 606  PHE A CZ    1 
ATOM   2345 N N     . ASN A 1 311 ? 15.186  11.241  32.150  1.00 32.51 ? 607  ASN A N     1 
ATOM   2346 C CA    . ASN A 1 311 ? 14.537  12.544  32.032  1.00 32.45 ? 607  ASN A CA    1 
ATOM   2347 C C     . ASN A 1 311 ? 13.131  12.386  31.441  1.00 32.37 ? 607  ASN A C     1 
ATOM   2348 O O     . ASN A 1 311 ? 12.962  12.066  30.269  1.00 32.61 ? 607  ASN A O     1 
ATOM   2349 C CB    . ASN A 1 311 ? 15.381  13.489  31.176  1.00 32.43 ? 607  ASN A CB    1 
ATOM   2350 C CG    . ASN A 1 311 ? 14.999  14.943  31.354  1.00 32.18 ? 607  ASN A CG    1 
ATOM   2351 O OD1   . ASN A 1 311 ? 13.882  15.269  31.760  1.00 31.99 ? 607  ASN A OD1   1 
ATOM   2352 N ND2   . ASN A 1 311 ? 15.931  15.829  31.040  1.00 32.07 ? 607  ASN A ND2   1 
ATOM   2353 N N     . GLN A 1 312 ? 12.127  12.623  32.270  1.00 32.19 ? 608  GLN A N     1 
ATOM   2354 C CA    . GLN A 1 312 ? 10.742  12.331  31.927  1.00 32.12 ? 608  GLN A CA    1 
ATOM   2355 C C     . GLN A 1 312 ? 10.025  13.536  31.345  1.00 32.08 ? 608  GLN A C     1 
ATOM   2356 O O     . GLN A 1 312 ? 9.027   13.386  30.640  1.00 32.38 ? 608  GLN A O     1 
ATOM   2357 C CB    . GLN A 1 312 ? 10.011  11.845  33.186  1.00 32.12 ? 608  GLN A CB    1 
ATOM   2358 C CG    . GLN A 1 312 ? 8.489   11.699  33.066  1.00 32.02 ? 608  GLN A CG    1 
ATOM   2359 C CD    . GLN A 1 312 ? 7.859   11.053  34.298  1.00 31.77 ? 608  GLN A CD    1 
ATOM   2360 O OE1   . GLN A 1 312 ? 6.640   10.919  34.392  1.00 31.69 ? 608  GLN A OE1   1 
ATOM   2361 N NE2   . GLN A 1 312 ? 8.690   10.663  35.253  1.00 31.53 ? 608  GLN A NE2   1 
ATOM   2362 N N     . ALA A 1 313 ? 10.531  14.725  31.648  1.00 31.96 ? 609  ALA A N     1 
ATOM   2363 C CA    . ALA A 1 313 ? 9.863   15.964  31.288  1.00 31.75 ? 609  ALA A CA    1 
ATOM   2364 C C     . ALA A 1 313 ? 10.664  16.798  30.288  1.00 31.68 ? 609  ALA A C     1 
ATOM   2365 O O     . ALA A 1 313 ? 10.561  18.018  30.299  1.00 31.69 ? 609  ALA A O     1 
ATOM   2366 C CB    . ALA A 1 313 ? 9.598   16.768  32.542  1.00 31.68 ? 609  ALA A CB    1 
ATOM   2367 N N     . LEU A 1 314 ? 11.441  16.149  29.420  1.00 31.68 ? 610  LEU A N     1 
ATOM   2368 C CA    . LEU A 1 314 ? 12.282  16.862  28.442  1.00 31.63 ? 610  LEU A CA    1 
ATOM   2369 C C     . LEU A 1 314 ? 11.812  16.762  26.989  1.00 31.72 ? 610  LEU A C     1 
ATOM   2370 O O     . LEU A 1 314 ? 11.946  17.722  26.242  1.00 31.67 ? 610  LEU A O     1 
ATOM   2371 C CB    . LEU A 1 314 ? 13.751  16.411  28.543  1.00 31.61 ? 610  LEU A CB    1 
ATOM   2372 C CG    . LEU A 1 314 ? 14.722  16.870  27.435  1.00 31.04 ? 610  LEU A CG    1 
ATOM   2373 C CD1   . LEU A 1 314 ? 16.117  17.107  27.973  1.00 30.70 ? 610  LEU A CD1   1 
ATOM   2374 C CD2   . LEU A 1 314 ? 14.765  15.876  26.288  1.00 30.62 ? 610  LEU A CD2   1 
ATOM   2375 N N     . THR A 1 315 ? 11.276  15.619  26.572  1.00 31.86 ? 611  THR A N     1 
ATOM   2376 C CA    . THR A 1 315 ? 11.019  15.411  25.134  1.00 32.03 ? 611  THR A CA    1 
ATOM   2377 C C     . THR A 1 315 ? 9.750   16.104  24.645  1.00 32.08 ? 611  THR A C     1 
ATOM   2378 O O     . THR A 1 315 ? 8.769   16.209  25.371  1.00 31.90 ? 611  THR A O     1 
ATOM   2379 C CB    . THR A 1 315 ? 10.952  13.912  24.736  1.00 32.08 ? 611  THR A CB    1 
ATOM   2380 O OG1   . THR A 1 315 ? 9.670   13.369  25.065  1.00 32.01 ? 611  THR A OG1   1 
ATOM   2381 C CG2   . THR A 1 315 ? 12.035  13.107  25.427  1.00 32.14 ? 611  THR A CG2   1 
ATOM   2382 N N     . GLN A 1 316 ? 9.775   16.557  23.397  1.00 32.33 ? 612  GLN A N     1 
ATOM   2383 C CA    . GLN A 1 316 ? 8.621   17.235  22.801  1.00 32.70 ? 612  GLN A CA    1 
ATOM   2384 C C     . GLN A 1 316 ? 7.451   16.275  22.514  1.00 32.92 ? 612  GLN A C     1 
ATOM   2385 O O     . GLN A 1 316 ? 6.299   16.696  22.436  1.00 32.70 ? 612  GLN A O     1 
ATOM   2386 C CB    . GLN A 1 316 ? 9.027   17.939  21.498  1.00 32.80 ? 612  GLN A CB    1 
ATOM   2387 C CG    . GLN A 1 316 ? 10.190  18.928  21.605  1.00 32.78 ? 612  GLN A CG    1 
ATOM   2388 C CD    . GLN A 1 316 ? 10.070  19.868  22.778  1.00 32.64 ? 612  GLN A CD    1 
ATOM   2389 O OE1   . GLN A 1 316 ? 9.277   20.801  22.761  1.00 32.56 ? 612  GLN A OE1   1 
ATOM   2390 N NE2   . GLN A 1 316 ? 10.869  19.628  23.806  1.00 33.14 ? 612  GLN A NE2   1 
ATOM   2391 N N     . THR A 1 317 ? 7.767   14.990  22.366  1.00 33.20 ? 613  THR A N     1 
ATOM   2392 C CA    . THR A 1 317 ? 6.817   13.971  21.923  1.00 33.21 ? 613  THR A CA    1 
ATOM   2393 C C     . THR A 1 317 ? 6.164   13.197  23.057  1.00 33.22 ? 613  THR A C     1 
ATOM   2394 O O     . THR A 1 317 ? 5.138   12.565  22.853  1.00 33.43 ? 613  THR A O     1 
ATOM   2395 C CB    . THR A 1 317 ? 7.517   12.941  21.004  1.00 33.37 ? 613  THR A CB    1 
ATOM   2396 O OG1   . THR A 1 317 ? 8.797   12.582  21.555  1.00 33.20 ? 613  THR A OG1   1 
ATOM   2397 C CG2   . THR A 1 317 ? 7.717   13.516  19.606  1.00 33.61 ? 613  THR A CG2   1 
ATOM   2398 N N     . GLY A 1 318 ? 6.747   13.235  24.247  1.00 33.27 ? 614  GLY A N     1 
ATOM   2399 C CA    . GLY A 1 318 ? 6.219   12.460  25.376  1.00 33.35 ? 614  GLY A CA    1 
ATOM   2400 C C     . GLY A 1 318 ? 7.073   11.254  25.698  1.00 33.44 ? 614  GLY A C     1 
ATOM   2401 O O     . GLY A 1 318 ? 6.761   10.487  26.603  1.00 33.37 ? 614  GLY A O     1 
ATOM   2402 N N     . ARG A 1 319 ? 8.158   11.096  24.947  1.00 33.54 ? 615  ARG A N     1 
ATOM   2403 C CA    . ARG A 1 319 ? 9.117   10.029  25.176  1.00 33.57 ? 615  ARG A CA    1 
ATOM   2404 C C     . ARG A 1 319 ? 9.935   10.279  26.436  1.00 33.40 ? 615  ARG A C     1 
ATOM   2405 O O     . ARG A 1 319 ? 9.875   11.356  27.031  1.00 33.47 ? 615  ARG A O     1 
ATOM   2406 C CB    . ARG A 1 319 ? 10.068  9.911   23.983  1.00 33.71 ? 615  ARG A CB    1 
ATOM   2407 C CG    . ARG A 1 319 ? 9.622   8.962   22.891  1.00 34.29 ? 615  ARG A CG    1 
ATOM   2408 C CD    . ARG A 1 319 ? 10.811  8.593   22.029  1.00 35.43 ? 615  ARG A CD    1 
ATOM   2409 N NE    . ARG A 1 319 ? 10.470  7.731   20.904  1.00 36.42 ? 615  ARG A NE    1 
ATOM   2410 C CZ    . ARG A 1 319 ? 11.318  7.398   19.931  1.00 37.60 ? 615  ARG A CZ    1 
ATOM   2411 N NH1   . ARG A 1 319 ? 12.572  7.854   19.929  1.00 37.90 ? 615  ARG A NH1   1 
ATOM   2412 N NH2   . ARG A 1 319 ? 10.909  6.610   18.946  1.00 38.23 ? 615  ARG A NH2   1 
ATOM   2413 N N     . LEU A 1 320 ? 10.700  9.266   26.830  1.00 33.29 ? 616  LEU A N     1 
ATOM   2414 C CA    . LEU A 1 320 ? 11.696  9.398   27.887  1.00 33.16 ? 616  LEU A CA    1 
ATOM   2415 C C     . LEU A 1 320 ? 13.055  9.693   27.294  1.00 33.07 ? 616  LEU A C     1 
ATOM   2416 O O     . LEU A 1 320 ? 13.251  9.610   26.086  1.00 33.14 ? 616  LEU A O     1 
ATOM   2417 C CB    . LEU A 1 320 ? 11.796  8.114   28.705  1.00 33.11 ? 616  LEU A CB    1 
ATOM   2418 C CG    . LEU A 1 320 ? 10.547  7.701   29.485  1.00 33.34 ? 616  LEU A CG    1 
ATOM   2419 C CD1   . LEU A 1 320 ? 10.912  6.665   30.538  1.00 33.48 ? 616  LEU A CD1   1 
ATOM   2420 C CD2   . LEU A 1 320 ? 9.852   8.899   30.129  1.00 33.31 ? 616  LEU A CD2   1 
ATOM   2421 N N     . SER A 1 321 ? 13.986  10.042  28.168  1.00 33.08 ? 617  SER A N     1 
ATOM   2422 C CA    . SER A 1 321 ? 15.385  10.217  27.808  1.00 33.33 ? 617  SER A CA    1 
ATOM   2423 C C     . SER A 1 321 ? 16.250  9.554   28.863  1.00 33.34 ? 617  SER A C     1 
ATOM   2424 O O     . SER A 1 321 ? 15.815  9.369   29.984  1.00 33.46 ? 617  SER A O     1 
ATOM   2425 C CB    . SER A 1 321 ? 15.735  11.699  27.741  1.00 33.39 ? 617  SER A CB    1 
ATOM   2426 O OG    . SER A 1 321 ? 14.827  12.401  26.918  1.00 34.03 ? 617  SER A OG    1 
ATOM   2427 N N     . SER A 1 322 ? 17.478  9.207   28.509  1.00 33.48 ? 618  SER A N     1 
ATOM   2428 C CA    . SER A 1 322 ? 18.388  8.565   29.442  1.00 33.53 ? 618  SER A CA    1 
ATOM   2429 C C     . SER A 1 322 ? 19.728  9.272   29.415  1.00 33.86 ? 618  SER A C     1 
ATOM   2430 O O     . SER A 1 322 ? 20.221  9.627   28.350  1.00 33.81 ? 618  SER A O     1 
ATOM   2431 C CB    . SER A 1 322 ? 18.571  7.098   29.077  1.00 33.48 ? 618  SER A CB    1 
ATOM   2432 O OG    . SER A 1 322 ? 18.877  6.331   30.222  1.00 33.12 ? 618  SER A OG    1 
ATOM   2433 N N     . THR A 1 323 ? 20.325  9.443   30.589  1.00 34.22 ? 619  THR A N     1 
ATOM   2434 C CA    . THR A 1 323 ? 21.548  10.212  30.730  1.00 34.55 ? 619  THR A CA    1 
ATOM   2435 C C     . THR A 1 323 ? 22.447  9.635   31.807  1.00 34.81 ? 619  THR A C     1 
ATOM   2436 O O     . THR A 1 323 ? 21.962  9.052   32.778  1.00 34.81 ? 619  THR A O     1 
ATOM   2437 C CB    . THR A 1 323 ? 21.236  11.668  31.115  1.00 34.66 ? 619  THR A CB    1 
ATOM   2438 O OG1   . THR A 1 323 ? 20.099  11.692  31.989  1.00 35.29 ? 619  THR A OG1   1 
ATOM   2439 C CG2   . THR A 1 323 ? 20.939  12.510  29.884  1.00 34.61 ? 619  THR A CG2   1 
ATOM   2440 N N     . GLU A 1 324 ? 23.754  9.824   31.622  1.00 35.17 ? 620  GLU A N     1 
ATOM   2441 C CA    . GLU A 1 324 ? 24.783  9.464   32.606  1.00 35.53 ? 620  GLU A CA    1 
ATOM   2442 C C     . GLU A 1 324 ? 24.649  8.040   33.126  1.00 35.50 ? 620  GLU A C     1 
ATOM   2443 O O     . GLU A 1 324 ? 24.404  7.824   34.314  1.00 35.66 ? 620  GLU A O     1 
ATOM   2444 C CB    . GLU A 1 324 ? 24.761  10.432  33.785  1.00 35.83 ? 620  GLU A CB    1 
ATOM   2445 C CG    . GLU A 1 324 ? 25.113  11.856  33.431  1.00 36.92 ? 620  GLU A CG    1 
ATOM   2446 C CD    . GLU A 1 324 ? 25.027  12.770  34.634  1.00 38.58 ? 620  GLU A CD    1 
ATOM   2447 O OE1   . GLU A 1 324 ? 25.838  12.591  35.578  1.00 38.93 ? 620  GLU A OE1   1 
ATOM   2448 O OE2   . GLU A 1 324 ? 24.140  13.657  34.630  1.00 40.05 ? 620  GLU A OE2   1 
ATOM   2449 N N     . PRO A 1 325 ? 24.795  7.055   32.239  1.00 35.45 ? 621  PRO A N     1 
ATOM   2450 C CA    . PRO A 1 325 ? 24.964  7.186   30.805  1.00 35.47 ? 621  PRO A CA    1 
ATOM   2451 C C     . PRO A 1 325 ? 23.640  6.973   30.099  1.00 35.39 ? 621  PRO A C     1 
ATOM   2452 O O     . PRO A 1 325 ? 22.675  6.507   30.712  1.00 35.39 ? 621  PRO A O     1 
ATOM   2453 C CB    . PRO A 1 325 ? 25.912  6.043   30.485  1.00 35.59 ? 621  PRO A CB    1 
ATOM   2454 C CG    . PRO A 1 325 ? 25.467  4.961   31.437  1.00 35.58 ? 621  PRO A CG    1 
ATOM   2455 C CD    . PRO A 1 325 ? 24.963  5.660   32.674  1.00 35.38 ? 621  PRO A CD    1 
ATOM   2456 N N     . ASN A 1 326 ? 23.587  7.314   28.821  1.00 35.20 ? 622  ASN A N     1 
ATOM   2457 C CA    . ASN A 1 326 ? 22.405  7.019   28.037  1.00 35.17 ? 622  ASN A CA    1 
ATOM   2458 C C     . ASN A 1 326 ? 22.375  5.536   27.740  1.00 34.65 ? 622  ASN A C     1 
ATOM   2459 O O     . ASN A 1 326 ? 23.170  5.046   26.954  1.00 34.74 ? 622  ASN A O     1 
ATOM   2460 C CB    . ASN A 1 326 ? 22.390  7.813   26.731  1.00 35.43 ? 622  ASN A CB    1 
ATOM   2461 C CG    . ASN A 1 326 ? 21.192  7.473   25.849  1.00 36.16 ? 622  ASN A CG    1 
ATOM   2462 O OD1   . ASN A 1 326 ? 20.312  6.692   26.233  1.00 37.19 ? 622  ASN A OD1   1 
ATOM   2463 N ND2   . ASN A 1 326 ? 21.157  8.060   24.657  1.00 36.53 ? 622  ASN A ND2   1 
ATOM   2464 N N     . LEU A 1 327 ? 21.456  4.825   28.371  1.00 34.14 ? 623  LEU A N     1 
ATOM   2465 C CA    . LEU A 1 327 ? 21.330  3.389   28.154  1.00 33.87 ? 623  LEU A CA    1 
ATOM   2466 C C     . LEU A 1 327 ? 20.330  3.057   27.050  1.00 33.77 ? 623  LEU A C     1 
ATOM   2467 O O     . LEU A 1 327 ? 20.144  1.886   26.707  1.00 33.82 ? 623  LEU A O     1 
ATOM   2468 C CB    . LEU A 1 327 ? 20.919  2.693   29.451  1.00 33.85 ? 623  LEU A CB    1 
ATOM   2469 C CG    . LEU A 1 327 ? 21.991  2.572   30.536  1.00 33.30 ? 623  LEU A CG    1 
ATOM   2470 C CD1   . LEU A 1 327 ? 21.376  2.032   31.811  1.00 32.53 ? 623  LEU A CD1   1 
ATOM   2471 C CD2   . LEU A 1 327 ? 23.141  1.682   30.076  1.00 32.77 ? 623  LEU A CD2   1 
ATOM   2472 N N     . GLN A 1 328 ? 19.693  4.082   26.489  1.00 33.59 ? 624  GLN A N     1 
ATOM   2473 C CA    . GLN A 1 328 ? 18.741  3.887   25.395  1.00 33.31 ? 624  GLN A CA    1 
ATOM   2474 C C     . GLN A 1 328 ? 19.410  3.774   24.023  1.00 33.19 ? 624  GLN A C     1 
ATOM   2475 O O     . GLN A 1 328 ? 18.752  3.432   23.050  1.00 33.03 ? 624  GLN A O     1 
ATOM   2476 C CB    . GLN A 1 328 ? 17.701  5.002   25.403  1.00 33.24 ? 624  GLN A CB    1 
ATOM   2477 C CG    . GLN A 1 328 ? 16.736  4.883   26.570  1.00 33.05 ? 624  GLN A CG    1 
ATOM   2478 C CD    . GLN A 1 328 ? 15.675  5.960   26.586  1.00 32.25 ? 624  GLN A CD    1 
ATOM   2479 O OE1   . GLN A 1 328 ? 15.962  7.140   26.409  1.00 31.97 ? 624  GLN A OE1   1 
ATOM   2480 N NE2   . GLN A 1 328 ? 14.436  5.556   26.805  1.00 32.16 ? 624  GLN A NE2   1 
ATOM   2481 N N     . ASN A 1 329 ? 20.714  4.042   23.955  1.00 33.17 ? 625  ASN A N     1 
ATOM   2482 C CA    . ASN A 1 329 ? 21.448  4.012   22.686  1.00 33.07 ? 625  ASN A CA    1 
ATOM   2483 C C     . ASN A 1 329 ? 22.632  3.043   22.618  1.00 32.76 ? 625  ASN A C     1 
ATOM   2484 O O     . ASN A 1 329 ? 23.561  3.257   21.851  1.00 32.44 ? 625  ASN A O     1 
ATOM   2485 C CB    . ASN A 1 329 ? 21.925  5.424   22.337  1.00 33.22 ? 625  ASN A CB    1 
ATOM   2486 C CG    . ASN A 1 329 ? 23.077  5.884   23.206  1.00 33.62 ? 625  ASN A CG    1 
ATOM   2487 O OD1   . ASN A 1 329 ? 23.502  5.181   24.122  1.00 34.34 ? 625  ASN A OD1   1 
ATOM   2488 N ND2   . ASN A 1 329 ? 23.597  7.071   22.912  1.00 34.01 ? 625  ASN A ND2   1 
ATOM   2489 N N     . ILE A 1 330 ? 22.606  1.981   23.407  1.00 32.75 ? 626  ILE A N     1 
ATOM   2490 C CA    . ILE A 1 330 ? 23.689  1.000   23.361  1.00 32.84 ? 626  ILE A CA    1 
ATOM   2491 C C     . ILE A 1 330 ? 23.610  0.235   22.041  1.00 32.94 ? 626  ILE A C     1 
ATOM   2492 O O     . ILE A 1 330 ? 22.530  -0.188  21.643  1.00 32.95 ? 626  ILE A O     1 
ATOM   2493 C CB    . ILE A 1 330 ? 23.631  0.018   24.535  1.00 32.81 ? 626  ILE A CB    1 
ATOM   2494 C CG1   . ILE A 1 330 ? 23.730  0.770   25.864  1.00 32.94 ? 626  ILE A CG1   1 
ATOM   2495 C CG2   . ILE A 1 330 ? 24.754  -0.988  24.453  1.00 32.64 ? 626  ILE A CG2   1 
ATOM   2496 C CD1   . ILE A 1 330 ? 24.981  1.603   26.016  1.00 32.82 ? 626  ILE A CD1   1 
ATOM   2497 N N     . PRO A 1 331 ? 24.759  0.044   21.364  1.00 33.09 ? 627  PRO A N     1 
ATOM   2498 C CA    . PRO A 1 331 ? 24.759  -0.417  19.983  1.00 33.16 ? 627  PRO A CA    1 
ATOM   2499 C C     . PRO A 1 331 ? 24.192  -1.814  19.828  1.00 33.42 ? 627  PRO A C     1 
ATOM   2500 O O     . PRO A 1 331 ? 24.427  -2.679  20.664  1.00 33.33 ? 627  PRO A O     1 
ATOM   2501 C CB    . PRO A 1 331 ? 26.239  -0.378  19.585  1.00 33.06 ? 627  PRO A CB    1 
ATOM   2502 C CG    . PRO A 1 331 ? 26.962  0.217   20.729  1.00 32.94 ? 627  PRO A CG    1 
ATOM   2503 C CD    . PRO A 1 331 ? 26.119  0.042   21.921  1.00 33.00 ? 627  PRO A CD    1 
ATOM   2504 N N     . ILE A 1 332 ? 23.425  -2.008  18.767  1.00 33.82 ? 628  ILE A N     1 
ATOM   2505 C CA    . ILE A 1 332 ? 22.799  -3.287  18.488  1.00 34.06 ? 628  ILE A CA    1 
ATOM   2506 C C     . ILE A 1 332 ? 22.905  -3.655  17.005  1.00 34.71 ? 628  ILE A C     1 
ATOM   2507 O O     . ILE A 1 332 ? 23.198  -4.804  16.670  1.00 34.78 ? 628  ILE A O     1 
ATOM   2508 C CB    . ILE A 1 332 ? 21.316  -3.284  18.955  1.00 33.95 ? 628  ILE A CB    1 
ATOM   2509 C CG1   . ILE A 1 332 ? 20.753  -4.711  18.977  1.00 33.87 ? 628  ILE A CG1   1 
ATOM   2510 C CG2   . ILE A 1 332 ? 20.465  -2.353  18.096  1.00 33.46 ? 628  ILE A CG2   1 
ATOM   2511 C CD1   . ILE A 1 332 ? 19.374  -4.821  19.596  1.00 33.04 ? 628  ILE A CD1   1 
ATOM   2512 N N     . ARG A 1 333 ? 22.696  -2.677  16.124  1.00 35.45 ? 629  ARG A N     1 
ATOM   2513 C CA    . ARG A 1 333 ? 22.545  -2.933  14.683  1.00 36.02 ? 629  ARG A CA    1 
ATOM   2514 C C     . ARG A 1 333 ? 23.715  -3.661  14.041  1.00 35.93 ? 629  ARG A C     1 
ATOM   2515 O O     . ARG A 1 333 ? 23.522  -4.475  13.137  1.00 35.91 ? 629  ARG A O     1 
ATOM   2516 C CB    . ARG A 1 333 ? 22.323  -1.625  13.920  1.00 36.42 ? 629  ARG A CB    1 
ATOM   2517 C CG    . ARG A 1 333 ? 20.921  -1.041  14.052  1.00 37.41 ? 629  ARG A CG    1 
ATOM   2518 C CD    . ARG A 1 333 ? 20.948  0.200   14.878  1.00 38.85 ? 629  ARG A CD    1 
ATOM   2519 N NE    . ARG A 1 333 ? 19.678  0.908   14.829  1.00 40.89 ? 629  ARG A NE    1 
ATOM   2520 C CZ    . ARG A 1 333 ? 19.553  2.233   14.775  1.00 42.84 ? 629  ARG A CZ    1 
ATOM   2521 N NH1   . ARG A 1 333 ? 20.626  3.014   14.739  1.00 43.74 ? 629  ARG A NH1   1 
ATOM   2522 N NH2   . ARG A 1 333 ? 18.345  2.788   14.738  1.00 43.47 ? 629  ARG A NH2   1 
ATOM   2523 N N     . LEU A 1 334 ? 24.922  -3.332  14.489  1.00 35.86 ? 630  LEU A N     1 
ATOM   2524 C CA    . LEU A 1 334 ? 26.125  -3.962  13.978  1.00 35.67 ? 630  LEU A CA    1 
ATOM   2525 C C     . LEU A 1 334 ? 26.692  -4.900  15.023  1.00 35.75 ? 630  LEU A C     1 
ATOM   2526 O O     . LEU A 1 334 ? 26.814  -4.550  16.193  1.00 35.49 ? 630  LEU A O     1 
ATOM   2527 C CB    . LEU A 1 334 ? 27.151  -2.909  13.578  1.00 35.56 ? 630  LEU A CB    1 
ATOM   2528 C CG    . LEU A 1 334 ? 26.876  -2.204  12.247  1.00 35.10 ? 630  LEU A CG    1 
ATOM   2529 C CD1   . LEU A 1 334 ? 28.038  -1.290  11.881  1.00 34.50 ? 630  LEU A CD1   1 
ATOM   2530 C CD2   . LEU A 1 334 ? 26.609  -3.208  11.134  1.00 34.09 ? 630  LEU A CD2   1 
ATOM   2531 N N     . GLU A 1 335 ? 27.020  -6.100  14.599  1.00 36.08 ? 631  GLU A N     1 
ATOM   2532 C CA    . GLU A 1 335 ? 27.463  -7.136  15.503  1.00 36.40 ? 631  GLU A CA    1 
ATOM   2533 C C     . GLU A 1 335 ? 28.735  -6.840  16.276  1.00 36.32 ? 631  GLU A C     1 
ATOM   2534 O O     . GLU A 1 335 ? 28.844  -7.196  17.426  1.00 36.35 ? 631  GLU A O     1 
ATOM   2535 C CB    . GLU A 1 335 ? 27.594  -8.452  14.763  1.00 36.55 ? 631  GLU A CB    1 
ATOM   2536 C CG    . GLU A 1 335 ? 28.285  -9.497  15.565  1.00 37.55 ? 631  GLU A CG    1 
ATOM   2537 C CD    . GLU A 1 335 ? 27.397  -10.081 16.606  1.00 38.93 ? 631  GLU A CD    1 
ATOM   2538 O OE1   . GLU A 1 335 ? 26.202  -9.747  16.609  1.00 39.66 ? 631  GLU A OE1   1 
ATOM   2539 O OE2   . GLU A 1 335 ? 27.890  -10.884 17.417  1.00 39.83 ? 631  GLU A OE2   1 
ATOM   2540 N N     . GLU A 1 336 ? 29.706  -6.205  15.656  1.00 36.17 ? 632  GLU A N     1 
ATOM   2541 C CA    . GLU A 1 336 ? 30.933  -5.913  16.356  1.00 36.07 ? 632  GLU A CA    1 
ATOM   2542 C C     . GLU A 1 336 ? 30.662  -5.011  17.536  1.00 35.64 ? 632  GLU A C     1 
ATOM   2543 O O     . GLU A 1 336 ? 31.211  -5.184  18.606  1.00 35.37 ? 632  GLU A O     1 
ATOM   2544 C CB    . GLU A 1 336 ? 31.839  -5.175  15.406  1.00 36.37 ? 632  GLU A CB    1 
ATOM   2545 C CG    . GLU A 1 336 ? 31.392  -3.753  15.181  1.00 37.29 ? 632  GLU A CG    1 
ATOM   2546 C CD    . GLU A 1 336 ? 30.586  -3.568  13.918  1.00 38.21 ? 632  GLU A CD    1 
ATOM   2547 O OE1   . GLU A 1 336 ? 30.452  -4.533  13.135  1.00 38.11 ? 632  GLU A OE1   1 
ATOM   2548 O OE2   . GLU A 1 336 ? 30.099  -2.440  13.714  1.00 38.02 ? 632  GLU A OE2   1 
ATOM   2549 N N     . GLY A 1 337 ? 29.831  -4.014  17.299  1.00 35.36 ? 633  GLY A N     1 
ATOM   2550 C CA    . GLY A 1 337 ? 29.356  -3.069  18.292  1.00 35.10 ? 633  GLY A CA    1 
ATOM   2551 C C     . GLY A 1 337 ? 28.443  -3.674  19.324  1.00 34.86 ? 633  GLY A C     1 
ATOM   2552 O O     . GLY A 1 337 ? 28.412  -3.263  20.462  1.00 34.69 ? 633  GLY A O     1 
ATOM   2553 N N     . ARG A 1 338 ? 27.649  -4.625  18.871  1.00 34.72 ? 634  ARG A N     1 
ATOM   2554 C CA    . ARG A 1 338 ? 26.618  -5.258  19.663  1.00 34.92 ? 634  ARG A CA    1 
ATOM   2555 C C     . ARG A 1 338 ? 27.168  -6.038  20.846  1.00 34.49 ? 634  ARG A C     1 
ATOM   2556 O O     . ARG A 1 338 ? 26.543  -6.091  21.898  1.00 34.23 ? 634  ARG A O     1 
ATOM   2557 C CB    . ARG A 1 338 ? 25.816  -6.184  18.769  1.00 35.30 ? 634  ARG A CB    1 
ATOM   2558 C CG    . ARG A 1 338 ? 24.829  -7.016  19.497  1.00 36.86 ? 634  ARG A CG    1 
ATOM   2559 C CD    . ARG A 1 338 ? 24.034  -7.831  18.534  1.00 39.69 ? 634  ARG A CD    1 
ATOM   2560 N NE    . ARG A 1 338 ? 23.176  -8.772  19.242  1.00 42.74 ? 634  ARG A NE    1 
ATOM   2561 C CZ    . ARG A 1 338 ? 22.008  -9.236  18.798  1.00 45.26 ? 634  ARG A CZ    1 
ATOM   2562 N NH1   . ARG A 1 338 ? 21.507  -8.858  17.618  1.00 46.05 ? 634  ARG A NH1   1 
ATOM   2563 N NH2   . ARG A 1 338 ? 21.327  -10.088 19.556  1.00 46.04 ? 634  ARG A NH2   1 
ATOM   2564 N N     . LYS A 1 339 ? 28.337  -6.639  20.662  1.00 34.35 ? 635  LYS A N     1 
ATOM   2565 C CA    . LYS A 1 339 ? 28.953  -7.491  21.684  1.00 34.26 ? 635  LYS A CA    1 
ATOM   2566 C C     . LYS A 1 339 ? 29.198  -6.745  23.001  1.00 34.12 ? 635  LYS A C     1 
ATOM   2567 O O     . LYS A 1 339 ? 29.293  -7.365  24.051  1.00 33.86 ? 635  LYS A O     1 
ATOM   2568 C CB    . LYS A 1 339 ? 30.262  -8.104  21.159  1.00 34.15 ? 635  LYS A CB    1 
ATOM   2569 N N     . ILE A 1 340 ? 29.284  -5.420  22.948  1.00 34.21 ? 636  ILE A N     1 
ATOM   2570 C CA    . ILE A 1 340 ? 29.398  -4.605  24.172  1.00 34.54 ? 636  ILE A CA    1 
ATOM   2571 C C     . ILE A 1 340 ? 28.278  -4.901  25.168  1.00 34.75 ? 636  ILE A C     1 
ATOM   2572 O O     . ILE A 1 340 ? 28.466  -4.821  26.386  1.00 34.60 ? 636  ILE A O     1 
ATOM   2573 C CB    . ILE A 1 340 ? 29.326  -3.096  23.873  1.00 34.52 ? 636  ILE A CB    1 
ATOM   2574 C CG1   . ILE A 1 340 ? 30.504  -2.661  23.024  1.00 34.72 ? 636  ILE A CG1   1 
ATOM   2575 C CG2   . ILE A 1 340 ? 29.344  -2.284  25.160  1.00 34.30 ? 636  ILE A CG2   1 
ATOM   2576 C CD1   . ILE A 1 340 ? 30.628  -1.171  22.950  1.00 35.01 ? 636  ILE A CD1   1 
ATOM   2577 N N     . ARG A 1 341 ? 27.108  -5.229  24.629  1.00 35.02 ? 637  ARG A N     1 
ATOM   2578 C CA    . ARG A 1 341 ? 25.948  -5.591  25.432  1.00 35.10 ? 637  ARG A CA    1 
ATOM   2579 C C     . ARG A 1 341 ? 26.181  -6.821  26.310  1.00 35.37 ? 637  ARG A C     1 
ATOM   2580 O O     . ARG A 1 341 ? 25.368  -7.115  27.184  1.00 35.31 ? 637  ARG A O     1 
ATOM   2581 C CB    . ARG A 1 341 ? 24.755  -5.851  24.525  1.00 35.11 ? 637  ARG A CB    1 
ATOM   2582 C CG    . ARG A 1 341 ? 24.323  -4.633  23.726  1.00 35.33 ? 637  ARG A CG    1 
ATOM   2583 C CD    . ARG A 1 341 ? 22.831  -4.634  23.447  1.00 35.17 ? 637  ARG A CD    1 
ATOM   2584 N NE    . ARG A 1 341 ? 22.355  -3.315  23.046  1.00 35.08 ? 637  ARG A NE    1 
ATOM   2585 C CZ    . ARG A 1 341 ? 21.104  -3.043  22.686  1.00 34.91 ? 637  ARG A CZ    1 
ATOM   2586 N NH1   . ARG A 1 341 ? 20.190  -3.997  22.661  1.00 35.11 ? 637  ARG A NH1   1 
ATOM   2587 N NH2   . ARG A 1 341 ? 20.763  -1.813  22.342  1.00 34.89 ? 637  ARG A NH2   1 
ATOM   2588 N N     . GLN A 1 342 ? 27.268  -7.554  26.046  1.00 35.72 ? 638  GLN A N     1 
ATOM   2589 C CA    . GLN A 1 342 ? 27.728  -8.667  26.905  1.00 35.75 ? 638  GLN A CA    1 
ATOM   2590 C C     . GLN A 1 342 ? 28.091  -8.229  28.312  1.00 35.49 ? 638  GLN A C     1 
ATOM   2591 O O     . GLN A 1 342 ? 27.900  -8.975  29.272  1.00 35.50 ? 638  GLN A O     1 
ATOM   2592 C CB    . GLN A 1 342 ? 28.959  -9.349  26.305  1.00 35.85 ? 638  GLN A CB    1 
ATOM   2593 C CG    . GLN A 1 342 ? 28.632  -10.500 25.371  1.00 36.43 ? 638  GLN A CG    1 
ATOM   2594 C CD    . GLN A 1 342 ? 29.643  -10.656 24.250  1.00 36.92 ? 638  GLN A CD    1 
ATOM   2595 O OE1   . GLN A 1 342 ? 30.853  -10.593 24.469  1.00 37.64 ? 638  GLN A OE1   1 
ATOM   2596 N NE2   . GLN A 1 342 ? 29.145  -10.853 23.034  1.00 37.26 ? 638  GLN A NE2   1 
ATOM   2597 N N     . ALA A 1 343 ? 28.634  -7.024  28.424  1.00 35.24 ? 639  ALA A N     1 
ATOM   2598 C CA    . ALA A 1 343 ? 28.992  -6.461  29.723  1.00 35.05 ? 639  ALA A CA    1 
ATOM   2599 C C     . ALA A 1 343 ? 27.789  -6.068  30.587  1.00 34.82 ? 639  ALA A C     1 
ATOM   2600 O O     . ALA A 1 343 ? 27.978  -5.596  31.703  1.00 34.91 ? 639  ALA A O     1 
ATOM   2601 C CB    . ALA A 1 343 ? 29.906  -5.260  29.535  1.00 35.13 ? 639  ALA A CB    1 
ATOM   2602 N N     . PHE A 1 344 ? 26.568  -6.240  30.084  1.00 34.57 ? 640  PHE A N     1 
ATOM   2603 C CA    . PHE A 1 344 ? 25.367  -5.962  30.881  1.00 34.39 ? 640  PHE A CA    1 
ATOM   2604 C C     . PHE A 1 344 ? 24.711  -7.230  31.369  1.00 34.18 ? 640  PHE A C     1 
ATOM   2605 O O     . PHE A 1 344 ? 24.117  -7.970  30.596  1.00 34.06 ? 640  PHE A O     1 
ATOM   2606 C CB    . PHE A 1 344 ? 24.386  -5.115  30.090  1.00 34.35 ? 640  PHE A CB    1 
ATOM   2607 C CG    . PHE A 1 344 ? 24.872  -3.738  29.880  1.00 34.32 ? 640  PHE A CG    1 
ATOM   2608 C CD1   . PHE A 1 344 ? 24.782  -2.811  30.895  1.00 34.92 ? 640  PHE A CD1   1 
ATOM   2609 C CD2   . PHE A 1 344 ? 25.488  -3.381  28.703  1.00 34.46 ? 640  PHE A CD2   1 
ATOM   2610 C CE1   . PHE A 1 344 ? 25.260  -1.531  30.725  1.00 35.30 ? 640  PHE A CE1   1 
ATOM   2611 C CE2   . PHE A 1 344 ? 25.962  -2.103  28.518  1.00 34.84 ? 640  PHE A CE2   1 
ATOM   2612 C CZ    . PHE A 1 344 ? 25.852  -1.175  29.533  1.00 35.13 ? 640  PHE A CZ    1 
ATOM   2613 N N     . VAL A 1 345 ? 24.814  -7.458  32.671  1.00 34.18 ? 641  VAL A N     1 
ATOM   2614 C CA    . VAL A 1 345 ? 24.454  -8.740  33.255  1.00 34.33 ? 641  VAL A CA    1 
ATOM   2615 C C     . VAL A 1 345 ? 23.367  -8.590  34.326  1.00 34.58 ? 641  VAL A C     1 
ATOM   2616 O O     . VAL A 1 345 ? 23.022  -7.474  34.714  1.00 34.57 ? 641  VAL A O     1 
ATOM   2617 C CB    . VAL A 1 345 ? 25.699  -9.424  33.870  1.00 34.23 ? 641  VAL A CB    1 
ATOM   2618 C CG1   . VAL A 1 345 ? 26.863  -9.398  32.894  1.00 33.93 ? 641  VAL A CG1   1 
ATOM   2619 C CG2   . VAL A 1 345 ? 26.084  -8.753  35.168  1.00 33.99 ? 641  VAL A CG2   1 
ATOM   2620 N N     . PRO A 1 346 ? 22.817  -9.720  34.800  1.00 34.82 ? 642  PRO A N     1 
ATOM   2621 C CA    . PRO A 1 346 ? 21.858  -9.686  35.887  1.00 35.02 ? 642  PRO A CA    1 
ATOM   2622 C C     . PRO A 1 346 ? 22.498  -9.227  37.191  1.00 35.37 ? 642  PRO A C     1 
ATOM   2623 O O     . PRO A 1 346 ? 23.708  -9.400  37.388  1.00 35.49 ? 642  PRO A O     1 
ATOM   2624 C CB    . PRO A 1 346 ? 21.399  -11.143 35.997  1.00 35.03 ? 642  PRO A CB    1 
ATOM   2625 C CG    . PRO A 1 346 ? 21.722  -11.751 34.693  1.00 35.02 ? 642  PRO A CG    1 
ATOM   2626 C CD    . PRO A 1 346 ? 22.966  -11.080 34.258  1.00 34.89 ? 642  PRO A CD    1 
ATOM   2627 N N     . SER A 1 347 ? 21.675  -8.643  38.059  1.00 35.71 ? 643  SER A N     1 
ATOM   2628 C CA    . SER A 1 347 ? 22.120  -8.090  39.338  1.00 35.98 ? 643  SER A CA    1 
ATOM   2629 C C     . SER A 1 347 ? 22.535  -9.174  40.322  1.00 36.17 ? 643  SER A C     1 
ATOM   2630 O O     . SER A 1 347 ? 23.475  -8.986  41.092  1.00 36.16 ? 643  SER A O     1 
ATOM   2631 C CB    . SER A 1 347 ? 21.008  -7.250  39.969  1.00 36.08 ? 643  SER A CB    1 
ATOM   2632 O OG    . SER A 1 347 ? 19.870  -8.041  40.258  1.00 36.50 ? 643  SER A OG    1 
ATOM   2633 N N     . GLU A 1 348 ? 21.820  -10.298 40.299  1.00 36.49 ? 644  GLU A N     1 
ATOM   2634 C CA    . GLU A 1 348 ? 22.037  -11.382 41.260  1.00 36.78 ? 644  GLU A CA    1 
ATOM   2635 C C     . GLU A 1 348 ? 22.263  -12.707 40.554  1.00 36.53 ? 644  GLU A C     1 
ATOM   2636 O O     . GLU A 1 348 ? 21.611  -13.027 39.565  1.00 36.36 ? 644  GLU A O     1 
ATOM   2637 C CB    . GLU A 1 348 ? 20.848  -11.520 42.214  1.00 37.03 ? 644  GLU A CB    1 
ATOM   2638 C CG    . GLU A 1 348 ? 20.037  -10.244 42.344  1.00 38.45 ? 644  GLU A CG    1 
ATOM   2639 C CD    . GLU A 1 348 ? 19.289  -10.107 43.652  1.00 40.52 ? 644  GLU A CD    1 
ATOM   2640 O OE1   . GLU A 1 348 ? 19.325  -11.038 44.492  1.00 41.59 ? 644  GLU A OE1   1 
ATOM   2641 O OE2   . GLU A 1 348 ? 18.658  -9.039  43.835  1.00 42.05 ? 644  GLU A OE2   1 
ATOM   2642 N N     . SER A 1 349 ? 23.187  -13.481 41.100  1.00 36.38 ? 645  SER A N     1 
ATOM   2643 C CA    . SER A 1 349 ? 23.534  -14.784 40.564  1.00 36.19 ? 645  SER A CA    1 
ATOM   2644 C C     . SER A 1 349 ? 22.291  -15.670 40.381  1.00 36.16 ? 645  SER A C     1 
ATOM   2645 O O     . SER A 1 349 ? 21.334  -15.580 41.157  1.00 36.07 ? 645  SER A O     1 
ATOM   2646 C CB    . SER A 1 349 ? 24.550  -15.445 41.498  1.00 36.14 ? 645  SER A CB    1 
ATOM   2647 O OG    . SER A 1 349 ? 24.210  -15.203 42.858  1.00 35.59 ? 645  SER A OG    1 
ATOM   2648 N N     . ASP A 1 350 ? 22.312  -16.502 39.339  1.00 36.10 ? 646  ASP A N     1 
ATOM   2649 C CA    . ASP A 1 350 ? 21.200  -17.408 39.004  1.00 36.19 ? 646  ASP A CA    1 
ATOM   2650 C C     . ASP A 1 350 ? 19.919  -16.680 38.564  1.00 36.14 ? 646  ASP A C     1 
ATOM   2651 O O     . ASP A 1 350 ? 18.817  -17.240 38.594  1.00 35.94 ? 646  ASP A O     1 
ATOM   2652 C CB    . ASP A 1 350 ? 20.918  -18.366 40.165  1.00 36.30 ? 646  ASP A CB    1 
ATOM   2653 C CG    . ASP A 1 350 ? 22.033  -19.372 40.372  1.00 36.84 ? 646  ASP A CG    1 
ATOM   2654 O OD1   . ASP A 1 350 ? 22.640  -19.819 39.373  1.00 37.50 ? 646  ASP A OD1   1 
ATOM   2655 O OD2   . ASP A 1 350 ? 22.300  -19.729 41.537  1.00 37.99 ? 646  ASP A OD2   1 
ATOM   2656 N N     . TRP A 1 351 ? 20.087  -15.431 38.147  1.00 36.09 ? 647  TRP A N     1 
ATOM   2657 C CA    . TRP A 1 351 ? 19.018  -14.654 37.545  1.00 35.98 ? 647  TRP A CA    1 
ATOM   2658 C C     . TRP A 1 351 ? 19.373  -14.483 36.085  1.00 35.62 ? 647  TRP A C     1 
ATOM   2659 O O     . TRP A 1 351 ? 20.521  -14.702 35.678  1.00 35.57 ? 647  TRP A O     1 
ATOM   2660 C CB    . TRP A 1 351 ? 18.900  -13.276 38.190  1.00 36.12 ? 647  TRP A CB    1 
ATOM   2661 C CG    . TRP A 1 351 ? 18.262  -13.273 39.521  1.00 36.68 ? 647  TRP A CG    1 
ATOM   2662 C CD1   . TRP A 1 351 ? 18.334  -14.242 40.469  1.00 37.34 ? 647  TRP A CD1   1 
ATOM   2663 C CD2   . TRP A 1 351 ? 17.466  -12.228 40.074  1.00 37.61 ? 647  TRP A CD2   1 
ATOM   2664 N NE1   . TRP A 1 351 ? 17.618  -13.874 41.576  1.00 37.77 ? 647  TRP A NE1   1 
ATOM   2665 C CE2   . TRP A 1 351 ? 17.078  -12.636 41.362  1.00 37.82 ? 647  TRP A CE2   1 
ATOM   2666 C CE3   . TRP A 1 351 ? 17.034  -10.986 39.601  1.00 38.58 ? 647  TRP A CE3   1 
ATOM   2667 C CZ2   . TRP A 1 351 ? 16.277  -11.849 42.189  1.00 38.62 ? 647  TRP A CZ2   1 
ATOM   2668 C CZ3   . TRP A 1 351 ? 16.235  -10.199 40.424  1.00 38.93 ? 647  TRP A CZ3   1 
ATOM   2669 C CH2   . TRP A 1 351 ? 15.867  -10.635 41.705  1.00 38.99 ? 647  TRP A CH2   1 
ATOM   2670 N N     . LEU A 1 352 ? 18.384  -14.066 35.308  1.00 35.05 ? 648  LEU A N     1 
ATOM   2671 C CA    . LEU A 1 352 ? 18.541  -13.909 33.873  1.00 34.59 ? 648  LEU A CA    1 
ATOM   2672 C C     . LEU A 1 352 ? 18.113  -12.501 33.476  1.00 34.38 ? 648  LEU A C     1 
ATOM   2673 O O     . LEU A 1 352 ? 17.770  -11.695 34.335  1.00 34.50 ? 648  LEU A O     1 
ATOM   2674 C CB    . LEU A 1 352 ? 17.726  -14.984 33.142  1.00 34.45 ? 648  LEU A CB    1 
ATOM   2675 C CG    . LEU A 1 352 ? 18.257  -16.419 33.217  1.00 33.76 ? 648  LEU A CG    1 
ATOM   2676 C CD1   . LEU A 1 352 ? 17.259  -17.357 32.590  1.00 32.98 ? 648  LEU A CD1   1 
ATOM   2677 C CD2   . LEU A 1 352 ? 19.620  -16.558 32.539  1.00 32.86 ? 648  LEU A CD2   1 
ATOM   2678 N N     . ILE A 1 353 ? 18.178  -12.203 32.183  1.00 34.13 ? 649  ILE A N     1 
ATOM   2679 C CA    . ILE A 1 353 ? 17.730  -10.918 31.640  1.00 33.92 ? 649  ILE A CA    1 
ATOM   2680 C C     . ILE A 1 353 ? 16.588  -11.178 30.670  1.00 33.71 ? 649  ILE A C     1 
ATOM   2681 O O     . ILE A 1 353 ? 16.660  -12.103 29.877  1.00 33.97 ? 649  ILE A O     1 
ATOM   2682 C CB    . ILE A 1 353 ? 18.864  -10.195 30.882  1.00 33.83 ? 649  ILE A CB    1 
ATOM   2683 C CG1   . ILE A 1 353 ? 19.993  -9.801  31.831  1.00 33.38 ? 649  ILE A CG1   1 
ATOM   2684 C CG2   . ILE A 1 353 ? 18.334  -8.946  30.193  1.00 34.00 ? 649  ILE A CG2   1 
ATOM   2685 C CD1   . ILE A 1 353 ? 19.886  -8.401  32.352  1.00 33.01 ? 649  ILE A CD1   1 
ATOM   2686 N N     . PHE A 1 354 ? 15.551  -10.353 30.723  1.00 33.44 ? 650  PHE A N     1 
ATOM   2687 C CA    . PHE A 1 354 ? 14.363  -10.528 29.886  1.00 33.34 ? 650  PHE A CA    1 
ATOM   2688 C C     . PHE A 1 354 ? 14.095  -9.259  29.086  1.00 33.28 ? 650  PHE A C     1 
ATOM   2689 O O     . PHE A 1 354 ? 14.173  -8.164  29.626  1.00 33.42 ? 650  PHE A O     1 
ATOM   2690 C CB    . PHE A 1 354 ? 13.167  -10.840 30.783  1.00 33.30 ? 650  PHE A CB    1 
ATOM   2691 C CG    . PHE A 1 354 ? 11.918  -11.212 30.041  1.00 33.11 ? 650  PHE A CG    1 
ATOM   2692 C CD1   . PHE A 1 354 ? 11.744  -12.497 29.556  1.00 33.03 ? 650  PHE A CD1   1 
ATOM   2693 C CD2   . PHE A 1 354 ? 10.904  -10.288 29.856  1.00 33.06 ? 650  PHE A CD2   1 
ATOM   2694 C CE1   . PHE A 1 354 ? 10.594  -12.852 28.889  1.00 33.11 ? 650  PHE A CE1   1 
ATOM   2695 C CE2   . PHE A 1 354 ? 9.750   -10.634 29.188  1.00 33.22 ? 650  PHE A CE2   1 
ATOM   2696 C CZ    . PHE A 1 354 ? 9.592   -11.920 28.703  1.00 33.32 ? 650  PHE A CZ    1 
ATOM   2697 N N     . ALA A 1 355 ? 13.772  -9.403  27.806  1.00 33.17 ? 651  ALA A N     1 
ATOM   2698 C CA    . ALA A 1 355 ? 13.490  -8.251  26.950  1.00 33.20 ? 651  ALA A CA    1 
ATOM   2699 C C     . ALA A 1 355 ? 12.147  -8.433  26.268  1.00 33.40 ? 651  ALA A C     1 
ATOM   2700 O O     . ALA A 1 355 ? 11.906  -9.460  25.657  1.00 33.64 ? 651  ALA A O     1 
ATOM   2701 C CB    . ALA A 1 355 ? 14.578  -8.087  25.912  1.00 33.03 ? 651  ALA A CB    1 
ATOM   2702 N N     . ALA A 1 356 ? 11.276  -7.440  26.375  1.00 33.64 ? 652  ALA A N     1 
ATOM   2703 C CA    . ALA A 1 356 ? 9.999   -7.455  25.674  1.00 33.98 ? 652  ALA A CA    1 
ATOM   2704 C C     . ALA A 1 356 ? 9.890   -6.213  24.787  1.00 34.36 ? 652  ALA A C     1 
ATOM   2705 O O     . ALA A 1 356 ? 9.937   -5.094  25.296  1.00 34.40 ? 652  ALA A O     1 
ATOM   2706 C CB    . ALA A 1 356 ? 8.862   -7.494  26.676  1.00 33.98 ? 652  ALA A CB    1 
ATOM   2707 N N     . ASP A 1 357 ? 9.740   -6.406  23.473  1.00 34.73 ? 653  ASP A N     1 
ATOM   2708 C CA    . ASP A 1 357 ? 9.629   -5.275  22.534  1.00 35.09 ? 653  ASP A CA    1 
ATOM   2709 C C     . ASP A 1 357 ? 8.433   -5.343  21.578  1.00 34.97 ? 653  ASP A C     1 
ATOM   2710 O O     . ASP A 1 357 ? 8.083   -6.405  21.066  1.00 34.88 ? 653  ASP A O     1 
ATOM   2711 C CB    . ASP A 1 357 ? 10.930  -5.084  21.732  1.00 35.35 ? 653  ASP A CB    1 
ATOM   2712 C CG    . ASP A 1 357 ? 11.174  -6.176  20.710  1.00 36.47 ? 653  ASP A CG    1 
ATOM   2713 O OD1   . ASP A 1 357 ? 11.517  -7.309  21.122  1.00 38.05 ? 653  ASP A OD1   1 
ATOM   2714 O OD2   . ASP A 1 357 ? 11.059  -5.889  19.492  1.00 37.65 ? 653  ASP A OD2   1 
ATOM   2715 N N     . TYR A 1 358 ? 7.829   -4.182  21.341  1.00 34.99 ? 654  TYR A N     1 
ATOM   2716 C CA    . TYR A 1 358 ? 6.725   -4.047  20.401  1.00 35.07 ? 654  TYR A CA    1 
ATOM   2717 C C     . TYR A 1 358 ? 7.209   -4.215  18.970  1.00 35.16 ? 654  TYR A C     1 
ATOM   2718 O O     . TYR A 1 358 ? 8.289   -3.752  18.614  1.00 35.27 ? 654  TYR A O     1 
ATOM   2719 C CB    . TYR A 1 358 ? 6.067   -2.675  20.522  1.00 35.05 ? 654  TYR A CB    1 
ATOM   2720 C CG    . TYR A 1 358 ? 5.160   -2.503  21.720  1.00 35.06 ? 654  TYR A CG    1 
ATOM   2721 C CD1   . TYR A 1 358 ? 3.917   -3.119  21.770  1.00 35.01 ? 654  TYR A CD1   1 
ATOM   2722 C CD2   . TYR A 1 358 ? 5.530   -1.698  22.789  1.00 35.03 ? 654  TYR A CD2   1 
ATOM   2723 C CE1   . TYR A 1 358 ? 3.072   -2.951  22.866  1.00 34.62 ? 654  TYR A CE1   1 
ATOM   2724 C CE2   . TYR A 1 358 ? 4.693   -1.527  23.883  1.00 34.79 ? 654  TYR A CE2   1 
ATOM   2725 C CZ    . TYR A 1 358 ? 3.470   -2.154  23.915  1.00 34.41 ? 654  TYR A CZ    1 
ATOM   2726 O OH    . TYR A 1 358 ? 2.649   -1.975  25.000  1.00 34.58 ? 654  TYR A OH    1 
ATOM   2727 N N     . SER A 1 359 ? 6.391   -4.872  18.154  1.00 35.29 ? 655  SER A N     1 
ATOM   2728 C CA    . SER A 1 359 ? 6.669   -5.040  16.730  1.00 35.26 ? 655  SER A CA    1 
ATOM   2729 C C     . SER A 1 359 ? 5.993   -3.949  15.922  1.00 35.30 ? 655  SER A C     1 
ATOM   2730 O O     . SER A 1 359 ? 4.769   -3.910  15.838  1.00 35.44 ? 655  SER A O     1 
ATOM   2731 C CB    . SER A 1 359 ? 6.151   -6.388  16.240  1.00 35.28 ? 655  SER A CB    1 
ATOM   2732 O OG    . SER A 1 359 ? 6.164   -6.437  14.824  1.00 34.94 ? 655  SER A OG    1 
ATOM   2733 N N     . GLN A 1 360 ? 6.791   -3.068  15.329  1.00 35.33 ? 656  GLN A N     1 
ATOM   2734 C CA    . GLN A 1 360 ? 6.278   -2.036  14.426  1.00 35.41 ? 656  GLN A CA    1 
ATOM   2735 C C     . GLN A 1 360 ? 5.105   -1.261  15.030  1.00 35.23 ? 656  GLN A C     1 
ATOM   2736 O O     . GLN A 1 360 ? 4.058   -1.118  14.409  1.00 34.95 ? 656  GLN A O     1 
ATOM   2737 C CB    . GLN A 1 360 ? 5.877   -2.668  13.087  1.00 35.61 ? 656  GLN A CB    1 
ATOM   2738 C CG    . GLN A 1 360 ? 7.060   -3.151  12.255  1.00 36.07 ? 656  GLN A CG    1 
ATOM   2739 C CD    . GLN A 1 360 ? 8.000   -2.016  11.885  1.00 37.42 ? 656  GLN A CD    1 
ATOM   2740 O OE1   . GLN A 1 360 ? 7.574   -0.859  11.745  1.00 37.84 ? 656  GLN A OE1   1 
ATOM   2741 N NE2   . GLN A 1 360 ? 9.290   -2.335  11.735  1.00 38.29 ? 656  GLN A NE2   1 
ATOM   2742 N N     . ILE A 1 361 ? 5.316   -0.757  16.242  1.00 35.21 ? 657  ILE A N     1 
ATOM   2743 C CA    . ILE A 1 361 ? 4.283   -0.060  17.017  1.00 35.22 ? 657  ILE A CA    1 
ATOM   2744 C C     . ILE A 1 361 ? 3.846   1.261   16.389  1.00 35.37 ? 657  ILE A C     1 
ATOM   2745 O O     . ILE A 1 361 ? 2.646   1.558   16.330  1.00 35.72 ? 657  ILE A O     1 
ATOM   2746 C CB    . ILE A 1 361 ? 4.758   0.204   18.471  1.00 35.22 ? 657  ILE A CB    1 
ATOM   2747 C CG1   . ILE A 1 361 ? 3.699   0.974   19.276  1.00 35.11 ? 657  ILE A CG1   1 
ATOM   2748 C CG2   . ILE A 1 361 ? 6.106   0.943   18.489  1.00 35.41 ? 657  ILE A CG2   1 
ATOM   2749 C CD1   . ILE A 1 361 ? 2.559   0.116   19.779  1.00 34.71 ? 657  ILE A CD1   1 
ATOM   2750 N N     . GLU A 1 362 ? 4.805   2.057   15.928  1.00 35.31 ? 658  GLU A N     1 
ATOM   2751 C CA    . GLU A 1 362 ? 4.484   3.350   15.317  1.00 35.27 ? 658  GLU A CA    1 
ATOM   2752 C C     . GLU A 1 362 ? 3.521   3.184   14.135  1.00 34.57 ? 658  GLU A C     1 
ATOM   2753 O O     . GLU A 1 362 ? 2.530   3.899   14.032  1.00 34.32 ? 658  GLU A O     1 
ATOM   2754 C CB    . GLU A 1 362 ? 5.759   4.086   14.885  1.00 35.67 ? 658  GLU A CB    1 
ATOM   2755 C CG    . GLU A 1 362 ? 6.362   4.982   15.975  1.00 37.34 ? 658  GLU A CG    1 
ATOM   2756 C CD    . GLU A 1 362 ? 7.778   5.475   15.651  1.00 39.95 ? 658  GLU A CD    1 
ATOM   2757 O OE1   . GLU A 1 362 ? 8.440   4.886   14.764  1.00 42.05 ? 658  GLU A OE1   1 
ATOM   2758 O OE2   . GLU A 1 362 ? 8.238   6.454   16.289  1.00 41.19 ? 658  GLU A OE2   1 
ATOM   2759 N N     . LEU A 1 363 ? 3.807   2.224   13.261  1.00 33.96 ? 659  LEU A N     1 
ATOM   2760 C CA    . LEU A 1 363 ? 2.938   1.957   12.108  1.00 33.64 ? 659  LEU A CA    1 
ATOM   2761 C C     . LEU A 1 363 ? 1.557   1.406   12.497  1.00 33.32 ? 659  LEU A C     1 
ATOM   2762 O O     . LEU A 1 363 ? 0.559   1.652   11.811  1.00 32.91 ? 659  LEU A O     1 
ATOM   2763 C CB    . LEU A 1 363 ? 3.614   0.994   11.127  1.00 33.63 ? 659  LEU A CB    1 
ATOM   2764 C CG    . LEU A 1 363 ? 4.668   1.558   10.168  1.00 33.30 ? 659  LEU A CG    1 
ATOM   2765 C CD1   . LEU A 1 363 ? 5.081   0.487   9.172   1.00 33.04 ? 659  LEU A CD1   1 
ATOM   2766 C CD2   . LEU A 1 363 ? 4.165   2.787   9.433   1.00 32.11 ? 659  LEU A CD2   1 
ATOM   2767 N N     . ARG A 1 364 ? 1.512   0.638   13.578  1.00 33.02 ? 660  ARG A N     1 
ATOM   2768 C CA    . ARG A 1 364 ? 0.250   0.137   14.094  1.00 32.90 ? 660  ARG A CA    1 
ATOM   2769 C C     . ARG A 1 364 ? -0.567  1.295   14.620  1.00 32.63 ? 660  ARG A C     1 
ATOM   2770 O O     . ARG A 1 364 ? -1.792  1.333   14.457  1.00 32.39 ? 660  ARG A O     1 
ATOM   2771 C CB    . ARG A 1 364 ? 0.483   -0.866  15.213  1.00 33.00 ? 660  ARG A CB    1 
ATOM   2772 C CG    . ARG A 1 364 ? 1.185   -2.114  14.755  1.00 33.53 ? 660  ARG A CG    1 
ATOM   2773 C CD    . ARG A 1 364 ? 1.365   -3.104  15.883  1.00 33.89 ? 660  ARG A CD    1 
ATOM   2774 N NE    . ARG A 1 364 ? 2.124   -4.257  15.416  1.00 34.04 ? 660  ARG A NE    1 
ATOM   2775 C CZ    . ARG A 1 364 ? 1.597   -5.374  14.920  1.00 34.38 ? 660  ARG A CZ    1 
ATOM   2776 N NH1   . ARG A 1 364 ? 0.282   -5.536  14.841  1.00 34.81 ? 660  ARG A NH1   1 
ATOM   2777 N NH2   . ARG A 1 364 ? 2.397   -6.350  14.512  1.00 34.70 ? 660  ARG A NH2   1 
ATOM   2778 N N     . VAL A 1 365 ? 0.120   2.241   15.252  1.00 32.25 ? 661  VAL A N     1 
ATOM   2779 C CA    . VAL A 1 365 ? -0.536  3.434   15.759  1.00 32.10 ? 661  VAL A CA    1 
ATOM   2780 C C     . VAL A 1 365 ? -1.167  4.211   14.612  1.00 31.90 ? 661  VAL A C     1 
ATOM   2781 O O     . VAL A 1 365 ? -2.277  4.736   14.735  1.00 31.79 ? 661  VAL A O     1 
ATOM   2782 C CB    . VAL A 1 365 ? 0.449   4.338   16.517  1.00 32.11 ? 661  VAL A CB    1 
ATOM   2783 C CG1   . VAL A 1 365 ? -0.138  5.728   16.728  1.00 31.94 ? 661  VAL A CG1   1 
ATOM   2784 C CG2   . VAL A 1 365 ? 0.812   3.710   17.845  1.00 32.02 ? 661  VAL A CG2   1 
ATOM   2785 N N     . LEU A 1 366 ? -0.460  4.266   13.492  1.00 31.65 ? 662  LEU A N     1 
ATOM   2786 C CA    . LEU A 1 366 ? -0.947  4.982   12.326  1.00 31.63 ? 662  LEU A CA    1 
ATOM   2787 C C     . LEU A 1 366 ? -2.256  4.382   11.802  1.00 32.13 ? 662  LEU A C     1 
ATOM   2788 O O     . LEU A 1 366 ? -3.231  5.103   11.587  1.00 32.22 ? 662  LEU A O     1 
ATOM   2789 C CB    . LEU A 1 366 ? 0.109   4.990   11.224  1.00 31.28 ? 662  LEU A CB    1 
ATOM   2790 C CG    . LEU A 1 366 ? -0.166  5.930   10.050  1.00 30.56 ? 662  LEU A CG    1 
ATOM   2791 C CD1   . LEU A 1 366 ? -0.245  7.381   10.508  1.00 29.70 ? 662  LEU A CD1   1 
ATOM   2792 C CD2   . LEU A 1 366 ? 0.886   5.759   8.978   1.00 29.74 ? 662  LEU A CD2   1 
ATOM   2793 N N     . ALA A 1 367 ? -2.279  3.064   11.610  1.00 32.49 ? 663  ALA A N     1 
ATOM   2794 C CA    . ALA A 1 367 ? -3.472  2.381   11.108  1.00 32.60 ? 663  ALA A CA    1 
ATOM   2795 C C     . ALA A 1 367 ? -4.692  2.815   11.884  1.00 32.88 ? 663  ALA A C     1 
ATOM   2796 O O     . ALA A 1 367 ? -5.722  3.133   11.307  1.00 33.05 ? 663  ALA A O     1 
ATOM   2797 C CB    . ALA A 1 367 ? -3.313  0.886   11.216  1.00 32.60 ? 663  ALA A CB    1 
ATOM   2798 N N     . HIS A 1 368 ? -4.553  2.837   13.203  1.00 33.31 ? 664  HIS A N     1 
ATOM   2799 C CA    . HIS A 1 368 ? -5.659  3.156   14.102  1.00 33.61 ? 664  HIS A CA    1 
ATOM   2800 C C     . HIS A 1 368 ? -6.162  4.587   13.928  1.00 33.72 ? 664  HIS A C     1 
ATOM   2801 O O     . HIS A 1 368 ? -7.328  4.811   13.614  1.00 33.71 ? 664  HIS A O     1 
ATOM   2802 C CB    . HIS A 1 368 ? -5.223  2.926   15.550  1.00 33.66 ? 664  HIS A CB    1 
ATOM   2803 C CG    . HIS A 1 368 ? -6.263  3.292   16.558  1.00 33.83 ? 664  HIS A CG    1 
ATOM   2804 N ND1   . HIS A 1 368 ? -7.178  2.386   17.046  1.00 34.60 ? 664  HIS A ND1   1 
ATOM   2805 C CD2   . HIS A 1 368 ? -6.535  4.467   17.170  1.00 33.74 ? 664  HIS A CD2   1 
ATOM   2806 C CE1   . HIS A 1 368 ? -7.965  2.984   17.922  1.00 34.46 ? 664  HIS A CE1   1 
ATOM   2807 N NE2   . HIS A 1 368 ? -7.596  4.248   18.014  1.00 34.26 ? 664  HIS A NE2   1 
ATOM   2808 N N     . ILE A 1 369 ? -5.279  5.550   14.139  1.00 34.00 ? 665  ILE A N     1 
ATOM   2809 C CA    . ILE A 1 369 ? -5.668  6.958   14.060  1.00 34.26 ? 665  ILE A CA    1 
ATOM   2810 C C     . ILE A 1 369 ? -6.076  7.336   12.641  1.00 34.17 ? 665  ILE A C     1 
ATOM   2811 O O     . ILE A 1 369 ? -7.051  8.041   12.441  1.00 34.06 ? 665  ILE A O     1 
ATOM   2812 C CB    . ILE A 1 369 ? -4.552  7.916   14.578  1.00 34.36 ? 665  ILE A CB    1 
ATOM   2813 C CG1   . ILE A 1 369 ? -3.283  7.830   13.727  1.00 34.96 ? 665  ILE A CG1   1 
ATOM   2814 C CG2   . ILE A 1 369 ? -4.199  7.596   16.019  1.00 34.07 ? 665  ILE A CG2   1 
ATOM   2815 C CD1   . ILE A 1 369 ? -2.097  8.577   14.339  1.00 35.76 ? 665  ILE A CD1   1 
ATOM   2816 N N     . ALA A 1 370 ? -5.324  6.843   11.665  1.00 34.38 ? 666  ALA A N     1 
ATOM   2817 C CA    . ALA A 1 370 ? -5.553  7.175   10.262  1.00 34.55 ? 666  ALA A CA    1 
ATOM   2818 C C     . ALA A 1 370 ? -6.743  6.420   9.684   1.00 34.71 ? 666  ALA A C     1 
ATOM   2819 O O     . ALA A 1 370 ? -7.329  6.864   8.704   1.00 34.77 ? 666  ALA A O     1 
ATOM   2820 C CB    . ALA A 1 370 ? -4.294  6.900   9.435   1.00 34.41 ? 666  ALA A CB    1 
ATOM   2821 N N     . GLU A 1 371 ? -7.086  5.285   10.288  1.00 35.02 ? 667  GLU A N     1 
ATOM   2822 C CA    . GLU A 1 371 ? -8.205  4.447   9.843   1.00 35.44 ? 667  GLU A CA    1 
ATOM   2823 C C     . GLU A 1 371 ? -8.070  3.962   8.405   1.00 35.47 ? 667  GLU A C     1 
ATOM   2824 O O     . GLU A 1 371 ? -9.074  3.859   7.673   1.00 35.81 ? 667  GLU A O     1 
ATOM   2825 C CB    . GLU A 1 371 ? -9.536  5.173   10.017  1.00 35.57 ? 667  GLU A CB    1 
ATOM   2826 C CG    . GLU A 1 371 ? -10.077 5.087   11.406  1.00 36.83 ? 667  GLU A CG    1 
ATOM   2827 C CD    . GLU A 1 371 ? -11.163 6.103   11.641  1.00 38.79 ? 667  GLU A CD    1 
ATOM   2828 O OE1   . GLU A 1 371 ? -12.286 5.911   11.114  1.00 39.93 ? 667  GLU A OE1   1 
ATOM   2829 O OE2   . GLU A 1 371 ? -10.880 7.108   12.332  1.00 40.12 ? 667  GLU A OE2   1 
ATOM   2830 N N     . ASP A 1 372 ? -6.841  3.651   8.002   1.00 35.17 ? 668  ASP A N     1 
ATOM   2831 C CA    . ASP A 1 372 ? -6.615  3.114   6.672   1.00 35.14 ? 668  ASP A CA    1 
ATOM   2832 C C     . ASP A 1 372 ? -7.003  1.641   6.643   1.00 35.14 ? 668  ASP A C     1 
ATOM   2833 O O     . ASP A 1 372 ? -6.542  0.860   7.474   1.00 35.10 ? 668  ASP A O     1 
ATOM   2834 C CB    . ASP A 1 372 ? -5.166  3.267   6.246   1.00 35.16 ? 668  ASP A CB    1 
ATOM   2835 C CG    . ASP A 1 372 ? -4.989  3.069   4.758   1.00 35.30 ? 668  ASP A CG    1 
ATOM   2836 O OD1   . ASP A 1 372 ? -5.340  3.989   3.986   1.00 35.14 ? 668  ASP A OD1   1 
ATOM   2837 O OD2   . ASP A 1 372 ? -4.541  1.976   4.360   1.00 35.24 ? 668  ASP A OD2   1 
ATOM   2838 N N     . ASP A 1 373 ? -7.850  1.268   5.687   1.00 35.08 ? 669  ASP A N     1 
ATOM   2839 C CA    . ASP A 1 373 ? -8.350  -0.101  5.609   1.00 35.06 ? 669  ASP A CA    1 
ATOM   2840 C C     . ASP A 1 373 ? -7.245  -1.054  5.208   1.00 35.02 ? 669  ASP A C     1 
ATOM   2841 O O     . ASP A 1 373 ? -7.073  -2.101  5.822   1.00 34.80 ? 669  ASP A O     1 
ATOM   2842 C CB    . ASP A 1 373 ? -9.518  -0.200  4.629   1.00 35.11 ? 669  ASP A CB    1 
ATOM   2843 C CG    . ASP A 1 373 ? -10.716 0.607   5.078   1.00 35.34 ? 669  ASP A CG    1 
ATOM   2844 O OD1   . ASP A 1 373 ? -11.012 0.628   6.296   1.00 35.08 ? 669  ASP A OD1   1 
ATOM   2845 O OD2   . ASP A 1 373 ? -11.352 1.236   4.206   1.00 36.03 ? 669  ASP A OD2   1 
ATOM   2846 N N     . ASN A 1 374 ? -6.485  -0.676  4.188   1.00 35.27 ? 670  ASN A N     1 
ATOM   2847 C CA    . ASN A 1 374 ? -5.378  -1.503  3.714   1.00 35.52 ? 670  ASN A CA    1 
ATOM   2848 C C     . ASN A 1 374 ? -4.321  -1.713  4.804   1.00 35.62 ? 670  ASN A C     1 
ATOM   2849 O O     . ASN A 1 374 ? -3.672  -2.751  4.842   1.00 35.81 ? 670  ASN A O     1 
ATOM   2850 C CB    . ASN A 1 374 ? -4.735  -0.895  2.453   1.00 35.58 ? 670  ASN A CB    1 
ATOM   2851 C CG    . ASN A 1 374 ? -4.009  -1.939  1.578   1.00 36.04 ? 670  ASN A CG    1 
ATOM   2852 O OD1   . ASN A 1 374 ? -3.701  -3.056  2.015   1.00 36.10 ? 670  ASN A OD1   1 
ATOM   2853 N ND2   . ASN A 1 374 ? -3.738  -1.564  0.326   1.00 36.20 ? 670  ASN A ND2   1 
ATOM   2854 N N     . LEU A 1 375 ? -4.148  -0.740  5.692   1.00 35.74 ? 671  LEU A N     1 
ATOM   2855 C CA    . LEU A 1 375 ? -3.151  -0.868  6.749   1.00 35.88 ? 671  LEU A CA    1 
ATOM   2856 C C     . LEU A 1 375 ? -3.628  -1.844  7.818   1.00 36.13 ? 671  LEU A C     1 
ATOM   2857 O O     . LEU A 1 375 ? -2.894  -2.746  8.218   1.00 36.29 ? 671  LEU A O     1 
ATOM   2858 C CB    . LEU A 1 375 ? -2.820  0.497   7.359   1.00 35.90 ? 671  LEU A CB    1 
ATOM   2859 C CG    . LEU A 1 375 ? -1.358  0.708   7.797   1.00 36.11 ? 671  LEU A CG    1 
ATOM   2860 C CD1   . LEU A 1 375 ? -0.346  0.058   6.850   1.00 35.83 ? 671  LEU A CD1   1 
ATOM   2861 C CD2   . LEU A 1 375 ? -1.048  2.194   7.932   1.00 35.80 ? 671  LEU A CD2   1 
ATOM   2862 N N     . MET A 1 376 ? -4.873  -1.678  8.252   1.00 36.41 ? 672  MET A N     1 
ATOM   2863 C CA    . MET A 1 376 ? -5.455  -2.523  9.298   1.00 36.52 ? 672  MET A CA    1 
ATOM   2864 C C     . MET A 1 376 ? -5.502  -3.972  8.903   1.00 36.01 ? 672  MET A C     1 
ATOM   2865 O O     . MET A 1 376 ? -5.070  -4.835  9.660   1.00 36.01 ? 672  MET A O     1 
ATOM   2866 C CB    . MET A 1 376 ? -6.866  -2.069  9.609   1.00 36.85 ? 672  MET A CB    1 
ATOM   2867 C CG    . MET A 1 376 ? -6.894  -0.724  10.270  1.00 38.71 ? 672  MET A CG    1 
ATOM   2868 S SD    . MET A 1 376 ? -8.554  -0.176  10.664  1.00 43.00 ? 672  MET A SD    1 
ATOM   2869 C CE    . MET A 1 376 ? -8.972  0.806   9.208   1.00 43.19 ? 672  MET A CE    1 
ATOM   2870 N N     . GLU A 1 377 ? -6.043  -4.229  7.718   1.00 35.61 ? 673  GLU A N     1 
ATOM   2871 C CA    . GLU A 1 377 ? -6.079  -5.577  7.174   1.00 35.36 ? 673  GLU A CA    1 
ATOM   2872 C C     . GLU A 1 377 ? -4.681  -6.189  7.213   1.00 35.09 ? 673  GLU A C     1 
ATOM   2873 O O     . GLU A 1 377 ? -4.510  -7.294  7.711   1.00 35.24 ? 673  GLU A O     1 
ATOM   2874 C CB    . GLU A 1 377 ? -6.649  -5.579  5.753   1.00 35.38 ? 673  GLU A CB    1 
ATOM   2875 C CG    . GLU A 1 377 ? -6.821  -6.958  5.129   1.00 35.60 ? 673  GLU A CG    1 
ATOM   2876 C CD    . GLU A 1 377 ? -7.867  -7.821  5.821   1.00 35.84 ? 673  GLU A CD    1 
ATOM   2877 O OE1   . GLU A 1 377 ? -8.438  -7.393  6.839   1.00 36.94 ? 673  GLU A OE1   1 
ATOM   2878 O OE2   . GLU A 1 377 ? -8.115  -8.947  5.342   1.00 35.87 ? 673  GLU A OE2   1 
ATOM   2879 N N     . ALA A 1 378 ? -3.681  -5.457  6.738   1.00 34.72 ? 674  ALA A N     1 
ATOM   2880 C CA    . ALA A 1 378 ? -2.299  -5.945  6.777   1.00 34.53 ? 674  ALA A CA    1 
ATOM   2881 C C     . ALA A 1 378 ? -1.915  -6.391  8.183   1.00 34.31 ? 674  ALA A C     1 
ATOM   2882 O O     . ALA A 1 378 ? -1.400  -7.492  8.379   1.00 34.18 ? 674  ALA A O     1 
ATOM   2883 C CB    . ALA A 1 378 ? -1.331  -4.878  6.281   1.00 34.57 ? 674  ALA A CB    1 
ATOM   2884 N N     . PHE A 1 379 ? -2.182  -5.536  9.161   1.00 34.23 ? 675  PHE A N     1 
ATOM   2885 C CA    . PHE A 1 379 ? -1.810  -5.830  10.541  1.00 34.17 ? 675  PHE A CA    1 
ATOM   2886 C C     . PHE A 1 379 ? -2.686  -6.885  11.179  1.00 34.36 ? 675  PHE A C     1 
ATOM   2887 O O     . PHE A 1 379 ? -2.199  -7.664  11.993  1.00 34.72 ? 675  PHE A O     1 
ATOM   2888 C CB    . PHE A 1 379 ? -1.835  -4.570  11.394  1.00 34.01 ? 675  PHE A CB    1 
ATOM   2889 C CG    . PHE A 1 379 ? -0.653  -3.688  11.182  1.00 33.48 ? 675  PHE A CG    1 
ATOM   2890 C CD1   . PHE A 1 379 ? 0.631   -4.185  11.352  1.00 33.33 ? 675  PHE A CD1   1 
ATOM   2891 C CD2   . PHE A 1 379 ? -0.818  -2.364  10.815  1.00 33.05 ? 675  PHE A CD2   1 
ATOM   2892 C CE1   . PHE A 1 379 ? 1.730   -3.380  11.157  1.00 33.52 ? 675  PHE A CE1   1 
ATOM   2893 C CE2   . PHE A 1 379 ? 0.271   -1.551  10.621  1.00 33.12 ? 675  PHE A CE2   1 
ATOM   2894 C CZ    . PHE A 1 379 ? 1.553   -2.061  10.791  1.00 33.66 ? 675  PHE A CZ    1 
ATOM   2895 N N     . ARG A 1 380 ? -3.964  -6.921  10.816  1.00 34.31 ? 676  ARG A N     1 
ATOM   2896 C CA    . ARG A 1 380 ? -4.857  -7.948  11.328  1.00 34.32 ? 676  ARG A CA    1 
ATOM   2897 C C     . ARG A 1 380 ? -4.370  -9.330  10.932  1.00 34.30 ? 676  ARG A C     1 
ATOM   2898 O O     . ARG A 1 380 ? -4.522  -10.280 11.685  1.00 34.09 ? 676  ARG A O     1 
ATOM   2899 C CB    . ARG A 1 380 ? -6.274  -7.730  10.829  1.00 34.47 ? 676  ARG A CB    1 
ATOM   2900 C CG    . ARG A 1 380 ? -7.048  -6.715  11.641  1.00 34.92 ? 676  ARG A CG    1 
ATOM   2901 C CD    . ARG A 1 380 ? -8.472  -6.609  11.126  1.00 35.80 ? 676  ARG A CD    1 
ATOM   2902 N NE    . ARG A 1 380 ? -9.331  -5.825  12.014  1.00 36.14 ? 676  ARG A NE    1 
ATOM   2903 C CZ    . ARG A 1 380 ? -9.686  -4.556  11.820  1.00 36.81 ? 676  ARG A CZ    1 
ATOM   2904 N NH1   . ARG A 1 380 ? -9.268  -3.874  10.759  1.00 37.54 ? 676  ARG A NH1   1 
ATOM   2905 N NH2   . ARG A 1 380 ? -10.476 -3.955  12.698  1.00 36.95 ? 676  ARG A NH2   1 
ATOM   2906 N N     . ARG A 1 381 ? -3.766  -9.424  9.754   1.00 34.56 ? 677  ARG A N     1 
ATOM   2907 C CA    . ARG A 1 381 ? -3.133  -10.662 9.286   1.00 34.80 ? 677  ARG A CA    1 
ATOM   2908 C C     . ARG A 1 381 ? -1.674  -10.813 9.718   1.00 34.71 ? 677  ARG A C     1 
ATOM   2909 O O     . ARG A 1 381 ? -1.047  -11.820 9.412   1.00 34.54 ? 677  ARG A O     1 
ATOM   2910 C CB    . ARG A 1 381 ? -3.141  -10.723 7.766   1.00 34.93 ? 677  ARG A CB    1 
ATOM   2911 C CG    . ARG A 1 381 ? -4.451  -10.417 7.110   1.00 35.40 ? 677  ARG A CG    1 
ATOM   2912 C CD    . ARG A 1 381 ? -4.248  -10.462 5.626   1.00 36.49 ? 677  ARG A CD    1 
ATOM   2913 N NE    . ARG A 1 381 ? -5.377  -9.927  4.885   1.00 37.32 ? 677  ARG A NE    1 
ATOM   2914 C CZ    . ARG A 1 381 ? -5.446  -9.899  3.559   1.00 37.85 ? 677  ARG A CZ    1 
ATOM   2915 N NH1   . ARG A 1 381 ? -4.445  -10.385 2.833   1.00 38.08 ? 677  ARG A NH1   1 
ATOM   2916 N NH2   . ARG A 1 381 ? -6.515  -9.394  2.952   1.00 38.14 ? 677  ARG A NH2   1 
ATOM   2917 N N     . ASP A 1 382 ? -1.123  -9.802  10.374  1.00 34.80 ? 678  ASP A N     1 
ATOM   2918 C CA    . ASP A 1 382 ? 0.233   -9.881  10.896  1.00 35.13 ? 678  ASP A CA    1 
ATOM   2919 C C     . ASP A 1 382 ? 1.278   -10.090 9.786   1.00 35.06 ? 678  ASP A C     1 
ATOM   2920 O O     . ASP A 1 382 ? 2.243   -10.840 9.933   1.00 34.77 ? 678  ASP A O     1 
ATOM   2921 C CB    . ASP A 1 382 ? 0.315   -11.003 11.932  1.00 35.32 ? 678  ASP A CB    1 
ATOM   2922 C CG    . ASP A 1 382 ? 1.499   -10.848 12.873  1.00 36.25 ? 678  ASP A CG    1 
ATOM   2923 O OD1   . ASP A 1 382 ? 2.660   -10.924 12.412  1.00 37.62 ? 678  ASP A OD1   1 
ATOM   2924 O OD2   . ASP A 1 382 ? 1.271   -10.639 14.084  1.00 37.16 ? 678  ASP A OD2   1 
ATOM   2925 N N     . LEU A 1 383 ? 1.073   -9.413  8.670   1.00 35.15 ? 679  LEU A N     1 
ATOM   2926 C CA    . LEU A 1 383 ? 2.028   -9.452  7.577   1.00 35.22 ? 679  LEU A CA    1 
ATOM   2927 C C     . LEU A 1 383 ? 3.256   -8.653  7.938   1.00 35.17 ? 679  LEU A C     1 
ATOM   2928 O O     . LEU A 1 383 ? 3.229   -7.848  8.865   1.00 35.12 ? 679  LEU A O     1 
ATOM   2929 C CB    . LEU A 1 383 ? 1.413   -8.864  6.309   1.00 35.33 ? 679  LEU A CB    1 
ATOM   2930 C CG    . LEU A 1 383 ? 0.798   -9.902  5.375   1.00 35.87 ? 679  LEU A CG    1 
ATOM   2931 C CD1   . LEU A 1 383 ? -0.363  -9.294  4.574   1.00 36.51 ? 679  LEU A CD1   1 
ATOM   2932 C CD2   . LEU A 1 383 ? 1.873   -10.526 4.460   1.00 35.59 ? 679  LEU A CD2   1 
ATOM   2933 N N     . ASP A 1 384 ? 4.335   -8.887  7.198   1.00 35.15 ? 680  ASP A N     1 
ATOM   2934 C CA    . ASP A 1 384 ? 5.494   -8.015  7.250   1.00 35.02 ? 680  ASP A CA    1 
ATOM   2935 C C     . ASP A 1 384 ? 5.126   -6.734  6.527   1.00 35.00 ? 680  ASP A C     1 
ATOM   2936 O O     . ASP A 1 384 ? 4.947   -6.729  5.308   1.00 34.86 ? 680  ASP A O     1 
ATOM   2937 C CB    . ASP A 1 384 ? 6.693   -8.658  6.572   1.00 35.03 ? 680  ASP A CB    1 
ATOM   2938 C CG    . ASP A 1 384 ? 7.893   -7.734  6.505   1.00 34.70 ? 680  ASP A CG    1 
ATOM   2939 O OD1   . ASP A 1 384 ? 7.956   -6.728  7.252   1.00 34.25 ? 680  ASP A OD1   1 
ATOM   2940 O OD2   . ASP A 1 384 ? 8.790   -8.028  5.695   1.00 34.32 ? 680  ASP A OD2   1 
ATOM   2941 N N     . ILE A 1 385 ? 5.024   -5.648  7.281   1.00 34.96 ? 681  ILE A N     1 
ATOM   2942 C CA    . ILE A 1 385 ? 4.486   -4.415  6.740   1.00 35.05 ? 681  ILE A CA    1 
ATOM   2943 C C     . ILE A 1 385 ? 5.338   -3.855  5.619   1.00 34.92 ? 681  ILE A C     1 
ATOM   2944 O O     . ILE A 1 385 ? 4.815   -3.245  4.696   1.00 34.95 ? 681  ILE A O     1 
ATOM   2945 C CB    . ILE A 1 385 ? 4.320   -3.347  7.826   1.00 35.18 ? 681  ILE A CB    1 
ATOM   2946 C CG1   . ILE A 1 385 ? 3.330   -2.267  7.358   1.00 35.70 ? 681  ILE A CG1   1 
ATOM   2947 C CG2   . ILE A 1 385 ? 5.669   -2.759  8.201   1.00 35.34 ? 681  ILE A CG2   1 
ATOM   2948 C CD1   . ILE A 1 385 ? 1.931   -2.799  6.981   1.00 35.83 ? 681  ILE A CD1   1 
ATOM   2949 N N     . HIS A 1 386 ? 6.644   -4.071  5.702   1.00 34.94 ? 682  HIS A N     1 
ATOM   2950 C CA    . HIS A 1 386 ? 7.575   -3.555  4.702   1.00 34.86 ? 682  HIS A CA    1 
ATOM   2951 C C     . HIS A 1 386 ? 7.494   -4.283  3.375   1.00 34.96 ? 682  HIS A C     1 
ATOM   2952 O O     . HIS A 1 386 ? 7.607   -3.667  2.316   1.00 34.99 ? 682  HIS A O     1 
ATOM   2953 C CB    . HIS A 1 386 ? 8.989   -3.623  5.238   1.00 34.76 ? 682  HIS A CB    1 
ATOM   2954 C CG    . HIS A 1 386 ? 9.183   -2.805  6.469   1.00 34.28 ? 682  HIS A CG    1 
ATOM   2955 N ND1   . HIS A 1 386 ? 8.427   -1.686  6.736   1.00 33.29 ? 682  HIS A ND1   1 
ATOM   2956 C CD2   . HIS A 1 386 ? 10.050  -2.932  7.500   1.00 34.05 ? 682  HIS A CD2   1 
ATOM   2957 C CE1   . HIS A 1 386 ? 8.815   -1.162  7.883   1.00 33.45 ? 682  HIS A CE1   1 
ATOM   2958 N NE2   . HIS A 1 386 ? 9.799   -1.899  8.367   1.00 33.56 ? 682  HIS A NE2   1 
ATOM   2959 N N     . THR A 1 387 ? 7.314   -5.596  3.437   1.00 35.05 ? 683  THR A N     1 
ATOM   2960 C CA    . THR A 1 387 ? 7.071   -6.381  2.239   1.00 35.21 ? 683  THR A CA    1 
ATOM   2961 C C     . THR A 1 387 ? 5.737   -5.958  1.636   1.00 35.47 ? 683  THR A C     1 
ATOM   2962 O O     . THR A 1 387 ? 5.673   -5.585  0.466   1.00 35.58 ? 683  THR A O     1 
ATOM   2963 C CB    . THR A 1 387 ? 7.048   -7.885  2.554   1.00 35.20 ? 683  THR A CB    1 
ATOM   2964 O OG1   . THR A 1 387 ? 8.311   -8.270  3.105   1.00 35.19 ? 683  THR A OG1   1 
ATOM   2965 C CG2   . THR A 1 387 ? 6.775   -8.707  1.299   1.00 35.04 ? 683  THR A CG2   1 
ATOM   2966 N N     . LYS A 1 388 ? 4.689   -5.998  2.458   1.00 35.66 ? 684  LYS A N     1 
ATOM   2967 C CA    . LYS A 1 388 ? 3.339   -5.615  2.044   1.00 35.91 ? 684  LYS A CA    1 
ATOM   2968 C C     . LYS A 1 388 ? 3.346   -4.255  1.361   1.00 35.82 ? 684  LYS A C     1 
ATOM   2969 O O     . LYS A 1 388 ? 2.879   -4.108  0.232   1.00 35.80 ? 684  LYS A O     1 
ATOM   2970 C CB    . LYS A 1 388 ? 2.408   -5.587  3.261   1.00 36.22 ? 684  LYS A CB    1 
ATOM   2971 C CG    . LYS A 1 388 ? 1.082   -4.834  3.078   1.00 37.34 ? 684  LYS A CG    1 
ATOM   2972 C CD    . LYS A 1 388 ? 0.176   -5.474  2.022   1.00 38.86 ? 684  LYS A CD    1 
ATOM   2973 C CE    . LYS A 1 388 ? -1.258  -4.941  2.131   1.00 39.89 ? 684  LYS A CE    1 
ATOM   2974 N NZ    . LYS A 1 388 ? -2.277  -5.824  1.481   1.00 40.81 ? 684  LYS A NZ    1 
ATOM   2975 N N     . THR A 1 389 ? 3.881   -3.261  2.059   1.00 35.85 ? 685  THR A N     1 
ATOM   2976 C CA    . THR A 1 389 ? 4.060   -1.925  1.486   1.00 35.77 ? 685  THR A CA    1 
ATOM   2977 C C     . THR A 1 389 ? 4.777   -2.045  0.145   1.00 35.81 ? 685  THR A C     1 
ATOM   2978 O O     . THR A 1 389 ? 4.281   -1.567  -0.878  1.00 35.65 ? 685  THR A O     1 
ATOM   2979 C CB    . THR A 1 389 ? 4.865   -0.998  2.434   1.00 35.69 ? 685  THR A CB    1 
ATOM   2980 O OG1   . THR A 1 389 ? 3.967   -0.334  3.331   1.00 35.76 ? 685  THR A OG1   1 
ATOM   2981 C CG2   . THR A 1 389 ? 5.640   0.048   1.652   1.00 35.64 ? 685  THR A CG2   1 
ATOM   2982 N N     . ALA A 1 390 ? 5.931   -2.713  0.167   1.00 35.95 ? 686  ALA A N     1 
ATOM   2983 C CA    . ALA A 1 390 ? 6.733   -2.956  -1.037  1.00 36.07 ? 686  ALA A CA    1 
ATOM   2984 C C     . ALA A 1 390 ? 5.889   -3.543  -2.169  1.00 36.24 ? 686  ALA A C     1 
ATOM   2985 O O     . ALA A 1 390 ? 6.012   -3.120  -3.321  1.00 36.30 ? 686  ALA A O     1 
ATOM   2986 C CB    . ALA A 1 390 ? 7.909   -3.876  -0.727  1.00 36.03 ? 686  ALA A CB    1 
ATOM   2987 N N     . MET A 1 391 ? 5.024   -4.501  -1.835  1.00 36.28 ? 687  MET A N     1 
ATOM   2988 C CA    . MET A 1 391 ? 4.146   -5.131  -2.828  1.00 36.40 ? 687  MET A CA    1 
ATOM   2989 C C     . MET A 1 391 ? 3.188   -4.139  -3.469  1.00 36.28 ? 687  MET A C     1 
ATOM   2990 O O     . MET A 1 391 ? 2.953   -4.177  -4.678  1.00 36.18 ? 687  MET A O     1 
ATOM   2991 C CB    . MET A 1 391 ? 3.307   -6.231  -2.191  1.00 36.53 ? 687  MET A CB    1 
ATOM   2992 C CG    . MET A 1 391 ? 4.089   -7.433  -1.731  1.00 37.39 ? 687  MET A CG    1 
ATOM   2993 S SD    . MET A 1 391 ? 2.986   -8.811  -1.370  1.00 39.26 ? 687  MET A SD    1 
ATOM   2994 C CE    . MET A 1 391 ? 2.222   -9.098  -2.969  1.00 39.18 ? 687  MET A CE    1 
ATOM   2995 N N     . ASP A 1 392 ? 2.626   -3.269  -2.638  1.00 36.19 ? 688  ASP A N     1 
ATOM   2996 C CA    . ASP A 1 392 ? 1.616   -2.303  -3.073  1.00 36.10 ? 688  ASP A CA    1 
ATOM   2997 C C     . ASP A 1 392 ? 2.164   -1.174  -3.944  1.00 35.79 ? 688  ASP A C     1 
ATOM   2998 O O     . ASP A 1 392 ? 1.487   -0.736  -4.874  1.00 35.62 ? 688  ASP A O     1 
ATOM   2999 C CB    . ASP A 1 392 ? 0.911   -1.702  -1.854  1.00 36.31 ? 688  ASP A CB    1 
ATOM   3000 C CG    . ASP A 1 392 ? 0.008   -2.698  -1.156  1.00 36.65 ? 688  ASP A CG    1 
ATOM   3001 O OD1   . ASP A 1 392 ? -0.838  -3.307  -1.843  1.00 38.13 ? 688  ASP A OD1   1 
ATOM   3002 O OD2   . ASP A 1 392 ? 0.140   -2.870  0.075   1.00 36.31 ? 688  ASP A OD2   1 
ATOM   3003 N N     . ILE A 1 393 ? 3.371   -0.693  -3.644  1.00 35.48 ? 689  ILE A N     1 
ATOM   3004 C CA    . ILE A 1 393 ? 3.955   0.417   -4.423  1.00 35.34 ? 689  ILE A CA    1 
ATOM   3005 C C     . ILE A 1 393 ? 4.671   -0.029  -5.707  1.00 35.07 ? 689  ILE A C     1 
ATOM   3006 O O     . ILE A 1 393 ? 4.836   0.765   -6.633  1.00 34.85 ? 689  ILE A O     1 
ATOM   3007 C CB    . ILE A 1 393 ? 4.916   1.309   -3.592  1.00 35.36 ? 689  ILE A CB    1 
ATOM   3008 C CG1   . ILE A 1 393 ? 6.304   0.674   -3.477  1.00 35.50 ? 689  ILE A CG1   1 
ATOM   3009 C CG2   . ILE A 1 393 ? 4.316   1.626   -2.221  1.00 35.30 ? 689  ILE A CG2   1 
ATOM   3010 C CD1   . ILE A 1 393 ? 7.172   1.343   -2.452  1.00 35.56 ? 689  ILE A CD1   1 
ATOM   3011 N N     . PHE A 1 394 ? 5.124   -1.276  -5.755  1.00 34.89 ? 690  PHE A N     1 
ATOM   3012 C CA    . PHE A 1 394 ? 5.698   -1.812  -6.993  1.00 34.86 ? 690  PHE A CA    1 
ATOM   3013 C C     . PHE A 1 394 ? 4.702   -2.667  -7.763  1.00 35.04 ? 690  PHE A C     1 
ATOM   3014 O O     . PHE A 1 394 ? 5.010   -3.140  -8.854  1.00 35.18 ? 690  PHE A O     1 
ATOM   3015 C CB    . PHE A 1 394 ? 6.982   -2.592  -6.702  1.00 34.80 ? 690  PHE A CB    1 
ATOM   3016 C CG    . PHE A 1 394 ? 8.044   -1.755  -6.061  1.00 34.32 ? 690  PHE A CG    1 
ATOM   3017 C CD1   . PHE A 1 394 ? 8.477   -0.592  -6.676  1.00 33.96 ? 690  PHE A CD1   1 
ATOM   3018 C CD2   . PHE A 1 394 ? 8.589   -2.105  -4.838  1.00 34.12 ? 690  PHE A CD2   1 
ATOM   3019 C CE1   . PHE A 1 394 ? 9.433   0.202   -6.093  1.00 33.85 ? 690  PHE A CE1   1 
ATOM   3020 C CE2   . PHE A 1 394 ? 9.556   -1.314  -4.250  1.00 34.27 ? 690  PHE A CE2   1 
ATOM   3021 C CZ    . PHE A 1 394 ? 9.980   -0.160  -4.881  1.00 34.06 ? 690  PHE A CZ    1 
ATOM   3022 N N     . GLN A 1 395 ? 3.506   -2.847  -7.201  1.00 35.20 ? 691  GLN A N     1 
ATOM   3023 C CA    . GLN A 1 395 ? 2.474   -3.692  -7.804  1.00 35.22 ? 691  GLN A CA    1 
ATOM   3024 C C     . GLN A 1 395 ? 3.049   -5.069  -8.156  1.00 35.27 ? 691  GLN A C     1 
ATOM   3025 O O     . GLN A 1 395 ? 2.921   -5.538  -9.284  1.00 35.21 ? 691  GLN A O     1 
ATOM   3026 C CB    . GLN A 1 395 ? 1.866   -3.010  -9.037  1.00 35.03 ? 691  GLN A CB    1 
ATOM   3027 N N     . VAL A 1 396 ? 3.690   -5.700  -7.174  1.00 35.47 ? 692  VAL A N     1 
ATOM   3028 C CA    . VAL A 1 396 ? 4.313   -7.006  -7.365  1.00 35.72 ? 692  VAL A CA    1 
ATOM   3029 C C     . VAL A 1 396 ? 3.788   -8.015  -6.351  1.00 36.20 ? 692  VAL A C     1 
ATOM   3030 O O     . VAL A 1 396 ? 3.068   -7.662  -5.412  1.00 36.09 ? 692  VAL A O     1 
ATOM   3031 C CB    . VAL A 1 396 ? 5.863   -6.940  -7.272  1.00 35.65 ? 692  VAL A CB    1 
ATOM   3032 C CG1   . VAL A 1 396 ? 6.396   -5.748  -8.043  1.00 35.23 ? 692  VAL A CG1   1 
ATOM   3033 C CG2   . VAL A 1 396 ? 6.335   -6.907  -5.819  1.00 35.28 ? 692  VAL A CG2   1 
ATOM   3034 N N     . SER A 1 397 ? 4.142   -9.275  -6.564  1.00 36.80 ? 693  SER A N     1 
ATOM   3035 C CA    . SER A 1 397 ? 3.770   -10.324 -5.633  1.00 37.34 ? 693  SER A CA    1 
ATOM   3036 C C     . SER A 1 397 ? 4.926   -10.612 -4.708  1.00 37.49 ? 693  SER A C     1 
ATOM   3037 O O     . SER A 1 397 ? 6.085   -10.286 -4.996  1.00 37.35 ? 693  SER A O     1 
ATOM   3038 C CB    . SER A 1 397 ? 3.336   -11.597 -6.352  1.00 37.54 ? 693  SER A CB    1 
ATOM   3039 O OG    . SER A 1 397 ? 2.248   -12.182 -5.644  1.00 38.37 ? 693  SER A OG    1 
ATOM   3040 N N     . GLU A 1 398 ? 4.614   -11.236 -3.589  1.00 37.72 ? 694  GLU A N     1 
ATOM   3041 C CA    . GLU A 1 398 ? 5.633   -11.447 -2.600  1.00 38.06 ? 694  GLU A CA    1 
ATOM   3042 C C     . GLU A 1 398 ? 6.854   -12.024 -3.273  1.00 38.40 ? 694  GLU A C     1 
ATOM   3043 O O     . GLU A 1 398 ? 7.985   -11.626 -2.995  1.00 38.34 ? 694  GLU A O     1 
ATOM   3044 C CB    . GLU A 1 398 ? 5.151   -12.424 -1.563  1.00 38.09 ? 694  GLU A CB    1 
ATOM   3045 C CG    . GLU A 1 398 ? 5.800   -12.221 -0.250  1.00 38.52 ? 694  GLU A CG    1 
ATOM   3046 C CD    . GLU A 1 398 ? 5.306   -13.215 0.749   1.00 39.47 ? 694  GLU A CD    1 
ATOM   3047 O OE1   . GLU A 1 398 ? 4.858   -14.300 0.311   1.00 40.17 ? 694  GLU A OE1   1 
ATOM   3048 O OE2   . GLU A 1 398 ? 5.357   -12.920 1.966   1.00 39.82 ? 694  GLU A OE2   1 
ATOM   3049 N N     . ASP A 1 399 ? 6.616   -12.968 -4.171  1.00 38.85 ? 695  ASP A N     1 
ATOM   3050 C CA    . ASP A 1 399 ? 7.707   -13.654 -4.823  1.00 39.26 ? 695  ASP A CA    1 
ATOM   3051 C C     . ASP A 1 399 ? 8.593   -12.652 -5.516  1.00 39.49 ? 695  ASP A C     1 
ATOM   3052 O O     . ASP A 1 399 ? 9.819   -12.766 -5.458  1.00 39.69 ? 695  ASP A O     1 
ATOM   3053 C CB    . ASP A 1 399 ? 7.182   -14.658 -5.831  1.00 39.39 ? 695  ASP A CB    1 
ATOM   3054 C CG    . ASP A 1 399 ? 6.092   -15.521 -5.258  1.00 40.06 ? 695  ASP A CG    1 
ATOM   3055 O OD1   . ASP A 1 399 ? 6.176   -15.856 -4.054  1.00 40.60 ? 695  ASP A OD1   1 
ATOM   3056 O OD2   . ASP A 1 399 ? 5.142   -15.846 -6.004  1.00 41.47 ? 695  ASP A OD2   1 
ATOM   3057 N N     . GLU A 1 400 ? 7.978   -11.666 -6.162  1.00 39.61 ? 696  GLU A N     1 
ATOM   3058 C CA    . GLU A 1 400 ? 8.749   -10.640 -6.860  1.00 39.79 ? 696  GLU A CA    1 
ATOM   3059 C C     . GLU A 1 400 ? 9.584   -9.758  -5.928  1.00 39.56 ? 696  GLU A C     1 
ATOM   3060 O O     . GLU A 1 400 ? 10.715  -9.403  -6.278  1.00 39.61 ? 696  GLU A O     1 
ATOM   3061 C CB    . GLU A 1 400 ? 7.846   -9.766  -7.731  1.00 40.01 ? 696  GLU A CB    1 
ATOM   3062 C CG    . GLU A 1 400 ? 7.447   -10.425 -9.041  1.00 40.79 ? 696  GLU A CG    1 
ATOM   3063 C CD    . GLU A 1 400 ? 6.086   -11.111 -8.984  1.00 42.24 ? 696  GLU A CD    1 
ATOM   3064 O OE1   . GLU A 1 400 ? 5.552   -11.336 -7.871  1.00 42.69 ? 696  GLU A OE1   1 
ATOM   3065 O OE2   . GLU A 1 400 ? 5.554   -11.433 -10.070 1.00 42.73 ? 696  GLU A OE2   1 
ATOM   3066 N N     . VAL A 1 401 ? 9.040   -9.409  -4.758  1.00 39.18 ? 697  VAL A N     1 
ATOM   3067 C CA    . VAL A 1 401 ? 9.730   -8.493  -3.849  1.00 38.80 ? 697  VAL A CA    1 
ATOM   3068 C C     . VAL A 1 401 ? 11.101  -9.020  -3.509  1.00 38.47 ? 697  VAL A C     1 
ATOM   3069 O O     . VAL A 1 401 ? 11.259  -10.164 -3.105  1.00 38.32 ? 697  VAL A O     1 
ATOM   3070 C CB    . VAL A 1 401 ? 9.001   -8.279  -2.518  1.00 38.87 ? 697  VAL A CB    1 
ATOM   3071 C CG1   . VAL A 1 401 ? 9.888   -7.488  -1.555  1.00 38.43 ? 697  VAL A CG1   1 
ATOM   3072 C CG2   . VAL A 1 401 ? 7.675   -7.558  -2.740  1.00 38.97 ? 697  VAL A CG2   1 
ATOM   3073 N N     . THR A 1 402 ? 12.074  -8.138  -3.662  1.00 38.22 ? 698  THR A N     1 
ATOM   3074 C CA    . THR A 1 402 ? 13.474  -8.451  -3.494  1.00 38.01 ? 698  THR A CA    1 
ATOM   3075 C C     . THR A 1 402 ? 13.982  -7.622  -2.314  1.00 37.81 ? 698  THR A C     1 
ATOM   3076 O O     . THR A 1 402 ? 13.340  -6.652  -1.930  1.00 37.83 ? 698  THR A O     1 
ATOM   3077 C CB    . THR A 1 402 ? 14.264  -8.091  -4.785  1.00 38.11 ? 698  THR A CB    1 
ATOM   3078 O OG1   . THR A 1 402 ? 14.416  -6.669  -4.893  1.00 38.49 ? 698  THR A OG1   1 
ATOM   3079 C CG2   . THR A 1 402 ? 13.543  -8.597  -6.030  1.00 37.77 ? 698  THR A CG2   1 
ATOM   3080 N N     . PRO A 1 403 ? 15.133  -7.998  -1.732  1.00 37.72 ? 699  PRO A N     1 
ATOM   3081 C CA    . PRO A 1 403 ? 15.710  -7.258  -0.605  1.00 37.61 ? 699  PRO A CA    1 
ATOM   3082 C C     . PRO A 1 403 ? 15.840  -5.750  -0.809  1.00 37.47 ? 699  PRO A C     1 
ATOM   3083 O O     . PRO A 1 403 ? 15.536  -4.989  0.111   1.00 37.46 ? 699  PRO A O     1 
ATOM   3084 C CB    . PRO A 1 403 ? 17.096  -7.889  -0.456  1.00 37.69 ? 699  PRO A CB    1 
ATOM   3085 C CG    . PRO A 1 403 ? 16.894  -9.293  -0.872  1.00 37.78 ? 699  PRO A CG    1 
ATOM   3086 C CD    . PRO A 1 403 ? 15.861  -9.255  -1.977  1.00 37.87 ? 699  PRO A CD    1 
ATOM   3087 N N     . ASN A 1 404 ? 16.292  -5.321  -1.987  1.00 37.33 ? 700  ASN A N     1 
ATOM   3088 C CA    . ASN A 1 404 ? 16.410  -3.887  -2.261  1.00 37.31 ? 700  ASN A CA    1 
ATOM   3089 C C     . ASN A 1 404 ? 15.052  -3.210  -2.206  1.00 37.31 ? 700  ASN A C     1 
ATOM   3090 O O     . ASN A 1 404 ? 14.929  -2.119  -1.664  1.00 37.31 ? 700  ASN A O     1 
ATOM   3091 C CB    . ASN A 1 404 ? 17.050  -3.608  -3.621  1.00 37.37 ? 700  ASN A CB    1 
ATOM   3092 C CG    . ASN A 1 404 ? 17.614  -2.190  -3.715  1.00 37.72 ? 700  ASN A CG    1 
ATOM   3093 O OD1   . ASN A 1 404 ? 18.561  -1.834  -3.002  1.00 37.96 ? 700  ASN A OD1   1 
ATOM   3094 N ND2   . ASN A 1 404 ? 17.030  -1.376  -4.592  1.00 37.57 ? 700  ASN A ND2   1 
ATOM   3095 N N     . MET A 1 405 ? 14.046  -3.872  -2.774  1.00 37.36 ? 701  MET A N     1 
ATOM   3096 C CA    . MET A 1 405 ? 12.670  -3.370  -2.779  1.00 37.43 ? 701  MET A CA    1 
ATOM   3097 C C     . MET A 1 405 ? 12.118  -3.179  -1.365  1.00 37.42 ? 701  MET A C     1 
ATOM   3098 O O     . MET A 1 405 ? 11.448  -2.181  -1.079  1.00 37.63 ? 701  MET A O     1 
ATOM   3099 C CB    . MET A 1 405 ? 11.760  -4.331  -3.537  1.00 37.48 ? 701  MET A CB    1 
ATOM   3100 C CG    . MET A 1 405 ? 11.929  -4.299  -5.036  1.00 38.09 ? 701  MET A CG    1 
ATOM   3101 S SD    . MET A 1 405 ? 10.888  -5.546  -5.829  1.00 39.76 ? 701  MET A SD    1 
ATOM   3102 C CE    . MET A 1 405 ? 10.880  -4.964  -7.521  1.00 39.61 ? 701  MET A CE    1 
ATOM   3103 N N     . ARG A 1 406 ? 12.393  -4.142  -0.491  1.00 37.22 ? 702  ARG A N     1 
ATOM   3104 C CA    . ARG A 1 406 ? 11.944  -4.074  0.892   1.00 37.08 ? 702  ARG A CA    1 
ATOM   3105 C C     . ARG A 1 406 ? 12.629  -2.921  1.628   1.00 37.10 ? 702  ARG A C     1 
ATOM   3106 O O     . ARG A 1 406 ? 11.978  -2.166  2.349   1.00 37.08 ? 702  ARG A O     1 
ATOM   3107 C CB    . ARG A 1 406 ? 12.235  -5.387  1.603   1.00 37.05 ? 702  ARG A CB    1 
ATOM   3108 C CG    . ARG A 1 406 ? 11.456  -5.571  2.890   1.00 36.98 ? 702  ARG A CG    1 
ATOM   3109 C CD    . ARG A 1 406 ? 12.299  -6.268  3.923   1.00 36.84 ? 702  ARG A CD    1 
ATOM   3110 N NE    . ARG A 1 406 ? 11.492  -6.895  4.962   1.00 36.70 ? 702  ARG A NE    1 
ATOM   3111 C CZ    . ARG A 1 406 ? 11.549  -6.616  6.265   1.00 37.21 ? 702  ARG A CZ    1 
ATOM   3112 N NH1   . ARG A 1 406 ? 12.381  -5.706  6.761   1.00 37.04 ? 702  ARG A NH1   1 
ATOM   3113 N NH2   . ARG A 1 406 ? 10.761  -7.273  7.099   1.00 38.16 ? 702  ARG A NH2   1 
ATOM   3114 N N     . ARG A 1 407 ? 13.941  -2.794  1.440   1.00 37.04 ? 703  ARG A N     1 
ATOM   3115 C CA    . ARG A 1 407 ? 14.715  -1.688  2.022   1.00 37.09 ? 703  ARG A CA    1 
ATOM   3116 C C     . ARG A 1 407 ? 14.115  -0.322  1.682   1.00 36.68 ? 703  ARG A C     1 
ATOM   3117 O O     . ARG A 1 407 ? 14.103  0.591   2.510   1.00 36.69 ? 703  ARG A O     1 
ATOM   3118 C CB    . ARG A 1 407 ? 16.179  -1.739  1.552   1.00 37.34 ? 703  ARG A CB    1 
ATOM   3119 C CG    . ARG A 1 407 ? 16.790  -0.364  1.228   1.00 38.42 ? 703  ARG A CG    1 
ATOM   3120 C CD    . ARG A 1 407 ? 18.275  -0.436  0.922   1.00 39.78 ? 703  ARG A CD    1 
ATOM   3121 N NE    . ARG A 1 407 ? 18.602  0.245   -0.338  1.00 40.86 ? 703  ARG A NE    1 
ATOM   3122 C CZ    . ARG A 1 407 ? 18.663  1.567   -0.509  1.00 41.43 ? 703  ARG A CZ    1 
ATOM   3123 N NH1   . ARG A 1 407 ? 18.418  2.399   0.504   1.00 41.61 ? 703  ARG A NH1   1 
ATOM   3124 N NH2   . ARG A 1 407 ? 18.970  2.063   -1.709  1.00 41.27 ? 703  ARG A NH2   1 
ATOM   3125 N N     . GLN A 1 408 ? 13.644  -0.192  0.451   1.00 36.28 ? 704  GLN A N     1 
ATOM   3126 C CA    . GLN A 1 408 ? 13.095  1.068   -0.037  1.00 36.13 ? 704  GLN A CA    1 
ATOM   3127 C C     . GLN A 1 408 ? 11.711  1.308   0.530   1.00 35.72 ? 704  GLN A C     1 
ATOM   3128 O O     . GLN A 1 408 ? 11.431  2.379   1.063   1.00 35.76 ? 704  GLN A O     1 
ATOM   3129 C CB    . GLN A 1 408 ? 13.008  1.067   -1.560  1.00 36.30 ? 704  GLN A CB    1 
ATOM   3130 C CG    . GLN A 1 408 ? 14.317  0.756   -2.250  1.00 36.69 ? 704  GLN A CG    1 
ATOM   3131 C CD    . GLN A 1 408 ? 14.302  1.147   -3.697  1.00 37.16 ? 704  GLN A CD    1 
ATOM   3132 O OE1   . GLN A 1 408 ? 13.235  1.304   -4.298  1.00 37.00 ? 704  GLN A OE1   1 
ATOM   3133 N NE2   . GLN A 1 408 ? 15.489  1.316   -4.276  1.00 37.27 ? 704  GLN A NE2   1 
ATOM   3134 N N     . ALA A 1 409 ? 10.847  0.305   0.400   1.00 35.21 ? 705  ALA A N     1 
ATOM   3135 C CA    . ALA A 1 409 ? 9.498   0.362   0.967   1.00 34.82 ? 705  ALA A CA    1 
ATOM   3136 C C     . ALA A 1 409 ? 9.543   0.697   2.461   1.00 34.40 ? 705  ALA A C     1 
ATOM   3137 O O     . ALA A 1 409 ? 8.667   1.383   2.984   1.00 34.21 ? 705  ALA A O     1 
ATOM   3138 C CB    . ALA A 1 409 ? 8.768   -0.960  0.741   1.00 34.84 ? 705  ALA A CB    1 
ATOM   3139 N N     . LYS A 1 410 ? 10.576  0.201   3.133   1.00 33.97 ? 706  LYS A N     1 
ATOM   3140 C CA    . LYS A 1 410 ? 10.822  0.500   4.537   1.00 33.69 ? 706  LYS A CA    1 
ATOM   3141 C C     . LYS A 1 410 ? 11.137  1.980   4.737   1.00 33.42 ? 706  LYS A C     1 
ATOM   3142 O O     . LYS A 1 410 ? 10.607  2.628   5.640   1.00 33.44 ? 706  LYS A O     1 
ATOM   3143 C CB    . LYS A 1 410 ? 11.981  -0.361  5.042   1.00 33.65 ? 706  LYS A CB    1 
ATOM   3144 C CG    . LYS A 1 410 ? 12.483  -0.023  6.430   1.00 33.92 ? 706  LYS A CG    1 
ATOM   3145 C CD    . LYS A 1 410 ? 13.588  -0.979  6.850   1.00 34.37 ? 706  LYS A CD    1 
ATOM   3146 C CE    . LYS A 1 410 ? 13.453  -1.378  8.306   1.00 34.69 ? 706  LYS A CE    1 
ATOM   3147 N NZ    . LYS A 1 410 ? 14.493  -2.363  8.719   1.00 34.60 ? 706  LYS A NZ    1 
ATOM   3148 N N     . ALA A 1 411 ? 12.012  2.512   3.896   1.00 33.08 ? 707  ALA A N     1 
ATOM   3149 C CA    . ALA A 1 411 ? 12.375  3.916   3.994   1.00 32.79 ? 707  ALA A CA    1 
ATOM   3150 C C     . ALA A 1 411 ? 11.117  4.764   3.929   1.00 32.52 ? 707  ALA A C     1 
ATOM   3151 O O     . ALA A 1 411 ? 10.901  5.618   4.772   1.00 32.28 ? 707  ALA A O     1 
ATOM   3152 C CB    . ALA A 1 411 ? 13.341  4.301   2.894   1.00 32.75 ? 707  ALA A CB    1 
ATOM   3153 N N     . VAL A 1 412 ? 10.270  4.497   2.947   1.00 32.58 ? 708  VAL A N     1 
ATOM   3154 C CA    . VAL A 1 412 ? 9.039   5.259   2.799   1.00 32.81 ? 708  VAL A CA    1 
ATOM   3155 C C     . VAL A 1 412 ? 8.234   5.168   4.084   1.00 33.23 ? 708  VAL A C     1 
ATOM   3156 O O     . VAL A 1 412 ? 7.725   6.172   4.562   1.00 33.26 ? 708  VAL A O     1 
ATOM   3157 C CB    . VAL A 1 412 ? 8.155   4.772   1.634   1.00 32.66 ? 708  VAL A CB    1 
ATOM   3158 C CG1   . VAL A 1 412 ? 7.063   5.781   1.365   1.00 32.48 ? 708  VAL A CG1   1 
ATOM   3159 C CG2   . VAL A 1 412 ? 8.974   4.575   0.376   1.00 32.89 ? 708  VAL A CG2   1 
ATOM   3160 N N     . ASN A 1 413 ? 8.141   3.968   4.652   1.00 33.77 ? 709  ASN A N     1 
ATOM   3161 C CA    . ASN A 1 413 ? 7.397   3.770   5.900   1.00 34.08 ? 709  ASN A CA    1 
ATOM   3162 C C     . ASN A 1 413 ? 7.942   4.649   7.018   1.00 34.63 ? 709  ASN A C     1 
ATOM   3163 O O     . ASN A 1 413 ? 7.183   5.351   7.681   1.00 34.81 ? 709  ASN A O     1 
ATOM   3164 C CB    . ASN A 1 413 ? 7.400   2.296   6.328   1.00 34.01 ? 709  ASN A CB    1 
ATOM   3165 C CG    . ASN A 1 413 ? 6.314   1.475   5.635   1.00 33.86 ? 709  ASN A CG    1 
ATOM   3166 O OD1   . ASN A 1 413 ? 5.199   1.956   5.401   1.00 33.21 ? 709  ASN A OD1   1 
ATOM   3167 N ND2   . ASN A 1 413 ? 6.636   0.223   5.315   1.00 33.48 ? 709  ASN A ND2   1 
ATOM   3168 N N     . PHE A 1 414 ? 9.257   4.638   7.207   1.00 35.22 ? 710  PHE A N     1 
ATOM   3169 C CA    . PHE A 1 414 ? 9.878   5.474   8.240   1.00 35.76 ? 710  PHE A CA    1 
ATOM   3170 C C     . PHE A 1 414 ? 9.802   6.942   7.884   1.00 35.69 ? 710  PHE A C     1 
ATOM   3171 O O     . PHE A 1 414 ? 9.647   7.783   8.760   1.00 35.78 ? 710  PHE A O     1 
ATOM   3172 C CB    . PHE A 1 414 ? 11.319  5.043   8.493   1.00 36.04 ? 710  PHE A CB    1 
ATOM   3173 C CG    . PHE A 1 414 ? 11.439  3.811   9.365   1.00 38.04 ? 710  PHE A CG    1 
ATOM   3174 C CD1   . PHE A 1 414 ? 10.322  3.004   9.647   1.00 39.40 ? 710  PHE A CD1   1 
ATOM   3175 C CD2   . PHE A 1 414 ? 12.673  3.437   9.889   1.00 40.06 ? 710  PHE A CD2   1 
ATOM   3176 C CE1   . PHE A 1 414 ? 10.430  1.865   10.449  1.00 39.60 ? 710  PHE A CE1   1 
ATOM   3177 C CE2   . PHE A 1 414 ? 12.790  2.289   10.692  1.00 40.77 ? 710  PHE A CE2   1 
ATOM   3178 C CZ    . PHE A 1 414 ? 11.659  1.504   10.969  1.00 40.39 ? 710  PHE A CZ    1 
ATOM   3179 N N     . GLY A 1 415 ? 9.895   7.248   6.599   1.00 35.76 ? 711  GLY A N     1 
ATOM   3180 C CA    . GLY A 1 415 ? 9.638   8.598   6.131   1.00 35.88 ? 711  GLY A CA    1 
ATOM   3181 C C     . GLY A 1 415 ? 8.216   8.995   6.446   1.00 36.10 ? 711  GLY A C     1 
ATOM   3182 O O     . GLY A 1 415 ? 7.991   9.983   7.134   1.00 36.22 ? 711  GLY A O     1 
ATOM   3183 N N     . ILE A 1 416 ? 7.260   8.196   5.978   1.00 36.22 ? 712  ILE A N     1 
ATOM   3184 C CA    . ILE A 1 416 ? 5.831   8.458   6.200   1.00 36.45 ? 712  ILE A CA    1 
ATOM   3185 C C     . ILE A 1 416 ? 5.540   8.737   7.680   1.00 36.71 ? 712  ILE A C     1 
ATOM   3186 O O     . ILE A 1 416 ? 4.742   9.623   8.012   1.00 36.97 ? 712  ILE A O     1 
ATOM   3187 C CB    . ILE A 1 416 ? 4.941   7.282   5.698   1.00 36.49 ? 712  ILE A CB    1 
ATOM   3188 C CG1   . ILE A 1 416 ? 4.917   7.242   4.161   1.00 36.53 ? 712  ILE A CG1   1 
ATOM   3189 C CG2   . ILE A 1 416 ? 3.520   7.400   6.239   1.00 36.01 ? 712  ILE A CG2   1 
ATOM   3190 C CD1   . ILE A 1 416 ? 3.988   8.252   3.523   1.00 36.04 ? 712  ILE A CD1   1 
ATOM   3191 N N     . VAL A 1 417 ? 6.202   7.984   8.556   1.00 36.78 ? 713  VAL A N     1 
ATOM   3192 C CA    . VAL A 1 417 ? 6.109   8.195   10.003  1.00 37.09 ? 713  VAL A CA    1 
ATOM   3193 C C     . VAL A 1 417 ? 6.786   9.487   10.471  1.00 37.44 ? 713  VAL A C     1 
ATOM   3194 O O     . VAL A 1 417 ? 6.300   10.145  11.389  1.00 37.30 ? 713  VAL A O     1 
ATOM   3195 C CB    . VAL A 1 417 ? 6.758   7.027   10.775  1.00 37.13 ? 713  VAL A CB    1 
ATOM   3196 C CG1   . VAL A 1 417 ? 7.177   7.467   12.178  1.00 37.20 ? 713  VAL A CG1   1 
ATOM   3197 C CG2   . VAL A 1 417 ? 5.815   5.840   10.843  1.00 37.65 ? 713  VAL A CG2   1 
ATOM   3198 N N     . TYR A 1 418 ? 7.915   9.829   9.846   1.00 38.00 ? 714  TYR A N     1 
ATOM   3199 C CA    . TYR A 1 418 ? 8.734   10.991  10.243  1.00 38.28 ? 714  TYR A CA    1 
ATOM   3200 C C     . TYR A 1 418 ? 8.335   12.313  9.590   1.00 38.27 ? 714  TYR A C     1 
ATOM   3201 O O     . TYR A 1 418 ? 9.142   13.256  9.553   1.00 38.29 ? 714  TYR A O     1 
ATOM   3202 C CB    . TYR A 1 418 ? 10.208  10.743  9.908   1.00 38.44 ? 714  TYR A CB    1 
ATOM   3203 C CG    . TYR A 1 418 ? 10.856  9.578   10.611  1.00 39.33 ? 714  TYR A CG    1 
ATOM   3204 C CD1   . TYR A 1 418 ? 10.281  8.989   11.738  1.00 40.48 ? 714  TYR A CD1   1 
ATOM   3205 C CD2   . TYR A 1 418 ? 12.076  9.080   10.156  1.00 40.36 ? 714  TYR A CD2   1 
ATOM   3206 C CE1   . TYR A 1 418 ? 10.895  7.919   12.379  1.00 41.53 ? 714  TYR A CE1   1 
ATOM   3207 C CE2   . TYR A 1 418 ? 12.701  8.016   10.785  1.00 41.26 ? 714  TYR A CE2   1 
ATOM   3208 C CZ    . TYR A 1 418 ? 12.111  7.435   11.898  1.00 41.96 ? 714  TYR A CZ    1 
ATOM   3209 O OH    . TYR A 1 418 ? 12.744  6.378   12.526  1.00 42.52 ? 714  TYR A OH    1 
ATOM   3210 N N     . GLY A 1 419 ? 7.108   12.397  9.085   1.00 38.17 ? 715  GLY A N     1 
ATOM   3211 C CA    . GLY A 1 419 ? 6.732   13.525  8.245   1.00 38.23 ? 715  GLY A CA    1 
ATOM   3212 C C     . GLY A 1 419 ? 7.248   13.166  6.865   1.00 38.34 ? 715  GLY A C     1 
ATOM   3213 O O     . GLY A 1 419 ? 8.086   12.274  6.727   1.00 38.70 ? 715  GLY A O     1 
ATOM   3214 N N     . ILE A 1 420 ? 6.779   13.853  5.836   1.00 38.28 ? 716  ILE A N     1 
ATOM   3215 C CA    . ILE A 1 420 ? 7.012   13.400  4.462   1.00 38.27 ? 716  ILE A CA    1 
ATOM   3216 C C     . ILE A 1 420 ? 7.829   14.361  3.639   1.00 38.38 ? 716  ILE A C     1 
ATOM   3217 O O     . ILE A 1 420 ? 7.310   15.389  3.184   1.00 38.59 ? 716  ILE A O     1 
ATOM   3218 C CB    . ILE A 1 420 ? 5.679   13.282  3.717   1.00 38.27 ? 716  ILE A CB    1 
ATOM   3219 C CG1   . ILE A 1 420 ? 5.017   11.946  4.018   1.00 38.44 ? 716  ILE A CG1   1 
ATOM   3220 C CG2   . ILE A 1 420 ? 5.872   13.428  2.204   1.00 38.08 ? 716  ILE A CG2   1 
ATOM   3221 C CD1   . ILE A 1 420 ? 4.306   11.363  2.822   1.00 38.32 ? 716  ILE A CD1   1 
ATOM   3222 N N     . SER A 1 421 ? 9.083   14.033  3.386   1.00 38.32 ? 717  SER A N     1 
ATOM   3223 C CA    . SER A 1 421 ? 9.903   14.948  2.623   1.00 38.21 ? 717  SER A CA    1 
ATOM   3224 C C     . SER A 1 421 ? 10.497  14.234  1.436   1.00 38.23 ? 717  SER A C     1 
ATOM   3225 O O     . SER A 1 421 ? 11.135  13.196  1.598   1.00 38.31 ? 717  SER A O     1 
ATOM   3226 C CB    . SER A 1 421 ? 10.987  15.496  3.534   1.00 38.22 ? 717  SER A CB    1 
ATOM   3227 O OG    . SER A 1 421 ? 11.042  14.725  4.726   1.00 38.16 ? 717  SER A OG    1 
ATOM   3228 N N     . ASP A 1 422 ? 10.286  14.777  0.244   1.00 38.20 ? 718  ASP A N     1 
ATOM   3229 C CA    . ASP A 1 422 ? 10.916  14.204  -0.939  1.00 38.21 ? 718  ASP A CA    1 
ATOM   3230 C C     . ASP A 1 422 ? 12.403  14.357  -0.727  1.00 38.05 ? 718  ASP A C     1 
ATOM   3231 O O     . ASP A 1 422 ? 13.168  13.412  -0.913  1.00 38.17 ? 718  ASP A O     1 
ATOM   3232 C CB    . ASP A 1 422 ? 10.510  14.929  -2.212  1.00 38.36 ? 718  ASP A CB    1 
ATOM   3233 C CG    . ASP A 1 422 ? 9.087   15.427  -2.172  1.00 39.20 ? 718  ASP A CG    1 
ATOM   3234 O OD1   . ASP A 1 422 ? 8.384   15.155  -1.167  1.00 40.90 ? 718  ASP A OD1   1 
ATOM   3235 O OD2   . ASP A 1 422 ? 8.673   16.102  -3.139  1.00 39.78 ? 718  ASP A OD2   1 
ATOM   3236 N N     . TYR A 1 423 ? 12.799  15.558  -0.312  1.00 37.82 ? 719  TYR A N     1 
ATOM   3237 C CA    . TYR A 1 423 ? 14.188  15.829  0.053   1.00 37.67 ? 719  TYR A CA    1 
ATOM   3238 C C     . TYR A 1 423 ? 14.727  14.722  0.972   1.00 37.56 ? 719  TYR A C     1 
ATOM   3239 O O     . TYR A 1 423 ? 15.787  14.152  0.705   1.00 37.52 ? 719  TYR A O     1 
ATOM   3240 C CB    . TYR A 1 423 ? 14.312  17.207  0.720   1.00 37.49 ? 719  TYR A CB    1 
ATOM   3241 N N     . GLY A 1 424 ? 13.965  14.408  2.020   1.00 37.45 ? 720  GLY A N     1 
ATOM   3242 C CA    . GLY A 1 424 ? 14.336  13.396  3.021   1.00 37.37 ? 720  GLY A CA    1 
ATOM   3243 C C     . GLY A 1 424 ? 14.398  11.985  2.462   1.00 37.34 ? 720  GLY A C     1 
ATOM   3244 O O     . GLY A 1 424 ? 15.381  11.275  2.671   1.00 37.38 ? 720  GLY A O     1 
ATOM   3245 N N     . LEU A 1 425 ? 13.352  11.594  1.738   1.00 37.31 ? 721  LEU A N     1 
ATOM   3246 C CA    . LEU A 1 425 ? 13.261  10.266  1.119   1.00 37.29 ? 721  LEU A CA    1 
ATOM   3247 C C     . LEU A 1 425 ? 14.315  10.070  0.031   1.00 37.42 ? 721  LEU A C     1 
ATOM   3248 O O     . LEU A 1 425 ? 14.916  8.999   -0.090  1.00 37.48 ? 721  LEU A O     1 
ATOM   3249 C CB    . LEU A 1 425 ? 11.874  10.073  0.504   1.00 37.24 ? 721  LEU A CB    1 
ATOM   3250 C CG    . LEU A 1 425 ? 11.579  8.708   -0.110  1.00 37.32 ? 721  LEU A CG    1 
ATOM   3251 C CD1   . LEU A 1 425 ? 11.987  7.579   0.821   1.00 37.67 ? 721  LEU A CD1   1 
ATOM   3252 C CD2   . LEU A 1 425 ? 10.108  8.627   -0.446  1.00 37.37 ? 721  LEU A CD2   1 
ATOM   3253 N N     . ALA A 1 426 ? 14.497  11.105  -0.781  1.00 37.52 ? 722  ALA A N     1 
ATOM   3254 C CA    . ALA A 1 426 ? 15.537  11.132  -1.809  1.00 37.62 ? 722  ALA A CA    1 
ATOM   3255 C C     . ALA A 1 426 ? 16.940  11.092  -1.192  1.00 37.75 ? 722  ALA A C     1 
ATOM   3256 O O     . ALA A 1 426 ? 17.794  10.305  -1.613  1.00 37.52 ? 722  ALA A O     1 
ATOM   3257 C CB    . ALA A 1 426 ? 15.377  12.374  -2.684  1.00 37.65 ? 722  ALA A CB    1 
ATOM   3258 N N     . GLN A 1 427 ? 17.169  11.950  -0.201  1.00 38.00 ? 723  GLN A N     1 
ATOM   3259 C CA    . GLN A 1 427 ? 18.434  11.961  0.542   1.00 38.33 ? 723  GLN A CA    1 
ATOM   3260 C C     . GLN A 1 427 ? 18.700  10.588  1.132   1.00 38.31 ? 723  GLN A C     1 
ATOM   3261 O O     . GLN A 1 427 ? 19.835  10.091  1.117   1.00 38.29 ? 723  GLN A O     1 
ATOM   3262 C CB    . GLN A 1 427 ? 18.402  13.009  1.672   1.00 38.57 ? 723  GLN A CB    1 
ATOM   3263 C CG    . GLN A 1 427 ? 19.414  12.795  2.834   1.00 39.46 ? 723  GLN A CG    1 
ATOM   3264 C CD    . GLN A 1 427 ? 20.890  12.928  2.421   1.00 40.46 ? 723  GLN A CD    1 
ATOM   3265 O OE1   . GLN A 1 427 ? 21.225  12.927  1.231   1.00 40.67 ? 723  GLN A OE1   1 
ATOM   3266 N NE2   . GLN A 1 427 ? 21.777  13.032  3.420   1.00 40.42 ? 723  GLN A NE2   1 
ATOM   3267 N N     . ASN A 1 428 ? 17.645  9.991   1.670   1.00 38.28 ? 724  ASN A N     1 
ATOM   3268 C CA    . ASN A 1 428 ? 17.773  8.708   2.329   1.00 38.42 ? 724  ASN A CA    1 
ATOM   3269 C C     . ASN A 1 428 ? 18.076  7.575   1.355   1.00 38.28 ? 724  ASN A C     1 
ATOM   3270 O O     . ASN A 1 428 ? 18.994  6.797   1.587   1.00 38.54 ? 724  ASN A O     1 
ATOM   3271 C CB    . ASN A 1 428 ? 16.526  8.386   3.135   1.00 38.58 ? 724  ASN A CB    1 
ATOM   3272 C CG    . ASN A 1 428 ? 16.806  7.399   4.234   1.00 39.26 ? 724  ASN A CG    1 
ATOM   3273 O OD1   . ASN A 1 428 ? 17.237  6.269   3.981   1.00 39.39 ? 724  ASN A OD1   1 
ATOM   3274 N ND2   . ASN A 1 428 ? 16.592  7.826   5.471   1.00 40.44 ? 724  ASN A ND2   1 
ATOM   3275 N N     . LEU A 1 429 ? 17.313  7.494   0.267   1.00 38.13 ? 725  LEU A N     1 
ATOM   3276 C CA    . LEU A 1 429 ? 17.495  6.438   -0.742  1.00 38.02 ? 725  LEU A CA    1 
ATOM   3277 C C     . LEU A 1 429 ? 18.532  6.790   -1.813  1.00 38.03 ? 725  LEU A C     1 
ATOM   3278 O O     . LEU A 1 429 ? 18.747  6.017   -2.756  1.00 38.00 ? 725  LEU A O     1 
ATOM   3279 C CB    . LEU A 1 429 ? 16.161  6.119   -1.424  1.00 37.87 ? 725  LEU A CB    1 
ATOM   3280 C CG    . LEU A 1 429 ? 15.152  5.403   -0.542  1.00 37.85 ? 725  LEU A CG    1 
ATOM   3281 C CD1   . LEU A 1 429 ? 13.842  5.227   -1.296  1.00 38.12 ? 725  LEU A CD1   1 
ATOM   3282 C CD2   . LEU A 1 429 ? 15.715  4.066   -0.101  1.00 37.67 ? 725  LEU A CD2   1 
ATOM   3283 N N     . ASN A 1 430 ? 19.173  7.947   -1.671  1.00 37.96 ? 726  ASN A N     1 
ATOM   3284 C CA    . ASN A 1 430 ? 20.110  8.419   -2.676  1.00 37.96 ? 726  ASN A CA    1 
ATOM   3285 C C     . ASN A 1 430 ? 19.419  8.441   -4.036  1.00 37.74 ? 726  ASN A C     1 
ATOM   3286 O O     . ASN A 1 430 ? 19.748  7.660   -4.925  1.00 37.62 ? 726  ASN A O     1 
ATOM   3287 C CB    . ASN A 1 430 ? 21.368  7.531   -2.697  1.00 38.02 ? 726  ASN A CB    1 
ATOM   3288 C CG    . ASN A 1 430 ? 22.352  7.923   -3.793  1.00 38.41 ? 726  ASN A CG    1 
ATOM   3289 O OD1   . ASN A 1 430 ? 22.416  9.087   -4.201  1.00 38.81 ? 726  ASN A OD1   1 
ATOM   3290 N ND2   . ASN A 1 430 ? 23.117  6.947   -4.281  1.00 38.65 ? 726  ASN A ND2   1 
ATOM   3291 N N     . ILE A 1 431 ? 18.428  9.312   -4.176  1.00 37.74 ? 727  ILE A N     1 
ATOM   3292 C CA    . ILE A 1 431 ? 17.757  9.495   -5.467  1.00 37.95 ? 727  ILE A CA    1 
ATOM   3293 C C     . ILE A 1 431 ? 17.280  10.946  -5.662  1.00 37.96 ? 727  ILE A C     1 
ATOM   3294 O O     . ILE A 1 431 ? 17.322  11.757  -4.734  1.00 38.04 ? 727  ILE A O     1 
ATOM   3295 C CB    . ILE A 1 431 ? 16.586  8.476   -5.661  1.00 38.10 ? 727  ILE A CB    1 
ATOM   3296 C CG1   . ILE A 1 431 ? 15.356  8.865   -4.843  1.00 38.45 ? 727  ILE A CG1   1 
ATOM   3297 C CG2   . ILE A 1 431 ? 17.020  7.055   -5.283  1.00 37.98 ? 727  ILE A CG2   1 
ATOM   3298 C CD1   . ILE A 1 431 ? 14.372  7.721   -4.670  1.00 39.10 ? 727  ILE A CD1   1 
ATOM   3299 N N     . SER A 1 432 ? 16.846  11.267  -6.879  1.00 37.96 ? 728  SER A N     1 
ATOM   3300 C CA    . SER A 1 432 ? 16.379  12.622  -7.206  1.00 37.92 ? 728  SER A CA    1 
ATOM   3301 C C     . SER A 1 432 ? 15.004  12.887  -6.583  1.00 37.94 ? 728  SER A C     1 
ATOM   3302 O O     . SER A 1 432 ? 14.162  11.984  -6.498  1.00 37.91 ? 728  SER A O     1 
ATOM   3303 C CB    . SER A 1 432 ? 16.286  12.811  -8.722  1.00 37.95 ? 728  SER A CB    1 
ATOM   3304 O OG    . SER A 1 432 ? 15.037  12.340  -9.212  1.00 38.10 ? 728  SER A OG    1 
ATOM   3305 N N     . ARG A 1 433 ? 14.774  14.131  -6.163  1.00 37.87 ? 729  ARG A N     1 
ATOM   3306 C CA    . ARG A 1 433 ? 13.482  14.528  -5.569  1.00 37.62 ? 729  ARG A CA    1 
ATOM   3307 C C     . ARG A 1 433 ? 12.297  14.033  -6.401  1.00 37.34 ? 729  ARG A C     1 
ATOM   3308 O O     . ARG A 1 433 ? 11.385  13.416  -5.865  1.00 37.40 ? 729  ARG A O     1 
ATOM   3309 C CB    . ARG A 1 433 ? 13.400  16.050  -5.382  1.00 37.55 ? 729  ARG A CB    1 
ATOM   3310 N N     . LYS A 1 434 ? 12.332  14.278  -7.710  1.00 37.20 ? 730  LYS A N     1 
ATOM   3311 C CA    . LYS A 1 434 ? 11.265  13.828  -8.618  1.00 37.21 ? 730  LYS A CA    1 
ATOM   3312 C C     . LYS A 1 434 ? 10.929  12.346  -8.416  1.00 37.22 ? 730  LYS A C     1 
ATOM   3313 O O     . LYS A 1 434 ? 9.779   11.941  -8.574  1.00 37.18 ? 730  LYS A O     1 
ATOM   3314 C CB    . LYS A 1 434 ? 11.656  14.080  -10.081 1.00 37.06 ? 730  LYS A CB    1 
ATOM   3315 N N     . GLU A 1 435 ? 11.938  11.553  -8.062  1.00 37.27 ? 731  GLU A N     1 
ATOM   3316 C CA    . GLU A 1 435 ? 11.737  10.138  -7.739  1.00 37.49 ? 731  GLU A CA    1 
ATOM   3317 C C     . GLU A 1 435 ? 10.987  9.953   -6.418  1.00 37.22 ? 731  GLU A C     1 
ATOM   3318 O O     . GLU A 1 435 ? 9.873   9.443   -6.398  1.00 37.11 ? 731  GLU A O     1 
ATOM   3319 C CB    . GLU A 1 435 ? 13.072  9.380   -7.710  1.00 37.82 ? 731  GLU A CB    1 
ATOM   3320 C CG    . GLU A 1 435 ? 13.442  8.727   -9.049  1.00 39.01 ? 731  GLU A CG    1 
ATOM   3321 C CD    . GLU A 1 435 ? 14.887  8.973   -9.481  1.00 40.93 ? 731  GLU A CD    1 
ATOM   3322 O OE1   . GLU A 1 435 ? 15.633  9.697   -8.776  1.00 41.82 ? 731  GLU A OE1   1 
ATOM   3323 O OE2   . GLU A 1 435 ? 15.271  8.438   -10.547 1.00 42.29 ? 731  GLU A OE2   1 
ATOM   3324 N N     . ALA A 1 436 ? 11.597  10.367  -5.313  1.00 36.98 ? 732  ALA A N     1 
ATOM   3325 C CA    . ALA A 1 436 ? 10.966  10.235  -3.995  1.00 36.88 ? 732  ALA A CA    1 
ATOM   3326 C C     . ALA A 1 436 ? 9.479   10.602  -4.040  1.00 36.87 ? 732  ALA A C     1 
ATOM   3327 O O     . ALA A 1 436 ? 8.641   9.923   -3.450  1.00 36.89 ? 732  ALA A O     1 
ATOM   3328 C CB    . ALA A 1 436 ? 11.689  11.100  -2.986  1.00 36.94 ? 732  ALA A CB    1 
ATOM   3329 N N     . ALA A 1 437 ? 9.169   11.680  -4.753  1.00 36.98 ? 733  ALA A N     1 
ATOM   3330 C CA    . ALA A 1 437 ? 7.788   12.115  -4.956  1.00 37.20 ? 733  ALA A CA    1 
ATOM   3331 C C     . ALA A 1 437 ? 6.907   11.052  -5.631  1.00 37.37 ? 733  ALA A C     1 
ATOM   3332 O O     . ALA A 1 437 ? 5.789   10.811  -5.183  1.00 37.54 ? 733  ALA A O     1 
ATOM   3333 C CB    . ALA A 1 437 ? 7.762   13.403  -5.758  1.00 37.27 ? 733  ALA A CB    1 
ATOM   3334 N N     . GLU A 1 438 ? 7.400   10.431  -6.704  1.00 37.62 ? 734  GLU A N     1 
ATOM   3335 C CA    . GLU A 1 438 ? 6.637   9.362   -7.403  1.00 37.88 ? 734  GLU A CA    1 
ATOM   3336 C C     . GLU A 1 438 ? 6.353   8.188   -6.461  1.00 37.66 ? 734  GLU A C     1 
ATOM   3337 O O     . GLU A 1 438 ? 5.297   7.559   -6.551  1.00 37.69 ? 734  GLU A O     1 
ATOM   3338 C CB    . GLU A 1 438 ? 7.328   8.859   -8.697  1.00 38.11 ? 734  GLU A CB    1 
ATOM   3339 C CG    . GLU A 1 438 ? 8.854   8.871   -8.651  1.00 39.55 ? 734  GLU A CG    1 
ATOM   3340 C CD    . GLU A 1 438 ? 9.556   8.076   -9.751  1.00 41.52 ? 734  GLU A CD    1 
ATOM   3341 O OE1   . GLU A 1 438 ? 9.662   8.594   -10.886 1.00 42.48 ? 734  GLU A OE1   1 
ATOM   3342 O OE2   . GLU A 1 438 ? 10.047  6.952   -9.467  1.00 42.41 ? 734  GLU A OE2   1 
ATOM   3343 N N     . PHE A 1 439 ? 7.300   7.907   -5.567  1.00 37.36 ? 735  PHE A N     1 
ATOM   3344 C CA    . PHE A 1 439 ? 7.137   6.870   -4.540  1.00 37.13 ? 735  PHE A CA    1 
ATOM   3345 C C     . PHE A 1 439 ? 6.045   7.232   -3.567  1.00 36.73 ? 735  PHE A C     1 
ATOM   3346 O O     . PHE A 1 439 ? 5.141   6.444   -3.304  1.00 36.49 ? 735  PHE A O     1 
ATOM   3347 C CB    . PHE A 1 439 ? 8.426   6.699   -3.742  1.00 37.25 ? 735  PHE A CB    1 
ATOM   3348 C CG    . PHE A 1 439 ? 9.217   5.518   -4.141  1.00 37.81 ? 735  PHE A CG    1 
ATOM   3349 C CD1   . PHE A 1 439 ? 9.828   5.476   -5.380  1.00 38.90 ? 735  PHE A CD1   1 
ATOM   3350 C CD2   . PHE A 1 439 ? 9.354   4.443   -3.278  1.00 38.36 ? 735  PHE A CD2   1 
ATOM   3351 C CE1   . PHE A 1 439 ? 10.569  4.380   -5.757  1.00 39.97 ? 735  PHE A CE1   1 
ATOM   3352 C CE2   . PHE A 1 439 ? 10.092  3.344   -3.641  1.00 39.31 ? 735  PHE A CE2   1 
ATOM   3353 C CZ    . PHE A 1 439 ? 10.706  3.308   -4.882  1.00 40.06 ? 735  PHE A CZ    1 
ATOM   3354 N N     . ILE A 1 440 ? 6.185   8.432   -3.016  1.00 36.50 ? 736  ILE A N     1 
ATOM   3355 C CA    . ILE A 1 440 ? 5.240   9.003   -2.072  1.00 36.54 ? 736  ILE A CA    1 
ATOM   3356 C C     . ILE A 1 440 ? 3.838   9.108   -2.687  1.00 36.60 ? 736  ILE A C     1 
ATOM   3357 O O     . ILE A 1 440 ? 2.831   8.799   -2.038  1.00 36.46 ? 736  ILE A O     1 
ATOM   3358 C CB    . ILE A 1 440 ? 5.739   10.392  -1.615  1.00 36.52 ? 736  ILE A CB    1 
ATOM   3359 C CG1   . ILE A 1 440 ? 6.817   10.232  -0.541  1.00 36.79 ? 736  ILE A CG1   1 
ATOM   3360 C CG2   . ILE A 1 440 ? 4.602   11.235  -1.086  1.00 36.76 ? 736  ILE A CG2   1 
ATOM   3361 C CD1   . ILE A 1 440 ? 7.553   11.522  -0.217  1.00 37.50 ? 736  ILE A CD1   1 
ATOM   3362 N N     . GLU A 1 441 ? 3.791   9.541   -3.944  1.00 36.68 ? 737  GLU A N     1 
ATOM   3363 C CA    . GLU A 1 441 ? 2.540   9.638   -4.691  1.00 36.81 ? 737  GLU A CA    1 
ATOM   3364 C C     . GLU A 1 441 ? 1.874   8.274   -4.815  1.00 37.12 ? 737  GLU A C     1 
ATOM   3365 O O     . GLU A 1 441 ? 0.678   8.143   -4.559  1.00 37.06 ? 737  GLU A O     1 
ATOM   3366 C CB    . GLU A 1 441 ? 2.789   10.218  -6.084  1.00 36.70 ? 737  GLU A CB    1 
ATOM   3367 N N     . ARG A 1 442 ? 2.654   7.267   -5.209  1.00 37.64 ? 738  ARG A N     1 
ATOM   3368 C CA    . ARG A 1 442 ? 2.144   5.889   -5.346  1.00 38.13 ? 738  ARG A CA    1 
ATOM   3369 C C     . ARG A 1 442 ? 1.756   5.302   -3.996  1.00 38.03 ? 738  ARG A C     1 
ATOM   3370 O O     . ARG A 1 442 ? 0.836   4.487   -3.911  1.00 38.08 ? 738  ARG A O     1 
ATOM   3371 C CB    . ARG A 1 442 ? 3.161   4.958   -6.031  1.00 38.52 ? 738  ARG A CB    1 
ATOM   3372 C CG    . ARG A 1 442 ? 2.798   4.569   -7.479  1.00 39.86 ? 738  ARG A CG    1 
ATOM   3373 C CD    . ARG A 1 442 ? 3.824   3.603   -8.132  1.00 42.17 ? 738  ARG A CD    1 
ATOM   3374 N NE    . ARG A 1 442 ? 5.224   4.073   -8.079  1.00 43.97 ? 738  ARG A NE    1 
ATOM   3375 C CZ    . ARG A 1 442 ? 6.233   3.592   -8.817  1.00 45.07 ? 738  ARG A CZ    1 
ATOM   3376 N NH1   . ARG A 1 442 ? 6.030   2.616   -9.698  1.00 45.49 ? 738  ARG A NH1   1 
ATOM   3377 N NH2   . ARG A 1 442 ? 7.460   4.100   -8.679  1.00 45.20 ? 738  ARG A NH2   1 
ATOM   3378 N N     . TYR A 1 443 ? 2.471   5.705   -2.950  1.00 37.97 ? 739  TYR A N     1 
ATOM   3379 C CA    . TYR A 1 443 ? 2.142   5.275   -1.597  1.00 37.99 ? 739  TYR A CA    1 
ATOM   3380 C C     . TYR A 1 443 ? 0.717   5.685   -1.244  1.00 38.12 ? 739  TYR A C     1 
ATOM   3381 O O     . TYR A 1 443 ? -0.101  4.847   -0.854  1.00 38.00 ? 739  TYR A O     1 
ATOM   3382 C CB    . TYR A 1 443 ? 3.110   5.875   -0.576  1.00 37.96 ? 739  TYR A CB    1 
ATOM   3383 C CG    . TYR A 1 443 ? 2.871   5.377   0.830   1.00 38.01 ? 739  TYR A CG    1 
ATOM   3384 C CD1   . TYR A 1 443 ? 1.735   5.761   1.544   1.00 38.31 ? 739  TYR A CD1   1 
ATOM   3385 C CD2   . TYR A 1 443 ? 3.772   4.514   1.445   1.00 38.12 ? 739  TYR A CD2   1 
ATOM   3386 C CE1   . TYR A 1 443 ? 1.504   5.303   2.829   1.00 38.74 ? 739  TYR A CE1   1 
ATOM   3387 C CE2   . TYR A 1 443 ? 3.551   4.049   2.732   1.00 38.59 ? 739  TYR A CE2   1 
ATOM   3388 C CZ    . TYR A 1 443 ? 2.415   4.447   3.419   1.00 39.00 ? 739  TYR A CZ    1 
ATOM   3389 O OH    . TYR A 1 443 ? 2.193   3.993   4.699   1.00 39.37 ? 739  TYR A OH    1 
ATOM   3390 N N     . PHE A 1 444 ? 0.428   6.977   -1.380  1.00 38.26 ? 740  PHE A N     1 
ATOM   3391 C CA    . PHE A 1 444 ? -0.888  7.513   -1.021  1.00 38.36 ? 740  PHE A CA    1 
ATOM   3392 C C     . PHE A 1 444 ? -2.028  6.844   -1.778  1.00 38.52 ? 740  PHE A C     1 
ATOM   3393 O O     . PHE A 1 444 ? -3.158  6.810   -1.295  1.00 38.75 ? 740  PHE A O     1 
ATOM   3394 C CB    . PHE A 1 444 ? -0.941  9.026   -1.227  1.00 38.36 ? 740  PHE A CB    1 
ATOM   3395 C CG    . PHE A 1 444 ? -0.117  9.801   -0.236  1.00 38.81 ? 740  PHE A CG    1 
ATOM   3396 C CD1   . PHE A 1 444 ? -0.262  9.592   1.133   1.00 38.87 ? 740  PHE A CD1   1 
ATOM   3397 C CD2   . PHE A 1 444 ? 0.802   10.748  -0.668  1.00 39.08 ? 740  PHE A CD2   1 
ATOM   3398 C CE1   . PHE A 1 444 ? 0.496   10.305  2.048   1.00 38.60 ? 740  PHE A CE1   1 
ATOM   3399 C CE2   . PHE A 1 444 ? 1.559   11.464  0.247   1.00 38.87 ? 740  PHE A CE2   1 
ATOM   3400 C CZ    . PHE A 1 444 ? 1.402   11.240  1.605   1.00 38.57 ? 740  PHE A CZ    1 
ATOM   3401 N N     . GLU A 1 445 ? -1.732  6.304   -2.956  1.00 38.75 ? 741  GLU A N     1 
ATOM   3402 C CA    . GLU A 1 445 ? -2.724  5.531   -3.720  1.00 38.94 ? 741  GLU A CA    1 
ATOM   3403 C C     . GLU A 1 445 ? -3.006  4.199   -3.025  1.00 38.61 ? 741  GLU A C     1 
ATOM   3404 O O     . GLU A 1 445 ? -4.147  3.737   -2.993  1.00 38.69 ? 741  GLU A O     1 
ATOM   3405 C CB    . GLU A 1 445 ? -2.254  5.267   -5.162  1.00 39.10 ? 741  GLU A CB    1 
ATOM   3406 C CG    . GLU A 1 445 ? -1.581  6.458   -5.850  1.00 39.96 ? 741  GLU A CG    1 
ATOM   3407 C CD    . GLU A 1 445 ? -1.368  6.242   -7.341  1.00 41.11 ? 741  GLU A CD    1 
ATOM   3408 O OE1   . GLU A 1 445 ? -1.337  5.066   -7.770  1.00 41.76 ? 741  GLU A OE1   1 
ATOM   3409 O OE2   . GLU A 1 445 ? -1.230  7.245   -8.084  1.00 41.44 ? 741  GLU A OE2   1 
ATOM   3410 N N     . SER A 1 446 ? -1.954  3.595   -2.473  1.00 38.14 ? 742  SER A N     1 
ATOM   3411 C CA    . SER A 1 446 ? -2.057  2.327   -1.746  1.00 37.71 ? 742  SER A CA    1 
ATOM   3412 C C     . SER A 1 446 ? -2.767  2.492   -0.405  1.00 37.19 ? 742  SER A C     1 
ATOM   3413 O O     . SER A 1 446 ? -3.372  1.545   0.098   1.00 37.04 ? 742  SER A O     1 
ATOM   3414 C CB    . SER A 1 446 ? -0.661  1.740   -1.492  1.00 37.79 ? 742  SER A CB    1 
ATOM   3415 O OG    . SER A 1 446 ? 0.067   1.561   -2.698  1.00 38.00 ? 742  SER A OG    1 
ATOM   3416 N N     . PHE A 1 447 ? -2.662  3.684   0.179   1.00 36.60 ? 743  PHE A N     1 
ATOM   3417 C CA    . PHE A 1 447 ? -3.217  3.959   1.502   1.00 36.27 ? 743  PHE A CA    1 
ATOM   3418 C C     . PHE A 1 447 ? -3.874  5.348   1.531   1.00 35.87 ? 743  PHE A C     1 
ATOM   3419 O O     . PHE A 1 447 ? -3.316  6.294   2.086   1.00 35.79 ? 743  PHE A O     1 
ATOM   3420 C CB    . PHE A 1 447 ? -2.124  3.871   2.582   1.00 36.32 ? 743  PHE A CB    1 
ATOM   3421 C CG    . PHE A 1 447 ? -1.305  2.602   2.537   1.00 36.25 ? 743  PHE A CG    1 
ATOM   3422 C CD1   . PHE A 1 447 ? -1.786  1.418   3.088   1.00 36.13 ? 743  PHE A CD1   1 
ATOM   3423 C CD2   . PHE A 1 447 ? -0.044  2.600   1.959   1.00 36.11 ? 743  PHE A CD2   1 
ATOM   3424 C CE1   . PHE A 1 447 ? -1.030  0.257   3.054   1.00 36.21 ? 743  PHE A CE1   1 
ATOM   3425 C CE2   . PHE A 1 447 ? 0.721   1.444   1.916   1.00 36.14 ? 743  PHE A CE2   1 
ATOM   3426 C CZ    . PHE A 1 447 ? 0.227   0.269   2.465   1.00 36.36 ? 743  PHE A CZ    1 
ATOM   3427 N N     . PRO A 1 448 ? -5.072  5.474   0.940   1.00 35.39 ? 744  PRO A N     1 
ATOM   3428 C CA    . PRO A 1 448 ? -5.792  6.751   0.886   1.00 35.12 ? 744  PRO A CA    1 
ATOM   3429 C C     . PRO A 1 448 ? -6.182  7.328   2.255   1.00 34.89 ? 744  PRO A C     1 
ATOM   3430 O O     . PRO A 1 448 ? -6.323  8.546   2.393   1.00 34.81 ? 744  PRO A O     1 
ATOM   3431 C CB    . PRO A 1 448 ? -7.057  6.395   0.104   1.00 35.19 ? 744  PRO A CB    1 
ATOM   3432 C CG    . PRO A 1 448 ? -7.254  4.955   0.364   1.00 35.47 ? 744  PRO A CG    1 
ATOM   3433 C CD    . PRO A 1 448 ? -5.877  4.378   0.377   1.00 35.42 ? 744  PRO A CD    1 
ATOM   3434 N N     . GLY A 1 449 ? -6.390  6.454   3.238   1.00 34.59 ? 745  GLY A N     1 
ATOM   3435 C CA    . GLY A 1 449 ? -6.667  6.873   4.611   1.00 34.43 ? 745  GLY A CA    1 
ATOM   3436 C C     . GLY A 1 449 ? -5.481  7.536   5.298   1.00 34.40 ? 745  GLY A C     1 
ATOM   3437 O O     . GLY A 1 449 ? -5.653  8.504   6.046   1.00 34.30 ? 745  GLY A O     1 
ATOM   3438 N N     . VAL A 1 450 ? -4.281  7.006   5.046   1.00 34.34 ? 746  VAL A N     1 
ATOM   3439 C CA    . VAL A 1 450 ? -3.030  7.565   5.580   1.00 33.98 ? 746  VAL A CA    1 
ATOM   3440 C C     . VAL A 1 450 ? -2.746  8.936   4.983   1.00 33.88 ? 746  VAL A C     1 
ATOM   3441 O O     . VAL A 1 450 ? -2.254  9.815   5.670   1.00 33.78 ? 746  VAL A O     1 
ATOM   3442 C CB    . VAL A 1 450 ? -1.843  6.641   5.295   1.00 33.96 ? 746  VAL A CB    1 
ATOM   3443 C CG1   . VAL A 1 450 ? -0.538  7.279   5.763   1.00 33.74 ? 746  VAL A CG1   1 
ATOM   3444 C CG2   . VAL A 1 450 ? -2.066  5.295   5.959   1.00 33.72 ? 746  VAL A CG2   1 
ATOM   3445 N N     . LYS A 1 451 ? -3.056  9.104   3.702   1.00 33.91 ? 747  LYS A N     1 
ATOM   3446 C CA    . LYS A 1 451 ? -3.032  10.416  3.058   1.00 34.10 ? 747  LYS A CA    1 
ATOM   3447 C C     . LYS A 1 451 ? -3.984  11.349  3.804   1.00 34.06 ? 747  LYS A C     1 
ATOM   3448 O O     . LYS A 1 451 ? -3.555  12.350  4.377   1.00 33.99 ? 747  LYS A O     1 
ATOM   3449 C CB    . LYS A 1 451 ? -3.459  10.289  1.588   1.00 34.37 ? 747  LYS A CB    1 
ATOM   3450 C CG    . LYS A 1 451 ? -3.378  11.563  0.740   1.00 34.99 ? 747  LYS A CG    1 
ATOM   3451 C CD    . LYS A 1 451 ? -4.530  11.589  -0.291  1.00 35.82 ? 747  LYS A CD    1 
ATOM   3452 C CE    . LYS A 1 451 ? -4.411  12.727  -1.305  1.00 35.98 ? 747  LYS A CE    1 
ATOM   3453 N NZ    . LYS A 1 451 ? -3.271  12.524  -2.237  1.00 36.13 ? 747  LYS A NZ    1 
ATOM   3454 N N     . ARG A 1 452 ? -5.267  10.982  3.825   1.00 34.09 ? 748  ARG A N     1 
ATOM   3455 C CA    . ARG A 1 452 ? -6.330  11.797  4.429   1.00 34.14 ? 748  ARG A CA    1 
ATOM   3456 C C     . ARG A 1 452 ? -5.973  12.288  5.831   1.00 34.31 ? 748  ARG A C     1 
ATOM   3457 O O     . ARG A 1 452 ? -6.264  13.427  6.186   1.00 34.27 ? 748  ARG A O     1 
ATOM   3458 C CB    . ARG A 1 452 ? -7.648  11.014  4.470   1.00 34.04 ? 748  ARG A CB    1 
ATOM   3459 N N     . TYR A 1 453 ? -5.334  11.425  6.616   1.00 34.70 ? 749  TYR A N     1 
ATOM   3460 C CA    . TYR A 1 453 ? -4.899  11.780  7.974   1.00 34.89 ? 749  TYR A CA    1 
ATOM   3461 C C     . TYR A 1 453 ? -3.836  12.872  7.957   1.00 35.16 ? 749  TYR A C     1 
ATOM   3462 O O     . TYR A 1 453 ? -3.927  13.831  8.724   1.00 35.03 ? 749  TYR A O     1 
ATOM   3463 C CB    . TYR A 1 453 ? -4.400  10.548  8.746   1.00 34.77 ? 749  TYR A CB    1 
ATOM   3464 C CG    . TYR A 1 453 ? -3.450  10.878  9.867   1.00 34.39 ? 749  TYR A CG    1 
ATOM   3465 C CD1   . TYR A 1 453 ? -3.869  11.601  10.979  1.00 33.95 ? 749  TYR A CD1   1 
ATOM   3466 C CD2   . TYR A 1 453 ? -2.121  10.473  9.810   1.00 35.07 ? 749  TYR A CD2   1 
ATOM   3467 C CE1   . TYR A 1 453 ? -2.981  11.915  12.003  1.00 33.93 ? 749  TYR A CE1   1 
ATOM   3468 C CE2   . TYR A 1 453 ? -1.228  10.779  10.831  1.00 34.57 ? 749  TYR A CE2   1 
ATOM   3469 C CZ    . TYR A 1 453 ? -1.663  11.500  11.913  1.00 34.00 ? 749  TYR A CZ    1 
ATOM   3470 O OH    . TYR A 1 453 ? -0.763  11.787  12.897  1.00 34.06 ? 749  TYR A OH    1 
ATOM   3471 N N     . MET A 1 454 ? -2.847  12.737  7.076   1.00 35.58 ? 750  MET A N     1 
ATOM   3472 C CA    . MET A 1 454 ? -1.781  13.747  6.967   1.00 36.21 ? 750  MET A CA    1 
ATOM   3473 C C     . MET A 1 454 ? -2.352  15.118  6.615   1.00 36.31 ? 750  MET A C     1 
ATOM   3474 O O     . MET A 1 454 ? -1.838  16.150  7.064   1.00 36.41 ? 750  MET A O     1 
ATOM   3475 C CB    . MET A 1 454 ? -0.731  13.368  5.920   1.00 36.41 ? 750  MET A CB    1 
ATOM   3476 C CG    . MET A 1 454 ? -0.141  11.968  6.050   1.00 37.68 ? 750  MET A CG    1 
ATOM   3477 S SD    . MET A 1 454 ? 0.959   11.692  7.450   1.00 40.23 ? 750  MET A SD    1 
ATOM   3478 C CE    . MET A 1 454 ? -0.075  12.207  8.806   1.00 38.93 ? 750  MET A CE    1 
ATOM   3479 N N     . GLU A 1 455 ? -3.410  15.122  5.810   1.00 36.19 ? 751  GLU A N     1 
ATOM   3480 C CA    . GLU A 1 455 ? -4.076  16.360  5.431   1.00 36.13 ? 751  GLU A CA    1 
ATOM   3481 C C     . GLU A 1 455 ? -4.799  16.958  6.627   1.00 35.84 ? 751  GLU A C     1 
ATOM   3482 O O     . GLU A 1 455 ? -4.634  18.134  6.944   1.00 35.91 ? 751  GLU A O     1 
ATOM   3483 C CB    . GLU A 1 455 ? -5.070  16.103  4.302   1.00 36.27 ? 751  GLU A CB    1 
ATOM   3484 C CG    . GLU A 1 455 ? -4.418  15.645  3.007   1.00 37.08 ? 751  GLU A CG    1 
ATOM   3485 C CD    . GLU A 1 455 ? -5.408  15.492  1.856   1.00 38.19 ? 751  GLU A CD    1 
ATOM   3486 O OE1   . GLU A 1 455 ? -6.578  15.119  2.093   1.00 38.95 ? 751  GLU A OE1   1 
ATOM   3487 O OE2   . GLU A 1 455 ? -5.011  15.738  0.700   1.00 39.21 ? 751  GLU A OE2   1 
ATOM   3488 N N     . ASN A 1 456 ? -5.590  16.131  7.295   1.00 35.51 ? 752  ASN A N     1 
ATOM   3489 C CA    . ASN A 1 456 ? -6.411  16.585  8.417   1.00 35.29 ? 752  ASN A CA    1 
ATOM   3490 C C     . ASN A 1 456 ? -5.597  17.002  9.636   1.00 34.86 ? 752  ASN A C     1 
ATOM   3491 O O     . ASN A 1 456 ? -5.955  17.944  10.341  1.00 34.61 ? 752  ASN A O     1 
ATOM   3492 C CB    . ASN A 1 456 ? -7.412  15.498  8.811   1.00 35.39 ? 752  ASN A CB    1 
ATOM   3493 C CG    . ASN A 1 456 ? -8.373  15.170  7.690   1.00 35.45 ? 752  ASN A CG    1 
ATOM   3494 O OD1   . ASN A 1 456 ? -8.249  15.701  6.584   1.00 35.24 ? 752  ASN A OD1   1 
ATOM   3495 N ND2   . ASN A 1 456 ? -9.331  14.291  7.963   1.00 35.55 ? 752  ASN A ND2   1 
ATOM   3496 N N     . ILE A 1 457 ? -4.503  16.295  9.879   1.00 34.55 ? 753  ILE A N     1 
ATOM   3497 C CA    . ILE A 1 457 ? -3.655  16.582  11.038  1.00 34.29 ? 753  ILE A CA    1 
ATOM   3498 C C     . ILE A 1 457 ? -2.929  17.916  10.866  1.00 34.13 ? 753  ILE A C     1 
ATOM   3499 O O     . ILE A 1 457 ? -2.641  18.613  11.841  1.00 33.89 ? 753  ILE A O     1 
ATOM   3500 C CB    . ILE A 1 457 ? -2.638  15.447  11.291  1.00 34.15 ? 753  ILE A CB    1 
ATOM   3501 C CG1   . ILE A 1 457 ? -1.894  15.671  12.610  1.00 34.16 ? 753  ILE A CG1   1 
ATOM   3502 C CG2   . ILE A 1 457 ? -1.663  15.329  10.138  1.00 33.98 ? 753  ILE A CG2   1 
ATOM   3503 C CD1   . ILE A 1 457 ? -2.720  15.349  13.842  1.00 34.00 ? 753  ILE A CD1   1 
ATOM   3504 N N     . VAL A 1 458 ? -2.635  18.263  9.619   1.00 34.01 ? 754  VAL A N     1 
ATOM   3505 C CA    . VAL A 1 458 ? -2.025  19.546  9.321   1.00 33.94 ? 754  VAL A CA    1 
ATOM   3506 C C     . VAL A 1 458 ? -3.072  20.648  9.460   1.00 34.01 ? 754  VAL A C     1 
ATOM   3507 O O     . VAL A 1 458 ? -2.784  21.700  10.020  1.00 33.67 ? 754  VAL A O     1 
ATOM   3508 C CB    . VAL A 1 458 ? -1.380  19.540  7.925   1.00 33.95 ? 754  VAL A CB    1 
ATOM   3509 C CG1   . VAL A 1 458 ? -0.776  20.895  7.599   1.00 33.83 ? 754  VAL A CG1   1 
ATOM   3510 C CG2   . VAL A 1 458 ? -0.308  18.473  7.861   1.00 33.69 ? 754  VAL A CG2   1 
ATOM   3511 N N     . GLN A 1 459 ? -4.289  20.381  8.980   1.00 34.42 ? 755  GLN A N     1 
ATOM   3512 C CA    . GLN A 1 459 ? -5.415  21.338  9.060   1.00 34.70 ? 755  GLN A CA    1 
ATOM   3513 C C     . GLN A 1 459 ? -5.943  21.555  10.479  1.00 34.87 ? 755  GLN A C     1 
ATOM   3514 O O     . GLN A 1 459 ? -6.286  22.677  10.846  1.00 34.80 ? 755  GLN A O     1 
ATOM   3515 C CB    . GLN A 1 459 ? -6.569  20.892  8.156   1.00 34.62 ? 755  GLN A CB    1 
ATOM   3516 N N     . GLU A 1 460 ? -6.024  20.482  11.261  1.00 35.24 ? 756  GLU A N     1 
ATOM   3517 C CA    . GLU A 1 460 ? -6.396  20.587  12.675  1.00 35.68 ? 756  GLU A CA    1 
ATOM   3518 C C     . GLU A 1 460 ? -5.323  21.333  13.458  1.00 35.61 ? 756  GLU A C     1 
ATOM   3519 O O     . GLU A 1 460 ? -5.626  22.222  14.246  1.00 35.60 ? 756  GLU A O     1 
ATOM   3520 C CB    . GLU A 1 460 ? -6.620  19.207  13.304  1.00 35.99 ? 756  GLU A CB    1 
ATOM   3521 C CG    . GLU A 1 460 ? -7.078  19.272  14.772  1.00 37.16 ? 756  GLU A CG    1 
ATOM   3522 C CD    . GLU A 1 460 ? -7.378  17.907  15.377  1.00 38.70 ? 756  GLU A CD    1 
ATOM   3523 O OE1   . GLU A 1 460 ? -6.482  17.029  15.354  1.00 39.64 ? 756  GLU A OE1   1 
ATOM   3524 O OE2   . GLU A 1 460 ? -8.509  17.713  15.880  1.00 39.52 ? 756  GLU A OE2   1 
ATOM   3525 N N     . ALA A 1 461 ? -4.067  20.963  13.228  1.00 35.81 ? 757  ALA A N     1 
ATOM   3526 C CA    . ALA A 1 461 ? -2.916  21.607  13.882  1.00 35.89 ? 757  ALA A CA    1 
ATOM   3527 C C     . ALA A 1 461 ? -2.816  23.096  13.548  1.00 35.95 ? 757  ALA A C     1 
ATOM   3528 O O     . ALA A 1 461 ? -2.244  23.883  14.304  1.00 36.06 ? 757  ALA A O     1 
ATOM   3529 C CB    . ALA A 1 461 ? -1.627  20.900  13.488  1.00 35.91 ? 757  ALA A CB    1 
ATOM   3530 N N     . LYS A 1 462 ? -3.359  23.464  12.395  1.00 36.02 ? 758  LYS A N     1 
ATOM   3531 C CA    . LYS A 1 462 ? -3.453  24.859  11.984  1.00 36.03 ? 758  LYS A CA    1 
ATOM   3532 C C     . LYS A 1 462 ? -4.610  25.552  12.726  1.00 35.98 ? 758  LYS A C     1 
ATOM   3533 O O     . LYS A 1 462 ? -4.427  26.614  13.326  1.00 35.95 ? 758  LYS A O     1 
ATOM   3534 C CB    . LYS A 1 462 ? -3.671  24.940  10.467  1.00 36.12 ? 758  LYS A CB    1 
ATOM   3535 C CG    . LYS A 1 462 ? -2.802  25.969  9.766   1.00 36.49 ? 758  LYS A CG    1 
ATOM   3536 C CD    . LYS A 1 462 ? -3.387  26.416  8.425   1.00 37.01 ? 758  LYS A CD    1 
ATOM   3537 N N     . GLN A 1 463 ? -5.789  24.927  12.680  1.00 35.90 ? 759  GLN A N     1 
ATOM   3538 C CA    . GLN A 1 463 ? -7.030  25.474  13.253  1.00 35.88 ? 759  GLN A CA    1 
ATOM   3539 C C     . GLN A 1 463 ? -7.024  25.521  14.785  1.00 35.82 ? 759  GLN A C     1 
ATOM   3540 O O     . GLN A 1 463 ? -7.699  26.372  15.383  1.00 35.80 ? 759  GLN A O     1 
ATOM   3541 C CB    . GLN A 1 463 ? -8.233  24.656  12.743  1.00 36.02 ? 759  GLN A CB    1 
ATOM   3542 C CG    . GLN A 1 463 ? -9.585  24.887  13.465  1.00 36.92 ? 759  GLN A CG    1 
ATOM   3543 C CD    . GLN A 1 463 ? -9.891  23.848  14.539  1.00 37.43 ? 759  GLN A CD    1 
ATOM   3544 O OE1   . GLN A 1 463 ? -10.175 22.690  14.233  1.00 37.93 ? 759  GLN A OE1   1 
ATOM   3545 N NE2   . GLN A 1 463 ? -9.853  24.266  15.797  1.00 37.79 ? 759  GLN A NE2   1 
ATOM   3546 N N     . LYS A 1 464 ? -6.272  24.608  15.408  1.00 35.70 ? 760  LYS A N     1 
ATOM   3547 C CA    . LYS A 1 464 ? -6.193  24.493  16.880  1.00 35.57 ? 760  LYS A CA    1 
ATOM   3548 C C     . LYS A 1 464 ? -4.916  25.062  17.501  1.00 35.17 ? 760  LYS A C     1 
ATOM   3549 O O     . LYS A 1 464 ? -4.940  25.566  18.624  1.00 35.05 ? 760  LYS A O     1 
ATOM   3550 C CB    . LYS A 1 464 ? -6.329  23.033  17.310  1.00 35.68 ? 760  LYS A CB    1 
ATOM   3551 C CG    . LYS A 1 464 ? -7.746  22.619  17.645  1.00 36.67 ? 760  LYS A CG    1 
ATOM   3552 C CD    . LYS A 1 464 ? -7.835  21.112  17.904  1.00 38.34 ? 760  LYS A CD    1 
ATOM   3553 C CE    . LYS A 1 464 ? -9.043  20.725  18.771  1.00 39.13 ? 760  LYS A CE    1 
ATOM   3554 N NZ    . LYS A 1 464 ? -8.766  19.508  19.616  1.00 39.06 ? 760  LYS A NZ    1 
ATOM   3555 N N     . GLY A 1 465 ? -3.803  24.947  16.786  1.00 34.91 ? 761  GLY A N     1 
ATOM   3556 C CA    . GLY A 1 465 ? -2.501  25.424  17.276  1.00 34.80 ? 761  GLY A CA    1 
ATOM   3557 C C     . GLY A 1 465 ? -1.670  24.357  17.966  1.00 34.56 ? 761  GLY A C     1 
ATOM   3558 O O     . GLY A 1 465 ? -0.563  24.629  18.424  1.00 34.22 ? 761  GLY A O     1 
ATOM   3559 N N     . TYR A 1 466 ? -2.219  23.148  18.040  1.00 34.53 ? 762  TYR A N     1 
ATOM   3560 C CA    . TYR A 1 466 ? -1.541  22.010  18.637  1.00 34.62 ? 762  TYR A CA    1 
ATOM   3561 C C     . TYR A 1 466 ? -2.114  20.703  18.108  1.00 34.55 ? 762  TYR A C     1 
ATOM   3562 O O     . TYR A 1 466 ? -3.205  20.684  17.524  1.00 34.58 ? 762  TYR A O     1 
ATOM   3563 C CB    . TYR A 1 466 ? -1.710  22.036  20.150  1.00 34.63 ? 762  TYR A CB    1 
ATOM   3564 C CG    . TYR A 1 466 ? -3.145  21.895  20.574  1.00 35.51 ? 762  TYR A CG    1 
ATOM   3565 C CD1   . TYR A 1 466 ? -3.753  20.645  20.630  1.00 36.75 ? 762  TYR A CD1   1 
ATOM   3566 C CD2   . TYR A 1 466 ? -3.912  23.010  20.892  1.00 36.46 ? 762  TYR A CD2   1 
ATOM   3567 C CE1   . TYR A 1 466 ? -5.082  20.507  21.000  1.00 37.26 ? 762  TYR A CE1   1 
ATOM   3568 C CE2   . TYR A 1 466 ? -5.250  22.879  21.269  1.00 36.61 ? 762  TYR A CE2   1 
ATOM   3569 C CZ    . TYR A 1 466 ? -5.822  21.622  21.319  1.00 36.94 ? 762  TYR A CZ    1 
ATOM   3570 O OH    . TYR A 1 466 ? -7.134  21.449  21.681  1.00 37.44 ? 762  TYR A OH    1 
ATOM   3571 N N     . VAL A 1 467 ? -1.381  19.618  18.363  1.00 34.44 ? 763  VAL A N     1 
ATOM   3572 C CA    . VAL A 1 467 ? -1.823  18.253  18.047  1.00 34.22 ? 763  VAL A CA    1 
ATOM   3573 C C     . VAL A 1 467 ? -1.742  17.358  19.280  1.00 34.13 ? 763  VAL A C     1 
ATOM   3574 O O     . VAL A 1 467 ? -0.808  17.468  20.069  1.00 34.01 ? 763  VAL A O     1 
ATOM   3575 C CB    . VAL A 1 467 ? -0.987  17.639  16.930  1.00 34.21 ? 763  VAL A CB    1 
ATOM   3576 C CG1   . VAL A 1 467 ? -1.243  18.384  15.636  1.00 34.15 ? 763  VAL A CG1   1 
ATOM   3577 C CG2   . VAL A 1 467 ? 0.497   17.652  17.293  1.00 34.01 ? 763  VAL A CG2   1 
ATOM   3578 N N     . THR A 1 468 ? -2.722  16.468  19.426  1.00 34.11 ? 764  THR A N     1 
ATOM   3579 C CA    . THR A 1 468 ? -2.852  15.637  20.627  1.00 34.03 ? 764  THR A CA    1 
ATOM   3580 C C     . THR A 1 468 ? -2.582  14.174  20.326  1.00 34.01 ? 764  THR A C     1 
ATOM   3581 O O     . THR A 1 468 ? -2.965  13.682  19.272  1.00 34.00 ? 764  THR A O     1 
ATOM   3582 C CB    . THR A 1 468 ? -4.270  15.711  21.222  1.00 33.96 ? 764  THR A CB    1 
ATOM   3583 O OG1   . THR A 1 468 ? -5.207  15.186  20.277  1.00 34.24 ? 764  THR A OG1   1 
ATOM   3584 C CG2   . THR A 1 468 ? -4.648  17.132  21.552  1.00 33.73 ? 764  THR A CG2   1 
ATOM   3585 N N     . THR A 1 469 ? -1.940  13.485  21.266  1.00 34.11 ? 765  THR A N     1 
ATOM   3586 C CA    . THR A 1 469 ? -1.715  12.043  21.152  1.00 34.22 ? 765  THR A CA    1 
ATOM   3587 C C     . THR A 1 469 ? -2.954  11.303  21.652  1.00 34.36 ? 765  THR A C     1 
ATOM   3588 O O     . THR A 1 469 ? -3.912  11.930  22.087  1.00 34.29 ? 765  THR A O     1 
ATOM   3589 C CB    . THR A 1 469 ? -0.483  11.569  21.948  1.00 34.20 ? 765  THR A CB    1 
ATOM   3590 O OG1   . THR A 1 469 ? -0.789  11.577  23.346  1.00 34.34 ? 765  THR A OG1   1 
ATOM   3591 C CG2   . THR A 1 469 ? 0.732   12.449  21.675  1.00 34.06 ? 765  THR A CG2   1 
ATOM   3592 N N     . LEU A 1 470 ? -2.914  9.974   21.599  1.00 34.72 ? 766  LEU A N     1 
ATOM   3593 C CA    . LEU A 1 470 ? -4.072  9.116   21.900  1.00 34.94 ? 766  LEU A CA    1 
ATOM   3594 C C     . LEU A 1 470 ? -4.586  9.311   23.321  1.00 34.98 ? 766  LEU A C     1 
ATOM   3595 O O     . LEU A 1 470 ? -5.785  9.509   23.544  1.00 34.97 ? 766  LEU A O     1 
ATOM   3596 C CB    . LEU A 1 470 ? -3.697  7.649   21.698  1.00 35.12 ? 766  LEU A CB    1 
ATOM   3597 C CG    . LEU A 1 470 ? -4.867  6.701   21.476  1.00 35.49 ? 766  LEU A CG    1 
ATOM   3598 C CD1   . LEU A 1 470 ? -5.445  6.922   20.088  1.00 35.46 ? 766  LEU A CD1   1 
ATOM   3599 C CD2   . LEU A 1 470 ? -4.406  5.262   21.647  1.00 36.18 ? 766  LEU A CD2   1 
ATOM   3600 N N     . LEU A 1 471 ? -3.670  9.218   24.280  1.00 35.07 ? 767  LEU A N     1 
ATOM   3601 C CA    . LEU A 1 471 ? -3.895  9.778   25.606  1.00 35.08 ? 767  LEU A CA    1 
ATOM   3602 C C     . LEU A 1 471 ? -3.707  11.261  25.320  1.00 35.37 ? 767  LEU A C     1 
ATOM   3603 O O     . LEU A 1 471 ? -3.026  11.594  24.349  1.00 35.56 ? 767  LEU A O     1 
ATOM   3604 C CB    . LEU A 1 471 ? -2.877  9.247   26.617  1.00 34.88 ? 767  LEU A CB    1 
ATOM   3605 C CG    . LEU A 1 471 ? -2.755  7.718   26.692  1.00 34.22 ? 767  LEU A CG    1 
ATOM   3606 C CD1   . LEU A 1 471 ? -1.823  7.314   27.818  1.00 34.17 ? 767  LEU A CD1   1 
ATOM   3607 C CD2   . LEU A 1 471 ? -4.096  7.049   26.879  1.00 32.85 ? 767  LEU A CD2   1 
ATOM   3608 N N     . HIS A 1 472 ? -4.276  12.164  26.110  1.00 35.42 ? 768  HIS A N     1 
ATOM   3609 C CA    . HIS A 1 472 ? -4.399  13.544  25.616  1.00 35.59 ? 768  HIS A CA    1 
ATOM   3610 C C     . HIS A 1 472 ? -3.180  14.425  25.841  1.00 35.37 ? 768  HIS A C     1 
ATOM   3611 O O     . HIS A 1 472 ? -3.292  15.540  26.351  1.00 35.37 ? 768  HIS A O     1 
ATOM   3612 C CB    . HIS A 1 472 ? -5.666  14.177  26.149  1.00 35.81 ? 768  HIS A CB    1 
ATOM   3613 C CG    . HIS A 1 472 ? -6.864  13.307  25.967  1.00 36.93 ? 768  HIS A CG    1 
ATOM   3614 N ND1   . HIS A 1 472 ? -7.321  12.923  24.723  1.00 38.65 ? 768  HIS A ND1   1 
ATOM   3615 C CD2   . HIS A 1 472 ? -7.670  12.700  26.869  1.00 37.92 ? 768  HIS A CD2   1 
ATOM   3616 C CE1   . HIS A 1 472 ? -8.375  12.138  24.867  1.00 39.11 ? 768  HIS A CE1   1 
ATOM   3617 N NE2   . HIS A 1 472 ? -8.606  11.986  26.159  1.00 38.95 ? 768  HIS A NE2   1 
ATOM   3618 N N     . ARG A 1 473 ? -2.028  13.923  25.397  1.00 35.26 ? 769  ARG A N     1 
ATOM   3619 C CA    . ARG A 1 473 ? -0.763  14.648  25.452  1.00 35.19 ? 769  ARG A CA    1 
ATOM   3620 C C     . ARG A 1 473 ? -0.833  15.747  24.407  1.00 34.90 ? 769  ARG A C     1 
ATOM   3621 O O     . ARG A 1 473 ? -1.631  15.665  23.481  1.00 34.76 ? 769  ARG A O     1 
ATOM   3622 C CB    . ARG A 1 473 ? 0.414   13.708  25.174  1.00 35.28 ? 769  ARG A CB    1 
ATOM   3623 C CG    . ARG A 1 473 ? 1.684   14.114  25.883  1.00 36.01 ? 769  ARG A CG    1 
ATOM   3624 C CD    . ARG A 1 473 ? 2.865   13.201  25.559  1.00 36.74 ? 769  ARG A CD    1 
ATOM   3625 N NE    . ARG A 1 473 ? 2.923   12.011  26.411  1.00 37.41 ? 769  ARG A NE    1 
ATOM   3626 C CZ    . ARG A 1 473 ? 3.187   12.019  27.717  1.00 37.90 ? 769  ARG A CZ    1 
ATOM   3627 N NH1   . ARG A 1 473 ? 3.407   13.163  28.370  1.00 38.10 ? 769  ARG A NH1   1 
ATOM   3628 N NH2   . ARG A 1 473 ? 3.213   10.870  28.384  1.00 38.05 ? 769  ARG A NH2   1 
ATOM   3629 N N     . ARG A 1 474 ? -0.008  16.775  24.551  1.00 34.68 ? 770  ARG A N     1 
ATOM   3630 C CA    . ARG A 1 474 ? -0.162  17.964  23.722  1.00 34.57 ? 770  ARG A CA    1 
ATOM   3631 C C     . ARG A 1 474 ? 1.170   18.547  23.225  1.00 34.21 ? 770  ARG A C     1 
ATOM   3632 O O     . ARG A 1 474 ? 2.163   18.576  23.950  1.00 33.99 ? 770  ARG A O     1 
ATOM   3633 C CB    . ARG A 1 474 ? -0.950  19.007  24.511  1.00 34.68 ? 770  ARG A CB    1 
ATOM   3634 C CG    . ARG A 1 474 ? -1.674  20.000  23.652  1.00 35.50 ? 770  ARG A CG    1 
ATOM   3635 C CD    . ARG A 1 474 ? -2.475  20.992  24.479  1.00 36.49 ? 770  ARG A CD    1 
ATOM   3636 N NE    . ARG A 1 474 ? -3.879  20.599  24.615  1.00 37.04 ? 770  ARG A NE    1 
ATOM   3637 C CZ    . ARG A 1 474 ? -4.895  21.448  24.762  1.00 37.44 ? 770  ARG A CZ    1 
ATOM   3638 N NH1   . ARG A 1 474 ? -4.695  22.764  24.792  1.00 37.52 ? 770  ARG A NH1   1 
ATOM   3639 N NH2   . ARG A 1 474 ? -6.127  20.978  24.872  1.00 38.02 ? 770  ARG A NH2   1 
ATOM   3640 N N     . ARG A 1 475 ? 1.177   18.998  21.975  1.00 33.94 ? 771  ARG A N     1 
ATOM   3641 C CA    . ARG A 1 475 ? 2.333   19.669  21.398  1.00 33.83 ? 771  ARG A CA    1 
ATOM   3642 C C     . ARG A 1 475 ? 1.874   20.858  20.577  1.00 33.65 ? 771  ARG A C     1 
ATOM   3643 O O     . ARG A 1 475 ? 1.220   20.692  19.549  1.00 33.41 ? 771  ARG A O     1 
ATOM   3644 C CB    . ARG A 1 475 ? 3.145   18.726  20.511  1.00 33.92 ? 771  ARG A CB    1 
ATOM   3645 C CG    . ARG A 1 475 ? 4.434   19.364  19.982  1.00 34.43 ? 771  ARG A CG    1 
ATOM   3646 C CD    . ARG A 1 475 ? 5.227   18.417  19.108  1.00 35.15 ? 771  ARG A CD    1 
ATOM   3647 N NE    . ARG A 1 475 ? 6.575   18.920  18.837  1.00 36.11 ? 771  ARG A NE    1 
ATOM   3648 C CZ    . ARG A 1 475 ? 7.518   18.249  18.172  1.00 37.00 ? 771  ARG A CZ    1 
ATOM   3649 N NH1   . ARG A 1 475 ? 7.278   17.028  17.697  1.00 37.74 ? 771  ARG A NH1   1 
ATOM   3650 N NH2   . ARG A 1 475 ? 8.714   18.797  17.982  1.00 36.96 ? 771  ARG A NH2   1 
ATOM   3651 N N     . TYR A 1 476 ? 2.231   22.055  21.034  1.00 33.57 ? 772  TYR A N     1 
ATOM   3652 C CA    . TYR A 1 476 ? 1.869   23.285  20.344  1.00 33.65 ? 772  TYR A CA    1 
ATOM   3653 C C     . TYR A 1 476 ? 2.824   23.538  19.199  1.00 33.63 ? 772  TYR A C     1 
ATOM   3654 O O     . TYR A 1 476 ? 4.024   23.336  19.342  1.00 33.56 ? 772  TYR A O     1 
ATOM   3655 C CB    . TYR A 1 476 ? 1.884   24.460  21.313  1.00 33.72 ? 772  TYR A CB    1 
ATOM   3656 C CG    . TYR A 1 476 ? 0.754   24.411  22.307  1.00 34.17 ? 772  TYR A CG    1 
ATOM   3657 C CD1   . TYR A 1 476 ? -0.540  24.747  21.931  1.00 34.50 ? 772  TYR A CD1   1 
ATOM   3658 C CD2   . TYR A 1 476 ? 0.971   24.014  23.618  1.00 34.80 ? 772  TYR A CD2   1 
ATOM   3659 C CE1   . TYR A 1 476 ? -1.590  24.688  22.833  1.00 34.53 ? 772  TYR A CE1   1 
ATOM   3660 C CE2   . TYR A 1 476 ? -0.072  23.959  24.527  1.00 34.98 ? 772  TYR A CE2   1 
ATOM   3661 C CZ    . TYR A 1 476 ? -1.347  24.298  24.130  1.00 34.62 ? 772  TYR A CZ    1 
ATOM   3662 O OH    . TYR A 1 476 ? -2.379  24.240  25.034  1.00 34.58 ? 772  TYR A OH    1 
ATOM   3663 N N     . LEU A 1 477 ? 2.285   23.986  18.068  1.00 33.90 ? 773  LEU A N     1 
ATOM   3664 C CA    . LEU A 1 477 ? 3.053   24.134  16.822  1.00 34.15 ? 773  LEU A CA    1 
ATOM   3665 C C     . LEU A 1 477 ? 2.810   25.501  16.162  1.00 34.53 ? 773  LEU A C     1 
ATOM   3666 O O     . LEU A 1 477 ? 2.171   25.585  15.113  1.00 34.50 ? 773  LEU A O     1 
ATOM   3667 C CB    . LEU A 1 477 ? 2.682   23.016  15.838  1.00 34.06 ? 773  LEU A CB    1 
ATOM   3668 C CG    . LEU A 1 477 ? 2.983   21.573  16.247  1.00 33.54 ? 773  LEU A CG    1 
ATOM   3669 C CD1   . LEU A 1 477 ? 2.159   20.608  15.408  1.00 32.95 ? 773  LEU A CD1   1 
ATOM   3670 C CD2   . LEU A 1 477 ? 4.469   21.273  16.123  1.00 32.91 ? 773  LEU A CD2   1 
ATOM   3671 N N     . PRO A 1 478 ? 3.334   26.581  16.768  1.00 34.89 ? 774  PRO A N     1 
ATOM   3672 C CA    . PRO A 1 478 ? 3.051   27.936  16.290  1.00 34.98 ? 774  PRO A CA    1 
ATOM   3673 C C     . PRO A 1 478 ? 3.598   28.237  14.896  1.00 35.03 ? 774  PRO A C     1 
ATOM   3674 O O     . PRO A 1 478 ? 3.033   29.056  14.182  1.00 34.88 ? 774  PRO A O     1 
ATOM   3675 C CB    . PRO A 1 478 ? 3.752   28.814  17.327  1.00 35.07 ? 774  PRO A CB    1 
ATOM   3676 C CG    . PRO A 1 478 ? 4.851   27.974  17.840  1.00 35.00 ? 774  PRO A CG    1 
ATOM   3677 C CD    . PRO A 1 478 ? 4.290   26.594  17.889  1.00 34.96 ? 774  PRO A CD    1 
ATOM   3678 N N     . ASP A 1 479 ? 4.685   27.577  14.516  1.00 35.18 ? 775  ASP A N     1 
ATOM   3679 C CA    . ASP A 1 479 ? 5.252   27.759  13.182  1.00 35.42 ? 775  ASP A CA    1 
ATOM   3680 C C     . ASP A 1 479 ? 4.403   27.135  12.078  1.00 35.46 ? 775  ASP A C     1 
ATOM   3681 O O     . ASP A 1 479 ? 4.758   27.222  10.904  1.00 35.49 ? 775  ASP A O     1 
ATOM   3682 C CB    . ASP A 1 479 ? 6.656   27.170  13.123  1.00 35.68 ? 775  ASP A CB    1 
ATOM   3683 C CG    . ASP A 1 479 ? 7.603   27.856  14.079  1.00 36.53 ? 775  ASP A CG    1 
ATOM   3684 O OD1   . ASP A 1 479 ? 7.097   28.491  15.032  1.00 37.46 ? 775  ASP A OD1   1 
ATOM   3685 O OD2   . ASP A 1 479 ? 8.839   27.761  13.888  1.00 37.72 ? 775  ASP A OD2   1 
ATOM   3686 N N     . ILE A 1 480 ? 3.288   26.508  12.440  1.00 35.49 ? 776  ILE A N     1 
ATOM   3687 C CA    . ILE A 1 480 ? 2.406   25.901  11.444  1.00 35.63 ? 776  ILE A CA    1 
ATOM   3688 C C     . ILE A 1 480 ? 1.897   26.930  10.429  1.00 35.81 ? 776  ILE A C     1 
ATOM   3689 O O     . ILE A 1 480 ? 1.666   26.590  9.274   1.00 35.95 ? 776  ILE A O     1 
ATOM   3690 C CB    . ILE A 1 480 ? 1.202   25.167  12.105  1.00 35.69 ? 776  ILE A CB    1 
ATOM   3691 C CG1   . ILE A 1 480 ? 0.720   23.991  11.248  1.00 35.26 ? 776  ILE A CG1   1 
ATOM   3692 C CG2   . ILE A 1 480 ? 0.042   26.132  12.372  1.00 36.16 ? 776  ILE A CG2   1 
ATOM   3693 C CD1   . ILE A 1 480 ? 1.772   22.953  10.946  1.00 34.89 ? 776  ILE A CD1   1 
ATOM   3694 N N     . THR A 1 481 ? 1.736   28.181  10.859  1.00 36.12 ? 777  THR A N     1 
ATOM   3695 C CA    . THR A 1 481 ? 1.249   29.260  9.986   1.00 36.35 ? 777  THR A CA    1 
ATOM   3696 C C     . THR A 1 481 ? 2.356   30.192  9.495   1.00 36.34 ? 777  THR A C     1 
ATOM   3697 O O     . THR A 1 481 ? 2.074   31.223  8.888   1.00 36.30 ? 777  THR A O     1 
ATOM   3698 C CB    . THR A 1 481 ? 0.188   30.120  10.709  1.00 36.43 ? 777  THR A CB    1 
ATOM   3699 O OG1   . THR A 1 481 ? 0.731   30.618  11.937  1.00 36.79 ? 777  THR A OG1   1 
ATOM   3700 C CG2   . THR A 1 481 ? -1.055  29.305  11.013  1.00 36.74 ? 777  THR A CG2   1 
ATOM   3701 N N     . SER A 1 482 ? 3.610   29.827  9.746   1.00 36.50 ? 778  SER A N     1 
ATOM   3702 C CA    . SER A 1 482 ? 4.749   30.654  9.341   1.00 36.59 ? 778  SER A CA    1 
ATOM   3703 C C     . SER A 1 482 ? 4.762   30.848  7.822   1.00 36.76 ? 778  SER A C     1 
ATOM   3704 O O     . SER A 1 482 ? 4.274   29.998  7.069   1.00 36.76 ? 778  SER A O     1 
ATOM   3705 C CB    . SER A 1 482 ? 6.071   30.030  9.804   1.00 36.50 ? 778  SER A CB    1 
ATOM   3706 O OG    . SER A 1 482 ? 7.073   31.016  9.965   1.00 36.47 ? 778  SER A OG    1 
ATOM   3707 N N     . ARG A 1 483 ? 5.306   31.979  7.386   1.00 36.88 ? 779  ARG A N     1 
ATOM   3708 C CA    . ARG A 1 483 ? 5.387   32.298  5.957   1.00 37.02 ? 779  ARG A CA    1 
ATOM   3709 C C     . ARG A 1 483 ? 6.653   31.727  5.361   1.00 36.91 ? 779  ARG A C     1 
ATOM   3710 O O     . ARG A 1 483 ? 6.752   31.587  4.146   1.00 36.78 ? 779  ARG A O     1 
ATOM   3711 C CB    . ARG A 1 483 ? 5.332   33.811  5.697   1.00 37.22 ? 779  ARG A CB    1 
ATOM   3712 C CG    . ARG A 1 483 ? 3.911   34.395  5.519   1.00 37.74 ? 779  ARG A CG    1 
ATOM   3713 C CD    . ARG A 1 483 ? 2.856   33.796  6.471   1.00 38.45 ? 779  ARG A CD    1 
ATOM   3714 N NE    . ARG A 1 483 ? 2.437   34.669  7.573   1.00 38.96 ? 779  ARG A NE    1 
ATOM   3715 C CZ    . ARG A 1 483 ? 3.234   35.186  8.512   1.00 39.44 ? 779  ARG A CZ    1 
ATOM   3716 N NH1   . ARG A 1 483 ? 4.543   34.975  8.510   1.00 40.12 ? 779  ARG A NH1   1 
ATOM   3717 N NH2   . ARG A 1 483 ? 2.715   35.946  9.465   1.00 39.21 ? 779  ARG A NH2   1 
ATOM   3718 N N     . ASN A 1 484 ? 7.624   31.404  6.210   1.00 37.01 ? 780  ASN A N     1 
ATOM   3719 C CA    . ASN A 1 484 ? 8.847   30.767  5.741   1.00 37.17 ? 780  ASN A CA    1 
ATOM   3720 C C     . ASN A 1 484 ? 8.586   29.299  5.391   1.00 37.02 ? 780  ASN A C     1 
ATOM   3721 O O     . ASN A 1 484 ? 8.114   28.528  6.229   1.00 37.05 ? 780  ASN A O     1 
ATOM   3722 C CB    . ASN A 1 484 ? 9.958   30.860  6.780   1.00 37.24 ? 780  ASN A CB    1 
ATOM   3723 C CG    . ASN A 1 484 ? 11.203  30.115  6.346   1.00 37.78 ? 780  ASN A CG    1 
ATOM   3724 O OD1   . ASN A 1 484 ? 11.688  29.234  7.050   1.00 39.17 ? 780  ASN A OD1   1 
ATOM   3725 N ND2   . ASN A 1 484 ? 11.703  30.437  5.158   1.00 38.33 ? 780  ASN A ND2   1 
ATOM   3726 N N     . PHE A 1 485 ? 8.896   28.920  4.157   1.00 36.84 ? 781  PHE A N     1 
ATOM   3727 C CA    . PHE A 1 485 ? 8.558   27.591  3.677   1.00 36.82 ? 781  PHE A CA    1 
ATOM   3728 C C     . PHE A 1 485 ? 9.173   26.516  4.547   1.00 36.85 ? 781  PHE A C     1 
ATOM   3729 O O     . PHE A 1 485 ? 8.493   25.574  4.960   1.00 36.91 ? 781  PHE A O     1 
ATOM   3730 C CB    . PHE A 1 485 ? 9.021   27.392  2.241   1.00 36.92 ? 781  PHE A CB    1 
ATOM   3731 C CG    . PHE A 1 485 ? 8.850   25.985  1.751   1.00 37.31 ? 781  PHE A CG    1 
ATOM   3732 C CD1   . PHE A 1 485 ? 7.629   25.562  1.244   1.00 37.48 ? 781  PHE A CD1   1 
ATOM   3733 C CD2   . PHE A 1 485 ? 9.905   25.077  1.813   1.00 37.59 ? 781  PHE A CD2   1 
ATOM   3734 C CE1   . PHE A 1 485 ? 7.460   24.263  0.792   1.00 37.72 ? 781  PHE A CE1   1 
ATOM   3735 C CE2   . PHE A 1 485 ? 9.745   23.775  1.363   1.00 37.76 ? 781  PHE A CE2   1 
ATOM   3736 C CZ    . PHE A 1 485 ? 8.519   23.367  0.850   1.00 37.83 ? 781  PHE A CZ    1 
ATOM   3737 N N     . ASN A 1 486 ? 10.463  26.667  4.821   1.00 36.88 ? 782  ASN A N     1 
ATOM   3738 C CA    . ASN A 1 486 ? 11.218  25.661  5.572   1.00 36.85 ? 782  ASN A CA    1 
ATOM   3739 C C     . ASN A 1 486 ? 10.702  25.500  6.995   1.00 36.59 ? 782  ASN A C     1 
ATOM   3740 O O     . ASN A 1 486 ? 10.432  24.384  7.444   1.00 36.68 ? 782  ASN A O     1 
ATOM   3741 C CB    . ASN A 1 486 ? 12.697  26.029  5.602   1.00 36.95 ? 782  ASN A CB    1 
ATOM   3742 C CG    . ASN A 1 486 ? 13.303  26.092  4.216   1.00 37.60 ? 782  ASN A CG    1 
ATOM   3743 O OD1   . ASN A 1 486 ? 13.284  25.108  3.472   1.00 38.37 ? 782  ASN A OD1   1 
ATOM   3744 N ND2   . ASN A 1 486 ? 13.838  27.255  3.858   1.00 38.02 ? 782  ASN A ND2   1 
ATOM   3745 N N     . VAL A 1 487 ? 10.562  26.630  7.684   1.00 36.21 ? 783  VAL A N     1 
ATOM   3746 C CA    . VAL A 1 487 ? 10.024  26.673  9.044   1.00 35.88 ? 783  VAL A CA    1 
ATOM   3747 C C     . VAL A 1 487 ? 8.601   26.111  9.111   1.00 35.64 ? 783  VAL A C     1 
ATOM   3748 O O     . VAL A 1 487 ? 8.283   25.332  10.006  1.00 35.52 ? 783  VAL A O     1 
ATOM   3749 C CB    . VAL A 1 487 ? 10.053  28.116  9.615   1.00 35.88 ? 783  VAL A CB    1 
ATOM   3750 C CG1   . VAL A 1 487 ? 9.269   28.203  10.905  1.00 35.95 ? 783  VAL A CG1   1 
ATOM   3751 C CG2   . VAL A 1 487 ? 11.487  28.573  9.848   1.00 35.54 ? 783  VAL A CG2   1 
ATOM   3752 N N     . ARG A 1 488 ? 7.752   26.500  8.167   1.00 35.51 ? 784  ARG A N     1 
ATOM   3753 C CA    . ARG A 1 488 ? 6.383   25.987  8.128   1.00 35.61 ? 784  ARG A CA    1 
ATOM   3754 C C     . ARG A 1 488 ? 6.366   24.484  7.884   1.00 35.35 ? 784  ARG A C     1 
ATOM   3755 O O     . ARG A 1 488 ? 5.543   23.766  8.450   1.00 35.23 ? 784  ARG A O     1 
ATOM   3756 C CB    . ARG A 1 488 ? 5.555   26.685  7.047   1.00 35.84 ? 784  ARG A CB    1 
ATOM   3757 C CG    . ARG A 1 488 ? 4.154   26.081  6.872   1.00 36.58 ? 784  ARG A CG    1 
ATOM   3758 C CD    . ARG A 1 488 ? 3.367   26.653  5.694   1.00 37.58 ? 784  ARG A CD    1 
ATOM   3759 N NE    . ARG A 1 488 ? 4.189   26.905  4.509   1.00 37.86 ? 784  ARG A NE    1 
ATOM   3760 C CZ    . ARG A 1 488 ? 4.541   28.116  4.071   1.00 38.42 ? 784  ARG A CZ    1 
ATOM   3761 N NH1   . ARG A 1 488 ? 4.149   29.220  4.702   1.00 38.33 ? 784  ARG A NH1   1 
ATOM   3762 N NH2   . ARG A 1 488 ? 5.288   28.230  2.981   1.00 39.04 ? 784  ARG A NH2   1 
ATOM   3763 N N     . SER A 1 489 ? 7.274   24.018  7.035   1.00 35.17 ? 785  SER A N     1 
ATOM   3764 C CA    . SER A 1 489 ? 7.320   22.603  6.669   1.00 35.14 ? 785  SER A CA    1 
ATOM   3765 C C     . SER A 1 489 ? 7.692   21.693  7.837   1.00 35.15 ? 785  SER A C     1 
ATOM   3766 O O     . SER A 1 489 ? 7.129   20.608  7.975   1.00 34.98 ? 785  SER A O     1 
ATOM   3767 C CB    . SER A 1 489 ? 8.291   22.382  5.514   1.00 35.11 ? 785  SER A CB    1 
ATOM   3768 O OG    . SER A 1 489 ? 7.774   22.935  4.319   1.00 35.22 ? 785  SER A OG    1 
ATOM   3769 N N     . PHE A 1 490 ? 8.638   22.136  8.665   1.00 35.22 ? 786  PHE A N     1 
ATOM   3770 C CA    . PHE A 1 490 ? 9.097   21.359  9.824   1.00 35.38 ? 786  PHE A CA    1 
ATOM   3771 C C     . PHE A 1 490 ? 7.942   21.118  10.789  1.00 35.25 ? 786  PHE A C     1 
ATOM   3772 O O     . PHE A 1 490 ? 7.689   19.991  11.207  1.00 35.03 ? 786  PHE A O     1 
ATOM   3773 C CB    . PHE A 1 490 ? 10.252  22.090  10.529  1.00 35.53 ? 786  PHE A CB    1 
ATOM   3774 C CG    . PHE A 1 490 ? 11.009  21.256  11.562  1.00 36.66 ? 786  PHE A CG    1 
ATOM   3775 C CD1   . PHE A 1 490 ? 10.913  19.860  11.613  1.00 37.40 ? 786  PHE A CD1   1 
ATOM   3776 C CD2   . PHE A 1 490 ? 11.870  21.887  12.463  1.00 37.47 ? 786  PHE A CD2   1 
ATOM   3777 C CE1   . PHE A 1 490 ? 11.633  19.125  12.567  1.00 37.46 ? 786  PHE A CE1   1 
ATOM   3778 C CE2   . PHE A 1 490 ? 12.593  21.153  13.412  1.00 37.57 ? 786  PHE A CE2   1 
ATOM   3779 C CZ    . PHE A 1 490 ? 12.472  19.774  13.461  1.00 37.53 ? 786  PHE A CZ    1 
ATOM   3780 N N     . ALA A 1 491 ? 7.240   22.194  11.120  1.00 35.34 ? 787  ALA A N     1 
ATOM   3781 C CA    . ALA A 1 491 ? 6.042   22.129  11.958  1.00 35.32 ? 787  ALA A CA    1 
ATOM   3782 C C     . ALA A 1 491 ? 4.956   21.269  11.324  1.00 35.27 ? 787  ALA A C     1 
ATOM   3783 O O     . ALA A 1 491 ? 4.260   20.532  12.014  1.00 35.01 ? 787  ALA A O     1 
ATOM   3784 C CB    . ALA A 1 491 ? 5.514   23.527  12.223  1.00 35.36 ? 787  ALA A CB    1 
ATOM   3785 N N     . GLU A 1 492 ? 4.812   21.371  10.010  1.00 35.52 ? 788  GLU A N     1 
ATOM   3786 C CA    . GLU A 1 492 ? 3.866   20.526  9.292   1.00 35.92 ? 788  GLU A CA    1 
ATOM   3787 C C     . GLU A 1 492 ? 4.165   19.050  9.535   1.00 35.85 ? 788  GLU A C     1 
ATOM   3788 O O     . GLU A 1 492 ? 3.267   18.300  9.886   1.00 35.75 ? 788  GLU A O     1 
ATOM   3789 C CB    . GLU A 1 492 ? 3.845   20.860  7.795   1.00 36.04 ? 788  GLU A CB    1 
ATOM   3790 C CG    . GLU A 1 492 ? 2.800   21.922  7.456   1.00 37.64 ? 788  GLU A CG    1 
ATOM   3791 C CD    . GLU A 1 492 ? 2.979   22.570  6.075   1.00 39.74 ? 788  GLU A CD    1 
ATOM   3792 O OE1   . GLU A 1 492 ? 3.639   21.962  5.197   1.00 41.02 ? 788  GLU A OE1   1 
ATOM   3793 O OE2   . GLU A 1 492 ? 2.439   23.687  5.861   1.00 40.58 ? 788  GLU A OE2   1 
ATOM   3794 N N     . ARG A 1 493 ? 5.431   18.661  9.378   1.00 35.96 ? 789  ARG A N     1 
ATOM   3795 C CA    . ARG A 1 493 ? 5.879   17.277  9.599   1.00 36.05 ? 789  ARG A CA    1 
ATOM   3796 C C     . ARG A 1 493 ? 5.616   16.818  11.029  1.00 35.85 ? 789  ARG A C     1 
ATOM   3797 O O     . ARG A 1 493 ? 5.013   15.767  11.263  1.00 35.82 ? 789  ARG A O     1 
ATOM   3798 C CB    . ARG A 1 493 ? 7.374   17.146  9.302   1.00 36.20 ? 789  ARG A CB    1 
ATOM   3799 C CG    . ARG A 1 493 ? 7.715   17.239  7.826   1.00 37.12 ? 789  ARG A CG    1 
ATOM   3800 C CD    . ARG A 1 493 ? 9.144   16.761  7.520   1.00 38.35 ? 789  ARG A CD    1 
ATOM   3801 N NE    . ARG A 1 493 ? 10.181  17.595  8.130   1.00 38.62 ? 789  ARG A NE    1 
ATOM   3802 C CZ    . ARG A 1 493 ? 10.577  18.784  7.675   1.00 39.13 ? 789  ARG A CZ    1 
ATOM   3803 N NH1   . ARG A 1 493 ? 10.019  19.329  6.595   1.00 39.34 ? 789  ARG A NH1   1 
ATOM   3804 N NH2   . ARG A 1 493 ? 11.528  19.447  8.322   1.00 39.28 ? 789  ARG A NH2   1 
ATOM   3805 N N     . MET A 1 494 ? 6.089   17.615  11.978  1.00 35.60 ? 790  MET A N     1 
ATOM   3806 C CA    . MET A 1 494 ? 5.803   17.386  13.388  1.00 35.29 ? 790  MET A CA    1 
ATOM   3807 C C     . MET A 1 494 ? 4.307   17.198  13.600  1.00 34.86 ? 790  MET A C     1 
ATOM   3808 O O     . MET A 1 494 ? 3.898   16.309  14.331  1.00 34.95 ? 790  MET A O     1 
ATOM   3809 C CB    . MET A 1 494 ? 6.273   18.559  14.239  1.00 35.35 ? 790  MET A CB    1 
ATOM   3810 C CG    . MET A 1 494 ? 7.756   18.833  14.198  1.00 35.62 ? 790  MET A CG    1 
ATOM   3811 S SD    . MET A 1 494 ? 8.088   20.283  15.215  1.00 36.74 ? 790  MET A SD    1 
ATOM   3812 C CE    . MET A 1 494 ? 9.758   20.716  14.721  1.00 36.17 ? 790  MET A CE    1 
ATOM   3813 N N     . ALA A 1 495 ? 3.492   18.036  12.961  1.00 34.50 ? 791  ALA A N     1 
ATOM   3814 C CA    . ALA A 1 495 ? 2.033   17.929  13.085  1.00 34.09 ? 791  ALA A CA    1 
ATOM   3815 C C     . ALA A 1 495 ? 1.631   16.483  12.855  1.00 33.72 ? 791  ALA A C     1 
ATOM   3816 O O     . ALA A 1 495 ? 1.014   15.854  13.702  1.00 33.45 ? 791  ALA A O     1 
ATOM   3817 C CB    . ALA A 1 495 ? 1.336   18.845  12.088  1.00 33.97 ? 791  ALA A CB    1 
ATOM   3818 N N     . MET A 1 496 ? 2.058   15.960  11.718  1.00 33.57 ? 792  MET A N     1 
ATOM   3819 C CA    . MET A 1 496 ? 1.733   14.606  11.285  1.00 33.58 ? 792  MET A CA    1 
ATOM   3820 C C     . MET A 1 496 ? 2.396   13.575  12.204  1.00 33.49 ? 792  MET A C     1 
ATOM   3821 O O     . MET A 1 496 ? 1.760   12.620  12.661  1.00 33.31 ? 792  MET A O     1 
ATOM   3822 C CB    . MET A 1 496 ? 2.206   14.388  9.834   1.00 33.59 ? 792  MET A CB    1 
ATOM   3823 C CG    . MET A 1 496 ? 2.093   15.616  8.921   1.00 33.97 ? 792  MET A CG    1 
ATOM   3824 S SD    . MET A 1 496 ? 2.629   15.442  7.204   1.00 34.52 ? 792  MET A SD    1 
ATOM   3825 C CE    . MET A 1 496 ? 3.524   13.891  7.233   1.00 34.09 ? 792  MET A CE    1 
ATOM   3826 N N     . ASN A 1 497 ? 3.678   13.797  12.474  1.00 33.40 ? 793  ASN A N     1 
ATOM   3827 C CA    . ASN A 1 497 ? 4.520   12.841  13.201  1.00 33.34 ? 793  ASN A CA    1 
ATOM   3828 C C     . ASN A 1 497 ? 4.173   12.660  14.681  1.00 33.21 ? 793  ASN A C     1 
ATOM   3829 O O     . ASN A 1 497 ? 4.241   11.557  15.209  1.00 33.24 ? 793  ASN A O     1 
ATOM   3830 C CB    . ASN A 1 497 ? 5.990   13.266  13.077  1.00 33.40 ? 793  ASN A CB    1 
ATOM   3831 C CG    . ASN A 1 497 ? 6.932   12.380  13.878  1.00 33.42 ? 793  ASN A CG    1 
ATOM   3832 O OD1   . ASN A 1 497 ? 7.347   12.737  14.979  1.00 33.29 ? 793  ASN A OD1   1 
ATOM   3833 N ND2   . ASN A 1 497 ? 7.264   11.218  13.333  1.00 33.36 ? 793  ASN A ND2   1 
ATOM   3834 N N     . THR A 1 498 ? 3.807   13.744  15.347  1.00 33.21 ? 794  THR A N     1 
ATOM   3835 C CA    . THR A 1 498 ? 3.749   13.757  16.807  1.00 33.10 ? 794  THR A CA    1 
ATOM   3836 C C     . THR A 1 498 ? 2.675   12.847  17.390  1.00 33.10 ? 794  THR A C     1 
ATOM   3837 O O     . THR A 1 498 ? 2.947   12.139  18.346  1.00 33.25 ? 794  THR A O     1 
ATOM   3838 C CB    . THR A 1 498 ? 3.623   15.199  17.366  1.00 33.13 ? 794  THR A CB    1 
ATOM   3839 O OG1   . THR A 1 498 ? 4.862   15.890  17.166  1.00 32.57 ? 794  THR A OG1   1 
ATOM   3840 C CG2   . THR A 1 498 ? 3.307   15.192  18.858  1.00 33.08 ? 794  THR A CG2   1 
ATOM   3841 N N     . PRO A 1 499 ? 1.465   12.826  16.810  1.00 33.09 ? 795  PRO A N     1 
ATOM   3842 C CA    . PRO A 1 499 ? 0.475   11.894  17.361  1.00 33.09 ? 795  PRO A CA    1 
ATOM   3843 C C     . PRO A 1 499 ? 0.881   10.426  17.279  1.00 33.12 ? 795  PRO A C     1 
ATOM   3844 O O     . PRO A 1 499 ? 0.317   9.611   18.001  1.00 33.16 ? 795  PRO A O     1 
ATOM   3845 C CB    . PRO A 1 499 ? -0.761  12.134  16.494  1.00 33.02 ? 795  PRO A CB    1 
ATOM   3846 C CG    . PRO A 1 499 ? -0.599  13.494  15.979  1.00 33.11 ? 795  PRO A CG    1 
ATOM   3847 C CD    . PRO A 1 499 ? 0.877   13.696  15.784  1.00 33.08 ? 795  PRO A CD    1 
ATOM   3848 N N     . ILE A 1 500 ? 1.833   10.098  16.402  1.00 33.08 ? 796  ILE A N     1 
ATOM   3849 C CA    . ILE A 1 500 ? 2.356   8.733   16.286  1.00 32.92 ? 796  ILE A CA    1 
ATOM   3850 C C     . ILE A 1 500 ? 3.392   8.469   17.379  1.00 32.85 ? 796  ILE A C     1 
ATOM   3851 O O     . ILE A 1 500 ? 3.209   7.615   18.242  1.00 32.64 ? 796  ILE A O     1 
ATOM   3852 C CB    . ILE A 1 500 ? 3.001   8.489   14.901  1.00 32.69 ? 796  ILE A CB    1 
ATOM   3853 C CG1   . ILE A 1 500 ? 1.971   8.631   13.783  1.00 32.17 ? 796  ILE A CG1   1 
ATOM   3854 C CG2   . ILE A 1 500 ? 3.621   7.113   14.844  1.00 32.90 ? 796  ILE A CG2   1 
ATOM   3855 C CD1   . ILE A 1 500 ? 2.598   8.890   12.421  1.00 30.97 ? 796  ILE A CD1   1 
ATOM   3856 N N     . GLN A 1 501 ? 4.475   9.227   17.337  1.00 32.99 ? 797  GLN A N     1 
ATOM   3857 C CA    . GLN A 1 501 ? 5.575   9.056   18.282  1.00 33.18 ? 797  GLN A CA    1 
ATOM   3858 C C     . GLN A 1 501 ? 5.109   9.174   19.735  1.00 32.83 ? 797  GLN A C     1 
ATOM   3859 O O     . GLN A 1 501 ? 5.561   8.434   20.609  1.00 32.81 ? 797  GLN A O     1 
ATOM   3860 C CB    . GLN A 1 501 ? 6.661   10.091  17.996  1.00 33.43 ? 797  GLN A CB    1 
ATOM   3861 C CG    . GLN A 1 501 ? 8.018   9.736   18.561  1.00 33.96 ? 797  GLN A CG    1 
ATOM   3862 C CD    . GLN A 1 501 ? 9.114   10.621  18.018  1.00 34.82 ? 797  GLN A CD    1 
ATOM   3863 O OE1   . GLN A 1 501 ? 10.080  10.907  18.714  1.00 35.22 ? 797  GLN A OE1   1 
ATOM   3864 N NE2   . GLN A 1 501 ? 8.966   11.069  16.772  1.00 35.66 ? 797  GLN A NE2   1 
ATOM   3865 N N     . GLY A 1 502 ? 4.191   10.103  19.972  1.00 32.48 ? 798  GLY A N     1 
ATOM   3866 C CA    . GLY A 1 502 ? 3.655   10.357  21.307  1.00 32.12 ? 798  GLY A CA    1 
ATOM   3867 C C     . GLY A 1 502 ? 2.671   9.312   21.775  1.00 31.73 ? 798  GLY A C     1 
ATOM   3868 O O     . GLY A 1 502 ? 2.687   8.927   22.939  1.00 31.50 ? 798  GLY A O     1 
ATOM   3869 N N     . SER A 1 503 ? 1.812   8.853   20.873  1.00 31.57 ? 799  SER A N     1 
ATOM   3870 C CA    . SER A 1 503 ? 0.851   7.804   21.202  1.00 31.53 ? 799  SER A CA    1 
ATOM   3871 C C     . SER A 1 503 ? 1.557   6.482   21.467  1.00 31.55 ? 799  SER A C     1 
ATOM   3872 O O     . SER A 1 503 ? 1.150   5.729   22.342  1.00 31.52 ? 799  SER A O     1 
ATOM   3873 C CB    . SER A 1 503 ? -0.166  7.617   20.083  1.00 31.55 ? 799  SER A CB    1 
ATOM   3874 O OG    . SER A 1 503 ? -1.073  8.702   20.033  1.00 31.26 ? 799  SER A OG    1 
ATOM   3875 N N     . ALA A 1 504 ? 2.603   6.196   20.701  1.00 31.61 ? 800  ALA A N     1 
ATOM   3876 C CA    . ALA A 1 504 ? 3.439   5.025   20.965  1.00 31.73 ? 800  ALA A CA    1 
ATOM   3877 C C     . ALA A 1 504 ? 4.078   5.156   22.347  1.00 31.84 ? 800  ALA A C     1 
ATOM   3878 O O     . ALA A 1 504 ? 4.249   4.168   23.069  1.00 31.77 ? 800  ALA A O     1 
ATOM   3879 C CB    . ALA A 1 504 ? 4.517   4.875   19.894  1.00 31.70 ? 800  ALA A CB    1 
ATOM   3880 N N     . ALA A 1 505 ? 4.439   6.387   22.699  1.00 32.03 ? 801  ALA A N     1 
ATOM   3881 C CA    . ALA A 1 505 ? 4.983   6.690   24.021  1.00 32.17 ? 801  ALA A CA    1 
ATOM   3882 C C     . ALA A 1 505 ? 3.929   6.425   25.086  1.00 32.23 ? 801  ALA A C     1 
ATOM   3883 O O     . ALA A 1 505 ? 4.175   5.693   26.041  1.00 32.07 ? 801  ALA A O     1 
ATOM   3884 C CB    . ALA A 1 505 ? 5.459   8.137   24.089  1.00 32.12 ? 801  ALA A CB    1 
ATOM   3885 N N     . ASP A 1 506 ? 2.750   7.012   24.897  1.00 32.48 ? 802  ASP A N     1 
ATOM   3886 C CA    . ASP A 1 506 ? 1.603   6.835   25.809  1.00 32.76 ? 802  ASP A CA    1 
ATOM   3887 C C     . ASP A 1 506 ? 1.317   5.390   26.201  1.00 32.78 ? 802  ASP A C     1 
ATOM   3888 O O     . ASP A 1 506 ? 1.063   5.091   27.361  1.00 32.92 ? 802  ASP A O     1 
ATOM   3889 C CB    . ASP A 1 506 ? 0.330   7.348   25.153  1.00 32.84 ? 802  ASP A CB    1 
ATOM   3890 C CG    . ASP A 1 506 ? 0.263   8.855   25.072  1.00 33.70 ? 802  ASP A CG    1 
ATOM   3891 O OD1   . ASP A 1 506 ? 1.000   9.551   25.813  1.00 34.42 ? 802  ASP A OD1   1 
ATOM   3892 O OD2   . ASP A 1 506 ? -0.554  9.342   24.256  1.00 34.66 ? 802  ASP A OD2   1 
ATOM   3893 N N     . ILE A 1 507 ? 1.311   4.511   25.207  1.00 32.89 ? 803  ILE A N     1 
ATOM   3894 C CA    . ILE A 1 507 ? 1.014   3.090   25.406  1.00 32.89 ? 803  ILE A CA    1 
ATOM   3895 C C     . ILE A 1 507 ? 2.062   2.358   26.236  1.00 33.06 ? 803  ILE A C     1 
ATOM   3896 O O     . ILE A 1 507 ? 1.724   1.637   27.173  1.00 33.02 ? 803  ILE A O     1 
ATOM   3897 C CB    . ILE A 1 507 ? 0.889   2.361   24.060  1.00 32.84 ? 803  ILE A CB    1 
ATOM   3898 C CG1   . ILE A 1 507 ? -0.489  2.629   23.444  1.00 32.73 ? 803  ILE A CG1   1 
ATOM   3899 C CG2   . ILE A 1 507 ? 1.106   0.853   24.248  1.00 32.81 ? 803  ILE A CG2   1 
ATOM   3900 C CD1   . ILE A 1 507 ? -0.448  2.976   21.976  1.00 32.01 ? 803  ILE A CD1   1 
ATOM   3901 N N     . ILE A 1 508 ? 3.328   2.525   25.878  1.00 33.24 ? 804  ILE A N     1 
ATOM   3902 C CA    . ILE A 1 508 ? 4.393   1.874   26.613  1.00 33.43 ? 804  ILE A CA    1 
ATOM   3903 C C     . ILE A 1 508 ? 4.320   2.300   28.082  1.00 33.63 ? 804  ILE A C     1 
ATOM   3904 O O     . ILE A 1 508 ? 4.447   1.464   28.975  1.00 33.72 ? 804  ILE A O     1 
ATOM   3905 C CB    . ILE A 1 508 ? 5.789   2.171   26.005  1.00 33.46 ? 804  ILE A CB    1 
ATOM   3906 C CG1   . ILE A 1 508 ? 6.843   1.224   26.584  1.00 33.44 ? 804  ILE A CG1   1 
ATOM   3907 C CG2   . ILE A 1 508 ? 6.207   3.618   26.222  1.00 33.97 ? 804  ILE A CG2   1 
ATOM   3908 C CD1   . ILE A 1 508 ? 7.331   0.204   25.603  1.00 33.23 ? 804  ILE A CD1   1 
ATOM   3909 N N     . LYS A 1 509 ? 4.075   3.589   28.324  1.00 33.82 ? 805  LYS A N     1 
ATOM   3910 C CA    . LYS A 1 509 ? 3.983   4.115   29.689  1.00 33.94 ? 805  LYS A CA    1 
ATOM   3911 C C     . LYS A 1 509 ? 2.815   3.486   30.429  1.00 33.81 ? 805  LYS A C     1 
ATOM   3912 O O     . LYS A 1 509 ? 2.949   3.086   31.587  1.00 33.94 ? 805  LYS A O     1 
ATOM   3913 C CB    . LYS A 1 509 ? 3.837   5.638   29.691  1.00 34.03 ? 805  LYS A CB    1 
ATOM   3914 C CG    . LYS A 1 509 ? 5.109   6.380   29.295  1.00 34.63 ? 805  LYS A CG    1 
ATOM   3915 C CD    . LYS A 1 509 ? 5.025   7.861   29.659  1.00 35.26 ? 805  LYS A CD    1 
ATOM   3916 C CE    . LYS A 1 509 ? 5.894   8.722   28.765  1.00 35.57 ? 805  LYS A CE    1 
ATOM   3917 N NZ    . LYS A 1 509 ? 5.997   10.136  29.260  1.00 35.59 ? 805  LYS A NZ    1 
ATOM   3918 N N     . LYS A 1 510 ? 1.674   3.390   29.755  1.00 33.50 ? 806  LYS A N     1 
ATOM   3919 C CA    . LYS A 1 510 ? 0.521   2.733   30.339  1.00 33.23 ? 806  LYS A CA    1 
ATOM   3920 C C     . LYS A 1 510 ? 0.849   1.280   30.636  1.00 33.06 ? 806  LYS A C     1 
ATOM   3921 O O     . LYS A 1 510 ? 0.487   0.763   31.691  1.00 33.00 ? 806  LYS A O     1 
ATOM   3922 C CB    . LYS A 1 510 ? -0.699  2.826   29.429  1.00 33.23 ? 806  LYS A CB    1 
ATOM   3923 C CG    . LYS A 1 510 ? -1.891  2.031   29.962  1.00 33.21 ? 806  LYS A CG    1 
ATOM   3924 C CD    . LYS A 1 510 ? -3.170  2.835   29.951  1.00 33.40 ? 806  LYS A CD    1 
ATOM   3925 C CE    . LYS A 1 510 ? -4.350  2.030   30.475  1.00 33.61 ? 806  LYS A CE    1 
ATOM   3926 N NZ    . LYS A 1 510 ? -4.150  0.554   30.429  1.00 33.58 ? 806  LYS A NZ    1 
ATOM   3927 N N     . ALA A 1 511 ? 1.539   0.629   29.706  1.00 32.95 ? 807  ALA A N     1 
ATOM   3928 C CA    . ALA A 1 511 ? 1.973   -0.757  29.895  1.00 32.87 ? 807  ALA A CA    1 
ATOM   3929 C C     . ALA A 1 511 ? 2.720   -0.908  31.214  1.00 32.84 ? 807  ALA A C     1 
ATOM   3930 O O     . ALA A 1 511 ? 2.390   -1.782  32.017  1.00 32.93 ? 807  ALA A O     1 
ATOM   3931 C CB    . ALA A 1 511 ? 2.857   -1.208  28.745  1.00 32.80 ? 807  ALA A CB    1 
ATOM   3932 N N     . MET A 1 512 ? 3.704   -0.032  31.434  1.00 32.66 ? 808  MET A N     1 
ATOM   3933 C CA    . MET A 1 512 ? 4.555   -0.073  32.636  1.00 32.45 ? 808  MET A CA    1 
ATOM   3934 C C     . MET A 1 512 ? 3.754   -0.003  33.933  1.00 32.44 ? 808  MET A C     1 
ATOM   3935 O O     . MET A 1 512 ? 4.014   -0.750  34.868  1.00 32.15 ? 808  MET A O     1 
ATOM   3936 C CB    . MET A 1 512 ? 5.565   1.066   32.623  1.00 32.38 ? 808  MET A CB    1 
ATOM   3937 C CG    . MET A 1 512 ? 6.436   1.111   31.392  1.00 32.25 ? 808  MET A CG    1 
ATOM   3938 S SD    . MET A 1 512 ? 7.953   2.030   31.668  1.00 31.79 ? 808  MET A SD    1 
ATOM   3939 C CE    . MET A 1 512 ? 7.999   3.019   30.182  1.00 31.52 ? 808  MET A CE    1 
ATOM   3940 N N     . ILE A 1 513 ? 2.789   0.908   33.983  1.00 32.65 ? 809  ILE A N     1 
ATOM   3941 C CA    . ILE A 1 513 ? 1.860   0.995   35.115  1.00 32.79 ? 809  ILE A CA    1 
ATOM   3942 C C     . ILE A 1 513 ? 1.203   -0.355  35.361  1.00 32.85 ? 809  ILE A C     1 
ATOM   3943 O O     . ILE A 1 513 ? 1.236   -0.883  36.471  1.00 32.79 ? 809  ILE A O     1 
ATOM   3944 C CB    . ILE A 1 513 ? 0.744   2.054   34.872  1.00 32.85 ? 809  ILE A CB    1 
ATOM   3945 C CG1   . ILE A 1 513 ? 1.194   3.416   35.394  1.00 32.73 ? 809  ILE A CG1   1 
ATOM   3946 C CG2   . ILE A 1 513 ? -0.590  1.632   35.520  1.00 32.42 ? 809  ILE A CG2   1 
ATOM   3947 C CD1   . ILE A 1 513 ? 2.352   3.986   34.620  1.00 32.83 ? 809  ILE A CD1   1 
ATOM   3948 N N     . ASP A 1 514 ? 0.607   -0.902  34.312  1.00 32.90 ? 810  ASP A N     1 
ATOM   3949 C CA    . ASP A 1 514 ? -0.079  -2.177  34.417  1.00 33.13 ? 810  ASP A CA    1 
ATOM   3950 C C     . ASP A 1 514 ? 0.909   -3.276  34.788  1.00 33.00 ? 810  ASP A C     1 
ATOM   3951 O O     . ASP A 1 514 ? 0.603   -4.133  35.611  1.00 32.76 ? 810  ASP A O     1 
ATOM   3952 C CB    . ASP A 1 514 ? -0.796  -2.512  33.106  1.00 33.32 ? 810  ASP A CB    1 
ATOM   3953 C CG    . ASP A 1 514 ? -1.910  -1.523  32.769  1.00 33.79 ? 810  ASP A CG    1 
ATOM   3954 O OD1   . ASP A 1 514 ? -2.444  -0.862  33.687  1.00 34.59 ? 810  ASP A OD1   1 
ATOM   3955 O OD2   . ASP A 1 514 ? -2.253  -1.409  31.574  1.00 34.37 ? 810  ASP A OD2   1 
ATOM   3956 N N     . LEU A 1 515 ? 2.102   -3.210  34.198  1.00 32.97 ? 811  LEU A N     1 
ATOM   3957 C CA    . LEU A 1 515 ? 3.150   -4.216  34.387  1.00 32.77 ? 811  LEU A CA    1 
ATOM   3958 C C     . LEU A 1 515 ? 3.598   -4.321  35.834  1.00 32.65 ? 811  LEU A C     1 
ATOM   3959 O O     . LEU A 1 515 ? 3.787   -5.413  36.358  1.00 32.42 ? 811  LEU A O     1 
ATOM   3960 C CB    . LEU A 1 515 ? 4.361   -3.867  33.533  1.00 32.77 ? 811  LEU A CB    1 
ATOM   3961 C CG    . LEU A 1 515 ? 5.531   -4.841  33.671  1.00 33.11 ? 811  LEU A CG    1 
ATOM   3962 C CD1   . LEU A 1 515 ? 5.120   -6.216  33.146  1.00 32.94 ? 811  LEU A CD1   1 
ATOM   3963 C CD2   . LEU A 1 515 ? 6.757   -4.317  32.947  1.00 32.70 ? 811  LEU A CD2   1 
ATOM   3964 N N     . ASN A 1 516 ? 3.797   -3.170  36.459  1.00 32.72 ? 812  ASN A N     1 
ATOM   3965 C CA    . ASN A 1 516 ? 4.167   -3.104  37.870  1.00 32.73 ? 812  ASN A CA    1 
ATOM   3966 C C     . ASN A 1 516 ? 3.095   -3.721  38.766  1.00 32.60 ? 812  ASN A C     1 
ATOM   3967 O O     . ASN A 1 516 ? 3.407   -4.518  39.644  1.00 32.40 ? 812  ASN A O     1 
ATOM   3968 C CB    . ASN A 1 516 ? 4.421   -1.653  38.292  1.00 32.80 ? 812  ASN A CB    1 
ATOM   3969 C CG    . ASN A 1 516 ? 5.420   -1.542  39.424  1.00 33.17 ? 812  ASN A CG    1 
ATOM   3970 O OD1   . ASN A 1 516 ? 6.599   -1.877  39.265  1.00 34.13 ? 812  ASN A OD1   1 
ATOM   3971 N ND2   . ASN A 1 516 ? 4.961   -1.062  40.572  1.00 33.02 ? 812  ASN A ND2   1 
ATOM   3972 N N     . ALA A 1 517 ? 1.837   -3.349  38.535  1.00 32.54 ? 813  ALA A N     1 
ATOM   3973 C CA    . ALA A 1 517 ? 0.728   -3.872  39.322  1.00 32.58 ? 813  ALA A CA    1 
ATOM   3974 C C     . ALA A 1 517 ? 0.729   -5.391  39.263  1.00 32.80 ? 813  ALA A C     1 
ATOM   3975 O O     . ALA A 1 517 ? 0.712   -6.068  40.284  1.00 32.85 ? 813  ALA A O     1 
ATOM   3976 C CB    . ALA A 1 517 ? -0.580  -3.330  38.809  1.00 32.54 ? 813  ALA A CB    1 
ATOM   3977 N N     . ARG A 1 518 ? 0.792   -5.918  38.050  1.00 33.02 ? 814  ARG A N     1 
ATOM   3978 C CA    . ARG A 1 518 ? 0.750   -7.359  37.826  1.00 33.15 ? 814  ARG A CA    1 
ATOM   3979 C C     . ARG A 1 518 ? 1.905   -8.069  38.539  1.00 33.15 ? 814  ARG A C     1 
ATOM   3980 O O     . ARG A 1 518 ? 1.690   -9.045  39.249  1.00 33.08 ? 814  ARG A O     1 
ATOM   3981 C CB    . ARG A 1 518 ? 0.786   -7.673  36.324  1.00 33.24 ? 814  ARG A CB    1 
ATOM   3982 C CG    . ARG A 1 518 ? -0.312  -6.994  35.465  1.00 33.81 ? 814  ARG A CG    1 
ATOM   3983 C CD    . ARG A 1 518 ? -1.720  -7.476  35.774  1.00 34.42 ? 814  ARG A CD    1 
ATOM   3984 N NE    . ARG A 1 518 ? -1.685  -8.797  36.386  1.00 34.85 ? 814  ARG A NE    1 
ATOM   3985 C CZ    . ARG A 1 518 ? -1.822  -9.955  35.746  1.00 35.37 ? 814  ARG A CZ    1 
ATOM   3986 N NH1   . ARG A 1 518 ? -2.057  -10.001 34.434  1.00 35.56 ? 814  ARG A NH1   1 
ATOM   3987 N NH2   . ARG A 1 518 ? -1.739  -11.086 36.441  1.00 35.07 ? 814  ARG A NH2   1 
ATOM   3988 N N     . LEU A 1 519 ? 3.122   -7.559  38.366  1.00 33.32 ? 815  LEU A N     1 
ATOM   3989 C CA    . LEU A 1 519 ? 4.303   -8.115  39.035  1.00 33.54 ? 815  LEU A CA    1 
ATOM   3990 C C     . LEU A 1 519 ? 4.116   -8.189  40.540  1.00 34.06 ? 815  LEU A C     1 
ATOM   3991 O O     . LEU A 1 519 ? 4.656   -9.072  41.205  1.00 34.23 ? 815  LEU A O     1 
ATOM   3992 C CB    . LEU A 1 519 ? 5.535   -7.259  38.760  1.00 33.41 ? 815  LEU A CB    1 
ATOM   3993 C CG    . LEU A 1 519 ? 6.232   -7.440  37.414  1.00 33.25 ? 815  LEU A CG    1 
ATOM   3994 C CD1   . LEU A 1 519 ? 7.304   -6.384  37.227  1.00 32.94 ? 815  LEU A CD1   1 
ATOM   3995 C CD2   . LEU A 1 519 ? 6.836   -8.824  37.301  1.00 33.23 ? 815  LEU A CD2   1 
ATOM   3996 N N     . LYS A 1 520 ? 3.371   -7.228  41.071  1.00 34.65 ? 816  LYS A N     1 
ATOM   3997 C CA    . LYS A 1 520 ? 3.078   -7.163  42.496  1.00 35.02 ? 816  LYS A CA    1 
ATOM   3998 C C     . LYS A 1 520 ? 2.070   -8.243  42.891  1.00 35.33 ? 816  LYS A C     1 
ATOM   3999 O O     . LYS A 1 520 ? 2.249   -8.930  43.897  1.00 35.38 ? 816  LYS A O     1 
ATOM   4000 C CB    . LYS A 1 520 ? 2.533   -5.778  42.845  1.00 35.05 ? 816  LYS A CB    1 
ATOM   4001 C CG    . LYS A 1 520 ? 2.538   -5.446  44.321  1.00 35.35 ? 816  LYS A CG    1 
ATOM   4002 C CD    . LYS A 1 520 ? 1.900   -4.083  44.582  1.00 35.74 ? 816  LYS A CD    1 
ATOM   4003 C CE    . LYS A 1 520 ? 1.472   -3.929  46.033  1.00 35.62 ? 816  LYS A CE    1 
ATOM   4004 N NZ    . LYS A 1 520 ? 1.273   -2.505  46.419  1.00 35.29 ? 816  LYS A NZ    1 
ATOM   4005 N N     . GLU A 1 521 ? 1.013   -8.388  42.096  1.00 35.68 ? 817  GLU A N     1 
ATOM   4006 C CA    . GLU A 1 521 ? 0.000   -9.407  42.358  1.00 36.04 ? 817  GLU A CA    1 
ATOM   4007 C C     . GLU A 1 521 ? 0.599   -10.800 42.364  1.00 36.19 ? 817  GLU A C     1 
ATOM   4008 O O     . GLU A 1 521 ? 0.300   -11.607 43.246  1.00 36.41 ? 817  GLU A O     1 
ATOM   4009 C CB    . GLU A 1 521 ? -1.124  -9.360  41.323  1.00 36.20 ? 817  GLU A CB    1 
ATOM   4010 C CG    . GLU A 1 521 ? -2.258  -8.423  41.684  1.00 37.00 ? 817  GLU A CG    1 
ATOM   4011 C CD    . GLU A 1 521 ? -2.049  -7.025  41.141  1.00 38.33 ? 817  GLU A CD    1 
ATOM   4012 O OE1   . GLU A 1 521 ? -2.313  -6.811  39.930  1.00 39.54 ? 817  GLU A OE1   1 
ATOM   4013 O OE2   . GLU A 1 521 ? -1.625  -6.141  41.925  1.00 38.58 ? 817  GLU A OE2   1 
ATOM   4014 N N     . GLU A 1 522 ? 1.443   -11.078 41.377  1.00 36.33 ? 818  GLU A N     1 
ATOM   4015 C CA    . GLU A 1 522 ? 2.038   -12.409 41.224  1.00 36.60 ? 818  GLU A CA    1 
ATOM   4016 C C     . GLU A 1 522 ? 3.150   -12.663 42.216  1.00 36.36 ? 818  GLU A C     1 
ATOM   4017 O O     . GLU A 1 522 ? 3.587   -13.796 42.384  1.00 36.27 ? 818  GLU A O     1 
ATOM   4018 C CB    . GLU A 1 522 ? 2.580   -12.599 39.813  1.00 36.83 ? 818  GLU A CB    1 
ATOM   4019 C CG    . GLU A 1 522 ? 1.629   -12.216 38.684  1.00 38.12 ? 818  GLU A CG    1 
ATOM   4020 C CD    . GLU A 1 522 ? 0.157   -12.557 38.952  1.00 39.74 ? 818  GLU A CD    1 
ATOM   4021 O OE1   . GLU A 1 522 ? -0.329  -12.378 40.093  1.00 39.88 ? 818  GLU A OE1   1 
ATOM   4022 O OE2   . GLU A 1 522 ? -0.527  -12.991 37.997  1.00 40.81 ? 818  GLU A OE2   1 
ATOM   4023 N N     . ARG A 1 523 ? 3.609   -11.601 42.861  1.00 36.29 ? 819  ARG A N     1 
ATOM   4024 C CA    . ARG A 1 523 ? 4.628   -11.701 43.881  1.00 36.34 ? 819  ARG A CA    1 
ATOM   4025 C C     . ARG A 1 523 ? 5.928   -12.190 43.249  1.00 36.06 ? 819  ARG A C     1 
ATOM   4026 O O     . ARG A 1 523 ? 6.700   -12.917 43.871  1.00 36.19 ? 819  ARG A O     1 
ATOM   4027 C CB    . ARG A 1 523 ? 4.174   -12.628 45.014  1.00 36.47 ? 819  ARG A CB    1 
ATOM   4028 C CG    . ARG A 1 523 ? 2.716   -12.441 45.433  1.00 37.24 ? 819  ARG A CG    1 
ATOM   4029 C CD    . ARG A 1 523 ? 2.563   -11.445 46.568  1.00 38.19 ? 819  ARG A CD    1 
ATOM   4030 N NE    . ARG A 1 523 ? 1.176   -11.370 47.047  1.00 38.71 ? 819  ARG A NE    1 
ATOM   4031 C CZ    . ARG A 1 523 ? 0.395   -10.295 46.979  1.00 38.67 ? 819  ARG A CZ    1 
ATOM   4032 N NH1   . ARG A 1 523 ? 0.828   -9.157  46.444  1.00 39.14 ? 819  ARG A NH1   1 
ATOM   4033 N NH2   . ARG A 1 523 ? -0.836  -10.357 47.460  1.00 38.70 ? 819  ARG A NH2   1 
ATOM   4034 N N     . LEU A 1 524 ? 6.158   -11.793 42.001  1.00 35.74 ? 820  LEU A N     1 
ATOM   4035 C CA    . LEU A 1 524 ? 7.394   -12.145 41.317  1.00 35.53 ? 820  LEU A CA    1 
ATOM   4036 C C     . LEU A 1 524 ? 8.490   -11.184 41.741  1.00 35.41 ? 820  LEU A C     1 
ATOM   4037 O O     . LEU A 1 524 ? 8.236   -10.000 41.967  1.00 35.14 ? 820  LEU A O     1 
ATOM   4038 C CB    . LEU A 1 524 ? 7.236   -12.099 39.795  1.00 35.40 ? 820  LEU A CB    1 
ATOM   4039 C CG    . LEU A 1 524 ? 6.019   -12.793 39.204  1.00 35.08 ? 820  LEU A CG    1 
ATOM   4040 C CD1   . LEU A 1 524 ? 6.222   -13.061 37.729  1.00 34.88 ? 820  LEU A CD1   1 
ATOM   4041 C CD2   . LEU A 1 524 ? 5.743   -14.078 39.941  1.00 35.20 ? 820  LEU A CD2   1 
ATOM   4042 N N     . GLN A 1 525 ? 9.707   -11.708 41.839  1.00 35.37 ? 821  GLN A N     1 
ATOM   4043 C CA    . GLN A 1 525 ? 10.880  -10.892 42.127  1.00 35.48 ? 821  GLN A CA    1 
ATOM   4044 C C     . GLN A 1 525 ? 11.386  -10.178 40.891  1.00 35.38 ? 821  GLN A C     1 
ATOM   4045 O O     . GLN A 1 525 ? 12.319  -9.386  40.976  1.00 35.31 ? 821  GLN A O     1 
ATOM   4046 C CB    . GLN A 1 525 ? 12.010  -11.747 42.684  1.00 35.57 ? 821  GLN A CB    1 
ATOM   4047 C CG    . GLN A 1 525 ? 11.630  -12.578 43.895  1.00 35.98 ? 821  GLN A CG    1 
ATOM   4048 C CD    . GLN A 1 525 ? 12.849  -13.164 44.575  1.00 36.23 ? 821  GLN A CD    1 
ATOM   4049 O OE1   . GLN A 1 525 ? 13.004  -14.380 44.647  1.00 36.80 ? 821  GLN A OE1   1 
ATOM   4050 N NE2   . GLN A 1 525 ? 13.737  -12.297 45.053  1.00 36.04 ? 821  GLN A NE2   1 
ATOM   4051 N N     . ALA A 1 526 ? 10.784  -10.470 39.743  1.00 35.44 ? 822  ALA A N     1 
ATOM   4052 C CA    . ALA A 1 526 ? 11.166  -9.824  38.493  1.00 35.55 ? 822  ALA A CA    1 
ATOM   4053 C C     . ALA A 1 526 ? 11.040  -8.325  38.641  1.00 35.63 ? 822  ALA A C     1 
ATOM   4054 O O     . ALA A 1 526 ? 10.021  -7.841  39.123  1.00 35.66 ? 822  ALA A O     1 
ATOM   4055 C CB    . ALA A 1 526 ? 10.294  -10.307 37.358  1.00 35.57 ? 822  ALA A CB    1 
ATOM   4056 N N     . ARG A 1 527 ? 12.075  -7.595  38.237  1.00 35.87 ? 823  ARG A N     1 
ATOM   4057 C CA    . ARG A 1 527 ? 12.041  -6.133  38.292  1.00 36.02 ? 823  ARG A CA    1 
ATOM   4058 C C     . ARG A 1 527 ? 12.423  -5.450  36.980  1.00 35.68 ? 823  ARG A C     1 
ATOM   4059 O O     . ARG A 1 527 ? 13.304  -5.904  36.238  1.00 35.53 ? 823  ARG A O     1 
ATOM   4060 C CB    . ARG A 1 527 ? 12.923  -5.606  39.420  1.00 36.23 ? 823  ARG A CB    1 
ATOM   4061 C CG    . ARG A 1 527 ? 14.415  -5.791  39.212  1.00 37.37 ? 823  ARG A CG    1 
ATOM   4062 C CD    . ARG A 1 527 ? 15.206  -5.044  40.282  1.00 38.96 ? 823  ARG A CD    1 
ATOM   4063 N NE    . ARG A 1 527 ? 16.393  -5.796  40.682  1.00 40.21 ? 823  ARG A NE    1 
ATOM   4064 C CZ    . ARG A 1 527 ? 16.553  -6.427  41.846  1.00 41.22 ? 823  ARG A CZ    1 
ATOM   4065 N NH1   . ARG A 1 527 ? 15.612  -6.395  42.781  1.00 41.18 ? 823  ARG A NH1   1 
ATOM   4066 N NH2   . ARG A 1 527 ? 17.681  -7.090  42.085  1.00 41.93 ? 823  ARG A NH2   1 
ATOM   4067 N N     . LEU A 1 528 ? 11.741  -4.338  36.729  1.00 35.29 ? 824  LEU A N     1 
ATOM   4068 C CA    . LEU A 1 528 ? 12.046  -3.463  35.610  1.00 34.95 ? 824  LEU A CA    1 
ATOM   4069 C C     . LEU A 1 528 ? 13.411  -2.840  35.793  1.00 34.64 ? 824  LEU A C     1 
ATOM   4070 O O     . LEU A 1 528 ? 13.761  -2.406  36.890  1.00 34.82 ? 824  LEU A O     1 
ATOM   4071 C CB    . LEU A 1 528 ? 11.017  -2.343  35.515  1.00 34.84 ? 824  LEU A CB    1 
ATOM   4072 C CG    . LEU A 1 528 ? 9.811   -2.665  34.646  1.00 35.13 ? 824  LEU A CG    1 
ATOM   4073 C CD1   . LEU A 1 528 ? 8.563   -1.902  35.112  1.00 35.58 ? 824  LEU A CD1   1 
ATOM   4074 C CD2   . LEU A 1 528 ? 10.152  -2.353  33.194  1.00 35.23 ? 824  LEU A CD2   1 
ATOM   4075 N N     . LEU A 1 529 ? 14.180  -2.805  34.716  1.00 34.16 ? 825  LEU A N     1 
ATOM   4076 C CA    . LEU A 1 529 ? 15.438  -2.088  34.712  1.00 33.91 ? 825  LEU A CA    1 
ATOM   4077 C C     . LEU A 1 529 ? 15.337  -0.930  33.726  1.00 33.77 ? 825  LEU A C     1 
ATOM   4078 O O     . LEU A 1 529 ? 15.301  0.235   34.119  1.00 33.70 ? 825  LEU A O     1 
ATOM   4079 C CB    . LEU A 1 529 ? 16.597  -3.030  34.361  1.00 33.81 ? 825  LEU A CB    1 
ATOM   4080 C CG    . LEU A 1 529 ? 16.830  -4.190  35.336  1.00 33.35 ? 825  LEU A CG    1 
ATOM   4081 C CD1   . LEU A 1 529 ? 18.028  -5.009  34.901  1.00 32.68 ? 825  LEU A CD1   1 
ATOM   4082 C CD2   . LEU A 1 529 ? 17.010  -3.697  36.768  1.00 32.71 ? 825  LEU A CD2   1 
ATOM   4083 N N     . LEU A 1 530 ? 15.244  -1.261  32.448  1.00 33.61 ? 826  LEU A N     1 
ATOM   4084 C CA    . LEU A 1 530 ? 15.324  -0.262  31.407  1.00 33.47 ? 826  LEU A CA    1 
ATOM   4085 C C     . LEU A 1 530 ? 14.080  -0.222  30.570  1.00 33.46 ? 826  LEU A C     1 
ATOM   4086 O O     . LEU A 1 530 ? 13.287  -1.164  30.537  1.00 33.39 ? 826  LEU A O     1 
ATOM   4087 C CB    . LEU A 1 530 ? 16.505  -0.547  30.489  1.00 33.51 ? 826  LEU A CB    1 
ATOM   4088 C CG    . LEU A 1 530 ? 17.896  -0.328  31.080  1.00 33.35 ? 826  LEU A CG    1 
ATOM   4089 C CD1   . LEU A 1 530 ? 18.945  -0.882  30.121  1.00 32.91 ? 826  LEU A CD1   1 
ATOM   4090 C CD2   . LEU A 1 530 ? 18.134  1.146   31.371  1.00 32.80 ? 826  LEU A CD2   1 
ATOM   4091 N N     . GLN A 1 531 ? 13.939  0.903   29.889  1.00 33.51 ? 827  GLN A N     1 
ATOM   4092 C CA    . GLN A 1 531 ? 12.940  1.091   28.864  1.00 33.51 ? 827  GLN A CA    1 
ATOM   4093 C C     . GLN A 1 531 ? 13.641  1.772   27.696  1.00 33.61 ? 827  GLN A C     1 
ATOM   4094 O O     . GLN A 1 531 ? 14.459  2.670   27.897  1.00 33.57 ? 827  GLN A O     1 
ATOM   4095 C CB    . GLN A 1 531 ? 11.795  1.946   29.387  1.00 33.33 ? 827  GLN A CB    1 
ATOM   4096 C CG    . GLN A 1 531 ? 10.655  2.071   28.410  1.00 33.38 ? 827  GLN A CG    1 
ATOM   4097 C CD    . GLN A 1 531 ? 10.662  3.381   27.647  1.00 33.24 ? 827  GLN A CD    1 
ATOM   4098 O OE1   . GLN A 1 531 ? 11.707  3.844   27.191  1.00 32.30 ? 827  GLN A OE1   1 
ATOM   4099 N NE2   . GLN A 1 531 ? 9.485   3.985   27.496  1.00 33.68 ? 827  GLN A NE2   1 
ATOM   4100 N N     . VAL A 1 532 ? 13.341  1.325   26.482  1.00 33.75 ? 828  VAL A N     1 
ATOM   4101 C CA    . VAL A 1 532 ? 13.921  1.912   25.275  1.00 33.73 ? 828  VAL A CA    1 
ATOM   4102 C C     . VAL A 1 532 ? 12.811  2.153   24.251  1.00 33.76 ? 828  VAL A C     1 
ATOM   4103 O O     . VAL A 1 532 ? 12.766  1.536   23.189  1.00 33.66 ? 828  VAL A O     1 
ATOM   4104 C CB    . VAL A 1 532 ? 15.045  1.035   24.691  1.00 33.77 ? 828  VAL A CB    1 
ATOM   4105 C CG1   . VAL A 1 532 ? 15.614  1.676   23.440  1.00 33.78 ? 828  VAL A CG1   1 
ATOM   4106 C CG2   . VAL A 1 532 ? 16.152  0.823   25.722  1.00 33.57 ? 828  VAL A CG2   1 
ATOM   4107 N N     . HIS A 1 533 ? 11.897  3.043   24.627  1.00 33.83 ? 829  HIS A N     1 
ATOM   4108 C CA    . HIS A 1 533 ? 10.864  3.605   23.748  1.00 33.84 ? 829  HIS A CA    1 
ATOM   4109 C C     . HIS A 1 533 ? 9.774   2.624   23.314  1.00 33.89 ? 829  HIS A C     1 
ATOM   4110 O O     . HIS A 1 533 ? 8.585   2.888   23.519  1.00 33.83 ? 829  HIS A O     1 
ATOM   4111 C CB    . HIS A 1 533 ? 11.512  4.262   22.536  1.00 33.75 ? 829  HIS A CB    1 
ATOM   4112 C CG    . HIS A 1 533 ? 12.747  5.039   22.869  1.00 33.62 ? 829  HIS A CG    1 
ATOM   4113 N ND1   . HIS A 1 533 ? 12.741  6.091   23.760  1.00 33.28 ? 829  HIS A ND1   1 
ATOM   4114 C CD2   . HIS A 1 533 ? 14.029  4.905   22.451  1.00 33.23 ? 829  HIS A CD2   1 
ATOM   4115 C CE1   . HIS A 1 533 ? 13.965  6.578   23.866  1.00 32.94 ? 829  HIS A CE1   1 
ATOM   4116 N NE2   . HIS A 1 533 ? 14.765  5.878   23.081  1.00 32.49 ? 829  HIS A NE2   1 
ATOM   4117 N N     . ASP A 1 534 ? 10.184  1.517   22.703  1.00 34.01 ? 830  ASP A N     1 
ATOM   4118 C CA    . ASP A 1 534 ? 9.261   0.472   22.251  1.00 34.21 ? 830  ASP A CA    1 
ATOM   4119 C C     . ASP A 1 534 ? 9.519   -0.864  22.928  1.00 33.99 ? 830  ASP A C     1 
ATOM   4120 O O     . ASP A 1 534 ? 8.974   -1.878  22.514  1.00 33.84 ? 830  ASP A O     1 
ATOM   4121 C CB    . ASP A 1 534 ? 9.368   0.289   20.736  1.00 34.38 ? 830  ASP A CB    1 
ATOM   4122 C CG    . ASP A 1 534 ? 10.749  -0.199  20.291  1.00 35.36 ? 830  ASP A CG    1 
ATOM   4123 O OD1   . ASP A 1 534 ? 11.668  -0.342  21.136  1.00 36.21 ? 830  ASP A OD1   1 
ATOM   4124 O OD2   . ASP A 1 534 ? 10.916  -0.441  19.079  1.00 36.86 ? 830  ASP A OD2   1 
ATOM   4125 N N     . GLU A 1 535 ? 10.365  -0.872  23.953  1.00 34.06 ? 831  GLU A N     1 
ATOM   4126 C CA    . GLU A 1 535 ? 10.672  -2.113  24.648  1.00 34.08 ? 831  GLU A CA    1 
ATOM   4127 C C     . GLU A 1 535 ? 11.132  -1.918  26.082  1.00 33.79 ? 831  GLU A C     1 
ATOM   4128 O O     . GLU A 1 535 ? 11.752  -0.915  26.425  1.00 33.77 ? 831  GLU A O     1 
ATOM   4129 C CB    . GLU A 1 535 ? 11.699  -2.937  23.865  1.00 34.36 ? 831  GLU A CB    1 
ATOM   4130 C CG    . GLU A 1 535 ? 13.181  -2.600  24.046  1.00 34.94 ? 831  GLU A CG    1 
ATOM   4131 C CD    . GLU A 1 535 ? 14.084  -3.792  23.705  1.00 35.81 ? 831  GLU A CD    1 
ATOM   4132 O OE1   . GLU A 1 535 ? 13.817  -4.920  24.193  1.00 36.06 ? 831  GLU A OE1   1 
ATOM   4133 O OE2   . GLU A 1 535 ? 15.056  -3.601  22.941  1.00 36.18 ? 831  GLU A OE2   1 
ATOM   4134 N N     . LEU A 1 536 ? 10.811  -2.911  26.904  1.00 33.47 ? 832  LEU A N     1 
ATOM   4135 C CA    . LEU A 1 536 ? 11.164  -2.932  28.312  1.00 33.08 ? 832  LEU A CA    1 
ATOM   4136 C C     . LEU A 1 536 ? 12.160  -4.049  28.570  1.00 32.83 ? 832  LEU A C     1 
ATOM   4137 O O     . LEU A 1 536 ? 12.233  -5.013  27.823  1.00 32.87 ? 832  LEU A O     1 
ATOM   4138 C CB    . LEU A 1 536 ? 9.913   -3.165  29.151  1.00 33.00 ? 832  LEU A CB    1 
ATOM   4139 C CG    . LEU A 1 536 ? 8.754   -2.224  28.825  1.00 32.73 ? 832  LEU A CG    1 
ATOM   4140 C CD1   . LEU A 1 536 ? 7.480   -2.623  29.570  1.00 31.95 ? 832  LEU A CD1   1 
ATOM   4141 C CD2   . LEU A 1 536 ? 9.163   -0.797  29.139  1.00 32.18 ? 832  LEU A CD2   1 
ATOM   4142 N N     . ILE A 1 537 ? 12.934  -3.901  29.630  1.00 32.64 ? 833  ILE A N     1 
ATOM   4143 C CA    . ILE A 1 537 ? 13.897  -4.911  30.032  1.00 32.49 ? 833  ILE A CA    1 
ATOM   4144 C C     . ILE A 1 537 ? 13.679  -5.209  31.498  1.00 32.52 ? 833  ILE A C     1 
ATOM   4145 O O     . ILE A 1 537 ? 13.593  -4.293  32.311  1.00 32.57 ? 833  ILE A O     1 
ATOM   4146 C CB    . ILE A 1 537 ? 15.357  -4.421  29.856  1.00 32.46 ? 833  ILE A CB    1 
ATOM   4147 C CG1   . ILE A 1 537 ? 15.777  -4.457  28.386  1.00 32.23 ? 833  ILE A CG1   1 
ATOM   4148 C CG2   . ILE A 1 537 ? 16.318  -5.263  30.677  1.00 31.94 ? 833  ILE A CG2   1 
ATOM   4149 C CD1   . ILE A 1 537 ? 15.401  -3.219  27.622  1.00 32.12 ? 833  ILE A CD1   1 
ATOM   4150 N N     . LEU A 1 538 ? 13.603  -6.488  31.836  1.00 32.54 ? 834  LEU A N     1 
ATOM   4151 C CA    . LEU A 1 538 ? 13.525  -6.902  33.225  1.00 32.62 ? 834  LEU A CA    1 
ATOM   4152 C C     . LEU A 1 538 ? 14.715  -7.762  33.609  1.00 32.87 ? 834  LEU A C     1 
ATOM   4153 O O     . LEU A 1 538 ? 15.542  -8.118  32.770  1.00 32.97 ? 834  LEU A O     1 
ATOM   4154 C CB    . LEU A 1 538 ? 12.234  -7.665  33.465  1.00 32.49 ? 834  LEU A CB    1 
ATOM   4155 C CG    . LEU A 1 538 ? 10.994  -6.774  33.400  1.00 32.78 ? 834  LEU A CG    1 
ATOM   4156 C CD1   . LEU A 1 538 ? 10.459  -6.627  31.979  1.00 32.26 ? 834  LEU A CD1   1 
ATOM   4157 C CD2   . LEU A 1 538 ? 9.927   -7.327  34.315  1.00 33.27 ? 834  LEU A CD2   1 
ATOM   4158 N N     . GLU A 1 539 ? 14.821  -8.060  34.896  1.00 33.13 ? 835  GLU A N     1 
ATOM   4159 C CA    . GLU A 1 539 ? 15.686  -9.138  35.355  1.00 33.28 ? 835  GLU A CA    1 
ATOM   4160 C C     . GLU A 1 539 ? 14.954  -9.920  36.431  1.00 33.26 ? 835  GLU A C     1 
ATOM   4161 O O     . GLU A 1 539 ? 14.424  -9.331  37.372  1.00 33.28 ? 835  GLU A O     1 
ATOM   4162 C CB    . GLU A 1 539 ? 17.017  -8.602  35.883  1.00 33.35 ? 835  GLU A CB    1 
ATOM   4163 C CG    . GLU A 1 539 ? 16.892  -7.599  37.022  1.00 33.87 ? 835  GLU A CG    1 
ATOM   4164 C CD    . GLU A 1 539 ? 18.209  -7.361  37.750  1.00 34.40 ? 835  GLU A CD    1 
ATOM   4165 O OE1   . GLU A 1 539 ? 19.247  -7.912  37.328  1.00 34.39 ? 835  GLU A OE1   1 
ATOM   4166 O OE2   . GLU A 1 539 ? 18.206  -6.618  38.757  1.00 34.86 ? 835  GLU A OE2   1 
ATOM   4167 N N     . ALA A 1 540 ? 14.905  -11.240 36.282  1.00 33.31 ? 836  ALA A N     1 
ATOM   4168 C CA    . ALA A 1 540 ? 14.263  -12.094 37.277  1.00 33.52 ? 836  ALA A CA    1 
ATOM   4169 C C     . ALA A 1 540 ? 15.047  -13.373 37.471  1.00 33.76 ? 836  ALA A C     1 
ATOM   4170 O O     . ALA A 1 540 ? 15.955  -13.663 36.694  1.00 33.80 ? 836  ALA A O     1 
ATOM   4171 C CB    . ALA A 1 540 ? 12.852  -12.418 36.858  1.00 33.50 ? 836  ALA A CB    1 
ATOM   4172 N N     . PRO A 1 541 ? 14.707  -14.142 38.521  1.00 34.12 ? 837  PRO A N     1 
ATOM   4173 C CA    . PRO A 1 541 ? 15.304  -15.458 38.729  1.00 34.38 ? 837  PRO A CA    1 
ATOM   4174 C C     . PRO A 1 541 ? 15.024  -16.405 37.573  1.00 34.57 ? 837  PRO A C     1 
ATOM   4175 O O     . PRO A 1 541 ? 13.939  -16.362 37.007  1.00 34.52 ? 837  PRO A O     1 
ATOM   4176 C CB    . PRO A 1 541 ? 14.612  -15.957 39.997  1.00 34.37 ? 837  PRO A CB    1 
ATOM   4177 C CG    . PRO A 1 541 ? 14.238  -14.734 40.729  1.00 34.25 ? 837  PRO A CG    1 
ATOM   4178 C CD    . PRO A 1 541 ? 13.905  -13.719 39.681  1.00 34.14 ? 837  PRO A CD    1 
ATOM   4179 N N     . LYS A 1 542 ? 15.997  -17.255 37.243  1.00 35.04 ? 838  LYS A N     1 
ATOM   4180 C CA    . LYS A 1 542 ? 15.872  -18.222 36.140  1.00 35.35 ? 838  LYS A CA    1 
ATOM   4181 C C     . LYS A 1 542 ? 14.520  -18.927 36.205  1.00 35.66 ? 838  LYS A C     1 
ATOM   4182 O O     . LYS A 1 542 ? 13.879  -19.201 35.184  1.00 35.70 ? 838  LYS A O     1 
ATOM   4183 C CB    . LYS A 1 542 ? 17.002  -19.258 36.195  1.00 35.15 ? 838  LYS A CB    1 
ATOM   4184 N N     . GLU A 1 543 ? 14.081  -19.169 37.432  1.00 36.02 ? 839  GLU A N     1 
ATOM   4185 C CA    . GLU A 1 543 ? 12.823  -19.850 37.709  1.00 36.53 ? 839  GLU A CA    1 
ATOM   4186 C C     . GLU A 1 543 ? 11.574  -19.099 37.251  1.00 36.54 ? 839  GLU A C     1 
ATOM   4187 O O     . GLU A 1 543 ? 10.521  -19.707 37.072  1.00 36.52 ? 839  GLU A O     1 
ATOM   4188 C CB    . GLU A 1 543 ? 12.716  -20.130 39.210  1.00 36.80 ? 839  GLU A CB    1 
ATOM   4189 C CG    . GLU A 1 543 ? 13.771  -21.125 39.737  1.00 38.03 ? 839  GLU A CG    1 
ATOM   4190 C CD    . GLU A 1 543 ? 15.146  -20.508 40.029  1.00 39.11 ? 839  GLU A CD    1 
ATOM   4191 O OE1   . GLU A 1 543 ? 15.338  -19.283 39.831  1.00 39.95 ? 839  GLU A OE1   1 
ATOM   4192 O OE2   . GLU A 1 543 ? 16.040  -21.269 40.458  1.00 40.03 ? 839  GLU A OE2   1 
ATOM   4193 N N     . GLU A 1 544 ? 11.685  -17.787 37.070  1.00 36.71 ? 840  GLU A N     1 
ATOM   4194 C CA    . GLU A 1 544 ? 10.539  -16.963 36.687  1.00 36.87 ? 840  GLU A CA    1 
ATOM   4195 C C     . GLU A 1 544 ? 10.386  -16.786 35.174  1.00 36.75 ? 840  GLU A C     1 
ATOM   4196 O O     . GLU A 1 544 ? 9.318   -16.390 34.699  1.00 36.59 ? 840  GLU A O     1 
ATOM   4197 C CB    . GLU A 1 544 ? 10.619  -15.596 37.376  1.00 37.05 ? 840  GLU A CB    1 
ATOM   4198 C CG    . GLU A 1 544 ? 10.327  -15.647 38.890  1.00 37.87 ? 840  GLU A CG    1 
ATOM   4199 C CD    . GLU A 1 544 ? 10.305  -14.266 39.575  1.00 38.60 ? 840  GLU A CD    1 
ATOM   4200 O OE1   . GLU A 1 544 ? 10.525  -13.236 38.893  1.00 38.88 ? 840  GLU A OE1   1 
ATOM   4201 O OE2   . GLU A 1 544 ? 10.066  -14.214 40.808  1.00 38.32 ? 840  GLU A OE2   1 
ATOM   4202 N N     . MET A 1 545 ? 11.437  -17.098 34.421  1.00 36.77 ? 841  MET A N     1 
ATOM   4203 C CA    . MET A 1 545 ? 11.449  -16.834 32.979  1.00 36.87 ? 841  MET A CA    1 
ATOM   4204 C C     . MET A 1 545 ? 10.224  -17.383 32.260  1.00 36.67 ? 841  MET A C     1 
ATOM   4205 O O     . MET A 1 545 ? 9.719   -16.763 31.332  1.00 36.55 ? 841  MET A O     1 
ATOM   4206 C CB    . MET A 1 545 ? 12.733  -17.375 32.321  1.00 37.00 ? 841  MET A CB    1 
ATOM   4207 C CG    . MET A 1 545 ? 13.973  -16.501 32.535  1.00 37.41 ? 841  MET A CG    1 
ATOM   4208 S SD    . MET A 1 545 ? 13.633  -14.740 32.324  1.00 38.71 ? 841  MET A SD    1 
ATOM   4209 C CE    . MET A 1 545 ? 14.821  -13.959 33.412  1.00 39.03 ? 841  MET A CE    1 
ATOM   4210 N N     . GLU A 1 546 ? 9.741   -18.535 32.699  1.00 36.71 ? 842  GLU A N     1 
ATOM   4211 C CA    . GLU A 1 546 ? 8.628   -19.188 32.023  1.00 36.90 ? 842  GLU A CA    1 
ATOM   4212 C C     . GLU A 1 546 ? 7.290   -18.485 32.219  1.00 36.87 ? 842  GLU A C     1 
ATOM   4213 O O     . GLU A 1 546 ? 6.487   -18.422 31.289  1.00 36.74 ? 842  GLU A O     1 
ATOM   4214 C CB    . GLU A 1 546 ? 8.543   -20.647 32.441  1.00 36.97 ? 842  GLU A CB    1 
ATOM   4215 C CG    . GLU A 1 546 ? 9.676   -21.464 31.839  1.00 37.49 ? 842  GLU A CG    1 
ATOM   4216 C CD    . GLU A 1 546 ? 9.409   -22.950 31.857  1.00 38.71 ? 842  GLU A CD    1 
ATOM   4217 O OE1   . GLU A 1 546 ? 8.384   -23.373 31.278  1.00 39.92 ? 842  GLU A OE1   1 
ATOM   4218 O OE2   . GLU A 1 546 ? 10.234  -23.697 32.432  1.00 39.44 ? 842  GLU A OE2   1 
ATOM   4219 N N     . ARG A 1 547 ? 7.053   -17.953 33.411  1.00 37.00 ? 843  ARG A N     1 
ATOM   4220 C CA    . ARG A 1 547 ? 5.833   -17.182 33.655  1.00 37.24 ? 843  ARG A CA    1 
ATOM   4221 C C     . ARG A 1 547 ? 5.870   -15.802 32.993  1.00 37.06 ? 843  ARG A C     1 
ATOM   4222 O O     . ARG A 1 547 ? 4.845   -15.330 32.482  1.00 36.82 ? 843  ARG A O     1 
ATOM   4223 C CB    . ARG A 1 547 ? 5.553   -17.047 35.152  1.00 37.50 ? 843  ARG A CB    1 
ATOM   4224 C CG    . ARG A 1 547 ? 4.695   -18.178 35.706  1.00 38.80 ? 843  ARG A CG    1 
ATOM   4225 C CD    . ARG A 1 547 ? 4.029   -17.798 37.017  1.00 40.53 ? 843  ARG A CD    1 
ATOM   4226 N NE    . ARG A 1 547 ? 4.992   -17.728 38.110  1.00 42.36 ? 843  ARG A NE    1 
ATOM   4227 C CZ    . ARG A 1 547 ? 4.756   -17.177 39.299  1.00 44.24 ? 843  ARG A CZ    1 
ATOM   4228 N NH1   . ARG A 1 547 ? 3.575   -16.622 39.584  1.00 44.79 ? 843  ARG A NH1   1 
ATOM   4229 N NH2   . ARG A 1 547 ? 5.720   -17.172 40.212  1.00 45.09 ? 843  ARG A NH2   1 
ATOM   4230 N N     . LEU A 1 548 ? 7.042   -15.161 33.007  1.00 36.92 ? 844  LEU A N     1 
ATOM   4231 C CA    . LEU A 1 548 ? 7.205   -13.837 32.394  1.00 36.72 ? 844  LEU A CA    1 
ATOM   4232 C C     . LEU A 1 548 ? 6.823   -13.888 30.920  1.00 36.82 ? 844  LEU A C     1 
ATOM   4233 O O     . LEU A 1 548 ? 6.073   -13.039 30.433  1.00 36.83 ? 844  LEU A O     1 
ATOM   4234 C CB    . LEU A 1 548 ? 8.637   -13.317 32.553  1.00 36.58 ? 844  LEU A CB    1 
ATOM   4235 C CG    . LEU A 1 548 ? 9.029   -12.774 33.931  1.00 36.16 ? 844  LEU A CG    1 
ATOM   4236 C CD1   . LEU A 1 548 ? 10.411  -12.144 33.878  1.00 35.85 ? 844  LEU A CD1   1 
ATOM   4237 C CD2   . LEU A 1 548 ? 8.023   -11.765 34.435  1.00 35.74 ? 844  LEU A CD2   1 
ATOM   4238 N N     . CYS A 1 549 ? 7.320   -14.907 30.228  1.00 36.86 ? 845  CYS A N     1 
ATOM   4239 C CA    . CYS A 1 549 ? 6.979   -15.133 28.825  1.00 37.02 ? 845  CYS A CA    1 
ATOM   4240 C C     . CYS A 1 549 ? 5.481   -15.075 28.572  1.00 36.99 ? 845  CYS A C     1 
ATOM   4241 O O     . CYS A 1 549 ? 5.040   -14.587 27.537  1.00 37.07 ? 845  CYS A O     1 
ATOM   4242 C CB    . CYS A 1 549 ? 7.514   -16.481 28.364  1.00 37.00 ? 845  CYS A CB    1 
ATOM   4243 S SG    . CYS A 1 549 ? 9.293   -16.476 28.134  1.00 38.00 ? 845  CYS A SG    1 
ATOM   4244 N N     . ARG A 1 550 ? 4.703   -15.580 29.516  1.00 37.01 ? 846  ARG A N     1 
ATOM   4245 C CA    . ARG A 1 550 ? 3.251   -15.537 29.400  1.00 37.20 ? 846  ARG A CA    1 
ATOM   4246 C C     . ARG A 1 550 ? 2.634   -14.237 29.904  1.00 36.85 ? 846  ARG A C     1 
ATOM   4247 O O     . ARG A 1 550 ? 1.511   -13.896 29.531  1.00 36.78 ? 846  ARG A O     1 
ATOM   4248 C CB    . ARG A 1 550 ? 2.616   -16.718 30.141  1.00 37.54 ? 846  ARG A CB    1 
ATOM   4249 C CG    . ARG A 1 550 ? 2.197   -17.850 29.221  1.00 38.62 ? 846  ARG A CG    1 
ATOM   4250 C CD    . ARG A 1 550 ? 1.560   -18.990 29.989  1.00 39.95 ? 846  ARG A CD    1 
ATOM   4251 N NE    . ARG A 1 550 ? 0.144   -18.763 30.295  1.00 40.48 ? 846  ARG A NE    1 
ATOM   4252 C CZ    . ARG A 1 550 ? -0.847  -18.835 29.408  1.00 41.36 ? 846  ARG A CZ    1 
ATOM   4253 N NH1   . ARG A 1 550 ? -0.607  -19.098 28.127  1.00 41.46 ? 846  ARG A NH1   1 
ATOM   4254 N NH2   . ARG A 1 550 ? -2.094  -18.629 29.804  1.00 42.64 ? 846  ARG A NH2   1 
ATOM   4255 N N     . LEU A 1 551 ? 3.348   -13.524 30.763  1.00 36.47 ? 847  LEU A N     1 
ATOM   4256 C CA    . LEU A 1 551 ? 2.771   -12.365 31.438  1.00 36.18 ? 847  LEU A CA    1 
ATOM   4257 C C     . LEU A 1 551 ? 3.143   -11.047 30.759  1.00 35.86 ? 847  LEU A C     1 
ATOM   4258 O O     . LEU A 1 551 ? 2.269   -10.237 30.433  1.00 35.75 ? 847  LEU A O     1 
ATOM   4259 C CB    . LEU A 1 551 ? 3.208   -12.353 32.908  1.00 36.17 ? 847  LEU A CB    1 
ATOM   4260 C CG    . LEU A 1 551 ? 2.616   -11.268 33.810  1.00 35.81 ? 847  LEU A CG    1 
ATOM   4261 C CD1   . LEU A 1 551 ? 1.104   -11.216 33.659  1.00 35.58 ? 847  LEU A CD1   1 
ATOM   4262 C CD2   . LEU A 1 551 ? 3.001   -11.521 35.255  1.00 35.22 ? 847  LEU A CD2   1 
ATOM   4263 N N     . VAL A 1 552 ? 4.439   -10.846 30.540  1.00 35.35 ? 848  VAL A N     1 
ATOM   4264 C CA    . VAL A 1 552 ? 4.938   -9.564  30.064  1.00 35.02 ? 848  VAL A CA    1 
ATOM   4265 C C     . VAL A 1 552 ? 4.264   -9.143  28.751  1.00 34.85 ? 848  VAL A C     1 
ATOM   4266 O O     . VAL A 1 552 ? 3.734   -8.038  28.665  1.00 34.88 ? 848  VAL A O     1 
ATOM   4267 C CB    . VAL A 1 552 ? 6.478   -9.559  29.926  1.00 34.99 ? 848  VAL A CB    1 
ATOM   4268 C CG1   . VAL A 1 552 ? 6.968   -8.201  29.438  1.00 34.74 ? 848  VAL A CG1   1 
ATOM   4269 C CG2   . VAL A 1 552 ? 7.130   -9.928  31.258  1.00 35.13 ? 848  VAL A CG2   1 
ATOM   4270 N N     . PRO A 1 553 ? 4.264   -10.022 27.732  1.00 34.64 ? 849  PRO A N     1 
ATOM   4271 C CA    . PRO A 1 553 ? 3.652   -9.659  26.464  1.00 34.36 ? 849  PRO A CA    1 
ATOM   4272 C C     . PRO A 1 553 ? 2.169   -9.402  26.555  1.00 34.19 ? 849  PRO A C     1 
ATOM   4273 O O     . PRO A 1 553 ? 1.666   -8.525  25.869  1.00 34.06 ? 849  PRO A O     1 
ATOM   4274 C CB    . PRO A 1 553 ? 3.896   -10.894 25.599  1.00 34.39 ? 849  PRO A CB    1 
ATOM   4275 C CG    . PRO A 1 553 ? 5.095   -11.495 26.147  1.00 34.52 ? 849  PRO A CG    1 
ATOM   4276 C CD    . PRO A 1 553 ? 4.939   -11.326 27.623  1.00 34.89 ? 849  PRO A CD    1 
ATOM   4277 N N     . GLU A 1 554 ? 1.475   -10.178 27.376  1.00 34.15 ? 850  GLU A N     1 
ATOM   4278 C CA    . GLU A 1 554 ? 0.036   -10.030 27.493  1.00 34.31 ? 850  GLU A CA    1 
ATOM   4279 C C     . GLU A 1 554 ? -0.287  -8.655  28.032  1.00 34.00 ? 850  GLU A C     1 
ATOM   4280 O O     . GLU A 1 554 ? -1.140  -7.962  27.494  1.00 33.96 ? 850  GLU A O     1 
ATOM   4281 C CB    . GLU A 1 554 ? -0.563  -11.095 28.404  1.00 34.54 ? 850  GLU A CB    1 
ATOM   4282 C CG    . GLU A 1 554 ? -2.037  -10.839 28.798  1.00 36.16 ? 850  GLU A CG    1 
ATOM   4283 C CD    . GLU A 1 554 ? -3.051  -11.233 27.721  1.00 38.26 ? 850  GLU A CD    1 
ATOM   4284 O OE1   . GLU A 1 554 ? -2.648  -11.472 26.561  1.00 39.78 ? 850  GLU A OE1   1 
ATOM   4285 O OE2   . GLU A 1 554 ? -4.262  -11.304 28.041  1.00 39.42 ? 850  GLU A OE2   1 
ATOM   4286 N N     . VAL A 1 555 ? 0.405   -8.264  29.094  1.00 33.83 ? 851  VAL A N     1 
ATOM   4287 C CA    . VAL A 1 555 ? 0.154   -6.971  29.730  1.00 33.68 ? 851  VAL A CA    1 
ATOM   4288 C C     . VAL A 1 555 ? 0.507   -5.816  28.790  1.00 33.68 ? 851  VAL A C     1 
ATOM   4289 O O     . VAL A 1 555 ? -0.220  -4.826  28.715  1.00 33.62 ? 851  VAL A O     1 
ATOM   4290 C CB    . VAL A 1 555 ? 0.923   -6.816  31.047  1.00 33.60 ? 851  VAL A CB    1 
ATOM   4291 C CG1   . VAL A 1 555 ? 0.433   -5.593  31.789  1.00 33.40 ? 851  VAL A CG1   1 
ATOM   4292 C CG2   . VAL A 1 555 ? 0.760   -8.058  31.909  1.00 33.34 ? 851  VAL A CG2   1 
ATOM   4293 N N     . MET A 1 556 ? 1.617   -5.957  28.072  1.00 33.82 ? 852  MET A N     1 
ATOM   4294 C CA    . MET A 1 556 ? 1.998   -4.997  27.031  1.00 33.99 ? 852  MET A CA    1 
ATOM   4295 C C     . MET A 1 556 ? 0.963   -4.943  25.898  1.00 34.22 ? 852  MET A C     1 
ATOM   4296 O O     . MET A 1 556 ? 0.525   -3.860  25.508  1.00 34.19 ? 852  MET A O     1 
ATOM   4297 C CB    . MET A 1 556 ? 3.389   -5.323  26.466  1.00 33.88 ? 852  MET A CB    1 
ATOM   4298 C CG    . MET A 1 556 ? 4.502   -4.492  27.078  1.00 33.80 ? 852  MET A CG    1 
ATOM   4299 S SD    . MET A 1 556 ? 6.150   -5.219  26.924  1.00 34.30 ? 852  MET A SD    1 
ATOM   4300 C CE    . MET A 1 556 ? 6.746   -4.473  25.406  1.00 33.33 ? 852  MET A CE    1 
ATOM   4301 N N     . GLU A 1 557 ? 0.571   -6.114  25.394  1.00 34.42 ? 853  GLU A N     1 
ATOM   4302 C CA    . GLU A 1 557 ? -0.409  -6.219  24.301  1.00 34.58 ? 853  GLU A CA    1 
ATOM   4303 C C     . GLU A 1 557 ? -1.812  -5.741  24.680  1.00 34.35 ? 853  GLU A C     1 
ATOM   4304 O O     . GLU A 1 557 ? -2.605  -5.402  23.807  1.00 33.97 ? 853  GLU A O     1 
ATOM   4305 C CB    . GLU A 1 557 ? -0.477  -7.655  23.762  1.00 34.81 ? 853  GLU A CB    1 
ATOM   4306 C CG    . GLU A 1 557 ? 0.596   -7.955  22.700  1.00 36.07 ? 853  GLU A CG    1 
ATOM   4307 C CD    . GLU A 1 557 ? 0.757   -9.445  22.383  1.00 37.59 ? 853  GLU A CD    1 
ATOM   4308 O OE1   . GLU A 1 557 ? -0.147  -10.230 22.744  1.00 38.66 ? 853  GLU A OE1   1 
ATOM   4309 O OE2   . GLU A 1 557 ? 1.788   -9.831  21.775  1.00 38.02 ? 853  GLU A OE2   1 
ATOM   4310 N N     . GLN A 1 558 ? -2.102  -5.709  25.978  1.00 34.44 ? 854  GLN A N     1 
ATOM   4311 C CA    . GLN A 1 558 ? -3.429  -5.338  26.481  1.00 34.56 ? 854  GLN A CA    1 
ATOM   4312 C C     . GLN A 1 558 ? -3.494  -3.930  27.056  1.00 34.60 ? 854  GLN A C     1 
ATOM   4313 O O     . GLN A 1 558 ? -4.527  -3.527  27.596  1.00 34.49 ? 854  GLN A O     1 
ATOM   4314 C CB    . GLN A 1 558 ? -3.889  -6.346  27.544  1.00 34.68 ? 854  GLN A CB    1 
ATOM   4315 C CG    . GLN A 1 558 ? -4.237  -7.725  26.986  1.00 35.02 ? 854  GLN A CG    1 
ATOM   4316 C CD    . GLN A 1 558 ? -5.125  -7.637  25.765  1.00 35.49 ? 854  GLN A CD    1 
ATOM   4317 O OE1   . GLN A 1 558 ? -6.035  -6.807  25.710  1.00 35.87 ? 854  GLN A OE1   1 
ATOM   4318 N NE2   . GLN A 1 558 ? -4.858  -8.480  24.773  1.00 35.52 ? 854  GLN A NE2   1 
ATOM   4319 N N     . ALA A 1 559 ? -2.400  -3.186  26.919  1.00 34.72 ? 855  ALA A N     1 
ATOM   4320 C CA    . ALA A 1 559 ? -2.308  -1.822  27.442  1.00 34.79 ? 855  ALA A CA    1 
ATOM   4321 C C     . ALA A 1 559 ? -3.492  -0.981  26.973  1.00 34.86 ? 855  ALA A C     1 
ATOM   4322 O O     . ALA A 1 559 ? -4.240  -0.435  27.785  1.00 35.04 ? 855  ALA A O     1 
ATOM   4323 C CB    . ALA A 1 559 ? -1.002  -1.184  27.012  1.00 34.74 ? 855  ALA A CB    1 
ATOM   4324 N N     . VAL A 1 560 ? -3.650  -0.884  25.657  1.00 34.93 ? 856  VAL A N     1 
ATOM   4325 C CA    . VAL A 1 560 ? -4.815  -0.230  25.054  1.00 34.91 ? 856  VAL A CA    1 
ATOM   4326 C C     . VAL A 1 560 ? -5.364  -1.083  23.918  1.00 34.97 ? 856  VAL A C     1 
ATOM   4327 O O     . VAL A 1 560 ? -4.644  -1.890  23.322  1.00 34.98 ? 856  VAL A O     1 
ATOM   4328 C CB    . VAL A 1 560 ? -4.478  1.168   24.472  1.00 34.87 ? 856  VAL A CB    1 
ATOM   4329 C CG1   . VAL A 1 560 ? -3.330  1.820   25.236  1.00 34.43 ? 856  VAL A CG1   1 
ATOM   4330 C CG2   . VAL A 1 560 ? -4.133  1.061   22.991  1.00 34.67 ? 856  VAL A CG2   1 
ATOM   4331 N N     . THR A 1 561 ? -6.640  -0.877  23.611  1.00 34.97 ? 857  THR A N     1 
ATOM   4332 C CA    . THR A 1 561 ? -7.300  -1.572  22.513  1.00 34.89 ? 857  THR A CA    1 
ATOM   4333 C C     . THR A 1 561 ? -7.389  -0.646  21.309  1.00 34.80 ? 857  THR A C     1 
ATOM   4334 O O     . THR A 1 561 ? -8.056  0.386   21.366  1.00 34.67 ? 857  THR A O     1 
ATOM   4335 C CB    . THR A 1 561 ? -8.715  -2.015  22.901  1.00 34.81 ? 857  THR A CB    1 
ATOM   4336 O OG1   . THR A 1 561 ? -8.649  -2.832  24.073  1.00 34.93 ? 857  THR A OG1   1 
ATOM   4337 C CG2   . THR A 1 561 ? -9.361  -2.802  21.774  1.00 34.96 ? 857  THR A CG2   1 
ATOM   4338 N N     . LEU A 1 562 ? -6.703  -1.022  20.231  1.00 34.76 ? 858  LEU A N     1 
ATOM   4339 C CA    . LEU A 1 562 ? -6.741  -0.282  18.977  1.00 34.68 ? 858  LEU A CA    1 
ATOM   4340 C C     . LEU A 1 562 ? -7.571  -1.073  17.965  1.00 35.04 ? 858  LEU A C     1 
ATOM   4341 O O     . LEU A 1 562 ? -8.103  -2.140  18.273  1.00 35.09 ? 858  LEU A O     1 
ATOM   4342 C CB    . LEU A 1 562 ? -5.317  -0.050  18.435  1.00 34.41 ? 858  LEU A CB    1 
ATOM   4343 C CG    . LEU A 1 562 ? -4.242  0.442   19.408  1.00 33.61 ? 858  LEU A CG    1 
ATOM   4344 C CD1   . LEU A 1 562 ? -2.883  0.313   18.758  1.00 32.76 ? 858  LEU A CD1   1 
ATOM   4345 C CD2   . LEU A 1 562 ? -4.500  1.875   19.852  1.00 32.51 ? 858  LEU A CD2   1 
ATOM   4346 N N     . ARG A 1 563 ? -7.660  -0.539  16.752  1.00 35.45 ? 859  ARG A N     1 
ATOM   4347 C CA    . ARG A 1 563 ? -8.289  -1.218  15.619  1.00 35.74 ? 859  ARG A CA    1 
ATOM   4348 C C     . ARG A 1 563 ? -7.390  -2.290  15.002  1.00 35.49 ? 859  ARG A C     1 
ATOM   4349 O O     . ARG A 1 563 ? -7.762  -2.936  14.025  1.00 35.47 ? 859  ARG A O     1 
ATOM   4350 C CB    . ARG A 1 563 ? -8.655  -0.184  14.560  1.00 36.09 ? 859  ARG A CB    1 
ATOM   4351 C CG    . ARG A 1 563 ? -9.882  0.595   14.921  1.00 37.58 ? 859  ARG A CG    1 
ATOM   4352 C CD    . ARG A 1 563 ? -9.865  2.015   14.400  1.00 39.68 ? 859  ARG A CD    1 
ATOM   4353 N NE    . ARG A 1 563 ? -11.187 2.595   14.621  1.00 41.98 ? 859  ARG A NE    1 
ATOM   4354 C CZ    . ARG A 1 563 ? -11.442 3.864   14.931  1.00 43.74 ? 859  ARG A CZ    1 
ATOM   4355 N NH1   . ARG A 1 563 ? -10.462 4.760   15.070  1.00 43.99 ? 859  ARG A NH1   1 
ATOM   4356 N NH2   . ARG A 1 563 ? -12.708 4.232   15.109  1.00 44.58 ? 859  ARG A NH2   1 
ATOM   4357 N N     . VAL A 1 564 ? -6.195  -2.452  15.558  1.00 35.34 ? 860  VAL A N     1 
ATOM   4358 C CA    . VAL A 1 564 ? -5.292  -3.521  15.169  1.00 35.14 ? 860  VAL A CA    1 
ATOM   4359 C C     . VAL A 1 564 ? -4.665  -4.134  16.414  1.00 35.12 ? 860  VAL A C     1 
ATOM   4360 O O     . VAL A 1 564 ? -4.546  -3.469  17.443  1.00 35.06 ? 860  VAL A O     1 
ATOM   4361 C CB    . VAL A 1 564 ? -4.163  -3.016  14.263  1.00 35.02 ? 860  VAL A CB    1 
ATOM   4362 C CG1   . VAL A 1 564 ? -4.735  -2.349  13.034  1.00 34.79 ? 860  VAL A CG1   1 
ATOM   4363 C CG2   . VAL A 1 564 ? -3.244  -2.073  15.026  1.00 35.08 ? 860  VAL A CG2   1 
ATOM   4364 N N     . PRO A 1 565 ? -4.269  -5.411  16.330  1.00 35.14 ? 861  PRO A N     1 
ATOM   4365 C CA    . PRO A 1 565 ? -3.564  -6.040  17.435  1.00 35.10 ? 861  PRO A CA    1 
ATOM   4366 C C     . PRO A 1 565 ? -2.185  -5.464  17.665  1.00 34.96 ? 861  PRO A C     1 
ATOM   4367 O O     . PRO A 1 565 ? -1.486  -5.120  16.716  1.00 34.86 ? 861  PRO A O     1 
ATOM   4368 C CB    . PRO A 1 565 ? -3.425  -7.494  16.976  1.00 35.11 ? 861  PRO A CB    1 
ATOM   4369 C CG    . PRO A 1 565 ? -4.518  -7.682  16.073  1.00 35.12 ? 861  PRO A CG    1 
ATOM   4370 C CD    . PRO A 1 565 ? -4.652  -6.408  15.321  1.00 35.17 ? 861  PRO A CD    1 
ATOM   4371 N N     . LEU A 1 566 ? -1.819  -5.351  18.932  1.00 34.91 ? 862  LEU A N     1 
ATOM   4372 C CA    . LEU A 1 566 ? -0.442  -5.104  19.302  1.00 35.00 ? 862  LEU A CA    1 
ATOM   4373 C C     . LEU A 1 566 ? 0.277   -6.442  19.307  1.00 35.18 ? 862  LEU A C     1 
ATOM   4374 O O     . LEU A 1 566 ? -0.341  -7.496  19.461  1.00 35.19 ? 862  LEU A O     1 
ATOM   4375 C CB    . LEU A 1 566 ? -0.351  -4.427  20.664  1.00 34.98 ? 862  LEU A CB    1 
ATOM   4376 C CG    . LEU A 1 566 ? -0.543  -2.909  20.635  1.00 34.78 ? 862  LEU A CG    1 
ATOM   4377 C CD1   . LEU A 1 566 ? -1.742  -2.523  19.807  1.00 34.97 ? 862  LEU A CD1   1 
ATOM   4378 C CD2   . LEU A 1 566 ? -0.677  -2.361  22.042  1.00 34.77 ? 862  LEU A CD2   1 
ATOM   4379 N N     . LYS A 1 567 ? 1.584   -6.391  19.126  1.00 35.43 ? 863  LYS A N     1 
ATOM   4380 C CA    . LYS A 1 567 ? 2.375   -7.594  18.960  1.00 35.76 ? 863  LYS A CA    1 
ATOM   4381 C C     . LYS A 1 567 ? 3.673   -7.410  19.729  1.00 35.66 ? 863  LYS A C     1 
ATOM   4382 O O     . LYS A 1 567 ? 4.434   -6.479  19.456  1.00 35.78 ? 863  LYS A O     1 
ATOM   4383 C CB    . LYS A 1 567 ? 2.655   -7.824  17.473  1.00 35.96 ? 863  LYS A CB    1 
ATOM   4384 C CG    . LYS A 1 567 ? 2.562   -9.276  17.013  1.00 37.26 ? 863  LYS A CG    1 
ATOM   4385 C CD    . LYS A 1 567 ? 3.707   -10.140 17.555  1.00 39.07 ? 863  LYS A CD    1 
ATOM   4386 C CE    . LYS A 1 567 ? 4.010   -11.333 16.642  1.00 39.54 ? 863  LYS A CE    1 
ATOM   4387 N NZ    . LYS A 1 567 ? 4.579   -10.906 15.326  1.00 39.53 ? 863  LYS A NZ    1 
ATOM   4388 N N     . VAL A 1 568 ? 3.913   -8.286  20.701  1.00 35.41 ? 864  VAL A N     1 
ATOM   4389 C CA    . VAL A 1 568 ? 5.103   -8.199  21.526  1.00 35.23 ? 864  VAL A CA    1 
ATOM   4390 C C     . VAL A 1 568 ? 5.951   -9.427  21.341  1.00 35.15 ? 864  VAL A C     1 
ATOM   4391 O O     . VAL A 1 568 ? 5.502   -10.528 21.607  1.00 35.15 ? 864  VAL A O     1 
ATOM   4392 C CB    . VAL A 1 568 ? 4.757   -8.106  23.005  1.00 35.24 ? 864  VAL A CB    1 
ATOM   4393 C CG1   . VAL A 1 568 ? 6.032   -8.168  23.843  1.00 35.39 ? 864  VAL A CG1   1 
ATOM   4394 C CG2   . VAL A 1 568 ? 3.996   -6.832  23.290  1.00 35.35 ? 864  VAL A CG2   1 
ATOM   4395 N N     . ASP A 1 569 ? 7.177   -9.230  20.884  1.00 35.24 ? 865  ASP A N     1 
ATOM   4396 C CA    . ASP A 1 569 ? 8.140   -10.307 20.804  1.00 35.50 ? 865  ASP A CA    1 
ATOM   4397 C C     . ASP A 1 569 ? 9.078   -10.173 21.989  1.00 35.54 ? 865  ASP A C     1 
ATOM   4398 O O     . ASP A 1 569 ? 9.431   -9.068  22.387  1.00 35.60 ? 865  ASP A O     1 
ATOM   4399 C CB    . ASP A 1 569 ? 8.917   -10.250 19.487  1.00 35.67 ? 865  ASP A CB    1 
ATOM   4400 C CG    . ASP A 1 569 ? 8.026   -10.473 18.262  1.00 36.64 ? 865  ASP A CG    1 
ATOM   4401 O OD1   . ASP A 1 569 ? 7.060   -11.271 18.341  1.00 37.47 ? 865  ASP A OD1   1 
ATOM   4402 O OD2   . ASP A 1 569 ? 8.301   -9.850  17.209  1.00 37.92 ? 865  ASP A OD2   1 
ATOM   4403 N N     . TYR A 1 570 ? 9.469   -11.309 22.553  1.00 35.64 ? 866  TYR A N     1 
ATOM   4404 C CA    . TYR A 1 570 ? 10.329  -11.347 23.730  1.00 35.71 ? 866  TYR A CA    1 
ATOM   4405 C C     . TYR A 1 570 ? 11.521  -12.260 23.519  1.00 35.65 ? 866  TYR A C     1 
ATOM   4406 O O     . TYR A 1 570 ? 11.531  -13.092 22.612  1.00 35.55 ? 866  TYR A O     1 
ATOM   4407 C CB    . TYR A 1 570 ? 9.558   -11.849 24.947  1.00 35.84 ? 866  TYR A CB    1 
ATOM   4408 C CG    . TYR A 1 570 ? 8.960   -13.224 24.747  1.00 36.63 ? 866  TYR A CG    1 
ATOM   4409 C CD1   . TYR A 1 570 ? 9.748   -14.374 24.825  1.00 37.13 ? 866  TYR A CD1   1 
ATOM   4410 C CD2   . TYR A 1 570 ? 7.603   -13.374 24.463  1.00 37.37 ? 866  TYR A CD2   1 
ATOM   4411 C CE1   . TYR A 1 570 ? 9.196   -15.635 24.623  1.00 37.74 ? 866  TYR A CE1   1 
ATOM   4412 C CE2   . TYR A 1 570 ? 7.042   -14.626 24.267  1.00 37.58 ? 866  TYR A CE2   1 
ATOM   4413 C CZ    . TYR A 1 570 ? 7.839   -15.751 24.348  1.00 38.12 ? 866  TYR A CZ    1 
ATOM   4414 O OH    . TYR A 1 570 ? 7.271   -16.989 24.145  1.00 39.21 ? 866  TYR A OH    1 
ATOM   4415 N N     . HIS A 1 571 ? 12.500  -12.112 24.405  1.00 35.57 ? 867  HIS A N     1 
ATOM   4416 C CA    . HIS A 1 571 ? 13.720  -12.904 24.403  1.00 35.53 ? 867  HIS A CA    1 
ATOM   4417 C C     . HIS A 1 571 ? 14.319  -12.831 25.805  1.00 35.19 ? 867  HIS A C     1 
ATOM   4418 O O     . HIS A 1 571 ? 14.154  -11.823 26.495  1.00 35.23 ? 867  HIS A O     1 
ATOM   4419 C CB    . HIS A 1 571 ? 14.719  -12.345 23.385  1.00 35.73 ? 867  HIS A CB    1 
ATOM   4420 C CG    . HIS A 1 571 ? 14.229  -12.373 21.968  1.00 36.72 ? 867  HIS A CG    1 
ATOM   4421 N ND1   . HIS A 1 571 ? 13.916  -11.230 21.263  1.00 37.95 ? 867  HIS A ND1   1 
ATOM   4422 C CD2   . HIS A 1 571 ? 13.991  -13.408 21.128  1.00 37.83 ? 867  HIS A CD2   1 
ATOM   4423 C CE1   . HIS A 1 571 ? 13.508  -11.560 20.050  1.00 38.37 ? 867  HIS A CE1   1 
ATOM   4424 N NE2   . HIS A 1 571 ? 13.541  -12.876 19.943  1.00 38.24 ? 867  HIS A NE2   1 
ATOM   4425 N N     . TYR A 1 572 ? 14.990  -13.896 26.234  1.00 34.77 ? 868  TYR A N     1 
ATOM   4426 C CA    . TYR A 1 572 ? 15.764  -13.860 27.479  1.00 34.48 ? 868  TYR A CA    1 
ATOM   4427 C C     . TYR A 1 572 ? 17.131  -14.522 27.342  1.00 34.04 ? 868  TYR A C     1 
ATOM   4428 O O     . TYR A 1 572 ? 17.422  -15.165 26.345  1.00 34.16 ? 868  TYR A O     1 
ATOM   4429 C CB    . TYR A 1 572 ? 14.981  -14.460 28.653  1.00 34.60 ? 868  TYR A CB    1 
ATOM   4430 C CG    . TYR A 1 572 ? 14.413  -15.850 28.457  1.00 35.05 ? 868  TYR A CG    1 
ATOM   4431 C CD1   . TYR A 1 572 ? 15.195  -16.981 28.677  1.00 35.80 ? 868  TYR A CD1   1 
ATOM   4432 C CD2   . TYR A 1 572 ? 13.078  -16.033 28.113  1.00 34.90 ? 868  TYR A CD2   1 
ATOM   4433 C CE1   . TYR A 1 572 ? 14.668  -18.254 28.526  1.00 36.03 ? 868  TYR A CE1   1 
ATOM   4434 C CE2   . TYR A 1 572 ? 12.548  -17.294 27.965  1.00 35.15 ? 868  TYR A CE2   1 
ATOM   4435 C CZ    . TYR A 1 572 ? 13.344  -18.400 28.171  1.00 35.83 ? 868  TYR A CZ    1 
ATOM   4436 O OH    . TYR A 1 572 ? 12.815  -19.659 28.022  1.00 36.72 ? 868  TYR A OH    1 
ATOM   4437 N N     . GLY A 1 573 ? 17.980  -14.343 28.341  1.00 33.56 ? 869  GLY A N     1 
ATOM   4438 C CA    . GLY A 1 573 ? 19.323  -14.897 28.286  1.00 33.28 ? 869  GLY A CA    1 
ATOM   4439 C C     . GLY A 1 573 ? 20.205  -14.451 29.429  1.00 33.10 ? 869  GLY A C     1 
ATOM   4440 O O     . GLY A 1 573 ? 19.814  -13.610 30.234  1.00 32.92 ? 869  GLY A O     1 
ATOM   4441 N N     . SER A 1 574 ? 21.405  -15.022 29.480  1.00 33.01 ? 870  SER A N     1 
ATOM   4442 C CA    . SER A 1 574 ? 22.392  -14.701 30.511  1.00 33.11 ? 870  SER A CA    1 
ATOM   4443 C C     . SER A 1 574 ? 22.671  -13.215 30.574  1.00 33.03 ? 870  SER A C     1 
ATOM   4444 O O     . SER A 1 574 ? 22.475  -12.598 31.613  1.00 33.15 ? 870  SER A O     1 
ATOM   4445 C CB    . SER A 1 574 ? 23.710  -15.432 30.250  1.00 33.17 ? 870  SER A CB    1 
ATOM   4446 O OG    . SER A 1 574 ? 23.626  -16.792 30.638  1.00 33.95 ? 870  SER A OG    1 
ATOM   4447 N N     . THR A 1 575 ? 23.139  -12.663 29.455  1.00 32.97 ? 871  THR A N     1 
ATOM   4448 C CA    . THR A 1 575 ? 23.460  -11.238 29.333  1.00 32.91 ? 871  THR A CA    1 
ATOM   4449 C C     . THR A 1 575 ? 22.457  -10.507 28.450  1.00 33.18 ? 871  THR A C     1 
ATOM   4450 O O     . THR A 1 575 ? 21.611  -11.116 27.809  1.00 33.06 ? 871  THR A O     1 
ATOM   4451 C CB    . THR A 1 575 ? 24.877  -11.025 28.756  1.00 32.82 ? 871  THR A CB    1 
ATOM   4452 O OG1   . THR A 1 575 ? 24.997  -11.662 27.479  1.00 32.42 ? 871  THR A OG1   1 
ATOM   4453 C CG2   . THR A 1 575 ? 25.908  -11.594 29.689  1.00 32.60 ? 871  THR A CG2   1 
ATOM   4454 N N     . TRP A 1 576 ? 22.561  -9.187  28.418  1.00 33.73 ? 872  TRP A N     1 
ATOM   4455 C CA    . TRP A 1 576 ? 21.667  -8.376  27.599  1.00 34.28 ? 872  TRP A CA    1 
ATOM   4456 C C     . TRP A 1 576 ? 21.806  -8.797  26.150  1.00 34.51 ? 872  TRP A C     1 
ATOM   4457 O O     . TRP A 1 576 ? 20.826  -8.973  25.435  1.00 34.60 ? 872  TRP A O     1 
ATOM   4458 C CB    . TRP A 1 576 ? 22.008  -6.891  27.747  1.00 34.39 ? 872  TRP A CB    1 
ATOM   4459 C CG    . TRP A 1 576 ? 20.928  -5.942  27.302  1.00 35.10 ? 872  TRP A CG    1 
ATOM   4460 C CD1   . TRP A 1 576 ? 19.634  -6.245  26.960  1.00 35.78 ? 872  TRP A CD1   1 
ATOM   4461 C CD2   . TRP A 1 576 ? 21.045  -4.524  27.192  1.00 35.57 ? 872  TRP A CD2   1 
ATOM   4462 N NE1   . TRP A 1 576 ? 18.951  -5.100  26.626  1.00 35.74 ? 872  TRP A NE1   1 
ATOM   4463 C CE2   . TRP A 1 576 ? 19.793  -4.030  26.765  1.00 35.68 ? 872  TRP A CE2   1 
ATOM   4464 C CE3   . TRP A 1 576 ? 22.090  -3.623  27.407  1.00 36.02 ? 872  TRP A CE3   1 
ATOM   4465 C CZ2   . TRP A 1 576 ? 19.561  -2.678  26.549  1.00 36.23 ? 872  TRP A CZ2   1 
ATOM   4466 C CZ3   . TRP A 1 576 ? 21.859  -2.280  27.194  1.00 36.59 ? 872  TRP A CZ3   1 
ATOM   4467 C CH2   . TRP A 1 576 ? 20.602  -1.818  26.768  1.00 36.59 ? 872  TRP A CH2   1 
ATOM   4468 N N     . TYR A 1 577 ? 23.053  -8.983  25.745  1.00 34.98 ? 873  TYR A N     1 
ATOM   4469 C CA    . TYR A 1 577 ? 23.398  -9.448  24.406  1.00 35.26 ? 873  TYR A CA    1 
ATOM   4470 C C     . TYR A 1 577 ? 22.572  -10.678 24.018  1.00 35.17 ? 873  TYR A C     1 
ATOM   4471 O O     . TYR A 1 577 ? 22.189  -10.842 22.856  1.00 35.19 ? 873  TYR A O     1 
ATOM   4472 C CB    . TYR A 1 577 ? 24.910  -9.756  24.338  1.00 35.35 ? 873  TYR A CB    1 
ATOM   4473 C CG    . TYR A 1 577 ? 25.342  -10.374 23.026  1.00 35.89 ? 873  TYR A CG    1 
ATOM   4474 C CD1   . TYR A 1 577 ? 25.446  -9.603  21.877  1.00 36.56 ? 873  TYR A CD1   1 
ATOM   4475 C CD2   . TYR A 1 577 ? 25.617  -11.734 22.930  1.00 36.02 ? 873  TYR A CD2   1 
ATOM   4476 C CE1   . TYR A 1 577 ? 25.824  -10.170 20.663  1.00 36.68 ? 873  TYR A CE1   1 
ATOM   4477 C CE2   . TYR A 1 577 ? 25.992  -12.304 21.728  1.00 36.02 ? 873  TYR A CE2   1 
ATOM   4478 C CZ    . TYR A 1 577 ? 26.091  -11.519 20.599  1.00 36.40 ? 873  TYR A CZ    1 
ATOM   4479 O OH    . TYR A 1 577 ? 26.462  -12.089 19.406  1.00 36.47 ? 873  TYR A OH    1 
ATOM   4480 N N     . ASP A 1 578 ? 22.291  -11.519 25.009  1.00 35.09 ? 874  ASP A N     1 
ATOM   4481 C CA    . ASP A 1 578 ? 21.597  -12.783 24.803  1.00 35.17 ? 874  ASP A CA    1 
ATOM   4482 C C     . ASP A 1 578 ? 20.095  -12.644 24.856  1.00 35.05 ? 874  ASP A C     1 
ATOM   4483 O O     . ASP A 1 578 ? 19.380  -13.620 24.652  1.00 35.13 ? 874  ASP A O     1 
ATOM   4484 C CB    . ASP A 1 578 ? 22.027  -13.787 25.864  1.00 35.30 ? 874  ASP A CB    1 
ATOM   4485 C CG    . ASP A 1 578 ? 23.462  -14.219 25.696  1.00 35.88 ? 874  ASP A CG    1 
ATOM   4486 O OD1   . ASP A 1 578 ? 23.750  -14.901 24.688  1.00 37.22 ? 874  ASP A OD1   1 
ATOM   4487 O OD2   . ASP A 1 578 ? 24.301  -13.881 26.560  1.00 36.06 ? 874  ASP A OD2   1 
ATOM   4488 N N     . ALA A 1 579 ? 19.620  -11.445 25.168  1.00 34.91 ? 875  ALA A N     1 
ATOM   4489 C CA    . ALA A 1 579 ? 18.209  -11.139 25.073  1.00 34.69 ? 875  ALA A CA    1 
ATOM   4490 C C     . ALA A 1 579 ? 17.971  -10.666 23.655  1.00 34.66 ? 875  ALA A C     1 
ATOM   4491 O O     . ALA A 1 579 ? 17.876  -9.470  23.393  1.00 34.39 ? 875  ALA A O     1 
ATOM   4492 C CB    . ALA A 1 579 ? 17.829  -10.078 26.069  1.00 34.63 ? 875  ALA A CB    1 
ATOM   4493 N N     . LYS A 1 580 ? 17.914  -11.622 22.735  1.00 34.95 ? 876  LYS A N     1 
ATOM   4494 C CA    . LYS A 1 580 ? 17.651  -11.331 21.319  1.00 35.16 ? 876  LYS A CA    1 
ATOM   4495 C C     . LYS A 1 580 ? 17.890  -12.552 20.431  1.00 35.19 ? 876  LYS A C     1 
ATOM   4496 O O     . LYS A 1 580 ? 19.033  -12.977 20.242  1.00 35.37 ? 876  LYS A O     1 
ATOM   4497 C CB    . LYS A 1 580 ? 18.507  -10.155 20.840  1.00 35.03 ? 876  LYS A CB    1 
ATOM   4498 O "O5'" . DG  B 2 1   ? 33.998  28.220  31.950  1.00 60.97 ? 20   DG  B "O5'" 1 
ATOM   4499 C "C5'" . DG  B 2 1   ? 32.977  27.323  31.484  1.00 60.83 ? 20   DG  B "C5'" 1 
ATOM   4500 C "C4'" . DG  B 2 1   ? 31.927  27.994  30.598  1.00 60.47 ? 20   DG  B "C4'" 1 
ATOM   4501 O "O4'" . DG  B 2 1   ? 32.417  28.259  29.250  1.00 60.00 ? 20   DG  B "O4'" 1 
ATOM   4502 C "C3'" . DG  B 2 1   ? 30.673  27.158  30.366  1.00 60.29 ? 20   DG  B "C3'" 1 
ATOM   4503 O "O3'" . DG  B 2 1   ? 29.550  28.053  30.147  1.00 60.50 ? 20   DG  B "O3'" 1 
ATOM   4504 C "C2'" . DG  B 2 1   ? 31.120  26.286  29.189  1.00 59.83 ? 20   DG  B "C2'" 1 
ATOM   4505 C "C1'" . DG  B 2 1   ? 32.021  27.218  28.377  1.00 59.50 ? 20   DG  B "C1'" 1 
ATOM   4506 N N9    . DG  B 2 1   ? 33.241  26.593  27.851  1.00 59.19 ? 20   DG  B N9    1 
ATOM   4507 C C8    . DG  B 2 1   ? 34.114  25.734  28.491  1.00 58.79 ? 20   DG  B C8    1 
ATOM   4508 N N7    . DG  B 2 1   ? 35.119  25.346  27.756  1.00 58.24 ? 20   DG  B N7    1 
ATOM   4509 C C5    . DG  B 2 1   ? 34.910  25.991  26.548  1.00 58.34 ? 20   DG  B C5    1 
ATOM   4510 C C6    . DG  B 2 1   ? 35.673  25.960  25.354  1.00 58.33 ? 20   DG  B C6    1 
ATOM   4511 O O6    . DG  B 2 1   ? 36.720  25.336  25.117  1.00 58.12 ? 20   DG  B O6    1 
ATOM   4512 N N1    . DG  B 2 1   ? 35.101  26.762  24.364  1.00 58.45 ? 20   DG  B N1    1 
ATOM   4513 C C2    . DG  B 2 1   ? 33.941  27.499  24.510  1.00 58.36 ? 20   DG  B C2    1 
ATOM   4514 N N2    . DG  B 2 1   ? 33.534  28.207  23.450  1.00 58.54 ? 20   DG  B N2    1 
ATOM   4515 N N3    . DG  B 2 1   ? 33.214  27.532  25.618  1.00 58.25 ? 20   DG  B N3    1 
ATOM   4516 C C4    . DG  B 2 1   ? 33.760  26.760  26.590  1.00 58.63 ? 20   DG  B C4    1 
ATOM   4517 P P     . DC  B 2 2   ? 28.258  27.692  29.267  1.00 60.46 ? 21   DC  B P     1 
ATOM   4518 O OP1   . DC  B 2 2   ? 27.204  28.716  29.481  1.00 60.31 ? 21   DC  B OP1   1 
ATOM   4519 O OP2   . DC  B 2 2   ? 27.941  26.263  29.506  1.00 60.32 ? 21   DC  B OP2   1 
ATOM   4520 O "O5'" . DC  B 2 2   ? 28.839  27.865  27.784  1.00 59.30 ? 21   DC  B "O5'" 1 
ATOM   4521 C "C5'" . DC  B 2 2   ? 28.381  26.992  26.780  1.00 58.33 ? 21   DC  B "C5'" 1 
ATOM   4522 C "C4'" . DC  B 2 2   ? 28.362  27.671  25.428  1.00 57.79 ? 21   DC  B "C4'" 1 
ATOM   4523 O "O4'" . DC  B 2 2   ? 29.688  27.633  24.839  1.00 57.60 ? 21   DC  B "O4'" 1 
ATOM   4524 C "C3'" . DC  B 2 2   ? 27.439  26.972  24.447  1.00 57.47 ? 21   DC  B "C3'" 1 
ATOM   4525 O "O3'" . DC  B 2 2   ? 26.891  27.890  23.488  1.00 57.44 ? 21   DC  B "O3'" 1 
ATOM   4526 C "C2'" . DC  B 2 2   ? 28.374  25.928  23.846  1.00 57.24 ? 21   DC  B "C2'" 1 
ATOM   4527 C "C1'" . DC  B 2 2   ? 29.756  26.591  23.875  1.00 57.22 ? 21   DC  B "C1'" 1 
ATOM   4528 N N1    . DC  B 2 2   ? 30.917  25.639  24.190  1.00 56.58 ? 21   DC  B N1    1 
ATOM   4529 C C2    . DC  B 2 2   ? 31.983  25.476  23.286  1.00 56.11 ? 21   DC  B C2    1 
ATOM   4530 O O2    . DC  B 2 2   ? 31.995  26.122  22.231  1.00 56.04 ? 21   DC  B O2    1 
ATOM   4531 N N3    . DC  B 2 2   ? 32.995  24.615  23.593  1.00 55.76 ? 21   DC  B N3    1 
ATOM   4532 C C4    . DC  B 2 2   ? 32.980  23.924  24.737  1.00 55.17 ? 21   DC  B C4    1 
ATOM   4533 N N4    . DC  B 2 2   ? 33.997  23.093  24.991  1.00 54.75 ? 21   DC  B N4    1 
ATOM   4534 C C5    . DC  B 2 2   ? 31.913  24.063  25.668  1.00 55.33 ? 21   DC  B C5    1 
ATOM   4535 C C6    . DC  B 2 2   ? 30.925  24.914  25.356  1.00 55.99 ? 21   DC  B C6    1 
ATOM   4536 P P     . DC  B 2 3   ? 25.686  27.451  22.514  1.00 57.31 ? 22   DC  B P     1 
ATOM   4537 O OP1   . DC  B 2 3   ? 24.897  28.656  22.152  1.00 56.84 ? 22   DC  B OP1   1 
ATOM   4538 O OP2   . DC  B 2 3   ? 25.005  26.279  23.117  1.00 57.54 ? 22   DC  B OP2   1 
ATOM   4539 O "O5'" . DC  B 2 3   ? 26.482  26.960  21.216  1.00 56.00 ? 22   DC  B "O5'" 1 
ATOM   4540 C "C5'" . DC  B 2 3   ? 27.382  27.869  20.574  1.00 54.99 ? 22   DC  B "C5'" 1 
ATOM   4541 C "C4'" . DC  B 2 3   ? 28.253  27.176  19.539  1.00 54.15 ? 22   DC  B "C4'" 1 
ATOM   4542 O "O4'" . DC  B 2 3   ? 29.241  26.332  20.187  1.00 53.70 ? 22   DC  B "O4'" 1 
ATOM   4543 C "C3'" . DC  B 2 3   ? 27.506  26.263  18.569  1.00 53.63 ? 22   DC  B "C3'" 1 
ATOM   4544 O "O3'" . DC  B 2 3   ? 27.859  26.599  17.241  1.00 53.34 ? 22   DC  B "O3'" 1 
ATOM   4545 C "C2'" . DC  B 2 3   ? 27.968  24.860  18.954  1.00 53.37 ? 22   DC  B "C2'" 1 
ATOM   4546 C "C1'" . DC  B 2 3   ? 29.384  25.163  19.404  1.00 53.05 ? 22   DC  B "C1'" 1 
ATOM   4547 N N1    . DC  B 2 3   ? 30.034  24.102  20.218  1.00 52.29 ? 22   DC  B N1    1 
ATOM   4548 C C2    . DC  B 2 3   ? 31.144  23.397  19.726  1.00 52.01 ? 22   DC  B C2    1 
ATOM   4549 O O2    . DC  B 2 3   ? 31.587  23.647  18.599  1.00 52.18 ? 22   DC  B O2    1 
ATOM   4550 N N3    . DC  B 2 3   ? 31.711  22.448  20.512  1.00 51.91 ? 22   DC  B N3    1 
ATOM   4551 C C4    . DC  B 2 3   ? 31.208  22.199  21.726  1.00 51.99 ? 22   DC  B C4    1 
ATOM   4552 N N4    . DC  B 2 3   ? 31.782  21.257  22.476  1.00 51.88 ? 22   DC  B N4    1 
ATOM   4553 C C5    . DC  B 2 3   ? 30.083  22.900  22.240  1.00 52.13 ? 22   DC  B C5    1 
ATOM   4554 C C6    . DC  B 2 3   ? 29.538  23.832  21.459  1.00 52.09 ? 22   DC  B C6    1 
ATOM   4555 P P     . DT  B 2 4   ? 27.082  25.933  16.012  1.00 54.09 ? 23   DT  B P     1 
ATOM   4556 O OP1   . DT  B 2 4   ? 27.014  26.912  14.907  1.00 54.48 ? 23   DT  B OP1   1 
ATOM   4557 O OP2   . DT  B 2 4   ? 25.842  25.279  16.498  1.00 53.91 ? 23   DT  B OP2   1 
ATOM   4558 O "O5'" . DT  B 2 4   ? 28.119  24.805  15.586  1.00 53.18 ? 23   DT  B "O5'" 1 
ATOM   4559 C "C5'" . DT  B 2 4   ? 29.058  25.037  14.552  1.00 51.69 ? 23   DT  B "C5'" 1 
ATOM   4560 C "C4'" . DT  B 2 4   ? 29.726  23.723  14.219  1.00 50.94 ? 23   DT  B "C4'" 1 
ATOM   4561 O "O4'" . DT  B 2 4   ? 30.413  23.238  15.399  1.00 50.38 ? 23   DT  B "O4'" 1 
ATOM   4562 C "C3'" . DT  B 2 4   ? 28.748  22.608  13.839  1.00 50.37 ? 23   DT  B "C3'" 1 
ATOM   4563 O "O3'" . DT  B 2 4   ? 28.462  22.503  12.438  1.00 49.14 ? 23   DT  B "O3'" 1 
ATOM   4564 C "C2'" . DT  B 2 4   ? 29.401  21.349  14.379  1.00 50.41 ? 23   DT  B "C2'" 1 
ATOM   4565 C "C1'" . DT  B 2 4   ? 30.479  21.827  15.337  1.00 50.29 ? 23   DT  B "C1'" 1 
ATOM   4566 N N1    . DT  B 2 4   ? 30.247  21.202  16.671  1.00 49.97 ? 23   DT  B N1    1 
ATOM   4567 C C2    . DT  B 2 4   ? 31.168  20.318  17.188  1.00 49.41 ? 23   DT  B C2    1 
ATOM   4568 O O2    . DT  B 2 4   ? 32.211  20.005  16.645  1.00 49.10 ? 23   DT  B O2    1 
ATOM   4569 N N3    . DT  B 2 4   ? 30.816  19.809  18.406  1.00 49.49 ? 23   DT  B N3    1 
ATOM   4570 C C4    . DT  B 2 4   ? 29.673  20.070  19.145  1.00 49.63 ? 23   DT  B C4    1 
ATOM   4571 O O4    . DT  B 2 4   ? 29.447  19.562  20.236  1.00 49.41 ? 23   DT  B O4    1 
ATOM   4572 C C5    . DT  B 2 4   ? 28.748  20.986  18.542  1.00 49.67 ? 23   DT  B C5    1 
ATOM   4573 C C7    . DT  B 2 4   ? 27.475  21.343  19.249  1.00 49.12 ? 23   DT  B C7    1 
ATOM   4574 C C6    . DT  B 2 4   ? 29.072  21.495  17.347  1.00 50.04 ? 23   DT  B C6    1 
ATOM   4575 P P     . DG  B 2 5   ? 29.529  22.156  11.306  1.00 47.45 ? 24   DG  B P     1 
ATOM   4576 O OP1   . DG  B 2 5   ? 30.705  23.015  11.509  1.00 47.05 ? 24   DG  B OP1   1 
ATOM   4577 O OP2   . DG  B 2 5   ? 28.766  22.239  10.045  1.00 48.27 ? 24   DG  B OP2   1 
ATOM   4578 O "O5'" . DG  B 2 5   ? 29.985  20.640  11.540  1.00 47.58 ? 24   DG  B "O5'" 1 
ATOM   4579 C "C5'" . DG  B 2 5   ? 31.385  20.287  11.701  1.00 47.28 ? 24   DG  B "C5'" 1 
ATOM   4580 C "C4'" . DG  B 2 5   ? 31.586  18.788  11.898  1.00 46.45 ? 24   DG  B "C4'" 1 
ATOM   4581 O "O4'" . DG  B 2 5   ? 31.320  18.417  13.279  1.00 45.91 ? 24   DG  B "O4'" 1 
ATOM   4582 C "C3'" . DG  B 2 5   ? 30.668  17.938  11.029  1.00 46.05 ? 24   DG  B "C3'" 1 
ATOM   4583 O "O3'" . DG  B 2 5   ? 31.401  16.914  10.367  1.00 45.55 ? 24   DG  B "O3'" 1 
ATOM   4584 C "C2'" . DG  B 2 5   ? 29.623  17.420  12.017  1.00 45.98 ? 24   DG  B "C2'" 1 
ATOM   4585 C "C1'" . DG  B 2 5   ? 30.357  17.381  13.349  1.00 45.69 ? 24   DG  B "C1'" 1 
ATOM   4586 N N9    . DG  B 2 5   ? 29.499  17.559  14.530  1.00 45.27 ? 24   DG  B N9    1 
ATOM   4587 C C8    . DG  B 2 5   ? 28.330  18.280  14.647  1.00 44.91 ? 24   DG  B C8    1 
ATOM   4588 N N7    . DG  B 2 5   ? 27.800  18.254  15.836  1.00 44.68 ? 24   DG  B N7    1 
ATOM   4589 C C5    . DG  B 2 5   ? 28.667  17.453  16.557  1.00 45.10 ? 24   DG  B C5    1 
ATOM   4590 C C6    . DG  B 2 5   ? 28.614  17.052  17.908  1.00 45.38 ? 24   DG  B C6    1 
ATOM   4591 O O6    . DG  B 2 5   ? 27.754  17.338  18.750  1.00 45.77 ? 24   DG  B O6    1 
ATOM   4592 N N1    . DG  B 2 5   ? 29.692  16.233  18.252  1.00 45.27 ? 24   DG  B N1    1 
ATOM   4593 C C2    . DG  B 2 5   ? 30.700  15.846  17.397  1.00 44.61 ? 24   DG  B C2    1 
ATOM   4594 N N2    . DG  B 2 5   ? 31.651  15.053  17.905  1.00 43.44 ? 24   DG  B N2    1 
ATOM   4595 N N3    . DG  B 2 5   ? 30.762  16.215  16.125  1.00 44.89 ? 24   DG  B N3    1 
ATOM   4596 C C4    . DG  B 2 5   ? 29.716  17.015  15.775  1.00 45.26 ? 24   DG  B C4    1 
ATOM   4597 P P     . DA  B 2 6   ? 30.670  15.846  9.416   1.00 45.82 ? 25   DA  B P     1 
ATOM   4598 O OP1   . DA  B 2 6   ? 31.542  15.632  8.246   1.00 45.16 ? 25   DA  B OP1   1 
ATOM   4599 O OP2   . DA  B 2 6   ? 29.226  16.148  9.221   1.00 45.03 ? 25   DA  B OP2   1 
ATOM   4600 O "O5'" . DA  B 2 6   ? 30.733  14.574  10.371  1.00 45.23 ? 25   DA  B "O5'" 1 
ATOM   4601 C "C5'" . DA  B 2 6   ? 31.936  14.172  11.014  1.00 44.08 ? 25   DA  B "C5'" 1 
ATOM   4602 C "C4'" . DA  B 2 6   ? 31.659  12.962  11.885  1.00 43.67 ? 25   DA  B "C4'" 1 
ATOM   4603 O "O4'" . DA  B 2 6   ? 31.075  13.379  13.146  1.00 42.93 ? 25   DA  B "O4'" 1 
ATOM   4604 C "C3'" . DA  B 2 6   ? 30.666  11.991  11.253  1.00 44.01 ? 25   DA  B "C3'" 1 
ATOM   4605 O "O3'" . DA  B 2 6   ? 31.112  10.655  11.365  1.00 44.22 ? 25   DA  B "O3'" 1 
ATOM   4606 C "C2'" . DA  B 2 6   ? 29.374  12.262  12.017  1.00 43.73 ? 25   DA  B "C2'" 1 
ATOM   4607 C "C1'" . DA  B 2 6   ? 29.938  12.578  13.385  1.00 43.03 ? 25   DA  B "C1'" 1 
ATOM   4608 N N9    . DA  B 2 6   ? 28.995  13.280  14.235  1.00 42.34 ? 25   DA  B N9    1 
ATOM   4609 C C8    . DA  B 2 6   ? 28.080  14.236  13.890  1.00 42.19 ? 25   DA  B C8    1 
ATOM   4610 N N7    . DA  B 2 6   ? 27.369  14.675  14.899  1.00 41.95 ? 25   DA  B N7    1 
ATOM   4611 C C5    . DA  B 2 6   ? 27.855  13.950  15.971  1.00 41.74 ? 25   DA  B C5    1 
ATOM   4612 C C6    . DA  B 2 6   ? 27.528  13.937  17.337  1.00 41.25 ? 25   DA  B C6    1 
ATOM   4613 N N6    . DA  B 2 6   ? 26.588  14.714  17.864  1.00 40.98 ? 25   DA  B N6    1 
ATOM   4614 N N1    . DA  B 2 6   ? 28.203  13.093  18.147  1.00 41.59 ? 25   DA  B N1    1 
ATOM   4615 C C2    . DA  B 2 6   ? 29.149  12.307  17.617  1.00 41.92 ? 25   DA  B C2    1 
ATOM   4616 N N3    . DA  B 2 6   ? 29.549  12.231  16.349  1.00 42.20 ? 25   DA  B N3    1 
ATOM   4617 C C4    . DA  B 2 6   ? 28.853  13.084  15.578  1.00 42.10 ? 25   DA  B C4    1 
ATOM   4618 P P     . DC  B 2 7   ? 30.180  9.476   10.828  1.00 44.45 ? 26   DC  B P     1 
ATOM   4619 O OP1   . DC  B 2 7   ? 31.053  8.387   10.340  1.00 44.57 ? 26   DC  B OP1   1 
ATOM   4620 O OP2   . DC  B 2 7   ? 29.100  10.022  9.967   1.00 43.47 ? 26   DC  B OP2   1 
ATOM   4621 O "O5'" . DC  B 2 7   ? 29.549  9.008   12.207  1.00 44.76 ? 26   DC  B "O5'" 1 
ATOM   4622 C "C5'" . DC  B 2 7   ? 30.392  8.748   13.314  1.00 45.29 ? 26   DC  B "C5'" 1 
ATOM   4623 C "C4'" . DC  B 2 7   ? 29.616  8.016   14.385  1.00 45.41 ? 26   DC  B "C4'" 1 
ATOM   4624 O "O4'" . DC  B 2 7   ? 28.868  8.983   15.167  1.00 45.67 ? 26   DC  B "O4'" 1 
ATOM   4625 C "C3'" . DC  B 2 7   ? 28.584  7.040   13.839  1.00 45.36 ? 26   DC  B "C3'" 1 
ATOM   4626 O "O3'" . DC  B 2 7   ? 28.411  5.949   14.716  1.00 44.52 ? 26   DC  B "O3'" 1 
ATOM   4627 C "C2'" . DC  B 2 7   ? 27.343  7.916   13.783  1.00 45.58 ? 26   DC  B "C2'" 1 
ATOM   4628 C "C1'" . DC  B 2 7   ? 27.498  8.637   15.116  1.00 45.79 ? 26   DC  B "C1'" 1 
ATOM   4629 N N1    . DC  B 2 7   ? 26.618  9.844   15.335  1.00 45.88 ? 26   DC  B N1    1 
ATOM   4630 C C2    . DC  B 2 7   ? 26.285  10.213  16.649  1.00 45.59 ? 26   DC  B C2    1 
ATOM   4631 O O2    . DC  B 2 7   ? 26.715  9.564   17.613  1.00 45.00 ? 26   DC  B O2    1 
ATOM   4632 N N3    . DC  B 2 7   ? 25.481  11.291  16.838  1.00 45.86 ? 26   DC  B N3    1 
ATOM   4633 C C4    . DC  B 2 7   ? 25.013  11.988  15.797  1.00 45.61 ? 26   DC  B C4    1 
ATOM   4634 N N4    . DC  B 2 7   ? 24.231  13.041  16.027  1.00 44.92 ? 26   DC  B N4    1 
ATOM   4635 C C5    . DC  B 2 7   ? 25.336  11.634  14.462  1.00 46.02 ? 26   DC  B C5    1 
ATOM   4636 C C6    . DC  B 2 7   ? 26.126  10.569  14.279  1.00 46.16 ? 26   DC  B C6    1 
ATOM   4637 P P     . DT  B 2 8   ? 27.682  4.631   14.194  1.00 43.85 ? 27   DT  B P     1 
ATOM   4638 O OP1   . DT  B 2 8   ? 28.760  3.621   14.078  1.00 43.35 ? 27   DT  B OP1   1 
ATOM   4639 O OP2   . DT  B 2 8   ? 26.799  4.979   13.057  1.00 43.29 ? 27   DT  B OP2   1 
ATOM   4640 O "O5'" . DT  B 2 8   ? 26.706  4.234   15.392  1.00 43.40 ? 27   DT  B "O5'" 1 
ATOM   4641 C "C5'" . DT  B 2 8   ? 27.256  3.950   16.668  1.00 42.70 ? 27   DT  B "C5'" 1 
ATOM   4642 C "C4'" . DT  B 2 8   ? 26.247  4.182   17.771  1.00 41.97 ? 27   DT  B "C4'" 1 
ATOM   4643 O "O4'" . DT  B 2 8   ? 26.124  5.588   18.106  1.00 42.10 ? 27   DT  B "O4'" 1 
ATOM   4644 C "C3'" . DT  B 2 8   ? 24.830  3.776   17.424  1.00 41.36 ? 27   DT  B "C3'" 1 
ATOM   4645 O "O3'" . DT  B 2 8   ? 24.734  2.362   17.443  1.00 40.20 ? 27   DT  B "O3'" 1 
ATOM   4646 C "C2'" . DT  B 2 8   ? 24.084  4.474   18.549  1.00 41.58 ? 27   DT  B "C2'" 1 
ATOM   4647 C "C1'" . DT  B 2 8   ? 24.817  5.808   18.618  1.00 41.72 ? 27   DT  B "C1'" 1 
ATOM   4648 N N1    . DT  B 2 8   ? 24.096  6.847   17.836  1.00 41.07 ? 27   DT  B N1    1 
ATOM   4649 C C2    . DT  B 2 8   ? 23.185  7.650   18.485  1.00 40.91 ? 27   DT  B C2    1 
ATOM   4650 O O2    . DT  B 2 8   ? 22.946  7.566   19.678  1.00 41.01 ? 27   DT  B O2    1 
ATOM   4651 N N3    . DT  B 2 8   ? 22.566  8.568   17.676  1.00 40.80 ? 27   DT  B N3    1 
ATOM   4652 C C4    . DT  B 2 8   ? 22.760  8.755   16.320  1.00 40.99 ? 27   DT  B C4    1 
ATOM   4653 O O4    . DT  B 2 8   ? 22.159  9.603   15.672  1.00 40.61 ? 27   DT  B O4    1 
ATOM   4654 C C5    . DT  B 2 8   ? 23.720  7.878   15.708  1.00 41.29 ? 27   DT  B C5    1 
ATOM   4655 C C7    . DT  B 2 8   ? 24.003  7.994   14.241  1.00 41.56 ? 27   DT  B C7    1 
ATOM   4656 C C6    . DT  B 2 8   ? 24.333  6.974   16.482  1.00 41.15 ? 27   DT  B C6    1 
ATOM   4657 P P     . DC  B 2 9   ? 23.482  1.638   16.787  1.00 38.28 ? 28   DC  B P     1 
ATOM   4658 O OP1   . DC  B 2 9   ? 23.677  0.176   16.831  1.00 38.39 ? 28   DC  B OP1   1 
ATOM   4659 O OP2   . DC  B 2 9   ? 23.242  2.318   15.508  1.00 38.98 ? 28   DC  B OP2   1 
ATOM   4660 O "O5'" . DC  B 2 9   ? 22.308  2.057   17.754  1.00 39.25 ? 28   DC  B "O5'" 1 
ATOM   4661 C "C5'" . DC  B 2 9   ? 21.889  1.187   18.749  1.00 40.53 ? 28   DC  B "C5'" 1 
ATOM   4662 C "C4'" . DC  B 2 9   ? 20.757  1.828   19.496  1.00 41.36 ? 28   DC  B "C4'" 1 
ATOM   4663 O "O4'" . DC  B 2 9   ? 20.985  3.247   19.687  1.00 41.99 ? 28   DC  B "O4'" 1 
ATOM   4664 C "C3'" . DC  B 2 9   ? 19.472  1.742   18.721  1.00 41.53 ? 28   DC  B "C3'" 1 
ATOM   4665 O "O3'" . DC  B 2 9   ? 18.987  0.453   18.925  1.00 40.98 ? 28   DC  B "O3'" 1 
ATOM   4666 C "C2'" . DC  B 2 9   ? 18.686  2.861   19.388  1.00 42.10 ? 28   DC  B "C2'" 1 
ATOM   4667 C "C1'" . DC  B 2 9   ? 19.747  3.928   19.620  1.00 42.27 ? 28   DC  B "C1'" 1 
ATOM   4668 N N1    . DC  B 2 9   ? 19.814  4.966   18.547  1.00 42.75 ? 28   DC  B N1    1 
ATOM   4669 C C2    . DC  B 2 9   ? 19.067  6.147   18.648  1.00 43.23 ? 28   DC  B C2    1 
ATOM   4670 O O2    . DC  B 2 9   ? 18.352  6.326   19.635  1.00 44.25 ? 28   DC  B O2    1 
ATOM   4671 N N3    . DC  B 2 9   ? 19.144  7.076   17.658  1.00 43.14 ? 28   DC  B N3    1 
ATOM   4672 C C4    . DC  B 2 9   ? 19.926  6.857   16.599  1.00 42.91 ? 28   DC  B C4    1 
ATOM   4673 N N4    . DC  B 2 9   ? 19.990  7.777   15.639  1.00 42.59 ? 28   DC  B N4    1 
ATOM   4674 C C5    . DC  B 2 9   ? 20.692  5.669   16.476  1.00 42.95 ? 28   DC  B C5    1 
ATOM   4675 C C6    . DC  B 2 9   ? 20.604  4.763   17.455  1.00 42.96 ? 28   DC  B C6    1 
ATOM   4676 P P     . DG  B 2 10  ? 17.540  0.092   18.412  1.00 41.10 ? 29   DG  B P     1 
ATOM   4677 O OP1   . DG  B 2 10  ? 17.214  -1.242  18.949  1.00 41.75 ? 29   DG  B OP1   1 
ATOM   4678 O OP2   . DG  B 2 10  ? 17.479  0.371   16.968  1.00 41.37 ? 29   DG  B OP2   1 
ATOM   4679 O "O5'" . DG  B 2 10  ? 16.612  1.160   19.118  1.00 41.92 ? 29   DG  B "O5'" 1 
ATOM   4680 C "C5'" . DG  B 2 10  ? 15.257  0.901   19.112  1.00 42.75 ? 29   DG  B "C5'" 1 
ATOM   4681 C "C4'" . DG  B 2 10  ? 14.534  2.020   19.800  1.00 43.75 ? 29   DG  B "C4'" 1 
ATOM   4682 O "O4'" . DG  B 2 10  ? 15.200  3.283   19.553  1.00 44.38 ? 29   DG  B "O4'" 1 
ATOM   4683 C "C3'" . DG  B 2 10  ? 13.142  2.177   19.237  1.00 44.63 ? 29   DG  B "C3'" 1 
ATOM   4684 O "O3'" . DG  B 2 10  ? 12.293  2.784   20.150  1.00 45.99 ? 29   DG  B "O3'" 1 
ATOM   4685 C "C2'" . DG  B 2 10  ? 13.391  3.097   18.066  1.00 45.13 ? 29   DG  B "C2'" 1 
ATOM   4686 C "C1'" . DG  B 2 10  ? 14.404  4.048   18.669  1.00 45.54 ? 29   DG  B "C1'" 1 
ATOM   4687 N N9    . DG  B 2 10  ? 15.203  4.598   17.598  1.00 47.11 ? 29   DG  B N9    1 
ATOM   4688 C C8    . DG  B 2 10  ? 16.362  4.075   17.089  1.00 47.91 ? 29   DG  B C8    1 
ATOM   4689 N N7    . DG  B 2 10  ? 16.865  4.760   16.107  1.00 48.41 ? 29   DG  B N7    1 
ATOM   4690 C C5    . DG  B 2 10  ? 15.962  5.798   15.951  1.00 48.86 ? 29   DG  B C5    1 
ATOM   4691 C C6    . DG  B 2 10  ? 15.987  6.865   15.029  1.00 49.47 ? 29   DG  B C6    1 
ATOM   4692 O O6    . DG  B 2 10  ? 16.850  7.070   14.161  1.00 49.81 ? 29   DG  B O6    1 
ATOM   4693 N N1    . DG  B 2 10  ? 14.881  7.712   15.202  1.00 49.19 ? 29   DG  B N1    1 
ATOM   4694 C C2    . DG  B 2 10  ? 13.892  7.532   16.153  1.00 48.62 ? 29   DG  B C2    1 
ATOM   4695 N N2    . DG  B 2 10  ? 12.905  8.426   16.199  1.00 49.02 ? 29   DG  B N2    1 
ATOM   4696 N N3    . DG  B 2 10  ? 13.860  6.533   17.019  1.00 48.09 ? 29   DG  B N3    1 
ATOM   4697 C C4    . DG  B 2 10  ? 14.924  5.711   16.856  1.00 48.14 ? 29   DG  B C4    1 
HETATM 4698 C "C5'" . SAY C 3 1   ? 16.672  14.681  7.952   1.00 35.13 ? 3    SAY C "C5'" 1 
HETATM 4699 C "C4'" . SAY C 3 1   ? 15.183  14.806  7.847   1.00 31.58 ? 3    SAY C "C4'" 1 
HETATM 4700 O "O4'" . SAY C 3 1   ? 14.687  13.745  7.100   1.00 30.80 ? 3    SAY C "O4'" 1 
HETATM 4701 C "C3'" . SAY C 3 1   ? 14.669  14.437  9.202   1.00 28.79 ? 3    SAY C "C3'" 1 
HETATM 4702 O "O3'" . SAY C 3 1   ? 14.598  15.589  10.002  1.00 25.34 ? 3    SAY C "O3'" 1 
HETATM 4703 C "C2'" . SAY C 3 1   ? 13.247  14.000  8.876   1.00 29.13 ? 3    SAY C "C2'" 1 
HETATM 4704 C "C1'" . SAY C 3 1   ? 13.289  13.793  7.376   1.00 29.35 ? 3    SAY C "C1'" 1 
HETATM 4705 C CAA   . SAY C 3 1   ? 12.995  12.448  6.753   1.00 62.69 ? 3    SAY C CAA   1 
HETATM 4706 C CAB   . SAY C 3 1   ? 13.831  11.399  7.044   1.00 63.41 ? 3    SAY C CAB   1 
HETATM 4707 C CAF   . SAY C 3 1   ? 11.962  12.275  5.849   1.00 63.40 ? 3    SAY C CAF   1 
HETATM 4708 C CAE   . SAY C 3 1   ? 11.747  11.034  5.261   1.00 63.79 ? 3    SAY C CAE   1 
HETATM 4709 C CAD   . SAY C 3 1   ? 12.585  9.985   5.583   1.00 64.08 ? 3    SAY C CAD   1 
HETATM 4710 C CAG   . SAY C 3 1   ? 12.461  8.590   5.013   1.00 64.27 ? 3    SAY C CAG   1 
HETATM 4711 C CAC   . SAY C 3 1   ? 13.609  10.168  6.462   1.00 64.28 ? 3    SAY C CAC   1 
HETATM 4712 O OAR   . SAY C 3 1   ? 14.391  9.098   6.728   1.00 65.27 ? 3    SAY C OAR   1 
HETATM 4713 O OAH   . SAY C 3 1   ? 13.422  7.825   5.079   1.00 63.33 ? 3    SAY C OAH   1 
ATOM   4714 P P     . DC  C 3 2   ? 13.139  16.110  10.179  1.00 58.11 ? 4    DC  C P     1 
ATOM   4715 O OP1   . DC  C 3 2   ? 12.476  15.853  8.911   1.00 58.60 ? 4    DC  C OP1   1 
ATOM   4716 O OP2   . DC  C 3 2   ? 13.191  17.434  10.755  1.00 58.65 ? 4    DC  C OP2   1 
ATOM   4717 O "O5'" . DC  C 3 2   ? 12.498  15.205  11.289  1.00 56.47 ? 4    DC  C "O5'" 1 
ATOM   4718 C "C5'" . DC  C 3 2   ? 11.110  15.269  11.490  1.00 55.06 ? 4    DC  C "C5'" 1 
ATOM   4719 C "C4'" . DC  C 3 2   ? 10.727  14.470  12.709  1.00 53.94 ? 4    DC  C "C4'" 1 
ATOM   4720 O "O4'" . DC  C 3 2   ? 11.116  13.115  12.462  1.00 53.58 ? 4    DC  C "O4'" 1 
ATOM   4721 C "C3'" . DC  C 3 2   ? 11.474  14.832  13.972  1.00 52.90 ? 4    DC  C "C3'" 1 
ATOM   4722 O "O3'" . DC  C 3 2   ? 10.752  15.801  14.676  1.00 51.33 ? 4    DC  C "O3'" 1 
ATOM   4723 C "C2'" . DC  C 3 2   ? 11.458  13.523  14.740  1.00 53.05 ? 4    DC  C "C2'" 1 
ATOM   4724 C "C1'" . DC  C 3 2   ? 11.385  12.459  13.664  1.00 53.09 ? 4    DC  C "C1'" 1 
ATOM   4725 N N1    . DC  C 3 2   ? 12.638  11.785  13.449  1.00 52.55 ? 4    DC  C N1    1 
ATOM   4726 C C2    . DC  C 3 2   ? 12.885  10.612  14.109  1.00 52.56 ? 4    DC  C C2    1 
ATOM   4727 O O2    . DC  C 3 2   ? 12.020  10.181  14.867  1.00 52.75 ? 4    DC  C O2    1 
ATOM   4728 N N3    . DC  C 3 2   ? 14.056  9.983   13.905  1.00 52.40 ? 4    DC  C N3    1 
ATOM   4729 C C4    . DC  C 3 2   ? 14.937  10.487  13.069  1.00 51.96 ? 4    DC  C C4    1 
ATOM   4730 N N4    . DC  C 3 2   ? 16.062  9.807   12.914  1.00 51.66 ? 4    DC  C N4    1 
ATOM   4731 C C5    . DC  C 3 2   ? 14.702  11.690  12.373  1.00 52.06 ? 4    DC  C C5    1 
ATOM   4732 C C6    . DC  C 3 2   ? 13.545  12.297  12.595  1.00 52.30 ? 4    DC  C C6    1 
ATOM   4733 P P     . DG  C 3 3   ? 11.477  16.672  15.763  1.00 50.06 ? 5    DG  C P     1 
ATOM   4734 O OP1   . DG  C 3 3   ? 10.680  17.902  15.948  1.00 49.97 ? 5    DG  C OP1   1 
ATOM   4735 O OP2   . DG  C 3 3   ? 12.929  16.761  15.445  1.00 49.32 ? 5    DG  C OP2   1 
ATOM   4736 O "O5'" . DG  C 3 3   ? 11.267  15.758  17.055  1.00 49.80 ? 5    DG  C "O5'" 1 
ATOM   4737 C "C5'" . DG  C 3 3   ? 12.369  15.007  17.495  1.00 49.25 ? 5    DG  C "C5'" 1 
ATOM   4738 C "C4'" . DG  C 3 3   ? 12.010  14.013  18.574  1.00 48.97 ? 5    DG  C "C4'" 1 
ATOM   4739 O "O4'" . DG  C 3 3   ? 11.988  12.677  18.010  1.00 49.48 ? 5    DG  C "O4'" 1 
ATOM   4740 C "C3'" . DG  C 3 3   ? 13.024  13.988  19.706  1.00 48.40 ? 5    DG  C "C3'" 1 
ATOM   4741 O "O3'" . DG  C 3 3   ? 12.511  14.761  20.787  1.00 46.61 ? 5    DG  C "O3'" 1 
ATOM   4742 C "C2'" . DG  C 3 3   ? 13.157  12.502  20.019  1.00 49.13 ? 5    DG  C "C2'" 1 
ATOM   4743 C "C1'" . DG  C 3 3   ? 12.944  11.859  18.654  1.00 49.79 ? 5    DG  C "C1'" 1 
ATOM   4744 N N9    . DG  C 3 3   ? 14.129  11.754  17.794  1.00 50.93 ? 5    DG  C N9    1 
ATOM   4745 C C8    . DG  C 3 3   ? 14.461  12.529  16.702  1.00 51.46 ? 5    DG  C C8    1 
ATOM   4746 N N7    . DG  C 3 3   ? 15.576  12.203  16.119  1.00 51.22 ? 5    DG  C N7    1 
ATOM   4747 C C5    . DG  C 3 3   ? 16.018  11.134  16.871  1.00 51.20 ? 5    DG  C C5    1 
ATOM   4748 C C6    . DG  C 3 3   ? 17.181  10.361  16.711  1.00 51.34 ? 5    DG  C C6    1 
ATOM   4749 O O6    . DG  C 3 3   ? 18.058  10.485  15.850  1.00 51.36 ? 5    DG  C O6    1 
ATOM   4750 N N1    . DG  C 3 3   ? 17.276  9.364   17.677  1.00 51.33 ? 5    DG  C N1    1 
ATOM   4751 C C2    . DG  C 3 3   ? 16.352  9.146   18.671  1.00 50.93 ? 5    DG  C C2    1 
ATOM   4752 N N2    . DG  C 3 3   ? 16.603  8.140   19.511  1.00 50.94 ? 5    DG  C N2    1 
ATOM   4753 N N3    . DG  C 3 3   ? 15.251  9.861   18.834  1.00 51.09 ? 5    DG  C N3    1 
ATOM   4754 C C4    . DG  C 3 3   ? 15.149  10.837  17.899  1.00 51.19 ? 5    DG  C C4    1 
ATOM   4755 P P     . DA  C 3 4   ? 13.364  15.925  21.461  1.00 43.99 ? 6    DA  C P     1 
ATOM   4756 O OP1   . DA  C 3 4   ? 12.416  16.883  22.047  1.00 44.47 ? 6    DA  C OP1   1 
ATOM   4757 O OP2   . DA  C 3 4   ? 14.393  16.368  20.508  1.00 44.11 ? 6    DA  C OP2   1 
ATOM   4758 O "O5'" . DA  C 3 4   ? 14.070  15.192  22.675  1.00 43.54 ? 6    DA  C "O5'" 1 
ATOM   4759 C "C5'" . DA  C 3 4   ? 15.459  15.094  22.722  1.00 43.83 ? 6    DA  C "C5'" 1 
ATOM   4760 C "C4'" . DA  C 3 4   ? 15.825  13.684  23.103  1.00 43.63 ? 6    DA  C "C4'" 1 
ATOM   4761 O "O4'" . DA  C 3 4   ? 15.684  12.835  21.952  1.00 43.68 ? 6    DA  C "O4'" 1 
ATOM   4762 C "C3'" . DA  C 3 4   ? 17.263  13.528  23.529  1.00 43.54 ? 6    DA  C "C3'" 1 
ATOM   4763 O "O3'" . DA  C 3 4   ? 17.308  13.749  24.903  1.00 43.21 ? 6    DA  C "O3'" 1 
ATOM   4764 C "C2'" . DA  C 3 4   ? 17.577  12.093  23.155  1.00 43.76 ? 6    DA  C "C2'" 1 
ATOM   4765 C "C1'" . DA  C 3 4   ? 16.745  11.909  21.894  1.00 44.16 ? 6    DA  C "C1'" 1 
ATOM   4766 N N9    . DA  C 3 4   ? 17.478  12.134  20.653  1.00 45.64 ? 6    DA  C N9    1 
ATOM   4767 C C8    . DA  C 3 4   ? 17.208  13.040  19.659  1.00 46.30 ? 6    DA  C C8    1 
ATOM   4768 N N7    . DA  C 3 4   ? 18.049  12.997  18.655  1.00 46.44 ? 6    DA  C N7    1 
ATOM   4769 C C5    . DA  C 3 4   ? 18.931  11.995  19.016  1.00 46.23 ? 6    DA  C C5    1 
ATOM   4770 C C6    . DA  C 3 4   ? 20.062  11.452  18.382  1.00 46.14 ? 6    DA  C C6    1 
ATOM   4771 N N6    . DA  C 3 4   ? 20.496  11.887  17.199  1.00 46.11 ? 6    DA  C N6    1 
ATOM   4772 N N1    . DA  C 3 4   ? 20.728  10.453  19.001  1.00 46.30 ? 6    DA  C N1    1 
ATOM   4773 C C2    . DA  C 3 4   ? 20.280  10.026  20.188  1.00 46.39 ? 6    DA  C C2    1 
ATOM   4774 N N3    . DA  C 3 4   ? 19.231  10.461  20.882  1.00 46.62 ? 6    DA  C N3    1 
ATOM   4775 C C4    . DA  C 3 4   ? 18.592  11.451  20.236  1.00 46.26 ? 6    DA  C C4    1 
ATOM   4776 P P     . DG  C 3 5   ? 18.660  14.267  25.538  1.00 43.52 ? 7    DG  C P     1 
ATOM   4777 O OP1   . DG  C 3 5   ? 18.436  14.337  26.999  1.00 44.19 ? 7    DG  C OP1   1 
ATOM   4778 O OP2   . DG  C 3 5   ? 19.098  15.472  24.796  1.00 43.08 ? 7    DG  C OP2   1 
ATOM   4779 O "O5'" . DG  C 3 5   ? 19.654  13.069  25.207  1.00 42.83 ? 7    DG  C "O5'" 1 
ATOM   4780 C "C5'" . DG  C 3 5   ? 19.854  12.046  26.151  1.00 42.74 ? 7    DG  C "C5'" 1 
ATOM   4781 C "C4'" . DG  C 3 5   ? 21.194  11.419  25.875  1.00 42.91 ? 7    DG  C "C4'" 1 
ATOM   4782 O "O4'" . DG  C 3 5   ? 21.337  11.285  24.443  1.00 43.17 ? 7    DG  C "O4'" 1 
ATOM   4783 C "C3'" . DG  C 3 5   ? 22.381  12.241  26.352  1.00 42.80 ? 7    DG  C "C3'" 1 
ATOM   4784 O "O3'" . DG  C 3 5   ? 23.350  11.419  26.947  1.00 42.52 ? 7    DG  C "O3'" 1 
ATOM   4785 C "C2'" . DG  C 3 5   ? 22.923  12.868  25.081  1.00 42.93 ? 7    DG  C "C2'" 1 
ATOM   4786 C "C1'" . DG  C 3 5   ? 22.583  11.809  24.056  1.00 42.89 ? 7    DG  C "C1'" 1 
ATOM   4787 N N9    . DG  C 3 5   ? 22.485  12.363  22.714  1.00 43.05 ? 7    DG  C N9    1 
ATOM   4788 C C8    . DG  C 3 5   ? 21.666  13.378  22.275  1.00 43.12 ? 7    DG  C C8    1 
ATOM   4789 N N7    . DG  C 3 5   ? 21.814  13.649  21.008  1.00 42.87 ? 7    DG  C N7    1 
ATOM   4790 C C5    . DG  C 3 5   ? 22.798  12.761  20.591  1.00 42.40 ? 7    DG  C C5    1 
ATOM   4791 C C6    . DG  C 3 5   ? 23.387  12.573  19.327  1.00 41.82 ? 7    DG  C C6    1 
ATOM   4792 O O6    . DG  C 3 5   ? 23.158  13.179  18.281  1.00 41.48 ? 7    DG  C O6    1 
ATOM   4793 N N1    . DG  C 3 5   ? 24.337  11.561  19.339  1.00 41.87 ? 7    DG  C N1    1 
ATOM   4794 C C2    . DG  C 3 5   ? 24.690  10.817  20.434  1.00 42.16 ? 7    DG  C C2    1 
ATOM   4795 N N2    . DG  C 3 5   ? 25.633  9.884   20.256  1.00 42.69 ? 7    DG  C N2    1 
ATOM   4796 N N3    . DG  C 3 5   ? 24.150  10.980  21.625  1.00 42.52 ? 7    DG  C N3    1 
ATOM   4797 C C4    . DG  C 3 5   ? 23.219  11.964  21.627  1.00 42.74 ? 7    DG  C C4    1 
ATOM   4798 P P     . DT  C 3 6   ? 24.423  12.069  27.927  1.00 42.08 ? 8    DT  C P     1 
ATOM   4799 O OP1   . DT  C 3 6   ? 24.009  11.740  29.302  1.00 41.94 ? 8    DT  C OP1   1 
ATOM   4800 O OP2   . DT  C 3 6   ? 24.630  13.479  27.544  1.00 42.20 ? 8    DT  C OP2   1 
ATOM   4801 O "O5'" . DT  C 3 6   ? 25.787  11.316  27.581  1.00 43.27 ? 8    DT  C "O5'" 1 
ATOM   4802 C "C5'" . DT  C 3 6   ? 25.867  10.158  26.755  1.00 44.17 ? 8    DT  C "C5'" 1 
ATOM   4803 C "C4'" . DT  C 3 6   ? 27.138  10.173  25.926  1.00 44.41 ? 8    DT  C "C4'" 1 
ATOM   4804 O "O4'" . DT  C 3 6   ? 26.798  10.626  24.600  1.00 44.54 ? 8    DT  C "O4'" 1 
ATOM   4805 C "C3'" . DT  C 3 6   ? 28.255  11.095  26.423  1.00 44.82 ? 8    DT  C "C3'" 1 
ATOM   4806 O "O3'" . DT  C 3 6   ? 29.398  10.322  26.740  1.00 45.03 ? 8    DT  C "O3'" 1 
ATOM   4807 C "C2'" . DT  C 3 6   ? 28.480  12.088  25.284  1.00 44.92 ? 8    DT  C "C2'" 1 
ATOM   4808 C "C1'" . DT  C 3 6   ? 27.867  11.391  24.086  1.00 44.81 ? 8    DT  C "C1'" 1 
ATOM   4809 N N1    . DT  C 3 6   ? 27.319  12.318  23.049  1.00 44.48 ? 8    DT  C N1    1 
ATOM   4810 C C2    . DT  C 3 6   ? 27.690  12.185  21.722  1.00 44.04 ? 8    DT  C C2    1 
ATOM   4811 O O2    . DT  C 3 6   ? 28.468  11.350  21.300  1.00 43.98 ? 8    DT  C O2    1 
ATOM   4812 N N3    . DT  C 3 6   ? 27.104  13.095  20.884  1.00 43.95 ? 8    DT  C N3    1 
ATOM   4813 C C4    . DT  C 3 6   ? 26.205  14.087  21.231  1.00 43.81 ? 8    DT  C C4    1 
ATOM   4814 O O4    . DT  C 3 6   ? 25.731  14.860  20.414  1.00 44.70 ? 8    DT  C O4    1 
ATOM   4815 C C5    . DT  C 3 6   ? 25.865  14.168  22.623  1.00 43.35 ? 8    DT  C C5    1 
ATOM   4816 C C7    . DT  C 3 6   ? 24.908  15.201  23.116  1.00 42.98 ? 8    DT  C C7    1 
ATOM   4817 C C6    . DT  C 3 6   ? 26.425  13.294  23.455  1.00 43.89 ? 8    DT  C C6    1 
ATOM   4818 P P     . DC  C 3 7   ? 30.814  10.955  26.853  1.00 45.56 ? 9    DC  C P     1 
ATOM   4819 O OP1   . DC  C 3 7   ? 31.560  10.108  27.761  1.00 45.37 ? 9    DC  C OP1   1 
ATOM   4820 O OP2   . DC  C 3 7   ? 30.691  12.372  27.144  1.00 45.45 ? 9    DC  C OP2   1 
ATOM   4821 O "O5'" . DC  C 3 7   ? 31.358  10.762  25.394  1.00 45.57 ? 9    DC  C "O5'" 1 
ATOM   4822 C "C5'" . DC  C 3 7   ? 32.592  10.133  25.262  1.00 45.65 ? 9    DC  C "C5'" 1 
ATOM   4823 C "C4'" . DC  C 3 7   ? 33.250  10.642  24.016  1.00 45.40 ? 9    DC  C "C4'" 1 
ATOM   4824 O "O4'" . DC  C 3 7   ? 32.201  11.252  23.276  1.00 45.98 ? 9    DC  C "O4'" 1 
ATOM   4825 C "C3'" . DC  C 3 7   ? 34.273  11.724  24.254  1.00 45.08 ? 9    DC  C "C3'" 1 
ATOM   4826 O "O3'" . DC  C 3 7   ? 35.468  11.292  23.765  1.00 44.97 ? 9    DC  C "O3'" 1 
ATOM   4827 C "C2'" . DC  C 3 7   ? 33.821  12.872  23.388  1.00 45.74 ? 9    DC  C "C2'" 1 
ATOM   4828 C "C1'" . DC  C 3 7   ? 32.760  12.261  22.506  1.00 46.15 ? 9    DC  C "C1'" 1 
ATOM   4829 N N1    . DC  C 3 7   ? 31.708  13.226  22.252  1.00 46.85 ? 9    DC  C N1    1 
ATOM   4830 C C2    . DC  C 3 7   ? 31.396  13.543  20.953  1.00 47.63 ? 9    DC  C C2    1 
ATOM   4831 O O2    . DC  C 3 7   ? 32.022  12.980  20.061  1.00 47.90 ? 9    DC  C O2    1 
ATOM   4832 N N3    . DC  C 3 7   ? 30.429  14.449  20.724  1.00 48.12 ? 9    DC  C N3    1 
ATOM   4833 C C4    . DC  C 3 7   ? 29.801  15.011  21.741  1.00 47.24 ? 9    DC  C C4    1 
ATOM   4834 N N4    . DC  C 3 7   ? 28.856  15.898  21.467  1.00 47.26 ? 9    DC  C N4    1 
ATOM   4835 C C5    . DC  C 3 7   ? 30.110  14.702  23.079  1.00 46.76 ? 9    DC  C C5    1 
ATOM   4836 C C6    . DC  C 3 7   ? 31.064  13.811  23.284  1.00 46.71 ? 9    DC  C C6    1 
ATOM   4837 P P     . DA  C 3 8   ? 36.757  11.864  24.437  1.00 45.16 ? 10   DA  C P     1 
ATOM   4838 O OP1   . DA  C 3 8   ? 37.587  10.747  24.852  1.00 44.84 ? 10   DA  C OP1   1 
ATOM   4839 O OP2   . DA  C 3 8   ? 36.320  12.888  25.367  1.00 44.84 ? 10   DA  C OP2   1 
ATOM   4840 O "O5'" . DA  C 3 8   ? 37.454  12.604  23.236  1.00 44.72 ? 10   DA  C "O5'" 1 
ATOM   4841 C "C5'" . DA  C 3 8   ? 37.631  11.936  22.019  1.00 44.37 ? 10   DA  C "C5'" 1 
ATOM   4842 C "C4'" . DA  C 3 8   ? 37.574  12.901  20.859  1.00 44.24 ? 10   DA  C "C4'" 1 
ATOM   4843 O "O4'" . DA  C 3 8   ? 36.287  13.519  20.838  1.00 44.27 ? 10   DA  C "O4'" 1 
ATOM   4844 C "C3'" . DA  C 3 8   ? 38.558  14.039  20.943  1.00 44.14 ? 10   DA  C "C3'" 1 
ATOM   4845 O "O3'" . DA  C 3 8   ? 39.364  13.969  19.826  1.00 44.26 ? 10   DA  C "O3'" 1 
ATOM   4846 C "C2'" . DA  C 3 8   ? 37.710  15.297  20.903  1.00 44.17 ? 10   DA  C "C2'" 1 
ATOM   4847 C "C1'" . DA  C 3 8   ? 36.393  14.819  20.351  1.00 44.49 ? 10   DA  C "C1'" 1 
ATOM   4848 N N9    . DA  C 3 8   ? 35.265  15.566  20.876  1.00 45.14 ? 10   DA  C N9    1 
ATOM   4849 C C8    . DA  C 3 8   ? 34.880  15.589  22.167  1.00 45.23 ? 10   DA  C C8    1 
ATOM   4850 N N7    . DA  C 3 8   ? 33.847  16.337  22.403  1.00 45.42 ? 10   DA  C N7    1 
ATOM   4851 C C5    . DA  C 3 8   ? 33.521  16.840  21.176  1.00 45.38 ? 10   DA  C C5    1 
ATOM   4852 C C6    . DA  C 3 8   ? 32.509  17.701  20.764  1.00 45.50 ? 10   DA  C C6    1 
ATOM   4853 N N6    . DA  C 3 8   ? 31.602  18.224  21.571  1.00 45.54 ? 10   DA  C N6    1 
ATOM   4854 N N1    . DA  C 3 8   ? 32.445  18.012  19.479  1.00 46.02 ? 10   DA  C N1    1 
ATOM   4855 C C2    . DA  C 3 8   ? 33.354  17.492  18.671  1.00 46.22 ? 10   DA  C C2    1 
ATOM   4856 N N3    . DA  C 3 8   ? 34.351  16.672  18.939  1.00 45.78 ? 10   DA  C N3    1 
ATOM   4857 C C4    . DA  C 3 8   ? 34.379  16.381  20.227  1.00 45.30 ? 10   DA  C C4    1 
ATOM   4858 P P     . DG  C 3 9   ? 40.803  14.587  19.878  1.00 44.15 ? 11   DG  C P     1 
ATOM   4859 O OP1   . DG  C 3 9   ? 41.678  13.799  18.984  1.00 43.66 ? 11   DG  C OP1   1 
ATOM   4860 O OP2   . DG  C 3 9   ? 41.211  14.828  21.273  1.00 44.17 ? 11   DG  C OP2   1 
ATOM   4861 O "O5'" . DG  C 3 9   ? 40.514  16.007  19.224  1.00 45.21 ? 11   DG  C "O5'" 1 
ATOM   4862 C "C5'" . DG  C 3 9   ? 40.126  16.040  17.868  1.00 46.63 ? 11   DG  C "C5'" 1 
ATOM   4863 C "C4'" . DG  C 3 9   ? 39.457  17.354  17.521  1.00 47.44 ? 11   DG  C "C4'" 1 
ATOM   4864 O "O4'" . DG  C 3 9   ? 38.301  17.560  18.364  1.00 47.51 ? 11   DG  C "O4'" 1 
ATOM   4865 C "C3'" . DG  C 3 9   ? 40.349  18.578  17.685  1.00 47.83 ? 11   DG  C "C3'" 1 
ATOM   4866 O "O3'" . DG  C 3 9   ? 40.568  19.130  16.392  1.00 48.92 ? 11   DG  C "O3'" 1 
ATOM   4867 C "C2'" . DG  C 3 9   ? 39.571  19.489  18.634  1.00 47.82 ? 11   DG  C "C2'" 1 
ATOM   4868 C "C1'" . DG  C 3 9   ? 38.156  18.943  18.548  1.00 47.42 ? 11   DG  C "C1'" 1 
ATOM   4869 N N9    . DG  C 3 9   ? 37.353  19.083  19.747  1.00 47.01 ? 11   DG  C N9    1 
ATOM   4870 C C8    . DG  C 3 9   ? 37.609  18.548  20.982  1.00 46.76 ? 11   DG  C C8    1 
ATOM   4871 N N7    . DG  C 3 9   ? 36.699  18.824  21.868  1.00 46.60 ? 11   DG  C N7    1 
ATOM   4872 C C5    . DG  C 3 9   ? 35.782  19.583  21.167  1.00 46.51 ? 11   DG  C C5    1 
ATOM   4873 C C6    . DG  C 3 9   ? 34.584  20.169  21.602  1.00 46.38 ? 11   DG  C C6    1 
ATOM   4874 O O6    . DG  C 3 9   ? 34.086  20.124  22.729  1.00 46.44 ? 11   DG  C O6    1 
ATOM   4875 N N1    . DG  C 3 9   ? 33.956  20.863  20.572  1.00 46.50 ? 11   DG  C N1    1 
ATOM   4876 C C2    . DG  C 3 9   ? 34.419  20.978  19.287  1.00 46.68 ? 11   DG  C C2    1 
ATOM   4877 N N2    . DG  C 3 9   ? 33.657  21.690  18.448  1.00 46.90 ? 11   DG  C N2    1 
ATOM   4878 N N3    . DG  C 3 9   ? 35.545  20.428  18.862  1.00 46.90 ? 11   DG  C N3    1 
ATOM   4879 C C4    . DG  C 3 9   ? 36.167  19.752  19.858  1.00 46.85 ? 11   DG  C C4    1 
ATOM   4880 P P     . DG  C 3 10  ? 41.402  20.474  16.181  1.00 50.26 ? 12   DG  C P     1 
ATOM   4881 O OP1   . DG  C 3 10  ? 41.869  20.538  14.771  1.00 49.17 ? 12   DG  C OP1   1 
ATOM   4882 O OP2   . DG  C 3 10  ? 42.355  20.589  17.309  1.00 49.60 ? 12   DG  C OP2   1 
ATOM   4883 O "O5'" . DG  C 3 10  ? 40.253  21.556  16.390  1.00 50.72 ? 12   DG  C "O5'" 1 
ATOM   4884 C "C5'" . DG  C 3 10  ? 39.074  21.473  15.611  1.00 52.18 ? 12   DG  C "C5'" 1 
ATOM   4885 C "C4'" . DG  C 3 10  ? 38.404  22.829  15.567  1.00 53.45 ? 12   DG  C "C4'" 1 
ATOM   4886 O "O4'" . DG  C 3 10  ? 37.531  22.958  16.725  1.00 53.37 ? 12   DG  C "O4'" 1 
ATOM   4887 C "C3'" . DG  C 3 10  ? 39.371  24.014  15.609  1.00 54.55 ? 12   DG  C "C3'" 1 
ATOM   4888 O "O3'" . DG  C 3 10  ? 38.889  25.080  14.750  1.00 56.60 ? 12   DG  C "O3'" 1 
ATOM   4889 C "C2'" . DG  C 3 10  ? 39.415  24.333  17.108  1.00 53.90 ? 12   DG  C "C2'" 1 
ATOM   4890 C "C1'" . DG  C 3 10  ? 38.010  23.970  17.596  1.00 53.09 ? 12   DG  C "C1'" 1 
ATOM   4891 N N9    . DG  C 3 10  ? 37.951  23.500  18.987  1.00 51.64 ? 12   DG  C N9    1 
ATOM   4892 C C8    . DG  C 3 10  ? 38.921  22.810  19.685  1.00 51.13 ? 12   DG  C C8    1 
ATOM   4893 N N7    . DG  C 3 10  ? 38.593  22.521  20.914  1.00 50.33 ? 12   DG  C N7    1 
ATOM   4894 C C5    . DG  C 3 10  ? 37.322  23.052  21.047  1.00 50.08 ? 12   DG  C C5    1 
ATOM   4895 C C6    . DG  C 3 10  ? 36.463  23.045  22.171  1.00 49.43 ? 12   DG  C C6    1 
ATOM   4896 O O6    . DG  C 3 10  ? 36.684  22.548  23.288  1.00 49.01 ? 12   DG  C O6    1 
ATOM   4897 N N1    . DG  C 3 10  ? 35.253  23.694  21.896  1.00 48.58 ? 12   DG  C N1    1 
ATOM   4898 C C2    . DG  C 3 10  ? 34.927  24.272  20.691  1.00 48.34 ? 12   DG  C C2    1 
ATOM   4899 N N2    . DG  C 3 10  ? 33.727  24.847  20.621  1.00 47.96 ? 12   DG  C N2    1 
ATOM   4900 N N3    . DG  C 3 10  ? 35.722  24.286  19.627  1.00 49.20 ? 12   DG  C N3    1 
ATOM   4901 C C4    . DG  C 3 10  ? 36.905  23.660  19.874  1.00 50.49 ? 12   DG  C C4    1 
ATOM   4902 P P     . DC  C 3 11  ? 39.322  26.626  14.903  1.00 58.93 ? 13   DC  C P     1 
ATOM   4903 O OP1   . DC  C 3 11  ? 39.008  27.299  13.616  1.00 58.25 ? 13   DC  C OP1   1 
ATOM   4904 O OP2   . DC  C 3 11  ? 40.705  26.681  15.459  1.00 58.74 ? 13   DC  C OP2   1 
ATOM   4905 O "O5'" . DC  C 3 11  ? 38.313  27.152  16.048  1.00 58.59 ? 13   DC  C "O5'" 1 
ATOM   4906 C "C5'" . DC  C 3 11  ? 37.409  28.250  15.855  1.00 58.08 ? 13   DC  C "C5'" 1 
ATOM   4907 C "C4'" . DC  C 3 11  ? 36.914  28.811  17.182  1.00 57.77 ? 13   DC  C "C4'" 1 
ATOM   4908 O "O4'" . DC  C 3 11  ? 36.686  27.755  18.159  1.00 57.68 ? 13   DC  C "O4'" 1 
ATOM   4909 C "C3'" . DC  C 3 11  ? 37.895  29.755  17.859  1.00 57.76 ? 13   DC  C "C3'" 1 
ATOM   4910 O "O3'" . DC  C 3 11  ? 37.778  31.074  17.316  1.00 57.38 ? 13   DC  C "O3'" 1 
ATOM   4911 C "C2'" . DC  C 3 11  ? 37.476  29.660  19.327  1.00 57.84 ? 13   DC  C "C2'" 1 
ATOM   4912 C "C1'" . DC  C 3 11  ? 36.962  28.225  19.470  1.00 57.53 ? 13   DC  C "C1'" 1 
ATOM   4913 N N1    . DC  C 3 11  ? 37.945  27.296  20.141  1.00 57.28 ? 13   DC  C N1    1 
ATOM   4914 C C2    . DC  C 3 11  ? 37.723  26.831  21.449  1.00 57.10 ? 13   DC  C C2    1 
ATOM   4915 O O2    . DC  C 3 11  ? 36.702  27.182  22.051  1.00 57.61 ? 13   DC  C O2    1 
ATOM   4916 N N3    . DC  C 3 11  ? 38.629  25.998  22.029  1.00 56.85 ? 13   DC  C N3    1 
ATOM   4917 C C4    . DC  C 3 11  ? 39.723  25.627  21.353  1.00 57.43 ? 13   DC  C C4    1 
ATOM   4918 N N4    . DC  C 3 11  ? 40.592  24.804  21.957  1.00 57.56 ? 13   DC  C N4    1 
ATOM   4919 C C5    . DC  C 3 11  ? 39.975  26.091  20.022  1.00 57.59 ? 13   DC  C C5    1 
ATOM   4920 C C6    . DC  C 3 11  ? 39.074  26.913  19.466  1.00 57.47 ? 13   DC  C C6    1 
HETATM 4921 C C1    . GLC D 4 .   ? 18.533  18.690  35.301  0.80 59.80 ? 1    GLC D C1    1 
HETATM 4922 C C2    . GLC D 4 .   ? 19.545  19.426  34.444  0.80 60.10 ? 1    GLC D C2    1 
HETATM 4923 C C3    . GLC D 4 .   ? 19.917  18.597  33.215  0.80 60.37 ? 1    GLC D C3    1 
HETATM 4924 C C4    . GLC D 4 .   ? 20.201  17.134  33.556  0.80 60.39 ? 1    GLC D C4    1 
HETATM 4925 C C5    . GLC D 4 .   ? 19.203  16.553  34.554  0.80 60.50 ? 1    GLC D C5    1 
HETATM 4926 C C6    . GLC D 4 .   ? 19.675  15.197  35.068  0.80 60.69 ? 1    GLC D C6    1 
HETATM 4927 O O2    . GLC D 4 .   ? 18.963  20.637  34.025  0.80 60.13 ? 1    GLC D O2    1 
HETATM 4928 O O3    . GLC D 4 .   ? 21.047  19.137  32.564  0.80 60.53 ? 1    GLC D O3    1 
HETATM 4929 O O4    . GLC D 4 .   ? 20.162  16.389  32.357  0.80 60.22 ? 1    GLC D O4    1 
HETATM 4930 O O5    . GLC D 4 .   ? 19.033  17.423  35.653  0.80 60.09 ? 1    GLC D O5    1 
HETATM 4931 O O6    . GLC D 4 .   ? 20.655  15.367  36.068  0.80 60.72 ? 1    GLC D O6    1 
HETATM 4932 C C1    . FRU D 4 .   ? 16.016  20.183  35.735  0.80 58.78 ? 2    FRU D C1    1 
HETATM 4933 C C2    . FRU D 4 .   ? 16.126  18.753  35.216  0.80 58.66 ? 2    FRU D C2    1 
HETATM 4934 C C3    . FRU D 4 .   ? 14.977  18.430  34.267  0.80 58.31 ? 2    FRU D C3    1 
HETATM 4935 C C4    . FRU D 4 .   ? 14.662  16.978  34.553  0.80 58.16 ? 2    FRU D C4    1 
HETATM 4936 C C5    . FRU D 4 .   ? 15.130  16.788  35.986  0.80 58.02 ? 2    FRU D C5    1 
HETATM 4937 C C6    . FRU D 4 .   ? 15.780  15.440  36.234  0.80 57.76 ? 2    FRU D C6    1 
HETATM 4938 O O1    . FRU D 4 .   ? 14.752  20.406  36.319  0.80 58.87 ? 2    FRU D O1    1 
HETATM 4939 O O2    . FRU D 4 .   ? 17.348  18.577  34.531  0.80 59.25 ? 2    FRU D O2    1 
HETATM 4940 O O3    . FRU D 4 .   ? 15.321  18.648  32.919  0.80 58.32 ? 2    FRU D O3    1 
HETATM 4941 O O4    . FRU D 4 .   ? 13.286  16.706  34.425  0.80 57.89 ? 2    FRU D O4    1 
HETATM 4942 O O5    . FRU D 4 .   ? 16.059  17.815  36.272  0.80 58.24 ? 2    FRU D O5    1 
HETATM 4943 O O6    . FRU D 4 .   ? 16.236  15.429  37.564  0.80 57.36 ? 2    FRU D O6    1 
HETATM 4944 S S     . SO4 E 5 .   ? 4.515   37.168  54.411  1.00 42.44 ? 885  SO4 A S     1 
HETATM 4945 O O1    . SO4 E 5 .   ? 5.687   37.178  53.544  1.00 42.93 ? 885  SO4 A O1    1 
HETATM 4946 O O2    . SO4 E 5 .   ? 3.297   37.062  53.617  1.00 42.77 ? 885  SO4 A O2    1 
HETATM 4947 O O3    . SO4 E 5 .   ? 4.575   36.027  55.314  1.00 42.32 ? 885  SO4 A O3    1 
HETATM 4948 O O4    . SO4 E 5 .   ? 4.511   38.395  55.192  1.00 42.59 ? 885  SO4 A O4    1 
HETATM 4949 S S     . SO4 F 5 .   ? -2.964  -8.083  47.288  1.00 68.66 ? 886  SO4 A S     1 
HETATM 4950 O O1    . SO4 F 5 .   ? -1.943  -8.291  46.262  1.00 68.08 ? 886  SO4 A O1    1 
HETATM 4951 O O2    . SO4 F 5 .   ? -4.232  -7.755  46.632  1.00 68.67 ? 886  SO4 A O2    1 
HETATM 4952 O O3    . SO4 F 5 .   ? -3.171  -9.291  48.079  1.00 68.63 ? 886  SO4 A O3    1 
HETATM 4953 O O4    . SO4 F 5 .   ? -2.531  -7.007  48.185  1.00 68.53 ? 886  SO4 A O4    1 
HETATM 4954 O O     . HOH G 6 .   ? 14.538  17.893  44.017  1.00 16.59 ? 2001 HOH A O     1 
HETATM 4955 O O     . HOH G 6 .   ? 12.385  7.868   48.540  1.00 18.68 ? 2002 HOH A O     1 
HETATM 4956 O O     . HOH G 6 .   ? 17.932  28.196  36.576  1.00 30.00 ? 2003 HOH A O     1 
HETATM 4957 O O     . HOH G 6 .   ? 26.403  29.973  56.842  1.00 13.93 ? 2004 HOH A O     1 
HETATM 4958 O O     . HOH G 6 .   ? -9.154  4.049   3.655   1.00 21.91 ? 2005 HOH A O     1 
HETATM 4959 O O     . HOH G 6 .   ? -10.685 -2.185  6.732   1.00 12.67 ? 2006 HOH A O     1 
HETATM 4960 O O     . HOH G 6 .   ? 13.382  -5.131  9.685   1.00 4.82  ? 2007 HOH A O     1 
HETATM 4961 O O     . HOH G 6 .   ? 20.625  -5.841  43.569  1.00 17.83 ? 2008 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   297 297 ALA ALA A . n 
A 1 2   LYS 2   298 298 LYS LYS A . n 
A 1 3   MET 3   299 299 MET MET A . n 
A 1 4   ALA 4   300 300 ALA ALA A . n 
A 1 5   PHE 5   301 301 PHE PHE A . n 
A 1 6   THR 6   302 302 THR THR A . n 
A 1 7   LEU 7   303 303 LEU LEU A . n 
A 1 8   ALA 8   304 304 ALA ALA A . n 
A 1 9   ASP 9   305 305 ASP ASP A . n 
A 1 10  ARG 10  306 306 ARG ARG A . n 
A 1 11  VAL 11  307 307 VAL VAL A . n 
A 1 12  THR 12  308 308 THR THR A . n 
A 1 13  GLU 13  309 309 GLU GLU A . n 
A 1 14  GLU 14  310 310 GLU GLU A . n 
A 1 15  MET 15  311 311 MET MET A . n 
A 1 16  LEU 16  312 312 LEU LEU A . n 
A 1 17  ALA 17  313 313 ALA ALA A . n 
A 1 18  ASP 18  314 314 ASP ASP A . n 
A 1 19  LYS 19  315 315 LYS LYS A . n 
A 1 20  ALA 20  316 316 ALA ALA A . n 
A 1 21  ALA 21  317 317 ALA ALA A . n 
A 1 22  LEU 22  318 318 LEU LEU A . n 
A 1 23  VAL 23  319 319 VAL VAL A . n 
A 1 24  VAL 24  320 320 VAL VAL A . n 
A 1 25  GLU 25  321 321 GLU GLU A . n 
A 1 26  VAL 26  322 322 VAL VAL A . n 
A 1 27  VAL 27  323 323 VAL VAL A . n 
A 1 28  GLU 28  324 324 GLU GLU A . n 
A 1 29  GLU 29  325 325 GLU GLU A . n 
A 1 30  ASN 30  326 326 ASN ASN A . n 
A 1 31  TYR 31  327 327 TYR TYR A . n 
A 1 32  HIS 32  328 328 HIS HIS A . n 
A 1 33  ALA 33  329 329 ALA ALA A . n 
A 1 34  ALA 34  330 330 ALA ALA A . n 
A 1 35  PRO 35  331 331 PRO PRO A . n 
A 1 36  ILE 36  332 332 ILE ILE A . n 
A 1 37  VAL 37  333 333 VAL VAL A . n 
A 1 38  GLY 38  334 334 GLY GLY A . n 
A 1 39  ILE 39  335 335 ILE ILE A . n 
A 1 40  ALA 40  336 336 ALA ALA A . n 
A 1 41  VAL 41  337 337 VAL VAL A . n 
A 1 42  VAL 42  338 338 VAL VAL A . n 
A 1 43  ASN 43  339 339 ASN ASN A . n 
A 1 44  GLU 44  340 340 GLU GLU A . n 
A 1 45  HIS 45  341 341 HIS HIS A . n 
A 1 46  GLY 46  342 342 GLY GLY A . n 
A 1 47  ARG 47  343 343 ARG ARG A . n 
A 1 48  PHE 48  344 344 PHE PHE A . n 
A 1 49  PHE 49  345 345 PHE PHE A . n 
A 1 50  LEU 50  346 346 LEU LEU A . n 
A 1 51  ARG 51  347 347 ARG ARG A . n 
A 1 52  PRO 52  348 348 PRO PRO A . n 
A 1 53  GLU 53  349 349 GLU GLU A . n 
A 1 54  THR 54  350 350 THR THR A . n 
A 1 55  ALA 55  351 351 ALA ALA A . n 
A 1 56  LEU 56  352 352 LEU LEU A . n 
A 1 57  ALA 57  353 353 ALA ALA A . n 
A 1 58  ASP 58  354 354 ASP ASP A . n 
A 1 59  PRO 59  355 355 PRO PRO A . n 
A 1 60  GLN 60  356 356 GLN GLN A . n 
A 1 61  PHE 61  357 357 PHE PHE A . n 
A 1 62  VAL 62  358 358 VAL VAL A . n 
A 1 63  ALA 63  359 359 ALA ALA A . n 
A 1 64  TRP 64  360 360 TRP TRP A . n 
A 1 65  LEU 65  361 361 LEU LEU A . n 
A 1 66  GLY 66  362 362 GLY GLY A . n 
A 1 67  ASP 67  363 363 ASP ASP A . n 
A 1 68  GLU 68  364 364 GLU GLU A . n 
A 1 69  THR 69  365 365 THR THR A . n 
A 1 70  LYS 70  366 366 LYS LYS A . n 
A 1 71  LYS 71  367 367 LYS LYS A . n 
A 1 72  LYS 72  368 368 LYS LYS A . n 
A 1 73  SER 73  369 369 SER SER A . n 
A 1 74  MET 74  370 370 MET MET A . n 
A 1 75  PHE 75  371 371 PHE PHE A . n 
A 1 76  ASP 76  372 372 ASP ASP A . n 
A 1 77  SER 77  373 373 SER SER A . n 
A 1 78  LYS 78  374 374 LYS LYS A . n 
A 1 79  ARG 79  375 375 ARG ARG A . n 
A 1 80  ALA 80  376 376 ALA ALA A . n 
A 1 81  ALA 81  377 377 ALA ALA A . n 
A 1 82  VAL 82  378 378 VAL VAL A . n 
A 1 83  ALA 83  379 379 ALA ALA A . n 
A 1 84  LEU 84  380 380 LEU LEU A . n 
A 1 85  LYS 85  381 381 LYS LYS A . n 
A 1 86  TRP 86  382 382 TRP TRP A . n 
A 1 87  LYS 87  383 383 LYS LYS A . n 
A 1 88  GLY 88  384 384 GLY GLY A . n 
A 1 89  ILE 89  385 385 ILE ILE A . n 
A 1 90  GLU 90  386 386 GLU GLU A . n 
A 1 91  LEU 91  387 387 LEU LEU A . n 
A 1 92  CYS 92  388 388 CYS CYS A . n 
A 1 93  GLY 93  389 389 GLY GLY A . n 
A 1 94  VAL 94  390 390 VAL VAL A . n 
A 1 95  SER 95  391 391 SER SER A . n 
A 1 96  PHE 96  392 392 PHE PHE A . n 
A 1 97  ASP 97  393 393 ASP ASP A . n 
A 1 98  LEU 98  394 394 LEU LEU A . n 
A 1 99  LEU 99  395 395 LEU LEU A . n 
A 1 100 LEU 100 396 396 LEU LEU A . n 
A 1 101 ALA 101 397 397 ALA ALA A . n 
A 1 102 ALA 102 398 398 ALA ALA A . n 
A 1 103 TYR 103 399 399 TYR TYR A . n 
A 1 104 LEU 104 400 400 LEU LEU A . n 
A 1 105 LEU 105 401 401 LEU LEU A . n 
A 1 106 ASP 106 402 402 ASP ASP A . n 
A 1 107 PRO 107 403 403 PRO PRO A . n 
A 1 108 ALA 108 404 404 ALA ALA A . n 
A 1 109 GLN 109 405 405 GLN GLN A . n 
A 1 110 GLY 110 406 406 GLY GLY A . n 
A 1 111 VAL 111 407 407 VAL VAL A . n 
A 1 112 ASP 112 408 408 ASP ASP A . n 
A 1 113 ASP 113 409 409 ASP ASP A . n 
A 1 114 VAL 114 410 410 VAL VAL A . n 
A 1 115 ALA 115 411 411 ALA ALA A . n 
A 1 116 ALA 116 412 412 ALA ALA A . n 
A 1 117 ALA 117 413 413 ALA ALA A . n 
A 1 118 ALA 118 414 414 ALA ALA A . n 
A 1 119 LYS 119 415 415 LYS LYS A . n 
A 1 120 MET 120 416 416 MET MET A . n 
A 1 121 LYS 121 417 417 LYS LYS A . n 
A 1 122 GLN 122 418 418 GLN GLN A . n 
A 1 123 TYR 123 419 419 TYR TYR A . n 
A 1 124 GLU 124 420 420 GLU GLU A . n 
A 1 125 ALA 125 421 421 ALA ALA A . n 
A 1 126 VAL 126 422 422 VAL VAL A . n 
A 1 127 ARG 127 423 423 ARG ARG A . n 
A 1 128 PRO 128 424 424 PRO PRO A . n 
A 1 129 ASP 129 425 425 ASP ASP A . n 
A 1 130 GLU 130 426 426 GLU GLU A . n 
A 1 131 ALA 131 427 427 ALA ALA A . n 
A 1 132 VAL 132 428 428 VAL VAL A . n 
A 1 133 TYR 133 429 429 TYR TYR A . n 
A 1 134 GLY 134 430 430 GLY GLY A . n 
A 1 135 LYS 135 431 431 LYS LYS A . n 
A 1 136 GLY 136 432 432 GLY GLY A . n 
A 1 137 ALA 137 433 433 ALA ALA A . n 
A 1 138 LYS 138 434 434 LYS LYS A . n 
A 1 139 ARG 139 435 435 ARG ARG A . n 
A 1 140 ALA 140 436 436 ALA ALA A . n 
A 1 141 VAL 141 437 437 VAL VAL A . n 
A 1 142 PRO 142 438 438 PRO PRO A . n 
A 1 143 ASP 143 439 439 ASP ASP A . n 
A 1 144 GLU 144 440 440 GLU GLU A . n 
A 1 145 PRO 145 441 441 PRO PRO A . n 
A 1 146 VAL 146 442 442 VAL VAL A . n 
A 1 147 LEU 147 443 443 LEU LEU A . n 
A 1 148 ALA 148 444 444 ALA ALA A . n 
A 1 149 GLU 149 445 445 GLU GLU A . n 
A 1 150 HIS 150 446 446 HIS HIS A . n 
A 1 151 LEU 151 447 447 LEU LEU A . n 
A 1 152 VAL 152 448 448 VAL VAL A . n 
A 1 153 ARG 153 449 449 ARG ARG A . n 
A 1 154 LYS 154 450 450 LYS LYS A . n 
A 1 155 ALA 155 451 451 ALA ALA A . n 
A 1 156 ALA 156 452 452 ALA ALA A . n 
A 1 157 ALA 157 453 453 ALA ALA A . n 
A 1 158 ILE 158 454 454 ILE ILE A . n 
A 1 159 TRP 159 455 455 TRP TRP A . n 
A 1 160 ALA 160 456 456 ALA ALA A . n 
A 1 161 LEU 161 457 457 LEU LEU A . n 
A 1 162 GLU 162 458 458 GLU GLU A . n 
A 1 163 ARG 163 459 459 ARG ARG A . n 
A 1 164 PRO 164 460 460 PRO PRO A . n 
A 1 165 PHE 165 461 461 PHE PHE A . n 
A 1 166 LEU 166 462 462 LEU LEU A . n 
A 1 167 ASP 167 463 463 ASP ASP A . n 
A 1 168 GLU 168 464 464 GLU GLU A . n 
A 1 169 LEU 169 465 465 LEU LEU A . n 
A 1 170 ARG 170 466 466 ARG ARG A . n 
A 1 171 ARG 171 467 467 ARG ARG A . n 
A 1 172 ASN 172 468 468 ASN ASN A . n 
A 1 173 GLU 173 469 469 GLU GLU A . n 
A 1 174 GLN 174 470 470 GLN GLN A . n 
A 1 175 ASP 175 471 471 ASP ASP A . n 
A 1 176 ARG 176 472 472 ARG ARG A . n 
A 1 177 LEU 177 473 473 LEU LEU A . n 
A 1 178 LEU 178 474 474 LEU LEU A . n 
A 1 179 VAL 179 475 475 VAL VAL A . n 
A 1 180 GLU 180 476 476 GLU GLU A . n 
A 1 181 LEU 181 477 477 LEU LEU A . n 
A 1 182 GLU 182 478 478 GLU GLU A . n 
A 1 183 GLN 183 479 479 GLN GLN A . n 
A 1 184 PRO 184 480 480 PRO PRO A . n 
A 1 185 LEU 185 481 481 LEU LEU A . n 
A 1 186 SER 186 482 482 SER SER A . n 
A 1 187 SER 187 483 483 SER SER A . n 
A 1 188 ILE 188 484 484 ILE ILE A . n 
A 1 189 LEU 189 485 485 LEU LEU A . n 
A 1 190 ALA 190 486 486 ALA ALA A . n 
A 1 191 GLU 191 487 487 GLU GLU A . n 
A 1 192 MET 192 488 488 MET MET A . n 
A 1 193 GLU 193 489 489 GLU GLU A . n 
A 1 194 PHE 194 490 490 PHE PHE A . n 
A 1 195 ALA 195 491 491 ALA ALA A . n 
A 1 196 GLY 196 492 492 GLY GLY A . n 
A 1 197 VAL 197 493 493 VAL VAL A . n 
A 1 198 LYS 198 494 494 LYS LYS A . n 
A 1 199 VAL 199 495 495 VAL VAL A . n 
A 1 200 ASP 200 496 496 ASP ASP A . n 
A 1 201 THR 201 497 497 THR THR A . n 
A 1 202 LYS 202 498 498 LYS LYS A . n 
A 1 203 ARG 203 499 499 ARG ARG A . n 
A 1 204 LEU 204 500 500 LEU LEU A . n 
A 1 205 GLU 205 501 501 GLU GLU A . n 
A 1 206 GLN 206 502 502 GLN GLN A . n 
A 1 207 MET 207 503 503 MET MET A . n 
A 1 208 GLY 208 504 504 GLY GLY A . n 
A 1 209 GLU 209 505 505 GLU GLU A . n 
A 1 210 GLU 210 506 506 GLU GLU A . n 
A 1 211 LEU 211 507 507 LEU LEU A . n 
A 1 212 ALA 212 508 508 ALA ALA A . n 
A 1 213 GLU 213 509 509 GLU GLU A . n 
A 1 214 GLN 214 510 510 GLN GLN A . n 
A 1 215 LEU 215 511 511 LEU LEU A . n 
A 1 216 ARG 216 512 512 ARG ARG A . n 
A 1 217 THR 217 513 513 THR THR A . n 
A 1 218 VAL 218 514 514 VAL VAL A . n 
A 1 219 GLU 219 515 515 GLU GLU A . n 
A 1 220 GLN 220 516 516 GLN GLN A . n 
A 1 221 ARG 221 517 517 ARG ARG A . n 
A 1 222 ILE 222 518 518 ILE ILE A . n 
A 1 223 TYR 223 519 519 TYR TYR A . n 
A 1 224 GLU 224 520 520 GLU GLU A . n 
A 1 225 LEU 225 521 521 LEU LEU A . n 
A 1 226 ALA 226 522 522 ALA ALA A . n 
A 1 227 GLY 227 523 523 GLY GLY A . n 
A 1 228 GLN 228 524 524 GLN GLN A . n 
A 1 229 GLU 229 525 525 GLU GLU A . n 
A 1 230 PHE 230 526 526 PHE PHE A . n 
A 1 231 ASN 231 527 527 ASN ASN A . n 
A 1 232 ILE 232 528 528 ILE ILE A . n 
A 1 233 ASN 233 529 529 ASN ASN A . n 
A 1 234 SER 234 530 530 SER SER A . n 
A 1 235 PRO 235 531 531 PRO PRO A . n 
A 1 236 LYS 236 532 532 LYS LYS A . n 
A 1 237 GLN 237 533 533 GLN GLN A . n 
A 1 238 LEU 238 534 534 LEU LEU A . n 
A 1 239 GLY 239 535 535 GLY GLY A . n 
A 1 240 VAL 240 536 536 VAL VAL A . n 
A 1 241 ILE 241 537 537 ILE ILE A . n 
A 1 242 LEU 242 538 538 LEU LEU A . n 
A 1 243 PHE 243 539 539 PHE PHE A . n 
A 1 244 GLU 244 540 540 GLU GLU A . n 
A 1 245 LYS 245 541 541 LYS LYS A . n 
A 1 246 LEU 246 542 542 LEU LEU A . n 
A 1 247 GLN 247 543 543 GLN GLN A . n 
A 1 248 LEU 248 544 544 LEU LEU A . n 
A 1 249 PRO 249 545 545 PRO PRO A . n 
A 1 250 VAL 250 546 546 VAL VAL A . n 
A 1 251 LEU 251 547 547 LEU LEU A . n 
A 1 252 LYS 252 548 548 LYS LYS A . n 
A 1 253 LYS 253 549 549 LYS LYS A . n 
A 1 254 SER 254 550 550 SER SER A . n 
A 1 255 LYS 255 551 551 LYS LYS A . n 
A 1 256 THR 256 552 552 THR THR A . n 
A 1 257 GLY 257 553 553 GLY GLY A . n 
A 1 258 TYR 258 554 554 TYR TYR A . n 
A 1 259 SER 259 555 555 SER SER A . n 
A 1 260 THR 260 556 556 THR THR A . n 
A 1 261 SER 261 557 557 SER SER A . n 
A 1 262 ALA 262 558 558 ALA ALA A . n 
A 1 263 ASP 263 559 559 ASP ASP A . n 
A 1 264 VAL 264 560 560 VAL VAL A . n 
A 1 265 LEU 265 561 561 LEU LEU A . n 
A 1 266 GLU 266 562 562 GLU GLU A . n 
A 1 267 LYS 267 563 563 LYS LYS A . n 
A 1 268 LEU 268 564 564 LEU LEU A . n 
A 1 269 ALA 269 565 565 ALA ALA A . n 
A 1 270 PRO 270 566 566 PRO PRO A . n 
A 1 271 TYR 271 567 567 TYR TYR A . n 
A 1 272 HIS 272 568 568 HIS HIS A . n 
A 1 273 GLU 273 569 569 GLU GLU A . n 
A 1 274 ILE 274 570 570 ILE ILE A . n 
A 1 275 VAL 275 571 571 VAL VAL A . n 
A 1 276 GLU 276 572 572 GLU GLU A . n 
A 1 277 ASN 277 573 573 ASN ASN A . n 
A 1 278 ILE 278 574 574 ILE ILE A . n 
A 1 279 LEU 279 575 575 LEU LEU A . n 
A 1 280 HIS 280 576 576 HIS HIS A . n 
A 1 281 TYR 281 577 577 TYR TYR A . n 
A 1 282 ARG 282 578 578 ARG ARG A . n 
A 1 283 GLN 283 579 579 GLN GLN A . n 
A 1 284 LEU 284 580 580 LEU LEU A . n 
A 1 285 GLY 285 581 581 GLY GLY A . n 
A 1 286 LYS 286 582 582 LYS LYS A . n 
A 1 287 LEU 287 583 583 LEU LEU A . n 
A 1 288 GLN 288 584 584 GLN GLN A . n 
A 1 289 SER 289 585 585 SER SER A . n 
A 1 290 THR 290 586 586 THR THR A . n 
A 1 291 TYR 291 587 587 TYR TYR A . n 
A 1 292 ILE 292 588 588 ILE ILE A . n 
A 1 293 GLU 293 589 589 GLU GLU A . n 
A 1 294 GLY 294 590 590 GLY GLY A . n 
A 1 295 LEU 295 591 591 LEU LEU A . n 
A 1 296 LEU 296 592 592 LEU LEU A . n 
A 1 297 LYS 297 593 593 LYS LYS A . n 
A 1 298 VAL 298 594 594 VAL VAL A . n 
A 1 299 VAL 299 595 595 VAL VAL A . n 
A 1 300 ARG 300 596 596 ARG ARG A . n 
A 1 301 PRO 301 597 597 PRO PRO A . n 
A 1 302 ASP 302 598 598 ASP ASP A . n 
A 1 303 THR 303 599 599 THR THR A . n 
A 1 304 LYS 304 600 600 LYS LYS A . n 
A 1 305 LYS 305 601 601 LYS LYS A . n 
A 1 306 VAL 306 602 602 VAL VAL A . n 
A 1 307 HIS 307 603 603 HIS HIS A . n 
A 1 308 THR 308 604 604 THR THR A . n 
A 1 309 ILE 309 605 605 ILE ILE A . n 
A 1 310 PHE 310 606 606 PHE PHE A . n 
A 1 311 ASN 311 607 607 ASN ASN A . n 
A 1 312 GLN 312 608 608 GLN GLN A . n 
A 1 313 ALA 313 609 609 ALA ALA A . n 
A 1 314 LEU 314 610 610 LEU LEU A . n 
A 1 315 THR 315 611 611 THR THR A . n 
A 1 316 GLN 316 612 612 GLN GLN A . n 
A 1 317 THR 317 613 613 THR THR A . n 
A 1 318 GLY 318 614 614 GLY GLY A . n 
A 1 319 ARG 319 615 615 ARG ARG A . n 
A 1 320 LEU 320 616 616 LEU LEU A . n 
A 1 321 SER 321 617 617 SER SER A . n 
A 1 322 SER 322 618 618 SER SER A . n 
A 1 323 THR 323 619 619 THR THR A . n 
A 1 324 GLU 324 620 620 GLU GLU A . n 
A 1 325 PRO 325 621 621 PRO PRO A . n 
A 1 326 ASN 326 622 622 ASN ASN A . n 
A 1 327 LEU 327 623 623 LEU LEU A . n 
A 1 328 GLN 328 624 624 GLN GLN A . n 
A 1 329 ASN 329 625 625 ASN ASN A . n 
A 1 330 ILE 330 626 626 ILE ILE A . n 
A 1 331 PRO 331 627 627 PRO PRO A . n 
A 1 332 ILE 332 628 628 ILE ILE A . n 
A 1 333 ARG 333 629 629 ARG ARG A . n 
A 1 334 LEU 334 630 630 LEU LEU A . n 
A 1 335 GLU 335 631 631 GLU GLU A . n 
A 1 336 GLU 336 632 632 GLU GLU A . n 
A 1 337 GLY 337 633 633 GLY GLY A . n 
A 1 338 ARG 338 634 634 ARG ARG A . n 
A 1 339 LYS 339 635 635 LYS LYS A . n 
A 1 340 ILE 340 636 636 ILE ILE A . n 
A 1 341 ARG 341 637 637 ARG ARG A . n 
A 1 342 GLN 342 638 638 GLN GLN A . n 
A 1 343 ALA 343 639 639 ALA ALA A . n 
A 1 344 PHE 344 640 640 PHE PHE A . n 
A 1 345 VAL 345 641 641 VAL VAL A . n 
A 1 346 PRO 346 642 642 PRO PRO A . n 
A 1 347 SER 347 643 643 SER SER A . n 
A 1 348 GLU 348 644 644 GLU GLU A . n 
A 1 349 SER 349 645 645 SER SER A . n 
A 1 350 ASP 350 646 646 ASP ASP A . n 
A 1 351 TRP 351 647 647 TRP TRP A . n 
A 1 352 LEU 352 648 648 LEU LEU A . n 
A 1 353 ILE 353 649 649 ILE ILE A . n 
A 1 354 PHE 354 650 650 PHE PHE A . n 
A 1 355 ALA 355 651 651 ALA ALA A . n 
A 1 356 ALA 356 652 652 ALA ALA A . n 
A 1 357 ASP 357 653 653 ASP ASP A . n 
A 1 358 TYR 358 654 654 TYR TYR A . n 
A 1 359 SER 359 655 655 SER SER A . n 
A 1 360 GLN 360 656 656 GLN GLN A . n 
A 1 361 ILE 361 657 657 ILE ILE A . n 
A 1 362 GLU 362 658 658 GLU GLU A . n 
A 1 363 LEU 363 659 659 LEU LEU A . n 
A 1 364 ARG 364 660 660 ARG ARG A . n 
A 1 365 VAL 365 661 661 VAL VAL A . n 
A 1 366 LEU 366 662 662 LEU LEU A . n 
A 1 367 ALA 367 663 663 ALA ALA A . n 
A 1 368 HIS 368 664 664 HIS HIS A . n 
A 1 369 ILE 369 665 665 ILE ILE A . n 
A 1 370 ALA 370 666 666 ALA ALA A . n 
A 1 371 GLU 371 667 667 GLU GLU A . n 
A 1 372 ASP 372 668 668 ASP ASP A . n 
A 1 373 ASP 373 669 669 ASP ASP A . n 
A 1 374 ASN 374 670 670 ASN ASN A . n 
A 1 375 LEU 375 671 671 LEU LEU A . n 
A 1 376 MET 376 672 672 MET MET A . n 
A 1 377 GLU 377 673 673 GLU GLU A . n 
A 1 378 ALA 378 674 674 ALA ALA A . n 
A 1 379 PHE 379 675 675 PHE PHE A . n 
A 1 380 ARG 380 676 676 ARG ARG A . n 
A 1 381 ARG 381 677 677 ARG ARG A . n 
A 1 382 ASP 382 678 678 ASP ASP A . n 
A 1 383 LEU 383 679 679 LEU LEU A . n 
A 1 384 ASP 384 680 680 ASP ASP A . n 
A 1 385 ILE 385 681 681 ILE ILE A . n 
A 1 386 HIS 386 682 682 HIS HIS A . n 
A 1 387 THR 387 683 683 THR THR A . n 
A 1 388 LYS 388 684 684 LYS LYS A . n 
A 1 389 THR 389 685 685 THR THR A . n 
A 1 390 ALA 390 686 686 ALA ALA A . n 
A 1 391 MET 391 687 687 MET MET A . n 
A 1 392 ASP 392 688 688 ASP ASP A . n 
A 1 393 ILE 393 689 689 ILE ILE A . n 
A 1 394 PHE 394 690 690 PHE PHE A . n 
A 1 395 GLN 395 691 691 GLN GLN A . n 
A 1 396 VAL 396 692 692 VAL VAL A . n 
A 1 397 SER 397 693 693 SER SER A . n 
A 1 398 GLU 398 694 694 GLU GLU A . n 
A 1 399 ASP 399 695 695 ASP ASP A . n 
A 1 400 GLU 400 696 696 GLU GLU A . n 
A 1 401 VAL 401 697 697 VAL VAL A . n 
A 1 402 THR 402 698 698 THR THR A . n 
A 1 403 PRO 403 699 699 PRO PRO A . n 
A 1 404 ASN 404 700 700 ASN ASN A . n 
A 1 405 MET 405 701 701 MET MET A . n 
A 1 406 ARG 406 702 702 ARG ARG A . n 
A 1 407 ARG 407 703 703 ARG ARG A . n 
A 1 408 GLN 408 704 704 GLN GLN A . n 
A 1 409 ALA 409 705 705 ALA ALA A . n 
A 1 410 LYS 410 706 706 LYS LYS A . n 
A 1 411 ALA 411 707 707 ALA ALA A . n 
A 1 412 VAL 412 708 708 VAL VAL A . n 
A 1 413 ASN 413 709 709 ASN ASN A . n 
A 1 414 PHE 414 710 710 PHE PHE A . n 
A 1 415 GLY 415 711 711 GLY GLY A . n 
A 1 416 ILE 416 712 712 ILE ILE A . n 
A 1 417 VAL 417 713 713 VAL VAL A . n 
A 1 418 TYR 418 714 714 TYR TYR A . n 
A 1 419 GLY 419 715 715 GLY GLY A . n 
A 1 420 ILE 420 716 716 ILE ILE A . n 
A 1 421 SER 421 717 717 SER SER A . n 
A 1 422 ASP 422 718 718 ASP ASP A . n 
A 1 423 TYR 423 719 719 TYR TYR A . n 
A 1 424 GLY 424 720 720 GLY GLY A . n 
A 1 425 LEU 425 721 721 LEU LEU A . n 
A 1 426 ALA 426 722 722 ALA ALA A . n 
A 1 427 GLN 427 723 723 GLN GLN A . n 
A 1 428 ASN 428 724 724 ASN ASN A . n 
A 1 429 LEU 429 725 725 LEU LEU A . n 
A 1 430 ASN 430 726 726 ASN ASN A . n 
A 1 431 ILE 431 727 727 ILE ILE A . n 
A 1 432 SER 432 728 728 SER SER A . n 
A 1 433 ARG 433 729 729 ARG ARG A . n 
A 1 434 LYS 434 730 730 LYS LYS A . n 
A 1 435 GLU 435 731 731 GLU GLU A . n 
A 1 436 ALA 436 732 732 ALA ALA A . n 
A 1 437 ALA 437 733 733 ALA ALA A . n 
A 1 438 GLU 438 734 734 GLU GLU A . n 
A 1 439 PHE 439 735 735 PHE PHE A . n 
A 1 440 ILE 440 736 736 ILE ILE A . n 
A 1 441 GLU 441 737 737 GLU GLU A . n 
A 1 442 ARG 442 738 738 ARG ARG A . n 
A 1 443 TYR 443 739 739 TYR TYR A . n 
A 1 444 PHE 444 740 740 PHE PHE A . n 
A 1 445 GLU 445 741 741 GLU GLU A . n 
A 1 446 SER 446 742 742 SER SER A . n 
A 1 447 PHE 447 743 743 PHE PHE A . n 
A 1 448 PRO 448 744 744 PRO PRO A . n 
A 1 449 GLY 449 745 745 GLY GLY A . n 
A 1 450 VAL 450 746 746 VAL VAL A . n 
A 1 451 LYS 451 747 747 LYS LYS A . n 
A 1 452 ARG 452 748 748 ARG ARG A . n 
A 1 453 TYR 453 749 749 TYR TYR A . n 
A 1 454 MET 454 750 750 MET MET A . n 
A 1 455 GLU 455 751 751 GLU GLU A . n 
A 1 456 ASN 456 752 752 ASN ASN A . n 
A 1 457 ILE 457 753 753 ILE ILE A . n 
A 1 458 VAL 458 754 754 VAL VAL A . n 
A 1 459 GLN 459 755 755 GLN GLN A . n 
A 1 460 GLU 460 756 756 GLU GLU A . n 
A 1 461 ALA 461 757 757 ALA ALA A . n 
A 1 462 LYS 462 758 758 LYS LYS A . n 
A 1 463 GLN 463 759 759 GLN GLN A . n 
A 1 464 LYS 464 760 760 LYS LYS A . n 
A 1 465 GLY 465 761 761 GLY GLY A . n 
A 1 466 TYR 466 762 762 TYR TYR A . n 
A 1 467 VAL 467 763 763 VAL VAL A . n 
A 1 468 THR 468 764 764 THR THR A . n 
A 1 469 THR 469 765 765 THR THR A . n 
A 1 470 LEU 470 766 766 LEU LEU A . n 
A 1 471 LEU 471 767 767 LEU LEU A . n 
A 1 472 HIS 472 768 768 HIS HIS A . n 
A 1 473 ARG 473 769 769 ARG ARG A . n 
A 1 474 ARG 474 770 770 ARG ARG A . n 
A 1 475 ARG 475 771 771 ARG ARG A . n 
A 1 476 TYR 476 772 772 TYR TYR A . n 
A 1 477 LEU 477 773 773 LEU LEU A . n 
A 1 478 PRO 478 774 774 PRO PRO A . n 
A 1 479 ASP 479 775 775 ASP ASP A . n 
A 1 480 ILE 480 776 776 ILE ILE A . n 
A 1 481 THR 481 777 777 THR THR A . n 
A 1 482 SER 482 778 778 SER SER A . n 
A 1 483 ARG 483 779 779 ARG ARG A . n 
A 1 484 ASN 484 780 780 ASN ASN A . n 
A 1 485 PHE 485 781 781 PHE PHE A . n 
A 1 486 ASN 486 782 782 ASN ASN A . n 
A 1 487 VAL 487 783 783 VAL VAL A . n 
A 1 488 ARG 488 784 784 ARG ARG A . n 
A 1 489 SER 489 785 785 SER SER A . n 
A 1 490 PHE 490 786 786 PHE PHE A . n 
A 1 491 ALA 491 787 787 ALA ALA A . n 
A 1 492 GLU 492 788 788 GLU GLU A . n 
A 1 493 ARG 493 789 789 ARG ARG A . n 
A 1 494 MET 494 790 790 MET MET A . n 
A 1 495 ALA 495 791 791 ALA ALA A . n 
A 1 496 MET 496 792 792 MET MET A . n 
A 1 497 ASN 497 793 793 ASN ASN A . n 
A 1 498 THR 498 794 794 THR THR A . n 
A 1 499 PRO 499 795 795 PRO PRO A . n 
A 1 500 ILE 500 796 796 ILE ILE A . n 
A 1 501 GLN 501 797 797 GLN GLN A . n 
A 1 502 GLY 502 798 798 GLY GLY A . n 
A 1 503 SER 503 799 799 SER SER A . n 
A 1 504 ALA 504 800 800 ALA ALA A . n 
A 1 505 ALA 505 801 801 ALA ALA A . n 
A 1 506 ASP 506 802 802 ASP ASP A . n 
A 1 507 ILE 507 803 803 ILE ILE A . n 
A 1 508 ILE 508 804 804 ILE ILE A . n 
A 1 509 LYS 509 805 805 LYS LYS A . n 
A 1 510 LYS 510 806 806 LYS LYS A . n 
A 1 511 ALA 511 807 807 ALA ALA A . n 
A 1 512 MET 512 808 808 MET MET A . n 
A 1 513 ILE 513 809 809 ILE ILE A . n 
A 1 514 ASP 514 810 810 ASP ASP A . n 
A 1 515 LEU 515 811 811 LEU LEU A . n 
A 1 516 ASN 516 812 812 ASN ASN A . n 
A 1 517 ALA 517 813 813 ALA ALA A . n 
A 1 518 ARG 518 814 814 ARG ARG A . n 
A 1 519 LEU 519 815 815 LEU LEU A . n 
A 1 520 LYS 520 816 816 LYS LYS A . n 
A 1 521 GLU 521 817 817 GLU GLU A . n 
A 1 522 GLU 522 818 818 GLU GLU A . n 
A 1 523 ARG 523 819 819 ARG ARG A . n 
A 1 524 LEU 524 820 820 LEU LEU A . n 
A 1 525 GLN 525 821 821 GLN GLN A . n 
A 1 526 ALA 526 822 822 ALA ALA A . n 
A 1 527 ARG 527 823 823 ARG ARG A . n 
A 1 528 LEU 528 824 824 LEU LEU A . n 
A 1 529 LEU 529 825 825 LEU LEU A . n 
A 1 530 LEU 530 826 826 LEU LEU A . n 
A 1 531 GLN 531 827 827 GLN GLN A . n 
A 1 532 VAL 532 828 828 VAL VAL A . n 
A 1 533 HIS 533 829 829 HIS HIS A . n 
A 1 534 ASP 534 830 830 ASP ASP A . n 
A 1 535 GLU 535 831 831 GLU GLU A . n 
A 1 536 LEU 536 832 832 LEU LEU A . n 
A 1 537 ILE 537 833 833 ILE ILE A . n 
A 1 538 LEU 538 834 834 LEU LEU A . n 
A 1 539 GLU 539 835 835 GLU GLU A . n 
A 1 540 ALA 540 836 836 ALA ALA A . n 
A 1 541 PRO 541 837 837 PRO PRO A . n 
A 1 542 LYS 542 838 838 LYS LYS A . n 
A 1 543 GLU 543 839 839 GLU GLU A . n 
A 1 544 GLU 544 840 840 GLU GLU A . n 
A 1 545 MET 545 841 841 MET MET A . n 
A 1 546 GLU 546 842 842 GLU GLU A . n 
A 1 547 ARG 547 843 843 ARG ARG A . n 
A 1 548 LEU 548 844 844 LEU LEU A . n 
A 1 549 CYS 549 845 845 CYS CYS A . n 
A 1 550 ARG 550 846 846 ARG ARG A . n 
A 1 551 LEU 551 847 847 LEU LEU A . n 
A 1 552 VAL 552 848 848 VAL VAL A . n 
A 1 553 PRO 553 849 849 PRO PRO A . n 
A 1 554 GLU 554 850 850 GLU GLU A . n 
A 1 555 VAL 555 851 851 VAL VAL A . n 
A 1 556 MET 556 852 852 MET MET A . n 
A 1 557 GLU 557 853 853 GLU GLU A . n 
A 1 558 GLN 558 854 854 GLN GLN A . n 
A 1 559 ALA 559 855 855 ALA ALA A . n 
A 1 560 VAL 560 856 856 VAL VAL A . n 
A 1 561 THR 561 857 857 THR THR A . n 
A 1 562 LEU 562 858 858 LEU LEU A . n 
A 1 563 ARG 563 859 859 ARG ARG A . n 
A 1 564 VAL 564 860 860 VAL VAL A . n 
A 1 565 PRO 565 861 861 PRO PRO A . n 
A 1 566 LEU 566 862 862 LEU LEU A . n 
A 1 567 LYS 567 863 863 LYS LYS A . n 
A 1 568 VAL 568 864 864 VAL VAL A . n 
A 1 569 ASP 569 865 865 ASP ASP A . n 
A 1 570 TYR 570 866 866 TYR TYR A . n 
A 1 571 HIS 571 867 867 HIS HIS A . n 
A 1 572 TYR 572 868 868 TYR TYR A . n 
A 1 573 GLY 573 869 869 GLY GLY A . n 
A 1 574 SER 574 870 870 SER SER A . n 
A 1 575 THR 575 871 871 THR THR A . n 
A 1 576 TRP 576 872 872 TRP TRP A . n 
A 1 577 TYR 577 873 873 TYR TYR A . n 
A 1 578 ASP 578 874 874 ASP ASP A . n 
A 1 579 ALA 579 875 875 ALA ALA A . n 
A 1 580 LYS 580 876 876 LYS LYS A . n 
B 2 1   DG  1   20  20  DG  DG  B . n 
B 2 2   DC  2   21  21  DC  DC  B . n 
B 2 3   DC  3   22  22  DC  DC  B . n 
B 2 4   DT  4   23  23  DT  DT  B . n 
B 2 5   DG  5   24  24  DG  DG  B . n 
B 2 6   DA  6   25  25  DA  DA  B . n 
B 2 7   DC  7   26  26  DC  DC  B . n 
B 2 8   DT  8   27  27  DT  DT  B . n 
B 2 9   DC  9   28  28  DC  DC  B . n 
B 2 10  DG  10  29  29  DG  DG  B . n 
C 3 1   SAY 1   3   3   SAY SAY C . n 
C 3 2   DC  2   4   4   DC  DC  C . n 
C 3 3   DG  3   5   5   DG  DG  C . n 
C 3 4   DA  4   6   6   DA  DA  C . n 
C 3 5   DG  5   7   7   DG  DG  C . n 
C 3 6   DT  6   8   8   DT  DT  C . n 
C 3 7   DC  7   9   9   DC  DC  C . n 
C 3 8   DA  8   10  10  DA  DA  C . n 
C 3 9   DG  9   11  11  DG  DG  C . n 
C 3 10  DG  10  12  12  DG  DG  C . n 
C 3 11  DC  11  13  13  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 SO4 1 885  885  SO4 SO4 A . 
F 5 SO4 1 886  886  SO4 SO4 A . 
G 6 HOH 1 2001 2001 HOH HOH A . 
G 6 HOH 2 2002 2002 HOH HOH A . 
G 6 HOH 3 2003 2003 HOH HOH A . 
G 6 HOH 4 2004 2004 HOH HOH A . 
G 6 HOH 5 2005 2005 HOH HOH A . 
G 6 HOH 6 2006 2006 HOH HOH A . 
G 6 HOH 7 2007 2007 HOH HOH A . 
G 6 HOH 8 2008 2008 HOH HOH A . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       D 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5410  ? 
1 MORE         -35.6 ? 
1 'SSA (A^2)'  26560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-07-27 
2 'Structure model' 1 1 2011-10-05 
3 'Structure model' 1 2 2012-03-28 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'     
2 3 'Structure model' Other                     
3 4 'Structure model' Advisory                  
4 4 'Structure model' 'Atomic model'            
5 4 'Structure model' 'Data collection'         
6 4 'Structure model' 'Derived calculations'    
7 4 'Structure model' 'Non-polymer description' 
8 4 'Structure model' Other                     
9 4 'Structure model' 'Structure summary'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' entity_name_com               
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_database_status          
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_molecule_features        
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_validate_polymer_linkage 
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'            
2  4 'Structure model' '_atom_site.Cartn_x'                   
3  4 'Structure model' '_atom_site.Cartn_y'                   
4  4 'Structure model' '_atom_site.Cartn_z'                   
5  4 'Structure model' '_atom_site.auth_asym_id'              
6  4 'Structure model' '_atom_site.auth_atom_id'              
7  4 'Structure model' '_atom_site.auth_comp_id'              
8  4 'Structure model' '_atom_site.auth_seq_id'               
9  4 'Structure model' '_atom_site.label_asym_id'             
10 4 'Structure model' '_atom_site.label_atom_id'             
11 4 'Structure model' '_atom_site.label_comp_id'             
12 4 'Structure model' '_atom_site.label_entity_id'           
13 4 'Structure model' '_atom_site.occupancy'                 
14 4 'Structure model' '_atom_site.type_symbol'               
15 4 'Structure model' '_chem_comp.formula'                   
16 4 'Structure model' '_chem_comp.formula_weight'            
17 4 'Structure model' '_chem_comp.id'                        
18 4 'Structure model' '_chem_comp.mon_nstd_flag'             
19 4 'Structure model' '_chem_comp.name'                      
20 4 'Structure model' '_chem_comp.pdbx_synonyms'             
21 4 'Structure model' '_chem_comp.type'                      
22 4 'Structure model' '_entity.formula_weight'               
23 4 'Structure model' '_entity.pdbx_description'             
24 4 'Structure model' '_entity.pdbx_number_of_molecules'     
25 4 'Structure model' '_entity.src_method'                   
26 4 'Structure model' '_entity.type'                         
27 4 'Structure model' '_pdbx_database_status.status_code_sf' 
28 4 'Structure model' '_struct_asym.entity_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0109 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id                 2XY7 
_pdbx_entry_details.compound_details         'ENGINEERED RESIDUE IN CHAIN A, ASP 33 TO ALA' 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;THE ENTRY GIVEN IS NOT FROM STRAIN DSM22, BUT HAS MAXIMUM
IDENTITY. ONLY T550 IS S IN OUR SEQUENCE.
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ALA 
_pdbx_validate_close_contact.auth_seq_id_1    300 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    343 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" C DC 9  ? ? "C3'" C DC 9  ? ? 1.362 1.419 -0.057 0.006 N 
2 1 "O3'" C DA 10 ? ? "C3'" C DA 10 ? ? 1.379 1.419 -0.040 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" B DC 21 ? ? "C1'" B DC 21 ? ? N1 B DC 21 ? ? 110.61 108.30 2.31 0.30 N 
2 1 "O4'" B DT 23 ? ? "C1'" B DT 23 ? ? N1 B DT 23 ? ? 111.82 108.30 3.52 0.30 N 
3 1 "O4'" B DG 24 ? ? "C1'" B DG 24 ? ? N9 B DG 24 ? ? 110.36 108.30 2.06 0.30 N 
4 1 "O4'" B DA 25 ? ? "C1'" B DA 25 ? ? N9 B DA 25 ? ? 110.38 108.30 2.08 0.30 N 
5 1 "O4'" B DC 26 ? ? "C1'" B DC 26 ? ? N1 B DC 26 ? ? 111.34 108.30 3.04 0.30 N 
6 1 "O4'" B DT 27 ? ? "C1'" B DT 27 ? ? N1 B DT 27 ? ? 111.39 108.30 3.09 0.30 N 
7 1 "O4'" B DG 29 ? ? "C1'" B DG 29 ? ? N9 B DG 29 ? ? 110.97 108.30 2.67 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 477 ? ? -126.31 -65.22  
2 1 GLN A 524 ? ? -171.33 -175.46 
3 1 ILE A 588 ? ? -90.11  -62.27  
4 1 ILE A 628 ? ? -136.98 -41.72  
5 1 HIS A 829 ? ? 69.31   -56.27  
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   "C3'" 
_pdbx_validate_polymer_linkage.auth_asym_id_1   C 
_pdbx_validate_polymer_linkage.auth_comp_id_1   SAY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    3 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   P 
_pdbx_validate_polymer_linkage.auth_asym_id_2   C 
_pdbx_validate_polymer_linkage.auth_comp_id_2   DC 
_pdbx_validate_polymer_linkage.auth_seq_id_2    4 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             2.47 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 298 ? CG    ? A LYS 2   CG    
2   1 Y 1 A LYS 298 ? CD    ? A LYS 2   CD    
3   1 Y 1 A LYS 298 ? CE    ? A LYS 2   CE    
4   1 Y 1 A LYS 298 ? NZ    ? A LYS 2   NZ    
5   1 Y 1 A ASP 305 ? CG    ? A ASP 9   CG    
6   1 Y 1 A ASP 305 ? OD1   ? A ASP 9   OD1   
7   1 Y 1 A ASP 305 ? OD2   ? A ASP 9   OD2   
8   1 Y 1 A ARG 306 ? CG    ? A ARG 10  CG    
9   1 Y 1 A ARG 306 ? CD    ? A ARG 10  CD    
10  1 Y 1 A ARG 306 ? NE    ? A ARG 10  NE    
11  1 Y 1 A ARG 306 ? CZ    ? A ARG 10  CZ    
12  1 Y 1 A ARG 306 ? NH1   ? A ARG 10  NH1   
13  1 Y 1 A ARG 306 ? NH2   ? A ARG 10  NH2   
14  1 Y 1 A GLU 309 ? CG    ? A GLU 13  CG    
15  1 Y 1 A GLU 309 ? CD    ? A GLU 13  CD    
16  1 Y 1 A GLU 309 ? OE1   ? A GLU 13  OE1   
17  1 Y 1 A GLU 309 ? OE2   ? A GLU 13  OE2   
18  1 Y 1 A LEU 352 ? CG    ? A LEU 56  CG    
19  1 Y 1 A LEU 352 ? CD1   ? A LEU 56  CD1   
20  1 Y 1 A LEU 352 ? CD2   ? A LEU 56  CD2   
21  1 Y 1 A GLN 356 ? CD    ? A GLN 60  CD    
22  1 Y 1 A GLN 356 ? OE1   ? A GLN 60  OE1   
23  1 Y 1 A GLN 356 ? NE2   ? A GLN 60  NE2   
24  1 Y 1 A LYS 415 ? CE    ? A LYS 119 CE    
25  1 Y 1 A LYS 415 ? NZ    ? A LYS 119 NZ    
26  1 Y 1 A LYS 431 ? CG    ? A LYS 135 CG    
27  1 Y 1 A LYS 431 ? CD    ? A LYS 135 CD    
28  1 Y 1 A LYS 431 ? CE    ? A LYS 135 CE    
29  1 Y 1 A LYS 431 ? NZ    ? A LYS 135 NZ    
30  1 Y 1 A LYS 434 ? CG    ? A LYS 138 CG    
31  1 Y 1 A LYS 434 ? CD    ? A LYS 138 CD    
32  1 Y 1 A LYS 434 ? CE    ? A LYS 138 CE    
33  1 Y 1 A LYS 434 ? NZ    ? A LYS 138 NZ    
34  1 Y 1 A GLU 440 ? CG    ? A GLU 144 CG    
35  1 Y 1 A GLU 440 ? CD    ? A GLU 144 CD    
36  1 Y 1 A GLU 440 ? OE1   ? A GLU 144 OE1   
37  1 Y 1 A GLU 440 ? OE2   ? A GLU 144 OE2   
38  1 Y 1 A ARG 459 ? CG    ? A ARG 163 CG    
39  1 Y 1 A ARG 459 ? CD    ? A ARG 163 CD    
40  1 Y 1 A ARG 459 ? NE    ? A ARG 163 NE    
41  1 Y 1 A ARG 459 ? CZ    ? A ARG 163 CZ    
42  1 Y 1 A ARG 459 ? NH1   ? A ARG 163 NH1   
43  1 Y 1 A ARG 459 ? NH2   ? A ARG 163 NH2   
44  1 Y 1 A ARG 466 ? NE    ? A ARG 170 NE    
45  1 Y 1 A ARG 466 ? CZ    ? A ARG 170 CZ    
46  1 Y 1 A ARG 466 ? NH1   ? A ARG 170 NH1   
47  1 Y 1 A ARG 466 ? NH2   ? A ARG 170 NH2   
48  1 Y 1 A GLU 469 ? CD    ? A GLU 173 CD    
49  1 Y 1 A GLU 469 ? OE1   ? A GLU 173 OE1   
50  1 Y 1 A GLU 469 ? OE2   ? A GLU 173 OE2   
51  1 Y 1 A ARG 472 ? NE    ? A ARG 176 NE    
52  1 Y 1 A ARG 472 ? CZ    ? A ARG 176 CZ    
53  1 Y 1 A ARG 472 ? NH1   ? A ARG 176 NH1   
54  1 Y 1 A ARG 472 ? NH2   ? A ARG 176 NH2   
55  1 Y 1 A LYS 498 ? CG    ? A LYS 202 CG    
56  1 Y 1 A LYS 498 ? CD    ? A LYS 202 CD    
57  1 Y 1 A LYS 498 ? CE    ? A LYS 202 CE    
58  1 Y 1 A LYS 498 ? NZ    ? A LYS 202 NZ    
59  1 Y 1 A GLN 502 ? CG    ? A GLN 206 CG    
60  1 Y 1 A GLN 502 ? CD    ? A GLN 206 CD    
61  1 Y 1 A GLN 502 ? OE1   ? A GLN 206 OE1   
62  1 Y 1 A GLN 502 ? NE2   ? A GLN 206 NE2   
63  1 Y 1 A GLU 505 ? CG    ? A GLU 209 CG    
64  1 Y 1 A GLU 505 ? CD    ? A GLU 209 CD    
65  1 Y 1 A GLU 505 ? OE1   ? A GLU 209 OE1   
66  1 Y 1 A GLU 505 ? OE2   ? A GLU 209 OE2   
67  1 Y 1 A GLU 506 ? CG    ? A GLU 210 CG    
68  1 Y 1 A GLU 506 ? CD    ? A GLU 210 CD    
69  1 Y 1 A GLU 506 ? OE1   ? A GLU 210 OE1   
70  1 Y 1 A GLU 506 ? OE2   ? A GLU 210 OE2   
71  1 Y 1 A ARG 512 ? CG    ? A ARG 216 CG    
72  1 Y 1 A ARG 512 ? CD    ? A ARG 216 CD    
73  1 Y 1 A ARG 512 ? NE    ? A ARG 216 NE    
74  1 Y 1 A ARG 512 ? CZ    ? A ARG 216 CZ    
75  1 Y 1 A ARG 512 ? NH1   ? A ARG 216 NH1   
76  1 Y 1 A ARG 512 ? NH2   ? A ARG 216 NH2   
77  1 Y 1 A GLN 516 ? CG    ? A GLN 220 CG    
78  1 Y 1 A GLN 516 ? CD    ? A GLN 220 CD    
79  1 Y 1 A GLN 516 ? OE1   ? A GLN 220 OE1   
80  1 Y 1 A GLN 516 ? NE2   ? A GLN 220 NE2   
81  1 Y 1 A GLU 520 ? CG    ? A GLU 224 CG    
82  1 Y 1 A GLU 520 ? CD    ? A GLU 224 CD    
83  1 Y 1 A GLU 520 ? OE1   ? A GLU 224 OE1   
84  1 Y 1 A GLU 520 ? OE2   ? A GLU 224 OE2   
85  1 Y 1 A LYS 532 ? CG    ? A LYS 236 CG    
86  1 Y 1 A LYS 532 ? CD    ? A LYS 236 CD    
87  1 Y 1 A LYS 532 ? CE    ? A LYS 236 CE    
88  1 Y 1 A LYS 532 ? NZ    ? A LYS 236 NZ    
89  1 Y 1 A LYS 548 ? CG    ? A LYS 252 CG    
90  1 Y 1 A LYS 548 ? CD    ? A LYS 252 CD    
91  1 Y 1 A LYS 548 ? CE    ? A LYS 252 CE    
92  1 Y 1 A LYS 548 ? NZ    ? A LYS 252 NZ    
93  1 Y 1 A LYS 549 ? CG    ? A LYS 253 CG    
94  1 Y 1 A LYS 549 ? CD    ? A LYS 253 CD    
95  1 Y 1 A LYS 549 ? CE    ? A LYS 253 CE    
96  1 Y 1 A LYS 549 ? NZ    ? A LYS 253 NZ    
97  1 Y 1 A LYS 551 ? CG    ? A LYS 255 CG    
98  1 Y 1 A LYS 551 ? CD    ? A LYS 255 CD    
99  1 Y 1 A LYS 551 ? CE    ? A LYS 255 CE    
100 1 Y 1 A LYS 551 ? NZ    ? A LYS 255 NZ    
101 1 Y 1 A GLU 572 ? CG    ? A GLU 276 CG    
102 1 Y 1 A GLU 572 ? CD    ? A GLU 276 CD    
103 1 Y 1 A GLU 572 ? OE1   ? A GLU 276 OE1   
104 1 Y 1 A GLU 572 ? OE2   ? A GLU 276 OE2   
105 1 Y 1 A LYS 600 ? CD    ? A LYS 304 CD    
106 1 Y 1 A LYS 600 ? CE    ? A LYS 304 CE    
107 1 Y 1 A LYS 600 ? NZ    ? A LYS 304 NZ    
108 1 Y 1 A LYS 635 ? CG    ? A LYS 339 CG    
109 1 Y 1 A LYS 635 ? CD    ? A LYS 339 CD    
110 1 Y 1 A LYS 635 ? CE    ? A LYS 339 CE    
111 1 Y 1 A LYS 635 ? NZ    ? A LYS 339 NZ    
112 1 Y 1 A GLN 691 ? CG    ? A GLN 395 CG    
113 1 Y 1 A GLN 691 ? CD    ? A GLN 395 CD    
114 1 Y 1 A GLN 691 ? OE1   ? A GLN 395 OE1   
115 1 Y 1 A GLN 691 ? NE2   ? A GLN 395 NE2   
116 1 Y 1 A TYR 719 ? CG    ? A TYR 423 CG    
117 1 Y 1 A TYR 719 ? CD1   ? A TYR 423 CD1   
118 1 Y 1 A TYR 719 ? CD2   ? A TYR 423 CD2   
119 1 Y 1 A TYR 719 ? CE1   ? A TYR 423 CE1   
120 1 Y 1 A TYR 719 ? CE2   ? A TYR 423 CE2   
121 1 Y 1 A TYR 719 ? CZ    ? A TYR 423 CZ    
122 1 Y 1 A TYR 719 ? OH    ? A TYR 423 OH    
123 1 Y 1 A ARG 729 ? CG    ? A ARG 433 CG    
124 1 Y 1 A ARG 729 ? CD    ? A ARG 433 CD    
125 1 Y 1 A ARG 729 ? NE    ? A ARG 433 NE    
126 1 Y 1 A ARG 729 ? CZ    ? A ARG 433 CZ    
127 1 Y 1 A ARG 729 ? NH1   ? A ARG 433 NH1   
128 1 Y 1 A ARG 729 ? NH2   ? A ARG 433 NH2   
129 1 Y 1 A LYS 730 ? CG    ? A LYS 434 CG    
130 1 Y 1 A LYS 730 ? CD    ? A LYS 434 CD    
131 1 Y 1 A LYS 730 ? CE    ? A LYS 434 CE    
132 1 Y 1 A LYS 730 ? NZ    ? A LYS 434 NZ    
133 1 Y 1 A GLU 737 ? CG    ? A GLU 441 CG    
134 1 Y 1 A GLU 737 ? CD    ? A GLU 441 CD    
135 1 Y 1 A GLU 737 ? OE1   ? A GLU 441 OE1   
136 1 Y 1 A GLU 737 ? OE2   ? A GLU 441 OE2   
137 1 Y 1 A ARG 748 ? CG    ? A ARG 452 CG    
138 1 Y 1 A ARG 748 ? CD    ? A ARG 452 CD    
139 1 Y 1 A ARG 748 ? NE    ? A ARG 452 NE    
140 1 Y 1 A ARG 748 ? CZ    ? A ARG 452 CZ    
141 1 Y 1 A ARG 748 ? NH1   ? A ARG 452 NH1   
142 1 Y 1 A ARG 748 ? NH2   ? A ARG 452 NH2   
143 1 Y 1 A GLN 755 ? CG    ? A GLN 459 CG    
144 1 Y 1 A GLN 755 ? CD    ? A GLN 459 CD    
145 1 Y 1 A GLN 755 ? OE1   ? A GLN 459 OE1   
146 1 Y 1 A GLN 755 ? NE2   ? A GLN 459 NE2   
147 1 Y 1 A LYS 758 ? CE    ? A LYS 462 CE    
148 1 Y 1 A LYS 758 ? NZ    ? A LYS 462 NZ    
149 1 Y 1 A LYS 838 ? CG    ? A LYS 542 CG    
150 1 Y 1 A LYS 838 ? CD    ? A LYS 542 CD    
151 1 Y 1 A LYS 838 ? CE    ? A LYS 542 CE    
152 1 Y 1 A LYS 838 ? NZ    ? A LYS 542 NZ    
153 1 Y 1 A LYS 876 ? CG    ? A LYS 580 CG    
154 1 Y 1 A LYS 876 ? CD    ? A LYS 580 CD    
155 1 Y 1 A LYS 876 ? CE    ? A LYS 580 CE    
156 1 Y 1 A LYS 876 ? NZ    ? A LYS 580 NZ    
157 1 Y 1 C SAY 3   ? "O5'" ? C SAY 1   "O5'" 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2XY7 'double helix'        
2XY7 'a-form double helix' 
2XY7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 11 1_555 -3.349 0.015  0.396  -2.745 -2.279  23.198  1  B_DG20:DC13_C B 20 ? C 13 ? ?  1 
1 B DC 2  1_555 C DG 10 1_555 -0.488 0.012  -0.240 -0.663 -12.457 6.381   2  B_DC21:DG12_C B 21 ? C 12 ? 19 1 
1 B DC 3  1_555 C DG 9  1_555 -0.882 -0.347 0.261  -8.607 -9.961  -6.862  3  B_DC22:DG11_C B 22 ? C 11 ? 19 1 
1 B DT 4  1_555 C DA 8  1_555 -0.149 -0.326 0.030  -4.129 -18.066 1.047   4  B_DT23:DA10_C B 23 ? C 10 ? 20 1 
1 B DG 5  1_555 C DC 7  1_555 0.682  0.092  -0.582 -8.997 -14.644 4.088   5  B_DG24:DC9_C  B 24 ? C 9  ? 19 1 
1 B DA 6  1_555 C DT 6  1_555 -0.120 -0.161 -0.335 -1.429 -6.255  -10.099 6  B_DA25:DT8_C  B 25 ? C 8  ? 20 1 
1 B DC 7  1_555 C DG 5  1_555 0.156  -0.370 -0.554 13.174 -0.097  -7.452  7  B_DC26:DG7_C  B 26 ? C 7  ? 19 1 
1 B DT 8  1_555 C DA 4  1_555 -0.111 -0.029 0.412  11.640 -12.959 -0.231  8  B_DT27:DA6_C  B 27 ? C 6  ? 20 1 
1 B DC 9  1_555 C DG 3  1_555 0.027  0.067  -0.094 17.365 -9.981  7.714   9  B_DC28:DG5_C  B 28 ? C 5  ? 19 1 
1 B DG 10 1_555 C DC 2  1_555 0.289  -0.183 -0.036 -2.918 -8.358  8.200   10 B_DG29:DC4_C  B 29 ? C 4  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1 1_555 C DC 11 1_555 B DC 2  1_555 C DG 10 1_555 -0.934 0.230  3.175 3.822   2.507  47.110 0.091  1.462  3.102 3.128  
-4.768 47.318 1 BB_DG20DC21:DG12DC13_CC B 20 ? C 13 ? B 21 ? C 12 ? 
1 B DC 2 1_555 C DG 10 1_555 B DC 3  1_555 C DG 9  1_555 -0.532 -0.329 3.607 -7.539  0.469  33.669 -0.636 -0.413 3.633 0.798  
12.816 34.482 2 BB_DC21DC22:DG11DG12_CC B 21 ? C 12 ? B 22 ? C 11 ? 
1 B DC 3 1_555 C DG 9  1_555 B DT 4  1_555 C DA 8  1_555 -0.056 -0.267 3.191 1.614   0.462  39.417 -0.449 0.269  3.183 0.685  
-2.392 39.451 3 BB_DC22DT23:DA10DG11_CC B 22 ? C 11 ? B 23 ? C 10 ? 
1 B DT 4 1_555 C DA 8  1_555 B DG 5  1_555 C DC 7  1_555 0.438  0.421  3.648 5.281   9.547  35.113 -0.824 0.131  3.661 15.372 
-8.503 36.718 4 BB_DT23DG24:DC9DA10_CC  B 23 ? C 10 ? B 24 ? C 9  ? 
1 B DG 5 1_555 C DC 7  1_555 B DA 6  1_555 C DT 6  1_555 -0.304 -0.175 3.035 -3.059  8.322  28.003 -2.006 -0.009 2.881 16.677 
6.129  29.346 5 BB_DG24DA25:DT8DC9_CC   B 24 ? C 9  ? B 25 ? C 8  ? 
1 B DA 6 1_555 C DT 6  1_555 B DC 7  1_555 C DG 5  1_555 0.883  -0.731 3.102 2.444   2.383  30.809 -1.804 -1.204 3.097 4.469  
-4.584 30.993 6 BB_DA25DC26:DG7DT8_CC   B 25 ? C 8  ? B 26 ? C 7  ? 
1 B DC 7 1_555 C DG 5  1_555 B DT 8  1_555 C DA 4  1_555 0.214  -1.169 3.668 -11.594 5.542  36.089 -2.544 -1.916 3.242 8.616  
18.025 38.237 7 BB_DC26DT27:DA6DG7_CC   B 26 ? C 7  ? B 27 ? C 6  ? 
1 B DT 8 1_555 C DA 4  1_555 B DC 9  1_555 C DG 3  1_555 -0.181 -1.159 3.108 2.824   14.258 26.693 -4.698 0.837  2.191 28.368 
-5.620 30.330 8 BB_DT27DC28:DG5DA6_CC   B 27 ? C 6  ? B 28 ? C 5  ? 
1 B DC 9 1_555 C DG 3  1_555 B DG 10 1_555 C DC 2  1_555 -0.257 -1.206 3.889 -1.557  13.220 32.239 -4.280 0.162  3.175 22.640 
2.667  34.812 9 BB_DC28DG29:DC4DG5_CC   B 28 ? C 5  ? B 29 ? C 4  ? 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 GLC 1 D GLC 1 A SUC 887 n 
D 4 FRU 2 D FRU 2 A SUC 887 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  4 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 GLC 1 n 
4 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'SULFATE ION' SO4 
6 water         HOH 
#