data_2Y01
# 
_entry.id   2Y01 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y01         
PDBE  EBI-46474    
WWPDB D_1290046474 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1DEP unspecified 'MEMBRANE PROTEIN, NMR, 1 STRUCTURE' 
PDB 2VT4 unspecified 'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND CYANOPINDOLOL' 
PDB 2Y04 unspecified 'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND PARTIAL AGONIST SALBUTAMOL' 
PDB 2Y00 unspecified 
'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND PARTIAL AGONIST DOBUTAMINE (CRYSTAL DOB92)' 
PDB 2Y03 unspecified 'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND AGONIST ISOPRENALINE' 
PDB 2Y02 unspecified 'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND AGONIST CARMOTEROL' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y01 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Warne, A.'           1 
'Moukhametzianov, R.' 2 
'Baker, J.G.'         3 
'Nehme, R.'           4 
'Edwards, P.C.'       5 
'Leslie, A.G.W.'      6 
'Schertler, G.F.X.'   7 
'Tate, C.G.'          8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Structural Basis for Agonist and Partial Agonist Action on a Beta1-Adrenergic Receptor'          Nature 469 241 ? 
2011 NATUAS UK 0028-0836 0006 ? 21228877 10.1038/NATURE09746     
1       'Conformational Thermostabilization of the Beta1- Adrenergic Receptor in a Detergent-Resistant Form.' 
Proc.Natl.Acad.Sci.USA 105 877 ? 2008 PNASA6 US 0027-8424 0040 ? 18192400 10.1073/PNAS.0711253105 
2       'Structure of a Beta1-Adrenergic G-Protein-Coupled Receptor.'                                         Nature 454 486 ? 
2008 NATUAS UK 0028-0836 0006 ? 18594507 10.1038/NATURE07101     
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Warne, A.'           1  ? 
primary 'Moukhametzianov, R.' 2  ? 
primary 'Baker, J.G.'         3  ? 
primary 'Nehme, R.'           4  ? 
primary 'Edwards, P.C.'       5  ? 
primary 'Leslie, A.G.W.'      6  ? 
primary 'Schertler, G.F.X.'   7  ? 
primary 'Tate, C.G.'          8  ? 
1       'Serrano-Vega, M.J.'  9  ? 
1       'Magnani, F.'         10 ? 
1       'Shibata, Y.'         11 ? 
1       'Tate, C.G.'          12 ? 
2       'Warne, T.'           13 ? 
2       'Serrano-Vega, M.J.'  14 ? 
2       'Baker, J.G.'         15 ? 
2       'Moukhametzianov, R.' 16 ? 
2       'Edwards, P.C.'       17 ? 
2       'Henderson, R.'       18 ? 
2       'Leslie, A.G.W.'      19 ? 
2       'Tate, C.G.'          20 ? 
2       'Schertler, G.F.X.'   21 ? 
# 
_cell.entry_id           2Y01 
_cell.length_a           90.100 
_cell.length_b           61.600 
_cell.length_c           101.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y01 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BETA-1 ADRENERGIC RECEPTOR' 35940.777 2  ? YES 'RESIDUES 33-368' 
;RESIDUES 3-32 AT THE N-TERMINUS AND RESIDUES 244-271 OF THE THIRD INTRACELLULAR LOOP WERE DELETED FROM THE CONSTRUCT. THE CONSTRUCT WAS TRUNCATED AFTER RESIDUE 367 AND A HEXAHIS TAG ADDED.
;
2 non-polymer syn 'CHOLESTEROL HEMISUCCINATE'  486.726   4  ? ?   ?                 ? 
3 non-polymer syn HEGA-10                      379.489   10 ? ?   ?                 ? 
4 non-polymer syn DOBUTAMINE                   301.380   2  ? ?   ?                 ? 
5 water       nat water                        18.015    41 ? ?   ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETA-1 ADRENORECEPTOR, BETA-1 ADRENOCEPTOR, BETA-T' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWG
SFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQAL
KCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGV
FTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFPRKADRRLHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGAELLSQQWEAGMSLLMALVVLLIVAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLVVPFGATLVVRGTWLWG
SFLCELWTSLDVLCVTASIETLCVIAIDRYLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQAL
KCYQDPGCCDFVTNRAYAIASSIISFYIPLLIMIFVALRVYREAKEQIRKIDRASKRKTSRVMLMREHKALKTLGIIMGV
FTLCWLPFFLVNIVNVFNRDLVPDWLFVAFNWLGYANSAMNPIIYCRSPDFRKAFKRLLAFPRKADRRLHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ALA n 
1 4   GLU n 
1 5   LEU n 
1 6   LEU n 
1 7   SER n 
1 8   GLN n 
1 9   GLN n 
1 10  TRP n 
1 11  GLU n 
1 12  ALA n 
1 13  GLY n 
1 14  MET n 
1 15  SER n 
1 16  LEU n 
1 17  LEU n 
1 18  MET n 
1 19  ALA n 
1 20  LEU n 
1 21  VAL n 
1 22  VAL n 
1 23  LEU n 
1 24  LEU n 
1 25  ILE n 
1 26  VAL n 
1 27  ALA n 
1 28  GLY n 
1 29  ASN n 
1 30  VAL n 
1 31  LEU n 
1 32  VAL n 
1 33  ILE n 
1 34  ALA n 
1 35  ALA n 
1 36  ILE n 
1 37  GLY n 
1 38  SER n 
1 39  THR n 
1 40  GLN n 
1 41  ARG n 
1 42  LEU n 
1 43  GLN n 
1 44  THR n 
1 45  LEU n 
1 46  THR n 
1 47  ASN n 
1 48  LEU n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  SER n 
1 53  LEU n 
1 54  ALA n 
1 55  CYS n 
1 56  ALA n 
1 57  ASP n 
1 58  LEU n 
1 59  VAL n 
1 60  VAL n 
1 61  GLY n 
1 62  LEU n 
1 63  LEU n 
1 64  VAL n 
1 65  VAL n 
1 66  PRO n 
1 67  PHE n 
1 68  GLY n 
1 69  ALA n 
1 70  THR n 
1 71  LEU n 
1 72  VAL n 
1 73  VAL n 
1 74  ARG n 
1 75  GLY n 
1 76  THR n 
1 77  TRP n 
1 78  LEU n 
1 79  TRP n 
1 80  GLY n 
1 81  SER n 
1 82  PHE n 
1 83  LEU n 
1 84  CYS n 
1 85  GLU n 
1 86  LEU n 
1 87  TRP n 
1 88  THR n 
1 89  SER n 
1 90  LEU n 
1 91  ASP n 
1 92  VAL n 
1 93  LEU n 
1 94  CYS n 
1 95  VAL n 
1 96  THR n 
1 97  ALA n 
1 98  SER n 
1 99  ILE n 
1 100 GLU n 
1 101 THR n 
1 102 LEU n 
1 103 CYS n 
1 104 VAL n 
1 105 ILE n 
1 106 ALA n 
1 107 ILE n 
1 108 ASP n 
1 109 ARG n 
1 110 TYR n 
1 111 LEU n 
1 112 ALA n 
1 113 ILE n 
1 114 THR n 
1 115 SER n 
1 116 PRO n 
1 117 PHE n 
1 118 ARG n 
1 119 TYR n 
1 120 GLN n 
1 121 SER n 
1 122 LEU n 
1 123 MET n 
1 124 THR n 
1 125 ARG n 
1 126 ALA n 
1 127 ARG n 
1 128 ALA n 
1 129 LYS n 
1 130 VAL n 
1 131 ILE n 
1 132 ILE n 
1 133 CYS n 
1 134 THR n 
1 135 VAL n 
1 136 TRP n 
1 137 ALA n 
1 138 ILE n 
1 139 SER n 
1 140 ALA n 
1 141 LEU n 
1 142 VAL n 
1 143 SER n 
1 144 PHE n 
1 145 LEU n 
1 146 PRO n 
1 147 ILE n 
1 148 MET n 
1 149 MET n 
1 150 HIS n 
1 151 TRP n 
1 152 TRP n 
1 153 ARG n 
1 154 ASP n 
1 155 GLU n 
1 156 ASP n 
1 157 PRO n 
1 158 GLN n 
1 159 ALA n 
1 160 LEU n 
1 161 LYS n 
1 162 CYS n 
1 163 TYR n 
1 164 GLN n 
1 165 ASP n 
1 166 PRO n 
1 167 GLY n 
1 168 CYS n 
1 169 CYS n 
1 170 ASP n 
1 171 PHE n 
1 172 VAL n 
1 173 THR n 
1 174 ASN n 
1 175 ARG n 
1 176 ALA n 
1 177 TYR n 
1 178 ALA n 
1 179 ILE n 
1 180 ALA n 
1 181 SER n 
1 182 SER n 
1 183 ILE n 
1 184 ILE n 
1 185 SER n 
1 186 PHE n 
1 187 TYR n 
1 188 ILE n 
1 189 PRO n 
1 190 LEU n 
1 191 LEU n 
1 192 ILE n 
1 193 MET n 
1 194 ILE n 
1 195 PHE n 
1 196 VAL n 
1 197 ALA n 
1 198 LEU n 
1 199 ARG n 
1 200 VAL n 
1 201 TYR n 
1 202 ARG n 
1 203 GLU n 
1 204 ALA n 
1 205 LYS n 
1 206 GLU n 
1 207 GLN n 
1 208 ILE n 
1 209 ARG n 
1 210 LYS n 
1 211 ILE n 
1 212 ASP n 
1 213 ARG n 
1 214 ALA n 
1 215 SER n 
1 216 LYS n 
1 217 ARG n 
1 218 LYS n 
1 219 THR n 
1 220 SER n 
1 221 ARG n 
1 222 VAL n 
1 223 MET n 
1 224 LEU n 
1 225 MET n 
1 226 ARG n 
1 227 GLU n 
1 228 HIS n 
1 229 LYS n 
1 230 ALA n 
1 231 LEU n 
1 232 LYS n 
1 233 THR n 
1 234 LEU n 
1 235 GLY n 
1 236 ILE n 
1 237 ILE n 
1 238 MET n 
1 239 GLY n 
1 240 VAL n 
1 241 PHE n 
1 242 THR n 
1 243 LEU n 
1 244 CYS n 
1 245 TRP n 
1 246 LEU n 
1 247 PRO n 
1 248 PHE n 
1 249 PHE n 
1 250 LEU n 
1 251 VAL n 
1 252 ASN n 
1 253 ILE n 
1 254 VAL n 
1 255 ASN n 
1 256 VAL n 
1 257 PHE n 
1 258 ASN n 
1 259 ARG n 
1 260 ASP n 
1 261 LEU n 
1 262 VAL n 
1 263 PRO n 
1 264 ASP n 
1 265 TRP n 
1 266 LEU n 
1 267 PHE n 
1 268 VAL n 
1 269 ALA n 
1 270 PHE n 
1 271 ASN n 
1 272 TRP n 
1 273 LEU n 
1 274 GLY n 
1 275 TYR n 
1 276 ALA n 
1 277 ASN n 
1 278 SER n 
1 279 ALA n 
1 280 MET n 
1 281 ASN n 
1 282 PRO n 
1 283 ILE n 
1 284 ILE n 
1 285 TYR n 
1 286 CYS n 
1 287 ARG n 
1 288 SER n 
1 289 PRO n 
1 290 ASP n 
1 291 PHE n 
1 292 ARG n 
1 293 LYS n 
1 294 ALA n 
1 295 PHE n 
1 296 LYS n 
1 297 ARG n 
1 298 LEU n 
1 299 LEU n 
1 300 ALA n 
1 301 PHE n 
1 302 PRO n 
1 303 ARG n 
1 304 LYS n 
1 305 ALA n 
1 306 ASP n 
1 307 ARG n 
1 308 ARG n 
1 309 LEU n 
1 310 HIS n 
1 311 HIS n 
1 312 HIS n 
1 313 HIS n 
1 314 HIS n 
1 315 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               TURKEY 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MELEAGRIS GALLOPAVO' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9103 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ERYTHROCYTE 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CABBAGE LOOPER' 
_entity_src_gen.pdbx_host_org_scientific_name      'TRICHOPLUSIA NI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'High Five' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PBACPAK8 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADRB1_MELGA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07700 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Y01 A 3 ? 310 ? P07700 33 ? 368 ? 33 368 
2 1 2Y01 B 3 ? 310 ? P07700 33 ? 368 ? 33 368 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y01 MET A 1   ? UNP P07700 ?   ?   'expression tag'      31  1  
1 2Y01 GLY A 2   ? UNP P07700 ?   ?   'expression tag'      32  2  
1 2Y01 SER A 38  ? UNP P07700 ARG 68  'engineered mutation' 68  3  
1 2Y01 VAL A 60  ? UNP P07700 MET 90  'engineered mutation' 90  4  
1 2Y01 LEU A 86  ? UNP P07700 CYS 116 'engineered mutation' 116 5  
1 2Y01 ALA A 197 ? UNP P07700 TYR 227 'engineered mutation' 227 6  
1 2Y01 ?   A ?   ? UNP P07700 CYS 244 deletion              ?   7  
1 2Y01 ?   A ?   ? UNP P07700 GLU 245 deletion              ?   8  
1 2Y01 ?   A ?   ? UNP P07700 GLY 246 deletion              ?   9  
1 2Y01 ?   A ?   ? UNP P07700 ARG 247 deletion              ?   10 
1 2Y01 ?   A ?   ? UNP P07700 PHE 248 deletion              ?   11 
1 2Y01 ?   A ?   ? UNP P07700 TYR 249 deletion              ?   12 
1 2Y01 ?   A ?   ? UNP P07700 GLY 250 deletion              ?   13 
1 2Y01 ?   A ?   ? UNP P07700 SER 251 deletion              ?   14 
1 2Y01 ?   A ?   ? UNP P07700 GLN 252 deletion              ?   15 
1 2Y01 ?   A ?   ? UNP P07700 GLU 253 deletion              ?   16 
1 2Y01 ?   A ?   ? UNP P07700 GLN 254 deletion              ?   17 
1 2Y01 ?   A ?   ? UNP P07700 PRO 255 deletion              ?   18 
1 2Y01 ?   A ?   ? UNP P07700 GLN 256 deletion              ?   19 
1 2Y01 ?   A ?   ? UNP P07700 PRO 257 deletion              ?   20 
1 2Y01 ?   A ?   ? UNP P07700 PRO 258 deletion              ?   21 
1 2Y01 ?   A ?   ? UNP P07700 PRO 259 deletion              ?   22 
1 2Y01 ?   A ?   ? UNP P07700 LEU 260 deletion              ?   23 
1 2Y01 ?   A ?   ? UNP P07700 PRO 261 deletion              ?   24 
1 2Y01 ?   A ?   ? UNP P07700 GLN 262 deletion              ?   25 
1 2Y01 ?   A ?   ? UNP P07700 HIS 263 deletion              ?   26 
1 2Y01 ?   A ?   ? UNP P07700 GLN 264 deletion              ?   27 
1 2Y01 ?   A ?   ? UNP P07700 PRO 265 deletion              ?   28 
1 2Y01 ?   A ?   ? UNP P07700 ILE 266 deletion              ?   29 
1 2Y01 ?   A ?   ? UNP P07700 LEU 267 deletion              ?   30 
1 2Y01 ?   A ?   ? UNP P07700 GLY 268 deletion              ?   31 
1 2Y01 ?   A ?   ? UNP P07700 ASN 269 deletion              ?   32 
1 2Y01 ?   A ?   ? UNP P07700 GLY 270 deletion              ?   33 
1 2Y01 ?   A ?   ? UNP P07700 ARG 271 deletion              ?   34 
1 2Y01 HIS A 311 ? UNP P07700 ?   ?   'expression tag'      369 35 
1 2Y01 HIS A 312 ? UNP P07700 ?   ?   'expression tag'      370 36 
1 2Y01 HIS A 313 ? UNP P07700 ?   ?   'expression tag'      371 37 
1 2Y01 HIS A 314 ? UNP P07700 ?   ?   'expression tag'      372 38 
1 2Y01 HIS A 315 ? UNP P07700 ?   ?   'expression tag'      373 39 
1 2Y01 LEU A 224 ? UNP P07700 ALA 282 'engineered mutation' 282 40 
1 2Y01 ALA A 269 ? UNP P07700 PHE 327 'engineered mutation' 327 41 
1 2Y01 MET A 280 ? UNP P07700 PHE 338 'engineered mutation' 338 42 
1 2Y01 ALA A 300 ? UNP P07700 CYS 358 'engineered mutation' 358 43 
2 2Y01 MET B 1   ? UNP P07700 ?   ?   'expression tag'      31  44 
2 2Y01 GLY B 2   ? UNP P07700 ?   ?   'expression tag'      32  45 
2 2Y01 SER B 38  ? UNP P07700 ARG 68  'engineered mutation' 68  46 
2 2Y01 VAL B 60  ? UNP P07700 MET 90  'engineered mutation' 90  47 
2 2Y01 LEU B 86  ? UNP P07700 CYS 116 'engineered mutation' 116 48 
2 2Y01 ALA B 197 ? UNP P07700 TYR 227 'engineered mutation' 227 49 
2 2Y01 ?   B ?   ? UNP P07700 CYS 244 deletion              ?   50 
2 2Y01 ?   B ?   ? UNP P07700 GLU 245 deletion              ?   51 
2 2Y01 ?   B ?   ? UNP P07700 GLY 246 deletion              ?   52 
2 2Y01 ?   B ?   ? UNP P07700 ARG 247 deletion              ?   53 
2 2Y01 ?   B ?   ? UNP P07700 PHE 248 deletion              ?   54 
2 2Y01 ?   B ?   ? UNP P07700 TYR 249 deletion              ?   55 
2 2Y01 ?   B ?   ? UNP P07700 GLY 250 deletion              ?   56 
2 2Y01 ?   B ?   ? UNP P07700 SER 251 deletion              ?   57 
2 2Y01 ?   B ?   ? UNP P07700 GLN 252 deletion              ?   58 
2 2Y01 ?   B ?   ? UNP P07700 GLU 253 deletion              ?   59 
2 2Y01 ?   B ?   ? UNP P07700 GLN 254 deletion              ?   60 
2 2Y01 ?   B ?   ? UNP P07700 PRO 255 deletion              ?   61 
2 2Y01 ?   B ?   ? UNP P07700 GLN 256 deletion              ?   62 
2 2Y01 ?   B ?   ? UNP P07700 PRO 257 deletion              ?   63 
2 2Y01 ?   B ?   ? UNP P07700 PRO 258 deletion              ?   64 
2 2Y01 ?   B ?   ? UNP P07700 PRO 259 deletion              ?   65 
2 2Y01 ?   B ?   ? UNP P07700 LEU 260 deletion              ?   66 
2 2Y01 ?   B ?   ? UNP P07700 PRO 261 deletion              ?   67 
2 2Y01 ?   B ?   ? UNP P07700 GLN 262 deletion              ?   68 
2 2Y01 ?   B ?   ? UNP P07700 HIS 263 deletion              ?   69 
2 2Y01 ?   B ?   ? UNP P07700 GLN 264 deletion              ?   70 
2 2Y01 ?   B ?   ? UNP P07700 PRO 265 deletion              ?   71 
2 2Y01 ?   B ?   ? UNP P07700 ILE 266 deletion              ?   72 
2 2Y01 ?   B ?   ? UNP P07700 LEU 267 deletion              ?   73 
2 2Y01 ?   B ?   ? UNP P07700 GLY 268 deletion              ?   74 
2 2Y01 ?   B ?   ? UNP P07700 ASN 269 deletion              ?   75 
2 2Y01 ?   B ?   ? UNP P07700 GLY 270 deletion              ?   76 
2 2Y01 ?   B ?   ? UNP P07700 ARG 271 deletion              ?   77 
2 2Y01 LEU B 224 ? UNP P07700 ALA 282 'engineered mutation' 282 78 
2 2Y01 ALA B 269 ? UNP P07700 PHE 327 'engineered mutation' 327 79 
2 2Y01 MET B 280 ? UNP P07700 PHE 338 'engineered mutation' 338 80 
2 2Y01 ALA B 300 ? UNP P07700 CYS 358 'engineered mutation' 358 81 
2 2Y01 HIS B 311 ? UNP P07700 ?   ?   'expression tag'      369 82 
2 2Y01 HIS B 312 ? UNP P07700 ?   ?   'expression tag'      370 83 
2 2Y01 HIS B 313 ? UNP P07700 ?   ?   'expression tag'      371 84 
2 2Y01 HIS B 314 ? UNP P07700 ?   ?   'expression tag'      372 85 
2 2Y01 HIS B 315 ? UNP P07700 ?   ?   'expression tag'      373 86 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2CV non-polymer         . HEGA-10                     ? 'C18 H37 N O7'   379.489 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'    117.146 
Y00 non-polymer         . DOBUTAMINE                  ? 'C18 H23 N O3'   301.380 
Y01 non-polymer         . 'CHOLESTEROL HEMISUCCINATE' ? 'C31 H50 O4'     486.726 
# 
_exptl.entry_id          2Y01 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.78 
_exptl_crystal.density_percent_sol   67 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;SITTING DROP VAPOUR DIFFUSION, PROTEIN (15MG/ML) IN 100MM NACL, 0.1MM EDTA, 1.0MM (R, S)-DOBUTAMINE, 0.9MG/ML CHS, 0.6% HEGA-10, 0.1M BICINE PH9, 25% PEG600 AT 4 DEGREES C, pH 9.0
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_wavelength             0.8726 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y01 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             49.90 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   30953 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.13 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.10 
_reflns.B_iso_Wilson_estimate        32.0 
_reflns.pdbx_redundancy              3.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   91.3 
_reflns_shell.Rmerge_I_obs           0.72 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        3.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y01 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     29388 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             95.92 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    94.62 
_refine.ls_R_factor_obs                          0.22772 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22571 
_refine.ls_R_factor_R_free                       0.26636 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1565 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.923 
_refine.correlation_coeff_Fo_to_Fc_free          0.901 
_refine.B_iso_mean                               48.484 
_refine.aniso_B[1][1]                            1.36 
_refine.aniso_B[2][2]                            0.52 
_refine.aniso_B[3][3]                            -1.44 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.69 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2VT4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.451 
_refine.pdbx_overall_ESU_R_Free                  0.298 
_refine.overall_SU_ML                            0.213 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.967 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4639 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         373 
_refine_hist.number_atoms_solvent             41 
_refine_hist.number_atoms_total               5053 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        95.92 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 5129 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.385  2.016  ? 6968 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.995  5.000  ? 581  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.427 22.022 ? 178  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.030 15.000 ? 808  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.532 15.000 ? 35   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 832  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 3577 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.455  3.000  ? 2915 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.783  5.000  ? 4733 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.569  5.000  ? 2214 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.756  10.000 ? 2235 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1326 0.04 0.05  'tight positional'  1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 1326 0.04 0.05  'tight positional'  1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 208  0.06 0.50  'medium positional' 1 3 'X-RAY DIFFRACTION' ? ? ? 
2 B 208  0.06 0.50  'medium positional' 1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 1326 3.34 10.00 'tight thermal'     1 5 'X-RAY DIFFRACTION' ? ? ? 
2 B 1326 3.34 10.00 'tight thermal'     1 6 'X-RAY DIFFRACTION' ? ? ? 
1 A 208  2.41 20.00 'medium thermal'    1 7 'X-RAY DIFFRACTION' ? ? ? 
2 B 208  2.41 20.00 'medium thermal'    1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_R_work             1954 
_refine_ls_shell.R_factor_R_work                  0.309 
_refine_ls_shell.percent_reflns_obs               85.26 
_refine_ls_shell.R_factor_R_free                  0.334 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 47  A 65  1  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 47  B 65  1  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 75  A 97  2  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 75  B 97  2  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 111 A 143 3  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 111 B 143 3  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 153 A 176 4  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 153 B 176 4  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 205 A 219 5  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 205 B 219 5  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 222 A 226 6  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 222 B 226 6  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 279 A 303 7  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 279 B 303 7  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 331 A 358 8  1 ? ? ? ? ? ? ? ? 1 ? 
2 B 331 B 358 8  1 ? ? ? ? ? ? ? ? 1 ? 
1 A 33  A 46  9  4 ? ? ? ? ? ? ? ? 1 ? 
2 B 33  B 46  9  4 ? ? ? ? ? ? ? ? 1 ? 
1 A 98  A 110 10 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 98  B 110 10 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2Y01 
_struct.title                     
'TURKEY BETA1 ADRENERGIC RECEPTOR WITH STABILISING MUTATIONS AND BOUND PARTIAL AGONIST DOBUTAMINE (CRYSTAL DOB102)' 
_struct.pdbx_descriptor           'BETA-1 ADRENERGIC RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y01 
_struct_keywords.pdbx_keywords   RECEPTOR 
_struct_keywords.text            
;RECEPTOR, G PROTEIN COUPLED RECEPTOR, SEVEN-HELIX RECEPTOR, INTEGRAL MEMBRANE PROTEIN, THERMOSTABILISING POINT MUTATIONS, GPCR, 7TM RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 4 ? 
S N N 5 ? 
T N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 3   ? SER A 38  ? ALA A 33  SER A 68  1 ? 36 
HELX_P HELX_P2  2  THR A 39  ? GLN A 43  ? THR A 69  GLN A 73  5 ? 5  
HELX_P HELX_P3  3  LEU A 45  ? LEU A 63  ? LEU A 75  LEU A 93  1 ? 19 
HELX_P HELX_P4  4  LEU A 63  ? GLY A 75  ? LEU A 93  GLY A 105 1 ? 13 
HELX_P HELX_P5  5  GLY A 80  ? SER A 115 ? GLY A 110 SER A 145 1 ? 36 
HELX_P HELX_P6  6  SER A 115 ? MET A 123 ? SER A 145 MET A 153 1 ? 9  
HELX_P HELX_P7  7  THR A 124 ? MET A 149 ? THR A 154 MET A 179 1 ? 26 
HELX_P HELX_P8  8  ASP A 156 ? GLN A 164 ? ASP A 186 GLN A 194 1 ? 9  
HELX_P HELX_P9  9  ASN A 174 ? PHE A 186 ? ASN A 204 PHE A 216 1 ? 13 
HELX_P HELX_P10 10 PHE A 186 ? GLU A 206 ? PHE A 216 GLU A 236 1 ? 21 
HELX_P HELX_P11 11 SER A 220 ? ASN A 258 ? SER A 278 ASN A 316 1 ? 39 
HELX_P HELX_P12 12 PRO A 263 ? ASN A 277 ? PRO A 321 ASN A 335 1 ? 15 
HELX_P HELX_P13 13 ALA A 279 ? TYR A 285 ? ALA A 337 TYR A 343 1 ? 7  
HELX_P HELX_P14 14 SER A 288 ? LEU A 299 ? SER A 346 LEU A 357 1 ? 12 
HELX_P HELX_P15 15 ALA B 3   ? THR B 39  ? ALA B 33  THR B 69  1 ? 37 
HELX_P HELX_P16 16 GLN B 40  ? GLN B 43  ? GLN B 70  GLN B 73  5 ? 4  
HELX_P HELX_P17 17 LEU B 45  ? LEU B 63  ? LEU B 75  LEU B 93  1 ? 19 
HELX_P HELX_P18 18 LEU B 63  ? GLY B 75  ? LEU B 93  GLY B 105 1 ? 13 
HELX_P HELX_P19 19 GLY B 80  ? SER B 115 ? GLY B 110 SER B 145 1 ? 36 
HELX_P HELX_P20 20 PHE B 117 ? MET B 123 ? PHE B 147 MET B 153 1 ? 7  
HELX_P HELX_P21 21 THR B 124 ? MET B 149 ? THR B 154 MET B 179 1 ? 26 
HELX_P HELX_P22 22 ASP B 156 ? ASP B 165 ? ASP B 186 ASP B 195 1 ? 10 
HELX_P HELX_P23 23 ASN B 174 ? PHE B 186 ? ASN B 204 PHE B 216 1 ? 13 
HELX_P HELX_P24 24 PHE B 186 ? ILE B 208 ? PHE B 216 ILE B 238 1 ? 23 
HELX_P HELX_P25 25 THR B 219 ? ASN B 258 ? THR B 277 ASN B 316 1 ? 40 
HELX_P HELX_P26 26 PRO B 263 ? ASN B 277 ? PRO B 321 ASN B 335 1 ? 15 
HELX_P HELX_P27 27 ALA B 279 ? TYR B 285 ? ALA B 337 TYR B 343 1 ? 7  
HELX_P HELX_P28 28 SER B 288 ? LEU B 299 ? SER B 346 LEU B 357 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 84  SG ? ? ? 1_555 A CYS 169 SG ? ? A CYS 114 A CYS 199 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf2 disulf ? ? A CYS 162 SG ? ? ? 1_555 A CYS 168 SG ? ? A CYS 192 A CYS 198 1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf3 disulf ? ? B CYS 84  SG ? ? ? 1_555 B CYS 169 SG ? ? B CYS 114 B CYS 199 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf4 disulf ? ? B CYS 162 SG ? ? ? 1_555 B CYS 168 SG ? ? B CYS 192 B CYS 198 1_555 ? ? ? ? ? ? ? 2.082 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE Y01 A 401' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE Y01 A 402' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE 2CV A 501' 
AC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE 2CV A 502' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 2CV A 503' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE 2CV A 504' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE 2CV A 505' 
AC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE Y00 A 601' 
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE Y01 B 401' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE Y01 B 402' 
BC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE 2CV B 501' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE 2CV B 502' 
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE 2CV B 503' 
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE 2CV B 504' 
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE 2CV B 505' 
BC7 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE Y00 B 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ARG A 127 ? ARG A 157  . ? 1_555 ? 
2  AC1 6  ILE A 131 ? ILE A 161  . ? 1_555 ? 
3  AC1 6  HOH S .   ? HOH A 2019 . ? 1_555 ? 
4  AC1 6  ARG B 175 ? ARG B 205  . ? 1_555 ? 
5  AC1 6  ALA B 176 ? ALA B 206  . ? 1_555 ? 
6  AC1 6  2CV M .   ? 2CV B 501  . ? 1_555 ? 
7  AC2 3  GLY A 37  ? GLY A 67   . ? 1_555 ? 
8  AC2 3  LEU A 48  ? LEU A 78   . ? 1_555 ? 
9  AC2 3  TRP A 136 ? TRP A 166  . ? 1_555 ? 
10 AC3 10 HIS A 150 ? HIS A 180  . ? 1_555 ? 
11 AC3 10 TRP A 151 ? TRP A 181  . ? 1_555 ? 
12 AC3 10 ARG A 153 ? ARG A 183  . ? 1_555 ? 
13 AC3 10 ASP A 154 ? ASP A 184  . ? 1_555 ? 
14 AC3 10 ASN A 174 ? ASN A 204  . ? 1_555 ? 
15 AC3 10 HOH S .   ? HOH A 2020 . ? 1_555 ? 
16 AC3 10 VAL B 130 ? VAL B 160  . ? 1_555 ? 
17 AC3 10 THR B 134 ? THR B 164  . ? 1_555 ? 
18 AC3 10 Y01 K .   ? Y01 B 401  . ? 1_555 ? 
19 AC3 10 2CV Q .   ? 2CV B 505  . ? 1_555 ? 
20 AC4 1  LEU A 231 ? LEU A 289  . ? 1_555 ? 
21 AC5 6  ARG A 175 ? ARG A 205  . ? 1_555 ? 
22 AC5 6  VAL A 256 ? VAL A 314  . ? 1_555 ? 
23 AC5 6  PHE A 257 ? PHE A 315  . ? 1_555 ? 
24 AC5 6  LEU B 122 ? LEU B 152  . ? 1_555 ? 
25 AC5 6  ARG B 127 ? ARG B 157  . ? 1_555 ? 
26 AC5 6  Y01 K .   ? Y01 B 401  . ? 1_555 ? 
27 AC6 4  VAL A 21  ? VAL A 51   . ? 1_555 ? 
28 AC6 4  VAL A 268 ? VAL A 326  . ? 1_555 ? 
29 AC6 4  MET A 280 ? MET A 338  . ? 1_555 ? 
30 AC6 4  Y00 J .   ? Y00 A 601  . ? 1_555 ? 
31 AC7 5  LYS A 129 ? LYS A 159  . ? 1_555 ? 
32 AC7 5  VAL A 130 ? VAL A 160  . ? 1_555 ? 
33 AC7 5  CYS A 133 ? CYS A 163  . ? 1_555 ? 
34 AC7 5  GLU B 155 ? GLU B 185  . ? 1_555 ? 
35 AC7 5  2CV M .   ? 2CV B 501  . ? 1_555 ? 
36 AC8 9  ASP A 91  ? ASP A 121  . ? 1_555 ? 
37 AC8 9  SER A 181 ? SER A 211  . ? 1_555 ? 
38 AC8 9  PHE A 248 ? PHE A 306  . ? 1_555 ? 
39 AC8 9  PHE A 249 ? PHE A 307  . ? 1_555 ? 
40 AC8 9  ASN A 252 ? ASN A 310  . ? 1_555 ? 
41 AC8 9  ASN A 271 ? ASN A 329  . ? 1_555 ? 
42 AC8 9  TRP A 272 ? TRP A 330  . ? 1_555 ? 
43 AC8 9  TYR A 275 ? TYR A 333  . ? 1_555 ? 
44 AC8 9  2CV H .   ? 2CV A 504  . ? 1_555 ? 
45 AC9 8  ALA A 176 ? ALA A 206  . ? 1_555 ? 
46 AC9 8  2CV E .   ? 2CV A 501  . ? 1_555 ? 
47 AC9 8  2CV G .   ? 2CV A 503  . ? 1_555 ? 
48 AC9 8  HOH S .   ? HOH A 2020 . ? 1_555 ? 
49 AC9 8  CYS B 103 ? CYS B 133  . ? 1_555 ? 
50 AC9 8  ARG B 127 ? ARG B 157  . ? 1_555 ? 
51 AC9 8  VAL B 130 ? VAL B 160  . ? 1_555 ? 
52 AC9 8  ILE B 184 ? ILE B 214  . ? 1_555 ? 
53 BC1 3  LEU B 48  ? LEU B 78   . ? 1_555 ? 
54 BC1 3  LYS B 129 ? LYS B 159  . ? 1_555 ? 
55 BC1 3  TRP B 136 ? TRP B 166  . ? 1_555 ? 
56 BC2 8  VAL A 130 ? VAL A 160  . ? 1_555 ? 
57 BC2 8  THR A 134 ? THR A 164  . ? 1_555 ? 
58 BC2 8  Y01 C .   ? Y01 A 401  . ? 1_555 ? 
59 BC2 8  2CV I .   ? 2CV A 505  . ? 1_555 ? 
60 BC2 8  PRO B 146 ? PRO B 176  . ? 1_555 ? 
61 BC2 8  TRP B 151 ? TRP B 181  . ? 1_555 ? 
62 BC2 8  ASP B 154 ? ASP B 184  . ? 1_555 ? 
63 BC2 8  GLU B 155 ? GLU B 185  . ? 1_555 ? 
64 BC3 4  TYR B 201 ? TYR B 231  . ? 1_555 ? 
65 BC3 4  HIS B 228 ? HIS B 286  . ? 1_555 ? 
66 BC3 4  LEU B 231 ? LEU B 289  . ? 1_555 ? 
67 BC3 4  GLY B 235 ? GLY B 293  . ? 1_555 ? 
68 BC4 2  ARG A 127 ? ARG A 157  . ? 1_555 ? 
69 BC4 2  PHE B 257 ? PHE B 315  . ? 1_555 ? 
70 BC5 2  MET B 18  ? MET B 48   . ? 1_555 ? 
71 BC5 2  TRP B 272 ? TRP B 330  . ? 1_555 ? 
72 BC6 6  GLU A 155 ? GLU A 185  . ? 1_555 ? 
73 BC6 6  2CV E .   ? 2CV A 501  . ? 1_555 ? 
74 BC6 6  LYS B 129 ? LYS B 159  . ? 1_555 ? 
75 BC6 6  VAL B 130 ? VAL B 160  . ? 1_555 ? 
76 BC6 6  CYS B 133 ? CYS B 163  . ? 1_555 ? 
77 BC6 6  TRP B 136 ? TRP B 166  . ? 1_555 ? 
78 BC7 11 VAL B 72  ? VAL B 102  . ? 1_555 ? 
79 BC7 11 TRP B 87  ? TRP B 117  . ? 1_555 ? 
80 BC7 11 THR B 88  ? THR B 118  . ? 1_555 ? 
81 BC7 11 ASP B 91  ? ASP B 121  . ? 1_555 ? 
82 BC7 11 PHE B 171 ? PHE B 201  . ? 1_555 ? 
83 BC7 11 SER B 181 ? SER B 211  . ? 1_555 ? 
84 BC7 11 ASN B 252 ? ASN B 310  . ? 1_555 ? 
85 BC7 11 ASN B 271 ? ASN B 329  . ? 1_555 ? 
86 BC7 11 TRP B 272 ? TRP B 330  . ? 1_555 ? 
87 BC7 11 TYR B 275 ? TYR B 333  . ? 1_555 ? 
88 BC7 11 HOH T .   ? HOH B 2021 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y01 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y01 
_atom_sites.fract_transf_matrix[1][1]   0.011099 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003800 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016234 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010424 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 3   ? -54.400 -23.215 29.997 1.00 69.34  ? 33   ALA A N   1 
ATOM   2    C CA  . ALA A 1 3   ? -53.133 -23.988 30.171 1.00 70.83  ? 33   ALA A CA  1 
ATOM   3    C C   . ALA A 1 3   ? -52.432 -24.179 28.819 1.00 71.83  ? 33   ALA A C   1 
ATOM   4    O O   . ALA A 1 3   ? -51.537 -23.399 28.465 1.00 72.00  ? 33   ALA A O   1 
ATOM   5    C CB  . ALA A 1 3   ? -53.399 -25.338 30.864 1.00 69.86  ? 33   ALA A CB  1 
ATOM   6    N N   . GLU A 1 4   ? -52.850 -25.203 28.071 1.00 71.50  ? 34   GLU A N   1 
ATOM   7    C CA  . GLU A 1 4   ? -52.355 -25.447 26.719 1.00 70.93  ? 34   GLU A CA  1 
ATOM   8    C C   . GLU A 1 4   ? -52.733 -24.336 25.739 1.00 69.47  ? 34   GLU A C   1 
ATOM   9    O O   . GLU A 1 4   ? -52.049 -24.134 24.736 1.00 70.95  ? 34   GLU A O   1 
ATOM   10   C CB  . GLU A 1 4   ? -52.870 -26.780 26.189 1.00 72.00  ? 34   GLU A CB  1 
ATOM   11   C CG  . GLU A 1 4   ? -52.177 -27.989 26.783 1.00 80.00  ? 34   GLU A CG  1 
ATOM   12   C CD  . GLU A 1 4   ? -52.358 -29.249 25.947 1.00 88.00  ? 34   GLU A CD  1 
ATOM   13   O OE1 . GLU A 1 4   ? -53.316 -29.314 25.143 1.00 92.10  ? 34   GLU A OE1 1 
ATOM   14   O OE2 . GLU A 1 4   ? -51.539 -30.184 26.096 1.00 90.85  ? 34   GLU A OE2 1 
ATOM   15   N N   . LEU A 1 5   ? -53.822 -23.627 26.027 1.00 66.52  ? 35   LEU A N   1 
ATOM   16   C CA  . LEU A 1 5   ? -54.281 -22.538 25.170 1.00 63.66  ? 35   LEU A CA  1 
ATOM   17   C C   . LEU A 1 5   ? -53.435 -21.296 25.370 1.00 60.66  ? 35   LEU A C   1 
ATOM   18   O O   . LEU A 1 5   ? -53.148 -20.570 24.417 1.00 60.05  ? 35   LEU A O   1 
ATOM   19   C CB  . LEU A 1 5   ? -55.754 -22.214 25.446 1.00 64.60  ? 35   LEU A CB  1 
ATOM   20   C CG  . LEU A 1 5   ? -56.825 -23.245 25.063 1.00 63.96  ? 35   LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 5   ? -58.135 -22.966 25.807 1.00 62.74  ? 35   LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 5   ? -57.048 -23.277 23.552 1.00 62.25  ? 35   LEU A CD2 1 
ATOM   23   N N   . LEU A 1 6   ? -53.054 -21.066 26.624 1.00 58.08  ? 36   LEU A N   1 
ATOM   24   C CA  . LEU A 1 6   ? -52.189 -19.967 27.020 1.00 56.36  ? 36   LEU A CA  1 
ATOM   25   C C   . LEU A 1 6   ? -50.822 -20.102 26.339 1.00 54.94  ? 36   LEU A C   1 
ATOM   26   O O   . LEU A 1 6   ? -50.238 -19.120 25.880 1.00 53.77  ? 36   LEU A O   1 
ATOM   27   C CB  . LEU A 1 6   ? -52.042 -19.998 28.539 1.00 57.53  ? 36   LEU A CB  1 
ATOM   28   C CG  . LEU A 1 6   ? -51.768 -18.735 29.355 1.00 59.66  ? 36   LEU A CG  1 
ATOM   29   C CD1 . LEU A 1 6   ? -52.415 -17.487 28.766 1.00 59.49  ? 36   LEU A CD1 1 
ATOM   30   C CD2 . LEU A 1 6   ? -52.240 -18.971 30.789 1.00 61.70  ? 36   LEU A CD2 1 
ATOM   31   N N   . SER A 1 7   ? -50.346 -21.340 26.271 1.00 52.92  ? 37   SER A N   1 
ATOM   32   C CA  . SER A 1 7   ? -49.128 -21.695 25.588 1.00 52.95  ? 37   SER A CA  1 
ATOM   33   C C   . SER A 1 7   ? -49.224 -21.459 24.073 1.00 52.57  ? 37   SER A C   1 
ATOM   34   O O   . SER A 1 7   ? -48.320 -20.863 23.491 1.00 53.73  ? 37   SER A O   1 
ATOM   35   C CB  . SER A 1 7   ? -48.763 -23.146 25.926 1.00 53.35  ? 37   SER A CB  1 
ATOM   36   O OG  . SER A 1 7   ? -48.214 -23.829 24.818 1.00 56.45  ? 37   SER A OG  1 
ATOM   37   N N   . GLN A 1 8   ? -50.309 -21.914 23.445 1.00 50.66  ? 38   GLN A N   1 
ATOM   38   C CA  . GLN A 1 8   ? -50.548 -21.689 22.004 1.00 50.41  ? 38   GLN A CA  1 
ATOM   39   C C   . GLN A 1 8   ? -50.588 -20.215 21.586 1.00 48.81  ? 38   GLN A C   1 
ATOM   40   O O   . GLN A 1 8   ? -50.062 -19.846 20.532 1.00 47.78  ? 38   GLN A O   1 
ATOM   41   C CB  . GLN A 1 8   ? -51.858 -22.332 21.565 1.00 49.97  ? 38   GLN A CB  1 
ATOM   42   C CG  . GLN A 1 8   ? -51.779 -23.816 21.324 1.00 56.64  ? 38   GLN A CG  1 
ATOM   43   C CD  . GLN A 1 8   ? -53.099 -24.386 20.822 1.00 66.62  ? 38   GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 8   ? -53.819 -23.747 20.042 1.00 69.33  ? 38   GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 8   ? -53.424 -25.596 21.270 1.00 67.83  ? 38   GLN A NE2 1 
ATOM   46   N N   . GLN A 1 9   ? -51.245 -19.394 22.405 1.00 47.24  ? 39   GLN A N   1 
ATOM   47   C CA  . GLN A 1 9   ? -51.378 -17.964 22.155 1.00 45.09  ? 39   GLN A CA  1 
ATOM   48   C C   . GLN A 1 9   ? -50.016 -17.297 22.242 1.00 45.56  ? 39   GLN A C   1 
ATOM   49   O O   . GLN A 1 9   ? -49.663 -16.472 21.396 1.00 45.42  ? 39   GLN A O   1 
ATOM   50   C CB  . GLN A 1 9   ? -52.329 -17.331 23.170 1.00 42.77  ? 39   GLN A CB  1 
ATOM   51   C CG  . GLN A 1 9   ? -52.513 -15.825 22.984 1.00 42.09  ? 39   GLN A CG  1 
ATOM   52   C CD  . GLN A 1 9   ? -53.246 -15.155 24.134 1.00 41.37  ? 39   GLN A CD  1 
ATOM   53   O OE1 . GLN A 1 9   ? -53.416 -15.740 25.202 1.00 44.96  ? 39   GLN A OE1 1 
ATOM   54   N NE2 . GLN A 1 9   ? -53.673 -13.918 23.923 1.00 35.33  ? 39   GLN A NE2 1 
ATOM   55   N N   . TRP A 1 10  ? -49.265 -17.669 23.277 1.00 46.31  ? 40   TRP A N   1 
ATOM   56   C CA  . TRP A 1 10  ? -47.927 -17.148 23.510 1.00 46.31  ? 40   TRP A CA  1 
ATOM   57   C C   . TRP A 1 10  ? -46.961 -17.593 22.401 1.00 44.87  ? 40   TRP A C   1 
ATOM   58   O O   . TRP A 1 10  ? -46.297 -16.752 21.799 1.00 43.01  ? 40   TRP A O   1 
ATOM   59   C CB  . TRP A 1 10  ? -47.435 -17.557 24.897 1.00 46.23  ? 40   TRP A CB  1 
ATOM   60   C CG  . TRP A 1 10  ? -46.244 -16.784 25.336 1.00 49.32  ? 40   TRP A CG  1 
ATOM   61   C CD1 . TRP A 1 10  ? -46.233 -15.543 25.914 1.00 51.84  ? 40   TRP A CD1 1 
ATOM   62   C CD2 . TRP A 1 10  ? -44.873 -17.193 25.227 1.00 48.98  ? 40   TRP A CD2 1 
ATOM   63   N NE1 . TRP A 1 10  ? -44.932 -15.155 26.174 1.00 53.92  ? 40   TRP A NE1 1 
ATOM   64   C CE2 . TRP A 1 10  ? -44.081 -16.149 25.758 1.00 49.70  ? 40   TRP A CE2 1 
ATOM   65   C CE3 . TRP A 1 10  ? -44.237 -18.340 24.725 1.00 45.71  ? 40   TRP A CE3 1 
ATOM   66   C CZ2 . TRP A 1 10  ? -42.694 -16.216 25.798 1.00 47.46  ? 40   TRP A CZ2 1 
ATOM   67   C CZ3 . TRP A 1 10  ? -42.862 -18.405 24.772 1.00 44.67  ? 40   TRP A CZ3 1 
ATOM   68   C CH2 . TRP A 1 10  ? -42.104 -17.350 25.302 1.00 45.45  ? 40   TRP A CH2 1 
ATOM   69   N N   . GLU A 1 11  ? -46.937 -18.894 22.105 1.00 43.40  ? 41   GLU A N   1 
ATOM   70   C CA  . GLU A 1 11  ? -46.064 -19.440 21.077 1.00 44.78  ? 41   GLU A CA  1 
ATOM   71   C C   . GLU A 1 11  ? -46.261 -18.777 19.722 1.00 45.23  ? 41   GLU A C   1 
ATOM   72   O O   . GLU A 1 11  ? -45.289 -18.466 19.029 1.00 48.30  ? 41   GLU A O   1 
ATOM   73   C CB  . GLU A 1 11  ? -46.224 -20.954 20.947 1.00 45.07  ? 41   GLU A CB  1 
ATOM   74   C CG  . GLU A 1 11  ? -45.593 -21.757 22.091 1.00 53.09  ? 41   GLU A CG  1 
ATOM   75   C CD  . GLU A 1 11  ? -45.119 -23.148 21.665 1.00 63.05  ? 41   GLU A CD  1 
ATOM   76   O OE1 . GLU A 1 11  ? -45.257 -23.507 20.468 1.00 69.96  ? 41   GLU A OE1 1 
ATOM   77   O OE2 . GLU A 1 11  ? -44.587 -23.879 22.526 1.00 63.34  ? 41   GLU A OE2 1 
ATOM   78   N N   . ALA A 1 12  ? -47.509 -18.542 19.348 1.00 44.81  ? 42   ALA A N   1 
ATOM   79   C CA  . ALA A 1 12  ? -47.802 -18.018 18.011 1.00 45.07  ? 42   ALA A CA  1 
ATOM   80   C C   . ALA A 1 12  ? -47.476 -16.537 17.875 1.00 44.81  ? 42   ALA A C   1 
ATOM   81   O O   . ALA A 1 12  ? -46.951 -16.115 16.849 1.00 46.01  ? 42   ALA A O   1 
ATOM   82   C CB  . ALA A 1 12  ? -49.242 -18.302 17.603 1.00 42.70  ? 42   ALA A CB  1 
ATOM   83   N N   . GLY A 1 13  ? -47.774 -15.758 18.913 1.00 44.55  ? 43   GLY A N   1 
ATOM   84   C CA  . GLY A 1 13  ? -47.505 -14.321 18.915 1.00 43.34  ? 43   GLY A CA  1 
ATOM   85   C C   . GLY A 1 13  ? -46.025 -14.005 19.049 1.00 45.66  ? 43   GLY A C   1 
ATOM   86   O O   . GLY A 1 13  ? -45.529 -13.050 18.438 1.00 44.57  ? 43   GLY A O   1 
ATOM   87   N N   . MET A 1 14  ? -45.322 -14.813 19.849 1.00 46.84  ? 44   MET A N   1 
ATOM   88   C CA  . MET A 1 14  ? -43.872 -14.680 20.043 1.00 46.35  ? 44   MET A CA  1 
ATOM   89   C C   . MET A 1 14  ? -43.123 -15.054 18.766 1.00 44.95  ? 44   MET A C   1 
ATOM   90   O O   . MET A 1 14  ? -42.151 -14.389 18.411 1.00 44.52  ? 44   MET A O   1 
ATOM   91   C CB  . MET A 1 14  ? -43.392 -15.519 21.239 1.00 45.90  ? 44   MET A CB  1 
ATOM   92   C CG  . MET A 1 14  ? -42.160 -14.980 21.962 1.00 49.14  ? 44   MET A CG  1 
ATOM   93   S SD  . MET A 1 14  ? -42.241 -13.322 22.691 1.00 59.89  ? 44   MET A SD  1 
ATOM   94   C CE  . MET A 1 14  ? -43.886 -13.270 23.429 1.00 62.50  ? 44   MET A CE  1 
ATOM   95   N N   . SER A 1 15  ? -43.599 -16.094 18.079 1.00 43.76  ? 45   SER A N   1 
ATOM   96   C CA  . SER A 1 15  ? -43.082 -16.477 16.760 1.00 44.96  ? 45   SER A CA  1 
ATOM   97   C C   . SER A 1 15  ? -43.240 -15.365 15.724 1.00 46.47  ? 45   SER A C   1 
ATOM   98   O O   . SER A 1 15  ? -42.409 -15.206 14.841 1.00 47.26  ? 45   SER A O   1 
ATOM   99   C CB  . SER A 1 15  ? -43.789 -17.730 16.237 1.00 43.11  ? 45   SER A CB  1 
ATOM   100  O OG  . SER A 1 15  ? -43.471 -18.866 17.011 1.00 42.45  ? 45   SER A OG  1 
ATOM   101  N N   . LEU A 1 16  ? -44.328 -14.617 15.836 1.00 48.78  ? 46   LEU A N   1 
ATOM   102  C CA  . LEU A 1 16  ? -44.649 -13.560 14.894 1.00 50.62  ? 46   LEU A CA  1 
ATOM   103  C C   . LEU A 1 16  ? -43.732 -12.362 15.104 1.00 49.84  ? 46   LEU A C   1 
ATOM   104  O O   . LEU A 1 16  ? -43.313 -11.707 14.154 1.00 47.91  ? 46   LEU A O   1 
ATOM   105  C CB  . LEU A 1 16  ? -46.112 -13.134 15.070 1.00 52.57  ? 46   LEU A CB  1 
ATOM   106  C CG  . LEU A 1 16  ? -46.819 -12.806 13.754 1.00 57.22  ? 46   LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 16  ? -47.379 -14.084 13.136 1.00 59.17  ? 46   LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 16  ? -47.915 -11.771 13.956 1.00 59.36  ? 46   LEU A CD2 1 
ATOM   109  N N   . LEU A 1 17  ? -43.434 -12.093 16.370 1.00 50.26  ? 47   LEU A N   1 
ATOM   110  C CA  . LEU A 1 17  ? -42.562 -11.007 16.761 1.00 49.92  ? 47   LEU A CA  1 
ATOM   111  C C   . LEU A 1 17  ? -41.123 -11.334 16.366 1.00 50.83  ? 47   LEU A C   1 
ATOM   112  O O   . LEU A 1 17  ? -40.432 -10.503 15.772 1.00 51.54  ? 47   LEU A O   1 
ATOM   113  C CB  . LEU A 1 17  ? -42.682 -10.797 18.263 1.00 49.15  ? 47   LEU A CB  1 
ATOM   114  C CG  . LEU A 1 17  ? -41.869 -9.733  18.978 1.00 48.89  ? 47   LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 17  ? -42.085 -8.338  18.393 1.00 50.51  ? 47   LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 17  ? -42.262 -9.781  20.434 1.00 45.15  ? 47   LEU A CD2 1 
ATOM   117  N N   . MET A 1 18  ? -40.696 -12.558 16.669 1.00 50.39  ? 48   MET A N   1 
ATOM   118  C CA  . MET A 1 18  ? -39.357 -13.015 16.338 1.00 50.26  ? 48   MET A CA  1 
ATOM   119  C C   . MET A 1 18  ? -39.082 -12.921 14.840 1.00 50.04  ? 48   MET A C   1 
ATOM   120  O O   . MET A 1 18  ? -37.991 -12.486 14.434 1.00 52.10  ? 48   MET A O   1 
ATOM   121  C CB  . MET A 1 18  ? -39.120 -14.456 16.810 1.00 50.41  ? 48   MET A CB  1 
ATOM   122  C CG  . MET A 1 18  ? -39.042 -14.679 18.324 1.00 50.02  ? 48   MET A CG  1 
ATOM   123  S SD  . MET A 1 18  ? -37.880 -13.714 19.299 1.00 54.18  ? 48   MET A SD  1 
ATOM   124  C CE  . MET A 1 18  ? -36.563 -13.394 18.135 1.00 59.98  ? 48   MET A CE  1 
ATOM   125  N N   . ALA A 1 19  ? -40.061 -13.331 14.031 1.00 46.69  ? 49   ALA A N   1 
ATOM   126  C CA  . ALA A 1 19  ? -39.952 -13.260 12.578 1.00 44.99  ? 49   ALA A CA  1 
ATOM   127  C C   . ALA A 1 19  ? -39.818 -11.810 12.124 1.00 45.65  ? 49   ALA A C   1 
ATOM   128  O O   . ALA A 1 19  ? -39.065 -11.518 11.193 1.00 46.01  ? 49   ALA A O   1 
ATOM   129  C CB  . ALA A 1 19  ? -41.134 -13.895 11.929 1.00 42.86  ? 49   ALA A CB  1 
ATOM   130  N N   . LEU A 1 20  ? -40.529 -10.908 12.801 1.00 44.63  ? 50   LEU A N   1 
ATOM   131  C CA  . LEU A 1 20  ? -40.490 -9.504  12.451 1.00 45.22  ? 50   LEU A CA  1 
ATOM   132  C C   . LEU A 1 20  ? -39.085 -8.960  12.688 1.00 46.07  ? 50   LEU A C   1 
ATOM   133  O O   . LEU A 1 20  ? -38.518 -8.265  11.833 1.00 46.56  ? 50   LEU A O   1 
ATOM   134  C CB  . LEU A 1 20  ? -41.526 -8.702  13.249 1.00 44.59  ? 50   LEU A CB  1 
ATOM   135  C CG  . LEU A 1 20  ? -41.417 -7.164  13.187 1.00 47.17  ? 50   LEU A CG  1 
ATOM   136  C CD1 . LEU A 1 20  ? -41.749 -6.605  11.783 1.00 47.02  ? 50   LEU A CD1 1 
ATOM   137  C CD2 . LEU A 1 20  ? -42.256 -6.461  14.266 1.00 46.76  ? 50   LEU A CD2 1 
ATOM   138  N N   . VAL A 1 21  ? -38.539 -9.283  13.859 1.00 45.66  ? 51   VAL A N   1 
ATOM   139  C CA  . VAL A 1 21  ? -37.194 -8.869  14.256 1.00 43.66  ? 51   VAL A CA  1 
ATOM   140  C C   . VAL A 1 21  ? -36.150 -9.357  13.239 1.00 41.85  ? 51   VAL A C   1 
ATOM   141  O O   . VAL A 1 21  ? -35.334 -8.575  12.765 1.00 39.99  ? 51   VAL A O   1 
ATOM   142  C CB  . VAL A 1 21  ? -36.877 -9.358  15.688 1.00 43.43  ? 51   VAL A CB  1 
ATOM   143  C CG1 . VAL A 1 21  ? -35.397 -9.149  16.038 1.00 46.34  ? 51   VAL A CG1 1 
ATOM   144  C CG2 . VAL A 1 21  ? -37.744 -8.623  16.676 1.00 40.64  ? 51   VAL A CG2 1 
ATOM   145  N N   . VAL A 1 22  ? -36.207 -10.641 12.896 1.00 40.84  ? 52   VAL A N   1 
ATOM   146  C CA  . VAL A 1 22  ? -35.365 -11.207 11.855 1.00 41.82  ? 52   VAL A CA  1 
ATOM   147  C C   . VAL A 1 22  ? -35.482 -10.409 10.558 1.00 45.12  ? 52   VAL A C   1 
ATOM   148  O O   . VAL A 1 22  ? -34.470 -9.981  9.986  1.00 48.16  ? 52   VAL A O   1 
ATOM   149  C CB  . VAL A 1 22  ? -35.725 -12.688 11.595 1.00 40.59  ? 52   VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 22  ? -34.964 -13.239 10.380 1.00 39.02  ? 52   VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 22  ? -35.419 -13.514 12.824 1.00 40.46  ? 52   VAL A CG2 1 
ATOM   152  N N   . LEU A 1 23  ? -36.719 -10.203 10.113 1.00 45.23  ? 53   LEU A N   1 
ATOM   153  C CA  . LEU A 1 23  ? -37.000 -9.525  8.857  1.00 45.26  ? 53   LEU A CA  1 
ATOM   154  C C   . LEU A 1 23  ? -36.408 -8.125  8.836  1.00 42.46  ? 53   LEU A C   1 
ATOM   155  O O   . LEU A 1 23  ? -35.770 -7.726  7.879  1.00 43.15  ? 53   LEU A O   1 
ATOM   156  C CB  . LEU A 1 23  ? -38.515 -9.455  8.620  1.00 46.99  ? 53   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 23  ? -38.990 -9.800  7.209  1.00 48.12  ? 53   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 23  ? -39.434 -11.271 7.164  1.00 49.34  ? 53   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 23  ? -40.112 -8.858  6.801  1.00 48.67  ? 53   LEU A CD2 1 
ATOM   160  N N   . LEU A 1 24  ? -36.619 -7.396  9.912  1.00 41.82  ? 54   LEU A N   1 
ATOM   161  C CA  . LEU A 1 24  ? -36.143 -6.038  10.041 1.00 43.59  ? 54   LEU A CA  1 
ATOM   162  C C   . LEU A 1 24  ? -34.601 -5.968  10.005 1.00 44.86  ? 54   LEU A C   1 
ATOM   163  O O   . LEU A 1 24  ? -34.024 -5.094  9.346  1.00 46.18  ? 54   LEU A O   1 
ATOM   164  C CB  . LEU A 1 24  ? -36.707 -5.468  11.340 1.00 44.28  ? 54   LEU A CB  1 
ATOM   165  C CG  . LEU A 1 24  ? -36.727 -3.971  11.646 1.00 49.49  ? 54   LEU A CG  1 
ATOM   166  C CD1 . LEU A 1 24  ? -37.242 -3.130  10.476 1.00 47.48  ? 54   LEU A CD1 1 
ATOM   167  C CD2 . LEU A 1 24  ? -37.566 -3.743  12.910 1.00 47.50  ? 54   LEU A CD2 1 
ATOM   168  N N   . ILE A 1 25  ? -33.946 -6.908  10.688 1.00 43.60  ? 55   ILE A N   1 
ATOM   169  C CA  . ILE A 1 25  ? -32.492 -6.994  10.725 1.00 41.27  ? 55   ILE A CA  1 
ATOM   170  C C   . ILE A 1 25  ? -31.912 -7.416  9.374  1.00 43.47  ? 55   ILE A C   1 
ATOM   171  O O   . ILE A 1 25  ? -30.875 -6.886  8.945  1.00 45.09  ? 55   ILE A O   1 
ATOM   172  C CB  . ILE A 1 25  ? -32.003 -7.989  11.815 1.00 39.94  ? 55   ILE A CB  1 
ATOM   173  C CG1 . ILE A 1 25  ? -32.337 -7.471  13.214 1.00 36.37  ? 55   ILE A CG1 1 
ATOM   174  C CG2 . ILE A 1 25  ? -30.501 -8.209  11.715 1.00 36.52  ? 55   ILE A CG2 1 
ATOM   175  C CD1 . ILE A 1 25  ? -32.156 -8.508  14.311 1.00 27.64  ? 55   ILE A CD1 1 
ATOM   176  N N   . VAL A 1 26  ? -32.551 -8.379  8.712  1.00 42.98  ? 56   VAL A N   1 
ATOM   177  C CA  . VAL A 1 26  ? -32.036 -8.855  7.430  1.00 43.99  ? 56   VAL A CA  1 
ATOM   178  C C   . VAL A 1 26  ? -32.317 -7.877  6.267  1.00 46.55  ? 56   VAL A C   1 
ATOM   179  O O   . VAL A 1 26  ? -31.405 -7.577  5.482  1.00 47.72  ? 56   VAL A O   1 
ATOM   180  C CB  . VAL A 1 26  ? -32.488 -10.295 7.097  1.00 43.38  ? 56   VAL A CB  1 
ATOM   181  C CG1 . VAL A 1 26  ? -31.992 -10.711 5.710  1.00 41.37  ? 56   VAL A CG1 1 
ATOM   182  C CG2 . VAL A 1 26  ? -31.971 -11.278 8.153  1.00 44.42  ? 56   VAL A CG2 1 
ATOM   183  N N   . ALA A 1 27  ? -33.555 -7.383  6.158  1.00 46.14  ? 57   ALA A N   1 
ATOM   184  C CA  . ALA A 1 27  ? -33.892 -6.410  5.121  1.00 46.05  ? 57   ALA A CA  1 
ATOM   185  C C   . ALA A 1 27  ? -33.037 -5.158  5.274  1.00 46.11  ? 57   ALA A C   1 
ATOM   186  O O   . ALA A 1 27  ? -32.311 -4.785  4.354  1.00 48.50  ? 57   ALA A O   1 
ATOM   187  C CB  . ALA A 1 27  ? -35.375 -6.055  5.158  1.00 46.56  ? 57   ALA A CB  1 
ATOM   188  N N   . GLY A 1 28  ? -33.105 -4.533  6.445  1.00 44.76  ? 58   GLY A N   1 
ATOM   189  C CA  . GLY A 1 28  ? -32.332 -3.328  6.725  1.00 44.46  ? 58   GLY A CA  1 
ATOM   190  C C   . GLY A 1 28  ? -30.856 -3.414  6.369  1.00 44.55  ? 58   GLY A C   1 
ATOM   191  O O   . GLY A 1 28  ? -30.309 -2.479  5.799  1.00 45.24  ? 58   GLY A O   1 
ATOM   192  N N   . ASN A 1 29  ? -30.208 -4.533  6.696  1.00 44.17  ? 59   ASN A N   1 
ATOM   193  C CA  . ASN A 1 29  ? -28.753 -4.665  6.503  1.00 43.43  ? 59   ASN A CA  1 
ATOM   194  C C   . ASN A 1 29  ? -28.334 -5.115  5.109  1.00 44.23  ? 59   ASN A C   1 
ATOM   195  O O   . ASN A 1 29  ? -27.256 -4.738  4.651  1.00 45.43  ? 59   ASN A O   1 
ATOM   196  C CB  . ASN A 1 29  ? -28.105 -5.537  7.589  1.00 41.44  ? 59   ASN A CB  1 
ATOM   197  C CG  . ASN A 1 29  ? -27.937 -4.796  8.913  1.00 40.48  ? 59   ASN A CG  1 
ATOM   198  O OD1 . ASN A 1 29  ? -27.185 -3.834  9.005  1.00 40.11  ? 59   ASN A OD1 1 
ATOM   199  N ND2 . ASN A 1 29  ? -28.648 -5.244  9.944  1.00 41.58  ? 59   ASN A ND2 1 
ATOM   200  N N   . VAL A 1 30  ? -29.174 -5.911  4.443  1.00 44.33  ? 60   VAL A N   1 
ATOM   201  C CA  . VAL A 1 30  ? -29.018 -6.170  3.002  1.00 44.72  ? 60   VAL A CA  1 
ATOM   202  C C   . VAL A 1 30  ? -29.140 -4.846  2.221  1.00 45.51  ? 60   VAL A C   1 
ATOM   203  O O   . VAL A 1 30  ? -28.341 -4.559  1.322  1.00 46.17  ? 60   VAL A O   1 
ATOM   204  C CB  . VAL A 1 30  ? -30.040 -7.231  2.468  1.00 45.09  ? 60   VAL A CB  1 
ATOM   205  C CG1 . VAL A 1 30  ? -30.184 -7.165  0.940  1.00 43.11  ? 60   VAL A CG1 1 
ATOM   206  C CG2 . VAL A 1 30  ? -29.643 -8.643  2.901  1.00 42.61  ? 60   VAL A CG2 1 
ATOM   207  N N   . LEU A 1 31  ? -30.117 -4.027  2.588  1.00 44.32  ? 61   LEU A N   1 
ATOM   208  C CA  . LEU A 1 31  ? -30.262 -2.733  1.952  1.00 45.62  ? 61   LEU A CA  1 
ATOM   209  C C   . LEU A 1 31  ? -28.978 -1.905  2.050  1.00 46.60  ? 61   LEU A C   1 
ATOM   210  O O   . LEU A 1 31  ? -28.552 -1.310  1.058  1.00 47.83  ? 61   LEU A O   1 
ATOM   211  C CB  . LEU A 1 31  ? -31.471 -1.964  2.511  1.00 46.07  ? 61   LEU A CB  1 
ATOM   212  C CG  . LEU A 1 31  ? -32.825 -2.340  1.892  1.00 45.90  ? 61   LEU A CG  1 
ATOM   213  C CD1 . LEU A 1 31  ? -33.975 -1.705  2.672  1.00 47.21  ? 61   LEU A CD1 1 
ATOM   214  C CD2 . LEU A 1 31  ? -32.894 -1.953  0.417  1.00 44.19  ? 61   LEU A CD2 1 
ATOM   215  N N   . VAL A 1 32  ? -28.364 -1.883  3.236  1.00 45.26  ? 62   VAL A N   1 
ATOM   216  C CA  . VAL A 1 32  ? -27.148 -1.113  3.468  1.00 43.54  ? 62   VAL A CA  1 
ATOM   217  C C   . VAL A 1 32  ? -25.996 -1.640  2.609  1.00 44.98  ? 62   VAL A C   1 
ATOM   218  O O   . VAL A 1 32  ? -25.235 -0.862  2.019  1.00 43.15  ? 62   VAL A O   1 
ATOM   219  C CB  . VAL A 1 32  ? -26.756 -1.093  4.964  1.00 42.71  ? 62   VAL A CB  1 
ATOM   220  C CG1 . VAL A 1 32  ? -25.340 -0.536  5.158  1.00 42.14  ? 62   VAL A CG1 1 
ATOM   221  C CG2 . VAL A 1 32  ? -27.753 -0.270  5.770  1.00 38.33  ? 62   VAL A CG2 1 
ATOM   222  N N   . ILE A 1 33  ? -25.885 -2.962  2.528  1.00 45.61  ? 63   ILE A N   1 
ATOM   223  C CA  . ILE A 1 33  ? -24.815 -3.582  1.754  1.00 45.82  ? 63   ILE A CA  1 
ATOM   224  C C   . ILE A 1 33  ? -25.046 -3.355  0.268  1.00 46.27  ? 63   ILE A C   1 
ATOM   225  O O   . ILE A 1 33  ? -24.125 -2.988  -0.453 1.00 47.78  ? 63   ILE A O   1 
ATOM   226  C CB  . ILE A 1 33  ? -24.649 -5.088  2.087  1.00 44.74  ? 63   ILE A CB  1 
ATOM   227  C CG1 . ILE A 1 33  ? -24.228 -5.256  3.554  1.00 44.04  ? 63   ILE A CG1 1 
ATOM   228  C CG2 . ILE A 1 33  ? -23.629 -5.742  1.158  1.00 43.22  ? 63   ILE A CG2 1 
ATOM   229  C CD1 . ILE A 1 33  ? -24.395 -6.677  4.105  1.00 44.30  ? 63   ILE A CD1 1 
ATOM   230  N N   . ALA A 1 34  ? -26.282 -3.551  -0.176 1.00 46.92  ? 64   ALA A N   1 
ATOM   231  C CA  . ALA A 1 34  ? -26.635 -3.354  -1.586 1.00 46.14  ? 64   ALA A CA  1 
ATOM   232  C C   . ALA A 1 34  ? -26.503 -1.893  -2.034 1.00 45.46  ? 64   ALA A C   1 
ATOM   233  O O   . ALA A 1 34  ? -26.044 -1.633  -3.138 1.00 47.06  ? 64   ALA A O   1 
ATOM   234  C CB  . ALA A 1 34  ? -28.031 -3.889  -1.872 1.00 43.55  ? 64   ALA A CB  1 
ATOM   235  N N   . ALA A 1 35  ? -26.893 -0.954  -1.173 1.00 45.04  ? 65   ALA A N   1 
ATOM   236  C CA  . ALA A 1 35  ? -26.795 0.472   -1.475 1.00 45.47  ? 65   ALA A CA  1 
ATOM   237  C C   . ALA A 1 35  ? -25.340 0.857   -1.705 1.00 48.44  ? 65   ALA A C   1 
ATOM   238  O O   . ALA A 1 35  ? -25.028 1.642   -2.611 1.00 49.57  ? 65   ALA A O   1 
ATOM   239  C CB  . ALA A 1 35  ? -27.392 1.307   -0.359 1.00 42.44  ? 65   ALA A CB  1 
ATOM   240  N N   . ILE A 1 36  ? -24.460 0.272   -0.896 1.00 48.64  ? 66   ILE A N   1 
ATOM   241  C CA  . ILE A 1 36  ? -23.059 0.610   -0.911 1.00 49.55  ? 66   ILE A CA  1 
ATOM   242  C C   . ILE A 1 36  ? -22.424 -0.112  -2.085 1.00 52.07  ? 66   ILE A C   1 
ATOM   243  O O   . ILE A 1 36  ? -21.637 0.472   -2.842 1.00 54.71  ? 66   ILE A O   1 
ATOM   244  C CB  . ILE A 1 36  ? -22.382 0.269   0.448  1.00 49.10  ? 66   ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 36  ? -22.897 1.225   1.536  1.00 47.12  ? 66   ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 36  ? -20.857 0.356   0.352  1.00 48.24  ? 66   ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 36  ? -22.423 0.900   2.935  1.00 46.50  ? 66   ILE A CD1 1 
ATOM   248  N N   . GLY A 1 37  ? -22.806 -1.368  -2.266 1.00 52.44  ? 67   GLY A N   1 
ATOM   249  C CA  . GLY A 1 37  ? -22.241 -2.192  -3.324 1.00 53.11  ? 67   GLY A CA  1 
ATOM   250  C C   . GLY A 1 37  ? -22.531 -1.695  -4.725 1.00 54.06  ? 67   GLY A C   1 
ATOM   251  O O   . GLY A 1 37  ? -21.906 -2.154  -5.667 1.00 55.25  ? 67   GLY A O   1 
ATOM   252  N N   . SER A 1 38  ? -23.446 -0.734  -4.857 1.00 54.31  ? 68   SER A N   1 
ATOM   253  C CA  . SER A 1 38  ? -23.997 -0.358  -6.155 1.00 55.14  ? 68   SER A CA  1 
ATOM   254  C C   . SER A 1 38  ? -24.142 1.165   -6.355 1.00 56.69  ? 68   SER A C   1 
ATOM   255  O O   . SER A 1 38  ? -24.889 1.616   -7.231 1.00 56.83  ? 68   SER A O   1 
ATOM   256  C CB  . SER A 1 38  ? -25.366 -1.033  -6.331 1.00 55.73  ? 68   SER A CB  1 
ATOM   257  O OG  . SER A 1 38  ? -26.385 -0.321  -5.626 1.00 52.91  ? 68   SER A OG  1 
ATOM   258  N N   . THR A 1 39  ? -23.449 1.953   -5.540 1.00 57.61  ? 69   THR A N   1 
ATOM   259  C CA  . THR A 1 39  ? -23.504 3.415   -5.635 1.00 57.89  ? 69   THR A CA  1 
ATOM   260  C C   . THR A 1 39  ? -22.087 3.946   -5.417 1.00 61.03  ? 69   THR A C   1 
ATOM   261  O O   . THR A 1 39  ? -21.610 4.004   -4.273 1.00 60.35  ? 69   THR A O   1 
ATOM   262  C CB  . THR A 1 39  ? -24.469 4.037   -4.583 1.00 56.89  ? 69   THR A CB  1 
ATOM   263  O OG1 . THR A 1 39  ? -25.725 3.351   -4.597 1.00 54.95  ? 69   THR A OG1 1 
ATOM   264  C CG2 . THR A 1 39  ? -24.697 5.521   -4.838 1.00 54.80  ? 69   THR A CG2 1 
ATOM   265  N N   . GLN A 1 40  ? -21.421 4.308   -6.522 1.00 63.32  ? 70   GLN A N   1 
ATOM   266  C CA  . GLN A 1 40  ? -20.030 4.791   -6.515 1.00 63.83  ? 70   GLN A CA  1 
ATOM   267  C C   . GLN A 1 40  ? -19.844 5.894   -5.493 1.00 64.06  ? 70   GLN A C   1 
ATOM   268  O O   . GLN A 1 40  ? -18.838 5.930   -4.779 1.00 64.41  ? 70   GLN A O   1 
ATOM   269  C CB  . GLN A 1 40  ? -19.624 5.299   -7.899 1.00 63.96  ? 70   GLN A CB  1 
ATOM   270  C CG  . GLN A 1 40  ? -19.044 4.239   -8.810 1.00 69.54  ? 70   GLN A CG  1 
ATOM   271  C CD  . GLN A 1 40  ? -20.084 3.274   -9.353 1.00 77.71  ? 70   GLN A CD  1 
ATOM   272  O OE1 . GLN A 1 40  ? -21.285 3.574   -9.394 1.00 80.40  ? 70   GLN A OE1 1 
ATOM   273  N NE2 . GLN A 1 40  ? -19.625 2.101   -9.781 1.00 80.71  ? 70   GLN A NE2 1 
ATOM   274  N N   . ARG A 1 41  ? -20.834 6.781   -5.437 1.00 64.08  ? 71   ARG A N   1 
ATOM   275  C CA  . ARG A 1 41  ? -20.913 7.862   -4.463 1.00 65.64  ? 71   ARG A CA  1 
ATOM   276  C C   . ARG A 1 41  ? -20.819 7.337   -3.010 1.00 65.31  ? 71   ARG A C   1 
ATOM   277  O O   . ARG A 1 41  ? -20.373 8.054   -2.110 1.00 66.42  ? 71   ARG A O   1 
ATOM   278  C CB  . ARG A 1 41  ? -22.209 8.656   -4.733 1.00 67.87  ? 71   ARG A CB  1 
ATOM   279  C CG  . ARG A 1 41  ? -22.639 9.736   -3.727 1.00 74.14  ? 71   ARG A CG  1 
ATOM   280  C CD  . ARG A 1 41  ? -21.675 10.927  -3.589 1.00 82.79  ? 71   ARG A CD  1 
ATOM   281  N NE  . ARG A 1 41  ? -21.027 11.344  -4.837 1.00 90.52  ? 71   ARG A NE  1 
ATOM   282  C CZ  . ARG A 1 41  ? -21.594 12.079  -5.794 1.00 94.84  ? 71   ARG A CZ  1 
ATOM   283  N NH1 . ARG A 1 41  ? -22.861 12.484  -5.693 1.00 98.21  ? 71   ARG A NH1 1 
ATOM   284  N NH2 . ARG A 1 41  ? -20.889 12.399  -6.871 1.00 94.42  ? 71   ARG A NH2 1 
ATOM   285  N N   . LEU A 1 42  ? -21.207 6.080   -2.796 1.00 63.32  ? 72   LEU A N   1 
ATOM   286  C CA  . LEU A 1 42  ? -21.153 5.464   -1.469 1.00 60.92  ? 72   LEU A CA  1 
ATOM   287  C C   . LEU A 1 42  ? -19.983 4.492   -1.263 1.00 59.13  ? 72   LEU A C   1 
ATOM   288  O O   . LEU A 1 42  ? -19.917 3.805   -0.236 1.00 59.14  ? 72   LEU A O   1 
ATOM   289  C CB  . LEU A 1 42  ? -22.467 4.738   -1.174 1.00 60.68  ? 72   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 42  ? -23.670 5.577   -0.756 1.00 61.45  ? 72   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 42  ? -24.884 4.661   -0.639 1.00 62.25  ? 72   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 42  ? -23.414 6.335   0.557  1.00 57.81  ? 72   LEU A CD2 1 
ATOM   293  N N   . GLN A 1 43  ? -19.070 4.424   -2.225 1.00 55.60  ? 73   GLN A N   1 
ATOM   294  C CA  . GLN A 1 43  ? -17.962 3.492   -2.115 1.00 53.76  ? 73   GLN A CA  1 
ATOM   295  C C   . GLN A 1 43  ? -16.711 4.080   -1.459 1.00 52.43  ? 73   GLN A C   1 
ATOM   296  O O   . GLN A 1 43  ? -15.600 3.668   -1.756 1.00 53.75  ? 73   GLN A O   1 
ATOM   297  C CB  . GLN A 1 43  ? -17.668 2.846   -3.467 1.00 54.18  ? 73   GLN A CB  1 
ATOM   298  C CG  . GLN A 1 43  ? -18.618 1.708   -3.752 1.00 58.70  ? 73   GLN A CG  1 
ATOM   299  C CD  . GLN A 1 43  ? -18.602 1.249   -5.189 1.00 63.02  ? 73   GLN A CD  1 
ATOM   300  O OE1 . GLN A 1 43  ? -17.545 1.147   -5.815 1.00 66.34  ? 73   GLN A OE1 1 
ATOM   301  N NE2 . GLN A 1 43  ? -19.786 0.944   -5.719 1.00 62.91  ? 73   GLN A NE2 1 
ATOM   302  N N   . THR A 1 44  ? -16.902 5.029   -0.545 1.00 50.89  ? 74   THR A N   1 
ATOM   303  C CA  . THR A 1 44  ? -15.813 5.578   0.271  1.00 49.20  ? 74   THR A CA  1 
ATOM   304  C C   . THR A 1 44  ? -15.164 4.514   1.181  1.00 48.58  ? 74   THR A C   1 
ATOM   305  O O   . THR A 1 44  ? -15.657 3.391   1.296  1.00 48.51  ? 74   THR A O   1 
ATOM   306  C CB  . THR A 1 44  ? -16.315 6.735   1.145  1.00 48.85  ? 74   THR A CB  1 
ATOM   307  O OG1 . THR A 1 44  ? -17.266 6.230   2.087  1.00 51.24  ? 74   THR A OG1 1 
ATOM   308  C CG2 . THR A 1 44  ? -16.968 7.820   0.293  1.00 47.62  ? 74   THR A CG2 1 
ATOM   309  N N   . LEU A 1 45  ? -14.063 4.872   1.833  1.00 47.71  ? 75   LEU A N   1 
ATOM   310  C CA  . LEU A 1 45  ? -13.347 3.914   2.665  1.00 47.24  ? 75   LEU A CA  1 
ATOM   311  C C   . LEU A 1 45  ? -14.067 3.698   3.982  1.00 46.93  ? 75   LEU A C   1 
ATOM   312  O O   . LEU A 1 45  ? -14.170 2.564   4.465  1.00 47.13  ? 75   LEU A O   1 
ATOM   313  C CB  . LEU A 1 45  ? -11.903 4.352   2.913  1.00 47.31  ? 75   LEU A CB  1 
ATOM   314  C CG  . LEU A 1 45  ? -10.967 4.390   1.701  1.00 49.08  ? 75   LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 45  ? -9.637  4.985   2.100  1.00 51.61  ? 75   LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 45  ? -10.765 3.017   1.066  1.00 49.04  ? 75   LEU A CD2 1 
ATOM   317  N N   . THR A 1 46  ? -14.576 4.788   4.550  1.00 45.48  ? 76   THR A N   1 
ATOM   318  C CA  . THR A 1 46  ? -15.391 4.724   5.759  1.00 45.86  ? 76   THR A CA  1 
ATOM   319  C C   . THR A 1 46  ? -16.567 3.759   5.592  1.00 45.72  ? 76   THR A C   1 
ATOM   320  O O   . THR A 1 46  ? -16.929 3.035   6.527  1.00 45.39  ? 76   THR A O   1 
ATOM   321  C CB  . THR A 1 46  ? -15.908 6.120   6.153  1.00 46.29  ? 76   THR A CB  1 
ATOM   322  O OG1 . THR A 1 46  ? -14.797 7.014   6.290  1.00 50.13  ? 76   THR A OG1 1 
ATOM   323  C CG2 . THR A 1 46  ? -16.661 6.086   7.473  1.00 46.15  ? 76   THR A CG2 1 
ATOM   324  N N   . ASN A 1 47  ? -17.144 3.732   4.392  1.00 44.73  ? 77   ASN A N   1 
ATOM   325  C CA  . ASN A 1 47  ? -18.287 2.862   4.129  1.00 42.97  ? 77   ASN A CA  1 
ATOM   326  C C   . ASN A 1 47  ? -17.936 1.396   3.975  1.00 41.10  ? 77   ASN A C   1 
ATOM   327  O O   . ASN A 1 47  ? -18.832 0.537   3.999  1.00 40.24  ? 77   ASN A O   1 
ATOM   328  C CB  . ASN A 1 47  ? -19.109 3.367   2.945  1.00 43.23  ? 77   ASN A CB  1 
ATOM   329  C CG  . ASN A 1 47  ? -19.979 4.545   3.318  1.00 45.02  ? 77   ASN A CG  1 
ATOM   330  O OD1 . ASN A 1 47  ? -20.115 4.885   4.499  1.00 42.61  ? 77   ASN A OD1 1 
ATOM   331  N ND2 . ASN A 1 47  ? -20.569 5.182   2.318  1.00 47.37  ? 77   ASN A ND2 1 
ATOM   332  N N   . LEU A 1 48  ? -16.639 1.116   3.824  1.00 38.42  ? 78   LEU A N   1 
ATOM   333  C CA  . LEU A 1 48  ? -16.157 -0.259  3.816  1.00 36.94  ? 78   LEU A CA  1 
ATOM   334  C C   . LEU A 1 48  ? -16.227 -0.837  5.243  1.00 36.41  ? 78   LEU A C   1 
ATOM   335  O O   . LEU A 1 48  ? -16.569 -2.019  5.440  1.00 33.45  ? 78   LEU A O   1 
ATOM   336  C CB  . LEU A 1 48  ? -14.741 -0.343  3.239  1.00 36.98  ? 78   LEU A CB  1 
ATOM   337  C CG  . LEU A 1 48  ? -14.577 -0.288  1.715  1.00 39.00  ? 78   LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 48  ? -13.111 -0.309  1.327  1.00 34.69  ? 78   LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 48  ? -15.324 -1.430  1.008  1.00 38.80  ? 78   LEU A CD2 1 
ATOM   340  N N   . PHE A 1 49  ? -15.932 0.025   6.221  1.00 35.03  ? 79   PHE A N   1 
ATOM   341  C CA  . PHE A 1 49  ? -16.078 -0.298  7.636  1.00 36.01  ? 79   PHE A CA  1 
ATOM   342  C C   . PHE A 1 49  ? -17.548 -0.470  8.017  1.00 36.01  ? 79   PHE A C   1 
ATOM   343  O O   . PHE A 1 49  ? -17.899 -1.378  8.784  1.00 34.54  ? 79   PHE A O   1 
ATOM   344  C CB  . PHE A 1 49  ? -15.419 0.772   8.513  1.00 35.81  ? 79   PHE A CB  1 
ATOM   345  C CG  . PHE A 1 49  ? -13.942 0.958   8.250  1.00 38.69  ? 79   PHE A CG  1 
ATOM   346  C CD1 . PHE A 1 49  ? -13.099 -0.145  8.119  1.00 41.88  ? 79   PHE A CD1 1 
ATOM   347  C CD2 . PHE A 1 49  ? -13.396 2.233   8.142  1.00 35.98  ? 79   PHE A CD2 1 
ATOM   348  C CE1 . PHE A 1 49  ? -11.756 0.017   7.871  1.00 40.44  ? 79   PHE A CE1 1 
ATOM   349  C CE2 . PHE A 1 49  ? -12.060 2.401   7.902  1.00 37.84  ? 79   PHE A CE2 1 
ATOM   350  C CZ  . PHE A 1 49  ? -11.235 1.292   7.765  1.00 41.67  ? 79   PHE A CZ  1 
ATOM   351  N N   . ILE A 1 50  ? -18.398 0.390   7.453  1.00 36.04  ? 80   ILE A N   1 
ATOM   352  C CA  . ILE A 1 50  ? -19.842 0.293   7.622  1.00 35.96  ? 80   ILE A CA  1 
ATOM   353  C C   . ILE A 1 50  ? -20.359 -1.043  7.096  1.00 35.04  ? 80   ILE A C   1 
ATOM   354  O O   . ILE A 1 50  ? -21.192 -1.689  7.755  1.00 34.79  ? 80   ILE A O   1 
ATOM   355  C CB  . ILE A 1 50  ? -20.552 1.475   6.943  1.00 37.26  ? 80   ILE A CB  1 
ATOM   356  C CG1 . ILE A 1 50  ? -20.132 2.798   7.597  1.00 38.06  ? 80   ILE A CG1 1 
ATOM   357  C CG2 . ILE A 1 50  ? -22.063 1.320   6.975  1.00 38.82  ? 80   ILE A CG2 1 
ATOM   358  C CD1 . ILE A 1 50  ? -20.758 3.075   8.943  1.00 38.60  ? 80   ILE A CD1 1 
ATOM   359  N N   . THR A 1 51  ? -19.843 -1.464  5.936  1.00 33.65  ? 81   THR A N   1 
ATOM   360  C CA  . THR A 1 51  ? -20.210 -2.759  5.334  1.00 33.06  ? 81   THR A CA  1 
ATOM   361  C C   . THR A 1 51  ? -19.861 -3.911  6.275  1.00 32.53  ? 81   THR A C   1 
ATOM   362  O O   . THR A 1 51  ? -20.615 -4.872  6.403  1.00 33.33  ? 81   THR A O   1 
ATOM   363  C CB  . THR A 1 51  ? -19.566 -2.973  3.920  1.00 33.35  ? 81   THR A CB  1 
ATOM   364  O OG1 . THR A 1 51  ? -20.028 -1.961  3.013  1.00 40.30  ? 81   THR A OG1 1 
ATOM   365  C CG2 . THR A 1 51  ? -19.929 -4.341  3.326  1.00 29.65  ? 81   THR A CG2 1 
ATOM   366  N N   . SER A 1 52  ? -18.722 -3.790  6.946  1.00 32.25  ? 82   SER A N   1 
ATOM   367  C CA  . SER A 1 52  ? -18.245 -4.803  7.869  1.00 31.55  ? 82   SER A CA  1 
ATOM   368  C C   . SER A 1 52  ? -19.181 -4.891  9.082  1.00 32.82  ? 82   SER A C   1 
ATOM   369  O O   . SER A 1 52  ? -19.561 -5.981  9.521  1.00 31.85  ? 82   SER A O   1 
ATOM   370  C CB  . SER A 1 52  ? -16.822 -4.466  8.297  1.00 31.68  ? 82   SER A CB  1 
ATOM   371  O OG  . SER A 1 52  ? -16.304 -5.455  9.163  1.00 31.78  ? 82   SER A OG  1 
ATOM   372  N N   . LEU A 1 53  ? -19.576 -3.730  9.593  1.00 32.63  ? 83   LEU A N   1 
ATOM   373  C CA  . LEU A 1 53  ? -20.542 -3.641  10.671 1.00 31.20  ? 83   LEU A CA  1 
ATOM   374  C C   . LEU A 1 53  ? -21.882 -4.273  10.250 1.00 32.30  ? 83   LEU A C   1 
ATOM   375  O O   . LEU A 1 53  ? -22.496 -5.048  11.000 1.00 32.52  ? 83   LEU A O   1 
ATOM   376  C CB  . LEU A 1 53  ? -20.723 -2.184  11.046 1.00 29.70  ? 83   LEU A CB  1 
ATOM   377  C CG  . LEU A 1 53  ? -21.021 -1.854  12.502 1.00 30.97  ? 83   LEU A CG  1 
ATOM   378  C CD2 . LEU A 1 53  ? -20.989 -0.333  12.611 1.00 32.92  ? 83   LEU A CD2 1 
ATOM   379  N N   . ALA A 1 54  ? -22.320 -3.970  9.037  1.00 33.38  ? 84   ALA A N   1 
ATOM   380  C CA  . ALA A 1 54  ? -23.563 -4.553  8.511  1.00 35.15  ? 84   ALA A CA  1 
ATOM   381  C C   . ALA A 1 54  ? -23.503 -6.080  8.400  1.00 36.25  ? 84   ALA A C   1 
ATOM   382  O O   . ALA A 1 54  ? -24.531 -6.753  8.558  1.00 34.59  ? 84   ALA A O   1 
ATOM   383  C CB  . ALA A 1 54  ? -23.923 -3.938  7.157  1.00 33.82  ? 84   ALA A CB  1 
ATOM   384  N N   . CYS A 1 55  ? -22.307 -6.618  8.114  1.00 35.87  ? 85   CYS A N   1 
ATOM   385  C CA  . CYS A 1 55  ? -22.126 -8.068  8.045  1.00 35.60  ? 85   CYS A CA  1 
ATOM   386  C C   . CYS A 1 55  ? -22.253 -8.699  9.424  1.00 35.02  ? 85   CYS A C   1 
ATOM   387  O O   . CYS A 1 55  ? -22.844 -9.759  9.562  1.00 32.15  ? 85   CYS A O   1 
ATOM   388  C CB  . CYS A 1 55  ? -20.791 -8.430  7.413  1.00 34.42  ? 85   CYS A CB  1 
ATOM   389  S SG  . CYS A 1 55  ? -20.784 -8.184  5.651  1.00 42.52  ? 85   CYS A SG  1 
ATOM   390  N N   . ALA A 1 56  ? -21.700 -8.025  10.433 1.00 34.92  ? 86   ALA A N   1 
ATOM   391  C CA  . ALA A 1 56  ? -21.827 -8.452  11.808 1.00 36.35  ? 86   ALA A CA  1 
ATOM   392  C C   . ALA A 1 56  ? -23.298 -8.511  12.199 1.00 38.73  ? 86   ALA A C   1 
ATOM   393  O O   . ALA A 1 56  ? -23.751 -9.485  12.818 1.00 39.48  ? 86   ALA A O   1 
ATOM   394  C CB  . ALA A 1 56  ? -21.076 -7.507  12.726 1.00 36.91  ? 86   ALA A CB  1 
ATOM   395  N N   . ASP A 1 57  ? -24.041 -7.471  11.827 1.00 39.60  ? 87   ASP A N   1 
ATOM   396  C CA  . ASP A 1 57  ? -25.465 -7.403  12.136 1.00 39.52  ? 87   ASP A CA  1 
ATOM   397  C C   . ASP A 1 57  ? -26.275 -8.422  11.345 1.00 39.72  ? 87   ASP A C   1 
ATOM   398  O O   . ASP A 1 57  ? -27.213 -9.013  11.872 1.00 39.61  ? 87   ASP A O   1 
ATOM   399  C CB  . ASP A 1 57  ? -25.974 -5.988  11.940 1.00 39.07  ? 87   ASP A CB  1 
ATOM   400  C CG  . ASP A 1 57  ? -25.494 -5.068  13.031 1.00 40.52  ? 87   ASP A CG  1 
ATOM   401  O OD1 . ASP A 1 57  ? -25.386 -5.549  14.172 1.00 37.32  ? 87   ASP A OD1 1 
ATOM   402  O OD2 . ASP A 1 57  ? -25.203 -3.879  12.765 1.00 47.33  ? 87   ASP A OD2 1 
ATOM   403  N N   . LEU A 1 58  ? -25.867 -8.667  10.107 1.00 40.55  ? 88   LEU A N   1 
ATOM   404  C CA  . LEU A 1 58  ? -26.553 -9.612  9.243  1.00 39.79  ? 88   LEU A CA  1 
ATOM   405  C C   . LEU A 1 58  ? -26.434 -11.018 9.797  1.00 40.29  ? 88   LEU A C   1 
ATOM   406  O O   . LEU A 1 58  ? -27.376 -11.799 9.684  1.00 44.14  ? 88   LEU A O   1 
ATOM   407  C CB  . LEU A 1 58  ? -25.991 -9.539  7.825  1.00 40.59  ? 88   LEU A CB  1 
ATOM   408  C CG  . LEU A 1 58  ? -26.676 -10.339 6.717  1.00 42.83  ? 88   LEU A CG  1 
ATOM   409  C CD1 . LEU A 1 58  ? -28.161 -10.048 6.701  1.00 43.25  ? 88   LEU A CD1 1 
ATOM   410  C CD2 . LEU A 1 58  ? -26.057 -10.029 5.364  1.00 42.59  ? 88   LEU A CD2 1 
ATOM   411  N N   . VAL A 1 59  ? -25.295 -11.330 10.413 1.00 38.22  ? 89   VAL A N   1 
ATOM   412  C CA  . VAL A 1 59  ? -25.042 -12.670 10.959 1.00 36.57  ? 89   VAL A CA  1 
ATOM   413  C C   . VAL A 1 59  ? -25.906 -12.861 12.213 1.00 36.13  ? 89   VAL A C   1 
ATOM   414  O O   . VAL A 1 59  ? -26.349 -13.973 12.518 1.00 34.42  ? 89   VAL A O   1 
ATOM   415  C CB  . VAL A 1 59  ? -23.515 -12.896 11.273 1.00 37.50  ? 89   VAL A CB  1 
ATOM   416  C CG1 . VAL A 1 59  ? -23.267 -14.218 11.992 1.00 36.01  ? 89   VAL A CG1 1 
ATOM   417  C CG2 . VAL A 1 59  ? -22.664 -12.824 10.009 1.00 35.02  ? 89   VAL A CG2 1 
ATOM   418  N N   . VAL A 1 60  ? -26.133 -11.768 12.939 1.00 36.22  ? 90   VAL A N   1 
ATOM   419  C CA  . VAL A 1 60  ? -27.060 -11.775 14.065 1.00 36.15  ? 90   VAL A CA  1 
ATOM   420  C C   . VAL A 1 60  ? -28.493 -12.083 13.585 1.00 36.14  ? 90   VAL A C   1 
ATOM   421  O O   . VAL A 1 60  ? -29.187 -12.924 14.167 1.00 33.75  ? 90   VAL A O   1 
ATOM   422  C CB  . VAL A 1 60  ? -26.995 -10.447 14.850 1.00 37.39  ? 90   VAL A CB  1 
ATOM   423  C CG1 . VAL A 1 60  ? -28.217 -10.266 15.752 1.00 37.98  ? 90   VAL A CG1 1 
ATOM   424  C CG2 . VAL A 1 60  ? -25.719 -10.391 15.676 1.00 39.31  ? 90   VAL A CG2 1 
ATOM   425  N N   . GLY A 1 61  ? -28.905 -11.423 12.501 1.00 36.79  ? 91   GLY A N   1 
ATOM   426  C CA  . GLY A 1 61  ? -30.219 -11.639 11.889 1.00 36.29  ? 91   GLY A CA  1 
ATOM   427  C C   . GLY A 1 61  ? -30.427 -13.026 11.308 1.00 36.36  ? 91   GLY A C   1 
ATOM   428  O O   . GLY A 1 61  ? -31.514 -13.590 11.429 1.00 35.59  ? 91   GLY A O   1 
ATOM   429  N N   . LEU A 1 62  ? -29.390 -13.584 10.689 1.00 35.76  ? 92   LEU A N   1 
ATOM   430  C CA  . LEU A 1 62  ? -29.513 -14.882 10.030 1.00 37.44  ? 92   LEU A CA  1 
ATOM   431  C C   . LEU A 1 62  ? -29.229 -16.078 10.939 1.00 38.82  ? 92   LEU A C   1 
ATOM   432  O O   . LEU A 1 62  ? -29.723 -17.184 10.681 1.00 39.21  ? 92   LEU A O   1 
ATOM   433  C CB  . LEU A 1 62  ? -28.594 -14.963 8.807  1.00 37.84  ? 92   LEU A CB  1 
ATOM   434  C CG  . LEU A 1 62  ? -28.971 -14.182 7.550  1.00 38.47  ? 92   LEU A CG  1 
ATOM   435  C CD1 . LEU A 1 62  ? -27.795 -14.138 6.544  1.00 34.23  ? 92   LEU A CD1 1 
ATOM   436  C CD2 . LEU A 1 62  ? -30.205 -14.800 6.931  1.00 32.45  ? 92   LEU A CD2 1 
ATOM   437  N N   . LEU A 1 63  ? -28.416 -15.889 11.978 1.00 37.20  ? 93   LEU A N   1 
ATOM   438  C CA  . LEU A 1 63  ? -27.989 -17.033 12.769 1.00 36.74  ? 93   LEU A CA  1 
ATOM   439  C C   . LEU A 1 63  ? -28.199 -16.867 14.262 1.00 37.15  ? 93   LEU A C   1 
ATOM   440  O O   . LEU A 1 63  ? -28.738 -17.750 14.915 1.00 37.45  ? 93   LEU A O   1 
ATOM   441  C CB  . LEU A 1 63  ? -26.537 -17.398 12.466 1.00 36.86  ? 93   LEU A CB  1 
ATOM   442  C CG  . LEU A 1 63  ? -26.221 -17.963 11.077 1.00 39.71  ? 93   LEU A CG  1 
ATOM   443  C CD1 . LEU A 1 63  ? -24.707 -18.066 10.880 1.00 38.68  ? 93   LEU A CD1 1 
ATOM   444  C CD2 . LEU A 1 63  ? -26.916 -19.320 10.843 1.00 39.97  ? 93   LEU A CD2 1 
ATOM   445  N N   . VAL A 1 64  ? -27.789 -15.732 14.809 1.00 37.12  ? 94   VAL A N   1 
ATOM   446  C CA  . VAL A 1 64  ? -27.883 -15.563 16.249 1.00 36.34  ? 94   VAL A CA  1 
ATOM   447  C C   . VAL A 1 64  ? -29.342 -15.524 16.695 1.00 36.96  ? 94   VAL A C   1 
ATOM   448  O O   . VAL A 1 64  ? -29.753 -16.348 17.505 1.00 36.66  ? 94   VAL A O   1 
ATOM   449  C CB  . VAL A 1 64  ? -27.109 -14.337 16.755 1.00 35.30  ? 94   VAL A CB  1 
ATOM   450  C CG1 . VAL A 1 64  ? -27.358 -14.136 18.253 1.00 33.95  ? 94   VAL A CG1 1 
ATOM   451  C CG2 . VAL A 1 64  ? -25.612 -14.498 16.451 1.00 34.57  ? 94   VAL A CG2 1 
ATOM   452  N N   . VAL A 1 65  ? -30.117 -14.594 16.135 1.00 37.80  ? 95   VAL A N   1 
ATOM   453  C CA  . VAL A 1 65  ? -31.506 -14.373 16.540 1.00 36.64  ? 95   VAL A CA  1 
ATOM   454  C C   . VAL A 1 65  ? -32.446 -15.558 16.193 1.00 38.37  ? 95   VAL A C   1 
ATOM   455  O O   . VAL A 1 65  ? -33.219 -16.000 17.049 1.00 37.96  ? 95   VAL A O   1 
ATOM   456  C CB  . VAL A 1 65  ? -32.047 -13.009 16.025 1.00 35.70  ? 95   VAL A CB  1 
ATOM   457  C CG1 . VAL A 1 65  ? -33.570 -12.952 16.115 1.00 35.49  ? 95   VAL A CG1 1 
ATOM   458  C CG2 . VAL A 1 65  ? -31.424 -11.851 16.810 1.00 32.60  ? 95   VAL A CG2 1 
ATOM   459  N N   . PRO A 1 66  ? -32.378 -16.088 14.956 1.00 37.48  ? 96   PRO A N   1 
ATOM   460  C CA  . PRO A 1 66  ? -33.225 -17.240 14.679 1.00 38.64  ? 96   PRO A CA  1 
ATOM   461  C C   . PRO A 1 66  ? -33.074 -18.357 15.709 1.00 41.29  ? 96   PRO A C   1 
ATOM   462  O O   . PRO A 1 66  ? -34.084 -18.910 16.148 1.00 42.47  ? 96   PRO A O   1 
ATOM   463  C CB  . PRO A 1 66  ? -32.735 -17.714 13.301 1.00 36.81  ? 96   PRO A CB  1 
ATOM   464  C CG  . PRO A 1 66  ? -32.310 -16.491 12.644 1.00 36.97  ? 96   PRO A CG  1 
ATOM   465  C CD  . PRO A 1 66  ? -31.728 -15.597 13.730 1.00 37.31  ? 96   PRO A CD  1 
ATOM   466  N N   . PHE A 1 67  ? -31.834 -18.682 16.090 1.00 42.44  ? 97   PHE A N   1 
ATOM   467  C CA  . PHE A 1 67  ? -31.585 -19.763 17.050 1.00 42.75  ? 97   PHE A CA  1 
ATOM   468  C C   . PHE A 1 67  ? -32.152 -19.435 18.437 1.00 42.94  ? 97   PHE A C   1 
ATOM   469  O O   . PHE A 1 67  ? -32.806 -20.275 19.059 1.00 42.40  ? 97   PHE A O   1 
ATOM   470  C CB  . PHE A 1 67  ? -30.094 -20.107 17.141 1.00 42.49  ? 97   PHE A CB  1 
ATOM   471  C CG  . PHE A 1 67  ? -29.625 -21.097 16.101 1.00 46.25  ? 97   PHE A CG  1 
ATOM   472  C CD1 . PHE A 1 67  ? -29.832 -22.461 16.279 1.00 46.55  ? 97   PHE A CD1 1 
ATOM   473  C CD2 . PHE A 1 67  ? -28.959 -20.667 14.948 1.00 48.03  ? 97   PHE A CD2 1 
ATOM   474  C CE1 . PHE A 1 67  ? -29.394 -23.384 15.328 1.00 48.41  ? 97   PHE A CE1 1 
ATOM   475  C CE2 . PHE A 1 67  ? -28.517 -21.583 13.987 1.00 49.98  ? 97   PHE A CE2 1 
ATOM   476  C CZ  . PHE A 1 67  ? -28.732 -22.943 14.181 1.00 50.70  ? 97   PHE A CZ  1 
ATOM   477  N N   . GLY A 1 68  ? -31.907 -18.212 18.901 1.00 42.05  ? 98   GLY A N   1 
ATOM   478  C CA  . GLY A 1 68  ? -32.394 -17.755 20.199 1.00 42.58  ? 98   GLY A CA  1 
ATOM   479  C C   . GLY A 1 68  ? -33.911 -17.734 20.221 1.00 43.95  ? 98   GLY A C   1 
ATOM   480  O O   . GLY A 1 68  ? -34.531 -18.065 21.232 1.00 44.79  ? 98   GLY A O   1 
ATOM   481  N N   . ALA A 1 69  ? -34.505 -17.350 19.092 1.00 42.17  ? 99   ALA A N   1 
ATOM   482  C CA  . ALA A 1 69  ? -35.947 -17.361 18.923 1.00 39.64  ? 99   ALA A CA  1 
ATOM   483  C C   . ALA A 1 69  ? -36.533 -18.746 19.200 1.00 38.90  ? 99   ALA A C   1 
ATOM   484  O O   . ALA A 1 69  ? -37.462 -18.866 19.980 1.00 39.27  ? 99   ALA A O   1 
ATOM   485  C CB  . ALA A 1 69  ? -36.325 -16.897 17.526 1.00 39.04  ? 99   ALA A CB  1 
ATOM   486  N N   . THR A 1 70  ? -35.992 -19.786 18.571 1.00 37.63  ? 100  THR A N   1 
ATOM   487  C CA  . THR A 1 70  ? -36.435 -21.145 18.845 1.00 38.48  ? 100  THR A CA  1 
ATOM   488  C C   . THR A 1 70  ? -36.307 -21.545 20.319 1.00 40.95  ? 100  THR A C   1 
ATOM   489  O O   . THR A 1 70  ? -37.054 -22.394 20.781 1.00 42.99  ? 100  THR A O   1 
ATOM   490  C CB  . THR A 1 70  ? -35.706 -22.206 17.982 1.00 40.13  ? 100  THR A CB  1 
ATOM   491  O OG1 . THR A 1 70  ? -34.334 -22.350 18.408 1.00 41.09  ? 100  THR A OG1 1 
ATOM   492  C CG2 . THR A 1 70  ? -35.796 -21.876 16.480 1.00 32.51  ? 100  THR A CG2 1 
ATOM   493  N N   . LEU A 1 71  ? -35.370 -20.940 21.050 1.00 42.29  ? 101  LEU A N   1 
ATOM   494  C CA  . LEU A 1 71  ? -35.182 -21.238 22.466 1.00 41.75  ? 101  LEU A CA  1 
ATOM   495  C C   . LEU A 1 71  ? -36.226 -20.524 23.324 1.00 44.06  ? 101  LEU A C   1 
ATOM   496  O O   . LEU A 1 71  ? -36.736 -21.093 24.294 1.00 44.59  ? 101  LEU A O   1 
ATOM   497  C CB  . LEU A 1 71  ? -33.769 -20.858 22.902 1.00 41.39  ? 101  LEU A CB  1 
ATOM   498  C CG  . LEU A 1 71  ? -33.342 -20.989 24.363 1.00 39.80  ? 101  LEU A CG  1 
ATOM   499  C CD1 . LEU A 1 71  ? -33.430 -22.443 24.852 1.00 35.49  ? 101  LEU A CD1 1 
ATOM   500  C CD2 . LEU A 1 71  ? -31.942 -20.422 24.525 1.00 36.72  ? 101  LEU A CD2 1 
ATOM   501  N N   . VAL A 1 72  ? -36.523 -19.277 22.967 1.00 45.16  ? 102  VAL A N   1 
ATOM   502  C CA  . VAL A 1 72  ? -37.558 -18.500 23.638 1.00 46.51  ? 102  VAL A CA  1 
ATOM   503  C C   . VAL A 1 72  ? -38.950 -19.105 23.355 1.00 49.75  ? 102  VAL A C   1 
ATOM   504  O O   . VAL A 1 72  ? -39.714 -19.389 24.282 1.00 51.35  ? 102  VAL A O   1 
ATOM   505  C CB  . VAL A 1 72  ? -37.473 -16.992 23.265 1.00 44.23  ? 102  VAL A CB  1 
ATOM   506  C CG1 . VAL A 1 72  ? -38.710 -16.230 23.745 1.00 42.53  ? 102  VAL A CG1 1 
ATOM   507  C CG2 . VAL A 1 72  ? -36.209 -16.374 23.864 1.00 42.91  ? 102  VAL A CG2 1 
ATOM   508  N N   . VAL A 1 73  ? -39.256 -19.347 22.086 1.00 50.92  ? 103  VAL A N   1 
ATOM   509  C CA  . VAL A 1 73  ? -40.593 -19.800 21.699 1.00 52.76  ? 103  VAL A CA  1 
ATOM   510  C C   . VAL A 1 73  ? -40.912 -21.183 22.263 1.00 54.37  ? 103  VAL A C   1 
ATOM   511  O O   . VAL A 1 73  ? -41.971 -21.386 22.857 1.00 56.46  ? 103  VAL A O   1 
ATOM   512  C CB  . VAL A 1 73  ? -40.798 -19.765 20.157 1.00 51.92  ? 103  VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 73  ? -42.036 -20.545 19.747 1.00 51.74  ? 103  VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 73  ? -40.901 -18.331 19.678 1.00 50.83  ? 103  VAL A CG2 1 
ATOM   515  N N   . ARG A 1 74  ? -39.985 -22.118 22.097 1.00 54.73  ? 104  ARG A N   1 
ATOM   516  C CA  . ARG A 1 74  ? -40.239 -23.517 22.441 1.00 53.33  ? 104  ARG A CA  1 
ATOM   517  C C   . ARG A 1 74  ? -39.823 -23.956 23.850 1.00 51.64  ? 104  ARG A C   1 
ATOM   518  O O   . ARG A 1 74  ? -40.117 -25.072 24.252 1.00 51.24  ? 104  ARG A O   1 
ATOM   519  C CB  . ARG A 1 74  ? -39.599 -24.429 21.396 1.00 54.41  ? 104  ARG A CB  1 
ATOM   520  C CG  . ARG A 1 74  ? -40.114 -24.205 19.970 1.00 58.96  ? 104  ARG A CG  1 
ATOM   521  C CD  . ARG A 1 74  ? -41.526 -24.770 19.741 1.00 66.32  ? 104  ARG A CD  1 
ATOM   522  N NE  . ARG A 1 74  ? -41.595 -26.189 20.081 1.00 70.72  ? 104  ARG A NE  1 
ATOM   523  C CZ  . ARG A 1 74  ? -41.458 -27.184 19.211 1.00 73.62  ? 104  ARG A CZ  1 
ATOM   524  N NH1 . ARG A 1 74  ? -41.264 -26.929 17.918 1.00 72.85  ? 104  ARG A NH1 1 
ATOM   525  N NH2 . ARG A 1 74  ? -41.524 -28.441 19.639 1.00 73.66  ? 104  ARG A NH2 1 
ATOM   526  N N   . GLY A 1 75  ? -39.138 -23.092 24.591 1.00 52.15  ? 105  GLY A N   1 
ATOM   527  C CA  . GLY A 1 75  ? -38.771 -23.401 25.971 1.00 51.31  ? 105  GLY A CA  1 
ATOM   528  C C   . GLY A 1 75  ? -37.624 -24.376 26.197 1.00 50.93  ? 105  GLY A C   1 
ATOM   529  O O   . GLY A 1 75  ? -37.274 -24.636 27.345 1.00 52.41  ? 105  GLY A O   1 
ATOM   530  N N   . THR A 1 76  ? -37.049 -24.935 25.131 1.00 49.71  ? 106  THR A N   1 
ATOM   531  C CA  . THR A 1 76  ? -35.780 -25.699 25.237 1.00 49.85  ? 106  THR A CA  1 
ATOM   532  C C   . THR A 1 76  ? -34.831 -25.571 24.035 1.00 48.31  ? 106  THR A C   1 
ATOM   533  O O   . THR A 1 76  ? -35.199 -25.037 22.981 1.00 48.18  ? 106  THR A O   1 
ATOM   534  C CB  . THR A 1 76  ? -35.997 -27.214 25.477 1.00 49.95  ? 106  THR A CB  1 
ATOM   535  O OG1 . THR A 1 76  ? -36.802 -27.753 24.422 1.00 48.03  ? 106  THR A OG1 1 
ATOM   536  C CG2 . THR A 1 76  ? -36.645 -27.480 26.844 1.00 53.45  ? 106  THR A CG2 1 
ATOM   537  N N   . TRP A 1 77  ? -33.614 -26.087 24.200 1.00 46.19  ? 107  TRP A N   1 
ATOM   538  C CA  . TRP A 1 77  ? -32.657 -26.111 23.113 1.00 44.20  ? 107  TRP A CA  1 
ATOM   539  C C   . TRP A 1 77  ? -32.851 -27.374 22.309 1.00 43.33  ? 107  TRP A C   1 
ATOM   540  O O   . TRP A 1 77  ? -32.618 -28.467 22.809 1.00 43.48  ? 107  TRP A O   1 
ATOM   541  C CB  . TRP A 1 77  ? -31.203 -25.998 23.612 1.00 43.19  ? 107  TRP A CB  1 
ATOM   542  C CG  . TRP A 1 77  ? -30.219 -25.935 22.448 1.00 38.90  ? 107  TRP A CG  1 
ATOM   543  C CD1 . TRP A 1 77  ? -29.483 -26.964 21.947 1.00 37.01  ? 107  TRP A CD1 1 
ATOM   544  C CD2 . TRP A 1 77  ? -29.925 -24.795 21.624 1.00 36.60  ? 107  TRP A CD2 1 
ATOM   545  N NE1 . TRP A 1 77  ? -28.733 -26.537 20.872 1.00 38.49  ? 107  TRP A NE1 1 
ATOM   546  C CE2 . TRP A 1 77  ? -28.986 -25.213 20.650 1.00 34.84  ? 107  TRP A CE2 1 
ATOM   547  C CE3 . TRP A 1 77  ? -30.361 -23.466 21.614 1.00 35.49  ? 107  TRP A CE3 1 
ATOM   548  C CZ2 . TRP A 1 77  ? -28.469 -24.351 19.682 1.00 31.86  ? 107  TRP A CZ2 1 
ATOM   549  C CZ3 . TRP A 1 77  ? -29.834 -22.603 20.647 1.00 36.64  ? 107  TRP A CZ3 1 
ATOM   550  C CH2 . TRP A 1 77  ? -28.896 -23.055 19.699 1.00 34.32  ? 107  TRP A CH2 1 
ATOM   551  N N   . LEU A 1 78  ? -33.249 -27.212 21.054 1.00 44.30  ? 108  LEU A N   1 
ATOM   552  C CA  . LEU A 1 78  ? -33.603 -28.346 20.192 1.00 46.31  ? 108  LEU A CA  1 
ATOM   553  C C   . LEU A 1 78  ? -32.479 -28.919 19.333 1.00 47.27  ? 108  LEU A C   1 
ATOM   554  O O   . LEU A 1 78  ? -32.690 -29.901 18.617 1.00 47.14  ? 108  LEU A O   1 
ATOM   555  C CB  . LEU A 1 78  ? -34.745 -27.949 19.245 1.00 47.33  ? 108  LEU A CB  1 
ATOM   556  C CG  . LEU A 1 78  ? -36.073 -27.436 19.823 1.00 50.75  ? 108  LEU A CG  1 
ATOM   557  C CD1 . LEU A 1 78  ? -36.976 -26.987 18.691 1.00 49.66  ? 108  LEU A CD1 1 
ATOM   558  C CD2 . LEU A 1 78  ? -36.784 -28.479 20.717 1.00 49.75  ? 108  LEU A CD2 1 
ATOM   559  N N   . TRP A 1 79  ? -31.288 -28.328 19.393 1.00 46.96  ? 109  TRP A N   1 
ATOM   560  C CA  . TRP A 1 79  ? -30.327 -28.519 18.300 1.00 45.50  ? 109  TRP A CA  1 
ATOM   561  C C   . TRP A 1 79  ? -29.069 -29.317 18.645 1.00 43.74  ? 109  TRP A C   1 
ATOM   562  O O   . TRP A 1 79  ? -28.200 -29.507 17.795 1.00 42.66  ? 109  TRP A O   1 
ATOM   563  C CB  . TRP A 1 79  ? -29.978 -27.164 17.675 1.00 46.43  ? 109  TRP A CB  1 
ATOM   564  C CG  . TRP A 1 79  ? -31.197 -26.325 17.376 1.00 48.71  ? 109  TRP A CG  1 
ATOM   565  C CD1 . TRP A 1 79  ? -31.611 -25.191 18.033 1.00 48.59  ? 109  TRP A CD1 1 
ATOM   566  C CD2 . TRP A 1 79  ? -32.168 -26.572 16.359 1.00 50.74  ? 109  TRP A CD2 1 
ATOM   567  N NE1 . TRP A 1 79  ? -32.770 -24.707 17.466 1.00 46.22  ? 109  TRP A NE1 1 
ATOM   568  C CE2 . TRP A 1 79  ? -33.135 -25.537 16.438 1.00 50.38  ? 109  TRP A CE2 1 
ATOM   569  C CE3 . TRP A 1 79  ? -32.315 -27.564 15.377 1.00 53.08  ? 109  TRP A CE3 1 
ATOM   570  C CZ2 . TRP A 1 79  ? -34.241 -25.475 15.574 1.00 51.87  ? 109  TRP A CZ2 1 
ATOM   571  C CZ3 . TRP A 1 79  ? -33.413 -27.499 14.514 1.00 51.88  ? 109  TRP A CZ3 1 
ATOM   572  C CH2 . TRP A 1 79  ? -34.360 -26.460 14.623 1.00 52.15  ? 109  TRP A CH2 1 
ATOM   573  N N   . GLY A 1 80  ? -28.981 -29.794 19.882 1.00 42.86  ? 110  GLY A N   1 
ATOM   574  C CA  . GLY A 1 80  ? -27.821 -30.563 20.325 1.00 42.54  ? 110  GLY A CA  1 
ATOM   575  C C   . GLY A 1 80  ? -26.652 -29.722 20.825 1.00 44.15  ? 110  GLY A C   1 
ATOM   576  O O   . GLY A 1 80  ? -26.652 -28.485 20.725 1.00 45.01  ? 110  GLY A O   1 
ATOM   577  N N   . SER A 1 81  ? -25.644 -30.407 21.357 1.00 43.67  ? 111  SER A N   1 
ATOM   578  C CA  . SER A 1 81  ? -24.509 -29.770 22.013 1.00 43.08  ? 111  SER A CA  1 
ATOM   579  C C   . SER A 1 81  ? -23.624 -28.915 21.132 1.00 43.22  ? 111  SER A C   1 
ATOM   580  O O   . SER A 1 81  ? -23.337 -27.774 21.491 1.00 44.04  ? 111  SER A O   1 
ATOM   581  C CB  . SER A 1 81  ? -23.659 -30.814 22.697 1.00 42.79  ? 111  SER A CB  1 
ATOM   582  O OG  . SER A 1 81  ? -24.172 -31.030 23.988 1.00 48.93  ? 111  SER A OG  1 
ATOM   583  N N   . PHE A 1 82  ? -23.180 -29.462 20.002 1.00 43.41  ? 112  PHE A N   1 
ATOM   584  C CA  . PHE A 1 82  ? -22.290 -28.738 19.094 1.00 43.70  ? 112  PHE A CA  1 
ATOM   585  C C   . PHE A 1 82  ? -22.847 -27.359 18.710 1.00 43.46  ? 112  PHE A C   1 
ATOM   586  O O   . PHE A 1 82  ? -22.227 -26.322 19.003 1.00 43.76  ? 112  PHE A O   1 
ATOM   587  C CB  . PHE A 1 82  ? -21.967 -29.563 17.845 1.00 42.93  ? 112  PHE A CB  1 
ATOM   588  C CG  . PHE A 1 82  ? -21.127 -28.825 16.845 1.00 46.67  ? 112  PHE A CG  1 
ATOM   589  C CD1 . PHE A 1 82  ? -19.793 -28.503 17.131 1.00 45.26  ? 112  PHE A CD1 1 
ATOM   590  C CD2 . PHE A 1 82  ? -21.665 -28.436 15.620 1.00 48.22  ? 112  PHE A CD2 1 
ATOM   591  C CE1 . PHE A 1 82  ? -19.009 -27.806 16.211 1.00 43.33  ? 112  PHE A CE1 1 
ATOM   592  C CE2 . PHE A 1 82  ? -20.883 -27.743 14.685 1.00 49.38  ? 112  PHE A CE2 1 
ATOM   593  C CZ  . PHE A 1 82  ? -19.550 -27.427 14.987 1.00 45.72  ? 112  PHE A CZ  1 
ATOM   594  N N   . LEU A 1 83  ? -24.023 -27.355 18.086 1.00 42.85  ? 113  LEU A N   1 
ATOM   595  C CA  . LEU A 1 83  ? -24.661 -26.117 17.625 1.00 41.38  ? 113  LEU A CA  1 
ATOM   596  C C   . LEU A 1 83  ? -24.918 -25.101 18.738 1.00 39.46  ? 113  LEU A C   1 
ATOM   597  O O   . LEU A 1 83  ? -24.961 -23.897 18.479 1.00 38.94  ? 113  LEU A O   1 
ATOM   598  C CB  . LEU A 1 83  ? -25.951 -26.419 16.853 1.00 40.57  ? 113  LEU A CB  1 
ATOM   599  C CG  . LEU A 1 83  ? -25.748 -27.134 15.508 1.00 43.04  ? 113  LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 83  ? -27.084 -27.598 14.933 1.00 44.34  ? 113  LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 83  ? -25.006 -26.251 14.500 1.00 41.80  ? 113  LEU A CD2 1 
ATOM   602  N N   . CYS A 1 84  ? -25.076 -25.585 19.965 1.00 37.84  ? 114  CYS A N   1 
ATOM   603  C CA  . CYS A 1 84  ? -25.316 -24.720 21.110 1.00 37.56  ? 114  CYS A CA  1 
ATOM   604  C C   . CYS A 1 84  ? -24.055 -23.928 21.394 1.00 39.09  ? 114  CYS A C   1 
ATOM   605  O O   . CYS A 1 84  ? -24.116 -22.724 21.667 1.00 38.86  ? 114  CYS A O   1 
ATOM   606  C CB  . CYS A 1 84  ? -25.729 -25.563 22.316 1.00 37.14  ? 114  CYS A CB  1 
ATOM   607  S SG  . CYS A 1 84  ? -25.600 -24.795 23.926 1.00 43.28  ? 114  CYS A SG  1 
ATOM   608  N N   . GLU A 1 85  ? -22.913 -24.615 21.307 1.00 39.51  ? 115  GLU A N   1 
ATOM   609  C CA  . GLU A 1 85  ? -21.614 -23.993 21.479 1.00 38.86  ? 115  GLU A CA  1 
ATOM   610  C C   . GLU A 1 85  ? -21.273 -23.093 20.308 1.00 34.91  ? 115  GLU A C   1 
ATOM   611  O O   . GLU A 1 85  ? -20.760 -22.006 20.525 1.00 33.03  ? 115  GLU A O   1 
ATOM   612  C CB  . GLU A 1 85  ? -20.526 -25.044 21.691 1.00 42.21  ? 115  GLU A CB  1 
ATOM   613  C CG  . GLU A 1 85  ? -20.639 -25.767 23.031 1.00 49.41  ? 115  GLU A CG  1 
ATOM   614  C CD  . GLU A 1 85  ? -19.632 -26.891 23.190 1.00 58.96  ? 115  GLU A CD  1 
ATOM   615  O OE1 . GLU A 1 85  ? -18.724 -27.031 22.336 1.00 69.41  ? 115  GLU A OE1 1 
ATOM   616  O OE2 . GLU A 1 85  ? -19.749 -27.637 24.181 1.00 59.45  ? 115  GLU A OE2 1 
ATOM   617  N N   . LEU A 1 86  ? -21.562 -23.540 19.083 1.00 32.55  ? 116  LEU A N   1 
ATOM   618  C CA  . LEU A 1 86  ? -21.356 -22.708 17.900 1.00 33.14  ? 116  LEU A CA  1 
ATOM   619  C C   . LEU A 1 86  ? -22.208 -21.444 18.009 1.00 34.31  ? 116  LEU A C   1 
ATOM   620  O O   . LEU A 1 86  ? -21.729 -20.336 17.740 1.00 37.57  ? 116  LEU A O   1 
ATOM   621  C CB  . LEU A 1 86  ? -21.644 -23.474 16.600 1.00 32.66  ? 116  LEU A CB  1 
ATOM   622  C CG  . LEU A 1 86  ? -21.400 -22.765 15.256 1.00 35.87  ? 116  LEU A CG  1 
ATOM   623  C CD1 . LEU A 1 86  ? -19.942 -22.394 15.078 1.00 35.86  ? 116  LEU A CD1 1 
ATOM   624  C CD2 . LEU A 1 86  ? -21.882 -23.587 14.045 1.00 35.81  ? 116  LEU A CD2 1 
ATOM   625  N N   . TRP A 1 87  ? -23.453 -21.606 18.442 1.00 32.51  ? 117  TRP A N   1 
ATOM   626  C CA  . TRP A 1 87  ? -24.371 -20.487 18.556 1.00 31.64  ? 117  TRP A CA  1 
ATOM   627  C C   . TRP A 1 87  ? -23.839 -19.467 19.562 1.00 32.14  ? 117  TRP A C   1 
ATOM   628  O O   . TRP A 1 87  ? -23.871 -18.260 19.333 1.00 33.00  ? 117  TRP A O   1 
ATOM   629  C CB  . TRP A 1 87  ? -25.799 -20.980 18.902 1.00 31.63  ? 117  TRP A CB  1 
ATOM   630  C CG  . TRP A 1 87  ? -26.759 -19.870 19.206 1.00 26.89  ? 117  TRP A CG  1 
ATOM   631  C CD1 . TRP A 1 87  ? -27.204 -18.900 18.337 1.00 24.31  ? 117  TRP A CD1 1 
ATOM   632  C CD2 . TRP A 1 87  ? -27.361 -19.586 20.475 1.00 25.60  ? 117  TRP A CD2 1 
ATOM   633  N NE1 . TRP A 1 87  ? -28.040 -18.027 18.999 1.00 27.28  ? 117  TRP A NE1 1 
ATOM   634  C CE2 . TRP A 1 87  ? -28.155 -18.425 20.311 1.00 27.04  ? 117  TRP A CE2 1 
ATOM   635  C CE3 . TRP A 1 87  ? -27.315 -20.205 21.734 1.00 29.36  ? 117  TRP A CE3 1 
ATOM   636  C CZ2 . TRP A 1 87  ? -28.900 -17.872 21.361 1.00 26.43  ? 117  TRP A CZ2 1 
ATOM   637  C CZ3 . TRP A 1 87  ? -28.056 -19.651 22.790 1.00 28.56  ? 117  TRP A CZ3 1 
ATOM   638  C CH2 . TRP A 1 87  ? -28.838 -18.498 22.592 1.00 28.05  ? 117  TRP A CH2 1 
ATOM   639  N N   . THR A 1 88  ? -23.337 -19.968 20.677 1.00 32.89  ? 118  THR A N   1 
ATOM   640  C CA  . THR A 1 88  ? -22.722 -19.137 21.695 1.00 31.66  ? 118  THR A CA  1 
ATOM   641  C C   . THR A 1 88  ? -21.522 -18.387 21.124 1.00 31.62  ? 118  THR A C   1 
ATOM   642  O O   . THR A 1 88  ? -21.408 -17.183 21.307 1.00 29.32  ? 118  THR A O   1 
ATOM   643  C CB  . THR A 1 88  ? -22.271 -20.009 22.858 1.00 32.46  ? 118  THR A CB  1 
ATOM   644  O OG1 . THR A 1 88  ? -23.424 -20.586 23.478 1.00 35.87  ? 118  THR A OG1 1 
ATOM   645  C CG2 . THR A 1 88  ? -21.548 -19.188 23.861 1.00 37.99  ? 118  THR A CG2 1 
ATOM   646  N N   . SER A 1 89  ? -20.631 -19.126 20.447 1.00 33.59  ? 119  SER A N   1 
ATOM   647  C CA  . SER A 1 89  ? -19.464 -18.588 19.746 1.00 33.14  ? 119  SER A CA  1 
ATOM   648  C C   . SER A 1 89  ? -19.824 -17.405 18.871 1.00 33.84  ? 119  SER A C   1 
ATOM   649  O O   . SER A 1 89  ? -19.210 -16.331 18.975 1.00 34.29  ? 119  SER A O   1 
ATOM   650  C CB  . SER A 1 89  ? -18.852 -19.658 18.858 1.00 32.16  ? 119  SER A CB  1 
ATOM   651  O OG  . SER A 1 89  ? -18.017 -20.487 19.617 1.00 39.69  ? 119  SER A OG  1 
ATOM   652  N N   . LEU A 1 90  ? -20.818 -17.610 18.007 1.00 32.92  ? 120  LEU A N   1 
ATOM   653  C CA  . LEU A 1 90  ? -21.270 -16.574 17.083 1.00 31.42  ? 120  LEU A CA  1 
ATOM   654  C C   . LEU A 1 90  ? -21.831 -15.334 17.786 1.00 30.75  ? 120  LEU A C   1 
ATOM   655  O O   . LEU A 1 90  ? -21.661 -14.214 17.299 1.00 31.78  ? 120  LEU A O   1 
ATOM   656  C CB  . LEU A 1 90  ? -22.295 -17.148 16.120 1.00 32.14  ? 120  LEU A CB  1 
ATOM   657  C CG  . LEU A 1 90  ? -21.760 -18.177 15.129 1.00 32.34  ? 120  LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 90  ? -22.933 -18.779 14.345 1.00 35.00  ? 120  LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 90  ? -20.738 -17.527 14.194 1.00 28.45  ? 120  LEU A CD2 1 
ATOM   660  N N   . ASP A 1 91  ? -22.488 -15.523 18.929 1.00 28.45  ? 121  ASP A N   1 
ATOM   661  C CA  . ASP A 1 91  ? -23.012 -14.384 19.700 1.00 27.58  ? 121  ASP A CA  1 
ATOM   662  C C   . ASP A 1 91  ? -21.851 -13.509 20.194 1.00 27.59  ? 121  ASP A C   1 
ATOM   663  O O   . ASP A 1 91  ? -21.843 -12.299 19.958 1.00 28.51  ? 121  ASP A O   1 
ATOM   664  C CB  . ASP A 1 91  ? -23.889 -14.882 20.863 1.00 24.68  ? 121  ASP A CB  1 
ATOM   665  C CG  . ASP A 1 91  ? -24.609 -13.752 21.623 1.00 30.81  ? 121  ASP A CG  1 
ATOM   666  O OD1 . ASP A 1 91  ? -24.461 -12.539 21.331 1.00 32.35  ? 121  ASP A OD1 1 
ATOM   667  O OD2 . ASP A 1 91  ? -25.356 -14.091 22.559 1.00 37.24  ? 121  ASP A OD2 1 
ATOM   668  N N   . VAL A 1 92  ? -20.870 -14.132 20.861 1.00 27.73  ? 122  VAL A N   1 
ATOM   669  C CA  . VAL A 1 92  ? -19.662 -13.439 21.314 1.00 26.00  ? 122  VAL A CA  1 
ATOM   670  C C   . VAL A 1 92  ? -18.929 -12.799 20.122 1.00 26.36  ? 122  VAL A C   1 
ATOM   671  O O   . VAL A 1 92  ? -18.530 -11.628 20.202 1.00 25.66  ? 122  VAL A O   1 
ATOM   672  C CB  . VAL A 1 92  ? -18.704 -14.358 22.159 1.00 24.98  ? 122  VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 92  ? -17.498 -13.568 22.660 1.00 22.18  ? 122  VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 92  ? -19.437 -14.986 23.362 1.00 23.45  ? 122  VAL A CG2 1 
ATOM   675  N N   . LEU A 1 93  ? -18.793 -13.543 19.022 1.00 24.54  ? 123  LEU A N   1 
ATOM   676  C CA  . LEU A 1 93  ? -18.114 -13.036 17.837 1.00 27.19  ? 123  LEU A CA  1 
ATOM   677  C C   . LEU A 1 93  ? -18.661 -11.697 17.356 1.00 30.27  ? 123  LEU A C   1 
ATOM   678  O O   . LEU A 1 93  ? -17.911 -10.719 17.228 1.00 32.46  ? 123  LEU A O   1 
ATOM   679  C CB  . LEU A 1 93  ? -18.144 -14.053 16.694 1.00 26.66  ? 123  LEU A CB  1 
ATOM   680  C CG  . LEU A 1 93  ? -17.542 -13.496 15.406 1.00 28.68  ? 123  LEU A CG  1 
ATOM   681  C CD1 . LEU A 1 93  ? -16.016 -13.329 15.564 1.00 24.16  ? 123  LEU A CD1 1 
ATOM   682  C CD2 . LEU A 1 93  ? -17.918 -14.344 14.177 1.00 29.11  ? 123  LEU A CD2 1 
ATOM   683  N N   . CYS A 1 94  ? -19.970 -11.646 17.109 1.00 33.74  ? 124  CYS A N   1 
ATOM   684  C CA  . CYS A 1 94  ? -20.623 -10.449 16.538 1.00 33.11  ? 124  CYS A CA  1 
ATOM   685  C C   . CYS A 1 94  ? -20.525 -9.174  17.383 1.00 34.21  ? 124  CYS A C   1 
ATOM   686  O O   . CYS A 1 94  ? -20.225 -8.085  16.858 1.00 36.98  ? 124  CYS A O   1 
ATOM   687  C CB  . CYS A 1 94  ? -22.062 -10.752 16.187 1.00 30.53  ? 124  CYS A CB  1 
ATOM   688  S SG  . CYS A 1 94  ? -22.195 -11.937 14.826 1.00 34.95  ? 124  CYS A SG  1 
ATOM   689  N N   . VAL A 1 95  ? -20.748 -9.287  18.686 1.00 32.02  ? 125  VAL A N   1 
ATOM   690  C CA  . VAL A 1 95  ? -20.625 -8.090  19.511 1.00 31.64  ? 125  VAL A CA  1 
ATOM   691  C C   . VAL A 1 95  ? -19.159 -7.621  19.557 1.00 29.64  ? 125  VAL A C   1 
ATOM   692  O O   . VAL A 1 95  ? -18.899 -6.421  19.482 1.00 28.85  ? 125  VAL A O   1 
ATOM   693  C CB  . VAL A 1 95  ? -21.309 -8.241  20.908 1.00 31.81  ? 125  VAL A CB  1 
ATOM   694  C CG1 . VAL A 1 95  ? -20.672 -9.345  21.725 1.00 36.80  ? 125  VAL A CG1 1 
ATOM   695  C CG2 . VAL A 1 95  ? -21.299 -6.920  21.669 1.00 34.27  ? 125  VAL A CG2 1 
ATOM   696  N N   . THR A 1 96  ? -18.222 -8.575  19.631 1.00 28.06  ? 126  THR A N   1 
ATOM   697  C CA  . THR A 1 96  ? -16.779 -8.295  19.596 1.00 27.53  ? 126  THR A CA  1 
ATOM   698  C C   . THR A 1 96  ? -16.380 -7.571  18.280 1.00 25.47  ? 126  THR A C   1 
ATOM   699  O O   . THR A 1 96  ? -15.809 -6.465  18.318 1.00 23.34  ? 126  THR A O   1 
ATOM   700  C CB  . THR A 1 96  ? -15.933 -9.589  19.832 1.00 29.49  ? 126  THR A CB  1 
ATOM   701  O OG1 . THR A 1 96  ? -16.323 -10.215 21.067 1.00 28.47  ? 126  THR A OG1 1 
ATOM   702  C CG2 . THR A 1 96  ? -14.441 -9.274  19.879 1.00 26.83  ? 126  THR A CG2 1 
ATOM   703  N N   . ALA A 1 97  ? -16.736 -8.166  17.138 1.00 23.47  ? 127  ALA A N   1 
ATOM   704  C CA  . ALA A 1 97  ? -16.487 -7.558  15.825 1.00 23.71  ? 127  ALA A CA  1 
ATOM   705  C C   . ALA A 1 97  ? -17.160 -6.195  15.644 1.00 25.84  ? 127  ALA A C   1 
ATOM   706  O O   . ALA A 1 97  ? -16.592 -5.301  14.995 1.00 26.61  ? 127  ALA A O   1 
ATOM   707  C CB  . ALA A 1 97  ? -16.894 -8.483  14.724 1.00 22.96  ? 127  ALA A CB  1 
ATOM   708  N N   . SER A 1 98  ? -18.354 -6.024  16.220 1.00 27.30  ? 128  SER A N   1 
ATOM   709  C CA  . SER A 1 98  ? -19.047 -4.728  16.152 1.00 27.06  ? 128  SER A CA  1 
ATOM   710  C C   . SER A 1 98  ? -18.310 -3.616  16.875 1.00 28.35  ? 128  SER A C   1 
ATOM   711  O O   . SER A 1 98  ? -18.002 -2.592  16.276 1.00 30.55  ? 128  SER A O   1 
ATOM   712  C CB  . SER A 1 98  ? -20.461 -4.828  16.664 1.00 25.48  ? 128  SER A CB  1 
ATOM   713  O OG  . SER A 1 98  ? -21.264 -5.506  15.722 1.00 34.49  ? 128  SER A OG  1 
ATOM   714  N N   . ILE A 1 99  ? -17.992 -3.820  18.147 1.00 30.05  ? 129  ILE A N   1 
ATOM   715  C CA  . ILE A 1 99  ? -17.315 -2.778  18.938 1.00 31.20  ? 129  ILE A CA  1 
ATOM   716  C C   . ILE A 1 99  ? -15.890 -2.485  18.405 1.00 31.32  ? 129  ILE A C   1 
ATOM   717  O O   . ILE A 1 99  ? -15.472 -1.335  18.340 1.00 29.66  ? 129  ILE A O   1 
ATOM   718  C CB  . ILE A 1 99  ? -17.388 -3.076  20.477 1.00 29.83  ? 129  ILE A CB  1 
ATOM   719  C CG1 . ILE A 1 99  ? -16.917 -1.893  21.339 1.00 30.44  ? 129  ILE A CG1 1 
ATOM   720  C CG2 . ILE A 1 99  ? -16.637 -4.315  20.816 1.00 29.59  ? 129  ILE A CG2 1 
ATOM   721  C CD1 . ILE A 1 99  ? -17.533 -0.545  20.988 1.00 30.45  ? 129  ILE A CD1 1 
ATOM   722  N N   . GLU A 1 100 ? -15.191 -3.520  17.948 1.00 32.99  ? 130  GLU A N   1 
ATOM   723  C CA  . GLU A 1 100 ? -13.875 -3.336  17.354 1.00 35.07  ? 130  GLU A CA  1 
ATOM   724  C C   . GLU A 1 100 ? -13.927 -2.540  16.057 1.00 37.12  ? 130  GLU A C   1 
ATOM   725  O O   . GLU A 1 100 ? -13.078 -1.679  15.815 1.00 39.25  ? 130  GLU A O   1 
ATOM   726  C CB  . GLU A 1 100 ? -13.192 -4.679  17.128 1.00 36.10  ? 130  GLU A CB  1 
ATOM   727  C CG  . GLU A 1 100 ? -12.689 -5.327  18.403 1.00 35.42  ? 130  GLU A CG  1 
ATOM   728  C CD  . GLU A 1 100 ? -11.797 -6.518  18.135 1.00 40.93  ? 130  GLU A CD  1 
ATOM   729  O OE1 . GLU A 1 100 ? -11.066 -6.507  17.121 1.00 42.57  ? 130  GLU A OE1 1 
ATOM   730  O OE2 . GLU A 1 100 ? -11.804 -7.468  18.951 1.00 41.91  ? 130  GLU A OE2 1 
ATOM   731  N N   . THR A 1 101 ? -14.934 -2.815  15.231 1.00 36.35  ? 131  THR A N   1 
ATOM   732  C CA  . THR A 1 101 ? -15.132 -2.052  14.008 1.00 34.14  ? 131  THR A CA  1 
ATOM   733  C C   . THR A 1 101 ? -15.450 -0.594  14.339 1.00 35.41  ? 131  THR A C   1 
ATOM   734  O O   . THR A 1 101 ? -14.907 0.313   13.717 1.00 38.87  ? 131  THR A O   1 
ATOM   735  C CB  . THR A 1 101 ? -16.205 -2.692  13.144 1.00 32.93  ? 131  THR A CB  1 
ATOM   736  O OG1 . THR A 1 101 ? -15.822 -4.043  12.883 1.00 31.90  ? 131  THR A OG1 1 
ATOM   737  C CG2 . THR A 1 101 ? -16.356 -1.977  11.830 1.00 33.08  ? 131  THR A CG2 1 
ATOM   738  N N   . LEU A 1 102 ? -16.296 -0.361  15.337 1.00 35.67  ? 132  LEU A N   1 
ATOM   739  C CA  . LEU A 1 102 ? -16.636 1.020   15.721 1.00 35.33  ? 132  LEU A CA  1 
ATOM   740  C C   . LEU A 1 102 ? -15.412 1.816   16.145 1.00 34.92  ? 132  LEU A C   1 
ATOM   741  O O   . LEU A 1 102 ? -15.321 2.998   15.825 1.00 35.14  ? 132  LEU A O   1 
ATOM   742  C CB  . LEU A 1 102 ? -17.721 1.081   16.808 1.00 32.73  ? 132  LEU A CB  1 
ATOM   743  C CG  . LEU A 1 102 ? -19.109 0.595   16.369 1.00 31.35  ? 132  LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 102 ? -20.039 0.338   17.576 1.00 29.54  ? 132  LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 102 ? -19.755 1.528   15.345 1.00 28.00  ? 132  LEU A CD2 1 
ATOM   746  N N   . CYS A 1 103 ? -14.488 1.169   16.859 1.00 35.34  ? 133  CYS A N   1 
ATOM   747  C CA  . CYS A 1 103 ? -13.186 1.774   17.188 1.00 37.25  ? 133  CYS A CA  1 
ATOM   748  C C   . CYS A 1 103 ? -12.426 2.209   15.944 1.00 35.25  ? 133  CYS A C   1 
ATOM   749  O O   . CYS A 1 103 ? -12.031 3.365   15.833 1.00 35.29  ? 133  CYS A O   1 
ATOM   750  C CB  . CYS A 1 103 ? -12.320 0.812   17.980 1.00 36.87  ? 133  CYS A CB  1 
ATOM   751  S SG  . CYS A 1 103 ? -12.664 0.895   19.691 1.00 46.40  ? 133  CYS A SG  1 
ATOM   752  N N   . VAL A 1 104 ? -12.242 1.274   15.021 1.00 32.39  ? 134  VAL A N   1 
ATOM   753  C CA  . VAL A 1 104 ? -11.603 1.560   13.761 1.00 34.58  ? 134  VAL A CA  1 
ATOM   754  C C   . VAL A 1 104 ? -12.233 2.781   13.063 1.00 35.08  ? 134  VAL A C   1 
ATOM   755  O O   . VAL A 1 104 ? -11.504 3.692   12.671 1.00 36.59  ? 134  VAL A O   1 
ATOM   756  C CB  . VAL A 1 104 ? -11.577 0.303   12.849 1.00 34.78  ? 134  VAL A CB  1 
ATOM   757  C CG1 . VAL A 1 104 ? -11.161 0.672   11.422 1.00 34.25  ? 134  VAL A CG1 1 
ATOM   758  C CG2 . VAL A 1 104 ? -10.646 -0.765  13.443 1.00 28.89  ? 134  VAL A CG2 1 
ATOM   759  N N   . ILE A 1 105 ? -13.565 2.800   12.938 1.00 34.48  ? 135  ILE A N   1 
ATOM   760  C CA  . ILE A 1 105 ? -14.311 3.940   12.350 1.00 34.20  ? 135  ILE A CA  1 
ATOM   761  C C   . ILE A 1 105 ? -13.978 5.262   13.047 1.00 33.43  ? 135  ILE A C   1 
ATOM   762  O O   . ILE A 1 105 ? -13.767 6.280   12.389 1.00 33.83  ? 135  ILE A O   1 
ATOM   763  C CB  . ILE A 1 105 ? -15.856 3.703   12.371 1.00 33.43  ? 135  ILE A CB  1 
ATOM   764  C CG1 . ILE A 1 105 ? -16.255 2.696   11.299 1.00 33.68  ? 135  ILE A CG1 1 
ATOM   765  C CG2 . ILE A 1 105 ? -16.632 4.999   12.156 1.00 35.19  ? 135  ILE A CG2 1 
ATOM   766  C CD1 . ILE A 1 105 ? -17.635 2.038   11.526 1.00 38.70  ? 135  ILE A CD1 1 
ATOM   767  N N   . ALA A 1 106 ? -13.928 5.239   14.376 1.00 33.08  ? 136  ALA A N   1 
ATOM   768  C CA  . ALA A 1 106 ? -13.575 6.427   15.142 1.00 34.22  ? 136  ALA A CA  1 
ATOM   769  C C   . ALA A 1 106 ? -12.126 6.841   14.861 1.00 35.82  ? 136  ALA A C   1 
ATOM   770  O O   . ALA A 1 106 ? -11.837 8.031   14.761 1.00 35.80  ? 136  ALA A O   1 
ATOM   771  C CB  . ALA A 1 106 ? -13.814 6.201   16.638 1.00 31.59  ? 136  ALA A CB  1 
ATOM   772  N N   . ILE A 1 107 ? -11.235 5.855   14.727 1.00 37.88  ? 137  ILE A N   1 
ATOM   773  C CA  . ILE A 1 107 ? -9.804  6.112   14.497 1.00 42.17  ? 137  ILE A CA  1 
ATOM   774  C C   . ILE A 1 107 ? -9.573  6.642   13.071 1.00 43.91  ? 137  ILE A C   1 
ATOM   775  O O   . ILE A 1 107 ? -8.778  7.561   12.869 1.00 45.38  ? 137  ILE A O   1 
ATOM   776  C CB  . ILE A 1 107 ? -8.919  4.863   14.813 1.00 42.10  ? 137  ILE A CB  1 
ATOM   777  C CG1 . ILE A 1 107 ? -8.813  4.672   16.324 1.00 37.64  ? 137  ILE A CG1 1 
ATOM   778  C CG2 . ILE A 1 107 ? -7.503  4.995   14.205 1.00 44.16  ? 137  ILE A CG2 1 
ATOM   779  C CD1 . ILE A 1 107 ? -8.365  3.313   16.738 1.00 36.00  ? 137  ILE A CD1 1 
ATOM   780  N N   . ASP A 1 108 ? -10.297 6.070   12.110 1.00 42.82  ? 138  ASP A N   1 
ATOM   781  C CA  . ASP A 1 108 ? -10.279 6.507   10.727 1.00 43.16  ? 138  ASP A CA  1 
ATOM   782  C C   . ASP A 1 108 ? -10.649 7.985   10.653 1.00 44.66  ? 138  ASP A C   1 
ATOM   783  O O   . ASP A 1 108 ? -9.988  8.753   9.966  1.00 42.64  ? 138  ASP A O   1 
ATOM   784  C CB  . ASP A 1 108 ? -11.259 5.649   9.926  1.00 43.90  ? 138  ASP A CB  1 
ATOM   785  C CG  . ASP A 1 108 ? -11.503 6.171   8.516  1.00 48.28  ? 138  ASP A CG  1 
ATOM   786  O OD1 . ASP A 1 108 ? -10.678 5.881   7.620  1.00 50.36  ? 138  ASP A OD1 1 
ATOM   787  O OD2 . ASP A 1 108 ? -12.538 6.844   8.301  1.00 45.14  ? 138  ASP A OD2 1 
ATOM   788  N N   . ARG A 1 109 ? -11.692 8.374   11.390 1.00 47.64  ? 139  ARG A N   1 
ATOM   789  C CA  . ARG A 1 109 ? -12.203 9.748   11.374 1.00 48.02  ? 139  ARG A CA  1 
ATOM   790  C C   . ARG A 1 109 ? -11.278 10.721  12.077 1.00 49.34  ? 139  ARG A C   1 
ATOM   791  O O   . ARG A 1 109 ? -11.166 11.867  11.657 1.00 51.06  ? 139  ARG A O   1 
ATOM   792  C CB  . ARG A 1 109 ? -13.605 9.832   11.991 1.00 47.11  ? 139  ARG A CB  1 
ATOM   793  C CG  . ARG A 1 109 ? -14.720 9.185   11.166 1.00 45.26  ? 139  ARG A CG  1 
ATOM   794  C CD  . ARG A 1 109 ? -14.950 9.890   9.837  1.00 39.97  ? 139  ARG A CD  1 
ATOM   795  N NE  . ARG A 1 109 ? -14.005 9.422   8.829  1.00 43.53  ? 139  ARG A NE  1 
ATOM   796  C CZ  . ARG A 1 109 ? -13.663 10.088  7.730  1.00 44.06  ? 139  ARG A CZ  1 
ATOM   797  N NH1 . ARG A 1 109 ? -14.186 11.280  7.466  1.00 46.88  ? 139  ARG A NH1 1 
ATOM   798  N NH2 . ARG A 1 109 ? -12.783 9.559   6.896  1.00 42.89  ? 139  ARG A NH2 1 
ATOM   799  N N   . TYR A 1 110 ? -10.626 10.267  13.146 1.00 50.82  ? 140  TYR A N   1 
ATOM   800  C CA  . TYR A 1 110 ? -9.669  11.098  13.880 1.00 52.24  ? 140  TYR A CA  1 
ATOM   801  C C   . TYR A 1 110 ? -8.492  11.461  12.980 1.00 53.63  ? 140  TYR A C   1 
ATOM   802  O O   . TYR A 1 110 ? -8.063  12.613  12.937 1.00 53.42  ? 140  TYR A O   1 
ATOM   803  C CB  . TYR A 1 110 ? -9.171  10.388  15.143 1.00 51.68  ? 140  TYR A CB  1 
ATOM   804  C CG  . TYR A 1 110 ? -8.205  11.220  15.954 1.00 53.77  ? 140  TYR A CG  1 
ATOM   805  C CD1 . TYR A 1 110 ? -8.661  12.273  16.748 1.00 54.77  ? 140  TYR A CD1 1 
ATOM   806  C CD2 . TYR A 1 110 ? -6.833  10.967  15.916 1.00 56.20  ? 140  TYR A CD2 1 
ATOM   807  C CE1 . TYR A 1 110 ? -7.784  13.051  17.488 1.00 55.02  ? 140  TYR A CE1 1 
ATOM   808  C CE2 . TYR A 1 110 ? -5.942  11.740  16.655 1.00 57.38  ? 140  TYR A CE2 1 
ATOM   809  C CZ  . TYR A 1 110 ? -6.429  12.782  17.441 1.00 58.52  ? 140  TYR A CZ  1 
ATOM   810  O OH  . TYR A 1 110 ? -5.564  13.563  18.177 1.00 61.31  ? 140  TYR A OH  1 
ATOM   811  N N   . LEU A 1 111 ? -7.991  10.460  12.261 1.00 55.46  ? 141  LEU A N   1 
ATOM   812  C CA  . LEU A 1 111 ? -6.908  10.625  11.315 1.00 56.87  ? 141  LEU A CA  1 
ATOM   813  C C   . LEU A 1 111 ? -7.251  11.639  10.227 1.00 57.35  ? 141  LEU A C   1 
ATOM   814  O O   . LEU A 1 111 ? -6.508  12.599  9.999  1.00 56.58  ? 141  LEU A O   1 
ATOM   815  C CB  . LEU A 1 111 ? -6.592  9.286   10.672 1.00 57.90  ? 141  LEU A CB  1 
ATOM   816  C CG  . LEU A 1 111 ? -5.096  9.043   10.500 1.00 64.25  ? 141  LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 111 ? -4.520  8.523   11.829 1.00 65.18  ? 141  LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 111 ? -4.812  8.078   9.333  1.00 65.96  ? 141  LEU A CD2 1 
ATOM   819  N N   . ALA A 1 112 ? -8.393  11.424  9.579  1.00 58.16  ? 142  ALA A N   1 
ATOM   820  C CA  . ALA A 1 112 ? -8.837  12.233  8.455  1.00 58.31  ? 142  ALA A CA  1 
ATOM   821  C C   . ALA A 1 112 ? -9.037  13.685  8.838  1.00 59.90  ? 142  ALA A C   1 
ATOM   822  O O   . ALA A 1 112 ? -8.941  14.566  7.983  1.00 62.72  ? 142  ALA A O   1 
ATOM   823  C CB  . ALA A 1 112 ? -10.120 11.666  7.882  1.00 57.68  ? 142  ALA A CB  1 
ATOM   824  N N   . ILE A 1 113 ? -9.306  13.934  10.117 1.00 59.87  ? 143  ILE A N   1 
ATOM   825  C CA  . ILE A 1 113 ? -9.627  15.278  10.594 1.00 59.76  ? 143  ILE A CA  1 
ATOM   826  C C   . ILE A 1 113 ? -8.413  16.036  11.131 1.00 60.25  ? 143  ILE A C   1 
ATOM   827  O O   . ILE A 1 113 ? -8.417  17.260  11.149 1.00 63.43  ? 143  ILE A O   1 
ATOM   828  C CB  . ILE A 1 113 ? -10.754 15.245  11.660 1.00 59.34  ? 143  ILE A CB  1 
ATOM   829  C CG1 . ILE A 1 113 ? -11.710 16.418  11.489 1.00 55.64  ? 143  ILE A CG1 1 
ATOM   830  C CG2 . ILE A 1 113 ? -10.184 15.193  13.075 1.00 61.31  ? 143  ILE A CG2 1 
ATOM   831  C CD1 . ILE A 1 113 ? -12.861 16.381  12.449 1.00 53.74  ? 143  ILE A CD1 1 
ATOM   832  N N   . THR A 1 114 ? -7.387  15.318  11.576 1.00 59.46  ? 144  THR A N   1 
ATOM   833  C CA  . THR A 1 114 ? -6.194  15.960  12.125 1.00 58.89  ? 144  THR A CA  1 
ATOM   834  C C   . THR A 1 114 ? -5.028  15.929  11.147 1.00 58.37  ? 144  THR A C   1 
ATOM   835  O O   . THR A 1 114 ? -4.186  16.816  11.176 1.00 58.17  ? 144  THR A O   1 
ATOM   836  C CB  . THR A 1 114 ? -5.732  15.324  13.459 1.00 59.80  ? 144  THR A CB  1 
ATOM   837  O OG1 . THR A 1 114 ? -5.389  13.949  13.245 1.00 59.45  ? 144  THR A OG1 1 
ATOM   838  C CG2 . THR A 1 114 ? -6.816  15.433  14.527 1.00 59.14  ? 144  THR A CG2 1 
ATOM   839  N N   . SER A 1 115 ? -4.972  14.897  10.307 1.00 58.64  ? 145  SER A N   1 
ATOM   840  C CA  . SER A 1 115 ? -3.959  14.797  9.254  1.00 59.78  ? 145  SER A CA  1 
ATOM   841  C C   . SER A 1 115 ? -4.604  14.437  7.923  1.00 59.93  ? 145  SER A C   1 
ATOM   842  O O   . SER A 1 115 ? -4.402  13.329  7.424  1.00 59.85  ? 145  SER A O   1 
ATOM   843  C CB  . SER A 1 115 ? -2.902  13.736  9.591  1.00 60.51  ? 145  SER A CB  1 
ATOM   844  O OG  . SER A 1 115 ? -2.322  13.940  10.864 1.00 63.08  ? 145  SER A OG  1 
ATOM   845  N N   . PRO A 1 116 ? -5.369  15.370  7.332  1.00 60.70  ? 146  PRO A N   1 
ATOM   846  C CA  . PRO A 1 116 ? -6.064  15.048  6.080  1.00 61.39  ? 146  PRO A CA  1 
ATOM   847  C C   . PRO A 1 116 ? -5.118  14.589  4.974  1.00 62.31  ? 146  PRO A C   1 
ATOM   848  O O   . PRO A 1 116 ? -5.492  13.739  4.167  1.00 62.79  ? 146  PRO A O   1 
ATOM   849  C CB  . PRO A 1 116 ? -6.735  16.368  5.694  1.00 61.72  ? 146  PRO A CB  1 
ATOM   850  C CG  . PRO A 1 116 ? -6.806  17.150  6.976  1.00 62.35  ? 146  PRO A CG  1 
ATOM   851  C CD  . PRO A 1 116 ? -5.593  16.767  7.745  1.00 60.35  ? 146  PRO A CD  1 
ATOM   852  N N   . PHE A 1 117 ? -3.902  15.129  4.940  1.00 63.37  ? 147  PHE A N   1 
ATOM   853  C CA  . PHE A 1 117 ? -2.952  14.736  3.898  1.00 64.84  ? 147  PHE A CA  1 
ATOM   854  C C   . PHE A 1 117 ? -2.189  13.444  4.219  1.00 63.63  ? 147  PHE A C   1 
ATOM   855  O O   . PHE A 1 117 ? -1.990  12.603  3.338  1.00 63.18  ? 147  PHE A O   1 
ATOM   856  C CB  . PHE A 1 117 ? -1.996  15.881  3.507  1.00 66.40  ? 147  PHE A CB  1 
ATOM   857  C CG  . PHE A 1 117 ? -1.238  15.616  2.228  1.00 70.39  ? 147  PHE A CG  1 
ATOM   858  C CD1 . PHE A 1 117 ? -1.884  15.678  0.992  1.00 71.86  ? 147  PHE A CD1 1 
ATOM   859  C CD2 . PHE A 1 117 ? 0.116   15.268  2.259  1.00 73.77  ? 147  PHE A CD2 1 
ATOM   860  C CE1 . PHE A 1 117 ? -1.189  15.411  -0.201 1.00 75.22  ? 147  PHE A CE1 1 
ATOM   861  C CE2 . PHE A 1 117 ? 0.822   15.000  1.070  1.00 74.93  ? 147  PHE A CE2 1 
ATOM   862  C CZ  . PHE A 1 117 ? 0.167   15.075  -0.162 1.00 74.13  ? 147  PHE A CZ  1 
ATOM   863  N N   . ARG A 1 118 ? -1.759  13.290  5.469  1.00 63.05  ? 148  ARG A N   1 
ATOM   864  C CA  . ARG A 1 118 ? -1.145  12.040  5.902  1.00 62.84  ? 148  ARG A CA  1 
ATOM   865  C C   . ARG A 1 118 ? -2.151  10.894  5.766  1.00 60.87  ? 148  ARG A C   1 
ATOM   866  O O   . ARG A 1 118 ? -1.786  9.783   5.380  1.00 60.58  ? 148  ARG A O   1 
ATOM   867  C CB  . ARG A 1 118 ? -0.595  12.161  7.328  1.00 65.47  ? 148  ARG A CB  1 
ATOM   868  C CG  . ARG A 1 118 ? 0.943   12.117  7.432  1.00 70.26  ? 148  ARG A CG  1 
ATOM   869  C CD  . ARG A 1 118 ? 1.432   10.700  7.754  1.00 76.15  ? 148  ARG A CD  1 
ATOM   870  N NE  . ARG A 1 118 ? 2.892   10.596  7.831  1.00 81.87  ? 148  ARG A NE  1 
ATOM   871  C CZ  . ARG A 1 118 ? 3.565   9.479   8.128  1.00 83.58  ? 148  ARG A CZ  1 
ATOM   872  N NH1 . ARG A 1 118 ? 2.927   8.343   8.387  1.00 80.39  ? 148  ARG A NH1 1 
ATOM   873  N NH2 . ARG A 1 118 ? 4.892   9.497   8.167  1.00 86.51  ? 148  ARG A NH2 1 
ATOM   874  N N   . TYR A 1 119 ? -3.419  11.189  6.053  1.00 58.63  ? 149  TYR A N   1 
ATOM   875  C CA  . TYR A 1 119 ? -4.529  10.279  5.771  1.00 56.51  ? 149  TYR A CA  1 
ATOM   876  C C   . TYR A 1 119 ? -4.616  9.883   4.299  1.00 56.12  ? 149  TYR A C   1 
ATOM   877  O O   . TYR A 1 119 ? -4.825  8.719   3.980  1.00 54.89  ? 149  TYR A O   1 
ATOM   878  C CB  . TYR A 1 119 ? -5.860  10.895  6.210  1.00 55.58  ? 149  TYR A CB  1 
ATOM   879  C CG  . TYR A 1 119 ? -7.037  9.964   6.029  1.00 55.34  ? 149  TYR A CG  1 
ATOM   880  C CD1 . TYR A 1 119 ? -7.385  9.042   7.032  1.00 55.95  ? 149  TYR A CD1 1 
ATOM   881  C CD2 . TYR A 1 119 ? -7.796  9.983   4.852  1.00 52.59  ? 149  TYR A CD2 1 
ATOM   882  C CE1 . TYR A 1 119 ? -8.473  8.162   6.868  1.00 55.46  ? 149  TYR A CE1 1 
ATOM   883  C CE2 . TYR A 1 119 ? -8.877  9.114   4.677  1.00 53.73  ? 149  TYR A CE2 1 
ATOM   884  C CZ  . TYR A 1 119 ? -9.214  8.205   5.689  1.00 54.75  ? 149  TYR A CZ  1 
ATOM   885  O OH  . TYR A 1 119 ? -10.280 7.349   5.514  1.00 50.74  ? 149  TYR A OH  1 
ATOM   886  N N   . GLN A 1 120 ? -4.465  10.864  3.414  1.00 57.75  ? 150  GLN A N   1 
ATOM   887  C CA  . GLN A 1 120 ? -4.553  10.660  1.970  1.00 58.88  ? 150  GLN A CA  1 
ATOM   888  C C   . GLN A 1 120 ? -3.542  9.633   1.463  1.00 58.62  ? 150  GLN A C   1 
ATOM   889  O O   . GLN A 1 120 ? -3.856  8.829   0.591  1.00 57.14  ? 150  GLN A O   1 
ATOM   890  C CB  . GLN A 1 120 ? -4.359  12.000  1.240  1.00 60.26  ? 150  GLN A CB  1 
ATOM   891  C CG  . GLN A 1 120 ? -4.675  11.986  -0.258 1.00 65.13  ? 150  GLN A CG  1 
ATOM   892  C CD  . GLN A 1 120 ? -6.169  11.827  -0.565 1.00 70.24  ? 150  GLN A CD  1 
ATOM   893  O OE1 . GLN A 1 120 ? -7.029  12.070  0.290  1.00 71.53  ? 150  GLN A OE1 1 
ATOM   894  N NE2 . GLN A 1 120 ? -6.479  11.415  -1.796 1.00 70.10  ? 150  GLN A NE2 1 
ATOM   895  N N   . SER A 1 121 ? -2.337  9.658   2.026  1.00 60.22  ? 151  SER A N   1 
ATOM   896  C CA  . SER A 1 121 ? -1.233  8.818   1.545  1.00 61.50  ? 151  SER A CA  1 
ATOM   897  C C   . SER A 1 121 ? -1.113  7.499   2.281  1.00 61.91  ? 151  SER A C   1 
ATOM   898  O O   . SER A 1 121 ? -0.353  6.635   1.867  1.00 62.89  ? 151  SER A O   1 
ATOM   899  C CB  . SER A 1 121 ? 0.095   9.572   1.625  1.00 62.08  ? 151  SER A CB  1 
ATOM   900  O OG  . SER A 1 121 ? 0.273   10.138  2.912  1.00 63.43  ? 151  SER A OG  1 
ATOM   901  N N   . LEU A 1 122 ? -1.860  7.347   3.370  1.00 63.07  ? 152  LEU A N   1 
ATOM   902  C CA  . LEU A 1 122 ? -1.873  6.103   4.138  1.00 63.76  ? 152  LEU A CA  1 
ATOM   903  C C   . LEU A 1 122 ? -3.044  5.192   3.781  1.00 64.22  ? 152  LEU A C   1 
ATOM   904  O O   . LEU A 1 122 ? -2.855  3.995   3.566  1.00 64.61  ? 152  LEU A O   1 
ATOM   905  C CB  . LEU A 1 122 ? -1.915  6.390   5.642  1.00 64.18  ? 152  LEU A CB  1 
ATOM   906  C CG  . LEU A 1 122 ? -0.688  6.907   6.393  1.00 63.42  ? 152  LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 122 ? -1.051  7.077   7.859  1.00 63.52  ? 152  LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 122 ? 0.521   5.992   6.236  1.00 62.61  ? 152  LEU A CD2 1 
ATOM   909  N N   . MET A 1 123 ? -4.248  5.763   3.728  1.00 64.73  ? 153  MET A N   1 
ATOM   910  C CA  . MET A 1 123 ? -5.481  4.981   3.594  1.00 63.60  ? 153  MET A CA  1 
ATOM   911  C C   . MET A 1 123 ? -5.863  4.634   2.162  1.00 62.59  ? 153  MET A C   1 
ATOM   912  O O   . MET A 1 123 ? -6.196  5.506   1.362  1.00 63.70  ? 153  MET A O   1 
ATOM   913  C CB  . MET A 1 123 ? -6.632  5.664   4.325  1.00 63.01  ? 153  MET A CB  1 
ATOM   914  C CG  . MET A 1 123 ? -6.783  5.199   5.762  1.00 67.36  ? 153  MET A CG  1 
ATOM   915  S SD  . MET A 1 123 ? -7.333  3.477   5.884  1.00 71.35  ? 153  MET A SD  1 
ATOM   916  C CE  . MET A 1 123 ? -8.326  3.579   7.370  1.00 73.02  ? 153  MET A CE  1 
ATOM   917  N N   . THR A 1 124 ? -5.800  3.344   1.856  1.00 61.36  ? 154  THR A N   1 
ATOM   918  C CA  . THR A 1 124 ? -6.188  2.825   0.552  1.00 59.86  ? 154  THR A CA  1 
ATOM   919  C C   . THR A 1 124 ? -7.227  1.715   0.711  1.00 59.89  ? 154  THR A C   1 
ATOM   920  O O   . THR A 1 124 ? -7.462  1.222   1.819  1.00 58.70  ? 154  THR A O   1 
ATOM   921  C CB  . THR A 1 124 ? -4.972  2.254   -0.205 1.00 59.27  ? 154  THR A CB  1 
ATOM   922  O OG1 . THR A 1 124 ? -4.498  1.077   0.459  1.00 56.70  ? 154  THR A OG1 1 
ATOM   923  C CG2 . THR A 1 124 ? -3.856  3.273   -0.274 1.00 58.74  ? 154  THR A CG2 1 
ATOM   924  N N   . ARG A 1 125 ? -7.828  1.310   -0.405 1.00 60.55  ? 155  ARG A N   1 
ATOM   925  C CA  . ARG A 1 125 ? -8.805  0.225   -0.392 1.00 59.70  ? 155  ARG A CA  1 
ATOM   926  C C   . ARG A 1 125 ? -8.157  -1.058  0.096  1.00 58.03  ? 155  ARG A C   1 
ATOM   927  O O   . ARG A 1 125 ? -8.750  -1.777  0.900  1.00 59.90  ? 155  ARG A O   1 
ATOM   928  C CB  . ARG A 1 125 ? -9.464  0.036   -1.766 1.00 60.99  ? 155  ARG A CB  1 
ATOM   929  C CG  . ARG A 1 125 ? -10.135 1.310   -2.303 1.00 67.24  ? 155  ARG A CG  1 
ATOM   930  C CD  . ARG A 1 125 ? -11.100 1.048   -3.463 1.00 73.35  ? 155  ARG A CD  1 
ATOM   931  N NE  . ARG A 1 125 ? -12.462 0.797   -2.990 1.00 77.29  ? 155  ARG A NE  1 
ATOM   932  C CZ  . ARG A 1 125 ? -13.288 1.729   -2.517 1.00 79.25  ? 155  ARG A CZ  1 
ATOM   933  N NH1 . ARG A 1 125 ? -12.907 3.006   -2.432 1.00 79.82  ? 155  ARG A NH1 1 
ATOM   934  N NH2 . ARG A 1 125 ? -14.503 1.376   -2.114 1.00 79.08  ? 155  ARG A NH2 1 
ATOM   935  N N   . ALA A 1 126 ? -6.929  -1.324  -0.355 1.00 54.81  ? 156  ALA A N   1 
ATOM   936  C CA  . ALA A 1 126 ? -6.187  -2.527  0.052  1.00 51.34  ? 156  ALA A CA  1 
ATOM   937  C C   . ALA A 1 126 ? -5.915  -2.569  1.569  1.00 49.63  ? 156  ALA A C   1 
ATOM   938  O O   . ALA A 1 126 ? -6.036  -3.626  2.205  1.00 49.03  ? 156  ALA A O   1 
ATOM   939  C CB  . ALA A 1 126 ? -4.884  -2.668  -0.741 1.00 49.15  ? 156  ALA A CB  1 
ATOM   940  N N   . ARG A 1 127 ? -5.564  -1.422  2.143  1.00 45.88  ? 157  ARG A N   1 
ATOM   941  C CA  . ARG A 1 127 ? -5.325  -1.346  3.580  1.00 44.96  ? 157  ARG A CA  1 
ATOM   942  C C   . ARG A 1 127 ? -6.608  -1.472  4.424  1.00 43.58  ? 157  ARG A C   1 
ATOM   943  O O   . ARG A 1 127 ? -6.620  -2.195  5.430  1.00 43.83  ? 157  ARG A O   1 
ATOM   944  C CB  . ARG A 1 127 ? -4.511  -0.108  3.930  1.00 43.37  ? 157  ARG A CB  1 
ATOM   945  C CG  . ARG A 1 127 ? -3.120  -0.228  3.368  1.00 50.79  ? 157  ARG A CG  1 
ATOM   946  C CD  . ARG A 1 127 ? -2.141  0.680   4.046  1.00 58.92  ? 157  ARG A CD  1 
ATOM   947  N NE  . ARG A 1 127 ? -0.808  0.471   3.494  1.00 62.49  ? 157  ARG A NE  1 
ATOM   948  C CZ  . ARG A 1 127 ? -0.187  1.307   2.669  1.00 62.17  ? 157  ARG A CZ  1 
ATOM   949  N NH1 . ARG A 1 127 ? -0.764  2.442   2.297  1.00 58.62  ? 157  ARG A NH1 1 
ATOM   950  N NH2 . ARG A 1 127 ? 1.027   1.005   2.227  1.00 64.43  ? 157  ARG A NH2 1 
ATOM   951  N N   . ALA A 1 128 ? -7.677  -0.799  3.992  1.00 40.68  ? 158  ALA A N   1 
ATOM   952  C CA  . ALA A 1 128 ? -8.988  -0.946  4.606  1.00 37.57  ? 158  ALA A CA  1 
ATOM   953  C C   . ALA A 1 128 ? -9.406  -2.423  4.690  1.00 36.21  ? 158  ALA A C   1 
ATOM   954  O O   . ALA A 1 128 ? -9.888  -2.858  5.743  1.00 33.78  ? 158  ALA A O   1 
ATOM   955  C CB  . ALA A 1 128 ? -10.028 -0.125  3.854  1.00 36.70  ? 158  ALA A CB  1 
ATOM   956  N N   . LYS A 1 129 ? -9.210  -3.181  3.603  1.00 34.43  ? 159  LYS A N   1 
ATOM   957  C CA  . LYS A 1 129 ? -9.462  -4.634  3.611  1.00 35.93  ? 159  LYS A CA  1 
ATOM   958  C C   . LYS A 1 129 ? -8.636  -5.369  4.663  1.00 34.08  ? 159  LYS A C   1 
ATOM   959  O O   . LYS A 1 129 ? -9.141  -6.256  5.349  1.00 35.83  ? 159  LYS A O   1 
ATOM   960  C CB  . LYS A 1 129 ? -9.185  -5.279  2.249  1.00 38.61  ? 159  LYS A CB  1 
ATOM   961  C CG  . LYS A 1 129 ? -10.318 -5.165  1.237  1.00 48.07  ? 159  LYS A CG  1 
ATOM   962  C CD  . LYS A 1 129 ? -9.999  -5.914  -0.076 1.00 58.52  ? 159  LYS A CD  1 
ATOM   963  C CE  . LYS A 1 129 ? -9.861  -7.443  0.140  1.00 63.33  ? 159  LYS A CE  1 
ATOM   964  N NZ  . LYS A 1 129 ? -9.928  -8.244  -1.132 1.00 63.90  ? 159  LYS A NZ  1 
ATOM   965  N N   . VAL A 1 130 ? -7.363  -5.011  4.779  1.00 31.90  ? 160  VAL A N   1 
ATOM   966  C CA  . VAL A 1 130 ? -6.512  -5.619  5.772  1.00 28.76  ? 160  VAL A CA  1 
ATOM   967  C C   . VAL A 1 130 ? -7.036  -5.267  7.156  1.00 27.96  ? 160  VAL A C   1 
ATOM   968  O O   . VAL A 1 130 ? -7.137  -6.144  8.014  1.00 28.56  ? 160  VAL A O   1 
ATOM   969  C CB  . VAL A 1 130 ? -5.020  -5.246  5.570  1.00 29.11  ? 160  VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 130 ? -4.140  -5.843  6.703  1.00 25.14  ? 160  VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 130 ? -4.542  -5.755  4.222  1.00 24.79  ? 160  VAL A CG2 1 
ATOM   972  N N   . ILE A 1 131 ? -7.410  -4.003  7.366  1.00 26.68  ? 161  ILE A N   1 
ATOM   973  C CA  . ILE A 1 131 ? -7.955  -3.593  8.662  1.00 28.62  ? 161  ILE A CA  1 
ATOM   974  C C   . ILE A 1 131 ? -9.170  -4.441  9.056  1.00 30.95  ? 161  ILE A C   1 
ATOM   975  O O   . ILE A 1 131 ? -9.205  -5.031  10.137 1.00 32.38  ? 161  ILE A O   1 
ATOM   976  C CB  . ILE A 1 131 ? -8.336  -2.113  8.698  1.00 27.61  ? 161  ILE A CB  1 
ATOM   977  C CG1 . ILE A 1 131 ? -7.105  -1.243  8.506  1.00 27.59  ? 161  ILE A CG1 1 
ATOM   978  C CG2 . ILE A 1 131 ? -9.026  -1.765  10.030 1.00 28.55  ? 161  ILE A CG2 1 
ATOM   979  C CD1 . ILE A 1 131 ? -7.428  0.207   8.255  1.00 24.89  ? 161  ILE A CD1 1 
ATOM   980  N N   . ILE A 1 132 ? -10.144 -4.509  8.152  1.00 31.94  ? 162  ILE A N   1 
ATOM   981  C CA  . ILE A 1 132 ? -11.336 -5.288  8.357  1.00 31.86  ? 162  ILE A CA  1 
ATOM   982  C C   . ILE A 1 132 ? -10.996 -6.740  8.690  1.00 32.74  ? 162  ILE A C   1 
ATOM   983  O O   . ILE A 1 132 ? -11.546 -7.298  9.663  1.00 32.66  ? 162  ILE A O   1 
ATOM   984  C CB  . ILE A 1 132 ? -12.303 -5.181  7.157  1.00 32.92  ? 162  ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 132 ? -12.974 -3.801  7.139  1.00 36.23  ? 162  ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 132 ? -13.387 -6.265  7.230  1.00 33.76  ? 162  ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 132 ? -13.420 -3.322  5.738  1.00 31.04  ? 162  ILE A CD1 1 
ATOM   988  N N   . CYS A 1 133 ? -10.092 -7.342  7.913  1.00 30.99  ? 163  CYS A N   1 
ATOM   989  C CA  . CYS A 1 133 ? -9.768  -8.749  8.115  1.00 32.35  ? 163  CYS A CA  1 
ATOM   990  C C   . CYS A 1 133 ? -9.097  -8.973  9.465  1.00 32.58  ? 163  CYS A C   1 
ATOM   991  O O   . CYS A 1 133 ? -9.400  -9.946  10.178 1.00 32.82  ? 163  CYS A O   1 
ATOM   992  C CB  . CYS A 1 133 ? -8.894  -9.283  6.991  1.00 34.31  ? 163  CYS A CB  1 
ATOM   993  S SG  . CYS A 1 133 ? -9.800  -9.641  5.509  1.00 47.42  ? 163  CYS A SG  1 
ATOM   994  N N   . THR A 1 134 ? -8.201  -8.056  9.821  1.00 30.55  ? 164  THR A N   1 
ATOM   995  C CA  . THR A 1 134 ? -7.529  -8.109  11.107 1.00 30.96  ? 164  THR A CA  1 
ATOM   996  C C   . THR A 1 134 ? -8.556  -8.049  12.258 1.00 29.29  ? 164  THR A C   1 
ATOM   997  O O   . THR A 1 134 ? -8.520  -8.887  13.191 1.00 26.61  ? 164  THR A O   1 
ATOM   998  C CB  . THR A 1 134 ? -6.437  -6.986  11.212 1.00 32.18  ? 164  THR A CB  1 
ATOM   999  O OG1 . THR A 1 134 ? -5.478  -7.160  10.155 1.00 34.88  ? 164  THR A OG1 1 
ATOM   1000 C CG2 . THR A 1 134 ? -5.711  -7.042  12.548 1.00 31.53  ? 164  THR A CG2 1 
ATOM   1001 N N   . VAL A 1 135 ? -9.483  -7.088  12.174 1.00 27.17  ? 165  VAL A N   1 
ATOM   1002 C CA  . VAL A 1 135 ? -10.578 -7.005  13.151 1.00 28.52  ? 165  VAL A CA  1 
ATOM   1003 C C   . VAL A 1 135 ? -11.329 -8.352  13.295 1.00 28.65  ? 165  VAL A C   1 
ATOM   1004 O O   . VAL A 1 135 ? -11.484 -8.844  14.415 1.00 25.82  ? 165  VAL A O   1 
ATOM   1005 C CB  . VAL A 1 135 ? -11.554 -5.835  12.850 1.00 29.99  ? 165  VAL A CB  1 
ATOM   1006 C CG1 . VAL A 1 135 ? -12.918 -6.037  13.570 1.00 27.33  ? 165  VAL A CG1 1 
ATOM   1007 C CG2 . VAL A 1 135 ? -10.926 -4.503  13.251 1.00 27.95  ? 165  VAL A CG2 1 
ATOM   1008 N N   . TRP A 1 136 ? -11.753 -8.959  12.175 1.00 27.32  ? 166  TRP A N   1 
ATOM   1009 C CA  . TRP A 1 136 ? -12.427 -10.252 12.248 1.00 27.54  ? 166  TRP A CA  1 
ATOM   1010 C C   . TRP A 1 136 ? -11.528 -11.385 12.751 1.00 29.19  ? 166  TRP A C   1 
ATOM   1011 O O   . TRP A 1 136 ? -12.015 -12.284 13.423 1.00 30.64  ? 166  TRP A O   1 
ATOM   1012 C CB  . TRP A 1 136 ? -13.113 -10.627 10.924 1.00 29.25  ? 166  TRP A CB  1 
ATOM   1013 C CG  . TRP A 1 136 ? -14.385 -9.833  10.679 1.00 31.26  ? 166  TRP A CG  1 
ATOM   1014 C CD1 . TRP A 1 136 ? -14.479 -8.633  10.049 1.00 33.74  ? 166  TRP A CD1 1 
ATOM   1015 C CD2 . TRP A 1 136 ? -15.714 -10.175 11.087 1.00 26.98  ? 166  TRP A CD2 1 
ATOM   1016 N NE1 . TRP A 1 136 ? -15.774 -8.202  10.036 1.00 28.07  ? 166  TRP A NE1 1 
ATOM   1017 C CE2 . TRP A 1 136 ? -16.557 -9.127  10.664 1.00 28.29  ? 166  TRP A CE2 1 
ATOM   1018 C CE3 . TRP A 1 136 ? -16.274 -11.266 11.771 1.00 27.82  ? 166  TRP A CE3 1 
ATOM   1019 C CZ2 . TRP A 1 136 ? -17.940 -9.131  10.892 1.00 29.62  ? 166  TRP A CZ2 1 
ATOM   1020 C CZ3 . TRP A 1 136 ? -17.642 -11.278 12.004 1.00 28.70  ? 166  TRP A CZ3 1 
ATOM   1021 C CH2 . TRP A 1 136 ? -18.464 -10.208 11.566 1.00 32.20  ? 166  TRP A CH2 1 
ATOM   1022 N N   . ALA A 1 137 ? -10.230 -11.342 12.436 1.00 29.10  ? 167  ALA A N   1 
ATOM   1023 C CA  . ALA A 1 137 ? -9.267  -12.324 12.956 1.00 27.94  ? 167  ALA A CA  1 
ATOM   1024 C C   . ALA A 1 137 ? -9.193  -12.282 14.485 1.00 26.99  ? 167  ALA A C   1 
ATOM   1025 O O   . ALA A 1 137 ? -9.432  -13.287 15.151 1.00 26.29  ? 167  ALA A O   1 
ATOM   1026 C CB  . ALA A 1 137 ? -7.871  -12.101 12.336 1.00 27.65  ? 167  ALA A CB  1 
ATOM   1027 N N   . ILE A 1 138 ? -8.900  -11.102 15.029 1.00 27.20  ? 168  ILE A N   1 
ATOM   1028 C CA  . ILE A 1 138 ? -8.792  -10.883 16.480 1.00 26.00  ? 168  ILE A CA  1 
ATOM   1029 C C   . ILE A 1 138 ? -10.068 -11.295 17.193 1.00 26.72  ? 168  ILE A C   1 
ATOM   1030 O O   . ILE A 1 138 ? -10.024 -11.945 18.254 1.00 26.65  ? 168  ILE A O   1 
ATOM   1031 C CB  . ILE A 1 138 ? -8.458  -9.391  16.811 1.00 25.23  ? 168  ILE A CB  1 
ATOM   1032 C CG1 . ILE A 1 138 ? -7.165  -8.921  16.089 1.00 23.87  ? 168  ILE A CG1 1 
ATOM   1033 C CG2 . ILE A 1 138 ? -8.276  -9.206  18.292 1.00 23.37  ? 168  ILE A CG2 1 
ATOM   1034 C CD1 . ILE A 1 138 ? -6.896  -7.395  16.190 1.00 10.71  ? 168  ILE A CD1 1 
ATOM   1035 N N   . SER A 1 139 ? -11.202 -10.925 16.591 1.00 27.35  ? 169  SER A N   1 
ATOM   1036 C CA  . SER A 1 139 ? -12.530 -11.228 17.122 1.00 26.13  ? 169  SER A CA  1 
ATOM   1037 C C   . SER A 1 139 ? -12.805 -12.727 17.135 1.00 27.48  ? 169  SER A C   1 
ATOM   1038 O O   . SER A 1 139 ? -13.341 -13.255 18.121 1.00 29.91  ? 169  SER A O   1 
ATOM   1039 C CB  . SER A 1 139 ? -13.607 -10.472 16.340 1.00 27.50  ? 169  SER A CB  1 
ATOM   1040 O OG  . SER A 1 139 ? -13.485 -9.058  16.518 1.00 25.00  ? 169  SER A OG  1 
ATOM   1041 N N   . ALA A 1 140 ? -12.418 -13.414 16.061 1.00 26.23  ? 170  ALA A N   1 
ATOM   1042 C CA  . ALA A 1 140 ? -12.539 -14.870 15.987 1.00 25.53  ? 170  ALA A CA  1 
ATOM   1043 C C   . ALA A 1 140 ? -11.674 -15.509 17.052 1.00 25.90  ? 170  ALA A C   1 
ATOM   1044 O O   . ALA A 1 140 ? -12.125 -16.383 17.796 1.00 25.19  ? 170  ALA A O   1 
ATOM   1045 C CB  . ALA A 1 140 ? -12.138 -15.362 14.626 1.00 25.51  ? 170  ALA A CB  1 
ATOM   1046 N N   . LEU A 1 141 ? -10.438 -15.034 17.146 1.00 27.47  ? 171  LEU A N   1 
ATOM   1047 C CA  . LEU A 1 141 ? -9.487  -15.525 18.149 1.00 30.25  ? 171  LEU A CA  1 
ATOM   1048 C C   . LEU A 1 141 ? -10.076 -15.472 19.575 1.00 30.35  ? 171  LEU A C   1 
ATOM   1049 O O   . LEU A 1 141 ? -10.129 -16.471 20.280 1.00 28.95  ? 171  LEU A O   1 
ATOM   1050 C CB  . LEU A 1 141 ? -8.172  -14.724 18.049 1.00 29.48  ? 171  LEU A CB  1 
ATOM   1051 C CG  . LEU A 1 141 ? -6.961  -15.106 18.900 1.00 31.59  ? 171  LEU A CG  1 
ATOM   1052 C CD1 . LEU A 1 141 ? -6.486  -16.519 18.571 1.00 36.71  ? 171  LEU A CD1 1 
ATOM   1053 C CD2 . LEU A 1 141 ? -5.853  -14.116 18.665 1.00 30.60  ? 171  LEU A CD2 1 
ATOM   1054 N N   . VAL A 1 142 ? -10.537 -14.290 19.955 1.00 31.75  ? 172  VAL A N   1 
ATOM   1055 C CA  . VAL A 1 142 ? -11.049 -14.002 21.286 1.00 32.89  ? 172  VAL A CA  1 
ATOM   1056 C C   . VAL A 1 142 ? -12.397 -14.665 21.615 1.00 32.88  ? 172  VAL A C   1 
ATOM   1057 O O   . VAL A 1 142 ? -12.726 -14.848 22.776 1.00 30.82  ? 172  VAL A O   1 
ATOM   1058 C CB  . VAL A 1 142 ? -11.107 -12.454 21.450 1.00 34.72  ? 172  VAL A CB  1 
ATOM   1059 C CG1 . VAL A 1 142 ? -12.324 -11.982 22.224 1.00 37.17  ? 172  VAL A CG1 1 
ATOM   1060 C CG2 . VAL A 1 142 ? -9.822  -11.963 22.073 1.00 36.90  ? 172  VAL A CG2 1 
ATOM   1061 N N   . SER A 1 143 ? -13.164 -15.035 20.596 1.00 36.06  ? 173  SER A N   1 
ATOM   1062 C CA  . SER A 1 143 ? -14.505 -15.590 20.807 1.00 38.48  ? 173  SER A CA  1 
ATOM   1063 C C   . SER A 1 143 ? -14.596 -17.114 20.716 1.00 38.17  ? 173  SER A C   1 
ATOM   1064 O O   . SER A 1 143 ? -15.148 -17.729 21.627 1.00 38.37  ? 173  SER A O   1 
ATOM   1065 C CB  . SER A 1 143 ? -15.508 -14.936 19.858 1.00 39.72  ? 173  SER A CB  1 
ATOM   1066 O OG  . SER A 1 143 ? -15.276 -15.361 18.525 1.00 47.48  ? 173  SER A OG  1 
ATOM   1067 N N   . PHE A 1 144 ? -14.055 -17.714 19.643 1.00 39.30  ? 174  PHE A N   1 
ATOM   1068 C CA  . PHE A 1 144 ? -14.102 -19.185 19.432 1.00 39.05  ? 174  PHE A CA  1 
ATOM   1069 C C   . PHE A 1 144 ? -13.260 -20.031 20.385 1.00 38.11  ? 174  PHE A C   1 
ATOM   1070 O O   . PHE A 1 144 ? -13.776 -20.935 21.050 1.00 38.93  ? 174  PHE A O   1 
ATOM   1071 C CB  . PHE A 1 144 ? -13.748 -19.560 17.995 1.00 40.01  ? 174  PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 144 ? -14.861 -19.340 17.031 1.00 44.80  ? 174  PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 144 ? -15.867 -20.291 16.881 1.00 51.22  ? 174  PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 144 ? -14.918 -18.178 16.273 1.00 46.10  ? 174  PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 144 ? -16.932 -20.082 15.979 1.00 50.94  ? 174  PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 144 ? -15.970 -17.962 15.371 1.00 47.84  ? 174  PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 144 ? -16.981 -18.911 15.230 1.00 46.27  ? 174  PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 145 ? -11.973 -19.728 20.458 1.00 36.94  ? 175  LEU A N   1 
ATOM   1079 C CA  . LEU A 1 145 ? -11.039 -20.593 21.160 1.00 37.06  ? 175  LEU A CA  1 
ATOM   1080 C C   . LEU A 1 145 ? -11.397 -20.864 22.624 1.00 33.69  ? 175  LEU A C   1 
ATOM   1081 O O   . LEU A 1 145 ? -11.428 -22.025 23.021 1.00 34.82  ? 175  LEU A O   1 
ATOM   1082 C CB  . LEU A 1 145 ? -9.593  -20.095 20.998 1.00 39.13  ? 175  LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 145 ? -8.528  -21.133 20.572 1.00 47.04  ? 175  LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 145 ? -7.966  -21.921 21.766 1.00 50.09  ? 175  LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 145 ? -9.029  -22.092 19.449 1.00 44.45  ? 175  LEU A CD2 1 
ATOM   1086 N N   . PRO A 1 146 ? -11.695 -19.810 23.419 1.00 30.71  ? 176  PRO A N   1 
ATOM   1087 C CA  . PRO A 1 146 ? -11.985 -20.051 24.833 1.00 28.78  ? 176  PRO A CA  1 
ATOM   1088 C C   . PRO A 1 146 ? -13.217 -20.897 24.965 1.00 28.75  ? 176  PRO A C   1 
ATOM   1089 O O   . PRO A 1 146 ? -13.359 -21.652 25.927 1.00 25.56  ? 176  PRO A O   1 
ATOM   1090 C CB  . PRO A 1 146 ? -12.260 -18.653 25.388 1.00 26.59  ? 176  PRO A CB  1 
ATOM   1091 C CG  . PRO A 1 146 ? -11.634 -17.737 24.442 1.00 27.81  ? 176  PRO A CG  1 
ATOM   1092 C CD  . PRO A 1 146 ? -11.777 -18.374 23.102 1.00 30.56  ? 176  PRO A CD  1 
ATOM   1093 N N   . ILE A 1 147 ? -14.081 -20.777 23.964 1.00 31.72  ? 177  ILE A N   1 
ATOM   1094 C CA  . ILE A 1 147 ? -15.313 -21.531 23.924 1.00 34.56  ? 177  ILE A CA  1 
ATOM   1095 C C   . ILE A 1 147 ? -15.081 -22.968 23.472 1.00 37.64  ? 177  ILE A C   1 
ATOM   1096 O O   . ILE A 1 147 ? -15.640 -23.886 24.069 1.00 39.55  ? 177  ILE A O   1 
ATOM   1097 C CB  . ILE A 1 147 ? -16.374 -20.800 23.107 1.00 33.86  ? 177  ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 147 ? -16.929 -19.648 23.963 1.00 31.40  ? 177  ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 147 ? -17.459 -21.771 22.646 1.00 29.92  ? 177  ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 147 ? -17.726 -18.632 23.196 1.00 31.87  ? 177  ILE A CD1 1 
ATOM   1101 N N   . MET A 1 148 ? -14.246 -23.169 22.449 1.00 40.28  ? 178  MET A N   1 
ATOM   1102 C CA  . MET A 1 148 ? -13.861 -24.533 22.060 1.00 43.19  ? 178  MET A CA  1 
ATOM   1103 C C   . MET A 1 148 ? -12.850 -25.172 23.012 1.00 42.79  ? 178  MET A C   1 
ATOM   1104 O O   . MET A 1 148 ? -12.655 -26.383 23.001 1.00 42.01  ? 178  MET A O   1 
ATOM   1105 C CB  . MET A 1 148 ? -13.411 -24.642 20.598 1.00 44.21  ? 178  MET A CB  1 
ATOM   1106 C CG  . MET A 1 148 ? -12.388 -23.658 20.143 1.00 52.56  ? 178  MET A CG  1 
ATOM   1107 S SD  . MET A 1 148 ? -12.333 -23.582 18.331 1.00 64.51  ? 178  MET A SD  1 
ATOM   1108 C CE  . MET A 1 148 ? -11.371 -25.057 17.957 1.00 62.79  ? 178  MET A CE  1 
ATOM   1109 N N   . MET A 1 149 ? -12.242 -24.364 23.864 1.00 43.24  ? 179  MET A N   1 
ATOM   1110 C CA  . MET A 1 149 ? -11.366 -24.914 24.876 1.00 44.37  ? 179  MET A CA  1 
ATOM   1111 C C   . MET A 1 149 ? -12.070 -25.149 26.211 1.00 44.13  ? 179  MET A C   1 
ATOM   1112 O O   . MET A 1 149 ? -11.477 -25.653 27.161 1.00 42.40  ? 179  MET A O   1 
ATOM   1113 C CB  . MET A 1 149 ? -10.100 -24.076 24.991 1.00 45.30  ? 179  MET A CB  1 
ATOM   1114 C CG  . MET A 1 149 ? -9.215  -24.322 23.772 1.00 50.11  ? 179  MET A CG  1 
ATOM   1115 S SD  . MET A 1 149 ? -7.567  -24.919 24.134 1.00 58.55  ? 179  MET A SD  1 
ATOM   1116 C CE  . MET A 1 149 ? -7.807  -25.952 25.598 1.00 59.54  ? 179  MET A CE  1 
ATOM   1117 N N   . HIS A 1 150 ? -13.356 -24.802 26.252 1.00 44.64  ? 180  HIS A N   1 
ATOM   1118 C CA  . HIS A 1 150 ? -14.203 -24.989 27.431 1.00 43.00  ? 180  HIS A CA  1 
ATOM   1119 C C   . HIS A 1 150 ? -13.750 -24.202 28.649 1.00 41.27  ? 180  HIS A C   1 
ATOM   1120 O O   . HIS A 1 150 ? -14.113 -24.539 29.779 1.00 40.61  ? 180  HIS A O   1 
ATOM   1121 C CB  . HIS A 1 150 ? -14.364 -26.477 27.747 1.00 44.10  ? 180  HIS A CB  1 
ATOM   1122 C CG  . HIS A 1 150 ? -15.128 -27.221 26.695 1.00 51.11  ? 180  HIS A CG  1 
ATOM   1123 N ND1 . HIS A 1 150 ? -16.500 -27.368 26.735 1.00 53.85  ? 180  HIS A ND1 1 
ATOM   1124 C CD2 . HIS A 1 150 ? -14.716 -27.835 25.560 1.00 53.53  ? 180  HIS A CD2 1 
ATOM   1125 C CE1 . HIS A 1 150 ? -16.898 -28.048 25.675 1.00 55.19  ? 180  HIS A CE1 1 
ATOM   1126 N NE2 . HIS A 1 150 ? -15.837 -28.337 24.943 1.00 56.14  ? 180  HIS A NE2 1 
ATOM   1127 N N   . TRP A 1 151 ? -12.994 -23.132 28.400 1.00 39.15  ? 181  TRP A N   1 
ATOM   1128 C CA  . TRP A 1 151 ? -12.521 -22.225 29.439 1.00 38.54  ? 181  TRP A CA  1 
ATOM   1129 C C   . TRP A 1 151 ? -13.644 -21.469 30.131 1.00 38.33  ? 181  TRP A C   1 
ATOM   1130 O O   . TRP A 1 151 ? -13.410 -20.839 31.162 1.00 39.67  ? 181  TRP A O   1 
ATOM   1131 C CB  . TRP A 1 151 ? -11.526 -21.208 28.860 1.00 40.76  ? 181  TRP A CB  1 
ATOM   1132 C CG  . TRP A 1 151 ? -10.169 -21.761 28.494 1.00 39.87  ? 181  TRP A CG  1 
ATOM   1133 C CD1 . TRP A 1 151 ? -9.621  -22.955 28.891 1.00 40.09  ? 181  TRP A CD1 1 
ATOM   1134 C CD2 . TRP A 1 151 ? -9.187  -21.120 27.690 1.00 40.74  ? 181  TRP A CD2 1 
ATOM   1135 N NE1 . TRP A 1 151 ? -8.372  -23.104 28.363 1.00 40.70  ? 181  TRP A NE1 1 
ATOM   1136 C CE2 . TRP A 1 151 ? -8.070  -21.989 27.624 1.00 42.79  ? 181  TRP A CE2 1 
ATOM   1137 C CE3 . TRP A 1 151 ? -9.132  -19.892 27.016 1.00 37.70  ? 181  TRP A CE3 1 
ATOM   1138 C CZ2 . TRP A 1 151 ? -6.911  -21.668 26.904 1.00 37.64  ? 181  TRP A CZ2 1 
ATOM   1139 C CZ3 . TRP A 1 151 ? -7.978  -19.575 26.306 1.00 37.81  ? 181  TRP A CZ3 1 
ATOM   1140 C CH2 . TRP A 1 151 ? -6.885  -20.459 26.256 1.00 35.90  ? 181  TRP A CH2 1 
ATOM   1141 N N   . TRP A 1 152 ? -14.850 -21.525 29.557 1.00 37.25  ? 182  TRP A N   1 
ATOM   1142 C CA  . TRP A 1 152 ? -16.053 -20.867 30.108 1.00 35.54  ? 182  TRP A CA  1 
ATOM   1143 C C   . TRP A 1 152 ? -16.837 -21.700 31.155 1.00 35.90  ? 182  TRP A C   1 
ATOM   1144 O O   . TRP A 1 152 ? -17.576 -21.133 31.967 1.00 34.44  ? 182  TRP A O   1 
ATOM   1145 C CB  . TRP A 1 152 ? -16.998 -20.491 28.975 1.00 34.20  ? 182  TRP A CB  1 
ATOM   1146 C CG  . TRP A 1 152 ? -17.390 -21.683 28.153 1.00 34.41  ? 182  TRP A CG  1 
ATOM   1147 C CD1 . TRP A 1 152 ? -16.663 -22.251 27.154 1.00 32.78  ? 182  TRP A CD1 1 
ATOM   1148 C CD2 . TRP A 1 152 ? -18.594 -22.472 28.278 1.00 32.71  ? 182  TRP A CD2 1 
ATOM   1149 N NE1 . TRP A 1 152 ? -17.332 -23.333 26.642 1.00 35.66  ? 182  TRP A NE1 1 
ATOM   1150 C CE2 . TRP A 1 152 ? -18.517 -23.497 27.316 1.00 34.44  ? 182  TRP A CE2 1 
ATOM   1151 C CE3 . TRP A 1 152 ? -19.736 -22.402 29.107 1.00 30.61  ? 182  TRP A CE3 1 
ATOM   1152 C CZ2 . TRP A 1 152 ? -19.544 -24.460 27.149 1.00 36.50  ? 182  TRP A CZ2 1 
ATOM   1153 C CZ3 . TRP A 1 152 ? -20.755 -23.364 28.955 1.00 23.37  ? 182  TRP A CZ3 1 
ATOM   1154 C CH2 . TRP A 1 152 ? -20.651 -24.375 27.979 1.00 28.95  ? 182  TRP A CH2 1 
ATOM   1155 N N   . ARG A 1 153 ? -16.675 -23.027 31.135 1.00 36.28  ? 183  ARG A N   1 
ATOM   1156 C CA  . ARG A 1 153 ? -17.392 -23.947 32.047 1.00 37.02  ? 183  ARG A CA  1 
ATOM   1157 C C   . ARG A 1 153 ? -17.140 -23.713 33.533 1.00 38.84  ? 183  ARG A C   1 
ATOM   1158 O O   . ARG A 1 153 ? -16.063 -23.241 33.921 1.00 39.63  ? 183  ARG A O   1 
ATOM   1159 C CB  . ARG A 1 153 ? -17.057 -25.400 31.721 1.00 34.50  ? 183  ARG A CB  1 
ATOM   1160 C CG  . ARG A 1 153 ? -17.287 -25.720 30.292 1.00 38.02  ? 183  ARG A CG  1 
ATOM   1161 C CD  . ARG A 1 153 ? -17.647 -27.143 30.099 1.00 42.52  ? 183  ARG A CD  1 
ATOM   1162 N NE  . ARG A 1 153 ? -18.800 -27.216 29.218 1.00 51.59  ? 183  ARG A NE  1 
ATOM   1163 C CZ  . ARG A 1 153 ? -19.252 -28.327 28.655 1.00 58.77  ? 183  ARG A CZ  1 
ATOM   1164 N NH1 . ARG A 1 153 ? -18.638 -29.485 28.873 1.00 64.02  ? 183  ARG A NH1 1 
ATOM   1165 N NH2 . ARG A 1 153 ? -20.318 -28.276 27.864 1.00 61.36  ? 183  ARG A NH2 1 
ATOM   1166 N N   . ASP A 1 154 ? -18.147 -24.034 34.353 1.00 40.99  ? 184  ASP A N   1 
ATOM   1167 C CA  . ASP A 1 154 ? -17.999 -24.053 35.811 1.00 43.39  ? 184  ASP A CA  1 
ATOM   1168 C C   . ASP A 1 154 ? -18.305 -25.425 36.376 1.00 46.29  ? 184  ASP A C   1 
ATOM   1169 O O   . ASP A 1 154 ? -18.774 -26.289 35.651 1.00 45.74  ? 184  ASP A O   1 
ATOM   1170 C CB  . ASP A 1 154 ? -18.850 -22.987 36.496 1.00 42.30  ? 184  ASP A CB  1 
ATOM   1171 C CG  . ASP A 1 154 ? -18.274 -22.561 37.838 1.00 46.73  ? 184  ASP A CG  1 
ATOM   1172 O OD1 . ASP A 1 154 ? -17.299 -23.196 38.316 1.00 49.23  ? 184  ASP A OD1 1 
ATOM   1173 O OD2 . ASP A 1 154 ? -18.776 -21.580 38.422 1.00 48.21  ? 184  ASP A OD2 1 
ATOM   1174 N N   . GLU A 1 155 ? -18.000 -25.614 37.662 1.00 52.62  ? 185  GLU A N   1 
ATOM   1175 C CA  . GLU A 1 155 ? -18.226 -26.865 38.401 1.00 58.12  ? 185  GLU A CA  1 
ATOM   1176 C C   . GLU A 1 155 ? -19.284 -26.705 39.495 1.00 60.03  ? 185  GLU A C   1 
ATOM   1177 O O   . GLU A 1 155 ? -19.473 -27.605 40.316 1.00 61.59  ? 185  GLU A O   1 
ATOM   1178 C CB  . GLU A 1 155 ? -16.937 -27.318 39.074 1.00 60.29  ? 185  GLU A CB  1 
ATOM   1179 C CG  . GLU A 1 155 ? -15.919 -27.949 38.163 1.00 66.56  ? 185  GLU A CG  1 
ATOM   1180 C CD  . GLU A 1 155 ? -14.527 -27.890 38.760 1.00 72.06  ? 185  GLU A CD  1 
ATOM   1181 O OE1 . GLU A 1 155 ? -14.316 -27.102 39.717 1.00 72.57  ? 185  GLU A OE1 1 
ATOM   1182 O OE2 . GLU A 1 155 ? -13.645 -28.628 38.267 1.00 75.90  ? 185  GLU A OE2 1 
ATOM   1183 N N   . ASP A 1 156 ? -19.922 -25.537 39.520 1.00 61.61  ? 186  ASP A N   1 
ATOM   1184 C CA  . ASP A 1 156 ? -21.118 -25.233 40.318 1.00 63.25  ? 186  ASP A CA  1 
ATOM   1185 C C   . ASP A 1 156 ? -22.150 -26.355 40.121 1.00 62.88  ? 186  ASP A C   1 
ATOM   1186 O O   . ASP A 1 156 ? -22.182 -26.962 39.038 1.00 62.50  ? 186  ASP A O   1 
ATOM   1187 C CB  . ASP A 1 156 ? -21.702 -23.920 39.779 1.00 65.23  ? 186  ASP A CB  1 
ATOM   1188 C CG  . ASP A 1 156 ? -22.254 -23.019 40.859 1.00 70.54  ? 186  ASP A CG  1 
ATOM   1189 O OD1 . ASP A 1 156 ? -23.445 -23.165 41.212 1.00 78.10  ? 186  ASP A OD1 1 
ATOM   1190 O OD2 . ASP A 1 156 ? -21.510 -22.129 41.324 1.00 72.24  ? 186  ASP A OD2 1 
ATOM   1191 N N   . PRO A 1 157 ? -22.993 -26.640 41.148 1.00 62.18  ? 187  PRO A N   1 
ATOM   1192 C CA  . PRO A 1 157 ? -24.123 -27.573 40.947 1.00 61.49  ? 187  PRO A CA  1 
ATOM   1193 C C   . PRO A 1 157 ? -25.083 -27.097 39.837 1.00 60.52  ? 187  PRO A C   1 
ATOM   1194 O O   . PRO A 1 157 ? -25.459 -27.881 38.958 1.00 60.50  ? 187  PRO A O   1 
ATOM   1195 C CB  . PRO A 1 157 ? -24.816 -27.612 42.319 1.00 61.50  ? 187  PRO A CB  1 
ATOM   1196 C CG  . PRO A 1 157 ? -24.259 -26.466 43.102 1.00 61.77  ? 187  PRO A CG  1 
ATOM   1197 C CD  . PRO A 1 157 ? -22.879 -26.217 42.556 1.00 62.48  ? 187  PRO A CD  1 
ATOM   1198 N N   . GLN A 1 158 ? -25.433 -25.813 39.870 1.00 60.01  ? 188  GLN A N   1 
ATOM   1199 C CA  . GLN A 1 158 ? -26.150 -25.131 38.778 1.00 61.36  ? 188  GLN A CA  1 
ATOM   1200 C C   . GLN A 1 158 ? -25.611 -25.405 37.365 1.00 61.34  ? 188  GLN A C   1 
ATOM   1201 O O   . GLN A 1 158 ? -26.385 -25.624 36.428 1.00 62.47  ? 188  GLN A O   1 
ATOM   1202 C CB  . GLN A 1 158 ? -26.155 -23.622 39.040 1.00 61.78  ? 188  GLN A CB  1 
ATOM   1203 C CG  . GLN A 1 158 ? -26.685 -22.753 37.898 1.00 67.78  ? 188  GLN A CG  1 
ATOM   1204 C CD  . GLN A 1 158 ? -26.576 -21.260 38.197 1.00 75.09  ? 188  GLN A CD  1 
ATOM   1205 O OE1 . GLN A 1 158 ? -25.704 -20.825 38.950 1.00 81.12  ? 188  GLN A OE1 1 
ATOM   1206 N NE2 . GLN A 1 158 ? -27.457 -20.472 37.600 1.00 75.61  ? 188  GLN A NE2 1 
ATOM   1207 N N   . ALA A 1 159 ? -24.288 -25.383 37.219 1.00 60.77  ? 189  ALA A N   1 
ATOM   1208 C CA  . ALA A 1 159 ? -23.644 -25.574 35.929 1.00 59.85  ? 189  ALA A CA  1 
ATOM   1209 C C   . ALA A 1 159 ? -23.674 -27.026 35.451 1.00 60.74  ? 189  ALA A C   1 
ATOM   1210 O O   . ALA A 1 159 ? -23.839 -27.285 34.256 1.00 60.33  ? 189  ALA A O   1 
ATOM   1211 C CB  . ALA A 1 159 ? -22.222 -25.051 35.979 1.00 59.34  ? 189  ALA A CB  1 
ATOM   1212 N N   . LEU A 1 160 ? -23.512 -27.967 36.385 1.00 63.11  ? 190  LEU A N   1 
ATOM   1213 C CA  . LEU A 1 160 ? -23.543 -29.413 36.076 1.00 64.59  ? 190  LEU A CA  1 
ATOM   1214 C C   . LEU A 1 160 ? -24.962 -29.854 35.689 1.00 62.71  ? 190  LEU A C   1 
ATOM   1215 O O   . LEU A 1 160 ? -25.162 -30.681 34.786 1.00 60.74  ? 190  LEU A O   1 
ATOM   1216 C CB  . LEU A 1 160 ? -23.030 -30.239 37.271 1.00 66.96  ? 190  LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 160 ? -21.660 -29.907 37.904 1.00 70.14  ? 190  LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 160 ? -21.721 -30.064 39.434 1.00 71.15  ? 190  LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 160 ? -20.499 -30.712 37.293 1.00 68.16  ? 190  LEU A CD2 1 
ATOM   1220 N N   . LYS A 1 161 ? -25.938 -29.275 36.380 1.00 62.30  ? 191  LYS A N   1 
ATOM   1221 C CA  . LYS A 1 161 ? -27.338 -29.422 36.020 1.00 64.19  ? 191  LYS A CA  1 
ATOM   1222 C C   . LYS A 1 161 ? -27.584 -29.102 34.541 1.00 65.01  ? 191  LYS A C   1 
ATOM   1223 O O   . LYS A 1 161 ? -28.177 -29.916 33.822 1.00 66.11  ? 191  LYS A O   1 
ATOM   1224 C CB  . LYS A 1 161 ? -28.211 -28.535 36.908 1.00 64.68  ? 191  LYS A CB  1 
ATOM   1225 C CG  . LYS A 1 161 ? -29.690 -28.865 36.814 1.00 65.03  ? 191  LYS A CG  1 
ATOM   1226 C CD  . LYS A 1 161 ? -30.357 -28.778 38.170 1.00 65.61  ? 191  LYS A CD  1 
ATOM   1227 C CE  . LYS A 1 161 ? -31.174 -30.033 38.425 1.00 65.55  ? 191  LYS A CE  1 
ATOM   1228 N NZ  . LYS A 1 161 ? -31.917 -29.920 39.697 1.00 67.03  ? 191  LYS A NZ  1 
ATOM   1229 N N   . CYS A 1 162 ? -27.112 -27.935 34.094 1.00 64.28  ? 192  CYS A N   1 
ATOM   1230 C CA  . CYS A 1 162 ? -27.291 -27.517 32.705 1.00 64.20  ? 192  CYS A CA  1 
ATOM   1231 C C   . CYS A 1 162 ? -26.513 -28.367 31.696 1.00 64.25  ? 192  CYS A C   1 
ATOM   1232 O O   . CYS A 1 162 ? -27.038 -28.679 30.630 1.00 63.63  ? 192  CYS A O   1 
ATOM   1233 C CB  . CYS A 1 162 ? -27.011 -26.015 32.522 1.00 63.93  ? 192  CYS A CB  1 
ATOM   1234 S SG  . CYS A 1 162 ? -27.249 -25.389 30.808 1.00 67.95  ? 192  CYS A SG  1 
ATOM   1235 N N   . TYR A 1 163 ? -25.281 -28.755 32.006 1.00 66.46  ? 193  TYR A N   1 
ATOM   1236 C CA  . TYR A 1 163 ? -24.528 -29.508 30.999 1.00 70.29  ? 193  TYR A CA  1 
ATOM   1237 C C   . TYR A 1 163 ? -24.964 -30.967 30.976 1.00 70.28  ? 193  TYR A C   1 
ATOM   1238 O O   . TYR A 1 163 ? -24.753 -31.660 29.985 1.00 69.38  ? 193  TYR A O   1 
ATOM   1239 C CB  . TYR A 1 163 ? -22.990 -29.350 31.102 1.00 73.07  ? 193  TYR A CB  1 
ATOM   1240 C CG  . TYR A 1 163 ? -22.462 -27.938 31.424 1.00 77.63  ? 193  TYR A CG  1 
ATOM   1241 C CD1 . TYR A 1 163 ? -23.139 -26.775 31.000 1.00 75.26  ? 193  TYR A CD1 1 
ATOM   1242 C CD2 . TYR A 1 163 ? -21.263 -27.777 32.150 1.00 77.22  ? 193  TYR A CD2 1 
ATOM   1243 C CE1 . TYR A 1 163 ? -22.651 -25.498 31.328 1.00 75.42  ? 193  TYR A CE1 1 
ATOM   1244 C CE2 . TYR A 1 163 ? -20.765 -26.511 32.475 1.00 74.80  ? 193  TYR A CE2 1 
ATOM   1245 C CZ  . TYR A 1 163 ? -21.456 -25.372 32.064 1.00 75.96  ? 193  TYR A CZ  1 
ATOM   1246 O OH  . TYR A 1 163 ? -20.946 -24.117 32.387 1.00 70.51  ? 193  TYR A OH  1 
ATOM   1247 N N   . GLN A 1 164 ? -25.595 -31.425 32.056 1.00 71.55  ? 194  GLN A N   1 
ATOM   1248 C CA  . GLN A 1 164 ? -26.221 -32.750 32.042 1.00 73.03  ? 194  GLN A CA  1 
ATOM   1249 C C   . GLN A 1 164 ? -27.739 -32.680 31.815 1.00 70.61  ? 194  GLN A C   1 
ATOM   1250 O O   . GLN A 1 164 ? -28.526 -33.291 32.541 1.00 70.26  ? 194  GLN A O   1 
ATOM   1251 C CB  . GLN A 1 164 ? -25.865 -33.587 33.282 1.00 75.01  ? 194  GLN A CB  1 
ATOM   1252 C CG  . GLN A 1 164 ? -25.653 -35.069 32.917 1.00 80.06  ? 194  GLN A CG  1 
ATOM   1253 C CD  . GLN A 1 164 ? -25.420 -35.964 34.115 1.00 85.12  ? 194  GLN A CD  1 
ATOM   1254 O OE1 . GLN A 1 164 ? -26.212 -35.980 35.067 1.00 87.69  ? 194  GLN A OE1 1 
ATOM   1255 N NE2 . GLN A 1 164 ? -24.337 -36.732 34.067 1.00 85.61  ? 194  GLN A NE2 1 
ATOM   1256 N N   . ASP A 1 165 ? -28.108 -31.936 30.772 1.00 67.92  ? 195  ASP A N   1 
ATOM   1257 C CA  . ASP A 1 165 ? -29.483 -31.705 30.336 1.00 64.45  ? 195  ASP A CA  1 
ATOM   1258 C C   . ASP A 1 165 ? -29.365 -31.244 28.877 1.00 62.73  ? 195  ASP A C   1 
ATOM   1259 O O   . ASP A 1 165 ? -28.931 -30.116 28.619 1.00 63.75  ? 195  ASP A O   1 
ATOM   1260 C CB  . ASP A 1 165 ? -30.134 -30.633 31.220 1.00 64.01  ? 195  ASP A CB  1 
ATOM   1261 C CG  . ASP A 1 165 ? -31.461 -30.113 30.671 1.00 66.36  ? 195  ASP A CG  1 
ATOM   1262 O OD1 . ASP A 1 165 ? -31.986 -30.644 29.657 1.00 65.83  ? 195  ASP A OD1 1 
ATOM   1263 O OD2 . ASP A 1 165 ? -31.988 -29.154 31.281 1.00 66.06  ? 195  ASP A OD2 1 
ATOM   1264 N N   . PRO A 1 166 ? -29.728 -32.119 27.916 1.00 60.01  ? 196  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 166 ? -29.431 -31.895 26.489 1.00 57.96  ? 196  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 166 ? -30.217 -30.743 25.839 1.00 56.18  ? 196  PRO A C   1 
ATOM   1267 O O   . PRO A 1 166 ? -29.899 -30.322 24.718 1.00 55.69  ? 196  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 166 ? -29.794 -33.237 25.834 1.00 57.99  ? 196  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 166 ? -29.944 -34.212 26.969 1.00 59.79  ? 196  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 166 ? -30.411 -33.405 28.132 1.00 59.45  ? 196  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 167 ? -31.230 -30.250 26.543 1.00 53.90  ? 197  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 167 ? -32.022 -29.127 26.082 1.00 51.53  ? 197  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 167 ? -31.701 -27.867 26.854 1.00 50.35  ? 197  GLY A C   1 
ATOM   1274 O O   . GLY A 1 167 ? -32.472 -26.908 26.832 1.00 49.57  ? 197  GLY A O   1 
ATOM   1275 N N   . CYS A 1 168 ? -30.567 -27.870 27.551 1.00 50.75  ? 198  CYS A N   1 
ATOM   1276 C CA  . CYS A 1 168 ? -30.069 -26.648 28.183 1.00 50.79  ? 198  CYS A CA  1 
ATOM   1277 C C   . CYS A 1 168 ? -28.951 -25.988 27.387 1.00 51.16  ? 198  CYS A C   1 
ATOM   1278 O O   . CYS A 1 168 ? -27.920 -26.600 27.083 1.00 52.79  ? 198  CYS A O   1 
ATOM   1279 C CB  . CYS A 1 168 ? -29.632 -26.871 29.621 1.00 50.27  ? 198  CYS A CB  1 
ATOM   1280 S SG  . CYS A 1 168 ? -29.282 -25.313 30.502 1.00 56.59  ? 198  CYS A SG  1 
ATOM   1281 N N   . CYS A 1 169 ? -29.191 -24.733 27.031 1.00 50.00  ? 199  CYS A N   1 
ATOM   1282 C CA  . CYS A 1 169 ? -28.196 -23.911 26.395 1.00 48.61  ? 199  CYS A CA  1 
ATOM   1283 C C   . CYS A 1 169 ? -28.277 -22.535 27.009 1.00 48.82  ? 199  CYS A C   1 
ATOM   1284 O O   . CYS A 1 169 ? -28.370 -21.541 26.297 1.00 49.27  ? 199  CYS A O   1 
ATOM   1285 C CB  . CYS A 1 169 ? -28.390 -23.857 24.875 1.00 47.61  ? 199  CYS A CB  1 
ATOM   1286 S SG  . CYS A 1 169 ? -26.938 -23.260 23.934 1.00 47.62  ? 199  CYS A SG  1 
ATOM   1287 N N   . ASP A 1 170 ? -28.266 -22.479 28.341 1.00 49.91  ? 200  ASP A N   1 
ATOM   1288 C CA  . ASP A 1 170 ? -27.906 -21.240 29.028 1.00 51.90  ? 200  ASP A CA  1 
ATOM   1289 C C   . ASP A 1 170 ? -26.412 -21.114 28.801 1.00 52.85  ? 200  ASP A C   1 
ATOM   1290 O O   . ASP A 1 170 ? -25.717 -22.111 28.539 1.00 56.62  ? 200  ASP A O   1 
ATOM   1291 C CB  . ASP A 1 170 ? -28.145 -21.305 30.543 1.00 52.32  ? 200  ASP A CB  1 
ATOM   1292 C CG  . ASP A 1 170 ? -29.577 -21.679 30.921 1.00 58.07  ? 200  ASP A CG  1 
ATOM   1293 O OD1 . ASP A 1 170 ? -30.472 -21.733 30.044 1.00 63.09  ? 200  ASP A OD1 1 
ATOM   1294 O OD2 . ASP A 1 170 ? -29.805 -21.917 32.128 1.00 59.85  ? 200  ASP A OD2 1 
ATOM   1295 N N   . PHE A 1 171 ? -25.895 -19.907 28.911 1.00 49.53  ? 201  PHE A N   1 
ATOM   1296 C CA  . PHE A 1 171 ? -24.458 -19.747 28.875 1.00 45.46  ? 201  PHE A CA  1 
ATOM   1297 C C   . PHE A 1 171 ? -23.996 -19.554 30.319 1.00 43.33  ? 201  PHE A C   1 
ATOM   1298 O O   . PHE A 1 171 ? -23.692 -18.438 30.750 1.00 44.43  ? 201  PHE A O   1 
ATOM   1299 C CB  . PHE A 1 171 ? -24.107 -18.564 27.969 1.00 45.78  ? 201  PHE A CB  1 
ATOM   1300 C CG  . PHE A 1 171 ? -22.658 -18.470 27.611 1.00 45.72  ? 201  PHE A CG  1 
ATOM   1301 C CD1 . PHE A 1 171 ? -21.926 -19.614 27.270 1.00 43.99  ? 201  PHE A CD1 1 
ATOM   1302 C CD2 . PHE A 1 171 ? -22.029 -17.221 27.577 1.00 42.02  ? 201  PHE A CD2 1 
ATOM   1303 C CE1 . PHE A 1 171 ? -20.582 -19.516 26.936 1.00 43.85  ? 201  PHE A CE1 1 
ATOM   1304 C CE2 . PHE A 1 171 ? -20.701 -17.109 27.233 1.00 43.74  ? 201  PHE A CE2 1 
ATOM   1305 C CZ  . PHE A 1 171 ? -19.966 -18.262 26.913 1.00 44.54  ? 201  PHE A CZ  1 
ATOM   1306 N N   . VAL A 1 172 ? -23.997 -20.639 31.082 1.00 40.50  ? 202  VAL A N   1 
ATOM   1307 C CA  . VAL A 1 172 ? -23.554 -20.580 32.474 1.00 40.42  ? 202  VAL A CA  1 
ATOM   1308 C C   . VAL A 1 172 ? -22.032 -20.602 32.480 1.00 37.51  ? 202  VAL A C   1 
ATOM   1309 O O   . VAL A 1 172 ? -21.412 -21.574 32.017 1.00 39.24  ? 202  VAL A O   1 
ATOM   1310 C CB  . VAL A 1 172 ? -24.119 -21.768 33.313 1.00 42.43  ? 202  VAL A CB  1 
ATOM   1311 C CG1 . VAL A 1 172 ? -23.573 -21.742 34.759 1.00 39.33  ? 202  VAL A CG1 1 
ATOM   1312 C CG2 . VAL A 1 172 ? -25.635 -21.730 33.310 1.00 44.20  ? 202  VAL A CG2 1 
ATOM   1313 N N   . THR A 1 173 ? -21.424 -19.538 32.980 1.00 32.37  ? 203  THR A N   1 
ATOM   1314 C CA  . THR A 1 173 ? -19.974 -19.416 32.862 1.00 31.55  ? 203  THR A CA  1 
ATOM   1315 C C   . THR A 1 173 ? -19.363 -19.325 34.235 1.00 31.09  ? 203  THR A C   1 
ATOM   1316 O O   . THR A 1 173 ? -20.055 -18.954 35.179 1.00 30.41  ? 203  THR A O   1 
ATOM   1317 C CB  . THR A 1 173 ? -19.532 -18.194 31.966 1.00 30.48  ? 203  THR A CB  1 
ATOM   1318 O OG1 . THR A 1 173 ? -19.889 -16.954 32.590 1.00 30.29  ? 203  THR A OG1 1 
ATOM   1319 C CG2 . THR A 1 173 ? -20.180 -18.265 30.578 1.00 22.55  ? 203  THR A CG2 1 
ATOM   1320 N N   . ASN A 1 174 ? -18.079 -19.668 34.354 1.00 30.30  ? 204  ASN A N   1 
ATOM   1321 C CA  . ASN A 1 174 ? -17.335 -19.392 35.590 1.00 28.06  ? 204  ASN A CA  1 
ATOM   1322 C C   . ASN A 1 174 ? -17.078 -17.881 35.688 1.00 28.75  ? 204  ASN A C   1 
ATOM   1323 O O   . ASN A 1 174 ? -17.213 -17.157 34.685 1.00 29.14  ? 204  ASN A O   1 
ATOM   1324 C CB  . ASN A 1 174 ? -16.045 -20.213 35.638 1.00 27.90  ? 204  ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 174 ? -15.067 -19.868 34.502 1.00 30.29  ? 204  ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 174 ? -14.406 -18.812 34.524 1.00 29.75  ? 204  ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 174 ? -14.956 -20.770 33.518 1.00 22.73  ? 204  ASN A ND2 1 
ATOM   1328 N N   . ARG A 1 175 ? -16.729 -17.397 36.876 1.00 29.78  ? 205  ARG A N   1 
ATOM   1329 C CA  . ARG A 1 175 ? -16.474 -15.964 37.074 1.00 32.31  ? 205  ARG A CA  1 
ATOM   1330 C C   . ARG A 1 175 ? -15.277 -15.403 36.307 1.00 31.12  ? 205  ARG A C   1 
ATOM   1331 O O   . ARG A 1 175 ? -15.321 -14.264 35.843 1.00 30.95  ? 205  ARG A O   1 
ATOM   1332 C CB  . ARG A 1 175 ? -16.319 -15.652 38.556 1.00 34.60  ? 205  ARG A CB  1 
ATOM   1333 C CG  . ARG A 1 175 ? -17.584 -15.885 39.337 1.00 43.30  ? 205  ARG A CG  1 
ATOM   1334 C CD  . ARG A 1 175 ? -17.312 -15.852 40.805 1.00 53.03  ? 205  ARG A CD  1 
ATOM   1335 N NE  . ARG A 1 175 ? -18.038 -16.919 41.478 1.00 59.59  ? 205  ARG A NE  1 
ATOM   1336 C CZ  . ARG A 1 175 ? -19.112 -16.730 42.230 1.00 66.75  ? 205  ARG A CZ  1 
ATOM   1337 N NH1 . ARG A 1 175 ? -19.597 -15.510 42.423 1.00 71.32  ? 205  ARG A NH1 1 
ATOM   1338 N NH2 . ARG A 1 175 ? -19.699 -17.766 42.804 1.00 71.15  ? 205  ARG A NH2 1 
ATOM   1339 N N   . ALA A 1 176 ? -14.212 -16.196 36.180 1.00 31.19  ? 206  ALA A N   1 
ATOM   1340 C CA  . ALA A 1 176 ? -12.995 -15.729 35.517 1.00 30.42  ? 206  ALA A CA  1 
ATOM   1341 C C   . ALA A 1 176 ? -13.308 -15.360 34.072 1.00 29.67  ? 206  ALA A C   1 
ATOM   1342 O O   . ALA A 1 176 ? -12.957 -14.258 33.616 1.00 29.27  ? 206  ALA A O   1 
ATOM   1343 C CB  . ALA A 1 176 ? -11.884 -16.774 35.609 1.00 29.92  ? 206  ALA A CB  1 
ATOM   1344 N N   . TYR A 1 177 ? -14.008 -16.265 33.384 1.00 27.53  ? 207  TYR A N   1 
ATOM   1345 C CA  . TYR A 1 177 ? -14.371 -16.058 31.992 1.00 28.50  ? 207  TYR A CA  1 
ATOM   1346 C C   . TYR A 1 177 ? -15.304 -14.850 31.812 1.00 30.11  ? 207  TYR A C   1 
ATOM   1347 O O   . TYR A 1 177 ? -15.088 -14.004 30.932 1.00 33.15  ? 207  TYR A O   1 
ATOM   1348 C CB  . TYR A 1 177 ? -14.998 -17.309 31.400 1.00 28.95  ? 207  TYR A CB  1 
ATOM   1349 C CG  . TYR A 1 177 ? -15.432 -17.107 29.978 1.00 30.23  ? 207  TYR A CG  1 
ATOM   1350 C CD1 . TYR A 1 177 ? -16.685 -16.571 29.694 1.00 35.35  ? 207  TYR A CD1 1 
ATOM   1351 C CD2 . TYR A 1 177 ? -14.589 -17.432 28.911 1.00 29.92  ? 207  TYR A CD2 1 
ATOM   1352 C CE1 . TYR A 1 177 ? -17.105 -16.369 28.381 1.00 36.02  ? 207  TYR A CE1 1 
ATOM   1353 C CE2 . TYR A 1 177 ? -14.992 -17.244 27.595 1.00 31.59  ? 207  TYR A CE2 1 
ATOM   1354 C CZ  . TYR A 1 177 ? -16.257 -16.702 27.341 1.00 36.29  ? 207  TYR A CZ  1 
ATOM   1355 O OH  . TYR A 1 177 ? -16.687 -16.484 26.058 1.00 37.55  ? 207  TYR A OH  1 
ATOM   1356 N N   . ALA A 1 178 ? -16.332 -14.761 32.646 1.00 29.37  ? 208  ALA A N   1 
ATOM   1357 C CA  . ALA A 1 178 ? -17.216 -13.587 32.642 1.00 27.94  ? 208  ALA A CA  1 
ATOM   1358 C C   . ALA A 1 178 ? -16.460 -12.268 32.737 1.00 26.17  ? 208  ALA A C   1 
ATOM   1359 O O   . ALA A 1 178 ? -16.700 -11.366 31.938 1.00 26.58  ? 208  ALA A O   1 
ATOM   1360 C CB  . ALA A 1 178 ? -18.255 -13.680 33.754 1.00 26.79  ? 208  ALA A CB  1 
ATOM   1361 N N   . ILE A 1 179 ? -15.569 -12.133 33.719 1.00 24.57  ? 209  ILE A N   1 
ATOM   1362 C CA  . ILE A 1 179 ? -14.816 -10.883 33.829 1.00 25.60  ? 209  ILE A CA  1 
ATOM   1363 C C   . ILE A 1 179 ? -13.854 -10.704 32.642 1.00 26.29  ? 209  ILE A C   1 
ATOM   1364 O O   . ILE A 1 179 ? -13.875 -9.651  32.004 1.00 26.63  ? 209  ILE A O   1 
ATOM   1365 C CB  . ILE A 1 179 ? -14.092 -10.753 35.173 1.00 26.80  ? 209  ILE A CB  1 
ATOM   1366 C CG1 . ILE A 1 179 ? -15.126 -10.761 36.313 1.00 26.40  ? 209  ILE A CG1 1 
ATOM   1367 C CG2 . ILE A 1 179 ? -13.241 -9.460  35.204 1.00 22.15  ? 209  ILE A CG2 1 
ATOM   1368 C CD1 . ILE A 1 179 ? -14.619 -11.379 37.607 1.00 27.05  ? 209  ILE A CD1 1 
ATOM   1369 N N   . ALA A 1 180 ? -13.070 -11.747 32.331 1.00 24.90  ? 210  ALA A N   1 
ATOM   1370 C CA  . ALA A 1 180 ? -12.123 -11.731 31.214 1.00 25.72  ? 210  ALA A CA  1 
ATOM   1371 C C   . ALA A 1 180 ? -12.746 -11.413 29.845 1.00 26.15  ? 210  ALA A C   1 
ATOM   1372 O O   . ALA A 1 180 ? -12.291 -10.478 29.160 1.00 23.36  ? 210  ALA A O   1 
ATOM   1373 C CB  . ALA A 1 180 ? -11.350 -13.032 31.153 1.00 26.13  ? 210  ALA A CB  1 
ATOM   1374 N N   . SER A 1 181 ? -13.770 -12.181 29.454 1.00 25.57  ? 211  SER A N   1 
ATOM   1375 C CA  . SER A 1 181 ? -14.414 -11.973 28.151 1.00 26.76  ? 211  SER A CA  1 
ATOM   1376 C C   . SER A 1 181 ? -15.107 -10.625 28.044 1.00 27.07  ? 211  SER A C   1 
ATOM   1377 O O   . SER A 1 181 ? -15.026 -10.001 27.006 1.00 27.89  ? 211  SER A O   1 
ATOM   1378 C CB  . SER A 1 181 ? -15.361 -13.105 27.789 1.00 28.20  ? 211  SER A CB  1 
ATOM   1379 O OG  . SER A 1 181 ? -16.464 -13.119 28.663 1.00 30.99  ? 211  SER A OG  1 
ATOM   1380 N N   . SER A 1 182 ? -15.728 -10.157 29.129 1.00 29.30  ? 212  SER A N   1 
ATOM   1381 C CA  . SER A 1 182 ? -16.331 -8.830  29.167 1.00 29.96  ? 212  SER A CA  1 
ATOM   1382 C C   . SER A 1 182 ? -15.305 -7.745  28.926 1.00 31.68  ? 212  SER A C   1 
ATOM   1383 O O   . SER A 1 182 ? -15.507 -6.877  28.070 1.00 31.51  ? 212  SER A O   1 
ATOM   1384 C CB  . SER A 1 182 ? -17.016 -8.576  30.506 1.00 31.58  ? 212  SER A CB  1 
ATOM   1385 O OG  . SER A 1 182 ? -18.176 -9.376  30.651 1.00 30.74  ? 212  SER A OG  1 
ATOM   1386 N N   . ILE A 1 183 ? -14.205 -7.788  29.685 1.00 34.53  ? 213  ILE A N   1 
ATOM   1387 C CA  . ILE A 1 183 ? -13.138 -6.787  29.562 1.00 33.38  ? 213  ILE A CA  1 
ATOM   1388 C C   . ILE A 1 183 ? -12.507 -6.818  28.169 1.00 33.39  ? 213  ILE A C   1 
ATOM   1389 O O   . ILE A 1 183 ? -12.315 -5.773  27.541 1.00 34.24  ? 213  ILE A O   1 
ATOM   1390 C CB  . ILE A 1 183 ? -12.066 -6.966  30.652 1.00 34.35  ? 213  ILE A CB  1 
ATOM   1391 C CG1 . ILE A 1 183 ? -12.658 -6.619  32.027 1.00 31.80  ? 213  ILE A CG1 1 
ATOM   1392 C CG2 . ILE A 1 183 ? -10.806 -6.120  30.321 1.00 30.37  ? 213  ILE A CG2 1 
ATOM   1393 C CD1 . ILE A 1 183 ? -11.724 -6.883  33.209 1.00 33.81  ? 213  ILE A CD1 1 
ATOM   1394 N N   . ILE A 1 184 ? -12.228 -8.023  27.679 1.00 32.91  ? 214  ILE A N   1 
ATOM   1395 C CA  . ILE A 1 184 ? -11.533 -8.189  26.406 1.00 32.53  ? 214  ILE A CA  1 
ATOM   1396 C C   . ILE A 1 184 ? -12.433 -7.958  25.212 1.00 33.03  ? 214  ILE A C   1 
ATOM   1397 O O   . ILE A 1 184 ? -12.016 -7.322  24.247 1.00 33.28  ? 214  ILE A O   1 
ATOM   1398 C CB  . ILE A 1 184 ? -10.835 -9.559  26.311 1.00 32.46  ? 214  ILE A CB  1 
ATOM   1399 C CG1 . ILE A 1 184 ? -9.553  -9.510  27.146 1.00 29.45  ? 214  ILE A CG1 1 
ATOM   1400 C CG2 . ILE A 1 184 ? -10.526 -9.917  24.858 1.00 28.89  ? 214  ILE A CG2 1 
ATOM   1401 C CD1 . ILE A 1 184 ? -9.131  -10.835 27.713 1.00 28.91  ? 214  ILE A CD1 1 
ATOM   1402 N N   . SER A 1 185 ? -13.661 -8.472  25.266 1.00 33.03  ? 215  SER A N   1 
ATOM   1403 C CA  . SER A 1 185 ? -14.608 -8.232  24.167 1.00 33.34  ? 215  SER A CA  1 
ATOM   1404 C C   . SER A 1 185 ? -15.223 -6.833  24.141 1.00 34.81  ? 215  SER A C   1 
ATOM   1405 O O   . SER A 1 185 ? -15.474 -6.306  23.059 1.00 36.61  ? 215  SER A O   1 
ATOM   1406 C CB  . SER A 1 185 ? -15.711 -9.280  24.132 1.00 32.94  ? 215  SER A CB  1 
ATOM   1407 O OG  . SER A 1 185 ? -15.185 -10.540 23.721 1.00 38.45  ? 215  SER A OG  1 
ATOM   1408 N N   . PHE A 1 186 ? -15.432 -6.218  25.310 1.00 33.99  ? 216  PHE A N   1 
ATOM   1409 C CA  . PHE A 1 186 ? -16.292 -5.044  25.396 1.00 32.14  ? 216  PHE A CA  1 
ATOM   1410 C C   . PHE A 1 186 ? -15.684 -3.821  26.093 1.00 32.63  ? 216  PHE A C   1 
ATOM   1411 O O   . PHE A 1 186 ? -15.505 -2.783  25.461 1.00 33.72  ? 216  PHE A O   1 
ATOM   1412 C CB  . PHE A 1 186 ? -17.663 -5.448  25.996 1.00 32.39  ? 216  PHE A CB  1 
ATOM   1413 C CG  . PHE A 1 186 ? -18.637 -4.309  26.131 1.00 28.28  ? 216  PHE A CG  1 
ATOM   1414 C CD1 . PHE A 1 186 ? -19.423 -3.923  25.054 1.00 25.64  ? 216  PHE A CD1 1 
ATOM   1415 C CD2 . PHE A 1 186 ? -18.763 -3.625  27.333 1.00 27.66  ? 216  PHE A CD2 1 
ATOM   1416 C CE1 . PHE A 1 186 ? -20.327 -2.873  25.172 1.00 28.36  ? 216  PHE A CE1 1 
ATOM   1417 C CE2 . PHE A 1 186 ? -19.661 -2.577  27.462 1.00 29.69  ? 216  PHE A CE2 1 
ATOM   1418 C CZ  . PHE A 1 186 ? -20.444 -2.193  26.381 1.00 26.80  ? 216  PHE A CZ  1 
ATOM   1419 N N   . TYR A 1 187 ? -15.367 -3.925  27.381 1.00 33.58  ? 217  TYR A N   1 
ATOM   1420 C CA  . TYR A 1 187 ? -14.915 -2.740  28.132 1.00 32.81  ? 217  TYR A CA  1 
ATOM   1421 C C   . TYR A 1 187 ? -13.714 -1.995  27.544 1.00 33.42  ? 217  TYR A C   1 
ATOM   1422 O O   . TYR A 1 187 ? -13.734 -0.763  27.476 1.00 34.27  ? 217  TYR A O   1 
ATOM   1423 C CB  . TYR A 1 187 ? -14.703 -3.063  29.611 1.00 32.53  ? 217  TYR A CB  1 
ATOM   1424 C CG  . TYR A 1 187 ? -16.007 -3.272  30.349 1.00 34.44  ? 217  TYR A CG  1 
ATOM   1425 C CD1 . TYR A 1 187 ? -16.851 -2.187  30.641 1.00 34.25  ? 217  TYR A CD1 1 
ATOM   1426 C CD2 . TYR A 1 187 ? -16.414 -4.544  30.726 1.00 31.24  ? 217  TYR A CD2 1 
ATOM   1427 C CE1 . TYR A 1 187 ? -18.062 -2.370  31.301 1.00 33.55  ? 217  TYR A CE1 1 
ATOM   1428 C CE2 . TYR A 1 187 ? -17.625 -4.741  31.389 1.00 35.47  ? 217  TYR A CE2 1 
ATOM   1429 C CZ  . TYR A 1 187 ? -18.442 -3.655  31.673 1.00 35.72  ? 217  TYR A CZ  1 
ATOM   1430 O OH  . TYR A 1 187 ? -19.628 -3.863  32.333 1.00 34.41  ? 217  TYR A OH  1 
ATOM   1431 N N   . ILE A 1 188 ? -12.682 -2.729  27.115 1.00 32.96  ? 218  ILE A N   1 
ATOM   1432 C CA  . ILE A 1 188 ? -11.474 -2.098  26.557 1.00 32.51  ? 218  ILE A CA  1 
ATOM   1433 C C   . ILE A 1 188 ? -11.751 -1.375  25.225 1.00 30.75  ? 218  ILE A C   1 
ATOM   1434 O O   . ILE A 1 188 ? -11.471 -0.186  25.126 1.00 29.37  ? 218  ILE A O   1 
ATOM   1435 C CB  . ILE A 1 188 ? -10.275 -3.080  26.437 1.00 32.89  ? 218  ILE A CB  1 
ATOM   1436 C CG1 . ILE A 1 188 ? -9.836  -3.516  27.838 1.00 34.38  ? 218  ILE A CG1 1 
ATOM   1437 C CG2 . ILE A 1 188 ? -9.111  -2.433  25.642 1.00 29.65  ? 218  ILE A CG2 1 
ATOM   1438 C CD1 . ILE A 1 188 ? -8.717  -4.535  27.855 1.00 35.45  ? 218  ILE A CD1 1 
ATOM   1439 N N   . PRO A 1 189 ? -12.300 -2.088  24.209 1.00 30.10  ? 219  PRO A N   1 
ATOM   1440 C CA  . PRO A 1 189 ? -12.677 -1.356  22.994 1.00 30.82  ? 219  PRO A CA  1 
ATOM   1441 C C   . PRO A 1 189 ? -13.691 -0.237  23.276 1.00 31.77  ? 219  PRO A C   1 
ATOM   1442 O O   . PRO A 1 189 ? -13.617 0.807   22.632 1.00 33.56  ? 219  PRO A O   1 
ATOM   1443 C CB  . PRO A 1 189 ? -13.278 -2.429  22.071 1.00 29.18  ? 219  PRO A CB  1 
ATOM   1444 C CG  . PRO A 1 189 ? -13.081 -3.708  22.714 1.00 26.48  ? 219  PRO A CG  1 
ATOM   1445 C CD  . PRO A 1 189 ? -12.566 -3.534  24.097 1.00 29.37  ? 219  PRO A CD  1 
ATOM   1446 N N   . LEU A 1 190 ? -14.602 -0.438  24.233 1.00 32.73  ? 220  LEU A N   1 
ATOM   1447 C CA  . LEU A 1 190 ? -15.513 0.650   24.652 1.00 36.53  ? 220  LEU A CA  1 
ATOM   1448 C C   . LEU A 1 190 ? -14.757 1.899   25.079 1.00 37.11  ? 220  LEU A C   1 
ATOM   1449 O O   . LEU A 1 190 ? -15.080 3.002   24.639 1.00 40.69  ? 220  LEU A O   1 
ATOM   1450 C CB  . LEU A 1 190 ? -16.516 0.240   25.760 1.00 35.40  ? 220  LEU A CB  1 
ATOM   1451 C CG  . LEU A 1 190 ? -17.689 1.234   25.902 1.00 37.86  ? 220  LEU A CG  1 
ATOM   1452 C CD1 . LEU A 1 190 ? -18.759 1.050   24.803 1.00 38.53  ? 220  LEU A CD1 1 
ATOM   1453 C CD2 . LEU A 1 190 ? -18.342 1.204   27.275 1.00 36.44  ? 220  LEU A CD2 1 
ATOM   1454 N N   . LEU A 1 191 ? -13.749 1.719   25.921 1.00 37.33  ? 221  LEU A N   1 
ATOM   1455 C CA  . LEU A 1 191 ? -13.006 2.846   26.467 1.00 38.86  ? 221  LEU A CA  1 
ATOM   1456 C C   . LEU A 1 191 ? -12.193 3.562   25.400 1.00 39.13  ? 221  LEU A C   1 
ATOM   1457 O O   . LEU A 1 191 ? -12.166 4.794   25.372 1.00 40.33  ? 221  LEU A O   1 
ATOM   1458 C CB  . LEU A 1 191 ? -12.138 2.397   27.643 1.00 38.80  ? 221  LEU A CB  1 
ATOM   1459 C CG  . LEU A 1 191 ? -13.005 1.864   28.799 1.00 41.49  ? 221  LEU A CG  1 
ATOM   1460 C CD1 . LEU A 1 191 ? -12.230 0.878   29.688 1.00 42.13  ? 221  LEU A CD1 1 
ATOM   1461 C CD2 . LEU A 1 191 ? -13.651 2.998   29.626 1.00 38.72  ? 221  LEU A CD2 1 
ATOM   1462 N N   . ILE A 1 192 ? -11.552 2.791   24.522 1.00 38.82  ? 222  ILE A N   1 
ATOM   1463 C CA  . ILE A 1 192 ? -10.840 3.333   23.372 1.00 39.55  ? 222  ILE A CA  1 
ATOM   1464 C C   . ILE A 1 192 ? -11.794 4.152   22.481 1.00 41.69  ? 222  ILE A C   1 
ATOM   1465 O O   . ILE A 1 192 ? -11.516 5.326   22.191 1.00 43.52  ? 222  ILE A O   1 
ATOM   1466 C CB  . ILE A 1 192 ? -10.137 2.212   22.568 1.00 39.41  ? 222  ILE A CB  1 
ATOM   1467 C CG1 . ILE A 1 192 ? -9.060  1.540   23.420 1.00 34.15  ? 222  ILE A CG1 1 
ATOM   1468 C CG2 . ILE A 1 192 ? -9.530  2.755   21.240 1.00 39.33  ? 222  ILE A CG2 1 
ATOM   1469 C CD1 . ILE A 1 192 ? -8.582  0.202   22.867 1.00 27.96  ? 222  ILE A CD1 1 
ATOM   1470 N N   . MET A 1 193 ? -12.909 3.542   22.071 1.00 40.89  ? 223  MET A N   1 
ATOM   1471 C CA  . MET A 1 193 ? -13.922 4.223   21.262 1.00 41.31  ? 223  MET A CA  1 
ATOM   1472 C C   . MET A 1 193 ? -14.386 5.555   21.871 1.00 42.21  ? 223  MET A C   1 
ATOM   1473 O O   . MET A 1 193 ? -14.439 6.558   21.165 1.00 42.79  ? 223  MET A O   1 
ATOM   1474 C CB  . MET A 1 193 ? -15.133 3.322   21.031 1.00 41.07  ? 223  MET A CB  1 
ATOM   1475 C CG  . MET A 1 193 ? -16.136 3.888   20.033 1.00 42.83  ? 223  MET A CG  1 
ATOM   1476 S SD  . MET A 1 193 ? -17.777 3.129   20.138 1.00 49.84  ? 223  MET A SD  1 
ATOM   1477 C CE  . MET A 1 193 ? -18.452 3.981   21.577 1.00 53.58  ? 223  MET A CE  1 
ATOM   1478 N N   . ILE A 1 194 ? -14.716 5.567   23.167 1.00 40.88  ? 224  ILE A N   1 
ATOM   1479 C CA  . ILE A 1 194 ? -15.147 6.803   23.840 1.00 40.60  ? 224  ILE A CA  1 
ATOM   1480 C C   . ILE A 1 194 ? -14.035 7.867   23.847 1.00 41.92  ? 224  ILE A C   1 
ATOM   1481 O O   . ILE A 1 194 ? -14.262 9.011   23.450 1.00 42.19  ? 224  ILE A O   1 
ATOM   1482 C CB  . ILE A 1 194 ? -15.664 6.526   25.272 1.00 40.25  ? 224  ILE A CB  1 
ATOM   1483 C CG1 . ILE A 1 194 ? -16.964 5.726   25.219 1.00 39.06  ? 224  ILE A CG1 1 
ATOM   1484 C CG2 . ILE A 1 194 ? -15.867 7.828   26.060 1.00 38.07  ? 224  ILE A CG2 1 
ATOM   1485 C CD1 . ILE A 1 194 ? -17.290 5.011   26.504 1.00 37.57  ? 224  ILE A CD1 1 
ATOM   1486 N N   . PHE A 1 195 ? -12.839 7.475   24.275 1.00 41.52  ? 225  PHE A N   1 
ATOM   1487 C CA  . PHE A 1 195 ? -11.695 8.357   24.272 1.00 42.68  ? 225  PHE A CA  1 
ATOM   1488 C C   . PHE A 1 195 ? -11.476 8.957   22.871 1.00 43.20  ? 225  PHE A C   1 
ATOM   1489 O O   . PHE A 1 195 ? -11.349 10.179  22.737 1.00 42.68  ? 225  PHE A O   1 
ATOM   1490 C CB  . PHE A 1 195 ? -10.467 7.601   24.804 1.00 44.84  ? 225  PHE A CB  1 
ATOM   1491 C CG  . PHE A 1 195 ? -9.155  8.329   24.631 1.00 51.15  ? 225  PHE A CG  1 
ATOM   1492 C CD1 . PHE A 1 195 ? -8.810  9.389   25.468 1.00 54.29  ? 225  PHE A CD1 1 
ATOM   1493 C CD2 . PHE A 1 195 ? -8.243  7.922   23.645 1.00 53.45  ? 225  PHE A CD2 1 
ATOM   1494 C CE1 . PHE A 1 195 ? -7.581  10.054  25.311 1.00 57.26  ? 225  PHE A CE1 1 
ATOM   1495 C CE2 . PHE A 1 195 ? -7.016  8.574   23.481 1.00 56.18  ? 225  PHE A CE2 1 
ATOM   1496 C CZ  . PHE A 1 195 ? -6.686  9.644   24.312 1.00 57.75  ? 225  PHE A CZ  1 
ATOM   1497 N N   . VAL A 1 196 ? -11.462 8.117   21.832 1.00 42.52  ? 226  VAL A N   1 
ATOM   1498 C CA  . VAL A 1 196 ? -11.222 8.609   20.463 1.00 43.38  ? 226  VAL A CA  1 
ATOM   1499 C C   . VAL A 1 196 ? -12.387 9.454   19.920 1.00 44.87  ? 226  VAL A C   1 
ATOM   1500 O O   . VAL A 1 196 ? -12.172 10.481  19.283 1.00 45.01  ? 226  VAL A O   1 
ATOM   1501 C CB  . VAL A 1 196 ? -10.825 7.476   19.470 1.00 42.53  ? 226  VAL A CB  1 
ATOM   1502 C CG1 . VAL A 1 196 ? -10.742 7.999   18.027 1.00 40.50  ? 226  VAL A CG1 1 
ATOM   1503 C CG2 . VAL A 1 196 ? -9.493  6.865   19.872 1.00 42.01  ? 226  VAL A CG2 1 
ATOM   1504 N N   . ALA A 1 197 ? -13.615 9.019   20.185 1.00 47.36  ? 227  ALA A N   1 
ATOM   1505 C CA  . ALA A 1 197 ? -14.808 9.760   19.783 1.00 48.47  ? 227  ALA A CA  1 
ATOM   1506 C C   . ALA A 1 197 ? -14.874 11.154  20.420 1.00 51.04  ? 227  ALA A C   1 
ATOM   1507 O O   . ALA A 1 197 ? -15.329 12.096  19.779 1.00 52.34  ? 227  ALA A O   1 
ATOM   1508 C CB  . ALA A 1 197 ? -16.057 8.967   20.102 1.00 47.26  ? 227  ALA A CB  1 
ATOM   1509 N N   . LEU A 1 198 ? -14.416 11.289  21.668 1.00 52.47  ? 228  LEU A N   1 
ATOM   1510 C CA  . LEU A 1 198 ? -14.315 12.610  22.294 1.00 52.90  ? 228  LEU A CA  1 
ATOM   1511 C C   . LEU A 1 198 ? -13.205 13.479  21.688 1.00 54.34  ? 228  LEU A C   1 
ATOM   1512 O O   . LEU A 1 198 ? -13.385 14.683  21.537 1.00 54.46  ? 228  LEU A O   1 
ATOM   1513 C CB  . LEU A 1 198 ? -14.164 12.517  23.813 1.00 52.26  ? 228  LEU A CB  1 
ATOM   1514 C CG  . LEU A 1 198 ? -15.356 12.051  24.666 1.00 53.48  ? 228  LEU A CG  1 
ATOM   1515 C CD1 . LEU A 1 198 ? -15.096 12.359  26.141 1.00 52.93  ? 228  LEU A CD1 1 
ATOM   1516 C CD2 . LEU A 1 198 ? -16.693 12.657  24.224 1.00 54.34  ? 228  LEU A CD2 1 
ATOM   1517 N N   . ARG A 1 199 ? -12.067 12.885  21.335 1.00 56.39  ? 229  ARG A N   1 
ATOM   1518 C CA  . ARG A 1 199 ? -11.034 13.639  20.611 1.00 59.59  ? 229  ARG A CA  1 
ATOM   1519 C C   . ARG A 1 199 ? -11.564 14.119  19.248 1.00 61.10  ? 229  ARG A C   1 
ATOM   1520 O O   . ARG A 1 199 ? -11.243 15.227  18.808 1.00 61.53  ? 229  ARG A O   1 
ATOM   1521 C CB  . ARG A 1 199 ? -9.727  12.849  20.410 1.00 59.09  ? 229  ARG A CB  1 
ATOM   1522 C CG  . ARG A 1 199 ? -9.068  12.246  21.646 1.00 65.27  ? 229  ARG A CG  1 
ATOM   1523 C CD  . ARG A 1 199 ? -8.952  13.193  22.829 1.00 73.37  ? 229  ARG A CD  1 
ATOM   1524 N NE  . ARG A 1 199 ? -9.271  12.486  24.075 1.00 81.65  ? 229  ARG A NE  1 
ATOM   1525 C CZ  . ARG A 1 199 ? -9.542  13.068  25.244 1.00 87.49  ? 229  ARG A CZ  1 
ATOM   1526 N NH1 . ARG A 1 199 ? -9.534  14.391  25.363 1.00 90.21  ? 229  ARG A NH1 1 
ATOM   1527 N NH2 . ARG A 1 199 ? -9.827  12.323  26.306 1.00 89.34  ? 229  ARG A NH2 1 
ATOM   1528 N N   . VAL A 1 200 ? -12.366 13.288  18.584 1.00 61.63  ? 230  VAL A N   1 
ATOM   1529 C CA  . VAL A 1 200 ? -12.938 13.659  17.299 1.00 62.53  ? 230  VAL A CA  1 
ATOM   1530 C C   . VAL A 1 200 ? -13.930 14.798  17.517 1.00 65.78  ? 230  VAL A C   1 
ATOM   1531 O O   . VAL A 1 200 ? -14.121 15.636  16.638 1.00 66.44  ? 230  VAL A O   1 
ATOM   1532 C CB  . VAL A 1 200 ? -13.602 12.455  16.580 1.00 61.55  ? 230  VAL A CB  1 
ATOM   1533 C CG1 . VAL A 1 200 ? -14.264 12.884  15.272 1.00 57.31  ? 230  VAL A CG1 1 
ATOM   1534 C CG2 . VAL A 1 200 ? -12.576 11.383  16.298 1.00 59.79  ? 230  VAL A CG2 1 
ATOM   1535 N N   . TYR A 1 201 ? -14.532 14.843  18.702 1.00 68.97  ? 231  TYR A N   1 
ATOM   1536 C CA  . TYR A 1 201 ? -15.468 15.910  19.038 1.00 72.68  ? 231  TYR A CA  1 
ATOM   1537 C C   . TYR A 1 201 ? -14.758 17.232  19.324 1.00 74.76  ? 231  TYR A C   1 
ATOM   1538 O O   . TYR A 1 201 ? -15.226 18.281  18.891 1.00 75.67  ? 231  TYR A O   1 
ATOM   1539 C CB  . TYR A 1 201 ? -16.377 15.520  20.208 1.00 73.34  ? 231  TYR A CB  1 
ATOM   1540 C CG  . TYR A 1 201 ? -17.392 16.590  20.562 1.00 78.36  ? 231  TYR A CG  1 
ATOM   1541 C CD1 . TYR A 1 201 ? -18.555 16.759  19.803 1.00 80.55  ? 231  TYR A CD1 1 
ATOM   1542 C CD2 . TYR A 1 201 ? -17.185 17.444  21.655 1.00 81.55  ? 231  TYR A CD2 1 
ATOM   1543 C CE1 . TYR A 1 201 ? -19.489 17.748  20.125 1.00 83.08  ? 231  TYR A CE1 1 
ATOM   1544 C CE2 . TYR A 1 201 ? -18.112 18.436  21.986 1.00 83.13  ? 231  TYR A CE2 1 
ATOM   1545 C CZ  . TYR A 1 201 ? -19.260 18.582  21.217 1.00 84.53  ? 231  TYR A CZ  1 
ATOM   1546 O OH  . TYR A 1 201 ? -20.176 19.559  21.538 1.00 84.46  ? 231  TYR A OH  1 
ATOM   1547 N N   . ARG A 1 202 ? -13.643 17.184  20.051 1.00 77.05  ? 232  ARG A N   1 
ATOM   1548 C CA  . ARG A 1 202 ? -12.853 18.386  20.306 1.00 79.49  ? 232  ARG A CA  1 
ATOM   1549 C C   . ARG A 1 202 ? -12.299 18.964  19.003 1.00 80.28  ? 232  ARG A C   1 
ATOM   1550 O O   . ARG A 1 202 ? -12.381 20.171  18.776 1.00 80.65  ? 232  ARG A O   1 
ATOM   1551 C CB  . ARG A 1 202 ? -11.707 18.118  21.292 1.00 80.92  ? 232  ARG A CB  1 
ATOM   1552 C CG  . ARG A 1 202 ? -10.956 19.397  21.701 1.00 85.56  ? 232  ARG A CG  1 
ATOM   1553 C CD  . ARG A 1 202 ? -9.475  19.154  21.961 1.00 90.28  ? 232  ARG A CD  1 
ATOM   1554 N NE  . ARG A 1 202 ? -9.216  18.745  23.342 1.00 95.23  ? 232  ARG A NE  1 
ATOM   1555 C CZ  . ARG A 1 202 ? -9.009  17.489  23.735 1.00 98.98  ? 232  ARG A CZ  1 
ATOM   1556 N NH1 . ARG A 1 202 ? -9.024  16.493  22.856 1.00 99.72  ? 232  ARG A NH1 1 
ATOM   1557 N NH2 . ARG A 1 202 ? -8.782  17.230  25.019 1.00 101.23 ? 232  ARG A NH2 1 
ATOM   1558 N N   . GLU A 1 203 ? -11.755 18.093  18.152 1.00 81.52  ? 233  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 203 ? -11.091 18.505  16.911 1.00 82.49  ? 233  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 203 ? -12.051 18.946  15.812 1.00 82.56  ? 233  GLU A C   1 
ATOM   1561 O O   . GLU A 1 203 ? -11.660 19.671  14.893 1.00 82.96  ? 233  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 203 ? -10.150 17.411  16.395 1.00 83.13  ? 233  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 203 ? -8.782  17.391  17.082 1.00 84.09  ? 233  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 203 ? -7.853  18.504  16.610 1.00 87.10  ? 233  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 203 ? -8.080  19.063  15.514 1.00 89.42  ? 233  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 203 ? -6.885  18.814  17.337 1.00 87.98  ? 233  GLU A OE2 1 
ATOM   1567 N N   . ALA A 1 204 ? -13.300 18.500  15.906 1.00 83.01  ? 234  ALA A N   1 
ATOM   1568 C CA  . ALA A 1 204 ? -14.349 18.969  15.002 1.00 83.27  ? 234  ALA A CA  1 
ATOM   1569 C C   . ALA A 1 204 ? -14.892 20.321  15.454 1.00 83.78  ? 234  ALA A C   1 
ATOM   1570 O O   . ALA A 1 204 ? -15.509 21.038  14.669 1.00 84.04  ? 234  ALA A O   1 
ATOM   1571 C CB  . ALA A 1 204 ? -15.475 17.949  14.902 1.00 82.89  ? 234  ALA A CB  1 
ATOM   1572 N N   . LYS A 1 205 ? -14.659 20.670  16.718 1.00 84.57  ? 235  LYS A N   1 
ATOM   1573 C CA  . LYS A 1 205 ? -15.124 21.948  17.250 1.00 85.34  ? 235  LYS A CA  1 
ATOM   1574 C C   . LYS A 1 205 ? -14.170 23.092  16.875 1.00 86.09  ? 235  LYS A C   1 
ATOM   1575 O O   . LYS A 1 205 ? -14.610 24.221  16.640 1.00 86.14  ? 235  LYS A O   1 
ATOM   1576 C CB  . LYS A 1 205 ? -15.350 21.864  18.763 1.00 85.13  ? 235  LYS A CB  1 
ATOM   1577 C CG  . LYS A 1 205 ? -16.689 22.449  19.202 1.00 84.61  ? 235  LYS A CG  1 
ATOM   1578 C CD  . LYS A 1 205 ? -17.103 21.981  20.586 1.00 83.49  ? 235  LYS A CD  1 
ATOM   1579 C CE  . LYS A 1 205 ? -16.463 22.824  21.671 1.00 83.34  ? 235  LYS A CE  1 
ATOM   1580 N NZ  . LYS A 1 205 ? -16.565 22.147  22.987 1.00 82.85  ? 235  LYS A NZ  1 
ATOM   1581 N N   . GLU A 1 206 ? -12.874 22.791  16.789 1.00 86.49  ? 236  GLU A N   1 
ATOM   1582 C CA  . GLU A 1 206 ? -11.883 23.766  16.328 1.00 87.02  ? 236  GLU A CA  1 
ATOM   1583 C C   . GLU A 1 206 ? -11.941 23.982  14.802 1.00 86.70  ? 236  GLU A C   1 
ATOM   1584 O O   . GLU A 1 206 ? -10.903 24.061  14.136 1.00 87.43  ? 236  GLU A O   1 
ATOM   1585 C CB  . GLU A 1 206 ? -10.473 23.372  16.793 1.00 87.56  ? 236  GLU A CB  1 
ATOM   1586 C CG  . GLU A 1 206 ? -10.246 23.532  18.303 1.00 90.97  ? 236  GLU A CG  1 
ATOM   1587 C CD  . GLU A 1 206 ? -8.769  23.646  18.691 1.00 96.07  ? 236  GLU A CD  1 
ATOM   1588 O OE1 . GLU A 1 206 ? -7.947  24.104  17.861 1.00 96.37  ? 236  GLU A OE1 1 
ATOM   1589 O OE2 . GLU A 1 206 ? -8.429  23.284  19.841 1.00 97.80  ? 236  GLU A OE2 1 
ATOM   1590 N N   . GLN A 1 207 ? -13.163 24.085  14.266 1.00 85.65  ? 237  GLN A N   1 
ATOM   1591 C CA  . GLN A 1 207 ? -13.408 24.275  12.830 1.00 84.57  ? 237  GLN A CA  1 
ATOM   1592 C C   . GLN A 1 207 ? -14.564 25.240  12.589 1.00 84.36  ? 237  GLN A C   1 
ATOM   1593 O O   . GLN A 1 207 ? -14.404 26.457  12.707 1.00 84.88  ? 237  GLN A O   1 
ATOM   1594 C CB  . GLN A 1 207 ? -13.708 22.939  12.139 1.00 84.00  ? 237  GLN A CB  1 
ATOM   1595 C CG  . GLN A 1 207 ? -12.556 21.928  12.140 1.00 80.81  ? 237  GLN A CG  1 
ATOM   1596 C CD  . GLN A 1 207 ? -12.839 20.671  11.312 1.00 79.87  ? 237  GLN A CD  1 
ATOM   1597 O OE1 . GLN A 1 207 ? -13.988 20.352  10.986 1.00 77.47  ? 237  GLN A OE1 1 
ATOM   1598 N NE2 . GLN A 1 207 ? -11.779 19.950  10.973 1.00 78.48  ? 237  GLN A NE2 1 
ATOM   1599 N N   . SER A 1 220 ? -16.815 25.723  1.464  1.00 93.52  ? 278  SER A N   1 
ATOM   1600 C CA  . SER A 1 220 ? -17.894 26.620  1.922  1.00 93.17  ? 278  SER A CA  1 
ATOM   1601 C C   . SER A 1 220 ? -18.460 26.083  3.248  1.00 93.21  ? 278  SER A C   1 
ATOM   1602 O O   . SER A 1 220 ? -18.410 24.878  3.492  1.00 91.98  ? 278  SER A O   1 
ATOM   1603 C CB  . SER A 1 220 ? -19.005 26.686  0.836  1.00 93.01  ? 278  SER A CB  1 
ATOM   1604 O OG  . SER A 1 220 ? -19.270 28.041  0.449  1.00 92.91  ? 278  SER A OG  1 
ATOM   1605 N N   . ARG A 1 221 ? -18.967 26.983  4.102  1.00 94.20  ? 279  ARG A N   1 
ATOM   1606 C CA  . ARG A 1 221 ? -19.763 26.644  5.303  1.00 94.66  ? 279  ARG A CA  1 
ATOM   1607 C C   . ARG A 1 221 ? -20.725 25.462  5.079  1.00 94.70  ? 279  ARG A C   1 
ATOM   1608 O O   . ARG A 1 221 ? -20.960 24.650  5.987  1.00 94.81  ? 279  ARG A O   1 
ATOM   1609 C CB  . ARG A 1 221 ? -20.557 27.878  5.765  1.00 94.84  ? 279  ARG A CB  1 
ATOM   1610 C CG  . ARG A 1 221 ? -21.504 27.621  6.932  1.00 96.23  ? 279  ARG A CG  1 
ATOM   1611 C CD  . ARG A 1 221 ? -22.523 28.730  7.103  1.00 98.29  ? 279  ARG A CD  1 
ATOM   1612 N NE  . ARG A 1 221 ? -23.548 28.337  8.066  1.00 100.97 ? 279  ARG A NE  1 
ATOM   1613 C CZ  . ARG A 1 221 ? -23.413 28.414  9.389  1.00 102.11 ? 279  ARG A CZ  1 
ATOM   1614 N NH1 . ARG A 1 221 ? -22.288 28.876  9.929  1.00 101.25 ? 279  ARG A NH1 1 
ATOM   1615 N NH2 . ARG A 1 221 ? -24.409 28.025  10.177 1.00 102.61 ? 279  ARG A NH2 1 
ATOM   1616 N N   . VAL A 1 222 ? -21.278 25.390  3.867  1.00 94.25  ? 280  VAL A N   1 
ATOM   1617 C CA  . VAL A 1 222 ? -22.178 24.313  3.452  1.00 93.36  ? 280  VAL A CA  1 
ATOM   1618 C C   . VAL A 1 222 ? -21.473 22.947  3.512  1.00 93.53  ? 280  VAL A C   1 
ATOM   1619 O O   . VAL A 1 222 ? -22.034 21.972  4.026  1.00 93.74  ? 280  VAL A O   1 
ATOM   1620 C CB  . VAL A 1 222 ? -22.763 24.592  2.035  1.00 92.66  ? 280  VAL A CB  1 
ATOM   1621 C CG1 . VAL A 1 222 ? -23.661 23.448  1.564  1.00 91.79  ? 280  VAL A CG1 1 
ATOM   1622 C CG2 . VAL A 1 222 ? -23.529 25.922  2.024  1.00 91.52  ? 280  VAL A CG2 1 
ATOM   1623 N N   . MET A 1 223 ? -20.236 22.901  3.016  1.00 93.26  ? 281  MET A N   1 
ATOM   1624 C CA  . MET A 1 223 ? -19.441 21.667  2.980  1.00 93.41  ? 281  MET A CA  1 
ATOM   1625 C C   . MET A 1 223 ? -19.063 21.144  4.379  1.00 91.68  ? 281  MET A C   1 
ATOM   1626 O O   . MET A 1 223 ? -19.092 19.936  4.614  1.00 91.00  ? 281  MET A O   1 
ATOM   1627 C CB  . MET A 1 223 ? -18.182 21.854  2.119  1.00 94.84  ? 281  MET A CB  1 
ATOM   1628 C CG  . MET A 1 223 ? -18.428 22.398  0.697  1.00 100.25 ? 281  MET A CG  1 
ATOM   1629 S SD  . MET A 1 223 ? -19.190 21.220  -0.457 1.00 108.78 ? 281  MET A SD  1 
ATOM   1630 C CE  . MET A 1 223 ? -19.107 22.120  -2.011 1.00 106.17 ? 281  MET A CE  1 
ATOM   1631 N N   . LEU A 1 224 ? -18.712 22.054  5.291  1.00 90.00  ? 282  LEU A N   1 
ATOM   1632 C CA  . LEU A 1 224 ? -18.371 21.691  6.672  1.00 88.72  ? 282  LEU A CA  1 
ATOM   1633 C C   . LEU A 1 224 ? -19.595 21.234  7.470  1.00 88.38  ? 282  LEU A C   1 
ATOM   1634 O O   . LEU A 1 224 ? -19.470 20.402  8.370  1.00 88.07  ? 282  LEU A O   1 
ATOM   1635 C CB  . LEU A 1 224 ? -17.669 22.851  7.397  1.00 88.36  ? 282  LEU A CB  1 
ATOM   1636 C CG  . LEU A 1 224 ? -16.902 22.522  8.688  1.00 87.52  ? 282  LEU A CG  1 
ATOM   1637 C CD1 . LEU A 1 224 ? -15.566 21.857  8.370  1.00 86.02  ? 282  LEU A CD1 1 
ATOM   1638 C CD2 . LEU A 1 224 ? -16.692 23.761  9.566  1.00 86.54  ? 282  LEU A CD2 1 
ATOM   1639 N N   . MET A 1 225 ? -20.766 21.782  7.144  1.00 88.19  ? 283  MET A N   1 
ATOM   1640 C CA  . MET A 1 225 ? -22.018 21.373  7.785  1.00 88.31  ? 283  MET A CA  1 
ATOM   1641 C C   . MET A 1 225 ? -22.403 19.954  7.388  1.00 86.12  ? 283  MET A C   1 
ATOM   1642 O O   . MET A 1 225 ? -22.847 19.170  8.230  1.00 85.58  ? 283  MET A O   1 
ATOM   1643 C CB  . MET A 1 225 ? -23.159 22.350  7.467  1.00 89.71  ? 283  MET A CB  1 
ATOM   1644 C CG  . MET A 1 225 ? -23.184 23.606  8.352  1.00 94.96  ? 283  MET A CG  1 
ATOM   1645 S SD  . MET A 1 225 ? -23.618 23.322  10.099 1.00 102.79 ? 283  MET A SD  1 
ATOM   1646 C CE  . MET A 1 225 ? -25.413 23.229  10.026 1.00 101.39 ? 283  MET A CE  1 
ATOM   1647 N N   . ARG A 1 226 ? -22.211 19.632  6.110  1.00 84.25  ? 284  ARG A N   1 
ATOM   1648 C CA  . ARG A 1 226 ? -22.518 18.304  5.584  1.00 83.22  ? 284  ARG A CA  1 
ATOM   1649 C C   . ARG A 1 226 ? -21.593 17.228  6.158  1.00 81.46  ? 284  ARG A C   1 
ATOM   1650 O O   . ARG A 1 226 ? -21.995 16.081  6.335  1.00 80.99  ? 284  ARG A O   1 
ATOM   1651 C CB  . ARG A 1 226 ? -22.444 18.302  4.058  1.00 84.02  ? 284  ARG A CB  1 
ATOM   1652 C CG  . ARG A 1 226 ? -23.433 17.347  3.409  1.00 87.69  ? 284  ARG A CG  1 
ATOM   1653 C CD  . ARG A 1 226 ? -22.996 16.937  2.009  1.00 94.37  ? 284  ARG A CD  1 
ATOM   1654 N NE  . ARG A 1 226 ? -23.082 18.030  1.041  1.00 98.79  ? 284  ARG A NE  1 
ATOM   1655 C CZ  . ARG A 1 226 ? -22.673 17.949  -0.224 1.00 101.84 ? 284  ARG A CZ  1 
ATOM   1656 N NH1 . ARG A 1 226 ? -22.140 16.823  -0.693 1.00 102.08 ? 284  ARG A NH1 1 
ATOM   1657 N NH2 . ARG A 1 226 ? -22.795 19.003  -1.024 1.00 103.41 ? 284  ARG A NH2 1 
ATOM   1658 N N   . GLU A 1 227 ? -20.354 17.612  6.445  1.00 80.55  ? 285  GLU A N   1 
ATOM   1659 C CA  . GLU A 1 227 ? -19.383 16.721  7.076  1.00 79.53  ? 285  GLU A CA  1 
ATOM   1660 C C   . GLU A 1 227 ? -19.691 16.489  8.557  1.00 77.46  ? 285  GLU A C   1 
ATOM   1661 O O   . GLU A 1 227 ? -19.468 15.394  9.078  1.00 77.76  ? 285  GLU A O   1 
ATOM   1662 C CB  . GLU A 1 227 ? -17.959 17.265  6.909  1.00 80.43  ? 285  GLU A CB  1 
ATOM   1663 C CG  . GLU A 1 227 ? -17.270 16.833  5.616  1.00 84.23  ? 285  GLU A CG  1 
ATOM   1664 C CD  . GLU A 1 227 ? -15.919 17.516  5.395  1.00 91.86  ? 285  GLU A CD  1 
ATOM   1665 O OE1 . GLU A 1 227 ? -15.215 17.827  6.387  1.00 94.31  ? 285  GLU A OE1 1 
ATOM   1666 O OE2 . GLU A 1 227 ? -15.552 17.738  4.218  1.00 95.37  ? 285  GLU A OE2 1 
ATOM   1667 N N   . HIS A 1 228 ? -20.197 17.521  9.228  1.00 74.22  ? 286  HIS A N   1 
ATOM   1668 C CA  . HIS A 1 228 ? -20.574 17.418  10.633 1.00 71.06  ? 286  HIS A CA  1 
ATOM   1669 C C   . HIS A 1 228 ? -21.884 16.657  10.823 1.00 68.96  ? 286  HIS A C   1 
ATOM   1670 O O   . HIS A 1 228 ? -22.082 16.024  11.853 1.00 69.14  ? 286  HIS A O   1 
ATOM   1671 C CB  . HIS A 1 228 ? -20.638 18.805  11.278 1.00 71.35  ? 286  HIS A CB  1 
ATOM   1672 C CG  . HIS A 1 228 ? -19.294 19.366  11.632 1.00 72.84  ? 286  HIS A CG  1 
ATOM   1673 N ND1 . HIS A 1 228 ? -19.086 20.151  12.746 1.00 74.97  ? 286  HIS A ND1 1 
ATOM   1674 C CD2 . HIS A 1 228 ? -18.086 19.243  11.028 1.00 72.71  ? 286  HIS A CD2 1 
ATOM   1675 C CE1 . HIS A 1 228 ? -17.812 20.497  12.806 1.00 75.22  ? 286  HIS A CE1 1 
ATOM   1676 N NE2 . HIS A 1 228 ? -17.183 19.958  11.776 1.00 73.84  ? 286  HIS A NE2 1 
ATOM   1677 N N   . LYS A 1 229 ? -22.772 16.721  9.834  1.00 66.43  ? 287  LYS A N   1 
ATOM   1678 C CA  . LYS A 1 229 ? -23.965 15.886  9.829  1.00 64.11  ? 287  LYS A CA  1 
ATOM   1679 C C   . LYS A 1 229 ? -23.545 14.417  9.787  1.00 61.43  ? 287  LYS A C   1 
ATOM   1680 O O   . LYS A 1 229 ? -24.045 13.607  10.562 1.00 61.99  ? 287  LYS A O   1 
ATOM   1681 C CB  . LYS A 1 229 ? -24.871 16.215  8.636  1.00 65.45  ? 287  LYS A CB  1 
ATOM   1682 C CG  . LYS A 1 229 ? -26.338 15.795  8.817  1.00 71.19  ? 287  LYS A CG  1 
ATOM   1683 C CD  . LYS A 1 229 ? -27.095 15.698  7.484  1.00 76.26  ? 287  LYS A CD  1 
ATOM   1684 C CE  . LYS A 1 229 ? -28.611 15.550  7.692  1.00 81.21  ? 287  LYS A CE  1 
ATOM   1685 N NZ  . LYS A 1 229 ? -29.297 16.832  8.088  1.00 84.67  ? 287  LYS A NZ  1 
ATOM   1686 N N   . ALA A 1 230 ? -22.608 14.090  8.897  1.00 58.92  ? 288  ALA A N   1 
ATOM   1687 C CA  . ALA A 1 230 ? -22.101 12.718  8.742  1.00 55.95  ? 288  ALA A CA  1 
ATOM   1688 C C   . ALA A 1 230 ? -21.439 12.178  10.014 1.00 54.21  ? 288  ALA A C   1 
ATOM   1689 O O   . ALA A 1 230 ? -21.661 11.027  10.387 1.00 51.87  ? 288  ALA A O   1 
ATOM   1690 C CB  . ALA A 1 230 ? -21.145 12.636  7.570  1.00 55.20  ? 288  ALA A CB  1 
ATOM   1691 N N   . LEU A 1 231 ? -20.637 13.017  10.671 1.00 53.55  ? 289  LEU A N   1 
ATOM   1692 C CA  . LEU A 1 231 ? -19.957 12.647  11.908 1.00 53.14  ? 289  LEU A CA  1 
ATOM   1693 C C   . LEU A 1 231 ? -20.945 12.387  13.039 1.00 54.10  ? 289  LEU A C   1 
ATOM   1694 O O   . LEU A 1 231 ? -20.767 11.444  13.812 1.00 54.77  ? 289  LEU A O   1 
ATOM   1695 C CB  . LEU A 1 231 ? -18.974 13.738  12.337 1.00 53.07  ? 289  LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 231 ? -17.577 13.809  11.732 1.00 52.43  ? 289  LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 231 ? -16.820 14.905  12.457 1.00 53.41  ? 289  LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 231 ? -16.838 12.470  11.839 1.00 51.07  ? 289  LEU A CD2 1 
ATOM   1699 N N   . LYS A 1 232 ? -21.970 13.238  13.131 1.00 54.03  ? 290  LYS A N   1 
ATOM   1700 C CA  . LYS A 1 232 ? -23.026 13.097  14.120 1.00 53.95  ? 290  LYS A CA  1 
ATOM   1701 C C   . LYS A 1 232 ? -23.725 11.748  13.942 1.00 51.81  ? 290  LYS A C   1 
ATOM   1702 O O   . LYS A 1 232 ? -24.052 11.079  14.921 1.00 50.91  ? 290  LYS A O   1 
ATOM   1703 C CB  . LYS A 1 232 ? -24.025 14.252  14.003 1.00 55.76  ? 290  LYS A CB  1 
ATOM   1704 C CG  . LYS A 1 232 ? -24.795 14.556  15.288 1.00 63.21  ? 290  LYS A CG  1 
ATOM   1705 C CD  . LYS A 1 232 ? -25.714 15.762  15.115 1.00 70.24  ? 290  LYS A CD  1 
ATOM   1706 C CE  . LYS A 1 232 ? -26.618 15.957  16.336 1.00 75.01  ? 290  LYS A CE  1 
ATOM   1707 N NZ  . LYS A 1 232 ? -27.891 16.669  15.993 1.00 77.31  ? 290  LYS A NZ  1 
ATOM   1708 N N   . THR A 1 233 ? -23.932 11.347  12.688 1.00 50.09  ? 291  THR A N   1 
ATOM   1709 C CA  . THR A 1 233 ? -24.526 10.048  12.381 1.00 49.07  ? 291  THR A CA  1 
ATOM   1710 C C   . THR A 1 233 ? -23.678 8.910   12.985 1.00 50.23  ? 291  THR A C   1 
ATOM   1711 O O   . THR A 1 233 ? -24.212 7.991   13.617 1.00 51.80  ? 291  THR A O   1 
ATOM   1712 C CB  . THR A 1 233 ? -24.716 9.864   10.866 1.00 48.18  ? 291  THR A CB  1 
ATOM   1713 O OG1 . THR A 1 233 ? -25.469 10.965  10.348 1.00 51.29  ? 291  THR A OG1 1 
ATOM   1714 C CG2 . THR A 1 233 ? -25.461 8.589   10.556 1.00 45.30  ? 291  THR A CG2 1 
ATOM   1715 N N   . LEU A 1 234 ? -22.360 9.001   12.825 1.00 49.36  ? 292  LEU A N   1 
ATOM   1716 C CA  . LEU A 1 234 ? -21.431 8.036   13.425 1.00 46.74  ? 292  LEU A CA  1 
ATOM   1717 C C   . LEU A 1 234 ? -21.434 8.073   14.952 1.00 44.35  ? 292  LEU A C   1 
ATOM   1718 O O   . LEU A 1 234 ? -21.429 7.025   15.597 1.00 44.87  ? 292  LEU A O   1 
ATOM   1719 C CB  . LEU A 1 234 ? -20.016 8.236   12.871 1.00 47.01  ? 292  LEU A CB  1 
ATOM   1720 C CG  . LEU A 1 234 ? -19.881 7.981   11.362 1.00 44.92  ? 292  LEU A CG  1 
ATOM   1721 C CD1 . LEU A 1 234 ? -18.520 8.411   10.871 1.00 44.24  ? 292  LEU A CD1 1 
ATOM   1722 C CD2 . LEU A 1 234 ? -20.153 6.524   11.012 1.00 46.05  ? 292  LEU A CD2 1 
ATOM   1723 N N   . GLY A 1 235 ? -21.454 9.274   15.524 1.00 42.35  ? 293  GLY A N   1 
ATOM   1724 C CA  . GLY A 1 235 ? -21.640 9.443   16.971 1.00 41.30  ? 293  GLY A CA  1 
ATOM   1725 C C   . GLY A 1 235 ? -22.898 8.733   17.473 1.00 41.74  ? 293  GLY A C   1 
ATOM   1726 O O   . GLY A 1 235 ? -22.877 8.048   18.506 1.00 40.94  ? 293  GLY A O   1 
ATOM   1727 N N   . ILE A 1 236 ? -23.986 8.874   16.716 1.00 40.42  ? 294  ILE A N   1 
ATOM   1728 C CA  . ILE A 1 236 ? -25.261 8.255   17.053 1.00 41.44  ? 294  ILE A CA  1 
ATOM   1729 C C   . ILE A 1 236 ? -25.206 6.716   17.018 1.00 41.46  ? 294  ILE A C   1 
ATOM   1730 O O   . ILE A 1 236 ? -25.722 6.034   17.928 1.00 40.74  ? 294  ILE A O   1 
ATOM   1731 C CB  . ILE A 1 236 ? -26.412 8.805   16.167 1.00 41.31  ? 294  ILE A CB  1 
ATOM   1732 C CG1 . ILE A 1 236 ? -26.671 10.280  16.501 1.00 40.43  ? 294  ILE A CG1 1 
ATOM   1733 C CG2 . ILE A 1 236 ? -27.693 7.997   16.375 1.00 39.81  ? 294  ILE A CG2 1 
ATOM   1734 C CD1 . ILE A 1 236 ? -27.473 11.039  15.438 1.00 38.78  ? 294  ILE A CD1 1 
ATOM   1735 N N   . ILE A 1 237 ? -24.580 6.184   15.968 1.00 41.15  ? 295  ILE A N   1 
ATOM   1736 C CA  . ILE A 1 237 ? -24.313 4.742   15.837 1.00 38.83  ? 295  ILE A CA  1 
ATOM   1737 C C   . ILE A 1 237 ? -23.585 4.210   17.080 1.00 38.11  ? 295  ILE A C   1 
ATOM   1738 O O   . ILE A 1 237 ? -24.017 3.228   17.683 1.00 36.42  ? 295  ILE A O   1 
ATOM   1739 C CB  . ILE A 1 237 ? -23.510 4.469   14.561 1.00 38.14  ? 295  ILE A CB  1 
ATOM   1740 C CG1 . ILE A 1 237 ? -24.366 4.759   13.329 1.00 39.46  ? 295  ILE A CG1 1 
ATOM   1741 C CG2 . ILE A 1 237 ? -22.974 3.075   14.535 1.00 40.22  ? 295  ILE A CG2 1 
ATOM   1742 C CD1 . ILE A 1 237 ? -25.541 3.856   13.155 1.00 43.28  ? 295  ILE A CD1 1 
ATOM   1743 N N   . MET A 1 238 ? -22.525 4.910   17.485 1.00 37.69  ? 296  MET A N   1 
ATOM   1744 C CA  . MET A 1 238 ? -21.720 4.527   18.634 1.00 39.33  ? 296  MET A CA  1 
ATOM   1745 C C   . MET A 1 238 ? -22.451 4.692   19.959 1.00 39.69  ? 296  MET A C   1 
ATOM   1746 O O   . MET A 1 238 ? -22.262 3.890   20.876 1.00 41.82  ? 296  MET A O   1 
ATOM   1747 C CB  . MET A 1 238 ? -20.437 5.357   18.670 1.00 40.78  ? 296  MET A CB  1 
ATOM   1748 C CG  . MET A 1 238 ? -19.558 5.163   17.465 1.00 44.67  ? 296  MET A CG  1 
ATOM   1749 S SD  . MET A 1 238 ? -18.206 6.336   17.431 1.00 47.05  ? 296  MET A SD  1 
ATOM   1750 C CE  . MET A 1 238 ? -17.564 5.968   15.796 1.00 43.26  ? 296  MET A CE  1 
ATOM   1751 N N   . GLY A 1 239 ? -23.256 5.748   20.072 1.00 39.96  ? 297  GLY A N   1 
ATOM   1752 C CA  . GLY A 1 239 ? -24.025 6.025   21.298 1.00 37.24  ? 297  GLY A CA  1 
ATOM   1753 C C   . GLY A 1 239 ? -25.120 4.999   21.518 1.00 35.73  ? 297  GLY A C   1 
ATOM   1754 O O   . GLY A 1 239 ? -25.252 4.436   22.601 1.00 36.60  ? 297  GLY A O   1 
ATOM   1755 N N   . VAL A 1 240 ? -25.886 4.736   20.468 1.00 35.26  ? 298  VAL A N   1 
ATOM   1756 C CA  . VAL A 1 240 ? -26.927 3.723   20.505 1.00 34.89  ? 298  VAL A CA  1 
ATOM   1757 C C   . VAL A 1 240 ? -26.358 2.320   20.799 1.00 35.03  ? 298  VAL A C   1 
ATOM   1758 O O   . VAL A 1 240 ? -26.912 1.588   21.619 1.00 37.78  ? 298  VAL A O   1 
ATOM   1759 C CB  . VAL A 1 240 ? -27.762 3.761   19.202 1.00 35.56  ? 298  VAL A CB  1 
ATOM   1760 C CG1 . VAL A 1 240 ? -28.708 2.577   19.123 1.00 35.16  ? 298  VAL A CG1 1 
ATOM   1761 C CG2 . VAL A 1 240 ? -28.556 5.069   19.138 1.00 35.47  ? 298  VAL A CG2 1 
ATOM   1762 N N   . PHE A 1 241 ? -25.252 1.958   20.152 1.00 33.45  ? 299  PHE A N   1 
ATOM   1763 C CA  . PHE A 1 241 ? -24.563 0.692   20.445 1.00 31.67  ? 299  PHE A CA  1 
ATOM   1764 C C   . PHE A 1 241 ? -24.137 0.549   21.923 1.00 30.83  ? 299  PHE A C   1 
ATOM   1765 O O   . PHE A 1 241 ? -24.310 -0.507  22.534 1.00 29.20  ? 299  PHE A O   1 
ATOM   1766 C CB  . PHE A 1 241 ? -23.328 0.516   19.545 1.00 30.19  ? 299  PHE A CB  1 
ATOM   1767 C CG  . PHE A 1 241 ? -22.594 -0.789  19.768 1.00 24.28  ? 299  PHE A CG  1 
ATOM   1768 C CD1 . PHE A 1 241 ? -21.641 -0.911  20.775 1.00 22.18  ? 299  PHE A CD1 1 
ATOM   1769 C CD2 . PHE A 1 241 ? -22.869 -1.893  18.969 1.00 21.26  ? 299  PHE A CD2 1 
ATOM   1770 C CE1 . PHE A 1 241 ? -20.956 -2.116  20.988 1.00 23.69  ? 299  PHE A CE1 1 
ATOM   1771 C CE2 . PHE A 1 241 ? -22.208 -3.096  19.154 1.00 22.85  ? 299  PHE A CE2 1 
ATOM   1772 C CZ  . PHE A 1 241 ? -21.237 -3.218  20.173 1.00 25.19  ? 299  PHE A CZ  1 
ATOM   1773 N N   . THR A 1 242 ? -23.548 1.598   22.475 1.00 30.32  ? 300  THR A N   1 
ATOM   1774 C CA  . THR A 1 242 ? -23.232 1.616   23.894 1.00 34.25  ? 300  THR A CA  1 
ATOM   1775 C C   . THR A 1 242 ? -24.496 1.431   24.761 1.00 35.63  ? 300  THR A C   1 
ATOM   1776 O O   . THR A 1 242 ? -24.511 0.605   25.693 1.00 36.13  ? 300  THR A O   1 
ATOM   1777 C CB  . THR A 1 242 ? -22.482 2.914   24.292 1.00 34.39  ? 300  THR A CB  1 
ATOM   1778 O OG1 . THR A 1 242 ? -21.326 3.080   23.456 1.00 33.88  ? 300  THR A OG1 1 
ATOM   1779 C CG2 . THR A 1 242 ? -22.047 2.849   25.750 1.00 33.67  ? 300  THR A CG2 1 
ATOM   1780 N N   . LEU A 1 243 ? -25.553 2.182   24.446 1.00 35.31  ? 301  LEU A N   1 
ATOM   1781 C CA  . LEU A 1 243 ? -26.822 2.071   25.189 1.00 34.96  ? 301  LEU A CA  1 
ATOM   1782 C C   . LEU A 1 243 ? -27.473 0.711   25.059 1.00 34.96  ? 301  LEU A C   1 
ATOM   1783 O O   . LEU A 1 243 ? -28.128 0.251   25.999 1.00 35.65  ? 301  LEU A O   1 
ATOM   1784 C CB  . LEU A 1 243 ? -27.837 3.126   24.759 1.00 34.87  ? 301  LEU A CB  1 
ATOM   1785 C CG  . LEU A 1 243 ? -27.534 4.608   24.951 1.00 38.17  ? 301  LEU A CG  1 
ATOM   1786 C CD1 . LEU A 1 243 ? -28.663 5.405   24.310 1.00 40.36  ? 301  LEU A CD1 1 
ATOM   1787 C CD2 . LEU A 1 243 ? -27.345 5.000   26.423 1.00 38.66  ? 301  LEU A CD2 1 
ATOM   1788 N N   . CYS A 1 244 ? -27.315 0.069   23.902 1.00 33.35  ? 302  CYS A N   1 
ATOM   1789 C CA  . CYS A 1 244 ? -27.845 -1.279  23.739 1.00 34.93  ? 302  CYS A CA  1 
ATOM   1790 C C   . CYS A 1 244 ? -27.088 -2.402  24.451 1.00 34.13  ? 302  CYS A C   1 
ATOM   1791 O O   . CYS A 1 244 ? -27.697 -3.405  24.817 1.00 35.95  ? 302  CYS A O   1 
ATOM   1792 C CB  . CYS A 1 244 ? -27.995 -1.625  22.272 1.00 38.34  ? 302  CYS A CB  1 
ATOM   1793 S SG  . CYS A 1 244 ? -29.337 -0.749  21.453 1.00 44.14  ? 302  CYS A SG  1 
ATOM   1794 N N   . TRP A 1 245 ? -25.779 -2.255  24.656 1.00 33.53  ? 303  TRP A N   1 
ATOM   1795 C CA  . TRP A 1 245 ? -24.975 -3.362  25.185 1.00 30.65  ? 303  TRP A CA  1 
ATOM   1796 C C   . TRP A 1 245 ? -24.421 -3.123  26.590 1.00 31.58  ? 303  TRP A C   1 
ATOM   1797 O O   . TRP A 1 245 ? -24.224 -4.063  27.374 1.00 31.40  ? 303  TRP A O   1 
ATOM   1798 C CB  . TRP A 1 245 ? -23.832 -3.677  24.238 1.00 28.90  ? 303  TRP A CB  1 
ATOM   1799 C CG  . TRP A 1 245 ? -24.212 -4.507  23.074 1.00 23.61  ? 303  TRP A CG  1 
ATOM   1800 C CD1 . TRP A 1 245 ? -24.223 -4.115  21.775 1.00 22.90  ? 303  TRP A CD1 1 
ATOM   1801 C CD2 . TRP A 1 245 ? -24.605 -5.890  23.083 1.00 23.54  ? 303  TRP A CD2 1 
ATOM   1802 N NE1 . TRP A 1 245 ? -24.600 -5.164  20.962 1.00 22.51  ? 303  TRP A NE1 1 
ATOM   1803 C CE2 . TRP A 1 245 ? -24.843 -6.264  21.741 1.00 20.57  ? 303  TRP A CE2 1 
ATOM   1804 C CE3 . TRP A 1 245 ? -24.755 -6.858  24.094 1.00 26.30  ? 303  TRP A CE3 1 
ATOM   1805 C CZ2 . TRP A 1 245 ? -25.252 -7.562  21.376 1.00 23.46  ? 303  TRP A CZ2 1 
ATOM   1806 C CZ3 . TRP A 1 245 ? -25.177 -8.158  23.734 1.00 20.51  ? 303  TRP A CZ3 1 
ATOM   1807 C CH2 . TRP A 1 245 ? -25.426 -8.490  22.387 1.00 22.92  ? 303  TRP A CH2 1 
ATOM   1808 N N   . LEU A 1 246 ? -24.156 -1.870  26.915 1.00 31.75  ? 304  LEU A N   1 
ATOM   1809 C CA  . LEU A 1 246 ? -23.615 -1.559  28.233 1.00 33.17  ? 304  LEU A CA  1 
ATOM   1810 C C   . LEU A 1 246 ? -24.451 -2.124  29.407 1.00 34.81  ? 304  LEU A C   1 
ATOM   1811 O O   . LEU A 1 246 ? -23.878 -2.656  30.357 1.00 34.52  ? 304  LEU A O   1 
ATOM   1812 C CB  . LEU A 1 246 ? -23.369 -0.052  28.376 1.00 31.71  ? 304  LEU A CB  1 
ATOM   1813 C CG  . LEU A 1 246 ? -22.682 0.410   29.655 1.00 34.39  ? 304  LEU A CG  1 
ATOM   1814 C CD1 . LEU A 1 246 ? -21.375 -0.367  29.915 1.00 34.09  ? 304  LEU A CD1 1 
ATOM   1815 C CD2 . LEU A 1 246 ? -22.444 1.912   29.606 1.00 35.73  ? 304  LEU A CD2 1 
ATOM   1816 N N   . PRO A 1 247 ? -25.799 -2.007  29.352 1.00 36.36  ? 305  PRO A N   1 
ATOM   1817 C CA  . PRO A 1 247 ? -26.624 -2.608  30.411 1.00 36.63  ? 305  PRO A CA  1 
ATOM   1818 C C   . PRO A 1 247 ? -26.380 -4.113  30.587 1.00 35.29  ? 305  PRO A C   1 
ATOM   1819 O O   . PRO A 1 247 ? -26.205 -4.576  31.715 1.00 35.85  ? 305  PRO A O   1 
ATOM   1820 C CB  . PRO A 1 247 ? -28.057 -2.348  29.928 1.00 38.71  ? 305  PRO A CB  1 
ATOM   1821 C CG  . PRO A 1 247 ? -27.961 -1.066  29.157 1.00 38.30  ? 305  PRO A CG  1 
ATOM   1822 C CD  . PRO A 1 247 ? -26.607 -1.145  28.462 1.00 37.98  ? 305  PRO A CD  1 
ATOM   1823 N N   . PHE A 1 248 ? -26.356 -4.869  29.494 1.00 33.42  ? 306  PHE A N   1 
ATOM   1824 C CA  . PHE A 1 248 ? -25.997 -6.283  29.581 1.00 31.51  ? 306  PHE A CA  1 
ATOM   1825 C C   . PHE A 1 248 ? -24.639 -6.544  30.215 1.00 31.32  ? 306  PHE A C   1 
ATOM   1826 O O   . PHE A 1 248 ? -24.515 -7.446  31.034 1.00 32.09  ? 306  PHE A O   1 
ATOM   1827 C CB  . PHE A 1 248 ? -26.001 -6.962  28.231 1.00 31.03  ? 306  PHE A CB  1 
ATOM   1828 C CG  . PHE A 1 248 ? -25.384 -8.340  28.261 1.00 34.01  ? 306  PHE A CG  1 
ATOM   1829 C CD1 . PHE A 1 248 ? -26.102 -9.429  28.774 1.00 34.52  ? 306  PHE A CD1 1 
ATOM   1830 C CD2 . PHE A 1 248 ? -24.082 -8.550  27.800 1.00 33.05  ? 306  PHE A CD2 1 
ATOM   1831 C CE1 . PHE A 1 248 ? -25.548 -10.712 28.807 1.00 32.25  ? 306  PHE A CE1 1 
ATOM   1832 C CE2 . PHE A 1 248 ? -23.513 -9.834  27.824 1.00 32.09  ? 306  PHE A CE2 1 
ATOM   1833 C CZ  . PHE A 1 248 ? -24.247 -10.911 28.328 1.00 34.35  ? 306  PHE A CZ  1 
ATOM   1834 N N   . PHE A 1 249 ? -23.624 -5.778  29.821 1.00 30.37  ? 307  PHE A N   1 
ATOM   1835 C CA  . PHE A 1 249 ? -22.272 -6.036  30.310 1.00 29.81  ? 307  PHE A CA  1 
ATOM   1836 C C   . PHE A 1 249 ? -22.073 -5.604  31.747 1.00 31.29  ? 307  PHE A C   1 
ATOM   1837 O O   . PHE A 1 249 ? -21.353 -6.272  32.492 1.00 30.16  ? 307  PHE A O   1 
ATOM   1838 C CB  . PHE A 1 249 ? -21.198 -5.493  29.348 1.00 27.78  ? 307  PHE A CB  1 
ATOM   1839 C CG  . PHE A 1 249 ? -21.036 -6.350  28.124 1.00 23.26  ? 307  PHE A CG  1 
ATOM   1840 C CD1 . PHE A 1 249 ? -20.372 -7.580  28.206 1.00 19.72  ? 307  PHE A CD1 1 
ATOM   1841 C CD2 . PHE A 1 249 ? -21.618 -5.978  26.914 1.00 21.87  ? 307  PHE A CD2 1 
ATOM   1842 C CE1 . PHE A 1 249 ? -20.251 -8.421  27.086 1.00 17.95  ? 307  PHE A CE1 1 
ATOM   1843 C CE2 . PHE A 1 249 ? -21.507 -6.800  25.786 1.00 21.48  ? 307  PHE A CE2 1 
ATOM   1844 C CZ  . PHE A 1 249 ? -20.813 -8.025  25.870 1.00 16.51  ? 307  PHE A CZ  1 
ATOM   1845 N N   . LEU A 1 250 ? -22.744 -4.517  32.139 1.00 32.83  ? 308  LEU A N   1 
ATOM   1846 C CA  . LEU A 1 250 ? -22.772 -4.095  33.533 1.00 35.09  ? 308  LEU A CA  1 
ATOM   1847 C C   . LEU A 1 250 ? -23.350 -5.187  34.430 1.00 37.21  ? 308  LEU A C   1 
ATOM   1848 O O   . LEU A 1 250 ? -22.778 -5.491  35.492 1.00 39.46  ? 308  LEU A O   1 
ATOM   1849 C CB  . LEU A 1 250 ? -23.550 -2.797  33.702 1.00 35.14  ? 308  LEU A CB  1 
ATOM   1850 C CG  . LEU A 1 250 ? -22.774 -1.537  33.297 1.00 40.30  ? 308  LEU A CG  1 
ATOM   1851 C CD1 . LEU A 1 250 ? -23.720 -0.364  33.024 1.00 42.11  ? 308  LEU A CD1 1 
ATOM   1852 C CD2 . LEU A 1 250 ? -21.725 -1.165  34.332 1.00 37.68  ? 308  LEU A CD2 1 
ATOM   1853 N N   . VAL A 1 251 ? -24.450 -5.801  33.984 1.00 35.27  ? 309  VAL A N   1 
ATOM   1854 C CA  . VAL A 1 251 ? -25.128 -6.835  34.764 1.00 35.18  ? 309  VAL A CA  1 
ATOM   1855 C C   . VAL A 1 251 ? -24.275 -8.094  34.812 1.00 36.03  ? 309  VAL A C   1 
ATOM   1856 O O   . VAL A 1 251 ? -24.255 -8.806  35.822 1.00 34.64  ? 309  VAL A O   1 
ATOM   1857 C CB  . VAL A 1 251 ? -26.556 -7.156  34.217 1.00 35.70  ? 309  VAL A CB  1 
ATOM   1858 C CG1 . VAL A 1 251 ? -27.243 -8.213  35.077 1.00 29.37  ? 309  VAL A CG1 1 
ATOM   1859 C CG2 . VAL A 1 251 ? -27.417 -5.892  34.180 1.00 34.99  ? 309  VAL A CG2 1 
ATOM   1860 N N   . ASN A 1 252 ? -23.573 -8.357  33.708 1.00 37.02  ? 310  ASN A N   1 
ATOM   1861 C CA  . ASN A 1 252 ? -22.670 -9.495  33.607 1.00 36.57  ? 310  ASN A CA  1 
ATOM   1862 C C   . ASN A 1 252 ? -21.604 -9.424  34.700 1.00 37.53  ? 310  ASN A C   1 
ATOM   1863 O O   . ASN A 1 252 ? -21.298 -10.417 35.353 1.00 37.83  ? 310  ASN A O   1 
ATOM   1864 C CB  . ASN A 1 252 ? -22.026 -9.533  32.219 1.00 36.42  ? 310  ASN A CB  1 
ATOM   1865 C CG  . ASN A 1 252 ? -21.626 -10.935 31.805 1.00 35.93  ? 310  ASN A CG  1 
ATOM   1866 O OD1 . ASN A 1 252 ? -22.171 -11.906 32.321 1.00 37.58  ? 310  ASN A OD1 1 
ATOM   1867 N ND2 . ASN A 1 252 ? -20.672 -11.051 30.864 1.00 30.54  ? 310  ASN A ND2 1 
ATOM   1868 N N   . ILE A 1 253 ? -21.064 -8.229  34.912 1.00 38.26  ? 311  ILE A N   1 
ATOM   1869 C CA  . ILE A 1 253 ? -20.093 -8.011  35.968 1.00 39.36  ? 311  ILE A CA  1 
ATOM   1870 C C   . ILE A 1 253 ? -20.770 -8.209  37.318 1.00 40.07  ? 311  ILE A C   1 
ATOM   1871 O O   . ILE A 1 253 ? -20.288 -8.992  38.145 1.00 40.70  ? 311  ILE A O   1 
ATOM   1872 C CB  . ILE A 1 253 ? -19.429 -6.598  35.881 1.00 39.93  ? 311  ILE A CB  1 
ATOM   1873 C CG1 . ILE A 1 253 ? -18.734 -6.398  34.525 1.00 37.84  ? 311  ILE A CG1 1 
ATOM   1874 C CG2 . ILE A 1 253 ? -18.449 -6.373  37.041 1.00 38.41  ? 311  ILE A CG2 1 
ATOM   1875 C CD1 . ILE A 1 253 ? -17.863 -7.571  34.089 1.00 34.31  ? 311  ILE A CD1 1 
ATOM   1876 N N   . VAL A 1 254 ? -21.893 -7.522  37.531 1.00 40.12  ? 312  VAL A N   1 
ATOM   1877 C CA  . VAL A 1 254 ? -22.578 -7.560  38.839 1.00 40.24  ? 312  VAL A CA  1 
ATOM   1878 C C   . VAL A 1 254 ? -22.922 -8.978  39.319 1.00 39.21  ? 312  VAL A C   1 
ATOM   1879 O O   . VAL A 1 254 ? -22.816 -9.262  40.500 1.00 38.64  ? 312  VAL A O   1 
ATOM   1880 C CB  . VAL A 1 254 ? -23.810 -6.595  38.909 1.00 40.48  ? 312  VAL A CB  1 
ATOM   1881 C CG1 . VAL A 1 254 ? -24.652 -6.862  40.150 1.00 42.57  ? 312  VAL A CG1 1 
ATOM   1882 C CG2 . VAL A 1 254 ? -23.365 -5.136  38.901 1.00 35.30  ? 312  VAL A CG2 1 
ATOM   1883 N N   . ASN A 1 255 ? -23.288 -9.873  38.407 1.00 40.70  ? 313  ASN A N   1 
ATOM   1884 C CA  . ASN A 1 255 ? -23.533 -11.267 38.769 1.00 44.68  ? 313  ASN A CA  1 
ATOM   1885 C C   . ASN A 1 255 ? -22.341 -11.963 39.415 1.00 47.86  ? 313  ASN A C   1 
ATOM   1886 O O   . ASN A 1 255 ? -22.517 -12.803 40.307 1.00 50.87  ? 313  ASN A O   1 
ATOM   1887 C CB  . ASN A 1 255 ? -23.963 -12.098 37.562 1.00 45.01  ? 313  ASN A CB  1 
ATOM   1888 C CG  . ASN A 1 255 ? -25.258 -11.634 36.964 1.00 48.44  ? 313  ASN A CG  1 
ATOM   1889 O OD1 . ASN A 1 255 ? -26.008 -10.866 37.571 1.00 50.31  ? 313  ASN A OD1 1 
ATOM   1890 N ND2 . ASN A 1 255 ? -25.544 -12.108 35.762 1.00 53.43  ? 313  ASN A ND2 1 
ATOM   1891 N N   . VAL A 1 256 ? -21.135 -11.657 38.947 1.00 48.10  ? 314  VAL A N   1 
ATOM   1892 C CA  . VAL A 1 256 ? -19.961 -12.298 39.511 1.00 49.89  ? 314  VAL A CA  1 
ATOM   1893 C C   . VAL A 1 256 ? -19.970 -12.067 41.028 1.00 51.09  ? 314  VAL A C   1 
ATOM   1894 O O   . VAL A 1 256 ? -19.638 -12.961 41.802 1.00 50.78  ? 314  VAL A O   1 
ATOM   1895 C CB  . VAL A 1 256 ? -18.628 -11.797 38.855 1.00 50.25  ? 314  VAL A CB  1 
ATOM   1896 C CG1 . VAL A 1 256 ? -17.417 -12.298 39.637 1.00 48.99  ? 314  VAL A CG1 1 
ATOM   1897 C CG2 . VAL A 1 256 ? -18.534 -12.231 37.387 1.00 47.72  ? 314  VAL A CG2 1 
ATOM   1898 N N   . PHE A 1 257 ? -20.400 -10.876 41.436 1.00 53.37  ? 315  PHE A N   1 
ATOM   1899 C CA  . PHE A 1 257 ? -20.323 -10.440 42.837 1.00 56.12  ? 315  PHE A CA  1 
ATOM   1900 C C   . PHE A 1 257 ? -21.607 -10.663 43.644 1.00 58.01  ? 315  PHE A C   1 
ATOM   1901 O O   . PHE A 1 257 ? -21.539 -10.916 44.845 1.00 58.65  ? 315  PHE A O   1 
ATOM   1902 C CB  . PHE A 1 257 ? -19.870 -8.971  42.917 1.00 55.50  ? 315  PHE A CB  1 
ATOM   1903 C CG  . PHE A 1 257 ? -18.472 -8.747  42.411 1.00 56.44  ? 315  PHE A CG  1 
ATOM   1904 C CD1 . PHE A 1 257 ? -17.372 -9.002  43.231 1.00 57.41  ? 315  PHE A CD1 1 
ATOM   1905 C CD2 . PHE A 1 257 ? -18.250 -8.309  41.111 1.00 57.72  ? 315  PHE A CD2 1 
ATOM   1906 C CE1 . PHE A 1 257 ? -16.070 -8.811  42.773 1.00 59.85  ? 315  PHE A CE1 1 
ATOM   1907 C CE2 . PHE A 1 257 ? -16.950 -8.115  40.637 1.00 60.35  ? 315  PHE A CE2 1 
ATOM   1908 C CZ  . PHE A 1 257 ? -15.856 -8.367  41.470 1.00 61.38  ? 315  PHE A CZ  1 
ATOM   1909 N N   . ASN A 1 258 ? -22.760 -10.587 42.974 1.00 60.05  ? 316  ASN A N   1 
ATOM   1910 C CA  . ASN A 1 258 ? -24.071 -10.743 43.617 1.00 61.55  ? 316  ASN A CA  1 
ATOM   1911 C C   . ASN A 1 258 ? -25.230 -11.044 42.641 1.00 62.02  ? 316  ASN A C   1 
ATOM   1912 O O   . ASN A 1 258 ? -25.743 -10.155 41.935 1.00 60.00  ? 316  ASN A O   1 
ATOM   1913 C CB  . ASN A 1 258 ? -24.390 -9.518  44.490 1.00 62.35  ? 316  ASN A CB  1 
ATOM   1914 C CG  . ASN A 1 258 ? -25.694 -9.663  45.263 1.00 62.35  ? 316  ASN A CG  1 
ATOM   1915 O OD1 . ASN A 1 258 ? -26.257 -10.755 45.385 1.00 60.21  ? 316  ASN A OD1 1 
ATOM   1916 N ND2 . ASN A 1 258 ? -26.178 -8.549  45.792 1.00 63.38  ? 316  ASN A ND2 1 
ATOM   1917 N N   . ARG A 1 259 ? -25.643 -12.311 42.645 1.00 63.92  ? 317  ARG A N   1 
ATOM   1918 C CA  . ARG A 1 259 ? -26.718 -12.825 41.788 1.00 65.81  ? 317  ARG A CA  1 
ATOM   1919 C C   . ARG A 1 259 ? -28.108 -12.297 42.146 1.00 64.89  ? 317  ARG A C   1 
ATOM   1920 O O   . ARG A 1 259 ? -29.049 -12.454 41.368 1.00 65.65  ? 317  ARG A O   1 
ATOM   1921 C CB  . ARG A 1 259 ? -26.740 -14.357 41.843 1.00 67.39  ? 317  ARG A CB  1 
ATOM   1922 C CG  . ARG A 1 259 ? -25.870 -15.057 40.816 1.00 73.27  ? 317  ARG A CG  1 
ATOM   1923 C CD  . ARG A 1 259 ? -25.012 -16.131 41.476 1.00 82.01  ? 317  ARG A CD  1 
ATOM   1924 N NE  . ARG A 1 259 ? -23.801 -15.554 42.076 1.00 91.11  ? 317  ARG A NE  1 
ATOM   1925 C CZ  . ARG A 1 259 ? -23.617 -15.325 43.379 1.00 93.00  ? 317  ARG A CZ  1 
ATOM   1926 N NH1 . ARG A 1 259 ? -24.561 -15.635 44.263 1.00 91.28  ? 317  ARG A NH1 1 
ATOM   1927 N NH2 . ARG A 1 259 ? -22.472 -14.794 43.799 1.00 93.57  ? 317  ARG A NH2 1 
ATOM   1928 N N   . ASP A 1 260 ? -28.240 -11.684 43.318 1.00 63.77  ? 318  ASP A N   1 
ATOM   1929 C CA  . ASP A 1 260 ? -29.547 -11.242 43.792 1.00 63.78  ? 318  ASP A CA  1 
ATOM   1930 C C   . ASP A 1 260 ? -29.804 -9.774  43.508 1.00 62.65  ? 318  ASP A C   1 
ATOM   1931 O O   . ASP A 1 260 ? -30.942 -9.365  43.338 1.00 64.50  ? 318  ASP A O   1 
ATOM   1932 C CB  . ASP A 1 260 ? -29.710 -11.538 45.287 1.00 64.77  ? 318  ASP A CB  1 
ATOM   1933 C CG  . ASP A 1 260 ? -29.530 -13.022 45.620 1.00 67.29  ? 318  ASP A CG  1 
ATOM   1934 O OD1 . ASP A 1 260 ? -29.724 -13.887 44.733 1.00 65.97  ? 318  ASP A OD1 1 
ATOM   1935 O OD2 . ASP A 1 260 ? -29.191 -13.326 46.784 1.00 69.41  ? 318  ASP A OD2 1 
ATOM   1936 N N   . LEU A 1 261 ? -28.739 -8.993  43.431 1.00 61.39  ? 319  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 261 ? -28.835 -7.554  43.203 1.00 60.87  ? 319  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 261 ? -29.627 -7.141  41.952 1.00 59.01  ? 319  LEU A C   1 
ATOM   1939 O O   . LEU A 1 261 ? -30.138 -6.026  41.900 1.00 60.11  ? 319  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 261 ? -27.428 -6.939  43.156 1.00 62.07  ? 319  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 261 ? -27.227 -5.522  43.701 1.00 64.93  ? 319  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 261 ? -27.496 -5.477  45.213 1.00 68.25  ? 319  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 261 ? -25.817 -5.002  43.391 1.00 63.83  ? 319  LEU A CD2 1 
ATOM   1944 N N   . VAL A 1 262 ? -29.713 -8.018  40.946 1.00 55.63  ? 320  VAL A N   1 
ATOM   1945 C CA  . VAL A 1 262 ? -30.403 -7.693  39.686 1.00 51.74  ? 320  VAL A CA  1 
ATOM   1946 C C   . VAL A 1 262 ? -31.201 -8.895  39.159 1.00 50.66  ? 320  VAL A C   1 
ATOM   1947 O O   . VAL A 1 262 ? -30.619 -9.937  38.872 1.00 50.54  ? 320  VAL A O   1 
ATOM   1948 C CB  . VAL A 1 262 ? -29.425 -7.136  38.594 1.00 49.74  ? 320  VAL A CB  1 
ATOM   1949 C CG1 . VAL A 1 262 ? -30.047 -7.188  37.222 1.00 49.24  ? 320  VAL A CG1 1 
ATOM   1950 C CG2 . VAL A 1 262 ? -29.015 -5.702  38.904 1.00 47.09  ? 320  VAL A CG2 1 
ATOM   1951 N N   . PRO A 1 263 ? -32.537 -8.737  39.020 1.00 49.32  ? 321  PRO A N   1 
ATOM   1952 C CA  . PRO A 1 263 ? -33.442 -9.846  38.668 1.00 48.59  ? 321  PRO A CA  1 
ATOM   1953 C C   . PRO A 1 263 ? -33.154 -10.516 37.320 1.00 47.04  ? 321  PRO A C   1 
ATOM   1954 O O   . PRO A 1 263 ? -32.845 -9.839  36.336 1.00 47.24  ? 321  PRO A O   1 
ATOM   1955 C CB  . PRO A 1 263 ? -34.840 -9.194  38.659 1.00 46.69  ? 321  PRO A CB  1 
ATOM   1956 C CG  . PRO A 1 263 ? -34.596 -7.742  38.500 1.00 47.44  ? 321  PRO A CG  1 
ATOM   1957 C CD  . PRO A 1 263 ? -33.259 -7.451  39.133 1.00 49.27  ? 321  PRO A CD  1 
ATOM   1958 N N   . ASP A 1 264 ? -33.283 -11.839 37.290 1.00 45.68  ? 322  ASP A N   1 
ATOM   1959 C CA  . ASP A 1 264 ? -32.985 -12.621 36.099 1.00 46.74  ? 322  ASP A CA  1 
ATOM   1960 C C   . ASP A 1 264 ? -33.607 -12.082 34.810 1.00 47.16  ? 322  ASP A C   1 
ATOM   1961 O O   . ASP A 1 264 ? -32.886 -11.886 33.826 1.00 48.56  ? 322  ASP A O   1 
ATOM   1962 C CB  . ASP A 1 264 ? -33.380 -14.084 36.274 1.00 46.51  ? 322  ASP A CB  1 
ATOM   1963 C CG  . ASP A 1 264 ? -32.804 -14.969 35.182 1.00 52.44  ? 322  ASP A CG  1 
ATOM   1964 O OD1 . ASP A 1 264 ? -31.559 -15.074 35.102 1.00 58.21  ? 322  ASP A OD1 1 
ATOM   1965 O OD2 . ASP A 1 264 ? -33.582 -15.541 34.388 1.00 55.27  ? 322  ASP A OD2 1 
ATOM   1966 N N   . TRP A 1 265 ? -34.927 -11.858 34.823 1.00 46.00  ? 323  TRP A N   1 
ATOM   1967 C CA  . TRP A 1 265 ? -35.686 -11.507 33.617 1.00 44.16  ? 323  TRP A CA  1 
ATOM   1968 C C   . TRP A 1 265 ? -35.088 -10.280 32.899 1.00 44.53  ? 323  TRP A C   1 
ATOM   1969 O O   . TRP A 1 265 ? -35.108 -10.195 31.667 1.00 43.80  ? 323  TRP A O   1 
ATOM   1970 C CB  . TRP A 1 265 ? -37.199 -11.331 33.921 1.00 42.57  ? 323  TRP A CB  1 
ATOM   1971 C CG  . TRP A 1 265 ? -37.505 -10.171 34.814 1.00 39.49  ? 323  TRP A CG  1 
ATOM   1972 C CD1 . TRP A 1 265 ? -37.653 -10.202 36.165 1.00 42.49  ? 323  TRP A CD1 1 
ATOM   1973 C CD2 . TRP A 1 265 ? -37.657 -8.799  34.426 1.00 37.46  ? 323  TRP A CD2 1 
ATOM   1974 N NE1 . TRP A 1 265 ? -37.886 -8.932  36.654 1.00 39.93  ? 323  TRP A NE1 1 
ATOM   1975 C CE2 . TRP A 1 265 ? -37.894 -8.053  35.607 1.00 37.70  ? 323  TRP A CE2 1 
ATOM   1976 C CE3 . TRP A 1 265 ? -37.607 -8.126  33.200 1.00 37.95  ? 323  TRP A CE3 1 
ATOM   1977 C CZ2 . TRP A 1 265 ? -38.089 -6.664  35.599 1.00 38.29  ? 323  TRP A CZ2 1 
ATOM   1978 C CZ3 . TRP A 1 265 ? -37.791 -6.734  33.192 1.00 41.29  ? 323  TRP A CZ3 1 
ATOM   1979 C CH2 . TRP A 1 265 ? -38.028 -6.021  34.391 1.00 37.80  ? 323  TRP A CH2 1 
ATOM   1980 N N   . LEU A 1 266 ? -34.550 -9.350  33.686 1.00 44.73  ? 324  LEU A N   1 
ATOM   1981 C CA  . LEU A 1 266 ? -33.976 -8.120  33.166 1.00 46.06  ? 324  LEU A CA  1 
ATOM   1982 C C   . LEU A 1 266 ? -32.594 -8.386  32.546 1.00 46.94  ? 324  LEU A C   1 
ATOM   1983 O O   . LEU A 1 266 ? -32.253 -7.797  31.512 1.00 47.42  ? 324  LEU A O   1 
ATOM   1984 C CB  . LEU A 1 266 ? -33.940 -7.031  34.263 1.00 45.60  ? 324  LEU A CB  1 
ATOM   1985 C CG  . LEU A 1 266 ? -33.590 -5.576  33.884 1.00 45.68  ? 324  LEU A CG  1 
ATOM   1986 C CD1 . LEU A 1 266 ? -34.516 -4.996  32.807 1.00 45.01  ? 324  LEU A CD1 1 
ATOM   1987 C CD2 . LEU A 1 266 ? -33.549 -4.650  35.102 1.00 41.91  ? 324  LEU A CD2 1 
ATOM   1988 N N   . PHE A 1 267 ? -31.820 -9.287  33.158 1.00 47.70  ? 325  PHE A N   1 
ATOM   1989 C CA  . PHE A 1 267 ? -30.532 -9.732  32.582 1.00 48.00  ? 325  PHE A CA  1 
ATOM   1990 C C   . PHE A 1 267 ? -30.695 -10.347 31.185 1.00 46.64  ? 325  PHE A C   1 
ATOM   1991 O O   . PHE A 1 267 ? -29.970 -9.976  30.251 1.00 47.18  ? 325  PHE A O   1 
ATOM   1992 C CB  . PHE A 1 267 ? -29.786 -10.692 33.530 1.00 47.79  ? 325  PHE A CB  1 
ATOM   1993 C CG  . PHE A 1 267 ? -28.469 -11.207 32.981 1.00 50.73  ? 325  PHE A CG  1 
ATOM   1994 C CD1 . PHE A 1 267 ? -27.490 -10.325 32.510 1.00 53.26  ? 325  PHE A CD1 1 
ATOM   1995 C CD2 . PHE A 1 267 ? -28.204 -12.576 32.943 1.00 51.91  ? 325  PHE A CD2 1 
ATOM   1996 C CE1 . PHE A 1 267 ? -26.285 -10.802 32.003 1.00 52.13  ? 325  PHE A CE1 1 
ATOM   1997 C CE2 . PHE A 1 267 ? -26.999 -13.062 32.435 1.00 51.68  ? 325  PHE A CE2 1 
ATOM   1998 C CZ  . PHE A 1 267 ? -26.043 -12.175 31.966 1.00 51.53  ? 325  PHE A CZ  1 
ATOM   1999 N N   . VAL A 1 268 ? -31.640 -11.280 31.054 1.00 44.29  ? 326  VAL A N   1 
ATOM   2000 C CA  . VAL A 1 268 ? -31.965 -11.915 29.766 1.00 42.27  ? 326  VAL A CA  1 
ATOM   2001 C C   . VAL A 1 268 ? -32.400 -10.869 28.730 1.00 40.54  ? 326  VAL A C   1 
ATOM   2002 O O   . VAL A 1 268 ? -31.917 -10.867 27.588 1.00 38.82  ? 326  VAL A O   1 
ATOM   2003 C CB  . VAL A 1 268 ? -33.080 -12.960 29.933 1.00 41.81  ? 326  VAL A CB  1 
ATOM   2004 C CG1 . VAL A 1 268 ? -33.244 -13.757 28.681 1.00 43.68  ? 326  VAL A CG1 1 
ATOM   2005 C CG2 . VAL A 1 268 ? -32.744 -13.889 31.057 1.00 45.64  ? 326  VAL A CG2 1 
ATOM   2006 N N   . ALA A 1 269 ? -33.299 -9.980  29.169 1.00 37.42  ? 327  ALA A N   1 
ATOM   2007 C CA  . ALA A 1 269 ? -33.898 -8.941  28.351 1.00 35.11  ? 327  ALA A CA  1 
ATOM   2008 C C   . ALA A 1 269 ? -32.819 -8.024  27.780 1.00 36.06  ? 327  ALA A C   1 
ATOM   2009 O O   . ALA A 1 269 ? -32.863 -7.656  26.595 1.00 34.87  ? 327  ALA A O   1 
ATOM   2010 C CB  . ALA A 1 269 ? -34.894 -8.138  29.177 1.00 33.05  ? 327  ALA A CB  1 
ATOM   2011 N N   . PHE A 1 270 ? -31.853 -7.674  28.635 1.00 35.42  ? 328  PHE A N   1 
ATOM   2012 C CA  . PHE A 1 270 ? -30.686 -6.900  28.233 1.00 34.18  ? 328  PHE A CA  1 
ATOM   2013 C C   . PHE A 1 270 ? -29.878 -7.567  27.136 1.00 34.63  ? 328  PHE A C   1 
ATOM   2014 O O   . PHE A 1 270 ? -29.345 -6.886  26.265 1.00 37.48  ? 328  PHE A O   1 
ATOM   2015 C CB  . PHE A 1 270 ? -29.813 -6.585  29.437 1.00 32.64  ? 328  PHE A CB  1 
ATOM   2016 C CG  . PHE A 1 270 ? -30.347 -5.470  30.282 1.00 33.52  ? 328  PHE A CG  1 
ATOM   2017 C CD1 . PHE A 1 270 ? -31.190 -4.506  29.731 1.00 36.31  ? 328  PHE A CD1 1 
ATOM   2018 C CD2 . PHE A 1 270 ? -30.021 -5.379  31.624 1.00 35.22  ? 328  PHE A CD2 1 
ATOM   2019 C CE1 . PHE A 1 270 ? -31.686 -3.466  30.506 1.00 38.07  ? 328  PHE A CE1 1 
ATOM   2020 C CE2 . PHE A 1 270 ? -30.508 -4.330  32.407 1.00 36.02  ? 328  PHE A CE2 1 
ATOM   2021 C CZ  . PHE A 1 270 ? -31.339 -3.383  31.852 1.00 36.41  ? 328  PHE A CZ  1 
ATOM   2022 N N   . ASN A 1 271 ? -29.808 -8.892  27.148 1.00 34.37  ? 329  ASN A N   1 
ATOM   2023 C CA  . ASN A 1 271 ? -29.106 -9.579  26.078 1.00 36.70  ? 329  ASN A CA  1 
ATOM   2024 C C   . ASN A 1 271 ? -29.871 -9.437  24.779 1.00 37.27  ? 329  ASN A C   1 
ATOM   2025 O O   . ASN A 1 271 ? -29.275 -9.361  23.701 1.00 39.28  ? 329  ASN A O   1 
ATOM   2026 C CB  . ASN A 1 271 ? -28.883 -11.052 26.403 1.00 36.93  ? 329  ASN A CB  1 
ATOM   2027 C CG  . ASN A 1 271 ? -27.639 -11.625 25.741 1.00 38.61  ? 329  ASN A CG  1 
ATOM   2028 O OD1 . ASN A 1 271 ? -27.097 -12.606 26.220 1.00 43.77  ? 329  ASN A OD1 1 
ATOM   2029 N ND2 . ASN A 1 271 ? -27.196 -11.034 24.632 1.00 40.86  ? 329  ASN A ND2 1 
ATOM   2030 N N   . TRP A 1 272 ? -31.199 -9.396  24.890 1.00 36.94  ? 330  TRP A N   1 
ATOM   2031 C CA  . TRP A 1 272 ? -32.066 -9.226  23.736 1.00 32.52  ? 330  TRP A CA  1 
ATOM   2032 C C   . TRP A 1 272 ? -32.062 -7.782  23.257 1.00 31.33  ? 330  TRP A C   1 
ATOM   2033 O O   . TRP A 1 272 ? -32.208 -7.524  22.065 1.00 29.30  ? 330  TRP A O   1 
ATOM   2034 C CB  . TRP A 1 272 ? -33.474 -9.692  24.069 1.00 33.58  ? 330  TRP A CB  1 
ATOM   2035 C CG  . TRP A 1 272 ? -33.617 -11.136 23.907 1.00 31.80  ? 330  TRP A CG  1 
ATOM   2036 C CD1 . TRP A 1 272 ? -33.543 -12.085 24.889 1.00 32.47  ? 330  TRP A CD1 1 
ATOM   2037 C CD2 . TRP A 1 272 ? -33.840 -11.834 22.681 1.00 30.41  ? 330  TRP A CD2 1 
ATOM   2038 N NE1 . TRP A 1 272 ? -33.698 -13.340 24.342 1.00 31.70  ? 330  TRP A NE1 1 
ATOM   2039 C CE2 . TRP A 1 272 ? -33.876 -13.216 22.988 1.00 31.19  ? 330  TRP A CE2 1 
ATOM   2040 C CE3 . TRP A 1 272 ? -34.003 -11.430 21.351 1.00 26.50  ? 330  TRP A CE3 1 
ATOM   2041 C CZ2 . TRP A 1 272 ? -34.084 -14.196 22.012 1.00 33.14  ? 330  TRP A CZ2 1 
ATOM   2042 C CZ3 . TRP A 1 272 ? -34.191 -12.399 20.381 1.00 28.21  ? 330  TRP A CZ3 1 
ATOM   2043 C CH2 . TRP A 1 272 ? -34.235 -13.770 20.717 1.00 34.15  ? 330  TRP A CH2 1 
ATOM   2044 N N   . LEU A 1 273 ? -31.881 -6.843  24.184 1.00 31.26  ? 331  LEU A N   1 
ATOM   2045 C CA  . LEU A 1 273 ? -31.699 -5.445  23.802 1.00 33.96  ? 331  LEU A CA  1 
ATOM   2046 C C   . LEU A 1 273 ? -30.444 -5.338  22.899 1.00 36.63  ? 331  LEU A C   1 
ATOM   2047 O O   . LEU A 1 273 ? -30.446 -4.616  21.892 1.00 36.92  ? 331  LEU A O   1 
ATOM   2048 C CB  . LEU A 1 273 ? -31.606 -4.532  25.036 1.00 31.71  ? 331  LEU A CB  1 
ATOM   2049 C CG  . LEU A 1 273 ? -31.316 -3.037  24.803 1.00 32.97  ? 331  LEU A CG  1 
ATOM   2050 C CD1 . LEU A 1 273 ? -32.335 -2.385  23.859 1.00 29.61  ? 331  LEU A CD1 1 
ATOM   2051 C CD2 . LEU A 1 273 ? -31.212 -2.266  26.115 1.00 28.20  ? 331  LEU A CD2 1 
ATOM   2052 N N   . GLY A 1 274 ? -29.401 -6.089  23.268 1.00 37.36  ? 332  GLY A N   1 
ATOM   2053 C CA  . GLY A 1 274 ? -28.177 -6.198  22.487 1.00 35.50  ? 332  GLY A CA  1 
ATOM   2054 C C   . GLY A 1 274 ? -28.443 -6.673  21.071 1.00 34.34  ? 332  GLY A C   1 
ATOM   2055 O O   . GLY A 1 274 ? -28.014 -6.020  20.099 1.00 33.90  ? 332  GLY A O   1 
ATOM   2056 N N   . TYR A 1 275 ? -29.154 -7.793  20.939 1.00 31.23  ? 333  TYR A N   1 
ATOM   2057 C CA  . TYR A 1 275 ? -29.525 -8.274  19.603 1.00 32.10  ? 333  TYR A CA  1 
ATOM   2058 C C   . TYR A 1 275 ? -30.282 -7.210  18.805 1.00 33.94  ? 333  TYR A C   1 
ATOM   2059 O O   . TYR A 1 275 ? -30.095 -7.081  17.594 1.00 33.96  ? 333  TYR A O   1 
ATOM   2060 C CB  . TYR A 1 275 ? -30.396 -9.507  19.686 1.00 31.47  ? 333  TYR A CB  1 
ATOM   2061 C CG  . TYR A 1 275 ? -29.749 -10.719 20.319 1.00 34.99  ? 333  TYR A CG  1 
ATOM   2062 C CD1 . TYR A 1 275 ? -28.352 -10.827 20.453 1.00 34.56  ? 333  TYR A CD1 1 
ATOM   2063 C CD2 . TYR A 1 275 ? -30.539 -11.776 20.781 1.00 35.02  ? 333  TYR A CD2 1 
ATOM   2064 C CE1 . TYR A 1 275 ? -27.775 -11.947 21.029 1.00 28.76  ? 333  TYR A CE1 1 
ATOM   2065 C CE2 . TYR A 1 275 ? -29.965 -12.896 21.359 1.00 35.05  ? 333  TYR A CE2 1 
ATOM   2066 C CZ  . TYR A 1 275 ? -28.587 -12.969 21.478 1.00 32.86  ? 333  TYR A CZ  1 
ATOM   2067 O OH  . TYR A 1 275 ? -28.042 -14.084 22.047 1.00 38.16  ? 333  TYR A OH  1 
ATOM   2068 N N   . ALA A 1 276 ? -31.110 -6.432  19.503 1.00 34.07  ? 334  ALA A N   1 
ATOM   2069 C CA  . ALA A 1 276 ? -31.966 -5.445  18.868 1.00 34.55  ? 334  ALA A CA  1 
ATOM   2070 C C   . ALA A 1 276 ? -31.177 -4.347  18.127 1.00 33.60  ? 334  ALA A C   1 
ATOM   2071 O O   . ALA A 1 276 ? -31.676 -3.744  17.162 1.00 33.49  ? 334  ALA A O   1 
ATOM   2072 C CB  . ALA A 1 276 ? -32.918 -4.829  19.910 1.00 35.31  ? 334  ALA A CB  1 
ATOM   2073 N N   . ASN A 1 277 ? -29.956 -4.089  18.588 1.00 32.38  ? 335  ASN A N   1 
ATOM   2074 C CA  . ASN A 1 277 ? -29.104 -3.050  18.017 1.00 30.77  ? 335  ASN A CA  1 
ATOM   2075 C C   . ASN A 1 277 ? -28.828 -3.320  16.539 1.00 30.52  ? 335  ASN A C   1 
ATOM   2076 O O   . ASN A 1 277 ? -28.697 -2.379  15.753 1.00 28.64  ? 335  ASN A O   1 
ATOM   2077 C CB  . ASN A 1 277 ? -27.806 -2.931  18.817 1.00 30.60  ? 335  ASN A CB  1 
ATOM   2078 C CG  . ASN A 1 277 ? -26.809 -1.963  18.194 1.00 30.39  ? 335  ASN A CG  1 
ATOM   2079 O OD1 . ASN A 1 277 ? -26.936 -0.737  18.310 1.00 32.57  ? 335  ASN A OD1 1 
ATOM   2080 N ND2 . ASN A 1 277 ? -25.793 -2.514  17.549 1.00 28.07  ? 335  ASN A ND2 1 
ATOM   2081 N N   . SER A 1 278 ? -28.802 -4.605  16.169 1.00 30.38  ? 336  SER A N   1 
ATOM   2082 C CA  . SER A 1 278 ? -28.552 -5.036  14.793 1.00 32.77  ? 336  SER A CA  1 
ATOM   2083 C C   . SER A 1 278 ? -29.583 -4.559  13.777 1.00 34.17  ? 336  SER A C   1 
ATOM   2084 O O   . SER A 1 278 ? -29.381 -4.699  12.563 1.00 35.64  ? 336  SER A O   1 
ATOM   2085 C CB  . SER A 1 278 ? -28.451 -6.558  14.716 1.00 32.29  ? 336  SER A CB  1 
ATOM   2086 O OG  . SER A 1 278 ? -27.263 -7.014  15.332 1.00 36.81  ? 336  SER A OG  1 
ATOM   2087 N N   . ALA A 1 279 ? -30.681 -4.014  14.288 1.00 35.23  ? 337  ALA A N   1 
ATOM   2088 C CA  . ALA A 1 279 ? -31.805 -3.551  13.485 1.00 36.59  ? 337  ALA A CA  1 
ATOM   2089 C C   . ALA A 1 279 ? -31.810 -2.032  13.340 1.00 37.19  ? 337  ALA A C   1 
ATOM   2090 O O   . ALA A 1 279 ? -32.465 -1.492  12.459 1.00 38.26  ? 337  ALA A O   1 
ATOM   2091 C CB  . ALA A 1 279 ? -33.108 -4.015  14.117 1.00 37.14  ? 337  ALA A CB  1 
ATOM   2092 N N   . MET A 1 280 ? -31.054 -1.355  14.195 1.00 38.67  ? 338  MET A N   1 
ATOM   2093 C CA  . MET A 1 280 ? -31.103 0.095   14.308 1.00 39.80  ? 338  MET A CA  1 
ATOM   2094 C C   . MET A 1 280 ? -30.288 0.889   13.287 1.00 40.32  ? 338  MET A C   1 
ATOM   2095 O O   . MET A 1 280 ? -30.742 1.943   12.819 1.00 42.48  ? 338  MET A O   1 
ATOM   2096 C CB  . MET A 1 280 ? -30.756 0.509   15.742 1.00 41.01  ? 338  MET A CB  1 
ATOM   2097 C CG  . MET A 1 280 ? -31.794 -0.005  16.751 1.00 43.56  ? 338  MET A CG  1 
ATOM   2098 S SD  . MET A 1 280 ? -31.314 0.255   18.461 1.00 46.00  ? 338  MET A SD  1 
ATOM   2099 C CE  . MET A 1 280 ? -32.360 -0.922  19.310 1.00 42.92  ? 338  MET A CE  1 
ATOM   2100 N N   . ASN A 1 281 ? -29.110 0.388   12.925 1.00 39.78  ? 339  ASN A N   1 
ATOM   2101 C CA  . ASN A 1 281 ? -28.189 1.138   12.052 1.00 39.46  ? 339  ASN A CA  1 
ATOM   2102 C C   . ASN A 1 281 ? -28.767 1.537   10.694 1.00 37.99  ? 339  ASN A C   1 
ATOM   2103 O O   . ASN A 1 281 ? -28.531 2.658   10.246 1.00 35.31  ? 339  ASN A O   1 
ATOM   2104 C CB  . ASN A 1 281 ? -26.837 0.417   11.879 1.00 39.22  ? 339  ASN A CB  1 
ATOM   2105 C CG  . ASN A 1 281 ? -25.967 0.488   13.124 1.00 43.16  ? 339  ASN A CG  1 
ATOM   2106 O OD1 . ASN A 1 281 ? -26.404 0.929   14.197 1.00 43.40  ? 339  ASN A OD1 1 
ATOM   2107 N ND2 . ASN A 1 281 ? -24.721 0.046   12.987 1.00 48.57  ? 339  ASN A ND2 1 
ATOM   2108 N N   . PRO A 1 282 ? -29.511 0.623   10.031 1.00 38.58  ? 340  PRO A N   1 
ATOM   2109 C CA  . PRO A 1 282 ? -30.091 1.001   8.739  1.00 39.84  ? 340  PRO A CA  1 
ATOM   2110 C C   . PRO A 1 282 ? -31.076 2.151   8.836  1.00 42.52  ? 340  PRO A C   1 
ATOM   2111 O O   . PRO A 1 282 ? -31.117 2.991   7.945  1.00 44.76  ? 340  PRO A O   1 
ATOM   2112 C CB  . PRO A 1 282 ? -30.788 -0.277  8.281  1.00 39.15  ? 340  PRO A CB  1 
ATOM   2113 C CG  . PRO A 1 282 ? -29.935 -1.355  8.875  1.00 39.46  ? 340  PRO A CG  1 
ATOM   2114 C CD  . PRO A 1 282 ? -29.567 -0.837  10.240 1.00 37.45  ? 340  PRO A CD  1 
ATOM   2115 N N   . ILE A 1 283 ? -31.862 2.196   9.907  1.00 44.56  ? 341  ILE A N   1 
ATOM   2116 C CA  . ILE A 1 283 ? -32.793 3.310   10.118 1.00 44.20  ? 341  ILE A CA  1 
ATOM   2117 C C   . ILE A 1 283 ? -31.969 4.588   10.314 1.00 44.97  ? 341  ILE A C   1 
ATOM   2118 O O   . ILE A 1 283 ? -32.176 5.574   9.615  1.00 45.33  ? 341  ILE A O   1 
ATOM   2119 C CB  . ILE A 1 283 ? -33.768 3.058   11.334 1.00 43.87  ? 341  ILE A CB  1 
ATOM   2120 C CG1 . ILE A 1 283 ? -34.748 1.927   11.027 1.00 42.08  ? 341  ILE A CG1 1 
ATOM   2121 C CG2 . ILE A 1 283 ? -34.525 4.324   11.733 1.00 36.78  ? 341  ILE A CG2 1 
ATOM   2122 C CD1 . ILE A 1 283 ? -35.013 1.031   12.243 1.00 44.46  ? 341  ILE A CD1 1 
ATOM   2123 N N   . ILE A 1 284 ? -31.026 4.546   11.253 1.00 44.78  ? 342  ILE A N   1 
ATOM   2124 C CA  . ILE A 1 284 ? -30.167 5.683   11.562 1.00 46.37  ? 342  ILE A CA  1 
ATOM   2125 C C   . ILE A 1 284 ? -29.493 6.283   10.310 1.00 48.09  ? 342  ILE A C   1 
ATOM   2126 O O   . ILE A 1 284 ? -29.289 7.499   10.241 1.00 49.21  ? 342  ILE A O   1 
ATOM   2127 C CB  . ILE A 1 284 ? -29.114 5.288   12.624 1.00 47.31  ? 342  ILE A CB  1 
ATOM   2128 C CG1 . ILE A 1 284 ? -29.809 4.962   13.953 1.00 48.30  ? 342  ILE A CG1 1 
ATOM   2129 C CG2 . ILE A 1 284 ? -28.056 6.385   12.803 1.00 49.63  ? 342  ILE A CG2 1 
ATOM   2130 C CD1 . ILE A 1 284 ? -28.900 4.348   15.000 1.00 47.76  ? 342  ILE A CD1 1 
ATOM   2131 N N   . TYR A 1 285 ? -29.166 5.447   9.322  1.00 48.75  ? 343  TYR A N   1 
ATOM   2132 C CA  . TYR A 1 285 ? -28.538 5.931   8.088  1.00 49.79  ? 343  TYR A CA  1 
ATOM   2133 C C   . TYR A 1 285 ? -29.478 6.746   7.198  1.00 51.81  ? 343  TYR A C   1 
ATOM   2134 O O   . TYR A 1 285 ? -29.036 7.341   6.212  1.00 52.62  ? 343  TYR A O   1 
ATOM   2135 C CB  . TYR A 1 285 ? -27.912 4.790   7.267  1.00 49.27  ? 343  TYR A CB  1 
ATOM   2136 C CG  . TYR A 1 285 ? -26.786 4.036   7.957  1.00 47.36  ? 343  TYR A CG  1 
ATOM   2137 C CD1 . TYR A 1 285 ? -25.953 4.667   8.891  1.00 43.37  ? 343  TYR A CD1 1 
ATOM   2138 C CD2 . TYR A 1 285 ? -26.571 2.682   7.688  1.00 43.79  ? 343  TYR A CD2 1 
ATOM   2139 C CE1 . TYR A 1 285 ? -24.940 3.971   9.529  1.00 40.85  ? 343  TYR A CE1 1 
ATOM   2140 C CE2 . TYR A 1 285 ? -25.555 1.979   8.315  1.00 41.49  ? 343  TYR A CE2 1 
ATOM   2141 C CZ  . TYR A 1 285 ? -24.744 2.626   9.238  1.00 42.36  ? 343  TYR A CZ  1 
ATOM   2142 O OH  . TYR A 1 285 ? -23.737 1.926   9.871  1.00 41.23  ? 343  TYR A OH  1 
ATOM   2143 N N   . CYS A 1 286 ? -30.763 6.779   7.539  1.00 52.80  ? 344  CYS A N   1 
ATOM   2144 C CA  . CYS A 1 286 ? -31.727 7.555   6.757  1.00 53.16  ? 344  CYS A CA  1 
ATOM   2145 C C   . CYS A 1 286 ? -31.608 9.042   7.040  1.00 53.11  ? 344  CYS A C   1 
ATOM   2146 O O   . CYS A 1 286 ? -32.294 9.852   6.426  1.00 54.06  ? 344  CYS A O   1 
ATOM   2147 C CB  . CYS A 1 286 ? -33.142 7.038   6.965  1.00 51.67  ? 344  CYS A CB  1 
ATOM   2148 S SG  . CYS A 1 286 ? -33.264 5.344   6.400  1.00 53.85  ? 344  CYS A SG  1 
ATOM   2149 N N   . ARG A 1 287 ? -30.707 9.388   7.954  1.00 53.26  ? 345  ARG A N   1 
ATOM   2150 C CA  . ARG A 1 287 ? -30.304 10.770  8.175  1.00 55.72  ? 345  ARG A CA  1 
ATOM   2151 C C   . ARG A 1 287 ? -29.556 11.314  6.967  1.00 57.73  ? 345  ARG A C   1 
ATOM   2152 O O   . ARG A 1 287 ? -29.398 12.531  6.814  1.00 58.37  ? 345  ARG A O   1 
ATOM   2153 C CB  . ARG A 1 287 ? -29.380 10.856  9.382  1.00 55.30  ? 345  ARG A CB  1 
ATOM   2154 C CG  . ARG A 1 287 ? -30.078 10.790  10.710 1.00 52.85  ? 345  ARG A CG  1 
ATOM   2155 C CD  . ARG A 1 287 ? -29.059 10.769  11.804 1.00 52.91  ? 345  ARG A CD  1 
ATOM   2156 N NE  . ARG A 1 287 ? -27.991 11.739  11.578 1.00 51.96  ? 345  ARG A NE  1 
ATOM   2157 C CZ  . ARG A 1 287 ? -27.968 12.957  12.100 1.00 54.07  ? 345  ARG A CZ  1 
ATOM   2158 N NH1 . ARG A 1 287 ? -28.966 13.360  12.873 1.00 53.36  ? 345  ARG A NH1 1 
ATOM   2159 N NH2 . ARG A 1 287 ? -26.946 13.768  11.848 1.00 55.21  ? 345  ARG A NH2 1 
ATOM   2160 N N   . SER A 1 288 ? -29.081 10.395  6.127  1.00 60.18  ? 346  SER A N   1 
ATOM   2161 C CA  . SER A 1 288 ? -28.292 10.732  4.945  1.00 61.85  ? 346  SER A CA  1 
ATOM   2162 C C   . SER A 1 288 ? -29.122 10.687  3.656  1.00 62.09  ? 346  SER A C   1 
ATOM   2163 O O   . SER A 1 288 ? -29.658 9.628   3.302  1.00 60.08  ? 346  SER A O   1 
ATOM   2164 C CB  . SER A 1 288 ? -27.073 9.808   4.835  1.00 62.05  ? 346  SER A CB  1 
ATOM   2165 O OG  . SER A 1 288 ? -26.555 9.799   3.514  1.00 65.64  ? 346  SER A OG  1 
ATOM   2166 N N   . PRO A 1 289 ? -29.225 11.844  2.957  1.00 63.40  ? 347  PRO A N   1 
ATOM   2167 C CA  . PRO A 1 289 ? -29.866 11.980  1.641  1.00 63.89  ? 347  PRO A CA  1 
ATOM   2168 C C   . PRO A 1 289 ? -29.497 10.852  0.667  1.00 64.72  ? 347  PRO A C   1 
ATOM   2169 O O   . PRO A 1 289 ? -30.382 10.263  0.023  1.00 64.43  ? 347  PRO A O   1 
ATOM   2170 C CB  . PRO A 1 289 ? -29.317 13.318  1.138  1.00 63.64  ? 347  PRO A CB  1 
ATOM   2171 C CG  . PRO A 1 289 ? -29.141 14.134  2.383  1.00 63.09  ? 347  PRO A CG  1 
ATOM   2172 C CD  . PRO A 1 289 ? -28.805 13.159  3.494  1.00 63.17  ? 347  PRO A CD  1 
ATOM   2173 N N   . ASP A 1 290 ? -28.201 10.554  0.593  1.00 64.87  ? 348  ASP A N   1 
ATOM   2174 C CA  . ASP A 1 290 ? -27.652 9.534   -0.305 1.00 66.33  ? 348  ASP A CA  1 
ATOM   2175 C C   . ASP A 1 290 ? -28.139 8.110   -0.045 1.00 66.15  ? 348  ASP A C   1 
ATOM   2176 O O   . ASP A 1 290 ? -28.493 7.395   -0.993 1.00 65.93  ? 348  ASP A O   1 
ATOM   2177 C CB  . ASP A 1 290 ? -26.128 9.559   -0.241 1.00 67.39  ? 348  ASP A CB  1 
ATOM   2178 C CG  . ASP A 1 290 ? -25.553 10.826  -0.812 1.00 70.25  ? 348  ASP A CG  1 
ATOM   2179 O OD1 . ASP A 1 290 ? -25.308 10.860  -2.037 1.00 73.26  ? 348  ASP A OD1 1 
ATOM   2180 O OD2 . ASP A 1 290 ? -25.359 11.789  -0.038 1.00 71.85  ? 348  ASP A OD2 1 
ATOM   2181 N N   . PHE A 1 291 ? -28.122 7.696   1.226  1.00 64.73  ? 349  PHE A N   1 
ATOM   2182 C CA  . PHE A 1 291 ? -28.631 6.384   1.628  1.00 63.05  ? 349  PHE A CA  1 
ATOM   2183 C C   . PHE A 1 291 ? -30.119 6.286   1.357  1.00 62.42  ? 349  PHE A C   1 
ATOM   2184 O O   . PHE A 1 291 ? -30.576 5.309   0.768  1.00 60.65  ? 349  PHE A O   1 
ATOM   2185 C CB  . PHE A 1 291 ? -28.343 6.104   3.109  1.00 63.41  ? 349  PHE A CB  1 
ATOM   2186 C CG  . PHE A 1 291 ? -26.983 5.510   3.362  1.00 62.00  ? 349  PHE A CG  1 
ATOM   2187 C CD1 . PHE A 1 291 ? -26.728 4.171   3.070  1.00 59.88  ? 349  PHE A CD1 1 
ATOM   2188 C CD2 . PHE A 1 291 ? -25.952 6.291   3.876  1.00 60.29  ? 349  PHE A CD2 1 
ATOM   2189 C CE1 . PHE A 1 291 ? -25.472 3.619   3.292  1.00 56.91  ? 349  PHE A CE1 1 
ATOM   2190 C CE2 . PHE A 1 291 ? -24.689 5.743   4.099  1.00 59.48  ? 349  PHE A CE2 1 
ATOM   2191 C CZ  . PHE A 1 291 ? -24.454 4.406   3.805  1.00 56.87  ? 349  PHE A CZ  1 
ATOM   2192 N N   . ARG A 1 292 ? -30.848 7.322   1.770  1.00 63.42  ? 350  ARG A N   1 
ATOM   2193 C CA  . ARG A 1 292 ? -32.284 7.436   1.553  1.00 65.62  ? 350  ARG A CA  1 
ATOM   2194 C C   . ARG A 1 292 ? -32.636 7.240   0.070  1.00 67.20  ? 350  ARG A C   1 
ATOM   2195 O O   . ARG A 1 292 ? -33.474 6.390   -0.267 1.00 67.16  ? 350  ARG A O   1 
ATOM   2196 C CB  . ARG A 1 292 ? -32.763 8.791   2.067  1.00 65.65  ? 350  ARG A CB  1 
ATOM   2197 C CG  . ARG A 1 292 ? -34.112 8.772   2.778  1.00 68.22  ? 350  ARG A CG  1 
ATOM   2198 C CD  . ARG A 1 292 ? -34.239 9.964   3.724  1.00 68.99  ? 350  ARG A CD  1 
ATOM   2199 N NE  . ARG A 1 292 ? -33.723 11.186  3.112  1.00 70.72  ? 350  ARG A NE  1 
ATOM   2200 C CZ  . ARG A 1 292 ? -33.179 12.202  3.777  1.00 72.67  ? 350  ARG A CZ  1 
ATOM   2201 N NH1 . ARG A 1 292 ? -33.071 12.166  5.099  1.00 75.81  ? 350  ARG A NH1 1 
ATOM   2202 N NH2 . ARG A 1 292 ? -32.734 13.261  3.115  1.00 70.54  ? 350  ARG A NH2 1 
ATOM   2203 N N   . LYS A 1 293 ? -31.964 7.995   -0.804 1.00 68.64  ? 351  LYS A N   1 
ATOM   2204 C CA  . LYS A 1 293 ? -32.126 7.860   -2.259 1.00 71.07  ? 351  LYS A CA  1 
ATOM   2205 C C   . LYS A 1 293 ? -31.779 6.471   -2.811 1.00 72.00  ? 351  LYS A C   1 
ATOM   2206 O O   . LYS A 1 293 ? -32.466 5.964   -3.708 1.00 73.36  ? 351  LYS A O   1 
ATOM   2207 C CB  . LYS A 1 293 ? -31.360 8.960   -3.011 1.00 71.82  ? 351  LYS A CB  1 
ATOM   2208 C CG  . LYS A 1 293 ? -32.281 10.029  -3.611 1.00 77.27  ? 351  LYS A CG  1 
ATOM   2209 C CD  . LYS A 1 293 ? -31.786 11.448  -3.365 1.00 81.01  ? 351  LYS A CD  1 
ATOM   2210 C CE  . LYS A 1 293 ? -32.960 12.433  -3.319 1.00 81.68  ? 351  LYS A CE  1 
ATOM   2211 N NZ  . LYS A 1 293 ? -32.533 13.795  -2.892 1.00 81.02  ? 351  LYS A NZ  1 
ATOM   2212 N N   . ALA A 1 294 ? -30.730 5.858   -2.267 1.00 72.21  ? 352  ALA A N   1 
ATOM   2213 C CA  . ALA A 1 294 ? -30.311 4.516   -2.680 1.00 72.77  ? 352  ALA A CA  1 
ATOM   2214 C C   . ALA A 1 294 ? -31.296 3.453   -2.209 1.00 73.40  ? 352  ALA A C   1 
ATOM   2215 O O   . ALA A 1 294 ? -31.518 2.451   -2.898 1.00 72.34  ? 352  ALA A O   1 
ATOM   2216 C CB  . ALA A 1 294 ? -28.915 4.211   -2.158 1.00 72.97  ? 352  ALA A CB  1 
ATOM   2217 N N   . PHE A 1 295 ? -31.872 3.682   -1.026 1.00 74.58  ? 353  PHE A N   1 
ATOM   2218 C CA  . PHE A 1 295 ? -32.890 2.797   -0.456 1.00 74.93  ? 353  PHE A CA  1 
ATOM   2219 C C   . PHE A 1 295 ? -34.145 2.813   -1.311 1.00 76.15  ? 353  PHE A C   1 
ATOM   2220 O O   . PHE A 1 295 ? -34.624 1.753   -1.728 1.00 74.85  ? 353  PHE A O   1 
ATOM   2221 C CB  . PHE A 1 295 ? -33.241 3.191   0.988  1.00 73.84  ? 353  PHE A CB  1 
ATOM   2222 C CG  . PHE A 1 295 ? -32.170 2.857   2.003  1.00 69.72  ? 353  PHE A CG  1 
ATOM   2223 C CD1 . PHE A 1 295 ? -31.219 1.871   1.752  1.00 64.67  ? 353  PHE A CD1 1 
ATOM   2224 C CD2 . PHE A 1 295 ? -32.135 3.518   3.231  1.00 67.83  ? 353  PHE A CD2 1 
ATOM   2225 C CE1 . PHE A 1 295 ? -30.238 1.568   2.696  1.00 60.68  ? 353  PHE A CE1 1 
ATOM   2226 C CE2 . PHE A 1 295 ? -31.156 3.216   4.183  1.00 64.17  ? 353  PHE A CE2 1 
ATOM   2227 C CZ  . PHE A 1 295 ? -30.209 2.242   3.911  1.00 60.90  ? 353  PHE A CZ  1 
ATOM   2228 N N   . LYS A 1 296 ? -34.658 4.022   -1.572 1.00 78.18  ? 354  LYS A N   1 
ATOM   2229 C CA  . LYS A 1 296 ? -35.848 4.220   -2.412 1.00 79.37  ? 354  LYS A CA  1 
ATOM   2230 C C   . LYS A 1 296 ? -35.679 3.623   -3.809 1.00 79.66  ? 354  LYS A C   1 
ATOM   2231 O O   . LYS A 1 296 ? -36.601 2.998   -4.330 1.00 80.40  ? 354  LYS A O   1 
ATOM   2232 C CB  . LYS A 1 296 ? -36.249 5.701   -2.471 1.00 79.25  ? 354  LYS A CB  1 
ATOM   2233 C CG  . LYS A 1 296 ? -37.195 6.099   -1.347 1.00 81.58  ? 354  LYS A CG  1 
ATOM   2234 C CD  . LYS A 1 296 ? -37.102 7.577   -0.975 1.00 83.98  ? 354  LYS A CD  1 
ATOM   2235 C CE  . LYS A 1 296 ? -37.843 7.839   0.344  1.00 83.50  ? 354  LYS A CE  1 
ATOM   2236 N NZ  . LYS A 1 296 ? -37.652 9.213   0.885  1.00 82.07  ? 354  LYS A NZ  1 
ATOM   2237 N N   . ARG A 1 297 ? -34.493 3.786   -4.391 1.00 80.10  ? 355  ARG A N   1 
ATOM   2238 C CA  . ARG A 1 297 ? -34.203 3.220   -5.705 1.00 81.62  ? 355  ARG A CA  1 
ATOM   2239 C C   . ARG A 1 297 ? -34.156 1.690   -5.683 1.00 81.97  ? 355  ARG A C   1 
ATOM   2240 O O   . ARG A 1 297 ? -34.692 1.037   -6.576 1.00 82.02  ? 355  ARG A O   1 
ATOM   2241 C CB  . ARG A 1 297 ? -32.899 3.796   -6.267 1.00 82.27  ? 355  ARG A CB  1 
ATOM   2242 C CG  . ARG A 1 297 ? -32.588 3.375   -7.704 1.00 83.77  ? 355  ARG A CG  1 
ATOM   2243 C CD  . ARG A 1 297 ? -31.107 3.512   -8.004 1.00 86.19  ? 355  ARG A CD  1 
ATOM   2244 N NE  . ARG A 1 297 ? -30.295 2.864   -6.977 1.00 89.15  ? 355  ARG A NE  1 
ATOM   2245 C CZ  . ARG A 1 297 ? -28.986 2.646   -7.065 1.00 90.87  ? 355  ARG A CZ  1 
ATOM   2246 N NH1 . ARG A 1 297 ? -28.314 3.015   -8.149 1.00 93.12  ? 355  ARG A NH1 1 
ATOM   2247 N NH2 . ARG A 1 297 ? -28.347 2.048   -6.067 1.00 89.20  ? 355  ARG A NH2 1 
ATOM   2248 N N   . LEU A 1 298 ? -33.520 1.123   -4.663 1.00 83.33  ? 356  LEU A N   1 
ATOM   2249 C CA  . LEU A 1 298 ? -33.364 -0.330  -4.571 1.00 83.81  ? 356  LEU A CA  1 
ATOM   2250 C C   . LEU A 1 298 ? -34.697 -1.049  -4.403 1.00 84.71  ? 356  LEU A C   1 
ATOM   2251 O O   . LEU A 1 298 ? -34.922 -2.093  -5.012 1.00 84.79  ? 356  LEU A O   1 
ATOM   2252 C CB  . LEU A 1 298 ? -32.409 -0.707  -3.435 1.00 83.07  ? 356  LEU A CB  1 
ATOM   2253 C CG  . LEU A 1 298 ? -30.907 -0.699  -3.724 1.00 81.34  ? 356  LEU A CG  1 
ATOM   2254 C CD1 . LEU A 1 298 ? -30.148 -0.680  -2.415 1.00 81.49  ? 356  LEU A CD1 1 
ATOM   2255 C CD2 . LEU A 1 298 ? -30.481 -1.895  -4.569 1.00 77.95  ? 356  LEU A CD2 1 
ATOM   2256 N N   . LEU A 1 299 ? -35.580 -0.475  -3.590 1.00 86.14  ? 357  LEU A N   1 
ATOM   2257 C CA  . LEU A 1 299 ? -36.880 -1.079  -3.303 1.00 87.77  ? 357  LEU A CA  1 
ATOM   2258 C C   . LEU A 1 299 ? -37.858 -1.019  -4.498 1.00 90.03  ? 357  LEU A C   1 
ATOM   2259 O O   . LEU A 1 299 ? -38.967 -1.561  -4.423 1.00 91.01  ? 357  LEU A O   1 
ATOM   2260 C CB  . LEU A 1 299 ? -37.494 -0.465  -2.031 1.00 86.77  ? 357  LEU A CB  1 
ATOM   2261 C CG  . LEU A 1 299 ? -36.754 -0.656  -0.692 1.00 84.99  ? 357  LEU A CG  1 
ATOM   2262 C CD1 . LEU A 1 299 ? -37.127 0.434   0.312  1.00 83.88  ? 357  LEU A CD1 1 
ATOM   2263 C CD2 . LEU A 1 299 ? -36.969 -2.037  -0.081 1.00 81.79  ? 357  LEU A CD2 1 
ATOM   2264 N N   . ALA A 1 300 ? -37.427 -0.381  -5.594 1.00 91.18  ? 358  ALA A N   1 
ATOM   2265 C CA  . ALA A 1 300 ? -38.182 -0.289  -6.859 1.00 91.41  ? 358  ALA A CA  1 
ATOM   2266 C C   . ALA A 1 300 ? -39.630 0.176   -6.688 1.00 92.38  ? 358  ALA A C   1 
ATOM   2267 O O   . ALA A 1 300 ? -39.889 1.339   -6.373 1.00 93.49  ? 358  ALA A O   1 
ATOM   2268 C CB  . ALA A 1 300 ? -38.120 -1.612  -7.635 1.00 90.75  ? 358  ALA A CB  1 
ATOM   2269 N N   . ALA B 1 3   ? 40.335  -15.072 9.093  1.00 74.67  ? 33   ALA B N   1 
ATOM   2270 C CA  . ALA B 1 3   ? 39.048  -15.523 8.491  1.00 73.76  ? 33   ALA B CA  1 
ATOM   2271 C C   . ALA B 1 3   ? 38.400  -16.586 9.381  1.00 73.28  ? 33   ALA B C   1 
ATOM   2272 O O   . ALA B 1 3   ? 37.559  -16.265 10.226 1.00 73.56  ? 33   ALA B O   1 
ATOM   2273 C CB  . ALA B 1 3   ? 39.275  -16.048 7.064  1.00 73.86  ? 33   ALA B CB  1 
ATOM   2274 N N   . GLU B 1 4   ? 38.810  -17.841 9.205  1.00 71.97  ? 34   GLU B N   1 
ATOM   2275 C CA  . GLU B 1 4   ? 38.313  -18.943 10.021 1.00 71.81  ? 34   GLU B CA  1 
ATOM   2276 C C   . GLU B 1 4   ? 38.690  -18.812 11.492 1.00 69.78  ? 34   GLU B C   1 
ATOM   2277 O O   . GLU B 1 4   ? 38.017  -19.363 12.365 1.00 71.21  ? 34   GLU B O   1 
ATOM   2278 C CB  . GLU B 1 4   ? 38.822  -20.278 9.490  1.00 72.91  ? 34   GLU B CB  1 
ATOM   2279 C CG  . GLU B 1 4   ? 38.106  -20.751 8.241  1.00 79.80  ? 34   GLU B CG  1 
ATOM   2280 C CD  . GLU B 1 4   ? 38.289  -22.237 7.990  1.00 86.87  ? 34   GLU B CD  1 
ATOM   2281 O OE1 . GLU B 1 4   ? 39.247  -22.829 8.542  1.00 89.14  ? 34   GLU B OE1 1 
ATOM   2282 O OE2 . GLU B 1 4   ? 37.471  -22.815 7.239  1.00 90.00  ? 34   GLU B OE2 1 
ATOM   2283 N N   . LEU B 1 5   ? 39.772  -18.093 11.763 1.00 66.62  ? 35   LEU B N   1 
ATOM   2284 C CA  . LEU B 1 5   ? 40.221  -17.877 13.134 1.00 63.19  ? 35   LEU B CA  1 
ATOM   2285 C C   . LEU B 1 5   ? 39.336  -16.849 13.823 1.00 59.90  ? 35   LEU B C   1 
ATOM   2286 O O   . LEU B 1 5   ? 38.977  -17.003 14.989 1.00 58.02  ? 35   LEU B O   1 
ATOM   2287 C CB  . LEU B 1 5   ? 41.696  -17.448 13.171 1.00 63.27  ? 35   LEU B CB  1 
ATOM   2288 C CG  . LEU B 1 5   ? 42.768  -18.473 12.765 1.00 64.43  ? 35   LEU B CG  1 
ATOM   2289 C CD1 . LEU B 1 5   ? 44.078  -17.779 12.402 1.00 64.33  ? 35   LEU B CD1 1 
ATOM   2290 C CD2 . LEU B 1 5   ? 42.991  -19.515 13.852 1.00 61.50  ? 35   LEU B CD2 1 
ATOM   2291 N N   . LEU B 1 6   ? 38.988  -15.810 13.075 1.00 59.30  ? 36   LEU B N   1 
ATOM   2292 C CA  . LEU B 1 6   ? 38.109  -14.738 13.531 1.00 58.55  ? 36   LEU B CA  1 
ATOM   2293 C C   . LEU B 1 6   ? 36.738  -15.288 13.925 1.00 58.64  ? 36   LEU B C   1 
ATOM   2294 O O   . LEU B 1 6   ? 36.130  -14.856 14.906 1.00 58.62  ? 36   LEU B O   1 
ATOM   2295 C CB  . LEU B 1 6   ? 37.962  -13.720 12.408 1.00 57.62  ? 36   LEU B CB  1 
ATOM   2296 C CG  . LEU B 1 6   ? 37.701  -12.243 12.708 1.00 58.61  ? 36   LEU B CG  1 
ATOM   2297 C CD1 . LEU B 1 6   ? 38.343  -11.742 14.012 1.00 55.21  ? 36   LEU B CD1 1 
ATOM   2298 C CD2 . LEU B 1 6   ? 38.181  -11.430 11.510 1.00 60.30  ? 36   LEU B CD2 1 
ATOM   2299 N N   . SER B 1 7   ? 36.277  -16.259 13.147 1.00 57.79  ? 37   SER B N   1 
ATOM   2300 C CA  . SER B 1 7   ? 35.062  -16.989 13.425 1.00 56.79  ? 37   SER B CA  1 
ATOM   2301 C C   . SER B 1 7   ? 35.173  -17.870 14.684 1.00 56.52  ? 37   SER B C   1 
ATOM   2302 O O   . SER B 1 7   ? 34.268  -17.884 15.500 1.00 57.70  ? 37   SER B O   1 
ATOM   2303 C CB  . SER B 1 7   ? 34.684  -17.800 12.182 1.00 56.74  ? 37   SER B CB  1 
ATOM   2304 O OG  . SER B 1 7   ? 34.116  -19.049 12.506 1.00 57.85  ? 37   SER B OG  1 
ATOM   2305 N N   . GLN B 1 8   ? 36.275  -18.599 14.842 1.00 56.52  ? 38   GLN B N   1 
ATOM   2306 C CA  . GLN B 1 8   ? 36.499  -19.424 16.047 1.00 55.71  ? 38   GLN B CA  1 
ATOM   2307 C C   . GLN B 1 8   ? 36.523  -18.615 17.350 1.00 53.16  ? 38   GLN B C   1 
ATOM   2308 O O   . GLN B 1 8   ? 35.981  -19.045 18.371 1.00 51.85  ? 38   GLN B O   1 
ATOM   2309 C CB  . GLN B 1 8   ? 37.805  -20.209 15.934 1.00 55.20  ? 38   GLN B CB  1 
ATOM   2310 C CG  . GLN B 1 8   ? 37.716  -21.442 15.087 1.00 61.79  ? 38   GLN B CG  1 
ATOM   2311 C CD  . GLN B 1 8   ? 38.998  -22.237 15.104 1.00 67.69  ? 38   GLN B CD  1 
ATOM   2312 O OE1 . GLN B 1 8   ? 39.676  -22.317 16.130 1.00 71.31  ? 38   GLN B OE1 1 
ATOM   2313 N NE2 . GLN B 1 8   ? 39.341  -22.834 13.965 1.00 68.75  ? 38   GLN B NE2 1 
ATOM   2314 N N   . GLN B 1 9   ? 37.170  -17.454 17.301 1.00 50.89  ? 39   GLN B N   1 
ATOM   2315 C CA  . GLN B 1 9   ? 37.300  -16.597 18.465 1.00 51.18  ? 39   GLN B CA  1 
ATOM   2316 C C   . GLN B 1 9   ? 35.923  -16.097 18.870 1.00 52.25  ? 39   GLN B C   1 
ATOM   2317 O O   . GLN B 1 9   ? 35.543  -16.121 20.046 1.00 52.47  ? 39   GLN B O   1 
ATOM   2318 C CB  . GLN B 1 9   ? 38.216  -15.405 18.166 1.00 49.54  ? 39   GLN B CB  1 
ATOM   2319 C CG  . GLN B 1 9   ? 38.294  -14.409 19.316 1.00 48.12  ? 39   GLN B CG  1 
ATOM   2320 C CD  . GLN B 1 9   ? 39.098  -13.183 18.980 1.00 50.16  ? 39   GLN B CD  1 
ATOM   2321 O OE1 . GLN B 1 9   ? 39.258  -12.837 17.818 1.00 55.00  ? 39   GLN B OE1 1 
ATOM   2322 N NE2 . GLN B 1 9   ? 39.619  -12.520 20.001 1.00 49.03  ? 39   GLN B NE2 1 
ATOM   2323 N N   . TRP B 1 10  ? 35.182  -15.646 17.868 1.00 51.73  ? 40   TRP B N   1 
ATOM   2324 C CA  . TRP B 1 10  ? 33.854  -15.111 18.069 1.00 50.83  ? 40   TRP B CA  1 
ATOM   2325 C C   . TRP B 1 10  ? 32.841  -16.170 18.538 1.00 49.30  ? 40   TRP B C   1 
ATOM   2326 O O   . TRP B 1 10  ? 32.072  -15.928 19.465 1.00 48.36  ? 40   TRP B O   1 
ATOM   2327 C CB  . TRP B 1 10  ? 33.378  -14.432 16.793 1.00 51.71  ? 40   TRP B CB  1 
ATOM   2328 C CG  . TRP B 1 10  ? 32.194  -13.566 17.026 1.00 55.38  ? 40   TRP B CG  1 
ATOM   2329 C CD1 . TRP B 1 10  ? 32.189  -12.276 17.498 1.00 57.75  ? 40   TRP B CD1 1 
ATOM   2330 C CD2 . TRP B 1 10  ? 30.831  -13.921 16.815 1.00 55.95  ? 40   TRP B CD2 1 
ATOM   2331 N NE1 . TRP B 1 10  ? 30.899  -11.807 17.588 1.00 55.85  ? 40   TRP B NE1 1 
ATOM   2332 C CE2 . TRP B 1 10  ? 30.044  -12.796 17.179 1.00 57.15  ? 40   TRP B CE2 1 
ATOM   2333 C CE3 . TRP B 1 10  ? 30.192  -15.078 16.349 1.00 53.32  ? 40   TRP B CE3 1 
ATOM   2334 C CZ2 . TRP B 1 10  ? 28.651  -12.797 17.091 1.00 56.14  ? 40   TRP B CZ2 1 
ATOM   2335 C CZ3 . TRP B 1 10  ? 28.814  -15.082 16.261 1.00 53.79  ? 40   TRP B CZ3 1 
ATOM   2336 C CH2 . TRP B 1 10  ? 28.054  -13.945 16.631 1.00 55.95  ? 40   TRP B CH2 1 
ATOM   2337 N N   . GLU B 1 11  ? 32.855  -17.341 17.911 1.00 47.62  ? 41   GLU B N   1 
ATOM   2338 C CA  . GLU B 1 11  ? 31.958  -18.425 18.286 1.00 46.29  ? 41   GLU B CA  1 
ATOM   2339 C C   . GLU B 1 11  ? 32.156  -18.915 19.698 1.00 45.20  ? 41   GLU B C   1 
ATOM   2340 O O   . GLU B 1 11  ? 31.187  -19.219 20.378 1.00 44.69  ? 41   GLU B O   1 
ATOM   2341 C CB  . GLU B 1 11  ? 32.104  -19.608 17.348 1.00 47.57  ? 41   GLU B CB  1 
ATOM   2342 C CG  . GLU B 1 11  ? 31.466  -19.389 15.999 1.00 53.96  ? 41   GLU B CG  1 
ATOM   2343 C CD  . GLU B 1 11  ? 30.983  -20.679 15.369 1.00 63.94  ? 41   GLU B CD  1 
ATOM   2344 O OE1 . GLU B 1 11  ? 31.128  -21.758 15.995 1.00 68.02  ? 41   GLU B OE1 1 
ATOM   2345 O OE2 . GLU B 1 11  ? 30.444  -20.612 14.244 1.00 68.64  ? 41   GLU B OE2 1 
ATOM   2346 N N   . ALA B 1 12  ? 33.407  -18.997 20.141 1.00 45.95  ? 42   ALA B N   1 
ATOM   2347 C CA  . ALA B 1 12  ? 33.710  -19.549 21.457 1.00 43.21  ? 42   ALA B CA  1 
ATOM   2348 C C   . ALA B 1 12  ? 33.404  -18.554 22.571 1.00 42.23  ? 42   ALA B C   1 
ATOM   2349 O O   . ALA B 1 12  ? 32.931  -18.945 23.633 1.00 41.08  ? 42   ALA B O   1 
ATOM   2350 C CB  . ALA B 1 12  ? 35.153  -20.017 21.521 1.00 43.36  ? 42   ALA B CB  1 
ATOM   2351 N N   . GLY B 1 13  ? 33.685  -17.279 22.327 1.00 42.86  ? 43   GLY B N   1 
ATOM   2352 C CA  . GLY B 1 13  ? 33.474  -16.233 23.325 1.00 46.59  ? 43   GLY B CA  1 
ATOM   2353 C C   . GLY B 1 13  ? 31.993  -15.933 23.481 1.00 48.46  ? 43   GLY B C   1 
ATOM   2354 O O   . GLY B 1 13  ? 31.496  -15.690 24.588 1.00 47.75  ? 43   GLY B O   1 
ATOM   2355 N N   . MET B 1 14  ? 31.287  -15.963 22.355 1.00 49.72  ? 44   MET B N   1 
ATOM   2356 C CA  . MET B 1 14  ? 29.864  -15.676 22.339 1.00 50.15  ? 44   MET B CA  1 
ATOM   2357 C C   . MET B 1 14  ? 29.103  -16.820 23.008 1.00 49.84  ? 44   MET B C   1 
ATOM   2358 O O   . MET B 1 14  ? 28.155  -16.575 23.740 1.00 49.45  ? 44   MET B O   1 
ATOM   2359 C CB  . MET B 1 14  ? 29.383  -15.427 20.910 1.00 50.33  ? 44   MET B CB  1 
ATOM   2360 C CG  . MET B 1 14  ? 28.207  -14.474 20.797 1.00 53.24  ? 44   MET B CG  1 
ATOM   2361 S SD  . MET B 1 14  ? 28.426  -12.796 21.483 1.00 55.97  ? 44   MET B SD  1 
ATOM   2362 C CE  . MET B 1 14  ? 30.008  -12.297 20.830 1.00 60.32  ? 44   MET B CE  1 
ATOM   2363 N N   . SER B 1 15  ? 29.543  -18.058 22.783 1.00 49.03  ? 45   SER B N   1 
ATOM   2364 C CA  . SER B 1 15  ? 29.008  -19.217 23.502 1.00 48.80  ? 45   SER B CA  1 
ATOM   2365 C C   . SER B 1 15  ? 29.218  -19.092 25.005 1.00 50.49  ? 45   SER B C   1 
ATOM   2366 O O   . SER B 1 15  ? 28.394  -19.556 25.790 1.00 51.21  ? 45   SER B O   1 
ATOM   2367 C CB  . SER B 1 15  ? 29.670  -20.511 23.035 1.00 47.26  ? 45   SER B CB  1 
ATOM   2368 O OG  . SER B 1 15  ? 29.383  -20.772 21.679 1.00 48.21  ? 45   SER B OG  1 
ATOM   2369 N N   . LEU B 1 16  ? 30.332  -18.485 25.404 1.00 51.33  ? 46   LEU B N   1 
ATOM   2370 C CA  . LEU B 1 16  ? 30.664  -18.365 26.818 1.00 51.48  ? 46   LEU B CA  1 
ATOM   2371 C C   . LEU B 1 16  ? 29.732  -17.353 27.470 1.00 49.30  ? 46   LEU B C   1 
ATOM   2372 O O   . LEU B 1 16  ? 29.227  -17.564 28.572 1.00 47.94  ? 46   LEU B O   1 
ATOM   2373 C CB  . LEU B 1 16  ? 32.119  -17.946 27.003 1.00 51.74  ? 46   LEU B CB  1 
ATOM   2374 C CG  . LEU B 1 16  ? 32.773  -18.622 28.202 1.00 57.69  ? 46   LEU B CG  1 
ATOM   2375 C CD1 . LEU B 1 16  ? 33.299  -19.999 27.810 1.00 56.17  ? 46   LEU B CD1 1 
ATOM   2376 C CD2 . LEU B 1 16  ? 33.887  -17.737 28.783 1.00 63.66  ? 46   LEU B CD2 1 
ATOM   2377 N N   . LEU B 1 17  ? 29.512  -16.257 26.761 1.00 47.10  ? 47   LEU B N   1 
ATOM   2378 C CA  . LEU B 1 17  ? 28.612  -15.219 27.206 1.00 47.68  ? 47   LEU B CA  1 
ATOM   2379 C C   . LEU B 1 17  ? 27.158  -15.742 27.302 1.00 47.57  ? 47   LEU B C   1 
ATOM   2380 O O   . LEU B 1 17  ? 26.489  -15.549 28.323 1.00 46.38  ? 47   LEU B O   1 
ATOM   2381 C CB  . LEU B 1 17  ? 28.709  -14.023 26.259 1.00 47.09  ? 47   LEU B CB  1 
ATOM   2382 C CG  . LEU B 1 17  ? 27.868  -12.779 26.530 1.00 46.74  ? 47   LEU B CG  1 
ATOM   2383 C CD1 . LEU B 1 17  ? 28.118  -12.236 27.929 1.00 48.06  ? 47   LEU B CD1 1 
ATOM   2384 C CD2 . LEU B 1 17  ? 28.189  -11.723 25.486 1.00 46.41  ? 47   LEU B CD2 1 
ATOM   2385 N N   . MET B 1 18  ? 26.701  -16.416 26.246 1.00 45.27  ? 48   MET B N   1 
ATOM   2386 C CA  . MET B 1 18  ? 25.363  -16.978 26.190 1.00 43.06  ? 48   MET B CA  1 
ATOM   2387 C C   . MET B 1 18  ? 25.077  -17.962 27.325 1.00 42.15  ? 48   MET B C   1 
ATOM   2388 O O   . MET B 1 18  ? 23.979  -17.943 27.892 1.00 42.04  ? 48   MET B O   1 
ATOM   2389 C CB  . MET B 1 18  ? 25.098  -17.663 24.852 1.00 42.92  ? 48   MET B CB  1 
ATOM   2390 C CG  . MET B 1 18  ? 24.988  -16.757 23.633 1.00 44.80  ? 48   MET B CG  1 
ATOM   2391 S SD  . MET B 1 18  ? 23.932  -15.292 23.739 1.00 50.20  ? 48   MET B SD  1 
ATOM   2392 C CE  . MET B 1 18  ? 22.633  -15.925 24.771 1.00 55.51  ? 48   MET B CE  1 
ATOM   2393 N N   . ALA B 1 19  ? 26.049  -18.813 27.651 1.00 40.89  ? 49   ALA B N   1 
ATOM   2394 C CA  . ALA B 1 19  ? 25.917  -19.747 28.781 1.00 39.63  ? 49   ALA B CA  1 
ATOM   2395 C C   . ALA B 1 19  ? 25.842  -18.979 30.099 1.00 40.43  ? 49   ALA B C   1 
ATOM   2396 O O   . ALA B 1 19  ? 25.109  -19.364 30.997 1.00 40.11  ? 49   ALA B O   1 
ATOM   2397 C CB  . ALA B 1 19  ? 27.064  -20.741 28.812 1.00 37.56  ? 49   ALA B CB  1 
ATOM   2398 N N   . LEU B 1 20  ? 26.602  -17.891 30.214 1.00 41.50  ? 50   LEU B N   1 
ATOM   2399 C CA  . LEU B 1 20  ? 26.575  -17.096 31.435 1.00 42.77  ? 50   LEU B CA  1 
ATOM   2400 C C   . LEU B 1 20  ? 25.166  -16.507 31.634 1.00 42.51  ? 50   LEU B C   1 
ATOM   2401 O O   . LEU B 1 20  ? 24.606  -16.586 32.732 1.00 42.20  ? 50   LEU B O   1 
ATOM   2402 C CB  . LEU B 1 20  ? 27.654  -15.991 31.419 1.00 42.85  ? 50   LEU B CB  1 
ATOM   2403 C CG  . LEU B 1 20  ? 27.529  -14.892 32.494 1.00 46.71  ? 50   LEU B CG  1 
ATOM   2404 C CD1 . LEU B 1 20  ? 27.806  -15.446 33.899 1.00 48.40  ? 50   LEU B CD1 1 
ATOM   2405 C CD2 . LEU B 1 20  ? 28.410  -13.663 32.205 1.00 50.98  ? 50   LEU B CD2 1 
ATOM   2406 N N   . VAL B 1 21  ? 24.613  -15.927 30.562 1.00 40.29  ? 51   VAL B N   1 
ATOM   2407 C CA  . VAL B 1 21  ? 23.272  -15.358 30.567 1.00 38.06  ? 51   VAL B CA  1 
ATOM   2408 C C   . VAL B 1 21  ? 22.238  -16.415 30.993 1.00 39.22  ? 51   VAL B C   1 
ATOM   2409 O O   . VAL B 1 21  ? 21.429  -16.159 31.873 1.00 39.79  ? 51   VAL B O   1 
ATOM   2410 C CB  . VAL B 1 21  ? 22.923  -14.739 29.194 1.00 36.74  ? 51   VAL B CB  1 
ATOM   2411 C CG1 . VAL B 1 21  ? 21.438  -14.396 29.100 1.00 33.51  ? 51   VAL B CG1 1 
ATOM   2412 C CG2 . VAL B 1 21  ? 23.743  -13.492 28.965 1.00 34.94  ? 51   VAL B CG2 1 
ATOM   2413 N N   . VAL B 1 22  ? 22.296  -17.604 30.394 1.00 38.55  ? 52   VAL B N   1 
ATOM   2414 C CA  . VAL B 1 22  ? 21.405  -18.701 30.751 1.00 37.85  ? 52   VAL B CA  1 
ATOM   2415 C C   . VAL B 1 22  ? 21.548  -19.057 32.228 1.00 41.49  ? 52   VAL B C   1 
ATOM   2416 O O   . VAL B 1 22  ? 20.550  -19.216 32.941 1.00 41.82  ? 52   VAL B O   1 
ATOM   2417 C CB  . VAL B 1 22  ? 21.661  -19.955 29.877 1.00 36.34  ? 52   VAL B CB  1 
ATOM   2418 C CG1 . VAL B 1 22  ? 20.845  -21.153 30.364 1.00 30.05  ? 52   VAL B CG1 1 
ATOM   2419 C CG2 . VAL B 1 22  ? 21.338  -19.663 28.436 1.00 32.62  ? 52   VAL B CG2 1 
ATOM   2420 N N   . LEU B 1 23  ? 22.793  -19.169 32.682 1.00 43.60  ? 53   LEU B N   1 
ATOM   2421 C CA  . LEU B 1 23  ? 23.089  -19.563 34.056 1.00 45.33  ? 53   LEU B CA  1 
ATOM   2422 C C   . LEU B 1 23  ? 22.545  -18.545 35.058 1.00 45.16  ? 53   LEU B C   1 
ATOM   2423 O O   . LEU B 1 23  ? 21.997  -18.910 36.093 1.00 45.25  ? 53   LEU B O   1 
ATOM   2424 C CB  . LEU B 1 23  ? 24.595  -19.676 34.239 1.00 47.83  ? 53   LEU B CB  1 
ATOM   2425 C CG  . LEU B 1 23  ? 25.087  -20.886 35.019 1.00 51.27  ? 53   LEU B CG  1 
ATOM   2426 C CD1 . LEU B 1 23  ? 25.535  -21.965 34.024 1.00 50.34  ? 53   LEU B CD1 1 
ATOM   2427 C CD2 . LEU B 1 23  ? 26.224  -20.440 35.949 1.00 51.29  ? 53   LEU B CD2 1 
ATOM   2428 N N   . LEU B 1 24  ? 22.715  -17.271 34.738 1.00 44.49  ? 54   LEU B N   1 
ATOM   2429 C CA  . LEU B 1 24  ? 22.256  -16.182 35.573 1.00 44.34  ? 54   LEU B CA  1 
ATOM   2430 C C   . LEU B 1 24  ? 20.724  -16.179 35.656 1.00 44.49  ? 54   LEU B C   1 
ATOM   2431 O O   . LEU B 1 24  ? 20.157  -16.030 36.737 1.00 45.38  ? 54   LEU B O   1 
ATOM   2432 C CB  . LEU B 1 24  ? 22.771  -14.871 34.992 1.00 45.19  ? 54   LEU B CB  1 
ATOM   2433 C CG  . LEU B 1 24  ? 22.768  -13.579 35.804 1.00 49.01  ? 54   LEU B CG  1 
ATOM   2434 C CD1 . LEU B 1 24  ? 23.314  -13.810 37.224 1.00 47.67  ? 54   LEU B CD1 1 
ATOM   2435 C CD2 . LEU B 1 24  ? 23.569  -12.510 35.038 1.00 45.36  ? 54   LEU B CD2 1 
ATOM   2436 N N   . ILE B 1 25  ? 20.059  -16.364 34.516 1.00 42.53  ? 55   ILE B N   1 
ATOM   2437 C CA  . ILE B 1 25  ? 18.605  -16.373 34.466 1.00 38.70  ? 55   ILE B CA  1 
ATOM   2438 C C   . ILE B 1 25  ? 18.020  -17.598 35.168 1.00 40.88  ? 55   ILE B C   1 
ATOM   2439 O O   . ILE B 1 25  ? 17.012  -17.484 35.863 1.00 41.51  ? 55   ILE B O   1 
ATOM   2440 C CB  . ILE B 1 25  ? 18.069  -16.317 33.015 1.00 37.37  ? 55   ILE B CB  1 
ATOM   2441 C CG1 . ILE B 1 25  ? 18.431  -14.994 32.352 1.00 34.00  ? 55   ILE B CG1 1 
ATOM   2442 C CG2 . ILE B 1 25  ? 16.546  -16.496 32.982 1.00 29.97  ? 55   ILE B CG2 1 
ATOM   2443 C CD1 . ILE B 1 25  ? 18.129  -14.987 30.858 1.00 35.42  ? 55   ILE B CD1 1 
ATOM   2444 N N   . VAL B 1 26  ? 18.629  -18.769 34.982 1.00 42.05  ? 56   VAL B N   1 
ATOM   2445 C CA  . VAL B 1 26  ? 18.092  -19.992 35.604 1.00 42.09  ? 56   VAL B CA  1 
ATOM   2446 C C   . VAL B 1 26  ? 18.380  -20.085 37.114 1.00 43.00  ? 56   VAL B C   1 
ATOM   2447 O O   . VAL B 1 26  ? 17.474  -20.356 37.892 1.00 43.13  ? 56   VAL B O   1 
ATOM   2448 C CB  . VAL B 1 26  ? 18.500  -21.302 34.851 1.00 40.95  ? 56   VAL B CB  1 
ATOM   2449 C CG1 . VAL B 1 26  ? 17.976  -22.540 35.587 1.00 33.72  ? 56   VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 1 26  ? 17.960  -21.286 33.430 1.00 38.94  ? 56   VAL B CG2 1 
ATOM   2451 N N   . ALA B 1 27  ? 19.627  -19.858 37.526 1.00 44.93  ? 57   ALA B N   1 
ATOM   2452 C CA  . ALA B 1 27  ? 19.963  -19.851 38.953 1.00 45.25  ? 57   ALA B CA  1 
ATOM   2453 C C   . ALA B 1 27  ? 19.103  -18.812 39.690 1.00 45.51  ? 57   ALA B C   1 
ATOM   2454 O O   . ALA B 1 27  ? 18.379  -19.151 40.622 1.00 45.07  ? 57   ALA B O   1 
ATOM   2455 C CB  . ALA B 1 27  ? 21.446  -19.569 39.162 1.00 44.81  ? 57   ALA B CB  1 
ATOM   2456 N N   . GLY B 1 28  ? 19.174  -17.562 39.240 1.00 44.87  ? 58   GLY B N   1 
ATOM   2457 C CA  . GLY B 1 28  ? 18.450  -16.465 39.861 1.00 45.39  ? 58   GLY B CA  1 
ATOM   2458 C C   . GLY B 1 28  ? 16.977  -16.750 40.116 1.00 46.46  ? 58   GLY B C   1 
ATOM   2459 O O   . GLY B 1 28  ? 16.458  -16.437 41.205 1.00 45.81  ? 58   GLY B O   1 
ATOM   2460 N N   . ASN B 1 29  ? 16.308  -17.347 39.125 1.00 43.89  ? 59   ASN B N   1 
ATOM   2461 C CA  . ASN B 1 29  ? 14.856  -17.551 39.176 1.00 41.24  ? 59   ASN B CA  1 
ATOM   2462 C C   . ASN B 1 29  ? 14.432  -18.834 39.885 1.00 42.16  ? 59   ASN B C   1 
ATOM   2463 O O   . ASN B 1 29  ? 13.362  -18.881 40.480 1.00 43.15  ? 59   ASN B O   1 
ATOM   2464 C CB  . ASN B 1 29  ? 14.220  -17.443 37.784 1.00 39.50  ? 59   ASN B CB  1 
ATOM   2465 C CG  . ASN B 1 29  ? 14.048  -15.998 37.324 1.00 39.31  ? 59   ASN B CG  1 
ATOM   2466 O OD1 . ASN B 1 29  ? 13.269  -15.237 37.903 1.00 36.91  ? 59   ASN B OD1 1 
ATOM   2467 N ND2 . ASN B 1 29  ? 14.779  -15.614 36.274 1.00 39.62  ? 59   ASN B ND2 1 
ATOM   2468 N N   . VAL B 1 30  ? 15.264  -19.870 39.821 1.00 43.99  ? 60   VAL B N   1 
ATOM   2469 C CA  . VAL B 1 30  ? 15.082  -21.059 40.659 1.00 43.57  ? 60   VAL B CA  1 
ATOM   2470 C C   . VAL B 1 30  ? 15.219  -20.640 42.130 1.00 44.27  ? 60   VAL B C   1 
ATOM   2471 O O   . VAL B 1 30  ? 14.439  -21.070 42.975 1.00 43.40  ? 60   VAL B O   1 
ATOM   2472 C CB  . VAL B 1 30  ? 16.081  -22.203 40.292 1.00 42.34  ? 60   VAL B CB  1 
ATOM   2473 C CG1 . VAL B 1 30  ? 16.213  -23.213 41.424 1.00 42.12  ? 60   VAL B CG1 1 
ATOM   2474 C CG2 . VAL B 1 30  ? 15.642  -22.901 39.033 1.00 38.80  ? 60   VAL B CG2 1 
ATOM   2475 N N   . LEU B 1 31  ? 16.199  -19.785 42.419 1.00 45.42  ? 61   LEU B N   1 
ATOM   2476 C CA  . LEU B 1 31  ? 16.388  -19.285 43.771 1.00 46.20  ? 61   LEU B CA  1 
ATOM   2477 C C   . LEU B 1 31  ? 15.119  -18.617 44.276 1.00 45.41  ? 61   LEU B C   1 
ATOM   2478 O O   . LEU B 1 31  ? 14.676  -18.899 45.377 1.00 46.39  ? 61   LEU B O   1 
ATOM   2479 C CB  . LEU B 1 31  ? 17.598  -18.348 43.864 1.00 46.70  ? 61   LEU B CB  1 
ATOM   2480 C CG  . LEU B 1 31  ? 18.947  -19.057 44.053 1.00 50.76  ? 61   LEU B CG  1 
ATOM   2481 C CD1 . LEU B 1 31  ? 20.120  -18.077 43.919 1.00 52.02  ? 61   LEU B CD1 1 
ATOM   2482 C CD2 . LEU B 1 31  ? 19.000  -19.821 45.392 1.00 49.75  ? 61   LEU B CD2 1 
ATOM   2483 N N   . VAL B 1 32  ? 14.520  -17.770 43.446 1.00 46.03  ? 62   VAL B N   1 
ATOM   2484 C CA  . VAL B 1 32  ? 13.286  -17.051 43.793 1.00 44.84  ? 62   VAL B CA  1 
ATOM   2485 C C   . VAL B 1 32  ? 12.113  -17.996 44.072 1.00 44.97  ? 62   VAL B C   1 
ATOM   2486 O O   . VAL B 1 32  ? 11.394  -17.822 45.054 1.00 43.84  ? 62   VAL B O   1 
ATOM   2487 C CB  . VAL B 1 32  ? 12.897  -16.006 42.712 1.00 43.52  ? 62   VAL B CB  1 
ATOM   2488 C CG1 . VAL B 1 32  ? 11.507  -15.434 42.983 1.00 42.83  ? 62   VAL B CG1 1 
ATOM   2489 C CG2 . VAL B 1 32  ? 13.907  -14.864 42.684 1.00 43.07  ? 62   VAL B CG2 1 
ATOM   2490 N N   . ILE B 1 33  ? 11.935  -18.994 43.212 1.00 46.14  ? 63   ILE B N   1 
ATOM   2491 C CA  . ILE B 1 33  ? 10.881  -19.986 43.395 1.00 46.62  ? 63   ILE B CA  1 
ATOM   2492 C C   . ILE B 1 33  ? 11.151  -20.846 44.638 1.00 48.08  ? 63   ILE B C   1 
ATOM   2493 O O   . ILE B 1 33  ? 10.249  -21.041 45.453 1.00 48.62  ? 63   ILE B O   1 
ATOM   2494 C CB  . ILE B 1 33  ? 10.679  -20.862 42.132 1.00 46.83  ? 63   ILE B CB  1 
ATOM   2495 C CG1 . ILE B 1 33  ? 10.227  -19.996 40.949 1.00 47.83  ? 63   ILE B CG1 1 
ATOM   2496 C CG2 . ILE B 1 33  ? 9.660   -21.968 42.397 1.00 43.93  ? 63   ILE B CG2 1 
ATOM   2497 C CD1 . ILE B 1 33  ? 10.437  -20.640 39.556 1.00 50.01  ? 63   ILE B CD1 1 
ATOM   2498 N N   . ALA B 1 34  ? 12.386  -21.335 44.792 1.00 48.07  ? 64   ALA B N   1 
ATOM   2499 C CA  . ALA B 1 34  ? 12.761  -22.133 45.967 1.00 47.65  ? 64   ALA B CA  1 
ATOM   2500 C C   . ALA B 1 34  ? 12.647  -21.347 47.278 1.00 47.13  ? 64   ALA B C   1 
ATOM   2501 O O   . ALA B 1 34  ? 12.206  -21.889 48.288 1.00 47.63  ? 64   ALA B O   1 
ATOM   2502 C CB  . ALA B 1 34  ? 14.157  -22.720 45.811 1.00 47.64  ? 64   ALA B CB  1 
ATOM   2503 N N   . ALA B 1 35  ? 13.031  -20.073 47.255 1.00 46.85  ? 65   ALA B N   1 
ATOM   2504 C CA  . ALA B 1 35  ? 12.924  -19.205 48.442 1.00 47.99  ? 65   ALA B CA  1 
ATOM   2505 C C   . ALA B 1 35  ? 11.481  -19.031 48.923 1.00 49.77  ? 65   ALA B C   1 
ATOM   2506 O O   . ALA B 1 35  ? 11.187  -19.221 50.112 1.00 50.91  ? 65   ALA B O   1 
ATOM   2507 C CB  . ALA B 1 35  ? 13.555  -17.845 48.186 1.00 44.36  ? 65   ALA B CB  1 
ATOM   2508 N N   . ILE B 1 36  ? 10.591  -18.658 47.999 1.00 49.68  ? 66   ILE B N   1 
ATOM   2509 C CA  . ILE B 1 36  ? 9.168   -18.488 48.305 1.00 47.65  ? 66   ILE B CA  1 
ATOM   2510 C C   . ILE B 1 36  ? 8.527   -19.800 48.753 1.00 48.48  ? 66   ILE B C   1 
ATOM   2511 O O   . ILE B 1 36  ? 7.702   -19.795 49.662 1.00 49.44  ? 66   ILE B O   1 
ATOM   2512 C CB  . ILE B 1 36  ? 8.386   -17.875 47.111 1.00 46.51  ? 66   ILE B CB  1 
ATOM   2513 C CG1 . ILE B 1 36  ? 8.678   -16.379 46.999 1.00 41.37  ? 66   ILE B CG1 1 
ATOM   2514 C CG2 . ILE B 1 36  ? 6.869   -18.102 47.250 1.00 45.20  ? 66   ILE B CG2 1 
ATOM   2515 C CD1 . ILE B 1 36  ? 8.238   -15.762 45.690 1.00 34.36  ? 66   ILE B CD1 1 
ATOM   2516 N N   . GLY B 1 37  ? 8.916   -20.912 48.130 1.00 48.13  ? 67   GLY B N   1 
ATOM   2517 C CA  . GLY B 1 37  ? 8.321   -22.209 48.428 1.00 50.07  ? 67   GLY B CA  1 
ATOM   2518 C C   . GLY B 1 37  ? 8.716   -22.820 49.766 1.00 53.02  ? 67   GLY B C   1 
ATOM   2519 O O   . GLY B 1 37  ? 8.084   -23.773 50.224 1.00 53.22  ? 67   GLY B O   1 
ATOM   2520 N N   . SER B 1 38  ? 9.750   -22.268 50.399 1.00 55.68  ? 68   SER B N   1 
ATOM   2521 C CA  . SER B 1 38  ? 10.373  -22.891 51.570 1.00 57.09  ? 68   SER B CA  1 
ATOM   2522 C C   . SER B 1 38  ? 10.484  -21.950 52.766 1.00 59.11  ? 68   SER B C   1 
ATOM   2523 O O   . SER B 1 38  ? 10.627  -22.404 53.899 1.00 60.92  ? 68   SER B O   1 
ATOM   2524 C CB  . SER B 1 38  ? 11.759  -23.423 51.206 1.00 56.35  ? 68   SER B CB  1 
ATOM   2525 O OG  . SER B 1 38  ? 12.634  -22.351 50.893 1.00 55.82  ? 68   SER B OG  1 
ATOM   2526 N N   . THR B 1 39  ? 10.438  -20.647 52.517 1.00 60.76  ? 69   THR B N   1 
ATOM   2527 C CA  . THR B 1 39  ? 10.462  -19.669 53.594 1.00 63.16  ? 69   THR B CA  1 
ATOM   2528 C C   . THR B 1 39  ? 9.030   -19.294 53.951 1.00 67.00  ? 69   THR B C   1 
ATOM   2529 O O   . THR B 1 39  ? 8.270   -18.823 53.103 1.00 68.47  ? 69   THR B O   1 
ATOM   2530 C CB  . THR B 1 39  ? 11.284  -18.433 53.211 1.00 62.02  ? 69   THR B CB  1 
ATOM   2531 O OG1 . THR B 1 39  ? 12.667  -18.796 53.173 1.00 65.47  ? 69   THR B OG1 1 
ATOM   2532 C CG2 . THR B 1 39  ? 11.098  -17.311 54.217 1.00 60.15  ? 69   THR B CG2 1 
ATOM   2533 N N   . GLN B 1 40  ? 8.667   -19.511 55.211 1.00 70.15  ? 70   GLN B N   1 
ATOM   2534 C CA  . GLN B 1 40  ? 7.275   -19.375 55.645 1.00 71.92  ? 70   GLN B CA  1 
ATOM   2535 C C   . GLN B 1 40  ? 6.838   -17.911 55.695 1.00 70.70  ? 70   GLN B C   1 
ATOM   2536 O O   . GLN B 1 40  ? 5.692   -17.590 55.398 1.00 71.21  ? 70   GLN B O   1 
ATOM   2537 C CB  . GLN B 1 40  ? 7.045   -20.101 56.980 1.00 74.04  ? 70   GLN B CB  1 
ATOM   2538 C CG  . GLN B 1 40  ? 8.031   -21.281 57.215 1.00 81.41  ? 70   GLN B CG  1 
ATOM   2539 C CD  . GLN B 1 40  ? 7.353   -22.615 57.524 1.00 87.60  ? 70   GLN B CD  1 
ATOM   2540 O OE1 . GLN B 1 40  ? 6.173   -22.665 57.882 1.00 91.13  ? 70   GLN B OE1 1 
ATOM   2541 N NE2 . GLN B 1 40  ? 8.106   -23.706 57.380 1.00 87.78  ? 70   GLN B NE2 1 
ATOM   2542 N N   . ARG B 1 41  ? 7.770   -17.026 56.017 1.00 69.32  ? 71   ARG B N   1 
ATOM   2543 C CA  . ARG B 1 41  ? 7.507   -15.585 56.066 1.00 68.48  ? 71   ARG B CA  1 
ATOM   2544 C C   . ARG B 1 41  ? 7.344   -14.909 54.672 1.00 67.80  ? 71   ARG B C   1 
ATOM   2545 O O   . ARG B 1 41  ? 7.097   -13.703 54.577 1.00 66.73  ? 71   ARG B O   1 
ATOM   2546 C CB  . ARG B 1 41  ? 8.624   -14.920 56.874 1.00 68.98  ? 71   ARG B CB  1 
ATOM   2547 C CG  . ARG B 1 41  ? 8.292   -13.569 57.447 1.00 71.43  ? 71   ARG B CG  1 
ATOM   2548 C CD  . ARG B 1 41  ? 9.333   -13.148 58.481 1.00 77.16  ? 71   ARG B CD  1 
ATOM   2549 N NE  . ARG B 1 41  ? 9.866   -11.806 58.227 1.00 80.83  ? 71   ARG B NE  1 
ATOM   2550 C CZ  . ARG B 1 41  ? 9.175   -10.673 58.347 1.00 83.07  ? 71   ARG B CZ  1 
ATOM   2551 N NH1 . ARG B 1 41  ? 7.899   -10.693 58.710 1.00 83.49  ? 71   ARG B NH1 1 
ATOM   2552 N NH2 . ARG B 1 41  ? 9.763   -9.511  58.094 1.00 85.30  ? 71   ARG B NH2 1 
ATOM   2553 N N   . LEU B 1 42  ? 7.489   -15.684 53.596 1.00 67.23  ? 72   LEU B N   1 
ATOM   2554 C CA  . LEU B 1 42  ? 7.351   -15.156 52.232 1.00 64.72  ? 72   LEU B CA  1 
ATOM   2555 C C   . LEU B 1 42  ? 6.130   -15.720 51.499 1.00 63.51  ? 72   LEU B C   1 
ATOM   2556 O O   . LEU B 1 42  ? 5.820   -15.308 50.382 1.00 64.02  ? 72   LEU B O   1 
ATOM   2557 C CB  . LEU B 1 42  ? 8.624   -15.411 51.409 1.00 65.02  ? 72   LEU B CB  1 
ATOM   2558 C CG  . LEU B 1 42  ? 9.877   -14.551 51.626 1.00 63.99  ? 72   LEU B CG  1 
ATOM   2559 C CD1 . LEU B 1 42  ? 11.085  -15.193 50.951 1.00 64.87  ? 72   LEU B CD1 1 
ATOM   2560 C CD2 . LEU B 1 42  ? 9.687   -13.127 51.132 1.00 60.81  ? 72   LEU B CD2 1 
ATOM   2561 N N   . GLN B 1 43  ? 5.435   -16.660 52.128 1.00 61.85  ? 73   GLN B N   1 
ATOM   2562 C CA  . GLN B 1 43  ? 4.216   -17.218 51.558 1.00 59.92  ? 73   GLN B CA  1 
ATOM   2563 C C   . GLN B 1 43  ? 3.010   -16.261 51.644 1.00 58.03  ? 73   GLN B C   1 
ATOM   2564 O O   . GLN B 1 43  ? 1.983   -16.572 52.245 1.00 58.23  ? 73   GLN B O   1 
ATOM   2565 C CB  . GLN B 1 43  ? 3.933   -18.591 52.161 1.00 60.42  ? 73   GLN B CB  1 
ATOM   2566 C CG  . GLN B 1 43  ? 4.782   -19.680 51.513 1.00 63.66  ? 73   GLN B CG  1 
ATOM   2567 C CD  . GLN B 1 43  ? 5.388   -20.650 52.500 1.00 66.12  ? 73   GLN B CD  1 
ATOM   2568 O OE1 . GLN B 1 43  ? 5.098   -20.604 53.695 1.00 70.45  ? 73   GLN B OE1 1 
ATOM   2569 N NE2 . GLN B 1 43  ? 6.245   -21.538 52.002 1.00 67.55  ? 73   GLN B NE2 1 
ATOM   2570 N N   . THR B 1 44  ? 3.166   -15.093 51.026 1.00 55.06  ? 74   THR B N   1 
ATOM   2571 C CA  . THR B 1 44  ? 2.072   -14.158 50.804 1.00 52.95  ? 74   THR B CA  1 
ATOM   2572 C C   . THR B 1 44  ? 1.408   -14.425 49.450 1.00 52.46  ? 74   THR B C   1 
ATOM   2573 O O   . THR B 1 44  ? 1.920   -15.208 48.637 1.00 53.11  ? 74   THR B O   1 
ATOM   2574 C CB  . THR B 1 44  ? 2.555   -12.698 50.814 1.00 51.98  ? 74   THR B CB  1 
ATOM   2575 O OG1 . THR B 1 44  ? 3.287   -12.425 49.613 1.00 49.31  ? 74   THR B OG1 1 
ATOM   2576 C CG2 . THR B 1 44  ? 3.418   -12.414 52.031 1.00 50.79  ? 74   THR B CG2 1 
ATOM   2577 N N   . LEU B 1 45  ? 0.271   -13.771 49.215 1.00 50.76  ? 75   LEU B N   1 
ATOM   2578 C CA  . LEU B 1 45  ? -0.466  -13.922 47.963 1.00 49.96  ? 75   LEU B CA  1 
ATOM   2579 C C   . LEU B 1 45  ? 0.239   -13.190 46.840 1.00 49.26  ? 75   LEU B C   1 
ATOM   2580 O O   . LEU B 1 45  ? 0.334   -13.708 45.724 1.00 49.67  ? 75   LEU B O   1 
ATOM   2581 C CB  . LEU B 1 45  ? -1.910  -13.418 48.101 1.00 49.59  ? 75   LEU B CB  1 
ATOM   2582 C CG  . LEU B 1 45  ? -2.841  -14.229 49.015 1.00 47.77  ? 75   LEU B CG  1 
ATOM   2583 C CD1 . LEU B 1 45  ? -4.168  -13.516 49.179 1.00 46.87  ? 75   LEU B CD1 1 
ATOM   2584 C CD2 . LEU B 1 45  ? -3.059  -15.651 48.511 1.00 47.61  ? 75   LEU B CD2 1 
ATOM   2585 N N   . THR B 1 46  ? 0.735   -11.992 47.147 1.00 47.52  ? 76   THR B N   1 
ATOM   2586 C CA  . THR B 1 46  ? 1.529   -11.210 46.212 1.00 47.92  ? 76   THR B CA  1 
ATOM   2587 C C   . THR B 1 46  ? 2.693   -12.036 45.651 1.00 47.96  ? 76   THR B C   1 
ATOM   2588 O O   . THR B 1 46  ? 3.019   -11.920 44.466 1.00 49.61  ? 76   THR B O   1 
ATOM   2589 C CB  . THR B 1 46  ? 2.064   -9.926  46.874 1.00 48.70  ? 76   THR B CB  1 
ATOM   2590 O OG1 . THR B 1 46  ? 0.970   -9.168  47.392 1.00 48.25  ? 76   THR B OG1 1 
ATOM   2591 C CG2 . THR B 1 46  ? 2.825   -9.056  45.875 1.00 52.50  ? 76   THR B CG2 1 
ATOM   2592 N N   . ASN B 1 47  ? 3.300   -12.870 46.498 1.00 45.38  ? 77   ASN B N   1 
ATOM   2593 C CA  . ASN B 1 47  ? 4.433   -13.688 46.092 1.00 42.56  ? 77   ASN B CA  1 
ATOM   2594 C C   . ASN B 1 47  ? 4.066   -14.871 45.204 1.00 41.74  ? 77   ASN B C   1 
ATOM   2595 O O   . ASN B 1 47  ? 4.941   -15.489 44.588 1.00 41.72  ? 77   ASN B O   1 
ATOM   2596 C CB  . ASN B 1 47  ? 5.246   -14.117 47.311 1.00 42.36  ? 77   ASN B CB  1 
ATOM   2597 C CG  . ASN B 1 47  ? 6.152   -13.009 47.816 1.00 43.56  ? 77   ASN B CG  1 
ATOM   2598 O OD1 . ASN B 1 47  ? 6.324   -11.975 47.159 1.00 42.78  ? 77   ASN B OD1 1 
ATOM   2599 N ND2 . ASN B 1 47  ? 6.741   -13.218 48.986 1.00 45.28  ? 77   ASN B ND2 1 
ATOM   2600 N N   . LEU B 1 48  ? 2.773   -15.177 45.125 1.00 40.46  ? 78   LEU B N   1 
ATOM   2601 C CA  . LEU B 1 48  ? 2.293   -16.176 44.177 1.00 39.83  ? 78   LEU B CA  1 
ATOM   2602 C C   . LEU B 1 48  ? 2.367   -15.621 42.775 1.00 40.90  ? 78   LEU B C   1 
ATOM   2603 O O   . LEU B 1 48  ? 2.700   -16.341 41.829 1.00 42.57  ? 78   LEU B O   1 
ATOM   2604 C CB  . LEU B 1 48  ? 0.879   -16.648 44.499 1.00 38.23  ? 78   LEU B CB  1 
ATOM   2605 C CG  . LEU B 1 48  ? 0.740   -17.623 45.674 1.00 41.56  ? 78   LEU B CG  1 
ATOM   2606 C CD1 . LEU B 1 48  ? -0.716  -17.922 45.929 1.00 41.97  ? 78   LEU B CD1 1 
ATOM   2607 C CD2 . LEU B 1 48  ? 1.519   -18.930 45.479 1.00 41.23  ? 78   LEU B CD2 1 
ATOM   2608 N N   . PHE B 1 49  ? 2.083   -14.328 42.654 1.00 41.50  ? 79   PHE B N   1 
ATOM   2609 C CA  . PHE B 1 49  ? 2.208   -13.625 41.382 1.00 42.60  ? 79   PHE B CA  1 
ATOM   2610 C C   . PHE B 1 49  ? 3.674   -13.501 40.969 1.00 41.68  ? 79   PHE B C   1 
ATOM   2611 O O   . PHE B 1 49  ? 4.008   -13.655 39.788 1.00 41.90  ? 79   PHE B O   1 
ATOM   2612 C CB  . PHE B 1 49  ? 1.548   -12.239 41.455 1.00 42.79  ? 79   PHE B CB  1 
ATOM   2613 C CG  . PHE B 1 49  ? 0.075   -12.276 41.781 1.00 44.57  ? 79   PHE B CG  1 
ATOM   2614 C CD1 . PHE B 1 49  ? -0.787  -13.146 41.107 1.00 42.86  ? 79   PHE B CD1 1 
ATOM   2615 C CD2 . PHE B 1 49  ? -0.462  -11.423 42.757 1.00 47.25  ? 79   PHE B CD2 1 
ATOM   2616 C CE1 . PHE B 1 49  ? -2.155  -13.183 41.402 1.00 38.59  ? 79   PHE B CE1 1 
ATOM   2617 C CE2 . PHE B 1 49  ? -1.831  -11.453 43.060 1.00 41.15  ? 79   PHE B CE2 1 
ATOM   2618 C CZ  . PHE B 1 49  ? -2.674  -12.343 42.378 1.00 39.26  ? 79   PHE B CZ  1 
ATOM   2619 N N   . ILE B 1 50  ? 4.529   -13.228 41.957 1.00 40.53  ? 80   ILE B N   1 
ATOM   2620 C CA  . ILE B 1 50  ? 5.971   -13.173 41.778 1.00 39.38  ? 80   ILE B CA  1 
ATOM   2621 C C   . ILE B 1 50  ? 6.471   -14.501 41.228 1.00 37.46  ? 80   ILE B C   1 
ATOM   2622 O O   . ILE B 1 50  ? 7.251   -14.504 40.286 1.00 37.42  ? 80   ILE B O   1 
ATOM   2623 C CB  . ILE B 1 50  ? 6.667   -12.803 43.100 1.00 40.84  ? 80   ILE B CB  1 
ATOM   2624 C CG1 . ILE B 1 50  ? 6.254   -11.383 43.534 1.00 42.54  ? 80   ILE B CG1 1 
ATOM   2625 C CG2 . ILE B 1 50  ? 8.182   -12.938 42.987 1.00 42.09  ? 80   ILE B CG2 1 
ATOM   2626 C CD1 . ILE B 1 50  ? 6.783   -10.244 42.635 1.00 42.14  ? 80   ILE B CD1 1 
ATOM   2627 N N   . THR B 1 51  ? 5.974   -15.613 41.784 1.00 35.48  ? 81   THR B N   1 
ATOM   2628 C CA  . THR B 1 51  ? 6.344   -16.960 41.342 1.00 34.60  ? 81   THR B CA  1 
ATOM   2629 C C   . THR B 1 51  ? 5.979   -17.160 39.877 1.00 35.10  ? 81   THR B C   1 
ATOM   2630 O O   . THR B 1 51  ? 6.753   -17.715 39.094 1.00 36.39  ? 81   THR B O   1 
ATOM   2631 C CB  . THR B 1 51  ? 5.689   -18.070 42.228 1.00 34.49  ? 81   THR B CB  1 
ATOM   2632 O OG1 . THR B 1 51  ? 6.167   -17.953 43.569 1.00 34.19  ? 81   THR B OG1 1 
ATOM   2633 C CG2 . THR B 1 51  ? 6.018   -19.483 41.712 1.00 30.01  ? 81   THR B CG2 1 
ATOM   2634 N N   . SER B 1 52  ? 4.795   -16.689 39.518 1.00 35.75  ? 82   SER B N   1 
ATOM   2635 C CA  . SER B 1 52  ? 4.303   -16.718 38.144 1.00 35.87  ? 82   SER B CA  1 
ATOM   2636 C C   . SER B 1 52  ? 5.265   -15.983 37.198 1.00 35.85  ? 82   SER B C   1 
ATOM   2637 O O   . SER B 1 52  ? 5.666   -16.518 36.173 1.00 38.36  ? 82   SER B O   1 
ATOM   2638 C CB  . SER B 1 52  ? 2.910   -16.094 38.111 1.00 34.13  ? 82   SER B CB  1 
ATOM   2639 O OG  . SER B 1 52  ? 2.239   -16.365 36.906 1.00 37.80  ? 82   SER B OG  1 
ATOM   2640 N N   . LEU B 1 53  ? 5.642   -14.770 37.576 1.00 35.62  ? 83   LEU B N   1 
ATOM   2641 C CA  . LEU B 1 53  ? 6.618   -13.958 36.864 1.00 36.30  ? 83   LEU B CA  1 
ATOM   2642 C C   . LEU B 1 53  ? 7.976   -14.670 36.723 1.00 37.52  ? 83   LEU B C   1 
ATOM   2643 O O   . LEU B 1 53  ? 8.649   -14.575 35.682 1.00 35.89  ? 83   LEU B O   1 
ATOM   2644 C CB  . LEU B 1 53  ? 6.799   -12.644 37.625 1.00 35.41  ? 83   LEU B CB  1 
ATOM   2645 C CG  . LEU B 1 53  ? 7.260   -11.416 36.861 1.00 36.14  ? 83   LEU B CG  1 
ATOM   2646 C CD1 . LEU B 1 53  ? 6.420   -11.198 35.618 1.00 31.79  ? 83   LEU B CD1 1 
ATOM   2647 C CD2 . LEU B 1 53  ? 7.169   -10.231 37.800 1.00 34.24  ? 83   LEU B CD2 1 
ATOM   2648 N N   . ALA B 1 54  ? 8.360   -15.390 37.775 1.00 37.26  ? 84   ALA B N   1 
ATOM   2649 C CA  . ALA B 1 54  ? 9.615   -16.115 37.796 1.00 37.57  ? 84   ALA B CA  1 
ATOM   2650 C C   . ALA B 1 54  ? 9.577   -17.290 36.834 1.00 37.95  ? 84   ALA B C   1 
ATOM   2651 O O   . ALA B 1 54  ? 10.601  -17.642 36.242 1.00 38.58  ? 84   ALA B O   1 
ATOM   2652 C CB  . ALA B 1 54  ? 9.936   -16.582 39.206 1.00 38.48  ? 84   ALA B CB  1 
ATOM   2653 N N   . CYS B 1 55  ? 8.397   -17.888 36.679 1.00 37.62  ? 85   CYS B N   1 
ATOM   2654 C CA  . CYS B 1 55  ? 8.213   -18.982 35.736 1.00 37.11  ? 85   CYS B CA  1 
ATOM   2655 C C   . CYS B 1 55  ? 8.318   -18.486 34.310 1.00 36.47  ? 85   CYS B C   1 
ATOM   2656 O O   . CYS B 1 55  ? 8.902   -19.152 33.458 1.00 37.74  ? 85   CYS B O   1 
ATOM   2657 C CB  . CYS B 1 55  ? 6.880   -19.678 35.969 1.00 38.60  ? 85   CYS B CB  1 
ATOM   2658 S SG  . CYS B 1 55  ? 6.866   -20.628 37.513 1.00 45.14  ? 85   CYS B SG  1 
ATOM   2659 N N   . ALA B 1 56  ? 7.768   -17.305 34.055 1.00 35.30  ? 86   ALA B N   1 
ATOM   2660 C CA  . ALA B 1 56  ? 7.902   -16.676 32.751 1.00 34.81  ? 86   ALA B CA  1 
ATOM   2661 C C   . ALA B 1 56  ? 9.398   -16.463 32.408 1.00 35.86  ? 86   ALA B C   1 
ATOM   2662 O O   . ALA B 1 56  ? 9.858   -16.818 31.327 1.00 37.24  ? 86   ALA B O   1 
ATOM   2663 C CB  . ALA B 1 56  ? 7.126   -15.371 32.719 1.00 31.22  ? 86   ALA B CB  1 
ATOM   2664 N N   . ASP B 1 57  ? 10.150  -15.923 33.355 1.00 36.90  ? 87   ASP B N   1 
ATOM   2665 C CA  . ASP B 1 57  ? 11.569  -15.694 33.181 1.00 38.01  ? 87   ASP B CA  1 
ATOM   2666 C C   . ASP B 1 57  ? 12.360  -17.002 33.050 1.00 38.63  ? 87   ASP B C   1 
ATOM   2667 O O   . ASP B 1 57  ? 13.292  -17.084 32.252 1.00 38.09  ? 87   ASP B O   1 
ATOM   2668 C CB  . ASP B 1 57  ? 12.082  -14.798 34.309 1.00 37.62  ? 87   ASP B CB  1 
ATOM   2669 C CG  . ASP B 1 57  ? 11.587  -13.356 34.170 1.00 40.80  ? 87   ASP B CG  1 
ATOM   2670 O OD1 . ASP B 1 57  ? 11.468  -12.883 33.016 1.00 45.48  ? 87   ASP B OD1 1 
ATOM   2671 O OD2 . ASP B 1 57  ? 11.313  -12.690 35.195 1.00 39.64  ? 87   ASP B OD2 1 
ATOM   2672 N N   . LEU B 1 58  ? 11.948  -18.025 33.795 1.00 39.36  ? 88   LEU B N   1 
ATOM   2673 C CA  . LEU B 1 58  ? 12.587  -19.336 33.758 1.00 40.60  ? 88   LEU B CA  1 
ATOM   2674 C C   . LEU B 1 58  ? 12.477  -20.012 32.386 1.00 41.79  ? 88   LEU B C   1 
ATOM   2675 O O   . LEU B 1 58  ? 13.428  -20.640 31.907 1.00 44.60  ? 88   LEU B O   1 
ATOM   2676 C CB  . LEU B 1 58  ? 11.995  -20.237 34.840 1.00 40.54  ? 88   LEU B CB  1 
ATOM   2677 C CG  . LEU B 1 58  ? 12.687  -21.566 35.110 1.00 43.08  ? 88   LEU B CG  1 
ATOM   2678 C CD1 . LEU B 1 58  ? 14.188  -21.373 35.266 1.00 47.79  ? 88   LEU B CD1 1 
ATOM   2679 C CD2 . LEU B 1 58  ? 12.095  -22.188 36.357 1.00 43.51  ? 88   LEU B CD2 1 
ATOM   2680 N N   . VAL B 1 59  ? 11.312  -19.884 31.767 1.00 39.73  ? 89   VAL B N   1 
ATOM   2681 C CA  . VAL B 1 59  ? 11.076  -20.379 30.414 1.00 38.65  ? 89   VAL B CA  1 
ATOM   2682 C C   . VAL B 1 59  ? 11.938  -19.632 29.381 1.00 37.68  ? 89   VAL B C   1 
ATOM   2683 O O   . VAL B 1 59  ? 12.358  -20.212 28.383 1.00 37.23  ? 89   VAL B O   1 
ATOM   2684 C CB  . VAL B 1 59  ? 9.541   -20.275 30.048 1.00 39.67  ? 89   VAL B CB  1 
ATOM   2685 C CG1 . VAL B 1 59  ? 9.255   -20.667 28.582 1.00 34.26  ? 89   VAL B CG1 1 
ATOM   2686 C CG2 . VAL B 1 59  ? 8.685   -21.112 31.017 1.00 36.74  ? 89   VAL B CG2 1 
ATOM   2687 N N   . VAL B 1 60  ? 12.184  -18.347 29.621 1.00 36.39  ? 90   VAL B N   1 
ATOM   2688 C CA  . VAL B 1 60  ? 13.097  -17.584 28.785 1.00 37.18  ? 90   VAL B CA  1 
ATOM   2689 C C   . VAL B 1 60  ? 14.519  -18.141 28.906 1.00 36.94  ? 90   VAL B C   1 
ATOM   2690 O O   . VAL B 1 60  ? 15.186  -18.352 27.903 1.00 36.99  ? 90   VAL B O   1 
ATOM   2691 C CB  . VAL B 1 60  ? 13.047  -16.084 29.120 1.00 37.93  ? 90   VAL B CB  1 
ATOM   2692 C CG1 . VAL B 1 60  ? 14.252  -15.345 28.528 1.00 37.29  ? 90   VAL B CG1 1 
ATOM   2693 C CG2 . VAL B 1 60  ? 11.734  -15.487 28.604 1.00 34.75  ? 90   VAL B CG2 1 
ATOM   2694 N N   . GLY B 1 61  ? 14.947  -18.412 30.136 1.00 37.68  ? 91   GLY B N   1 
ATOM   2695 C CA  . GLY B 1 61  ? 16.263  -18.985 30.412 1.00 38.79  ? 91   GLY B CA  1 
ATOM   2696 C C   . GLY B 1 61  ? 16.470  -20.385 29.858 1.00 39.45  ? 91   GLY B C   1 
ATOM   2697 O O   . GLY B 1 61  ? 17.530  -20.686 29.339 1.00 41.02  ? 91   GLY B O   1 
ATOM   2698 N N   . LEU B 1 62  ? 15.450  -21.230 29.955 1.00 39.04  ? 92   LEU B N   1 
ATOM   2699 C CA  . LEU B 1 62  ? 15.565  -22.630 29.569 1.00 39.15  ? 92   LEU B CA  1 
ATOM   2700 C C   . LEU B 1 62  ? 15.259  -22.876 28.103 1.00 40.63  ? 92   LEU B C   1 
ATOM   2701 O O   . LEU B 1 62  ? 15.780  -23.828 27.522 1.00 42.42  ? 92   LEU B O   1 
ATOM   2702 C CB  . LEU B 1 62  ? 14.651  -23.520 30.427 1.00 38.00  ? 92   LEU B CB  1 
ATOM   2703 C CG  . LEU B 1 62  ? 15.027  -23.775 31.890 1.00 38.96  ? 92   LEU B CG  1 
ATOM   2704 C CD1 . LEU B 1 62  ? 13.852  -24.355 32.668 1.00 38.22  ? 92   LEU B CD1 1 
ATOM   2705 C CD2 . LEU B 1 62  ? 16.268  -24.681 32.007 1.00 37.69  ? 92   LEU B CD2 1 
ATOM   2706 N N   . LEU B 1 63  ? 14.405  -22.050 27.503 1.00 39.94  ? 93   LEU B N   1 
ATOM   2707 C CA  . LEU B 1 63  ? 13.997  -22.297 26.120 1.00 40.48  ? 93   LEU B CA  1 
ATOM   2708 C C   . LEU B 1 63  ? 14.226  -21.139 25.154 1.00 40.44  ? 93   LEU B C   1 
ATOM   2709 O O   . LEU B 1 63  ? 14.801  -21.333 24.089 1.00 41.97  ? 93   LEU B O   1 
ATOM   2710 C CB  . LEU B 1 63  ? 12.549  -22.778 26.046 1.00 41.28  ? 93   LEU B CB  1 
ATOM   2711 C CG  . LEU B 1 63  ? 12.224  -24.117 26.721 1.00 44.40  ? 93   LEU B CG  1 
ATOM   2712 C CD1 . LEU B 1 63  ? 10.706  -24.303 26.811 1.00 44.68  ? 93   LEU B CD1 1 
ATOM   2713 C CD2 . LEU B 1 63  ? 12.902  -25.306 26.011 1.00 43.13  ? 93   LEU B CD2 1 
ATOM   2714 N N   . VAL B 1 64  ? 13.797  -19.936 25.513 1.00 38.70  ? 94   VAL B N   1 
ATOM   2715 C CA  . VAL B 1 64  ? 13.895  -18.824 24.571 1.00 38.20  ? 94   VAL B CA  1 
ATOM   2716 C C   . VAL B 1 64  ? 15.345  -18.447 24.251 1.00 37.26  ? 94   VAL B C   1 
ATOM   2717 O O   . VAL B 1 64  ? 15.720  -18.408 23.086 1.00 37.31  ? 94   VAL B O   1 
ATOM   2718 C CB  . VAL B 1 64  ? 13.069  -17.595 25.022 1.00 38.54  ? 94   VAL B CB  1 
ATOM   2719 C CG1 . VAL B 1 64  ? 13.273  -16.410 24.073 1.00 37.37  ? 94   VAL B CG1 1 
ATOM   2720 C CG2 . VAL B 1 64  ? 11.599  -17.961 25.090 1.00 34.20  ? 94   VAL B CG2 1 
ATOM   2721 N N   . VAL B 1 65  ? 16.138  -18.186 25.287 1.00 36.54  ? 95   VAL B N   1 
ATOM   2722 C CA  . VAL B 1 65  ? 17.524  -17.758 25.150 1.00 35.21  ? 95   VAL B CA  1 
ATOM   2723 C C   . VAL B 1 65  ? 18.452  -18.855 24.587 1.00 36.63  ? 95   VAL B C   1 
ATOM   2724 O O   . VAL B 1 65  ? 19.189  -18.576 23.644 1.00 37.17  ? 95   VAL B O   1 
ATOM   2725 C CB  . VAL B 1 65  ? 18.069  -17.163 26.481 1.00 35.78  ? 95   VAL B CB  1 
ATOM   2726 C CG1 . VAL B 1 65  ? 19.614  -17.027 26.459 1.00 38.81  ? 95   VAL B CG1 1 
ATOM   2727 C CG2 . VAL B 1 65  ? 17.430  -15.822 26.765 1.00 29.48  ? 95   VAL B CG2 1 
ATOM   2728 N N   . PRO B 1 66  ? 18.422  -20.094 25.149 1.00 36.48  ? 96   PRO B N   1 
ATOM   2729 C CA  . PRO B 1 66  ? 19.261  -21.132 24.551 1.00 37.51  ? 96   PRO B CA  1 
ATOM   2730 C C   . PRO B 1 66  ? 19.088  -21.233 23.038 1.00 39.92  ? 96   PRO B C   1 
ATOM   2731 O O   . PRO B 1 66  ? 20.090  -21.297 22.321 1.00 41.63  ? 96   PRO B O   1 
ATOM   2732 C CB  . PRO B 1 66  ? 18.768  -22.413 25.218 1.00 36.89  ? 96   PRO B CB  1 
ATOM   2733 C CG  . PRO B 1 66  ? 18.307  -21.982 26.533 1.00 35.10  ? 96   PRO B CG  1 
ATOM   2734 C CD  . PRO B 1 66  ? 17.709  -20.610 26.331 1.00 35.31  ? 96   PRO B CD  1 
ATOM   2735 N N   . PHE B 1 67  ? 17.843  -21.213 22.559 1.00 39.54  ? 97   PHE B N   1 
ATOM   2736 C CA  . PHE B 1 67  ? 17.574  -21.340 21.127 1.00 40.80  ? 97   PHE B CA  1 
ATOM   2737 C C   . PHE B 1 67  ? 18.131  -20.166 20.333 1.00 39.80  ? 97   PHE B C   1 
ATOM   2738 O O   . PHE B 1 67  ? 18.778  -20.375 19.295 1.00 43.21  ? 97   PHE B O   1 
ATOM   2739 C CB  . PHE B 1 67  ? 16.071  -21.522 20.836 1.00 42.33  ? 97   PHE B CB  1 
ATOM   2740 C CG  . PHE B 1 67  ? 15.593  -22.965 20.891 1.00 47.34  ? 97   PHE B CG  1 
ATOM   2741 C CD1 . PHE B 1 67  ? 15.747  -23.815 19.788 1.00 48.24  ? 97   PHE B CD1 1 
ATOM   2742 C CD2 . PHE B 1 67  ? 14.968  -23.464 22.033 1.00 47.72  ? 97   PHE B CD2 1 
ATOM   2743 C CE1 . PHE B 1 67  ? 15.303  -25.139 19.834 1.00 48.47  ? 97   PHE B CE1 1 
ATOM   2744 C CE2 . PHE B 1 67  ? 14.519  -24.789 22.088 1.00 50.65  ? 97   PHE B CE2 1 
ATOM   2745 C CZ  . PHE B 1 67  ? 14.686  -25.626 20.986 1.00 50.28  ? 97   PHE B CZ  1 
ATOM   2746 N N   . GLY B 1 68  ? 17.881  -18.948 20.812 1.00 35.28  ? 98   GLY B N   1 
ATOM   2747 C CA  . GLY B 1 68  ? 18.344  -17.738 20.147 1.00 34.21  ? 98   GLY B CA  1 
ATOM   2748 C C   . GLY B 1 68  ? 19.860  -17.599 20.192 1.00 37.17  ? 98   GLY B C   1 
ATOM   2749 O O   . GLY B 1 68  ? 20.460  -16.981 19.310 1.00 36.12  ? 98   GLY B O   1 
ATOM   2750 N N   . ALA B 1 69  ? 20.475  -18.160 21.235 1.00 37.68  ? 99   ALA B N   1 
ATOM   2751 C CA  . ALA B 1 69  ? 21.918  -18.271 21.332 1.00 38.10  ? 99   ALA B CA  1 
ATOM   2752 C C   . ALA B 1 69  ? 22.471  -19.058 20.124 1.00 38.75  ? 99   ALA B C   1 
ATOM   2753 O O   . ALA B 1 69  ? 23.318  -18.554 19.377 1.00 36.22  ? 99   ALA B O   1 
ATOM   2754 C CB  . ALA B 1 69  ? 22.302  -18.939 22.650 1.00 38.03  ? 99   ALA B CB  1 
ATOM   2755 N N   . THR B 1 70  ? 21.960  -20.269 19.908 1.00 38.68  ? 100  THR B N   1 
ATOM   2756 C CA  . THR B 1 70  ? 22.417  -21.080 18.783 1.00 40.76  ? 100  THR B CA  1 
ATOM   2757 C C   . THR B 1 70  ? 22.282  -20.339 17.430 1.00 42.80  ? 100  THR B C   1 
ATOM   2758 O O   . THR B 1 70  ? 23.001  -20.623 16.477 1.00 44.10  ? 100  THR B O   1 
ATOM   2759 C CB  . THR B 1 70  ? 21.696  -22.433 18.720 1.00 40.21  ? 100  THR B CB  1 
ATOM   2760 O OG1 . THR B 1 70  ? 20.341  -22.230 18.298 1.00 37.75  ? 100  THR B OG1 1 
ATOM   2761 C CG2 . THR B 1 70  ? 21.757  -23.159 20.092 1.00 36.43  ? 100  THR B CG2 1 
ATOM   2762 N N   . LEU B 1 71  ? 21.371  -19.380 17.351 1.00 42.81  ? 101  LEU B N   1 
ATOM   2763 C CA  . LEU B 1 71  ? 21.183  -18.632 16.110 1.00 42.37  ? 101  LEU B CA  1 
ATOM   2764 C C   . LEU B 1 71  ? 22.195  -17.498 15.980 1.00 43.01  ? 101  LEU B C   1 
ATOM   2765 O O   . LEU B 1 71  ? 22.640  -17.169 14.882 1.00 43.40  ? 101  LEU B O   1 
ATOM   2766 C CB  . LEU B 1 71  ? 19.751  -18.086 16.022 1.00 41.34  ? 101  LEU B CB  1 
ATOM   2767 C CG  . LEU B 1 71  ? 19.356  -17.154 14.865 1.00 38.90  ? 101  LEU B CG  1 
ATOM   2768 C CD1 . LEU B 1 71  ? 19.340  -17.860 13.528 1.00 30.64  ? 101  LEU B CD1 1 
ATOM   2769 C CD2 . LEU B 1 71  ? 17.985  -16.545 15.131 1.00 42.87  ? 101  LEU B CD2 1 
ATOM   2770 N N   . VAL B 1 72  ? 22.527  -16.882 17.109 1.00 43.47  ? 102  VAL B N   1 
ATOM   2771 C CA  . VAL B 1 72  ? 23.543  -15.836 17.164 1.00 42.30  ? 102  VAL B CA  1 
ATOM   2772 C C   . VAL B 1 72  ? 24.957  -16.437 16.948 1.00 42.78  ? 102  VAL B C   1 
ATOM   2773 O O   . VAL B 1 72  ? 25.688  -15.981 16.080 1.00 42.97  ? 102  VAL B O   1 
ATOM   2774 C CB  . VAL B 1 72  ? 23.441  -15.018 18.497 1.00 41.07  ? 102  VAL B CB  1 
ATOM   2775 C CG1 . VAL B 1 72  ? 24.691  -14.170 18.748 1.00 40.36  ? 102  VAL B CG1 1 
ATOM   2776 C CG2 . VAL B 1 72  ? 22.218  -14.126 18.483 1.00 36.82  ? 102  VAL B CG2 1 
ATOM   2777 N N   . VAL B 1 73  ? 25.305  -17.468 17.718 1.00 42.85  ? 103  VAL B N   1 
ATOM   2778 C CA  . VAL B 1 73  ? 26.598  -18.136 17.621 1.00 43.31  ? 103  VAL B CA  1 
ATOM   2779 C C   . VAL B 1 73  ? 26.842  -18.703 16.212 1.00 45.72  ? 103  VAL B C   1 
ATOM   2780 O O   . VAL B 1 73  ? 27.837  -18.345 15.562 1.00 47.06  ? 103  VAL B O   1 
ATOM   2781 C CB  . VAL B 1 73  ? 26.762  -19.234 18.728 1.00 42.99  ? 103  VAL B CB  1 
ATOM   2782 C CG1 . VAL B 1 73  ? 27.967  -20.151 18.461 1.00 42.09  ? 103  VAL B CG1 1 
ATOM   2783 C CG2 . VAL B 1 73  ? 26.859  -18.590 20.119 1.00 39.14  ? 103  VAL B CG2 1 
ATOM   2784 N N   . ARG B 1 74  ? 25.924  -19.540 15.727 1.00 45.29  ? 104  ARG B N   1 
ATOM   2785 C CA  . ARG B 1 74  ? 26.173  -20.324 14.514 1.00 45.59  ? 104  ARG B CA  1 
ATOM   2786 C C   . ARG B 1 74  ? 25.779  -19.636 13.199 1.00 44.09  ? 104  ARG B C   1 
ATOM   2787 O O   . ARG B 1 74  ? 26.078  -20.145 12.126 1.00 46.30  ? 104  ARG B O   1 
ATOM   2788 C CB  . ARG B 1 74  ? 25.560  -21.731 14.631 1.00 46.54  ? 104  ARG B CB  1 
ATOM   2789 C CG  . ARG B 1 74  ? 26.107  -22.580 15.817 1.00 55.05  ? 104  ARG B CG  1 
ATOM   2790 C CD  . ARG B 1 74  ? 27.519  -23.152 15.572 1.00 61.36  ? 104  ARG B CD  1 
ATOM   2791 N NE  . ARG B 1 74  ? 27.543  -23.977 14.369 1.00 67.25  ? 104  ARG B NE  1 
ATOM   2792 C CZ  . ARG B 1 74  ? 27.386  -25.297 14.355 1.00 71.56  ? 104  ARG B CZ  1 
ATOM   2793 N NH1 . ARG B 1 74  ? 27.221  -25.971 15.488 1.00 74.02  ? 104  ARG B NH1 1 
ATOM   2794 N NH2 . ARG B 1 74  ? 27.410  -25.947 13.200 1.00 73.50  ? 104  ARG B NH2 1 
ATOM   2795 N N   . GLY B 1 75  ? 25.133  -18.479 13.274 1.00 42.96  ? 105  GLY B N   1 
ATOM   2796 C CA  . GLY B 1 75  ? 24.684  -17.756 12.071 1.00 40.76  ? 105  GLY B CA  1 
ATOM   2797 C C   . GLY B 1 75  ? 23.424  -18.231 11.334 1.00 41.88  ? 105  GLY B C   1 
ATOM   2798 O O   . GLY B 1 75  ? 22.959  -17.536 10.414 1.00 40.11  ? 105  GLY B O   1 
ATOM   2799 N N   . THR B 1 76  ? 22.878  -19.405 11.691 1.00 41.47  ? 106  THR B N   1 
ATOM   2800 C CA  . THR B 1 76  ? 21.638  -19.922 11.063 1.00 42.16  ? 106  THR B CA  1 
ATOM   2801 C C   . THR B 1 76  ? 20.695  -20.645 12.046 1.00 41.58  ? 106  THR B C   1 
ATOM   2802 O O   . THR B 1 76  ? 21.062  -20.942 13.195 1.00 41.03  ? 106  THR B O   1 
ATOM   2803 C CB  . THR B 1 76  ? 21.900  -20.916 9.849  1.00 42.76  ? 106  THR B CB  1 
ATOM   2804 O OG1 . THR B 1 76  ? 22.667  -22.048 10.283 1.00 44.87  ? 106  THR B OG1 1 
ATOM   2805 C CG2 . THR B 1 76  ? 22.594  -20.245 8.697  1.00 45.86  ? 106  THR B CG2 1 
ATOM   2806 N N   . TRP B 1 77  ? 19.491  -20.950 11.567 1.00 40.80  ? 107  TRP B N   1 
ATOM   2807 C CA  . TRP B 1 77  ? 18.554  -21.770 12.313 1.00 41.79  ? 107  TRP B CA  1 
ATOM   2808 C C   . TRP B 1 77  ? 18.796  -23.249 12.005 1.00 43.07  ? 107  TRP B C   1 
ATOM   2809 O O   . TRP B 1 77  ? 18.605  -23.686 10.870 1.00 45.35  ? 107  TRP B O   1 
ATOM   2810 C CB  . TRP B 1 77  ? 17.088  -21.360 12.033 1.00 39.73  ? 107  TRP B CB  1 
ATOM   2811 C CG  . TRP B 1 77  ? 16.126  -22.096 12.910 1.00 36.67  ? 107  TRP B CG  1 
ATOM   2812 C CD1 . TRP B 1 77  ? 15.397  -23.188 12.573 1.00 37.45  ? 107  TRP B CD1 1 
ATOM   2813 C CD2 . TRP B 1 77  ? 15.830  -21.826 14.292 1.00 38.10  ? 107  TRP B CD2 1 
ATOM   2814 N NE1 . TRP B 1 77  ? 14.648  -23.613 13.642 1.00 40.07  ? 107  TRP B NE1 1 
ATOM   2815 C CE2 . TRP B 1 77  ? 14.896  -22.793 14.713 1.00 39.77  ? 107  TRP B CE2 1 
ATOM   2816 C CE3 . TRP B 1 77  ? 16.255  -20.856 15.209 1.00 37.57  ? 107  TRP B CE3 1 
ATOM   2817 C CZ2 . TRP B 1 77  ? 14.384  -22.827 16.017 1.00 39.59  ? 107  TRP B CZ2 1 
ATOM   2818 C CZ3 . TRP B 1 77  ? 15.742  -20.888 16.506 1.00 37.81  ? 107  TRP B CZ3 1 
ATOM   2819 C CH2 . TRP B 1 77  ? 14.819  -21.867 16.895 1.00 39.89  ? 107  TRP B CH2 1 
ATOM   2820 N N   . LEU B 1 78  ? 19.186  -24.013 13.028 1.00 43.54  ? 108  LEU B N   1 
ATOM   2821 C CA  . LEU B 1 78  ? 19.549  -25.421 12.881 1.00 43.52  ? 108  LEU B CA  1 
ATOM   2822 C C   . LEU B 1 78  ? 18.434  -26.419 13.149 1.00 46.07  ? 108  LEU B C   1 
ATOM   2823 O O   . LEU B 1 78  ? 18.650  -27.627 12.988 1.00 48.16  ? 108  LEU B O   1 
ATOM   2824 C CB  . LEU B 1 78  ? 20.691  -25.752 13.839 1.00 44.13  ? 108  LEU B CB  1 
ATOM   2825 C CG  . LEU B 1 78  ? 21.983  -24.937 13.799 1.00 45.31  ? 108  LEU B CG  1 
ATOM   2826 C CD1 . LEU B 1 78  ? 22.892  -25.379 14.930 1.00 46.43  ? 108  LEU B CD1 1 
ATOM   2827 C CD2 . LEU B 1 78  ? 22.674  -25.073 12.441 1.00 45.90  ? 108  LEU B CD2 1 
ATOM   2828 N N   . TRP B 1 79  ? 17.254  -25.940 13.554 1.00 46.35  ? 109  TRP B N   1 
ATOM   2829 C CA  . TRP B 1 79  ? 16.272  -26.817 14.217 1.00 45.93  ? 109  TRP B CA  1 
ATOM   2830 C C   . TRP B 1 79  ? 15.000  -27.137 13.427 1.00 44.62  ? 109  TRP B C   1 
ATOM   2831 O O   . TRP B 1 79  ? 14.118  -27.845 13.923 1.00 43.78  ? 109  TRP B O   1 
ATOM   2832 C CB  . TRP B 1 79  ? 15.928  -26.257 15.603 1.00 46.71  ? 109  TRP B CB  1 
ATOM   2833 C CG  . TRP B 1 79  ? 17.146  -25.866 16.373 1.00 48.52  ? 109  TRP B CG  1 
ATOM   2834 C CD1 . TRP B 1 79  ? 17.581  -24.595 16.642 1.00 45.22  ? 109  TRP B CD1 1 
ATOM   2835 C CD2 . TRP B 1 79  ? 18.116  -26.754 16.939 1.00 52.74  ? 109  TRP B CD2 1 
ATOM   2836 N NE1 . TRP B 1 79  ? 18.756  -24.641 17.361 1.00 47.08  ? 109  TRP B NE1 1 
ATOM   2837 C CE2 . TRP B 1 79  ? 19.106  -25.953 17.556 1.00 52.49  ? 109  TRP B CE2 1 
ATOM   2838 C CE3 . TRP B 1 79  ? 18.247  -28.151 16.984 1.00 56.91  ? 109  TRP B CE3 1 
ATOM   2839 C CZ2 . TRP B 1 79  ? 20.215  -26.504 18.214 1.00 57.22  ? 109  TRP B CZ2 1 
ATOM   2840 C CZ3 . TRP B 1 79  ? 19.349  -28.702 17.643 1.00 59.06  ? 109  TRP B CZ3 1 
ATOM   2841 C CH2 . TRP B 1 79  ? 20.317  -27.877 18.248 1.00 59.34  ? 109  TRP B CH2 1 
ATOM   2842 N N   . GLY B 1 80  ? 14.907  -26.624 12.207 1.00 43.66  ? 110  GLY B N   1 
ATOM   2843 C CA  . GLY B 1 80  ? 13.756  -26.912 11.358 1.00 46.21  ? 110  GLY B CA  1 
ATOM   2844 C C   . GLY B 1 80  ? 12.580  -25.980 11.574 1.00 48.32  ? 110  GLY B C   1 
ATOM   2845 O O   . GLY B 1 80  ? 12.601  -25.133 12.474 1.00 49.02  ? 110  GLY B O   1 
ATOM   2846 N N   . SER B 1 81  ? 11.545  -26.151 10.754 1.00 49.10  ? 111  SER B N   1 
ATOM   2847 C CA  . SER B 1 81  ? 10.399  -25.225 10.705 1.00 49.66  ? 111  SER B CA  1 
ATOM   2848 C C   . SER B 1 81  ? 9.505   -25.195 11.942 1.00 48.97  ? 111  SER B C   1 
ATOM   2849 O O   . SER B 1 81  ? 9.141   -24.119 12.421 1.00 48.33  ? 111  SER B O   1 
ATOM   2850 C CB  . SER B 1 81  ? 9.534   -25.508 9.475  1.00 49.57  ? 111  SER B CB  1 
ATOM   2851 O OG  . SER B 1 81  ? 10.030  -24.777 8.375  1.00 54.00  ? 111  SER B OG  1 
ATOM   2852 N N   . PHE B 1 82  ? 9.131   -26.373 12.434 1.00 48.11  ? 112  PHE B N   1 
ATOM   2853 C CA  . PHE B 1 82  ? 8.206   -26.466 13.545 1.00 46.68  ? 112  PHE B CA  1 
ATOM   2854 C C   . PHE B 1 82  ? 8.778   -25.739 14.767 1.00 47.34  ? 112  PHE B C   1 
ATOM   2855 O O   . PHE B 1 82  ? 8.159   -24.799 15.303 1.00 49.16  ? 112  PHE B O   1 
ATOM   2856 C CB  . PHE B 1 82  ? 7.889   -27.924 13.869 1.00 45.21  ? 112  PHE B CB  1 
ATOM   2857 C CG  . PHE B 1 82  ? 7.070   -28.092 15.101 1.00 48.99  ? 112  PHE B CG  1 
ATOM   2858 C CD1 . PHE B 1 82  ? 5.740   -27.660 15.130 1.00 49.32  ? 112  PHE B CD1 1 
ATOM   2859 C CD2 . PHE B 1 82  ? 7.623   -28.662 16.249 1.00 51.42  ? 112  PHE B CD2 1 
ATOM   2860 C CE1 . PHE B 1 82  ? 4.963   -27.796 16.281 1.00 47.96  ? 112  PHE B CE1 1 
ATOM   2861 C CE2 . PHE B 1 82  ? 6.856   -28.809 17.414 1.00 51.99  ? 112  PHE B CE2 1 
ATOM   2862 C CZ  . PHE B 1 82  ? 5.522   -28.372 17.429 1.00 50.19  ? 112  PHE B CZ  1 
ATOM   2863 N N   . LEU B 1 83  ? 9.971   -26.154 15.182 1.00 44.20  ? 113  LEU B N   1 
ATOM   2864 C CA  . LEU B 1 83  ? 10.621  -25.572 16.343 1.00 40.11  ? 113  LEU B CA  1 
ATOM   2865 C C   . LEU B 1 83  ? 10.858  -24.070 16.200 1.00 37.96  ? 113  LEU B C   1 
ATOM   2866 O O   . LEU B 1 83  ? 10.901  -23.358 17.195 1.00 37.31  ? 113  LEU B O   1 
ATOM   2867 C CB  . LEU B 1 83  ? 11.909  -26.325 16.665 1.00 39.04  ? 113  LEU B CB  1 
ATOM   2868 C CG  . LEU B 1 83  ? 11.703  -27.751 17.186 1.00 39.76  ? 113  LEU B CG  1 
ATOM   2869 C CD1 . LEU B 1 83  ? 13.030  -28.486 17.300 1.00 39.38  ? 113  LEU B CD1 1 
ATOM   2870 C CD2 . LEU B 1 83  ? 10.938  -27.775 18.520 1.00 35.19  ? 113  LEU B CD2 1 
ATOM   2871 N N   . CYS B 1 84  ? 10.973  -23.579 14.973 1.00 36.66  ? 114  CYS B N   1 
ATOM   2872 C CA  . CYS B 1 84  ? 11.203  -22.152 14.757 1.00 37.77  ? 114  CYS B CA  1 
ATOM   2873 C C   . CYS B 1 84  ? 9.944   -21.397 15.112 1.00 38.66  ? 114  CYS B C   1 
ATOM   2874 O O   . CYS B 1 84  ? 9.976   -20.347 15.766 1.00 38.34  ? 114  CYS B O   1 
ATOM   2875 C CB  . CYS B 1 84  ? 11.634  -21.862 13.319 1.00 37.90  ? 114  CYS B CB  1 
ATOM   2876 S SG  . CYS B 1 84  ? 11.453  -20.129 12.728 1.00 40.29  ? 114  CYS B SG  1 
ATOM   2877 N N   . GLU B 1 85  ? 8.827   -21.962 14.692 1.00 39.53  ? 115  GLU B N   1 
ATOM   2878 C CA  . GLU B 1 85  ? 7.540   -21.414 15.029 1.00 40.44  ? 115  GLU B CA  1 
ATOM   2879 C C   . GLU B 1 85  ? 7.206   -21.568 16.525 1.00 38.62  ? 115  GLU B C   1 
ATOM   2880 O O   . GLU B 1 85  ? 6.679   -20.634 17.142 1.00 37.05  ? 115  GLU B O   1 
ATOM   2881 C CB  . GLU B 1 85  ? 6.480   -22.054 14.153 1.00 42.70  ? 115  GLU B CB  1 
ATOM   2882 C CG  . GLU B 1 85  ? 6.533   -21.585 12.712 1.00 49.73  ? 115  GLU B CG  1 
ATOM   2883 C CD  . GLU B 1 85  ? 5.536   -22.318 11.826 1.00 60.17  ? 115  GLU B CD  1 
ATOM   2884 O OE1 . GLU B 1 85  ? 4.625   -22.997 12.356 1.00 63.63  ? 115  GLU B OE1 1 
ATOM   2885 O OE2 . GLU B 1 85  ? 5.665   -22.211 10.588 1.00 66.59  ? 115  GLU B OE2 1 
ATOM   2886 N N   . LEU B 1 86  ? 7.520   -22.726 17.106 1.00 36.38  ? 116  LEU B N   1 
ATOM   2887 C CA  . LEU B 1 86  ? 7.340   -22.916 18.545 1.00 35.80  ? 116  LEU B CA  1 
ATOM   2888 C C   . LEU B 1 86  ? 8.196   -21.921 19.329 1.00 36.86  ? 116  LEU B C   1 
ATOM   2889 O O   . LEU B 1 86  ? 7.731   -21.309 20.301 1.00 37.88  ? 116  LEU B O   1 
ATOM   2890 C CB  . LEU B 1 86  ? 7.667   -24.353 18.969 1.00 35.36  ? 116  LEU B CB  1 
ATOM   2891 C CG  . LEU B 1 86  ? 7.445   -24.721 20.444 1.00 36.17  ? 116  LEU B CG  1 
ATOM   2892 C CD1 . LEU B 1 86  ? 5.971   -24.540 20.844 1.00 38.28  ? 116  LEU B CD1 1 
ATOM   2893 C CD2 . LEU B 1 86  ? 7.905   -26.146 20.755 1.00 34.12  ? 116  LEU B CD2 1 
ATOM   2894 N N   . TRP B 1 87  ? 9.442   -21.747 18.900 1.00 34.88  ? 117  TRP B N   1 
ATOM   2895 C CA  . TRP B 1 87  ? 10.335  -20.831 19.571 1.00 32.37  ? 117  TRP B CA  1 
ATOM   2896 C C   . TRP B 1 87  ? 9.774   -19.405 19.522 1.00 32.69  ? 117  TRP B C   1 
ATOM   2897 O O   . TRP B 1 87  ? 9.751   -18.700 20.551 1.00 32.31  ? 117  TRP B O   1 
ATOM   2898 C CB  . TRP B 1 87  ? 11.742  -20.901 18.955 1.00 32.87  ? 117  TRP B CB  1 
ATOM   2899 C CG  . TRP B 1 87  ? 12.678  -19.860 19.484 1.00 28.11  ? 117  TRP B CG  1 
ATOM   2900 C CD1 . TRP B 1 87  ? 13.128  -19.742 20.768 1.00 29.68  ? 117  TRP B CD1 1 
ATOM   2901 C CD2 . TRP B 1 87  ? 13.266  -18.788 18.749 1.00 22.88  ? 117  TRP B CD2 1 
ATOM   2902 N NE1 . TRP B 1 87  ? 13.966  -18.658 20.878 1.00 31.87  ? 117  TRP B NE1 1 
ATOM   2903 C CE2 . TRP B 1 87  ? 14.073  -18.056 19.651 1.00 24.83  ? 117  TRP B CE2 1 
ATOM   2904 C CE3 . TRP B 1 87  ? 13.207  -18.382 17.414 1.00 26.22  ? 117  TRP B CE3 1 
ATOM   2905 C CZ2 . TRP B 1 87  ? 14.806  -16.933 19.267 1.00 20.79  ? 117  TRP B CZ2 1 
ATOM   2906 C CZ3 . TRP B 1 87  ? 13.952  -17.254 17.024 1.00 27.91  ? 117  TRP B CZ3 1 
ATOM   2907 C CH2 . TRP B 1 87  ? 14.737  -16.547 17.955 1.00 24.29  ? 117  TRP B CH2 1 
ATOM   2908 N N   . THR B 1 88  ? 9.332   -18.988 18.331 1.00 30.80  ? 118  THR B N   1 
ATOM   2909 C CA  . THR B 1 88  ? 8.682   -17.690 18.139 1.00 30.97  ? 118  THR B CA  1 
ATOM   2910 C C   . THR B 1 88  ? 7.448   -17.530 19.051 1.00 32.71  ? 118  THR B C   1 
ATOM   2911 O O   . THR B 1 88  ? 7.318   -16.517 19.746 1.00 32.61  ? 118  THR B O   1 
ATOM   2912 C CB  . THR B 1 88  ? 8.249   -17.481 16.678 1.00 31.69  ? 118  THR B CB  1 
ATOM   2913 O OG1 . THR B 1 88  ? 9.390   -17.496 15.816 1.00 31.53  ? 118  THR B OG1 1 
ATOM   2914 C CG2 . THR B 1 88  ? 7.557   -16.160 16.527 1.00 30.75  ? 118  THR B CG2 1 
ATOM   2915 N N   . SER B 1 89  ? 6.559   -18.530 19.037 1.00 31.66  ? 119  SER B N   1 
ATOM   2916 C CA  . SER B 1 89  ? 5.431   -18.632 19.982 1.00 32.70  ? 119  SER B CA  1 
ATOM   2917 C C   . SER B 1 89  ? 5.785   -18.400 21.445 1.00 32.72  ? 119  SER B C   1 
ATOM   2918 O O   . SER B 1 89  ? 5.122   -17.603 22.134 1.00 31.60  ? 119  SER B O   1 
ATOM   2919 C CB  . SER B 1 89  ? 4.774   -20.005 19.883 1.00 33.73  ? 119  SER B CB  1 
ATOM   2920 O OG  . SER B 1 89  ? 3.961   -20.086 18.732 1.00 38.27  ? 119  SER B OG  1 
ATOM   2921 N N   . LEU B 1 90  ? 6.816   -19.110 21.912 1.00 32.44  ? 120  LEU B N   1 
ATOM   2922 C CA  . LEU B 1 90  ? 7.289   -18.986 23.287 1.00 31.58  ? 120  LEU B CA  1 
ATOM   2923 C C   . LEU B 1 90  ? 7.801   -17.596 23.619 1.00 32.67  ? 120  LEU B C   1 
ATOM   2924 O O   . LEU B 1 90  ? 7.563   -17.102 24.717 1.00 35.71  ? 120  LEU B O   1 
ATOM   2925 C CB  . LEU B 1 90  ? 8.351   -20.044 23.595 1.00 31.83  ? 120  LEU B CB  1 
ATOM   2926 C CG  . LEU B 1 90  ? 7.831   -21.488 23.635 1.00 33.02  ? 120  LEU B CG  1 
ATOM   2927 C CD1 . LEU B 1 90  ? 8.967   -22.476 23.803 1.00 30.88  ? 120  LEU B CD1 1 
ATOM   2928 C CD2 . LEU B 1 90  ? 6.789   -21.674 24.741 1.00 32.08  ? 120  LEU B CD2 1 
ATOM   2929 N N   . ASP B 1 91  ? 8.490   -16.952 22.681 1.00 31.94  ? 121  ASP B N   1 
ATOM   2930 C CA  . ASP B 1 91  ? 9.014   -15.605 22.917 1.00 32.34  ? 121  ASP B CA  1 
ATOM   2931 C C   . ASP B 1 91  ? 7.851   -14.616 23.147 1.00 32.63  ? 121  ASP B C   1 
ATOM   2932 O O   . ASP B 1 91  ? 7.836   -13.869 24.141 1.00 33.51  ? 121  ASP B O   1 
ATOM   2933 C CB  . ASP B 1 91  ? 9.917   -15.193 21.737 1.00 33.65  ? 121  ASP B CB  1 
ATOM   2934 C CG  . ASP B 1 91  ? 10.595  -13.838 21.919 1.00 34.79  ? 121  ASP B CG  1 
ATOM   2935 O OD1 . ASP B 1 91  ? 10.441  -13.151 22.958 1.00 34.36  ? 121  ASP B OD1 1 
ATOM   2936 O OD2 . ASP B 1 91  ? 11.309  -13.452 20.978 1.00 40.14  ? 121  ASP B OD2 1 
ATOM   2937 N N   . VAL B 1 92  ? 6.872   -14.642 22.244 1.00 31.28  ? 122  VAL B N   1 
ATOM   2938 C CA  . VAL B 1 92  ? 5.660   -13.824 22.383 1.00 29.77  ? 122  VAL B CA  1 
ATOM   2939 C C   . VAL B 1 92  ? 4.883   -14.153 23.664 1.00 30.51  ? 122  VAL B C   1 
ATOM   2940 O O   . VAL B 1 92  ? 4.419   -13.242 24.352 1.00 31.32  ? 122  VAL B O   1 
ATOM   2941 C CB  . VAL B 1 92  ? 4.719   -13.901 21.140 1.00 28.61  ? 122  VAL B CB  1 
ATOM   2942 C CG1 . VAL B 1 92  ? 3.489   -13.027 21.362 1.00 24.51  ? 122  VAL B CG1 1 
ATOM   2943 C CG2 . VAL B 1 92  ? 5.457   -13.474 19.834 1.00 23.18  ? 122  VAL B CG2 1 
ATOM   2944 N N   . LEU B 1 93  ? 4.766   -15.441 23.993 1.00 30.69  ? 123  LEU B N   1 
ATOM   2945 C CA  . LEU B 1 93  ? 4.080   -15.861 25.215 1.00 29.96  ? 123  LEU B CA  1 
ATOM   2946 C C   . LEU B 1 93  ? 4.631   -15.218 26.478 1.00 30.35  ? 123  LEU B C   1 
ATOM   2947 O O   . LEU B 1 93  ? 3.873   -14.685 27.292 1.00 31.53  ? 123  LEU B O   1 
ATOM   2948 C CB  . LEU B 1 93  ? 4.129   -17.375 25.380 1.00 31.50  ? 123  LEU B CB  1 
ATOM   2949 C CG  . LEU B 1 93  ? 3.527   -17.923 26.682 1.00 34.66  ? 123  LEU B CG  1 
ATOM   2950 C CD1 . LEU B 1 93  ? 2.006   -17.788 26.689 1.00 33.64  ? 123  LEU B CD1 1 
ATOM   2951 C CD2 . LEU B 1 93  ? 3.956   -19.375 26.970 1.00 33.16  ? 123  LEU B CD2 1 
ATOM   2952 N N   . CYS B 1 94  ? 5.945   -15.265 26.638 1.00 30.59  ? 124  CYS B N   1 
ATOM   2953 C CA  . CYS B 1 94  ? 6.576   -14.872 27.888 1.00 29.97  ? 124  CYS B CA  1 
ATOM   2954 C C   . CYS B 1 94  ? 6.486   -13.378 28.163 1.00 29.59  ? 124  CYS B C   1 
ATOM   2955 O O   . CYS B 1 94  ? 6.211   -12.968 29.293 1.00 30.44  ? 124  CYS B O   1 
ATOM   2956 C CB  . CYS B 1 94  ? 8.016   -15.389 27.921 1.00 31.08  ? 124  CYS B CB  1 
ATOM   2957 S SG  . CYS B 1 94  ? 8.059   -17.199 28.206 1.00 38.23  ? 124  CYS B SG  1 
ATOM   2958 N N   . VAL B 1 95  ? 6.701   -12.554 27.142 1.00 27.98  ? 125  VAL B N   1 
ATOM   2959 C CA  . VAL B 1 95  ? 6.648   -11.125 27.376 1.00 27.27  ? 125  VAL B CA  1 
ATOM   2960 C C   . VAL B 1 95  ? 5.193   -10.762 27.683 1.00 27.71  ? 125  VAL B C   1 
ATOM   2961 O O   . VAL B 1 95  ? 4.917   -9.925  28.549 1.00 27.03  ? 125  VAL B O   1 
ATOM   2962 C CB  . VAL B 1 95  ? 7.282   -10.265 26.221 1.00 25.63  ? 125  VAL B CB  1 
ATOM   2963 C CG1 . VAL B 1 95  ? 6.620   -10.529 24.901 1.00 26.99  ? 125  VAL B CG1 1 
ATOM   2964 C CG2 . VAL B 1 95  ? 7.184   -8.787  26.541 1.00 21.44  ? 125  VAL B CG2 1 
ATOM   2965 N N   . THR B 1 96  ? 4.274   -11.431 26.992 1.00 26.98  ? 126  THR B N   1 
ATOM   2966 C CA  . THR B 1 96  ? 2.833   -11.218 27.194 1.00 27.77  ? 126  THR B CA  1 
ATOM   2967 C C   . THR B 1 96  ? 2.379   -11.614 28.612 1.00 26.33  ? 126  THR B C   1 
ATOM   2968 O O   . THR B 1 96  ? 1.746   -10.813 29.306 1.00 23.03  ? 126  THR B O   1 
ATOM   2969 C CB  . THR B 1 96  ? 2.004   -11.956 26.117 1.00 28.33  ? 126  THR B CB  1 
ATOM   2970 O OG1 . THR B 1 96  ? 2.420   -11.511 24.822 1.00 30.18  ? 126  THR B OG1 1 
ATOM   2971 C CG2 . THR B 1 96  ? 0.541   -11.673 26.273 1.00 19.07  ? 126  THR B CG2 1 
ATOM   2972 N N   . ALA B 1 97  ? 2.737   -12.825 29.045 1.00 25.54  ? 127  ALA B N   1 
ATOM   2973 C CA  . ALA B 1 97  ? 2.467   -13.239 30.423 1.00 27.08  ? 127  ALA B CA  1 
ATOM   2974 C C   . ALA B 1 97  ? 3.174   -12.371 31.477 1.00 29.91  ? 127  ALA B C   1 
ATOM   2975 O O   . ALA B 1 97  ? 2.610   -12.161 32.561 1.00 30.29  ? 127  ALA B O   1 
ATOM   2976 C CB  . ALA B 1 97  ? 2.792   -14.708 30.629 1.00 24.60  ? 127  ALA B CB  1 
ATOM   2977 N N   . SER B 1 98  ? 4.388   -11.876 31.170 1.00 30.19  ? 128  SER B N   1 
ATOM   2978 C CA  . SER B 1 98  ? 5.122   -11.034 32.121 1.00 30.17  ? 128  SER B CA  1 
ATOM   2979 C C   . SER B 1 98  ? 4.368   -9.733  32.397 1.00 29.89  ? 128  SER B C   1 
ATOM   2980 O O   . SER B 1 98  ? 4.044   -9.442  33.537 1.00 28.61  ? 128  SER B O   1 
ATOM   2981 C CB  . SER B 1 98  ? 6.582   -10.774 31.686 1.00 30.67  ? 128  SER B CB  1 
ATOM   2982 O OG  . SER B 1 98  ? 7.433   -11.887 31.983 1.00 26.10  ? 128  SER B OG  1 
ATOM   2983 N N   . ILE B 1 99  ? 4.062   -8.972  31.348 1.00 31.93  ? 129  ILE B N   1 
ATOM   2984 C CA  . ILE B 1 99  ? 3.417   -7.661  31.497 1.00 30.83  ? 129  ILE B CA  1 
ATOM   2985 C C   . ILE B 1 99  ? 2.012   -7.792  32.104 1.00 33.54  ? 129  ILE B C   1 
ATOM   2986 O O   . ILE B 1 99  ? 1.647   -7.010  32.983 1.00 34.55  ? 129  ILE B O   1 
ATOM   2987 C CB  . ILE B 1 99  ? 3.474   -6.826  30.173 1.00 29.35  ? 129  ILE B CB  1 
ATOM   2988 C CG1 . ILE B 1 99  ? 2.959   -5.382  30.321 1.00 28.94  ? 129  ILE B CG1 1 
ATOM   2989 C CG2 . ILE B 1 99  ? 2.728   -7.508  29.056 1.00 30.24  ? 129  ILE B CG2 1 
ATOM   2990 C CD1 . ILE B 1 99  ? 3.480   -4.615  31.491 1.00 30.94  ? 129  ILE B CD1 1 
ATOM   2991 N N   . GLU B 1 100 ? 1.252   -8.799  31.677 1.00 34.21  ? 130  GLU B N   1 
ATOM   2992 C CA  . GLU B 1 100 ? -0.064  -9.077  32.278 1.00 32.90  ? 130  GLU B CA  1 
ATOM   2993 C C   . GLU B 1 100 ? 0.003   -9.405  33.758 1.00 33.26  ? 130  GLU B C   1 
ATOM   2994 O O   . GLU B 1 100 ? -0.840  -8.937  34.534 1.00 34.67  ? 130  GLU B O   1 
ATOM   2995 C CB  . GLU B 1 100 ? -0.788  -10.204 31.550 1.00 32.93  ? 130  GLU B CB  1 
ATOM   2996 C CG  . GLU B 1 100 ? -1.298  -9.794  30.189 1.00 36.74  ? 130  GLU B CG  1 
ATOM   2997 C CD  . GLU B 1 100 ? -2.144  -10.850 29.515 1.00 40.88  ? 130  GLU B CD  1 
ATOM   2998 O OE1 . GLU B 1 100 ? -2.820  -11.626 30.218 1.00 45.42  ? 130  GLU B OE1 1 
ATOM   2999 O OE2 . GLU B 1 100 ? -2.149  -10.884 28.264 1.00 44.01  ? 130  GLU B OE2 1 
ATOM   3000 N N   . THR B 1 101 ? 0.984   -10.215 34.152 1.00 31.45  ? 131  THR B N   1 
ATOM   3001 C CA  . THR B 1 101 ? 1.204   -10.504 35.564 1.00 30.59  ? 131  THR B CA  1 
ATOM   3002 C C   . THR B 1 101 ? 1.523   -9.205  36.331 1.00 32.45  ? 131  THR B C   1 
ATOM   3003 O O   . THR B 1 101 ? 1.006   -8.989  37.434 1.00 32.47  ? 131  THR B O   1 
ATOM   3004 C CB  . THR B 1 101 ? 2.315   -11.550 35.734 1.00 29.45  ? 131  THR B CB  1 
ATOM   3005 O OG1 . THR B 1 101 ? 1.955   -12.720 35.006 1.00 30.93  ? 131  THR B OG1 1 
ATOM   3006 C CG2 . THR B 1 101 ? 2.505   -11.935 37.181 1.00 30.07  ? 131  THR B CG2 1 
ATOM   3007 N N   . LEU B 1 102 ? 2.352   -8.342  35.738 1.00 32.52  ? 132  LEU B N   1 
ATOM   3008 C CA  . LEU B 1 102 ? 2.714   -7.080  36.366 1.00 33.41  ? 132  LEU B CA  1 
ATOM   3009 C C   . LEU B 1 102 ? 1.493   -6.197  36.630 1.00 35.59  ? 132  LEU B C   1 
ATOM   3010 O O   . LEU B 1 102 ? 1.432   -5.513  37.665 1.00 36.75  ? 132  LEU B O   1 
ATOM   3011 C CB  . LEU B 1 102 ? 3.771   -6.323  35.555 1.00 31.40  ? 132  LEU B CB  1 
ATOM   3012 C CG  . LEU B 1 102 ? 5.184   -6.919  35.588 1.00 30.32  ? 132  LEU B CG  1 
ATOM   3013 C CD1 . LEU B 1 102 ? 6.086   -6.205  34.573 1.00 25.33  ? 132  LEU B CD1 1 
ATOM   3014 C CD2 . LEU B 1 102 ? 5.784   -6.914  37.009 1.00 24.60  ? 132  LEU B CD2 1 
ATOM   3015 N N   . CYS B 1 103 ? 0.530   -6.210  35.705 1.00 34.49  ? 133  CYS B N   1 
ATOM   3016 C CA  . CYS B 1 103 ? -0.725  -5.481  35.895 1.00 35.65  ? 133  CYS B CA  1 
ATOM   3017 C C   . CYS B 1 103 ? -1.501  -6.025  37.103 1.00 34.89  ? 133  CYS B C   1 
ATOM   3018 O O   . CYS B 1 103 ? -1.954  -5.276  37.977 1.00 31.56  ? 133  CYS B O   1 
ATOM   3019 C CB  . CYS B 1 103 ? -1.598  -5.577  34.649 1.00 36.86  ? 133  CYS B CB  1 
ATOM   3020 S SG  . CYS B 1 103 ? -1.175  -4.374  33.387 1.00 44.43  ? 133  CYS B SG  1 
ATOM   3021 N N   . VAL B 1 104 ? -1.631  -7.343  37.149 1.00 32.86  ? 134  VAL B N   1 
ATOM   3022 C CA  . VAL B 1 104 ? -2.274  -7.987  38.267 1.00 32.41  ? 134  VAL B CA  1 
ATOM   3023 C C   . VAL B 1 104 ? -1.598  -7.572  39.579 1.00 35.34  ? 134  VAL B C   1 
ATOM   3024 O O   . VAL B 1 104 ? -2.287  -7.130  40.486 1.00 39.08  ? 134  VAL B O   1 
ATOM   3025 C CB  . VAL B 1 104 ? -2.348  -9.514  38.056 1.00 31.76  ? 134  VAL B CB  1 
ATOM   3026 C CG1 . VAL B 1 104 ? -2.706  -10.250 39.321 1.00 28.52  ? 134  VAL B CG1 1 
ATOM   3027 C CG2 . VAL B 1 104 ? -3.344  -9.825  36.955 1.00 31.16  ? 134  VAL B CG2 1 
ATOM   3028 N N   . ILE B 1 105 ? -0.268  -7.675  39.677 1.00 34.82  ? 135  ILE B N   1 
ATOM   3029 C CA  . ILE B 1 105 ? 0.443   -7.259  40.890 1.00 32.60  ? 135  ILE B CA  1 
ATOM   3030 C C   . ILE B 1 105 ? 0.049   -5.815  41.264 1.00 33.91  ? 135  ILE B C   1 
ATOM   3031 O O   . ILE B 1 105 ? -0.184  -5.511  42.437 1.00 33.56  ? 135  ILE B O   1 
ATOM   3032 C CB  . ILE B 1 105 ? 2.002   -7.410  40.740 1.00 34.39  ? 135  ILE B CB  1 
ATOM   3033 C CG1 . ILE B 1 105 ? 2.421   -8.890  40.752 1.00 32.37  ? 135  ILE B CG1 1 
ATOM   3034 C CG2 . ILE B 1 105 ? 2.770   -6.672  41.857 1.00 28.13  ? 135  ILE B CG2 1 
ATOM   3035 C CD1 . ILE B 1 105 ? 3.797   -9.166  40.167 1.00 22.92  ? 135  ILE B CD1 1 
ATOM   3036 N N   . ALA B 1 106 ? -0.046  -4.933  40.267 1.00 34.14  ? 136  ALA B N   1 
ATOM   3037 C CA  . ALA B 1 106 ? -0.342  -3.526  40.523 1.00 33.41  ? 136  ALA B CA  1 
ATOM   3038 C C   . ALA B 1 106 ? -1.766  -3.387  41.045 1.00 35.65  ? 136  ALA B C   1 
ATOM   3039 O O   . ALA B 1 106 ? -2.049  -2.569  41.933 1.00 33.89  ? 136  ALA B O   1 
ATOM   3040 C CB  . ALA B 1 106 ? -0.142  -2.684  39.270 1.00 31.90  ? 136  ALA B CB  1 
ATOM   3041 N N   . ILE B 1 107 ? -2.661  -4.205  40.491 1.00 37.41  ? 137  ILE B N   1 
ATOM   3042 C CA  . ILE B 1 107 ? -4.078  -4.164  40.842 1.00 36.24  ? 137  ILE B CA  1 
ATOM   3043 C C   . ILE B 1 107 ? -4.280  -4.754  42.239 1.00 35.78  ? 137  ILE B C   1 
ATOM   3044 O O   . ILE B 1 107 ? -5.008  -4.189  43.051 1.00 36.18  ? 137  ILE B O   1 
ATOM   3045 C CB  . ILE B 1 107 ? -4.953  -4.875  39.756 1.00 36.84  ? 137  ILE B CB  1 
ATOM   3046 C CG1 . ILE B 1 107 ? -5.085  -3.981  38.519 1.00 34.07  ? 137  ILE B CG1 1 
ATOM   3047 C CG2 . ILE B 1 107 ? -6.348  -5.257  40.286 1.00 34.59  ? 137  ILE B CG2 1 
ATOM   3048 C CD1 . ILE B 1 107 ? -5.579  -4.726  37.278 1.00 29.42  ? 137  ILE B CD1 1 
ATOM   3049 N N   . ASP B 1 108 ? -3.615  -5.876  42.509 1.00 35.64  ? 138  ASP B N   1 
ATOM   3050 C CA  . ASP B 1 108 ? -3.558  -6.479  43.843 1.00 36.47  ? 138  ASP B CA  1 
ATOM   3051 C C   . ASP B 1 108 ? -3.120  -5.452  44.907 1.00 39.66  ? 138  ASP B C   1 
ATOM   3052 O O   . ASP B 1 108 ? -3.705  -5.394  45.991 1.00 42.07  ? 138  ASP B O   1 
ATOM   3053 C CB  . ASP B 1 108 ? -2.605  -7.671  43.822 1.00 34.10  ? 138  ASP B CB  1 
ATOM   3054 C CG  . ASP B 1 108 ? -2.322  -8.228  45.194 1.00 36.80  ? 138  ASP B CG  1 
ATOM   3055 O OD1 . ASP B 1 108 ? -3.071  -9.104  45.658 1.00 43.68  ? 138  ASP B OD1 1 
ATOM   3056 O OD2 . ASP B 1 108 ? -1.325  -7.823  45.809 1.00 42.25  ? 138  ASP B OD2 1 
ATOM   3057 N N   . ARG B 1 109 ? -2.107  -4.642  44.599 1.00 39.34  ? 139  ARG B N   1 
ATOM   3058 C CA  . ARG B 1 109 ? -1.607  -3.674  45.567 1.00 40.34  ? 139  ARG B CA  1 
ATOM   3059 C C   . ARG B 1 109 ? -2.562  -2.505  45.766 1.00 42.06  ? 139  ARG B C   1 
ATOM   3060 O O   . ARG B 1 109 ? -2.697  -1.993  46.873 1.00 40.64  ? 139  ARG B O   1 
ATOM   3061 C CB  . ARG B 1 109 ? -0.211  -3.175  45.180 1.00 39.84  ? 139  ARG B CB  1 
ATOM   3062 C CG  . ARG B 1 109 ? 0.898   -4.219  45.298 1.00 36.75  ? 139  ARG B CG  1 
ATOM   3063 C CD  . ARG B 1 109 ? 1.103   -4.619  46.730 1.00 37.56  ? 139  ARG B CD  1 
ATOM   3064 N NE  . ARG B 1 109 ? 0.204   -5.691  47.151 1.00 35.98  ? 139  ARG B NE  1 
ATOM   3065 C CZ  . ARG B 1 109 ? -0.155  -5.929  48.409 1.00 37.43  ? 139  ARG B CZ  1 
ATOM   3066 N NH1 . ARG B 1 109 ? 0.286   -5.160  49.399 1.00 40.42  ? 139  ARG B NH1 1 
ATOM   3067 N NH2 . ARG B 1 109 ? -0.965  -6.942  48.677 1.00 38.92  ? 139  ARG B NH2 1 
ATOM   3068 N N   . TYR B 1 110 ? -3.209  -2.085  44.686 1.00 45.14  ? 140  TYR B N   1 
ATOM   3069 C CA  . TYR B 1 110 ? -4.126  -0.963  44.730 1.00 48.94  ? 140  TYR B CA  1 
ATOM   3070 C C   . TYR B 1 110 ? -5.316  -1.329  45.614 1.00 52.62  ? 140  TYR B C   1 
ATOM   3071 O O   . TYR B 1 110 ? -5.771  -0.532  46.448 1.00 52.18  ? 140  TYR B O   1 
ATOM   3072 C CB  . TYR B 1 110 ? -4.604  -0.612  43.320 1.00 49.96  ? 140  TYR B CB  1 
ATOM   3073 C CG  . TYR B 1 110 ? -5.573  0.540   43.288 1.00 51.45  ? 140  TYR B CG  1 
ATOM   3074 C CD1 . TYR B 1 110 ? -5.122  1.849   43.416 1.00 56.05  ? 140  TYR B CD1 1 
ATOM   3075 C CD2 . TYR B 1 110 ? -6.940  0.322   43.146 1.00 55.09  ? 140  TYR B CD2 1 
ATOM   3076 C CE1 . TYR B 1 110 ? -6.006  2.920   43.400 1.00 59.99  ? 140  TYR B CE1 1 
ATOM   3077 C CE2 . TYR B 1 110 ? -7.840  1.388   43.128 1.00 60.03  ? 140  TYR B CE2 1 
ATOM   3078 C CZ  . TYR B 1 110 ? -7.363  2.684   43.254 1.00 62.02  ? 140  TYR B CZ  1 
ATOM   3079 O OH  . TYR B 1 110 ? -8.236  3.749   43.234 1.00 64.36  ? 140  TYR B OH  1 
ATOM   3080 N N   . LEU B 1 111 ? -5.805  -2.550  45.422 1.00 54.99  ? 141  LEU B N   1 
ATOM   3081 C CA  . LEU B 1 111 ? -6.880  -3.095  46.222 1.00 57.21  ? 141  LEU B CA  1 
ATOM   3082 C C   . LEU B 1 111 ? -6.524  -3.103  47.705 1.00 57.96  ? 141  LEU B C   1 
ATOM   3083 O O   . LEU B 1 111 ? -7.234  -2.526  48.525 1.00 58.51  ? 141  LEU B O   1 
ATOM   3084 C CB  . LEU B 1 111 ? -7.175  -4.514  45.769 1.00 58.02  ? 141  LEU B CB  1 
ATOM   3085 C CG  . LEU B 1 111 ? -8.663  -4.820  45.729 1.00 63.54  ? 141  LEU B CG  1 
ATOM   3086 C CD1 . LEU B 1 111 ? -9.255  -4.270  44.420 1.00 65.83  ? 141  LEU B CD1 1 
ATOM   3087 C CD2 . LEU B 1 111 ? -8.916  -6.323  45.888 1.00 64.57  ? 141  LEU B CD2 1 
ATOM   3088 N N   . ALA B 1 112 ? -5.405  -3.742  48.031 1.00 58.04  ? 142  ALA B N   1 
ATOM   3089 C CA  . ALA B 1 112 ? -4.958  -3.880  49.410 1.00 58.53  ? 142  ALA B CA  1 
ATOM   3090 C C   . ALA B 1 112 ? -4.768  -2.545  50.126 1.00 59.21  ? 142  ALA B C   1 
ATOM   3091 O O   . ALA B 1 112 ? -4.861  -2.481  51.350 1.00 60.92  ? 142  ALA B O   1 
ATOM   3092 C CB  . ALA B 1 112 ? -3.680  -4.695  49.463 1.00 57.76  ? 142  ALA B CB  1 
ATOM   3093 N N   . ILE B 1 113 ? -4.510  -1.485  49.367 1.00 58.70  ? 143  ILE B N   1 
ATOM   3094 C CA  . ILE B 1 113 ? -4.178  -0.195  49.955 1.00 58.55  ? 143  ILE B CA  1 
ATOM   3095 C C   . ILE B 1 113 ? -5.422  0.691   50.129 1.00 57.81  ? 143  ILE B C   1 
ATOM   3096 O O   . ILE B 1 113 ? -5.433  1.571   50.986 1.00 57.58  ? 143  ILE B O   1 
ATOM   3097 C CB  . ILE B 1 113 ? -3.048  0.519   49.145 1.00 58.45  ? 143  ILE B CB  1 
ATOM   3098 C CG1 . ILE B 1 113 ? -2.071  1.243   50.067 1.00 57.32  ? 143  ILE B CG1 1 
ATOM   3099 C CG2 . ILE B 1 113 ? -3.626  1.460   48.086 1.00 62.54  ? 143  ILE B CG2 1 
ATOM   3100 C CD1 . ILE B 1 113 ? -0.882  1.860   49.334 1.00 58.23  ? 143  ILE B CD1 1 
ATOM   3101 N N   . THR B 1 114 ? -6.466  0.441   49.332 1.00 57.25  ? 144  THR B N   1 
ATOM   3102 C CA  . THR B 1 114 ? -7.673  1.291   49.330 1.00 55.91  ? 144  THR B CA  1 
ATOM   3103 C C   . THR B 1 114 ? -8.918  0.630   49.922 1.00 57.53  ? 144  THR B C   1 
ATOM   3104 O O   . THR B 1 114 ? -9.971  1.265   50.017 1.00 58.01  ? 144  THR B O   1 
ATOM   3105 C CB  . THR B 1 114 ? -8.063  1.775   47.918 1.00 53.44  ? 144  THR B CB  1 
ATOM   3106 O OG1 . THR B 1 114 ? -8.284  0.643   47.080 1.00 53.89  ? 144  THR B OG1 1 
ATOM   3107 C CG2 . THR B 1 114 ? -7.003  2.663   47.315 1.00 51.31  ? 144  THR B CG2 1 
ATOM   3108 N N   . SER B 1 115 ? -8.804  -0.631  50.321 1.00 59.02  ? 145  SER B N   1 
ATOM   3109 C CA  . SER B 1 115 ? -9.950  -1.382  50.803 1.00 60.48  ? 145  SER B CA  1 
ATOM   3110 C C   . SER B 1 115 ? -9.517  -2.680  51.465 1.00 62.37  ? 145  SER B C   1 
ATOM   3111 O O   . SER B 1 115 ? -9.908  -3.759  51.022 1.00 62.29  ? 145  SER B O   1 
ATOM   3112 C CB  . SER B 1 115 ? -10.876 -1.689  49.634 1.00 60.78  ? 145  SER B CB  1 
ATOM   3113 O OG  . SER B 1 115 ? -12.039 -2.333  50.101 1.00 66.11  ? 145  SER B OG  1 
ATOM   3114 N N   . PRO B 1 116 ? -8.742  -2.577  52.556 1.00 65.31  ? 146  PRO B N   1 
ATOM   3115 C CA  . PRO B 1 116 ? -7.917  -3.657  53.112 1.00 67.88  ? 146  PRO B CA  1 
ATOM   3116 C C   . PRO B 1 116 ? -8.645  -4.882  53.672 1.00 71.33  ? 146  PRO B C   1 
ATOM   3117 O O   . PRO B 1 116 ? -7.992  -5.887  53.965 1.00 72.69  ? 146  PRO B O   1 
ATOM   3118 C CB  . PRO B 1 116 ? -7.140  -2.962  54.241 1.00 67.94  ? 146  PRO B CB  1 
ATOM   3119 C CG  . PRO B 1 116 ? -7.341  -1.487  54.019 1.00 68.00  ? 146  PRO B CG  1 
ATOM   3120 C CD  . PRO B 1 116 ? -8.689  -1.375  53.403 1.00 66.27  ? 146  PRO B CD  1 
ATOM   3121 N N   . PHE B 1 117 ? -9.968  -4.813  53.820 1.00 74.89  ? 147  PHE B N   1 
ATOM   3122 C CA  . PHE B 1 117 ? -10.730 -5.919  54.438 1.00 77.32  ? 147  PHE B CA  1 
ATOM   3123 C C   . PHE B 1 117 ? -11.755 -6.539  53.489 1.00 75.79  ? 147  PHE B C   1 
ATOM   3124 O O   . PHE B 1 117 ? -12.135 -7.707  53.633 1.00 76.02  ? 147  PHE B O   1 
ATOM   3125 C CB  . PHE B 1 117 ? -11.335 -5.494  55.794 1.00 79.79  ? 147  PHE B CB  1 
ATOM   3126 C CG  . PHE B 1 117 ? -10.298 -5.009  56.793 1.00 84.50  ? 147  PHE B CG  1 
ATOM   3127 C CD1 . PHE B 1 117 ? -9.152  -5.771  57.064 1.00 88.88  ? 147  PHE B CD1 1 
ATOM   3128 C CD2 . PHE B 1 117 ? -10.457 -3.786  57.445 1.00 86.95  ? 147  PHE B CD2 1 
ATOM   3129 C CE1 . PHE B 1 117 ? -8.180  -5.320  57.972 1.00 91.77  ? 147  PHE B CE1 1 
ATOM   3130 C CE2 . PHE B 1 117 ? -9.497  -3.324  58.358 1.00 88.98  ? 147  PHE B CE2 1 
ATOM   3131 C CZ  . PHE B 1 117 ? -8.357  -4.091  58.621 1.00 91.25  ? 147  PHE B CZ  1 
ATOM   3132 N N   . ARG B 1 118 ? -12.189 -5.740  52.522 1.00 74.67  ? 148  ARG B N   1 
ATOM   3133 C CA  . ARG B 1 118 ? -12.744 -6.252  51.280 1.00 74.14  ? 148  ARG B CA  1 
ATOM   3134 C C   . ARG B 1 118 ? -11.672 -7.151  50.651 1.00 73.39  ? 148  ARG B C   1 
ATOM   3135 O O   . ARG B 1 118 ? -11.953 -8.296  50.301 1.00 73.28  ? 148  ARG B O   1 
ATOM   3136 C CB  . ARG B 1 118 ? -13.060 -5.079  50.355 1.00 74.56  ? 148  ARG B CB  1 
ATOM   3137 C CG  . ARG B 1 118 ? -13.735 -5.424  49.037 1.00 78.39  ? 148  ARG B CG  1 
ATOM   3138 C CD  . ARG B 1 118 ? -15.227 -5.139  49.097 1.00 81.82  ? 148  ARG B CD  1 
ATOM   3139 N NE  . ARG B 1 118 ? -15.960 -6.238  49.721 1.00 84.81  ? 148  ARG B NE  1 
ATOM   3140 C CZ  . ARG B 1 118 ? -17.069 -6.089  50.439 1.00 86.88  ? 148  ARG B CZ  1 
ATOM   3141 N NH1 . ARG B 1 118 ? -17.580 -4.875  50.643 1.00 86.58  ? 148  ARG B NH1 1 
ATOM   3142 N NH2 . ARG B 1 118 ? -17.663 -7.158  50.960 1.00 86.98  ? 148  ARG B NH2 1 
ATOM   3143 N N   . TYR B 1 119 ? -10.444 -6.627  50.543 1.00 71.69  ? 149  TYR B N   1 
ATOM   3144 C CA  . TYR B 1 119 ? -9.274  -7.390  50.100 1.00 69.73  ? 149  TYR B CA  1 
ATOM   3145 C C   . TYR B 1 119 ? -9.090  -8.673  50.913 1.00 70.18  ? 149  TYR B C   1 
ATOM   3146 O O   . TYR B 1 119 ? -8.852  -9.738  50.337 1.00 69.98  ? 149  TYR B O   1 
ATOM   3147 C CB  . TYR B 1 119 ? -7.992  -6.535  50.163 1.00 68.55  ? 149  TYR B CB  1 
ATOM   3148 C CG  . TYR B 1 119 ? -6.762  -7.240  49.617 1.00 64.38  ? 149  TYR B CG  1 
ATOM   3149 C CD1 . TYR B 1 119 ? -6.005  -8.090  50.423 1.00 60.71  ? 149  TYR B CD1 1 
ATOM   3150 C CD2 . TYR B 1 119 ? -6.370  -7.074  48.285 1.00 62.83  ? 149  TYR B CD2 1 
ATOM   3151 C CE1 . TYR B 1 119 ? -4.886  -8.756  49.919 1.00 60.58  ? 149  TYR B CE1 1 
ATOM   3152 C CE2 . TYR B 1 119 ? -5.245  -7.729  47.770 1.00 58.76  ? 149  TYR B CE2 1 
ATOM   3153 C CZ  . TYR B 1 119 ? -4.511  -8.567  48.593 1.00 59.48  ? 149  TYR B CZ  1 
ATOM   3154 O OH  . TYR B 1 119 ? -3.402  -9.217  48.104 1.00 57.83  ? 149  TYR B OH  1 
ATOM   3155 N N   . GLN B 1 120 ? -9.196  -8.562  52.240 1.00 70.70  ? 150  GLN B N   1 
ATOM   3156 C CA  . GLN B 1 120 ? -9.023  -9.709  53.142 1.00 71.41  ? 150  GLN B CA  1 
ATOM   3157 C C   . GLN B 1 120 ? -10.002 -10.839 52.860 1.00 70.37  ? 150  GLN B C   1 
ATOM   3158 O O   . GLN B 1 120 ? -9.597  -12.000 52.772 1.00 70.45  ? 150  GLN B O   1 
ATOM   3159 C CB  . GLN B 1 120 ? -9.114  -9.291  54.614 1.00 72.69  ? 150  GLN B CB  1 
ATOM   3160 C CG  . GLN B 1 120 ? -7.775  -8.884  55.236 1.00 77.19  ? 150  GLN B CG  1 
ATOM   3161 C CD  . GLN B 1 120 ? -6.835  -10.060 55.465 1.00 80.74  ? 150  GLN B CD  1 
ATOM   3162 O OE1 . GLN B 1 120 ? -7.097  -10.934 56.295 1.00 81.08  ? 150  GLN B OE1 1 
ATOM   3163 N NE2 . GLN B 1 120 ? -5.726  -10.076 54.735 1.00 82.79  ? 150  GLN B NE2 1 
ATOM   3164 N N   . SER B 1 121 ? -11.281 -10.503 52.705 1.00 69.63  ? 151  SER B N   1 
ATOM   3165 C CA  . SER B 1 121 ? -12.281 -11.525 52.424 1.00 69.14  ? 151  SER B CA  1 
ATOM   3166 C C   . SER B 1 121 ? -12.091 -12.116 51.025 1.00 68.49  ? 151  SER B C   1 
ATOM   3167 O O   . SER B 1 121 ? -12.003 -13.334 50.889 1.00 69.53  ? 151  SER B O   1 
ATOM   3168 C CB  . SER B 1 121 ? -13.709 -11.003 52.635 1.00 69.59  ? 151  SER B CB  1 
ATOM   3169 O OG  . SER B 1 121 ? -14.207 -10.344 51.484 1.00 70.65  ? 151  SER B OG  1 
ATOM   3170 N N   . LEU B 1 122 ? -11.978 -11.253 50.009 1.00 66.96  ? 152  LEU B N   1 
ATOM   3171 C CA  . LEU B 1 122 ? -11.962 -11.675 48.593 1.00 64.98  ? 152  LEU B CA  1 
ATOM   3172 C C   . LEU B 1 122 ? -10.705 -12.398 48.116 1.00 62.88  ? 152  LEU B C   1 
ATOM   3173 O O   . LEU B 1 122 ? -10.797 -13.415 47.422 1.00 62.05  ? 152  LEU B O   1 
ATOM   3174 C CB  . LEU B 1 122 ? -12.237 -10.497 47.650 1.00 65.64  ? 152  LEU B CB  1 
ATOM   3175 C CG  . LEU B 1 122 ? -13.552 -9.714  47.743 1.00 69.10  ? 152  LEU B CG  1 
ATOM   3176 C CD1 . LEU B 1 122 ? -13.819 -8.958  46.429 1.00 70.19  ? 152  LEU B CD1 1 
ATOM   3177 C CD2 . LEU B 1 122 ? -14.743 -10.605 48.111 1.00 70.18  ? 152  LEU B CD2 1 
ATOM   3178 N N   . MET B 1 123 ? -9.538  -11.857 48.453 1.00 60.81  ? 153  MET B N   1 
ATOM   3179 C CA  . MET B 1 123 ? -8.289  -12.455 47.991 1.00 60.26  ? 153  MET B CA  1 
ATOM   3180 C C   . MET B 1 123 ? -7.861  -13.681 48.783 1.00 58.99  ? 153  MET B C   1 
ATOM   3181 O O   . MET B 1 123 ? -7.461  -13.588 49.943 1.00 60.35  ? 153  MET B O   1 
ATOM   3182 C CB  . MET B 1 123 ? -7.168  -11.428 47.918 1.00 60.67  ? 153  MET B CB  1 
ATOM   3183 C CG  . MET B 1 123 ? -7.025  -10.825 46.532 1.00 64.21  ? 153  MET B CG  1 
ATOM   3184 S SD  . MET B 1 123 ? -6.436  -12.025 45.306 1.00 68.37  ? 153  MET B SD  1 
ATOM   3185 C CE  . MET B 1 123 ? -5.567  -10.905 44.214 1.00 69.03  ? 153  MET B CE  1 
ATOM   3186 N N   . THR B 1 124 ? -7.966  -14.834 48.133 1.00 56.76  ? 154  THR B N   1 
ATOM   3187 C CA  . THR B 1 124 ? -7.623  -16.107 48.739 1.00 54.45  ? 154  THR B CA  1 
ATOM   3188 C C   . THR B 1 124 ? -6.606  -16.815 47.871 1.00 52.99  ? 154  THR B C   1 
ATOM   3189 O O   . THR B 1 124 ? -6.375  -16.419 46.724 1.00 51.57  ? 154  THR B O   1 
ATOM   3190 C CB  . THR B 1 124 ? -8.852  -17.010 48.875 1.00 54.57  ? 154  THR B CB  1 
ATOM   3191 O OG1 . THR B 1 124 ? -9.273  -17.447 47.575 1.00 52.02  ? 154  THR B OG1 1 
ATOM   3192 C CG2 . THR B 1 124 ? -9.987  -16.263 49.568 1.00 53.75  ? 154  THR B CG2 1 
ATOM   3193 N N   . ARG B 1 125 ? -6.013  -17.870 48.417 1.00 52.01  ? 155  ARG B N   1 
ATOM   3194 C CA  . ARG B 1 125 ? -5.049  -18.660 47.665 1.00 51.50  ? 155  ARG B CA  1 
ATOM   3195 C C   . ARG B 1 125 ? -5.709  -19.242 46.416 1.00 47.65  ? 155  ARG B C   1 
ATOM   3196 O O   . ARG B 1 125 ? -5.134  -19.174 45.331 1.00 48.57  ? 155  ARG B O   1 
ATOM   3197 C CB  . ARG B 1 125 ? -4.374  -19.734 48.540 1.00 53.18  ? 155  ARG B CB  1 
ATOM   3198 C CG  . ARG B 1 125 ? -3.675  -19.156 49.783 1.00 59.31  ? 155  ARG B CG  1 
ATOM   3199 C CD  . ARG B 1 125 ? -2.700  -20.139 50.450 1.00 68.72  ? 155  ARG B CD  1 
ATOM   3200 N NE  . ARG B 1 125 ? -1.335  -20.000 49.924 1.00 73.51  ? 155  ARG B NE  1 
ATOM   3201 C CZ  . ARG B 1 125 ? -0.504  -18.992 50.213 1.00 74.64  ? 155  ARG B CZ  1 
ATOM   3202 N NH1 . ARG B 1 125 ? -0.883  -18.013 51.027 1.00 74.26  ? 155  ARG B NH1 1 
ATOM   3203 N NH2 . ARG B 1 125 ? 0.712   -18.954 49.679 1.00 75.15  ? 155  ARG B NH2 1 
ATOM   3204 N N   . ALA B 1 126 ? -6.929  -19.758 46.569 1.00 43.64  ? 156  ALA B N   1 
ATOM   3205 C CA  . ALA B 1 126 ? -7.692  -20.339 45.462 1.00 40.69  ? 156  ALA B CA  1 
ATOM   3206 C C   . ALA B 1 126 ? -7.950  -19.346 44.312 1.00 40.64  ? 156  ALA B C   1 
ATOM   3207 O O   . ALA B 1 126 ? -7.803  -19.686 43.131 1.00 39.54  ? 156  ALA B O   1 
ATOM   3208 C CB  . ALA B 1 126 ? -8.994  -20.920 45.970 1.00 37.82  ? 156  ALA B CB  1 
ATOM   3209 N N   . ARG B 1 127 ? -8.316  -18.120 44.665 1.00 40.53  ? 157  ARG B N   1 
ATOM   3210 C CA  . ARG B 1 127 ? -8.547  -17.087 43.669 1.00 43.36  ? 157  ARG B CA  1 
ATOM   3211 C C   . ARG B 1 127 ? -7.272  -16.583 42.981 1.00 43.99  ? 157  ARG B C   1 
ATOM   3212 O O   . ARG B 1 127 ? -7.275  -16.409 41.757 1.00 44.40  ? 157  ARG B O   1 
ATOM   3213 C CB  . ARG B 1 127 ? -9.369  -15.950 44.257 1.00 44.99  ? 157  ARG B CB  1 
ATOM   3214 C CG  . ARG B 1 127 ? -10.763 -16.413 44.598 1.00 51.99  ? 157  ARG B CG  1 
ATOM   3215 C CD  . ARG B 1 127 ? -11.734 -15.264 44.736 1.00 60.27  ? 157  ARG B CD  1 
ATOM   3216 N NE  . ARG B 1 127 ? -13.081 -15.771 45.000 1.00 63.99  ? 157  ARG B NE  1 
ATOM   3217 C CZ  . ARG B 1 127 ? -13.712 -15.693 46.170 1.00 63.03  ? 157  ARG B CZ  1 
ATOM   3218 N NH1 . ARG B 1 127 ? -13.145 -15.108 47.221 1.00 62.00  ? 157  ARG B NH1 1 
ATOM   3219 N NH2 . ARG B 1 127 ? -14.930 -16.194 46.281 1.00 63.47  ? 157  ARG B NH2 1 
ATOM   3220 N N   . ALA B 1 128 ? -6.196  -16.366 43.753 1.00 42.16  ? 158  ALA B N   1 
ATOM   3221 C CA  . ALA B 1 128 ? -4.877  -16.098 43.183 1.00 39.94  ? 158  ALA B CA  1 
ATOM   3222 C C   . ALA B 1 128 ? -4.480  -17.149 42.115 1.00 39.54  ? 158  ALA B C   1 
ATOM   3223 O O   . ALA B 1 128 ? -3.995  -16.788 41.038 1.00 40.43  ? 158  ALA B O   1 
ATOM   3224 C CB  . ALA B 1 128 ? -3.826  -15.992 44.275 1.00 40.34  ? 158  ALA B CB  1 
ATOM   3225 N N   . LYS B 1 129 ? -4.713  -18.430 42.394 1.00 37.15  ? 159  LYS B N   1 
ATOM   3226 C CA  . LYS B 1 129 ? -4.463  -19.474 41.410 1.00 39.87  ? 159  LYS B CA  1 
ATOM   3227 C C   . LYS B 1 129 ? -5.290  -19.284 40.135 1.00 39.44  ? 159  LYS B C   1 
ATOM   3228 O O   . LYS B 1 129 ? -4.819  -19.548 39.017 1.00 39.92  ? 159  LYS B O   1 
ATOM   3229 C CB  . LYS B 1 129 ? -4.744  -20.859 41.988 1.00 42.28  ? 159  LYS B CB  1 
ATOM   3230 C CG  . LYS B 1 129 ? -3.606  -21.457 42.827 1.00 50.44  ? 159  LYS B CG  1 
ATOM   3231 C CD  . LYS B 1 129 ? -3.897  -22.916 43.247 1.00 56.62  ? 159  LYS B CD  1 
ATOM   3232 C CE  . LYS B 1 129 ? -3.974  -23.876 42.041 1.00 63.19  ? 159  LYS B CE  1 
ATOM   3233 N NZ  . LYS B 1 129 ? -3.911  -25.330 42.446 1.00 66.03  ? 159  LYS B NZ  1 
ATOM   3234 N N   . VAL B 1 130 ? -6.527  -18.833 40.299 1.00 37.18  ? 160  VAL B N   1 
ATOM   3235 C CA  . VAL B 1 130 ? -7.398  -18.673 39.147 1.00 34.05  ? 160  VAL B CA  1 
ATOM   3236 C C   . VAL B 1 130 ? -6.926  -17.482 38.337 1.00 31.89  ? 160  VAL B C   1 
ATOM   3237 O O   . VAL B 1 130 ? -6.952  -17.518 37.098 1.00 30.23  ? 160  VAL B O   1 
ATOM   3238 C CB  . VAL B 1 130 ? -8.899  -18.564 39.544 1.00 34.18  ? 160  VAL B CB  1 
ATOM   3239 C CG1 . VAL B 1 130 ? -9.766  -18.198 38.340 1.00 31.48  ? 160  VAL B CG1 1 
ATOM   3240 C CG2 . VAL B 1 130 ? -9.381  -19.888 40.124 1.00 34.05  ? 160  VAL B CG2 1 
ATOM   3241 N N   . ILE B 1 131 ? -6.470  -16.444 39.037 1.00 30.07  ? 161  ILE B N   1 
ATOM   3242 C CA  . ILE B 1 131 ? -5.950  -15.253 38.369 1.00 29.03  ? 161  ILE B CA  1 
ATOM   3243 C C   . ILE B 1 131 ? -4.744  -15.619 37.521 1.00 30.41  ? 161  ILE B C   1 
ATOM   3244 O O   . ILE B 1 131 ? -4.718  -15.309 36.331 1.00 32.20  ? 161  ILE B O   1 
ATOM   3245 C CB  . ILE B 1 131 ? -5.577  -14.140 39.340 1.00 27.84  ? 161  ILE B CB  1 
ATOM   3246 C CG1 . ILE B 1 131 ? -6.819  -13.696 40.137 1.00 24.47  ? 161  ILE B CG1 1 
ATOM   3247 C CG2 . ILE B 1 131 ? -4.963  -12.948 38.561 1.00 24.00  ? 161  ILE B CG2 1 
ATOM   3248 C CD1 . ILE B 1 131 ? -6.514  -12.684 41.266 1.00 26.88  ? 161  ILE B CD1 1 
ATOM   3249 N N   . ILE B 1 132 ? -3.787  -16.322 38.129 1.00 28.59  ? 162  ILE B N   1 
ATOM   3250 C CA  . ILE B 1 132 ? -2.565  -16.706 37.457 1.00 28.67  ? 162  ILE B CA  1 
ATOM   3251 C C   . ILE B 1 132 ? -2.881  -17.533 36.222 1.00 28.44  ? 162  ILE B C   1 
ATOM   3252 O O   . ILE B 1 132 ? -2.354  -17.258 35.130 1.00 30.89  ? 162  ILE B O   1 
ATOM   3253 C CB  . ILE B 1 132 ? -1.562  -17.425 38.423 1.00 28.97  ? 162  ILE B CB  1 
ATOM   3254 C CG1 . ILE B 1 132 ? -0.892  -16.386 39.339 1.00 28.99  ? 162  ILE B CG1 1 
ATOM   3255 C CG2 . ILE B 1 132 ? -0.504  -18.222 37.642 1.00 26.18  ? 162  ILE B CG2 1 
ATOM   3256 C CD1 . ILE B 1 132 ? -0.382  -16.935 40.649 1.00 32.68  ? 162  ILE B CD1 1 
ATOM   3257 N N   . CYS B 1 133 ? -3.758  -18.513 36.388 1.00 27.29  ? 163  CYS B N   1 
ATOM   3258 C CA  . CYS B 1 133 ? -4.112  -19.412 35.300 1.00 28.53  ? 163  CYS B CA  1 
ATOM   3259 C C   . CYS B 1 133 ? -4.842  -18.693 34.158 1.00 28.21  ? 163  CYS B C   1 
ATOM   3260 O O   . CYS B 1 133 ? -4.607  -19.001 32.988 1.00 27.12  ? 163  CYS B O   1 
ATOM   3261 C CB  . CYS B 1 133 ? -4.931  -20.579 35.823 1.00 29.87  ? 163  CYS B CB  1 
ATOM   3262 S SG  . CYS B 1 133 ? -3.897  -21.788 36.721 1.00 41.55  ? 163  CYS B SG  1 
ATOM   3263 N N   . THR B 1 134 ? -5.679  -17.714 34.500 1.00 26.17  ? 164  THR B N   1 
ATOM   3264 C CA  . THR B 1 134 ? -6.385  -16.923 33.509 1.00 27.56  ? 164  THR B CA  1 
ATOM   3265 C C   . THR B 1 134 ? -5.383  -16.080 32.699 1.00 29.15  ? 164  THR B C   1 
ATOM   3266 O O   . THR B 1 134 ? -5.437  -16.081 31.454 1.00 29.49  ? 164  THR B O   1 
ATOM   3267 C CB  . THR B 1 134 ? -7.499  -16.038 34.178 1.00 30.05  ? 164  THR B CB  1 
ATOM   3268 O OG1 . THR B 1 134 ? -8.459  -16.879 34.835 1.00 29.21  ? 164  THR B OG1 1 
ATOM   3269 C CG2 . THR B 1 134 ? -8.212  -15.143 33.165 1.00 27.04  ? 164  THR B CG2 1 
ATOM   3270 N N   . VAL B 1 135 ? -4.474  -15.383 33.397 1.00 28.36  ? 165  VAL B N   1 
ATOM   3271 C CA  . VAL B 1 135 ? -3.357  -14.660 32.751 1.00 28.10  ? 165  VAL B CA  1 
ATOM   3272 C C   . VAL B 1 135 ? -2.585  -15.574 31.778 1.00 26.83  ? 165  VAL B C   1 
ATOM   3273 O O   . VAL B 1 135 ? -2.323  -15.201 30.652 1.00 24.34  ? 165  VAL B O   1 
ATOM   3274 C CB  . VAL B 1 135 ? -2.382  -14.039 33.789 1.00 29.20  ? 165  VAL B CB  1 
ATOM   3275 C CG1 . VAL B 1 135 ? -1.048  -13.691 33.153 1.00 27.27  ? 165  VAL B CG1 1 
ATOM   3276 C CG2 . VAL B 1 135 ? -3.002  -12.786 34.434 1.00 27.73  ? 165  VAL B CG2 1 
ATOM   3277 N N   . TRP B 1 136 ? -2.245  -16.787 32.188 1.00 27.46  ? 166  TRP B N   1 
ATOM   3278 C CA  . TRP B 1 136 ? -1.534  -17.651 31.248 1.00 28.88  ? 166  TRP B CA  1 
ATOM   3279 C C   . TRP B 1 136 ? -2.403  -18.094 30.087 1.00 29.48  ? 166  TRP B C   1 
ATOM   3280 O O   . TRP B 1 136 ? -1.900  -18.226 28.972 1.00 29.40  ? 166  TRP B O   1 
ATOM   3281 C CB  . TRP B 1 136 ? -0.858  -18.822 31.952 1.00 27.92  ? 166  TRP B CB  1 
ATOM   3282 C CG  . TRP B 1 136 ? 0.403   -18.397 32.655 1.00 31.51  ? 166  TRP B CG  1 
ATOM   3283 C CD1 . TRP B 1 136 ? 0.510   -17.948 33.942 1.00 32.03  ? 166  TRP B CD1 1 
ATOM   3284 C CD2 . TRP B 1 136 ? 1.729   -18.366 32.108 1.00 32.39  ? 166  TRP B CD2 1 
ATOM   3285 N NE1 . TRP B 1 136 ? 1.810   -17.649 34.236 1.00 33.44  ? 166  TRP B NE1 1 
ATOM   3286 C CE2 . TRP B 1 136 ? 2.587   -17.897 33.131 1.00 36.54  ? 166  TRP B CE2 1 
ATOM   3287 C CE3 . TRP B 1 136 ? 2.275   -18.692 30.859 1.00 33.61  ? 166  TRP B CE3 1 
ATOM   3288 C CZ2 . TRP B 1 136 ? 3.969   -17.741 32.944 1.00 33.90  ? 166  TRP B CZ2 1 
ATOM   3289 C CZ3 . TRP B 1 136 ? 3.644   -18.536 30.671 1.00 37.77  ? 166  TRP B CZ3 1 
ATOM   3290 C CH2 . TRP B 1 136 ? 4.475   -18.066 31.716 1.00 36.70  ? 166  TRP B CH2 1 
ATOM   3291 N N   . ALA B 1 137 ? -3.700  -18.308 30.352 1.00 30.15  ? 167  ALA B N   1 
ATOM   3292 C CA  . ALA B 1 137 ? -4.683  -18.678 29.318 1.00 28.88  ? 167  ALA B CA  1 
ATOM   3293 C C   . ALA B 1 137 ? -4.824  -17.598 28.234 1.00 28.80  ? 167  ALA B C   1 
ATOM   3294 O O   . ALA B 1 137 ? -4.747  -17.892 27.051 1.00 28.72  ? 167  ALA B O   1 
ATOM   3295 C CB  . ALA B 1 137 ? -6.040  -18.957 29.952 1.00 29.60  ? 167  ALA B CB  1 
ATOM   3296 N N   . ILE B 1 138 ? -5.040  -16.355 28.657 1.00 28.26  ? 168  ILE B N   1 
ATOM   3297 C CA  . ILE B 1 138 ? -5.131  -15.204 27.755 1.00 28.75  ? 168  ILE B CA  1 
ATOM   3298 C C   . ILE B 1 138 ? -3.853  -15.012 26.922 1.00 29.52  ? 168  ILE B C   1 
ATOM   3299 O O   . ILE B 1 138 ? -3.908  -14.734 25.723 1.00 28.04  ? 168  ILE B O   1 
ATOM   3300 C CB  . ILE B 1 138 ? -5.435  -13.897 28.566 1.00 28.71  ? 168  ILE B CB  1 
ATOM   3301 C CG1 . ILE B 1 138 ? -6.747  -14.048 29.350 1.00 22.86  ? 168  ILE B CG1 1 
ATOM   3302 C CG2 . ILE B 1 138 ? -5.452  -12.657 27.653 1.00 27.19  ? 168  ILE B CG2 1 
ATOM   3303 C CD1 . ILE B 1 138 ? -7.058  -12.904 30.283 1.00 19.41  ? 168  ILE B CD1 1 
ATOM   3304 N N   . SER B 1 139 ? -2.709  -15.149 27.584 1.00 30.60  ? 169  SER B N   1 
ATOM   3305 C CA  . SER B 1 139 ? -1.405  -15.021 26.947 1.00 32.00  ? 169  SER B CA  1 
ATOM   3306 C C   . SER B 1 139 ? -1.138  -16.106 25.894 1.00 32.01  ? 169  SER B C   1 
ATOM   3307 O O   . SER B 1 139 ? -0.568  -15.819 24.836 1.00 32.09  ? 169  SER B O   1 
ATOM   3308 C CB  . SER B 1 139 ? -0.312  -15.024 28.010 1.00 31.70  ? 169  SER B CB  1 
ATOM   3309 O OG  . SER B 1 139 ? -0.455  -13.887 28.844 1.00 36.36  ? 169  SER B OG  1 
ATOM   3310 N N   . ALA B 1 140 ? -1.540  -17.340 26.199 1.00 31.80  ? 170  ALA B N   1 
ATOM   3311 C CA  . ALA B 1 140 ? -1.439  -18.467 25.262 1.00 31.77  ? 170  ALA B CA  1 
ATOM   3312 C C   . ALA B 1 140 ? -2.297  -18.211 24.040 1.00 32.20  ? 170  ALA B C   1 
ATOM   3313 O O   . ALA B 1 140 ? -1.872  -18.425 22.901 1.00 31.37  ? 170  ALA B O   1 
ATOM   3314 C CB  . ALA B 1 140 ? -1.871  -19.762 25.931 1.00 30.82  ? 170  ALA B CB  1 
ATOM   3315 N N   . LEU B 1 141 ? -3.506  -17.729 24.292 1.00 32.59  ? 171  LEU B N   1 
ATOM   3316 C CA  . LEU B 1 141 ? -4.465  -17.432 23.247 1.00 33.97  ? 171  LEU B CA  1 
ATOM   3317 C C   . LEU B 1 141 ? -3.914  -16.385 22.269 1.00 34.20  ? 171  LEU B C   1 
ATOM   3318 O O   . LEU B 1 141 ? -3.981  -16.534 21.047 1.00 35.06  ? 171  LEU B O   1 
ATOM   3319 C CB  . LEU B 1 141 ? -5.755  -16.937 23.903 1.00 35.66  ? 171  LEU B CB  1 
ATOM   3320 C CG  . LEU B 1 141 ? -6.961  -16.600 23.037 1.00 41.27  ? 171  LEU B CG  1 
ATOM   3321 C CD1 . LEU B 1 141 ? -7.422  -17.846 22.306 1.00 48.42  ? 171  LEU B CD1 1 
ATOM   3322 C CD2 . LEU B 1 141 ? -8.059  -16.070 23.931 1.00 43.20  ? 171  LEU B CD2 1 
ATOM   3323 N N   . VAL B 1 142 ? -3.348  -15.332 22.827 1.00 32.43  ? 172  VAL B N   1 
ATOM   3324 C CA  . VAL B 1 142 ? -2.892  -14.206 22.065 1.00 31.37  ? 172  VAL B CA  1 
ATOM   3325 C C   . VAL B 1 142 ? -1.577  -14.518 21.340 1.00 31.38  ? 172  VAL B C   1 
ATOM   3326 O O   . VAL B 1 142 ? -1.260  -13.898 20.319 1.00 31.07  ? 172  VAL B O   1 
ATOM   3327 C CB  . VAL B 1 142 ? -2.828  -12.974 23.020 1.00 33.85  ? 172  VAL B CB  1 
ATOM   3328 C CG1 . VAL B 1 142 ? -1.630  -12.043 22.751 1.00 35.04  ? 172  VAL B CG1 1 
ATOM   3329 C CG2 . VAL B 1 142 ? -4.173  -12.230 22.997 1.00 32.11  ? 172  VAL B CG2 1 
ATOM   3330 N N   . SER B 1 143 ? -0.828  -15.494 21.844 1.00 30.09  ? 173  SER B N   1 
ATOM   3331 C CA  . SER B 1 143 ? 0.485   -15.783 21.297 1.00 32.29  ? 173  SER B CA  1 
ATOM   3332 C C   . SER B 1 143 ? 0.543   -16.937 20.275 1.00 33.57  ? 173  SER B C   1 
ATOM   3333 O O   . SER B 1 143 ? 0.998   -16.736 19.152 1.00 34.95  ? 173  SER B O   1 
ATOM   3334 C CB  . SER B 1 143 ? 1.485   -15.996 22.425 1.00 33.03  ? 173  SER B CB  1 
ATOM   3335 O OG  . SER B 1 143 ? 1.161   -17.170 23.143 1.00 38.01  ? 173  SER B OG  1 
ATOM   3336 N N   . PHE B 1 144 ? 0.072   -18.124 20.657 1.00 33.80  ? 174  PHE B N   1 
ATOM   3337 C CA  . PHE B 1 144 ? 0.128   -19.318 19.803 1.00 35.14  ? 174  PHE B CA  1 
ATOM   3338 C C   . PHE B 1 144 ? -0.697  -19.297 18.526 1.00 37.45  ? 174  PHE B C   1 
ATOM   3339 O O   . PHE B 1 144 ? -0.171  -19.522 17.431 1.00 37.05  ? 174  PHE B O   1 
ATOM   3340 C CB  . PHE B 1 144 ? -0.261  -20.562 20.589 1.00 34.69  ? 174  PHE B CB  1 
ATOM   3341 C CG  . PHE B 1 144 ? 0.823   -21.065 21.454 1.00 41.05  ? 174  PHE B CG  1 
ATOM   3342 C CD1 . PHE B 1 144 ? 1.847   -21.836 20.912 1.00 39.98  ? 174  PHE B CD1 1 
ATOM   3343 C CD2 . PHE B 1 144 ? 0.855   -20.750 22.812 1.00 44.33  ? 174  PHE B CD2 1 
ATOM   3344 C CE1 . PHE B 1 144 ? 2.873   -22.303 21.711 1.00 40.72  ? 174  PHE B CE1 1 
ATOM   3345 C CE2 . PHE B 1 144 ? 1.892   -21.210 23.621 1.00 45.79  ? 174  PHE B CE2 1 
ATOM   3346 C CZ  . PHE B 1 144 ? 2.902   -21.986 23.067 1.00 44.27  ? 174  PHE B CZ  1 
ATOM   3347 N N   . LEU B 1 145 ? -1.996  -19.069 18.662 1.00 38.43  ? 175  LEU B N   1 
ATOM   3348 C CA  . LEU B 1 145 ? -2.888  -19.218 17.530 1.00 37.88  ? 175  LEU B CA  1 
ATOM   3349 C C   . LEU B 1 145 ? -2.460  -18.347 16.327 1.00 34.03  ? 175  LEU B C   1 
ATOM   3350 O O   . LEU B 1 145 ? -2.248  -18.879 15.232 1.00 34.10  ? 175  LEU B O   1 
ATOM   3351 C CB  . LEU B 1 145 ? -4.332  -18.947 17.957 1.00 42.59  ? 175  LEU B CB  1 
ATOM   3352 C CG  . LEU B 1 145 ? -5.425  -19.957 17.575 1.00 47.72  ? 175  LEU B CG  1 
ATOM   3353 C CD1 . LEU B 1 145 ? -5.965  -19.686 16.195 1.00 47.15  ? 175  LEU B CD1 1 
ATOM   3354 C CD2 . LEU B 1 145 ? -4.940  -21.395 17.705 1.00 48.63  ? 175  LEU B CD2 1 
ATOM   3355 N N   . PRO B 1 146 ? -2.281  -17.021 16.521 1.00 28.62  ? 176  PRO B N   1 
ATOM   3356 C CA  . PRO B 1 146 ? -1.960  -16.249 15.319 1.00 29.12  ? 176  PRO B CA  1 
ATOM   3357 C C   . PRO B 1 146 ? -0.689  -16.734 14.633 1.00 31.89  ? 176  PRO B C   1 
ATOM   3358 O O   . PRO B 1 146 ? -0.586  -16.626 13.417 1.00 32.62  ? 176  PRO B O   1 
ATOM   3359 C CB  . PRO B 1 146 ? -1.749  -14.830 15.848 1.00 26.22  ? 176  PRO B CB  1 
ATOM   3360 C CG  . PRO B 1 146 ? -2.410  -14.823 17.202 1.00 24.63  ? 176  PRO B CG  1 
ATOM   3361 C CD  . PRO B 1 146 ? -2.217  -16.193 17.736 1.00 26.49  ? 176  PRO B CD  1 
ATOM   3362 N N   . ILE B 1 147 ? 0.266   -17.255 15.406 1.00 34.48  ? 177  ILE B N   1 
ATOM   3363 C CA  . ILE B 1 147 ? 1.551   -17.684 14.857 1.00 37.31  ? 177  ILE B CA  1 
ATOM   3364 C C   . ILE B 1 147 ? 1.507   -19.034 14.145 1.00 40.78  ? 177  ILE B C   1 
ATOM   3365 O O   . ILE B 1 147 ? 2.222   -19.244 13.171 1.00 42.69  ? 177  ILE B O   1 
ATOM   3366 C CB  . ILE B 1 147 ? 2.682   -17.621 15.909 1.00 36.52  ? 177  ILE B CB  1 
ATOM   3367 C CG1 . ILE B 1 147 ? 3.154   -16.172 16.038 1.00 34.78  ? 177  ILE B CG1 1 
ATOM   3368 C CG2 . ILE B 1 147 ? 3.865   -18.495 15.499 1.00 34.86  ? 177  ILE B CG2 1 
ATOM   3369 C CD1 . ILE B 1 147 ? 3.928   -15.891 17.269 1.00 35.96  ? 177  ILE B CD1 1 
ATOM   3370 N N   . MET B 1 148 ? 0.663   -19.936 14.629 1.00 45.17  ? 178  MET B N   1 
ATOM   3371 C CA  . MET B 1 148 ? 0.481   -21.245 14.009 1.00 48.19  ? 178  MET B CA  1 
ATOM   3372 C C   . MET B 1 148 ? -0.524  -21.162 12.845 1.00 49.34  ? 178  MET B C   1 
ATOM   3373 O O   . MET B 1 148 ? -0.493  -21.981 11.927 1.00 51.13  ? 178  MET B O   1 
ATOM   3374 C CB  . MET B 1 148 ? 0.046   -22.277 15.059 1.00 49.80  ? 178  MET B CB  1 
ATOM   3375 C CG  . MET B 1 148 ? 1.037   -22.477 16.229 1.00 58.10  ? 178  MET B CG  1 
ATOM   3376 S SD  . MET B 1 148 ? 2.699   -23.096 15.783 1.00 71.69  ? 178  MET B SD  1 
ATOM   3377 C CE  . MET B 1 148 ? 3.371   -23.542 17.386 1.00 67.45  ? 178  MET B CE  1 
ATOM   3378 N N   . MET B 1 149 ? -1.398  -20.162 12.882 1.00 48.51  ? 179  MET B N   1 
ATOM   3379 C CA  . MET B 1 149 ? -2.267  -19.858 11.756 1.00 47.33  ? 179  MET B CA  1 
ATOM   3380 C C   . MET B 1 149 ? -1.560  -19.074 10.652 1.00 45.35  ? 179  MET B C   1 
ATOM   3381 O O   . MET B 1 149 ? -2.157  -18.824 9.614  1.00 45.43  ? 179  MET B O   1 
ATOM   3382 C CB  . MET B 1 149 ? -3.456  -19.013 12.214 1.00 50.03  ? 179  MET B CB  1 
ATOM   3383 C CG  . MET B 1 149 ? -4.405  -19.682 13.186 1.00 54.96  ? 179  MET B CG  1 
ATOM   3384 S SD  . MET B 1 149 ? -5.398  -20.991 12.458 1.00 62.83  ? 179  MET B SD  1 
ATOM   3385 C CE  . MET B 1 149 ? -6.454  -20.083 11.319 1.00 64.52  ? 179  MET B CE  1 
ATOM   3386 N N   . HIS B 1 150 ? -0.325  -18.633 10.882 1.00 43.68  ? 180  HIS B N   1 
ATOM   3387 C CA  . HIS B 1 150 ? 0.423   -17.873 9.867  1.00 42.37  ? 180  HIS B CA  1 
ATOM   3388 C C   . HIS B 1 150 ? -0.162  -16.493 9.545  1.00 40.60  ? 180  HIS B C   1 
ATOM   3389 O O   . HIS B 1 150 ? 0.051   -15.951 8.448  1.00 39.56  ? 180  HIS B O   1 
ATOM   3390 C CB  . HIS B 1 150 ? 0.561   -18.705 8.584  1.00 43.67  ? 180  HIS B CB  1 
ATOM   3391 C CG  . HIS B 1 150 ? 1.639   -19.740 8.658  1.00 48.66  ? 180  HIS B CG  1 
ATOM   3392 N ND1 . HIS B 1 150 ? 2.267   -20.242 7.539  1.00 50.23  ? 180  HIS B ND1 1 
ATOM   3393 C CD2 . HIS B 1 150 ? 2.231   -20.336 9.723  1.00 51.53  ? 180  HIS B CD2 1 
ATOM   3394 C CE1 . HIS B 1 150 ? 3.179   -21.124 7.911  1.00 52.12  ? 180  HIS B CE1 1 
ATOM   3395 N NE2 . HIS B 1 150 ? 3.183   -21.193 9.230  1.00 51.78  ? 180  HIS B NE2 1 
ATOM   3396 N N   . TRP B 1 151 ? -0.891  -15.925 10.507 1.00 38.09  ? 181  TRP B N   1 
ATOM   3397 C CA  . TRP B 1 151 ? -1.413  -14.565 10.384 1.00 35.22  ? 181  TRP B CA  1 
ATOM   3398 C C   . TRP B 1 151 ? -0.296  -13.517 10.333 1.00 33.61  ? 181  TRP B C   1 
ATOM   3399 O O   . TRP B 1 151 ? -0.524  -12.374 9.930  1.00 31.15  ? 181  TRP B O   1 
ATOM   3400 C CB  . TRP B 1 151 ? -2.353  -14.262 11.548 1.00 35.73  ? 181  TRP B CB  1 
ATOM   3401 C CG  . TRP B 1 151 ? -3.647  -15.035 11.498 1.00 40.96  ? 181  TRP B CG  1 
ATOM   3402 C CD1 . TRP B 1 151 ? -4.117  -15.787 10.459 1.00 42.20  ? 181  TRP B CD1 1 
ATOM   3403 C CD2 . TRP B 1 151 ? -4.644  -15.110 12.523 1.00 40.54  ? 181  TRP B CD2 1 
ATOM   3404 N NE1 . TRP B 1 151 ? -5.322  -16.338 10.780 1.00 37.90  ? 181  TRP B NE1 1 
ATOM   3405 C CE2 . TRP B 1 151 ? -5.677  -15.931 12.037 1.00 40.53  ? 181  TRP B CE2 1 
ATOM   3406 C CE3 . TRP B 1 151 ? -4.767  -14.557 13.806 1.00 39.94  ? 181  TRP B CE3 1 
ATOM   3407 C CZ2 . TRP B 1 151 ? -6.825  -16.215 12.790 1.00 41.53  ? 181  TRP B CZ2 1 
ATOM   3408 C CZ3 . TRP B 1 151 ? -5.900  -14.841 14.552 1.00 35.59  ? 181  TRP B CZ3 1 
ATOM   3409 C CH2 . TRP B 1 151 ? -6.916  -15.659 14.040 1.00 37.24  ? 181  TRP B CH2 1 
ATOM   3410 N N   . TRP B 1 152 ? 0.906   -13.919 10.742 1.00 32.66  ? 182  TRP B N   1 
ATOM   3411 C CA  . TRP B 1 152 ? 2.030   -13.015 10.829 1.00 33.80  ? 182  TRP B CA  1 
ATOM   3412 C C   . TRP B 1 152 ? 2.791   -12.815 9.527  1.00 35.00  ? 182  TRP B C   1 
ATOM   3413 O O   . TRP B 1 152 ? 3.555   -11.860 9.412  1.00 34.34  ? 182  TRP B O   1 
ATOM   3414 C CB  . TRP B 1 152 ? 2.981   -13.477 11.917 1.00 35.50  ? 182  TRP B CB  1 
ATOM   3415 C CG  . TRP B 1 152 ? 3.509   -14.866 11.734 1.00 34.92  ? 182  TRP B CG  1 
ATOM   3416 C CD1 . TRP B 1 152 ? 2.954   -16.019 12.195 1.00 35.65  ? 182  TRP B CD1 1 
ATOM   3417 C CD2 . TRP B 1 152 ? 4.721   -15.242 11.076 1.00 37.26  ? 182  TRP B CD2 1 
ATOM   3418 N NE1 . TRP B 1 152 ? 3.748   -17.101 11.868 1.00 33.26  ? 182  TRP B NE1 1 
ATOM   3419 C CE2 . TRP B 1 152 ? 4.835   -16.647 11.175 1.00 35.11  ? 182  TRP B CE2 1 
ATOM   3420 C CE3 . TRP B 1 152 ? 5.727   -14.528 10.409 1.00 39.69  ? 182  TRP B CE3 1 
ATOM   3421 C CZ2 . TRP B 1 152 ? 5.904   -17.348 10.621 1.00 35.30  ? 182  TRP B CZ2 1 
ATOM   3422 C CZ3 . TRP B 1 152 ? 6.793   -15.229 9.874  1.00 35.49  ? 182  TRP B CZ3 1 
ATOM   3423 C CH2 . TRP B 1 152 ? 6.872   -16.616 9.976  1.00 32.74  ? 182  TRP B CH2 1 
ATOM   3424 N N   . ARG B 1 153 ? 2.563   -13.688 8.545  1.00 36.68  ? 183  ARG B N   1 
ATOM   3425 C CA  . ARG B 1 153 ? 3.318   -13.665 7.293  1.00 36.76  ? 183  ARG B CA  1 
ATOM   3426 C C   . ARG B 1 153 ? 2.965   -12.538 6.323  1.00 39.04  ? 183  ARG B C   1 
ATOM   3427 O O   . ARG B 1 153 ? 1.816   -12.087 6.244  1.00 38.58  ? 183  ARG B O   1 
ATOM   3428 C CB  . ARG B 1 153 ? 3.235   -15.003 6.586  1.00 36.17  ? 183  ARG B CB  1 
ATOM   3429 C CG  . ARG B 1 153 ? 3.969   -16.086 7.330  1.00 40.62  ? 183  ARG B CG  1 
ATOM   3430 C CD  . ARG B 1 153 ? 4.222   -17.264 6.442  1.00 49.00  ? 183  ARG B CD  1 
ATOM   3431 N NE  . ARG B 1 153 ? 5.113   -18.238 7.071  1.00 53.19  ? 183  ARG B NE  1 
ATOM   3432 C CZ  . ARG B 1 153 ? 5.402   -19.439 6.566  1.00 54.31  ? 183  ARG B CZ  1 
ATOM   3433 N NH1 . ARG B 1 153 ? 4.872   -19.850 5.416  1.00 52.69  ? 183  ARG B NH1 1 
ATOM   3434 N NH2 . ARG B 1 153 ? 6.220   -20.245 7.226  1.00 56.83  ? 183  ARG B NH2 1 
ATOM   3435 N N   . ASP B 1 154 ? 3.991   -12.109 5.591  1.00 39.78  ? 184  ASP B N   1 
ATOM   3436 C CA  . ASP B 1 154 ? 3.893   -11.080 4.585  1.00 41.54  ? 184  ASP B CA  1 
ATOM   3437 C C   . ASP B 1 154 ? 4.139   -11.648 3.178  1.00 45.57  ? 184  ASP B C   1 
ATOM   3438 O O   . ASP B 1 154 ? 4.713   -12.728 3.030  1.00 46.08  ? 184  ASP B O   1 
ATOM   3439 C CB  . ASP B 1 154 ? 4.918   -10.004 4.889  1.00 40.28  ? 184  ASP B CB  1 
ATOM   3440 C CG  . ASP B 1 154 ? 4.538   -8.668  4.314  1.00 42.36  ? 184  ASP B CG  1 
ATOM   3441 O OD1 . ASP B 1 154 ? 3.524   -8.599  3.583  1.00 43.06  ? 184  ASP B OD1 1 
ATOM   3442 O OD2 . ASP B 1 154 ? 5.247   -7.684  4.598  1.00 46.52  ? 184  ASP B OD2 1 
ATOM   3443 N N   . GLU B 1 155 ? 3.702   -10.918 2.152  1.00 49.40  ? 185  GLU B N   1 
ATOM   3444 C CA  . GLU B 1 155 ? 3.827   -11.365 0.758  1.00 54.00  ? 185  GLU B CA  1 
ATOM   3445 C C   . GLU B 1 155 ? 5.000   -10.690 0.023  1.00 55.11  ? 185  GLU B C   1 
ATOM   3446 O O   . GLU B 1 155 ? 5.300   -11.001 -1.131 1.00 53.97  ? 185  GLU B O   1 
ATOM   3447 C CB  . GLU B 1 155 ? 2.510   -11.144 0.017  1.00 55.95  ? 185  GLU B CB  1 
ATOM   3448 C CG  . GLU B 1 155 ? 1.329   -11.856 0.671  1.00 64.96  ? 185  GLU B CG  1 
ATOM   3449 C CD  . GLU B 1 155 ? -0.009  -11.247 0.298  1.00 75.05  ? 185  GLU B CD  1 
ATOM   3450 O OE1 . GLU B 1 155 ? -0.266  -11.077 -0.915 1.00 77.98  ? 185  GLU B OE1 1 
ATOM   3451 O OE2 . GLU B 1 155 ? -0.804  -10.943 1.221  1.00 80.12  ? 185  GLU B OE2 1 
ATOM   3452 N N   . ASP B 1 156 ? 5.648   -9.766  0.719  1.00 56.57  ? 186  ASP B N   1 
ATOM   3453 C CA  . ASP B 1 156 ? 6.907   -9.173  0.309  1.00 59.38  ? 186  ASP B CA  1 
ATOM   3454 C C   . ASP B 1 156 ? 7.920   -10.246 -0.152 1.00 59.23  ? 186  ASP B C   1 
ATOM   3455 O O   . ASP B 1 156 ? 8.025   -11.307 0.471  1.00 58.18  ? 186  ASP B O   1 
ATOM   3456 C CB  . ASP B 1 156 ? 7.470   -8.396  1.504  1.00 61.05  ? 186  ASP B CB  1 
ATOM   3457 C CG  . ASP B 1 156 ? 8.478   -7.337  1.105  1.00 66.95  ? 186  ASP B CG  1 
ATOM   3458 O OD1 . ASP B 1 156 ? 8.280   -6.642  0.074  1.00 68.55  ? 186  ASP B OD1 1 
ATOM   3459 O OD2 . ASP B 1 156 ? 9.469   -7.186  1.854  1.00 73.89  ? 186  ASP B OD2 1 
ATOM   3460 N N   . PRO B 1 157 ? 8.655   -9.977  -1.255 1.00 59.76  ? 187  PRO B N   1 
ATOM   3461 C CA  . PRO B 1 157 ? 9.649   -10.923 -1.792 1.00 59.28  ? 187  PRO B CA  1 
ATOM   3462 C C   . PRO B 1 157 ? 10.765  -11.317 -0.813 1.00 57.97  ? 187  PRO B C   1 
ATOM   3463 O O   . PRO B 1 157 ? 11.149  -12.492 -0.755 1.00 56.30  ? 187  PRO B O   1 
ATOM   3464 C CB  . PRO B 1 157 ? 10.208  -10.172 -3.002 1.00 60.14  ? 187  PRO B CB  1 
ATOM   3465 C CG  . PRO B 1 157 ? 9.021   -9.371  -3.484 1.00 59.29  ? 187  PRO B CG  1 
ATOM   3466 C CD  . PRO B 1 157 ? 8.417   -8.864  -2.199 1.00 60.17  ? 187  PRO B CD  1 
ATOM   3467 N N   . GLN B 1 158 ? 11.258  -10.351 -0.043 1.00 57.96  ? 188  GLN B N   1 
ATOM   3468 C CA  . GLN B 1 158 ? 12.267  -10.614 0.997  1.00 58.43  ? 188  GLN B CA  1 
ATOM   3469 C C   . GLN B 1 158 ? 11.747  -11.507 2.129  1.00 56.84  ? 188  GLN B C   1 
ATOM   3470 O O   . GLN B 1 158 ? 12.523  -12.228 2.772  1.00 57.52  ? 188  GLN B O   1 
ATOM   3471 C CB  . GLN B 1 158 ? 12.798  -9.301  1.577  1.00 60.40  ? 188  GLN B CB  1 
ATOM   3472 C CG  . GLN B 1 158 ? 13.650  -8.486  0.596  1.00 65.89  ? 188  GLN B CG  1 
ATOM   3473 C CD  . GLN B 1 158 ? 13.461  -6.980  0.759  1.00 71.95  ? 188  GLN B CD  1 
ATOM   3474 O OE1 . GLN B 1 158 ? 12.408  -6.514  1.213  1.00 72.51  ? 188  GLN B OE1 1 
ATOM   3475 N NE2 . GLN B 1 158 ? 14.480  -6.209  0.372  1.00 73.14  ? 188  GLN B NE2 1 
ATOM   3476 N N   . ALA B 1 159 ? 10.437  -11.454 2.372  1.00 53.41  ? 189  ALA B N   1 
ATOM   3477 C CA  . ALA B 1 159 ? 9.825   -12.288 3.394  1.00 49.62  ? 189  ALA B CA  1 
ATOM   3478 C C   . ALA B 1 159 ? 9.664   -13.707 2.886  1.00 47.21  ? 189  ALA B C   1 
ATOM   3479 O O   . ALA B 1 159 ? 9.906   -14.668 3.635  1.00 45.80  ? 189  ALA B O   1 
ATOM   3480 C CB  . ALA B 1 159 ? 8.489   -11.708 3.857  1.00 49.40  ? 189  ALA B CB  1 
ATOM   3481 N N   . LEU B 1 160 ? 9.272   -13.839 1.619  1.00 45.96  ? 190  LEU B N   1 
ATOM   3482 C CA  . LEU B 1 160 ? 9.151   -15.157 0.982  1.00 46.70  ? 190  LEU B CA  1 
ATOM   3483 C C   . LEU B 1 160 ? 10.485  -15.911 0.918  1.00 48.15  ? 190  LEU B C   1 
ATOM   3484 O O   . LEU B 1 160 ? 10.522  -17.112 1.145  1.00 47.37  ? 190  LEU B O   1 
ATOM   3485 C CB  . LEU B 1 160 ? 8.497   -15.064 -0.396 1.00 45.90  ? 190  LEU B CB  1 
ATOM   3486 C CG  . LEU B 1 160 ? 7.047   -14.536 -0.454 1.00 48.99  ? 190  LEU B CG  1 
ATOM   3487 C CD1 . LEU B 1 160 ? 6.570   -14.488 -1.884 1.00 50.84  ? 190  LEU B CD1 1 
ATOM   3488 C CD2 . LEU B 1 160 ? 6.059   -15.355 0.389  1.00 47.45  ? 190  LEU B CD2 1 
ATOM   3489 N N   . LYS B 1 161 ? 11.585  -15.204 0.663  1.00 51.23  ? 191  LYS B N   1 
ATOM   3490 C CA  . LYS B 1 161 ? 12.898  -15.857 0.667  1.00 54.79  ? 191  LYS B CA  1 
ATOM   3491 C C   . LYS B 1 161 ? 13.247  -16.430 2.042  1.00 54.70  ? 191  LYS B C   1 
ATOM   3492 O O   . LYS B 1 161 ? 13.895  -17.475 2.135  1.00 56.83  ? 191  LYS B O   1 
ATOM   3493 C CB  . LYS B 1 161 ? 14.017  -14.923 0.180  1.00 56.13  ? 191  LYS B CB  1 
ATOM   3494 C CG  . LYS B 1 161 ? 15.245  -15.688 -0.324 1.00 59.26  ? 191  LYS B CG  1 
ATOM   3495 C CD  . LYS B 1 161 ? 16.539  -14.938 -0.052 1.00 64.89  ? 191  LYS B CD  1 
ATOM   3496 C CE  . LYS B 1 161 ? 17.748  -15.874 -0.140 1.00 68.42  ? 191  LYS B CE  1 
ATOM   3497 N NZ  . LYS B 1 161 ? 17.963  -16.399 -1.525 1.00 67.94  ? 191  LYS B NZ  1 
ATOM   3498 N N   . CYS B 1 162 ? 12.824  -15.742 3.098  1.00 53.24  ? 192  CYS B N   1 
ATOM   3499 C CA  . CYS B 1 162 ? 13.042  -16.230 4.449  1.00 52.25  ? 192  CYS B CA  1 
ATOM   3500 C C   . CYS B 1 162 ? 12.180  -17.455 4.784  1.00 50.39  ? 192  CYS B C   1 
ATOM   3501 O O   . CYS B 1 162 ? 12.624  -18.332 5.533  1.00 47.86  ? 192  CYS B O   1 
ATOM   3502 C CB  . CYS B 1 162 ? 12.825  -15.127 5.495  1.00 52.04  ? 192  CYS B CB  1 
ATOM   3503 S SG  . CYS B 1 162 ? 12.892  -15.811 7.177  1.00 57.09  ? 192  CYS B SG  1 
ATOM   3504 N N   . TYR B 1 163 ? 10.955  -17.509 4.250  1.00 50.90  ? 193  TYR B N   1 
ATOM   3505 C CA  . TYR B 1 163 ? 10.067  -18.650 4.508  1.00 50.74  ? 193  TYR B CA  1 
ATOM   3506 C C   . TYR B 1 163 ? 10.535  -19.867 3.701  1.00 51.61  ? 193  TYR B C   1 
ATOM   3507 O O   . TYR B 1 163 ? 10.403  -20.999 4.151  1.00 49.72  ? 193  TYR B O   1 
ATOM   3508 C CB  . TYR B 1 163 ? 8.573   -18.323 4.261  1.00 51.29  ? 193  TYR B CB  1 
ATOM   3509 C CG  . TYR B 1 163 ? 8.047   -17.037 4.910  1.00 50.25  ? 193  TYR B CG  1 
ATOM   3510 C CD1 . TYR B 1 163 ? 8.375   -16.698 6.227  1.00 50.36  ? 193  TYR B CD1 1 
ATOM   3511 C CD2 . TYR B 1 163 ? 7.200   -16.166 4.202  1.00 47.85  ? 193  TYR B CD2 1 
ATOM   3512 C CE1 . TYR B 1 163 ? 7.900   -15.509 6.806  1.00 46.75  ? 193  TYR B CE1 1 
ATOM   3513 C CE2 . TYR B 1 163 ? 6.715   -14.976 4.780  1.00 42.06  ? 193  TYR B CE2 1 
ATOM   3514 C CZ  . TYR B 1 163 ? 7.075   -14.657 6.077  1.00 42.86  ? 193  TYR B CZ  1 
ATOM   3515 O OH  . TYR B 1 163 ? 6.615   -13.497 6.658  1.00 43.87  ? 193  TYR B OH  1 
ATOM   3516 N N   . GLN B 1 164 ? 11.121  -19.603 2.531  1.00 54.26  ? 194  GLN B N   1 
ATOM   3517 C CA  . GLN B 1 164 ? 11.744  -20.619 1.672  1.00 56.71  ? 194  GLN B CA  1 
ATOM   3518 C C   . GLN B 1 164 ? 13.039  -21.213 2.233  1.00 56.93  ? 194  GLN B C   1 
ATOM   3519 O O   . GLN B 1 164 ? 13.471  -22.289 1.797  1.00 58.63  ? 194  GLN B O   1 
ATOM   3520 C CB  . GLN B 1 164 ? 12.094  -20.009 0.307  1.00 58.99  ? 194  GLN B CB  1 
ATOM   3521 C CG  . GLN B 1 164 ? 10.916  -19.540 -0.528 1.00 65.63  ? 194  GLN B CG  1 
ATOM   3522 C CD  . GLN B 1 164 ? 10.041  -20.677 -0.981 1.00 73.74  ? 194  GLN B CD  1 
ATOM   3523 O OE1 . GLN B 1 164 ? 10.081  -21.063 -2.145 1.00 80.75  ? 194  GLN B OE1 1 
ATOM   3524 N NE2 . GLN B 1 164 ? 9.253   -21.236 -0.062 1.00 73.06  ? 194  GLN B NE2 1 
ATOM   3525 N N   . ASP B 1 165 ? 13.679  -20.488 3.149  1.00 53.84  ? 195  ASP B N   1 
ATOM   3526 C CA  . ASP B 1 165 ? 14.982  -20.857 3.677  1.00 50.77  ? 195  ASP B CA  1 
ATOM   3527 C C   . ASP B 1 165 ? 14.836  -21.480 5.065  1.00 50.10  ? 195  ASP B C   1 
ATOM   3528 O O   . ASP B 1 165 ? 14.605  -20.760 6.049  1.00 51.52  ? 195  ASP B O   1 
ATOM   3529 C CB  . ASP B 1 165 ? 15.909  -19.620 3.701  1.00 50.18  ? 195  ASP B CB  1 
ATOM   3530 C CG  . ASP B 1 165 ? 17.330  -19.930 4.219  1.00 49.42  ? 195  ASP B CG  1 
ATOM   3531 O OD1 . ASP B 1 165 ? 17.708  -21.112 4.353  1.00 51.72  ? 195  ASP B OD1 1 
ATOM   3532 O OD2 . ASP B 1 165 ? 18.086  -18.978 4.489  1.00 44.67  ? 195  ASP B OD2 1 
ATOM   3533 N N   . PRO B 1 166 ? 14.991  -22.822 5.162  1.00 49.01  ? 196  PRO B N   1 
ATOM   3534 C CA  . PRO B 1 166 ? 14.860  -23.491 6.469  1.00 48.14  ? 196  PRO B CA  1 
ATOM   3535 C C   . PRO B 1 166 ? 15.889  -22.965 7.473  1.00 48.41  ? 196  PRO B C   1 
ATOM   3536 O O   . PRO B 1 166 ? 15.761  -23.209 8.675  1.00 48.98  ? 196  PRO B O   1 
ATOM   3537 C CB  . PRO B 1 166 ? 15.130  -24.974 6.152  1.00 47.10  ? 196  PRO B CB  1 
ATOM   3538 C CG  . PRO B 1 166 ? 15.078  -25.094 4.671  1.00 45.89  ? 196  PRO B CG  1 
ATOM   3539 C CD  . PRO B 1 166 ? 15.450  -23.753 4.115  1.00 47.76  ? 196  PRO B CD  1 
ATOM   3540 N N   . GLY B 1 167 ? 16.896  -22.250 6.968  1.00 48.08  ? 197  GLY B N   1 
ATOM   3541 C CA  . GLY B 1 167 ? 17.939  -21.645 7.800  1.00 47.77  ? 197  GLY B CA  1 
ATOM   3542 C C   . GLY B 1 167 ? 17.534  -20.307 8.403  1.00 46.73  ? 197  GLY B C   1 
ATOM   3543 O O   . GLY B 1 167 ? 18.176  -19.828 9.341  1.00 42.98  ? 197  GLY B O   1 
ATOM   3544 N N   . CYS B 1 168 ? 16.468  -19.712 7.855  1.00 47.57  ? 198  CYS B N   1 
ATOM   3545 C CA  . CYS B 1 168 ? 15.995  -18.391 8.269  1.00 48.05  ? 198  CYS B CA  1 
ATOM   3546 C C   . CYS B 1 168 ? 14.872  -18.461 9.307  1.00 46.90  ? 198  CYS B C   1 
ATOM   3547 O O   . CYS B 1 168 ? 13.786  -18.939 9.005  1.00 44.87  ? 198  CYS B O   1 
ATOM   3548 C CB  . CYS B 1 168 ? 15.507  -17.579 7.072  1.00 46.25  ? 198  CYS B CB  1 
ATOM   3549 S SG  . CYS B 1 168 ? 14.921  -15.953 7.621  1.00 56.73  ? 198  CYS B SG  1 
ATOM   3550 N N   . CYS B 1 169 ? 15.147  -17.993 10.524 1.00 47.73  ? 199  CYS B N   1 
ATOM   3551 C CA  . CYS B 1 169 ? 14.095  -17.847 11.535 1.00 48.77  ? 199  CYS B CA  1 
ATOM   3552 C C   . CYS B 1 169 ? 14.047  -16.407 12.005 1.00 48.53  ? 199  CYS B C   1 
ATOM   3553 O O   . CYS B 1 169 ? 14.121  -16.121 13.189 1.00 48.02  ? 199  CYS B O   1 
ATOM   3554 C CB  . CYS B 1 169 ? 14.278  -18.819 12.703 1.00 48.24  ? 199  CYS B CB  1 
ATOM   3555 S SG  . CYS B 1 169 ? 12.809  -19.023 13.793 1.00 52.09  ? 199  CYS B SG  1 
ATOM   3556 N N   . ASP B 1 170 ? 13.953  -15.505 11.038 1.00 50.21  ? 200  ASP B N   1 
ATOM   3557 C CA  . ASP B 1 170 ? 13.761  -14.091 11.295 1.00 52.95  ? 200  ASP B CA  1 
ATOM   3558 C C   . ASP B 1 170 ? 12.270  -13.856 11.423 1.00 53.88  ? 200  ASP B C   1 
ATOM   3559 O O   . ASP B 1 170 ? 11.465  -14.519 10.758 1.00 56.23  ? 200  ASP B O   1 
ATOM   3560 C CB  . ASP B 1 170 ? 14.302  -13.240 10.135 1.00 53.85  ? 200  ASP B CB  1 
ATOM   3561 C CG  . ASP B 1 170 ? 15.805  -13.407 9.920  1.00 58.10  ? 200  ASP B CG  1 
ATOM   3562 O OD1 . ASP B 1 170 ? 16.476  -14.052 10.757 1.00 62.19  ? 200  ASP B OD1 1 
ATOM   3563 O OD2 . ASP B 1 170 ? 16.317  -12.887 8.905  1.00 57.64  ? 200  ASP B OD2 1 
ATOM   3564 N N   . PHE B 1 171 ? 11.906  -12.903 12.267 1.00 52.69  ? 201  PHE B N   1 
ATOM   3565 C CA  . PHE B 1 171 ? 10.512  -12.579 12.485 1.00 51.92  ? 201  PHE B CA  1 
ATOM   3566 C C   . PHE B 1 171 ? 10.114  -11.492 11.505 1.00 49.19  ? 201  PHE B C   1 
ATOM   3567 O O   . PHE B 1 171 ? 9.866   -10.353 11.888 1.00 51.20  ? 201  PHE B O   1 
ATOM   3568 C CB  . PHE B 1 171 ? 10.305  -12.122 13.933 1.00 53.66  ? 201  PHE B CB  1 
ATOM   3569 C CG  . PHE B 1 171 ? 8.895   -12.250 14.416 1.00 56.41  ? 201  PHE B CG  1 
ATOM   3570 C CD1 . PHE B 1 171 ? 8.143   -13.384 14.114 1.00 57.67  ? 201  PHE B CD1 1 
ATOM   3571 C CD2 . PHE B 1 171 ? 8.323   -11.244 15.202 1.00 59.94  ? 201  PHE B CD2 1 
ATOM   3572 C CE1 . PHE B 1 171 ? 6.833   -13.512 14.559 1.00 58.15  ? 201  PHE B CE1 1 
ATOM   3573 C CE2 . PHE B 1 171 ? 7.019   -11.364 15.667 1.00 58.41  ? 201  PHE B CE2 1 
ATOM   3574 C CZ  . PHE B 1 171 ? 6.272   -12.502 15.342 1.00 60.41  ? 201  PHE B CZ  1 
ATOM   3575 N N   . VAL B 1 172 ? 10.079  -11.846 10.231 1.00 45.48  ? 202  VAL B N   1 
ATOM   3576 C CA  . VAL B 1 172 ? 9.654   -10.914 9.200  1.00 43.53  ? 202  VAL B CA  1 
ATOM   3577 C C   . VAL B 1 172 ? 8.131   -10.981 9.087  1.00 40.40  ? 202  VAL B C   1 
ATOM   3578 O O   . VAL B 1 172 ? 7.572   -11.918 8.504  1.00 38.59  ? 202  VAL B O   1 
ATOM   3579 C CB  . VAL B 1 172 ? 10.311  -11.220 7.828  1.00 44.41  ? 202  VAL B CB  1 
ATOM   3580 C CG1 . VAL B 1 172 ? 9.919   -10.157 6.821  1.00 42.59  ? 202  VAL B CG1 1 
ATOM   3581 C CG2 . VAL B 1 172 ? 11.837  -11.298 7.968  1.00 43.31  ? 202  VAL B CG2 1 
ATOM   3582 N N   . THR B 1 173 ? 7.474   -9.975  9.651  1.00 36.72  ? 203  THR B N   1 
ATOM   3583 C CA  . THR B 1 173 ? 6.028   -9.982  9.760  1.00 33.24  ? 203  THR B CA  1 
ATOM   3584 C C   . THR B 1 173 ? 5.387   -8.992  8.809  1.00 32.13  ? 203  THR B C   1 
ATOM   3585 O O   . THR B 1 173 ? 6.052   -8.066  8.319  1.00 32.22  ? 203  THR B O   1 
ATOM   3586 C CB  . THR B 1 173 ? 5.551   -9.665  11.201 1.00 32.39  ? 203  THR B CB  1 
ATOM   3587 O OG1 . THR B 1 173 ? 5.852   -8.302  11.518 1.00 30.04  ? 203  THR B OG1 1 
ATOM   3588 C CG2 . THR B 1 173 ? 6.217   -10.589 12.211 1.00 29.36  ? 203  THR B CG2 1 
ATOM   3589 N N   . ASN B 1 174 ? 4.095   -9.196  8.544  1.00 28.58  ? 204  ASN B N   1 
ATOM   3590 C CA  . ASN B 1 174 ? 3.301   -8.182  7.892  1.00 26.03  ? 204  ASN B CA  1 
ATOM   3591 C C   . ASN B 1 174 ? 3.004   -7.075  8.907  1.00 25.54  ? 204  ASN B C   1 
ATOM   3592 O O   . ASN B 1 174 ? 3.113   -7.272  10.114 1.00 22.74  ? 204  ASN B O   1 
ATOM   3593 C CB  . ASN B 1 174 ? 2.013   -8.777  7.298  1.00 26.77  ? 204  ASN B CB  1 
ATOM   3594 C CG  . ASN B 1 174 ? 1.056   -9.312  8.362  1.00 27.50  ? 204  ASN B CG  1 
ATOM   3595 O OD1 . ASN B 1 174 ? 0.561   -8.557  9.209  1.00 27.17  ? 204  ASN B OD1 1 
ATOM   3596 N ND2 . ASN B 1 174 ? 0.783   -10.620 8.311  1.00 16.48  ? 204  ASN B ND2 1 
ATOM   3597 N N   . ARG B 1 175 ? 2.623   -5.915  8.402  1.00 26.58  ? 205  ARG B N   1 
ATOM   3598 C CA  . ARG B 1 175 ? 2.402   -4.755  9.227  1.00 28.07  ? 205  ARG B CA  1 
ATOM   3599 C C   . ARG B 1 175 ? 1.222   -4.892  10.184 1.00 29.18  ? 205  ARG B C   1 
ATOM   3600 O O   . ARG B 1 175 ? 1.317   -4.455  11.338 1.00 31.65  ? 205  ARG B O   1 
ATOM   3601 C CB  . ARG B 1 175 ? 2.235   -3.525  8.356  1.00 28.27  ? 205  ARG B CB  1 
ATOM   3602 C CG  . ARG B 1 175 ? 3.456   -3.236  7.545  1.00 33.76  ? 205  ARG B CG  1 
ATOM   3603 C CD  . ARG B 1 175 ? 3.232   -2.137  6.553  1.00 43.73  ? 205  ARG B CD  1 
ATOM   3604 N NE  . ARG B 1 175 ? 3.949   -2.453  5.323  1.00 57.78  ? 205  ARG B NE  1 
ATOM   3605 C CZ  . ARG B 1 175 ? 5.019   -1.804  4.890  1.00 65.83  ? 205  ARG B CZ  1 
ATOM   3606 N NH1 . ARG B 1 175 ? 5.493   -0.771  5.575  1.00 69.87  ? 205  ARG B NH1 1 
ATOM   3607 N NH2 . ARG B 1 175 ? 5.609   -2.184  3.763  1.00 69.88  ? 205  ARG B NH2 1 
ATOM   3608 N N   . ALA B 1 176 ? 0.133   -5.506  9.725  1.00 26.16  ? 206  ALA B N   1 
ATOM   3609 C CA  . ALA B 1 176 ? -1.046  -5.694  10.569 1.00 26.75  ? 206  ALA B CA  1 
ATOM   3610 C C   . ALA B 1 176 ? -0.709  -6.469  11.845 1.00 26.96  ? 206  ALA B C   1 
ATOM   3611 O O   . ALA B 1 176 ? -1.066  -6.044  12.953 1.00 28.30  ? 206  ALA B O   1 
ATOM   3612 C CB  . ALA B 1 176 ? -2.160  -6.389  9.802  1.00 28.36  ? 206  ALA B CB  1 
ATOM   3613 N N   . TYR B 1 177 ? -0.012  -7.589  11.692 1.00 24.17  ? 207  TYR B N   1 
ATOM   3614 C CA  . TYR B 1 177 ? 0.352   -8.401  12.834 1.00 25.03  ? 207  TYR B CA  1 
ATOM   3615 C C   . TYR B 1 177 ? 1.271   -7.643  13.799 1.00 26.11  ? 207  TYR B C   1 
ATOM   3616 O O   . TYR B 1 177 ? 1.059   -7.670  15.012 1.00 27.56  ? 207  TYR B O   1 
ATOM   3617 C CB  . TYR B 1 177 ? 0.992   -9.726  12.400 1.00 25.49  ? 207  TYR B CB  1 
ATOM   3618 C CG  . TYR B 1 177 ? 1.439   -10.553 13.591 1.00 27.07  ? 207  TYR B CG  1 
ATOM   3619 C CD1 . TYR B 1 177 ? 2.692   -10.345 14.168 1.00 25.11  ? 207  TYR B CD1 1 
ATOM   3620 C CD2 . TYR B 1 177 ? 0.591   -11.512 14.168 1.00 26.03  ? 207  TYR B CD2 1 
ATOM   3621 C CE1 . TYR B 1 177 ? 3.103   -11.057 15.277 1.00 23.49  ? 207  TYR B CE1 1 
ATOM   3622 C CE2 . TYR B 1 177 ? 0.991   -12.248 15.298 1.00 24.97  ? 207  TYR B CE2 1 
ATOM   3623 C CZ  . TYR B 1 177 ? 2.259   -12.012 15.842 1.00 26.91  ? 207  TYR B CZ  1 
ATOM   3624 O OH  . TYR B 1 177 ? 2.708   -12.714 16.938 1.00 19.45  ? 207  TYR B OH  1 
ATOM   3625 N N   . ALA B 1 178 ? 2.288   -6.977  13.255 1.00 26.18  ? 208  ALA B N   1 
ATOM   3626 C CA  . ALA B 1 178 ? 3.224   -6.175  14.052 1.00 24.85  ? 208  ALA B CA  1 
ATOM   3627 C C   . ALA B 1 178 ? 2.488   -5.145  14.924 1.00 24.68  ? 208  ALA B C   1 
ATOM   3628 O O   . ALA B 1 178 ? 2.748   -5.052  16.136 1.00 22.88  ? 208  ALA B O   1 
ATOM   3629 C CB  . ALA B 1 178 ? 4.272   -5.479  13.144 1.00 21.44  ? 208  ALA B CB  1 
ATOM   3630 N N   . ILE B 1 179 ? 1.571   -4.383  14.315 1.00 24.53  ? 209  ILE B N   1 
ATOM   3631 C CA  . ILE B 1 179 ? 0.820   -3.380  15.075 1.00 25.77  ? 209  ILE B CA  1 
ATOM   3632 C C   . ILE B 1 179 ? -0.116  -4.050  16.080 1.00 25.74  ? 209  ILE B C   1 
ATOM   3633 O O   . ILE B 1 179 ? -0.114  -3.688  17.255 1.00 26.88  ? 209  ILE B O   1 
ATOM   3634 C CB  . ILE B 1 179 ? 0.087   -2.361  14.173 1.00 27.62  ? 209  ILE B CB  1 
ATOM   3635 C CG1 . ILE B 1 179 ? 1.112   -1.617  13.296 1.00 30.47  ? 209  ILE B CG1 1 
ATOM   3636 C CG2 . ILE B 1 179 ? -0.701  -1.347  15.024 1.00 25.33  ? 209  ILE B CG2 1 
ATOM   3637 C CD1 . ILE B 1 179 ? 0.548   -1.086  12.016 1.00 35.51  ? 209  ILE B CD1 1 
ATOM   3638 N N   . ALA B 1 180 ? -0.850  -5.066  15.631 1.00 24.65  ? 210  ALA B N   1 
ATOM   3639 C CA  . ALA B 1 180 ? -1.805  -5.765  16.486 1.00 26.75  ? 210  ALA B CA  1 
ATOM   3640 C C   . ALA B 1 180 ? -1.157  -6.506  17.663 1.00 27.82  ? 210  ALA B C   1 
ATOM   3641 O O   . ALA B 1 180 ? -1.559  -6.310  18.807 1.00 30.04  ? 210  ALA B O   1 
ATOM   3642 C CB  . ALA B 1 180 ? -2.682  -6.721  15.663 1.00 28.24  ? 210  ALA B CB  1 
ATOM   3643 N N   . SER B 1 181 ? -0.152  -7.336  17.407 1.00 26.90  ? 211  SER B N   1 
ATOM   3644 C CA  . SER B 1 181 ? 0.501   -8.034  18.513 1.00 29.10  ? 211  SER B CA  1 
ATOM   3645 C C   . SER B 1 181 ? 1.222   -7.084  19.472 1.00 28.74  ? 211  SER B C   1 
ATOM   3646 O O   . SER B 1 181 ? 1.279   -7.340  20.672 1.00 28.89  ? 211  SER B O   1 
ATOM   3647 C CB  . SER B 1 181 ? 1.463   -9.103  18.026 1.00 28.90  ? 211  SER B CB  1 
ATOM   3648 O OG  . SER B 1 181 ? 2.560   -8.481  17.392 1.00 32.90  ? 211  SER B OG  1 
ATOM   3649 N N   . SER B 1 182 ? 1.755   -5.983  18.965 1.00 28.46  ? 212  SER B N   1 
ATOM   3650 C CA  . SER B 1 182 ? 2.359   -4.990  19.856 1.00 31.23  ? 212  SER B CA  1 
ATOM   3651 C C   . SER B 1 182 ? 1.321   -4.364  20.805 1.00 31.71  ? 212  SER B C   1 
ATOM   3652 O O   . SER B 1 182 ? 1.532   -4.293  22.032 1.00 30.60  ? 212  SER B O   1 
ATOM   3653 C CB  . SER B 1 182 ? 3.050   -3.877  19.053 1.00 32.16  ? 212  SER B CB  1 
ATOM   3654 O OG  . SER B 1 182 ? 4.237   -4.329  18.438 1.00 35.04  ? 212  SER B OG  1 
ATOM   3655 N N   . ILE B 1 183 ? 0.209   -3.894  20.229 1.00 30.83  ? 213  ILE B N   1 
ATOM   3656 C CA  . ILE B 1 183 ? -0.864  -3.256  21.003 1.00 29.61  ? 213  ILE B CA  1 
ATOM   3657 C C   . ILE B 1 183 ? -1.516  -4.228  21.990 1.00 28.57  ? 213  ILE B C   1 
ATOM   3658 O O   . ILE B 1 183 ? -1.754  -3.896  23.151 1.00 27.48  ? 213  ILE B O   1 
ATOM   3659 C CB  . ILE B 1 183 ? -1.936  -2.651  20.082 1.00 30.66  ? 213  ILE B CB  1 
ATOM   3660 C CG1 . ILE B 1 183 ? -1.339  -1.483  19.280 1.00 26.45  ? 213  ILE B CG1 1 
ATOM   3661 C CG2 . ILE B 1 183 ? -3.171  -2.214  20.894 1.00 27.39  ? 213  ILE B CG2 1 
ATOM   3662 C CD1 . ILE B 1 183 ? -2.264  -0.911  18.246 1.00 23.77  ? 213  ILE B CD1 1 
ATOM   3663 N N   . ILE B 1 184 ? -1.781  -5.435  21.520 1.00 28.77  ? 214  ILE B N   1 
ATOM   3664 C CA  . ILE B 1 184 ? -2.430  -6.447  22.349 1.00 29.48  ? 214  ILE B CA  1 
ATOM   3665 C C   . ILE B 1 184 ? -1.504  -7.093  23.373 1.00 32.24  ? 214  ILE B C   1 
ATOM   3666 O O   . ILE B 1 184 ? -1.908  -7.265  24.524 1.00 33.25  ? 214  ILE B O   1 
ATOM   3667 C CB  . ILE B 1 184 ? -3.136  -7.512  21.504 1.00 27.19  ? 214  ILE B CB  1 
ATOM   3668 C CG1 . ILE B 1 184 ? -4.410  -6.905  20.910 1.00 24.18  ? 214  ILE B CG1 1 
ATOM   3669 C CG2 . ILE B 1 184 ? -3.453  -8.742  22.351 1.00 23.57  ? 214  ILE B CG2 1 
ATOM   3670 C CD1 . ILE B 1 184 ? -4.745  -7.437  19.546 1.00 30.08  ? 214  ILE B CD1 1 
ATOM   3671 N N   . SER B 1 185 ? -0.281  -7.445  22.975 1.00 31.34  ? 215  SER B N   1 
ATOM   3672 C CA  . SER B 1 185 ? 0.645   -8.029  23.926 1.00 32.25  ? 215  SER B CA  1 
ATOM   3673 C C   . SER B 1 185 ? 1.240   -7.007  24.879 1.00 31.69  ? 215  SER B C   1 
ATOM   3674 O O   . SER B 1 185 ? 1.490   -7.333  26.040 1.00 34.22  ? 215  SER B O   1 
ATOM   3675 C CB  . SER B 1 185 ? 1.759   -8.791  23.214 1.00 34.76  ? 215  SER B CB  1 
ATOM   3676 O OG  . SER B 1 185 ? 1.217   -9.905  22.521 1.00 42.97  ? 215  SER B OG  1 
ATOM   3677 N N   . PHE B 1 186 ? 1.448   -5.771  24.419 1.00 28.69  ? 216  PHE B N   1 
ATOM   3678 C CA  . PHE B 1 186 ? 2.323   -4.867  25.161 1.00 28.39  ? 216  PHE B CA  1 
ATOM   3679 C C   . PHE B 1 186 ? 1.727   -3.495  25.526 1.00 29.19  ? 216  PHE B C   1 
ATOM   3680 O O   . PHE B 1 186 ? 1.641   -3.153  26.706 1.00 30.32  ? 216  PHE B O   1 
ATOM   3681 C CB  . PHE B 1 186 ? 3.690   -4.747  24.452 1.00 25.83  ? 216  PHE B CB  1 
ATOM   3682 C CG  . PHE B 1 186 ? 4.670   -3.830  25.143 1.00 27.94  ? 216  PHE B CG  1 
ATOM   3683 C CD1 . PHE B 1 186 ? 5.432   -4.283  26.224 1.00 27.13  ? 216  PHE B CD1 1 
ATOM   3684 C CD2 . PHE B 1 186 ? 4.851   -2.517  24.692 1.00 29.24  ? 216  PHE B CD2 1 
ATOM   3685 C CE1 . PHE B 1 186 ? 6.343   -3.432  26.862 1.00 24.94  ? 216  PHE B CE1 1 
ATOM   3686 C CE2 . PHE B 1 186 ? 5.755   -1.667  25.317 1.00 30.59  ? 216  PHE B CE2 1 
ATOM   3687 C CZ  . PHE B 1 186 ? 6.500   -2.122  26.408 1.00 27.79  ? 216  PHE B CZ  1 
ATOM   3688 N N   . TYR B 1 187 ? 1.335   -2.707  24.530 1.00 28.31  ? 217  TYR B N   1 
ATOM   3689 C CA  . TYR B 1 187 ? 0.980   -1.311  24.790 1.00 29.29  ? 217  TYR B CA  1 
ATOM   3690 C C   . TYR B 1 187 ? -0.210  -1.108  25.741 1.00 30.62  ? 217  TYR B C   1 
ATOM   3691 O O   . TYR B 1 187 ? -0.176  -0.216  26.605 1.00 27.34  ? 217  TYR B O   1 
ATOM   3692 C CB  . TYR B 1 187 ? 0.784   -0.542  23.482 1.00 29.21  ? 217  TYR B CB  1 
ATOM   3693 C CG  . TYR B 1 187 ? 2.084   -0.181  22.800 1.00 33.14  ? 217  TYR B CG  1 
ATOM   3694 C CD1 . TYR B 1 187 ? 2.922   0.816   23.322 1.00 35.24  ? 217  TYR B CD1 1 
ATOM   3695 C CD2 . TYR B 1 187 ? 2.496   -0.855  21.644 1.00 33.85  ? 217  TYR B CD2 1 
ATOM   3696 C CE1 . TYR B 1 187 ? 4.131   1.140   22.698 1.00 36.66  ? 217  TYR B CE1 1 
ATOM   3697 C CE2 . TYR B 1 187 ? 3.685   -0.538  21.017 1.00 35.20  ? 217  TYR B CE2 1 
ATOM   3698 C CZ  . TYR B 1 187 ? 4.497   0.454   21.545 1.00 36.30  ? 217  TYR B CZ  1 
ATOM   3699 O OH  . TYR B 1 187 ? 5.661   0.756   20.903 1.00 38.42  ? 217  TYR B OH  1 
ATOM   3700 N N   . ILE B 1 188 ? -1.245  -1.939  25.577 1.00 32.02  ? 218  ILE B N   1 
ATOM   3701 C CA  . ILE B 1 188 ? -2.441  -1.874  26.418 1.00 32.46  ? 218  ILE B CA  1 
ATOM   3702 C C   . ILE B 1 188 ? -2.147  -2.283  27.872 1.00 33.17  ? 218  ILE B C   1 
ATOM   3703 O O   . ILE B 1 188 ? -2.407  -1.496  28.787 1.00 34.62  ? 218  ILE B O   1 
ATOM   3704 C CB  . ILE B 1 188 ? -3.613  -2.679  25.821 1.00 32.63  ? 218  ILE B CB  1 
ATOM   3705 C CG1 . ILE B 1 188 ? -4.121  -1.989  24.551 1.00 31.93  ? 218  ILE B CG1 1 
ATOM   3706 C CG2 . ILE B 1 188 ? -4.739  -2.832  26.843 1.00 31.51  ? 218  ILE B CG2 1 
ATOM   3707 C CD1 . ILE B 1 188 ? -5.198  -2.757  23.823 1.00 35.18  ? 218  ILE B CD1 1 
ATOM   3708 N N   . PRO B 1 189 ? -1.584  -3.491  28.098 1.00 32.57  ? 219  PRO B N   1 
ATOM   3709 C CA  . PRO B 1 189 ? -1.249  -3.793  29.479 1.00 31.98  ? 219  PRO B CA  1 
ATOM   3710 C C   . PRO B 1 189 ? -0.295  -2.747  30.060 1.00 31.87  ? 219  PRO B C   1 
ATOM   3711 O O   . PRO B 1 189 ? -0.317  -2.503  31.275 1.00 31.33  ? 219  PRO B O   1 
ATOM   3712 C CB  . PRO B 1 189 ? -0.575  -5.170  29.394 1.00 32.00  ? 219  PRO B CB  1 
ATOM   3713 C CG  . PRO B 1 189 ? -1.010  -5.742  28.136 1.00 30.86  ? 219  PRO B CG  1 
ATOM   3714 C CD  . PRO B 1 189 ? -1.266  -4.618  27.200 1.00 32.91  ? 219  PRO B CD  1 
ATOM   3715 N N   . LEU B 1 190 ? 0.502   -2.110  29.201 1.00 31.27  ? 220  LEU B N   1 
ATOM   3716 C CA  . LEU B 1 190 ? 1.399   -1.060  29.649 1.00 32.42  ? 220  LEU B CA  1 
ATOM   3717 C C   . LEU B 1 190 ? 0.638   0.162   30.147 1.00 33.37  ? 220  LEU B C   1 
ATOM   3718 O O   . LEU B 1 190 ? 0.905   0.655   31.234 1.00 32.95  ? 220  LEU B O   1 
ATOM   3719 C CB  . LEU B 1 190 ? 2.400   -0.672  28.552 1.00 33.55  ? 220  LEU B CB  1 
ATOM   3720 C CG  . LEU B 1 190 ? 3.410   0.416   28.962 1.00 35.48  ? 220  LEU B CG  1 
ATOM   3721 C CD1 . LEU B 1 190 ? 4.572   -0.176  29.764 1.00 35.54  ? 220  LEU B CD1 1 
ATOM   3722 C CD2 . LEU B 1 190 ? 3.895   1.157   27.746 1.00 35.15  ? 220  LEU B CD2 1 
ATOM   3723 N N   . LEU B 1 191 ? -0.315  0.650   29.358 1.00 36.45  ? 221  LEU B N   1 
ATOM   3724 C CA  . LEU B 1 191 ? -1.125  1.785   29.791 1.00 39.69  ? 221  LEU B CA  1 
ATOM   3725 C C   . LEU B 1 191 ? -1.826  1.509   31.123 1.00 40.41  ? 221  LEU B C   1 
ATOM   3726 O O   . LEU B 1 191 ? -1.786  2.341   32.032 1.00 40.86  ? 221  LEU B O   1 
ATOM   3727 C CB  . LEU B 1 191 ? -2.128  2.194   28.715 1.00 41.39  ? 221  LEU B CB  1 
ATOM   3728 C CG  . LEU B 1 191 ? -1.533  2.856   27.460 1.00 46.24  ? 221  LEU B CG  1 
ATOM   3729 C CD1 . LEU B 1 191 ? -2.629  3.140   26.437 1.00 47.36  ? 221  LEU B CD1 1 
ATOM   3730 C CD2 . LEU B 1 191 ? -0.743  4.138   27.775 1.00 45.87  ? 221  LEU B CD2 1 
ATOM   3731 N N   . ILE B 1 192 ? -2.418  0.320   31.245 1.00 40.12  ? 222  ILE B N   1 
ATOM   3732 C CA  . ILE B 1 192 ? -3.065  -0.112  32.484 1.00 39.46  ? 222  ILE B CA  1 
ATOM   3733 C C   . ILE B 1 192 ? -2.073  -0.162  33.652 1.00 42.54  ? 222  ILE B C   1 
ATOM   3734 O O   . ILE B 1 192 ? -2.343  0.405   34.714 1.00 43.45  ? 222  ILE B O   1 
ATOM   3735 C CB  . ILE B 1 192 ? -3.770  -1.483  32.323 1.00 38.57  ? 222  ILE B CB  1 
ATOM   3736 C CG1 . ILE B 1 192 ? -4.880  -1.413  31.267 1.00 34.94  ? 222  ILE B CG1 1 
ATOM   3737 C CG2 . ILE B 1 192 ? -4.354  -1.960  33.645 1.00 35.42  ? 222  ILE B CG2 1 
ATOM   3738 C CD1 . ILE B 1 192 ? -5.264  -2.762  30.696 1.00 23.24  ? 222  ILE B CD1 1 
ATOM   3739 N N   . MET B 1 193 ? -0.931  -0.823  33.459 1.00 44.24  ? 223  MET B N   1 
ATOM   3740 C CA  . MET B 1 193 ? 0.075   -0.920  34.518 1.00 45.84  ? 223  MET B CA  1 
ATOM   3741 C C   . MET B 1 193 ? 0.506   0.459   34.997 1.00 47.82  ? 223  MET B C   1 
ATOM   3742 O O   . MET B 1 193 ? 0.568   0.700   36.203 1.00 50.16  ? 223  MET B O   1 
ATOM   3743 C CB  . MET B 1 193 ? 1.292   -1.711  34.059 1.00 45.64  ? 223  MET B CB  1 
ATOM   3744 C CG  . MET B 1 193 ? 2.267   -2.046  35.168 1.00 48.88  ? 223  MET B CG  1 
ATOM   3745 S SD  . MET B 1 193 ? 3.893   -2.472  34.516 1.00 56.02  ? 223  MET B SD  1 
ATOM   3746 C CE  . MET B 1 193 ? 4.571   -0.857  34.119 1.00 56.11  ? 223  MET B CE  1 
ATOM   3747 N N   . ILE B 1 194 ? 0.783   1.363   34.057 1.00 47.66  ? 224  ILE B N   1 
ATOM   3748 C CA  . ILE B 1 194 ? 1.238   2.710   34.393 1.00 48.30  ? 224  ILE B CA  1 
ATOM   3749 C C   . ILE B 1 194 ? 0.148   3.489   35.147 1.00 48.56  ? 224  ILE B C   1 
ATOM   3750 O O   . ILE B 1 194 ? 0.397   4.057   36.223 1.00 49.68  ? 224  ILE B O   1 
ATOM   3751 C CB  . ILE B 1 194 ? 1.739   3.478   33.140 1.00 48.28  ? 224  ILE B CB  1 
ATOM   3752 C CG1 . ILE B 1 194 ? 3.105   2.940   32.706 1.00 50.30  ? 224  ILE B CG1 1 
ATOM   3753 C CG2 . ILE B 1 194 ? 1.836   4.993   33.411 1.00 47.93  ? 224  ILE B CG2 1 
ATOM   3754 C CD1 . ILE B 1 194 ? 3.498   3.333   31.282 1.00 52.53  ? 224  ILE B CD1 1 
ATOM   3755 N N   . PHE B 1 195 ? -1.056  3.488   34.587 1.00 47.37  ? 225  PHE B N   1 
ATOM   3756 C CA  . PHE B 1 195 ? -2.215  4.127   35.202 1.00 47.16  ? 225  PHE B CA  1 
ATOM   3757 C C   . PHE B 1 195 ? -2.500  3.643   36.642 1.00 45.99  ? 225  PHE B C   1 
ATOM   3758 O O   . PHE B 1 195 ? -2.717  4.467   37.532 1.00 45.82  ? 225  PHE B O   1 
ATOM   3759 C CB  . PHE B 1 195 ? -3.434  3.943   34.293 1.00 48.55  ? 225  PHE B CB  1 
ATOM   3760 C CG  . PHE B 1 195 ? -4.748  4.367   34.909 1.00 53.93  ? 225  PHE B CG  1 
ATOM   3761 C CD1 . PHE B 1 195 ? -5.086  5.720   35.023 1.00 57.15  ? 225  PHE B CD1 1 
ATOM   3762 C CD2 . PHE B 1 195 ? -5.667  3.406   35.338 1.00 55.52  ? 225  PHE B CD2 1 
ATOM   3763 C CE1 . PHE B 1 195 ? -6.304  6.104   35.582 1.00 59.22  ? 225  PHE B CE1 1 
ATOM   3764 C CE2 . PHE B 1 195 ? -6.898  3.779   35.894 1.00 55.97  ? 225  PHE B CE2 1 
ATOM   3765 C CZ  . PHE B 1 195 ? -7.215  5.127   36.016 1.00 58.35  ? 225  PHE B CZ  1 
ATOM   3766 N N   . VAL B 1 196 ? -2.481  2.326   36.867 1.00 44.65  ? 226  VAL B N   1 
ATOM   3767 C CA  . VAL B 1 196 ? -2.711  1.756   38.208 1.00 43.33  ? 226  VAL B CA  1 
ATOM   3768 C C   . VAL B 1 196 ? -1.527  1.973   39.137 1.00 43.98  ? 226  VAL B C   1 
ATOM   3769 O O   . VAL B 1 196 ? -1.713  2.164   40.333 1.00 45.94  ? 226  VAL B O   1 
ATOM   3770 C CB  . VAL B 1 196 ? -3.067  0.239   38.173 1.00 43.14  ? 226  VAL B CB  1 
ATOM   3771 C CG1 . VAL B 1 196 ? -3.175  -0.353  39.588 1.00 41.03  ? 226  VAL B CG1 1 
ATOM   3772 C CG2 . VAL B 1 196 ? -4.355  0.007   37.421 1.00 41.59  ? 226  VAL B CG2 1 
ATOM   3773 N N   . ALA B 1 197 ? -0.313  1.946   38.598 1.00 43.16  ? 227  ALA B N   1 
ATOM   3774 C CA  . ALA B 1 197 ? 0.858   2.202   39.419 1.00 40.98  ? 227  ALA B CA  1 
ATOM   3775 C C   . ALA B 1 197 ? 0.790   3.619   39.974 1.00 40.79  ? 227  ALA B C   1 
ATOM   3776 O O   . ALA B 1 197 ? 1.131   3.842   41.126 1.00 41.97  ? 227  ALA B O   1 
ATOM   3777 C CB  . ALA B 1 197 ? 2.135   1.981   38.624 1.00 39.17  ? 227  ALA B CB  1 
ATOM   3778 N N   . LEU B 1 198 ? 0.335   4.565   39.157 1.00 40.62  ? 228  LEU B N   1 
ATOM   3779 C CA  . LEU B 1 198 ? 0.286   5.959   39.563 1.00 43.51  ? 228  LEU B CA  1 
ATOM   3780 C C   . LEU B 1 198 ? -0.680  6.170   40.732 1.00 45.63  ? 228  LEU B C   1 
ATOM   3781 O O   . LEU B 1 198 ? -0.428  6.970   41.633 1.00 47.38  ? 228  LEU B O   1 
ATOM   3782 C CB  . LEU B 1 198 ? -0.087  6.857   38.376 1.00 44.12  ? 228  LEU B CB  1 
ATOM   3783 C CG  . LEU B 1 198 ? 1.028   7.307   37.413 1.00 45.87  ? 228  LEU B CG  1 
ATOM   3784 C CD1 . LEU B 1 198 ? 0.487   8.263   36.366 1.00 43.18  ? 228  LEU B CD1 1 
ATOM   3785 C CD2 . LEU B 1 198 ? 2.236   7.947   38.130 1.00 48.67  ? 228  LEU B CD2 1 
ATOM   3786 N N   . ARG B 1 199 ? -1.780  5.431   40.704 1.00 46.53  ? 229  ARG B N   1 
ATOM   3787 C CA  . ARG B 1 199 ? -2.774  5.448   41.757 1.00 47.61  ? 229  ARG B CA  1 
ATOM   3788 C C   . ARG B 1 199 ? -2.202  4.895   43.044 1.00 47.03  ? 229  ARG B C   1 
ATOM   3789 O O   . ARG B 1 199 ? -2.347  5.522   44.085 1.00 50.77  ? 229  ARG B O   1 
ATOM   3790 C CB  . ARG B 1 199 ? -4.007  4.635   41.350 1.00 49.16  ? 229  ARG B CB  1 
ATOM   3791 C CG  . ARG B 1 199 ? -4.832  5.246   40.246 1.00 55.68  ? 229  ARG B CG  1 
ATOM   3792 C CD  . ARG B 1 199 ? -5.682  6.389   40.766 1.00 66.20  ? 229  ARG B CD  1 
ATOM   3793 N NE  . ARG B 1 199 ? -6.493  6.987   39.709 1.00 75.30  ? 229  ARG B NE  1 
ATOM   3794 C CZ  . ARG B 1 199 ? -7.006  8.214   39.762 1.00 80.58  ? 229  ARG B CZ  1 
ATOM   3795 N NH1 . ARG B 1 199 ? -6.790  8.992   40.821 1.00 81.00  ? 229  ARG B NH1 1 
ATOM   3796 N NH2 . ARG B 1 199 ? -7.729  8.669   38.747 1.00 82.46  ? 229  ARG B NH2 1 
ATOM   3797 N N   . VAL B 1 200 ? -1.558  3.731   42.982 1.00 44.34  ? 230  VAL B N   1 
ATOM   3798 C CA  . VAL B 1 200 ? -0.932  3.155   44.172 1.00 43.82  ? 230  VAL B CA  1 
ATOM   3799 C C   . VAL B 1 200 ? -0.029  4.211   44.797 1.00 43.03  ? 230  VAL B C   1 
ATOM   3800 O O   . VAL B 1 200 ? -0.103  4.465   45.993 1.00 40.30  ? 230  VAL B O   1 
ATOM   3801 C CB  . VAL B 1 200 ? -0.122  1.862   43.875 1.00 43.07  ? 230  VAL B CB  1 
ATOM   3802 C CG1 . VAL B 1 200 ? 0.591   1.370   45.129 1.00 43.03  ? 230  VAL B CG1 1 
ATOM   3803 C CG2 . VAL B 1 200 ? -1.030  0.770   43.353 1.00 41.69  ? 230  VAL B CG2 1 
ATOM   3804 N N   . TYR B 1 201 ? 0.789   4.843   43.961 1.00 45.00  ? 231  TYR B N   1 
ATOM   3805 C CA  . TYR B 1 201 ? 1.735   5.861   44.402 1.00 47.70  ? 231  TYR B CA  1 
ATOM   3806 C C   . TYR B 1 201 ? 1.044   6.999   45.182 1.00 49.46  ? 231  TYR B C   1 
ATOM   3807 O O   . TYR B 1 201 ? 1.503   7.387   46.276 1.00 47.22  ? 231  TYR B O   1 
ATOM   3808 C CB  . TYR B 1 201 ? 2.494   6.419   43.197 1.00 47.63  ? 231  TYR B CB  1 
ATOM   3809 C CG  . TYR B 1 201 ? 3.463   7.518   43.546 1.00 50.40  ? 231  TYR B CG  1 
ATOM   3810 C CD1 . TYR B 1 201 ? 4.681   7.228   44.154 1.00 54.63  ? 231  TYR B CD1 1 
ATOM   3811 C CD2 . TYR B 1 201 ? 3.159   8.845   43.276 1.00 54.52  ? 231  TYR B CD2 1 
ATOM   3812 C CE1 . TYR B 1 201 ? 5.571   8.226   44.486 1.00 58.59  ? 231  TYR B CE1 1 
ATOM   3813 C CE2 . TYR B 1 201 ? 4.042   9.858   43.602 1.00 59.73  ? 231  TYR B CE2 1 
ATOM   3814 C CZ  . TYR B 1 201 ? 5.249   9.542   44.202 1.00 63.21  ? 231  TYR B CZ  1 
ATOM   3815 O OH  . TYR B 1 201 ? 6.133   10.550  44.524 1.00 68.41  ? 231  TYR B OH  1 
ATOM   3816 N N   . ARG B 1 202 ? -0.047  7.521   44.607 1.00 49.31  ? 232  ARG B N   1 
ATOM   3817 C CA  . ARG B 1 202 ? -0.827  8.580   45.229 1.00 51.07  ? 232  ARG B CA  1 
ATOM   3818 C C   . ARG B 1 202 ? -1.486  8.152   46.533 1.00 50.46  ? 232  ARG B C   1 
ATOM   3819 O O   . ARG B 1 202 ? -1.523  8.920   47.483 1.00 50.75  ? 232  ARG B O   1 
ATOM   3820 C CB  . ARG B 1 202 ? -1.860  9.132   44.258 1.00 52.68  ? 232  ARG B CB  1 
ATOM   3821 C CG  . ARG B 1 202 ? -1.289  10.237  43.407 1.00 61.20  ? 232  ARG B CG  1 
ATOM   3822 C CD  . ARG B 1 202 ? -2.183  10.553  42.239 1.00 69.13  ? 232  ARG B CD  1 
ATOM   3823 N NE  . ARG B 1 202 ? -1.407  11.022  41.095 1.00 74.14  ? 232  ARG B NE  1 
ATOM   3824 C CZ  . ARG B 1 202 ? -1.843  11.006  39.837 1.00 77.88  ? 232  ARG B CZ  1 
ATOM   3825 N NH1 . ARG B 1 202 ? -3.060  10.546  39.553 1.00 76.59  ? 232  ARG B NH1 1 
ATOM   3826 N NH2 . ARG B 1 202 ? -1.061  11.452  38.861 1.00 79.97  ? 232  ARG B NH2 1 
ATOM   3827 N N   . GLU B 1 203 ? -1.986  6.924   46.580 1.00 50.16  ? 233  GLU B N   1 
ATOM   3828 C CA  . GLU B 1 203 ? -2.501  6.354   47.820 1.00 51.08  ? 233  GLU B CA  1 
ATOM   3829 C C   . GLU B 1 203 ? -1.423  6.178   48.878 1.00 49.91  ? 233  GLU B C   1 
ATOM   3830 O O   . GLU B 1 203 ? -1.699  6.311   50.065 1.00 51.58  ? 233  GLU B O   1 
ATOM   3831 C CB  . GLU B 1 203 ? -3.191  5.011   47.562 1.00 51.82  ? 233  GLU B CB  1 
ATOM   3832 C CG  . GLU B 1 203 ? -4.444  5.130   46.718 1.00 58.02  ? 233  GLU B CG  1 
ATOM   3833 C CD  . GLU B 1 203 ? -5.434  6.142   47.275 1.00 64.56  ? 233  GLU B CD  1 
ATOM   3834 O OE1 . GLU B 1 203 ? -5.852  5.983   48.446 1.00 67.69  ? 233  GLU B OE1 1 
ATOM   3835 O OE2 . GLU B 1 203 ? -5.789  7.095   46.544 1.00 64.77  ? 233  GLU B OE2 1 
ATOM   3836 N N   . ALA B 1 204 ? -0.205  5.864   48.450 1.00 49.22  ? 234  ALA B N   1 
ATOM   3837 C CA  . ALA B 1 204 ? 0.919   5.740   49.365 1.00 48.11  ? 234  ALA B CA  1 
ATOM   3838 C C   . ALA B 1 204 ? 1.331   7.106   49.911 1.00 48.89  ? 234  ALA B C   1 
ATOM   3839 O O   . ALA B 1 204 ? 1.651   7.228   51.086 1.00 46.57  ? 234  ALA B O   1 
ATOM   3840 C CB  . ALA B 1 204 ? 2.083   5.054   48.684 1.00 46.63  ? 234  ALA B CB  1 
ATOM   3841 N N   . LYS B 1 205 ? 1.316   8.130   49.056 1.00 52.23  ? 235  LYS B N   1 
ATOM   3842 C CA  . LYS B 1 205 ? 1.667   9.492   49.480 1.00 55.90  ? 235  LYS B CA  1 
ATOM   3843 C C   . LYS B 1 205 ? 0.661   10.049  50.483 1.00 57.42  ? 235  LYS B C   1 
ATOM   3844 O O   . LYS B 1 205 ? 1.012   10.844  51.355 1.00 57.28  ? 235  LYS B O   1 
ATOM   3845 C CB  . LYS B 1 205 ? 1.814   10.445  48.288 1.00 56.33  ? 235  LYS B CB  1 
ATOM   3846 C CG  . LYS B 1 205 ? 3.192   10.401  47.646 1.00 64.03  ? 235  LYS B CG  1 
ATOM   3847 C CD  . LYS B 1 205 ? 3.869   11.774  47.700 1.00 73.10  ? 235  LYS B CD  1 
ATOM   3848 C CE  . LYS B 1 205 ? 5.367   11.679  48.083 1.00 73.41  ? 235  LYS B CE  1 
ATOM   3849 N NZ  . LYS B 1 205 ? 6.000   13.041  48.176 1.00 74.30  ? 235  LYS B NZ  1 
ATOM   3850 N N   . GLU B 1 206 ? -0.592  9.624   50.345 1.00 58.46  ? 236  GLU B N   1 
ATOM   3851 C CA  . GLU B 1 206 ? -1.631  9.967   51.301 1.00 58.57  ? 236  GLU B CA  1 
ATOM   3852 C C   . GLU B 1 206 ? -1.334  9.381   52.679 1.00 57.29  ? 236  GLU B C   1 
ATOM   3853 O O   . GLU B 1 206 ? -1.473  10.069  53.698 1.00 58.32  ? 236  GLU B O   1 
ATOM   3854 C CB  . GLU B 1 206 ? -3.000  9.503   50.810 1.00 59.23  ? 236  GLU B CB  1 
ATOM   3855 C CG  . GLU B 1 206 ? -3.829  10.616  50.188 1.00 67.72  ? 236  GLU B CG  1 
ATOM   3856 C CD  . GLU B 1 206 ? -5.174  10.812  50.904 1.00 76.34  ? 236  GLU B CD  1 
ATOM   3857 O OE1 . GLU B 1 206 ? -6.020  9.881   50.901 1.00 78.17  ? 236  GLU B OE1 1 
ATOM   3858 O OE2 . GLU B 1 206 ? -5.382  11.905  51.476 1.00 78.27  ? 236  GLU B OE2 1 
ATOM   3859 N N   . GLN B 1 207 ? -0.920  8.119   52.706 1.00 54.13  ? 237  GLN B N   1 
ATOM   3860 C CA  . GLN B 1 207 ? -0.564  7.459   53.951 1.00 52.69  ? 237  GLN B CA  1 
ATOM   3861 C C   . GLN B 1 207 ? 0.591   8.114   54.695 1.00 51.37  ? 237  GLN B C   1 
ATOM   3862 O O   . GLN B 1 207 ? 0.773   7.848   55.872 1.00 50.63  ? 237  GLN B O   1 
ATOM   3863 C CB  . GLN B 1 207 ? -0.162  6.025   53.689 1.00 53.72  ? 237  GLN B CB  1 
ATOM   3864 C CG  . GLN B 1 207 ? -1.239  5.117   53.186 1.00 55.29  ? 237  GLN B CG  1 
ATOM   3865 C CD  . GLN B 1 207 ? -0.755  3.689   53.189 1.00 59.38  ? 237  GLN B CD  1 
ATOM   3866 O OE1 . GLN B 1 207 ? 0.181   3.332   52.459 1.00 59.63  ? 237  GLN B OE1 1 
ATOM   3867 N NE2 . GLN B 1 207 ? -1.357  2.868   54.043 1.00 60.25  ? 237  GLN B NE2 1 
ATOM   3868 N N   . ILE B 1 208 ? 1.381   8.945   54.019 1.00 51.88  ? 238  ILE B N   1 
ATOM   3869 C CA  . ILE B 1 208 ? 2.604   9.464   54.647 1.00 53.33  ? 238  ILE B CA  1 
ATOM   3870 C C   . ILE B 1 208 ? 2.415   10.798  55.367 1.00 54.90  ? 238  ILE B C   1 
ATOM   3871 O O   . ILE B 1 208 ? 3.323   11.276  56.056 1.00 55.75  ? 238  ILE B O   1 
ATOM   3872 C CB  . ILE B 1 208 ? 3.878   9.463   53.699 1.00 51.46  ? 238  ILE B CB  1 
ATOM   3873 C CG1 . ILE B 1 208 ? 3.763   10.471  52.553 1.00 51.25  ? 238  ILE B CG1 1 
ATOM   3874 C CG2 . ILE B 1 208 ? 4.170   8.075   53.190 1.00 48.82  ? 238  ILE B CG2 1 
ATOM   3875 C CD1 . ILE B 1 208 ? 4.427   11.810  52.811 1.00 49.24  ? 238  ILE B CD1 1 
ATOM   3876 N N   . ARG B 1 209 ? 1.239   11.397  55.201 1.00 56.65  ? 239  ARG B N   1 
ATOM   3877 C CA  . ARG B 1 209 ? 0.853   12.551  55.999 1.00 58.79  ? 239  ARG B CA  1 
ATOM   3878 C C   . ARG B 1 209 ? 0.733   12.001  57.413 1.00 59.62  ? 239  ARG B C   1 
ATOM   3879 O O   . ARG B 1 209 ? 0.310   10.847  57.597 1.00 61.55  ? 239  ARG B O   1 
ATOM   3880 C CB  . ARG B 1 209 ? -0.490  13.095  55.521 1.00 59.53  ? 239  ARG B CB  1 
ATOM   3881 C CG  . ARG B 1 209 ? -0.557  14.624  55.360 1.00 65.91  ? 239  ARG B CG  1 
ATOM   3882 C CD  . ARG B 1 209 ? -2.011  15.154  55.416 1.00 69.22  ? 239  ARG B CD  1 
ATOM   3883 N NE  . ARG B 1 209 ? -2.971  14.252  54.767 1.00 68.89  ? 239  ARG B NE  1 
ATOM   3884 C CZ  . ARG B 1 209 ? -3.298  14.297  53.477 1.00 67.09  ? 239  ARG B CZ  1 
ATOM   3885 N NH1 . ARG B 1 209 ? -2.758  15.208  52.672 1.00 65.71  ? 239  ARG B NH1 1 
ATOM   3886 N NH2 . ARG B 1 209 ? -4.170  13.428  52.991 1.00 62.28  ? 239  ARG B NH2 1 
ATOM   3887 N N   . LYS B 1 210 ? 1.134   12.784  58.409 1.00 58.20  ? 240  LYS B N   1 
ATOM   3888 C CA  . LYS B 1 210 ? 1.055   12.337  59.813 1.00 58.53  ? 240  LYS B CA  1 
ATOM   3889 C C   . LYS B 1 210 ? 2.107   11.310  60.232 1.00 58.91  ? 240  LYS B C   1 
ATOM   3890 O O   . LYS B 1 210 ? 2.133   10.926  61.399 1.00 59.22  ? 240  LYS B O   1 
ATOM   3891 C CB  . LYS B 1 210 ? -0.328  11.749  60.168 1.00 57.54  ? 240  LYS B CB  1 
ATOM   3892 C CG  . LYS B 1 210 ? -1.508  12.670  59.993 1.00 57.21  ? 240  LYS B CG  1 
ATOM   3893 C CD  . LYS B 1 210 ? -2.772  12.033  60.533 1.00 59.18  ? 240  LYS B CD  1 
ATOM   3894 C CE  . LYS B 1 210 ? -3.985  12.784  60.022 1.00 64.78  ? 240  LYS B CE  1 
ATOM   3895 N NZ  . LYS B 1 210 ? -5.217  12.427  60.784 1.00 69.32  ? 240  LYS B NZ  1 
ATOM   3896 N N   . ILE B 1 211 ? 2.954   10.844  59.316 1.00 59.24  ? 241  ILE B N   1 
ATOM   3897 C CA  . ILE B 1 211 ? 3.927   9.811   59.701 1.00 59.88  ? 241  ILE B CA  1 
ATOM   3898 C C   . ILE B 1 211 ? 5.184   10.348  60.430 1.00 58.83  ? 241  ILE B C   1 
ATOM   3899 O O   . ILE B 1 211 ? 5.777   9.657   61.266 1.00 57.20  ? 241  ILE B O   1 
ATOM   3900 C CB  . ILE B 1 211 ? 4.246   8.820   58.544 1.00 61.38  ? 241  ILE B CB  1 
ATOM   3901 C CG1 . ILE B 1 211 ? 4.324   7.390   59.115 1.00 64.08  ? 241  ILE B CG1 1 
ATOM   3902 C CG2 . ILE B 1 211 ? 5.465   9.274   57.704 1.00 58.82  ? 241  ILE B CG2 1 
ATOM   3903 C CD1 . ILE B 1 211 ? 5.207   6.442   58.338 1.00 70.48  ? 241  ILE B CD1 1 
ATOM   3904 N N   . ASP B 1 212 ? 5.545   11.594  60.130 1.00 59.72  ? 242  ASP B N   1 
ATOM   3905 C CA  . ASP B 1 212 ? 6.570   12.337  60.871 1.00 61.50  ? 242  ASP B CA  1 
ATOM   3906 C C   . ASP B 1 212 ? 6.095   12.767  62.264 1.00 60.20  ? 242  ASP B C   1 
ATOM   3907 O O   . ASP B 1 212 ? 6.720   13.620  62.893 1.00 60.03  ? 242  ASP B O   1 
ATOM   3908 C CB  . ASP B 1 212 ? 6.988   13.600  60.097 1.00 63.57  ? 242  ASP B CB  1 
ATOM   3909 C CG  . ASP B 1 212 ? 7.841   13.296  58.873 1.00 69.89  ? 242  ASP B CG  1 
ATOM   3910 O OD1 . ASP B 1 212 ? 8.263   12.127  58.683 1.00 72.59  ? 242  ASP B OD1 1 
ATOM   3911 O OD2 . ASP B 1 212 ? 8.094   14.249  58.101 1.00 74.53  ? 242  ASP B OD2 1 
ATOM   3912 N N   . ARG B 1 213 ? 4.985   12.204  62.732 1.00 58.43  ? 243  ARG B N   1 
ATOM   3913 C CA  . ARG B 1 213 ? 4.497   12.500  64.067 1.00 57.26  ? 243  ARG B CA  1 
ATOM   3914 C C   . ARG B 1 213 ? 5.294   11.730  65.078 1.00 56.89  ? 243  ARG B C   1 
ATOM   3915 O O   . ARG B 1 213 ? 5.374   10.496  65.010 1.00 57.42  ? 243  ARG B O   1 
ATOM   3916 C CB  . ARG B 1 213 ? 3.023   12.142  64.226 1.00 57.21  ? 243  ARG B CB  1 
ATOM   3917 C CG  . ARG B 1 213 ? 2.083   13.272  63.903 1.00 55.77  ? 243  ARG B CG  1 
ATOM   3918 C CD  . ARG B 1 213 ? 0.672   12.880  64.246 1.00 54.45  ? 243  ARG B CD  1 
ATOM   3919 N NE  . ARG B 1 213 ? -0.291  13.831  63.704 1.00 52.76  ? 243  ARG B NE  1 
ATOM   3920 C CZ  . ARG B 1 213 ? -1.577  13.861  64.033 1.00 52.25  ? 243  ARG B CZ  1 
ATOM   3921 N NH1 . ARG B 1 213 ? -2.072  12.991  64.911 1.00 53.08  ? 243  ARG B NH1 1 
ATOM   3922 N NH2 . ARG B 1 213 ? -2.369  14.764  63.482 1.00 52.22  ? 243  ARG B NH2 1 
ATOM   3923 N N   . ALA B 1 214 ? 5.868   12.460  66.027 1.00 55.84  ? 272  ALA B N   1 
ATOM   3924 C CA  . ALA B 1 214 ? 6.587   11.836  67.121 1.00 55.21  ? 272  ALA B CA  1 
ATOM   3925 C C   . ALA B 1 214 ? 5.702   10.767  67.760 1.00 54.62  ? 272  ALA B C   1 
ATOM   3926 O O   . ALA B 1 214 ? 6.156   9.647   68.001 1.00 54.57  ? 272  ALA B O   1 
ATOM   3927 C CB  . ALA B 1 214 ? 7.014   12.877  68.135 1.00 55.01  ? 272  ALA B CB  1 
ATOM   3928 N N   . SER B 1 215 ? 4.434   11.112  67.987 1.00 54.12  ? 273  SER B N   1 
ATOM   3929 C CA  . SER B 1 215 ? 3.448   10.215  68.608 1.00 53.60  ? 273  SER B CA  1 
ATOM   3930 C C   . SER B 1 215 ? 3.210   8.918   67.840 1.00 53.05  ? 273  SER B C   1 
ATOM   3931 O O   . SER B 1 215 ? 2.499   8.028   68.316 1.00 50.53  ? 273  SER B O   1 
ATOM   3932 C CB  . SER B 1 215 ? 2.114   10.938  68.773 1.00 53.32  ? 273  SER B CB  1 
ATOM   3933 O OG  . SER B 1 215 ? 1.488   11.107  67.518 1.00 56.48  ? 273  SER B OG  1 
ATOM   3934 N N   . LYS B 1 216 ? 3.798   8.815   66.652 1.00 54.01  ? 274  LYS B N   1 
ATOM   3935 C CA  . LYS B 1 216 ? 3.615   7.630   65.819 1.00 55.18  ? 274  LYS B CA  1 
ATOM   3936 C C   . LYS B 1 216 ? 4.914   6.837   65.589 1.00 56.70  ? 274  LYS B C   1 
ATOM   3937 O O   . LYS B 1 216 ? 4.875   5.615   65.459 1.00 58.58  ? 274  LYS B O   1 
ATOM   3938 C CB  . LYS B 1 216 ? 2.914   8.004   64.508 1.00 54.34  ? 274  LYS B CB  1 
ATOM   3939 C CG  . LYS B 1 216 ? 1.498   8.561   64.750 1.00 53.76  ? 274  LYS B CG  1 
ATOM   3940 C CD  . LYS B 1 216 ? 0.739   8.971   63.477 1.00 51.19  ? 274  LYS B CD  1 
ATOM   3941 C CE  . LYS B 1 216 ? 0.055   7.796   62.768 1.00 50.36  ? 274  LYS B CE  1 
ATOM   3942 N NZ  . LYS B 1 216 ? -0.761  6.902   63.654 1.00 49.33  ? 274  LYS B NZ  1 
ATOM   3943 N N   . ARG B 1 217 ? 6.051   7.532   65.631 1.00 56.97  ? 275  ARG B N   1 
ATOM   3944 C CA  . ARG B 1 217 ? 7.341   7.018   65.167 1.00 56.86  ? 275  ARG B CA  1 
ATOM   3945 C C   . ARG B 1 217 ? 7.713   5.588   65.565 1.00 58.60  ? 275  ARG B C   1 
ATOM   3946 O O   . ARG B 1 217 ? 8.313   4.859   64.776 1.00 59.61  ? 275  ARG B O   1 
ATOM   3947 C CB  . ARG B 1 217 ? 8.465   7.988   65.543 1.00 56.19  ? 275  ARG B CB  1 
ATOM   3948 C CG  . ARG B 1 217 ? 9.052   7.783   66.923 1.00 55.41  ? 275  ARG B CG  1 
ATOM   3949 C CD  . ARG B 1 217 ? 10.141  8.806   67.219 1.00 56.46  ? 275  ARG B CD  1 
ATOM   3950 N NE  . ARG B 1 217 ? 10.856  8.459   68.444 1.00 58.45  ? 275  ARG B NE  1 
ATOM   3951 C CZ  . ARG B 1 217 ? 10.395  8.675   69.674 1.00 59.55  ? 275  ARG B CZ  1 
ATOM   3952 N NH1 . ARG B 1 217 ? 9.210   9.252   69.867 1.00 57.71  ? 275  ARG B NH1 1 
ATOM   3953 N NH2 . ARG B 1 217 ? 11.123  8.309   70.719 1.00 61.78  ? 275  ARG B NH2 1 
ATOM   3954 N N   . LYS B 1 218 ? 7.354   5.184   66.774 1.00 60.67  ? 276  LYS B N   1 
ATOM   3955 C CA  . LYS B 1 218 ? 7.860   3.934   67.335 1.00 62.67  ? 276  LYS B CA  1 
ATOM   3956 C C   . LYS B 1 218 ? 7.417   2.661   66.599 1.00 64.20  ? 276  LYS B C   1 
ATOM   3957 O O   . LYS B 1 218 ? 8.227   1.756   66.392 1.00 66.00  ? 276  LYS B O   1 
ATOM   3958 C CB  . LYS B 1 218 ? 7.546   3.857   68.829 1.00 62.49  ? 276  LYS B CB  1 
ATOM   3959 C CG  . LYS B 1 218 ? 8.468   2.959   69.630 1.00 63.12  ? 276  LYS B CG  1 
ATOM   3960 C CD  . LYS B 1 218 ? 7.732   1.723   70.094 1.00 64.84  ? 276  LYS B CD  1 
ATOM   3961 C CE  . LYS B 1 218 ? 8.359   1.163   71.355 1.00 67.26  ? 276  LYS B CE  1 
ATOM   3962 N NZ  . LYS B 1 218 ? 7.436   0.209   72.027 1.00 67.62  ? 276  LYS B NZ  1 
ATOM   3963 N N   . THR B 1 219 ? 6.156   2.588   66.191 1.00 65.11  ? 277  THR B N   1 
ATOM   3964 C CA  . THR B 1 219 ? 5.640   1.357   65.577 1.00 66.53  ? 277  THR B CA  1 
ATOM   3965 C C   . THR B 1 219 ? 4.873   1.603   64.264 1.00 66.97  ? 277  THR B C   1 
ATOM   3966 O O   . THR B 1 219 ? 5.156   0.953   63.247 1.00 66.91  ? 277  THR B O   1 
ATOM   3967 C CB  . THR B 1 219 ? 4.783   0.531   66.581 1.00 67.16  ? 277  THR B CB  1 
ATOM   3968 O OG1 . THR B 1 219 ? 5.385   0.585   67.880 1.00 69.62  ? 277  THR B OG1 1 
ATOM   3969 C CG2 . THR B 1 219 ? 4.663   -0.942  66.136 1.00 67.75  ? 277  THR B CG2 1 
ATOM   3970 N N   . SER B 1 220 ? 3.908   2.528   64.293 1.00 66.15  ? 278  SER B N   1 
ATOM   3971 C CA  . SER B 1 220 ? 3.180   2.942   63.096 1.00 64.80  ? 278  SER B CA  1 
ATOM   3972 C C   . SER B 1 220 ? 4.141   3.286   61.975 1.00 64.78  ? 278  SER B C   1 
ATOM   3973 O O   . SER B 1 220 ? 3.914   2.934   60.811 1.00 63.38  ? 278  SER B O   1 
ATOM   3974 C CB  . SER B 1 220 ? 2.332   4.172   63.388 1.00 64.00  ? 278  SER B CB  1 
ATOM   3975 O OG  . SER B 1 220 ? 1.167   3.817   64.091 1.00 69.97  ? 278  SER B OG  1 
ATOM   3976 N N   . ARG B 1 221 ? 5.219   3.976   62.340 1.00 64.76  ? 279  ARG B N   1 
ATOM   3977 C CA  . ARG B 1 221 ? 6.135   4.510   61.353 1.00 64.50  ? 279  ARG B CA  1 
ATOM   3978 C C   . ARG B 1 221 ? 7.059   3.441   60.768 1.00 64.77  ? 279  ARG B C   1 
ATOM   3979 O O   . ARG B 1 221 ? 7.336   3.447   59.567 1.00 62.11  ? 279  ARG B O   1 
ATOM   3980 C CB  . ARG B 1 221 ? 6.946   5.663   61.933 1.00 64.70  ? 279  ARG B CB  1 
ATOM   3981 C CG  . ARG B 1 221 ? 7.844   6.320   60.923 1.00 64.82  ? 279  ARG B CG  1 
ATOM   3982 C CD  . ARG B 1 221 ? 8.859   7.223   61.566 1.00 72.19  ? 279  ARG B CD  1 
ATOM   3983 N NE  . ARG B 1 221 ? 9.882   7.587   60.594 1.00 77.28  ? 279  ARG B NE  1 
ATOM   3984 C CZ  . ARG B 1 221 ? 9.751   8.550   59.686 1.00 80.11  ? 279  ARG B CZ  1 
ATOM   3985 N NH1 . ARG B 1 221 ? 8.643   9.272   59.621 1.00 82.17  ? 279  ARG B NH1 1 
ATOM   3986 N NH2 . ARG B 1 221 ? 10.737  8.791   58.836 1.00 80.94  ? 279  ARG B NH2 1 
ATOM   3987 N N   . VAL B 1 222 ? 7.530   2.535   61.622 1.00 65.55  ? 280  VAL B N   1 
ATOM   3988 C CA  . VAL B 1 222 ? 8.445   1.488   61.206 1.00 67.54  ? 280  VAL B CA  1 
ATOM   3989 C C   . VAL B 1 222 ? 7.726   0.555   60.220 1.00 68.76  ? 280  VAL B C   1 
ATOM   3990 O O   . VAL B 1 222 ? 8.262   0.229   59.152 1.00 68.67  ? 280  VAL B O   1 
ATOM   3991 C CB  . VAL B 1 222 ? 9.043   0.729   62.434 1.00 67.76  ? 280  VAL B CB  1 
ATOM   3992 C CG1 . VAL B 1 222 ? 9.951   -0.422  61.996 1.00 66.94  ? 280  VAL B CG1 1 
ATOM   3993 C CG2 . VAL B 1 222 ? 9.807   1.702   63.345 1.00 68.69  ? 280  VAL B CG2 1 
ATOM   3994 N N   . MET B 1 223 ? 6.496   0.176   60.569 1.00 69.52  ? 281  MET B N   1 
ATOM   3995 C CA  . MET B 1 223 ? 5.685   -0.743  59.765 1.00 70.03  ? 281  MET B CA  1 
ATOM   3996 C C   . MET B 1 223 ? 5.322   -0.163  58.390 1.00 67.74  ? 281  MET B C   1 
ATOM   3997 O O   . MET B 1 223 ? 5.348   -0.872  57.380 1.00 66.86  ? 281  MET B O   1 
ATOM   3998 C CB  . MET B 1 223 ? 4.417   -1.174  60.527 1.00 72.09  ? 281  MET B CB  1 
ATOM   3999 C CG  . MET B 1 223 ? 4.653   -1.810  61.911 1.00 79.84  ? 281  MET B CG  1 
ATOM   4000 S SD  . MET B 1 223 ? 5.342   -3.492  61.917 1.00 93.37  ? 281  MET B SD  1 
ATOM   4001 C CE  . MET B 1 223 ? 5.378   -3.869  63.682 1.00 92.16  ? 281  MET B CE  1 
ATOM   4002 N N   . LEU B 1 224 ? 4.993   1.124   58.356 1.00 66.42  ? 282  LEU B N   1 
ATOM   4003 C CA  . LEU B 1 224 ? 4.672   1.808   57.101 1.00 65.95  ? 282  LEU B CA  1 
ATOM   4004 C C   . LEU B 1 224 ? 5.898   2.004   56.199 1.00 66.27  ? 282  LEU B C   1 
ATOM   4005 O O   . LEU B 1 224 ? 5.775   1.994   54.974 1.00 66.15  ? 282  LEU B O   1 
ATOM   4006 C CB  . LEU B 1 224 ? 3.974   3.155   57.352 1.00 65.03  ? 282  LEU B CB  1 
ATOM   4007 C CG  . LEU B 1 224 ? 3.211   3.774   56.164 1.00 63.29  ? 282  LEU B CG  1 
ATOM   4008 C CD1 . LEU B 1 224 ? 1.867   3.095   55.962 1.00 62.90  ? 282  LEU B CD1 1 
ATOM   4009 C CD2 . LEU B 1 224 ? 3.006   5.267   56.313 1.00 61.26  ? 282  LEU B CD2 1 
ATOM   4010 N N   . MET B 1 225 ? 7.068   2.196   56.801 1.00 66.50  ? 283  MET B N   1 
ATOM   4011 C CA  . MET B 1 225 ? 8.304   2.326   56.036 1.00 67.04  ? 283  MET B CA  1 
ATOM   4012 C C   . MET B 1 225 ? 8.663   1.007   55.364 1.00 66.14  ? 283  MET B C   1 
ATOM   4013 O O   . MET B 1 225 ? 9.090   0.996   54.215 1.00 64.76  ? 283  MET B O   1 
ATOM   4014 C CB  . MET B 1 225 ? 9.461   2.800   56.921 1.00 68.35  ? 283  MET B CB  1 
ATOM   4015 C CG  . MET B 1 225 ? 9.496   4.302   57.171 1.00 74.56  ? 283  MET B CG  1 
ATOM   4016 S SD  . MET B 1 225 ? 9.864   5.315   55.717 1.00 82.86  ? 283  MET B SD  1 
ATOM   4017 C CE  . MET B 1 225 ? 11.662  5.241   55.685 1.00 85.42  ? 283  MET B CE  1 
ATOM   4018 N N   . ARG B 1 226 ? 8.477   -0.095  56.088 1.00 65.79  ? 284  ARG B N   1 
ATOM   4019 C CA  . ARG B 1 226 ? 8.767   -1.422  55.576 1.00 65.98  ? 284  ARG B CA  1 
ATOM   4020 C C   . ARG B 1 226 ? 7.840   -1.791  54.417 1.00 64.87  ? 284  ARG B C   1 
ATOM   4021 O O   . ARG B 1 226 ? 8.248   -2.491  53.486 1.00 66.17  ? 284  ARG B O   1 
ATOM   4022 C CB  . ARG B 1 226 ? 8.682   -2.466  56.690 1.00 66.80  ? 284  ARG B CB  1 
ATOM   4023 C CG  . ARG B 1 226 ? 9.679   -3.605  56.512 1.00 76.38  ? 284  ARG B CG  1 
ATOM   4024 C CD  . ARG B 1 226 ? 9.262   -4.867  57.250 1.00 86.68  ? 284  ARG B CD  1 
ATOM   4025 N NE  . ARG B 1 226 ? 9.349   -4.729  58.706 1.00 92.83  ? 284  ARG B NE  1 
ATOM   4026 C CZ  . ARG B 1 226 ? 8.949   -5.656  59.577 1.00 95.91  ? 284  ARG B CZ  1 
ATOM   4027 N NH1 . ARG B 1 226 ? 8.424   -6.807  59.156 1.00 96.28  ? 284  ARG B NH1 1 
ATOM   4028 N NH2 . ARG B 1 226 ? 9.071   -5.427  60.878 1.00 96.62  ? 284  ARG B NH2 1 
ATOM   4029 N N   . GLU B 1 227 ? 6.603   -1.307  54.478 1.00 63.72  ? 285  GLU B N   1 
ATOM   4030 C CA  . GLU B 1 227 ? 5.607   -1.525  53.423 1.00 61.41  ? 285  GLU B CA  1 
ATOM   4031 C C   . GLU B 1 227 ? 5.892   -0.688  52.186 1.00 58.79  ? 285  GLU B C   1 
ATOM   4032 O O   . GLU B 1 227 ? 5.650   -1.125  51.065 1.00 59.35  ? 285  GLU B O   1 
ATOM   4033 C CB  . GLU B 1 227 ? 4.202   -1.220  53.940 1.00 61.04  ? 285  GLU B CB  1 
ATOM   4034 C CG  . GLU B 1 227 ? 3.508   -2.420  54.558 1.00 67.47  ? 285  GLU B CG  1 
ATOM   4035 C CD  . GLU B 1 227 ? 2.160   -2.088  55.205 1.00 73.98  ? 285  GLU B CD  1 
ATOM   4036 O OE1 . GLU B 1 227 ? 1.459   -1.168  54.723 1.00 72.42  ? 285  GLU B OE1 1 
ATOM   4037 O OE2 . GLU B 1 227 ? 1.799   -2.761  56.202 1.00 77.29  ? 285  GLU B OE2 1 
ATOM   4038 N N   . HIS B 1 228 ? 6.402   0.518   52.397 1.00 55.45  ? 286  HIS B N   1 
ATOM   4039 C CA  . HIS B 1 228 ? 6.801   1.389   51.297 1.00 52.24  ? 286  HIS B CA  1 
ATOM   4040 C C   . HIS B 1 228 ? 8.100   0.963   50.616 1.00 50.98  ? 286  HIS B C   1 
ATOM   4041 O O   . HIS B 1 228 ? 8.275   1.223   49.426 1.00 49.93  ? 286  HIS B O   1 
ATOM   4042 C CB  . HIS B 1 228 ? 6.877   2.836   51.771 1.00 51.34  ? 286  HIS B CB  1 
ATOM   4043 C CG  . HIS B 1 228 ? 5.537   3.495   51.877 1.00 51.85  ? 286  HIS B CG  1 
ATOM   4044 N ND1 . HIS B 1 228 ? 5.329   4.824   51.578 1.00 51.23  ? 286  HIS B ND1 1 
ATOM   4045 C CD2 . HIS B 1 228 ? 4.327   2.995   52.218 1.00 50.96  ? 286  HIS B CD2 1 
ATOM   4046 C CE1 . HIS B 1 228 ? 4.054   5.117   51.746 1.00 46.70  ? 286  HIS B CE1 1 
ATOM   4047 N NE2 . HIS B 1 228 ? 3.424   4.024   52.131 1.00 47.74  ? 286  HIS B NE2 1 
ATOM   4048 N N   . LYS B 1 229 ? 9.004   0.327   51.369 1.00 49.93  ? 287  LYS B N   1 
ATOM   4049 C CA  . LYS B 1 229 ? 10.194  -0.287  50.791 1.00 49.22  ? 287  LYS B CA  1 
ATOM   4050 C C   . LYS B 1 229 ? 9.731   -1.378  49.814 1.00 48.00  ? 287  LYS B C   1 
ATOM   4051 O O   . LYS B 1 229 ? 10.196  -1.426  48.673 1.00 47.56  ? 287  LYS B O   1 
ATOM   4052 C CB  . LYS B 1 229 ? 11.108  -0.884  51.871 1.00 50.24  ? 287  LYS B CB  1 
ATOM   4053 C CG  . LYS B 1 229 ? 12.574  -1.073  51.436 1.00 54.07  ? 287  LYS B CG  1 
ATOM   4054 C CD  . LYS B 1 229 ? 13.330  -2.043  52.360 1.00 61.53  ? 287  LYS B CD  1 
ATOM   4055 C CE  . LYS B 1 229 ? 14.842  -2.044  52.100 1.00 66.83  ? 287  LYS B CE  1 
ATOM   4056 N NZ  . LYS B 1 229 ? 15.542  -0.842  52.649 1.00 72.86  ? 287  LYS B NZ  1 
ATOM   4057 N N   . ALA B 1 230 ? 8.791   -2.216  50.258 1.00 45.32  ? 288  ALA B N   1 
ATOM   4058 C CA  . ALA B 1 230 ? 8.246   -3.308  49.443 1.00 44.49  ? 288  ALA B CA  1 
ATOM   4059 C C   . ALA B 1 230 ? 7.555   -2.833  48.160 1.00 44.58  ? 288  ALA B C   1 
ATOM   4060 O O   . ALA B 1 230 ? 7.691   -3.456  47.103 1.00 45.04  ? 288  ALA B O   1 
ATOM   4061 C CB  . ALA B 1 230 ? 7.312   -4.170  50.255 1.00 41.70  ? 288  ALA B CB  1 
ATOM   4062 N N   . LEU B 1 231 ? 6.833   -1.724  48.250 1.00 44.87  ? 289  LEU B N   1 
ATOM   4063 C CA  . LEU B 1 231 ? 6.149   -1.161  47.085 1.00 45.27  ? 289  LEU B CA  1 
ATOM   4064 C C   . LEU B 1 231 ? 7.106   -0.558  46.072 1.00 45.61  ? 289  LEU B C   1 
ATOM   4065 O O   . LEU B 1 231 ? 6.881   -0.662  44.863 1.00 45.65  ? 289  LEU B O   1 
ATOM   4066 C CB  . LEU B 1 231 ? 5.153   -0.086  47.503 1.00 44.75  ? 289  LEU B CB  1 
ATOM   4067 C CG  . LEU B 1 231 ? 3.773   -0.480  48.022 1.00 42.59  ? 289  LEU B CG  1 
ATOM   4068 C CD1 . LEU B 1 231 ? 2.960   0.787   48.230 1.00 41.16  ? 289  LEU B CD1 1 
ATOM   4069 C CD2 . LEU B 1 231 ? 3.057   -1.402  47.063 1.00 40.99  ? 289  LEU B CD2 1 
ATOM   4070 N N   . LYS B 1 232 ? 8.152   0.098   46.578 1.00 45.38  ? 290  LYS B N   1 
ATOM   4071 C CA  . LYS B 1 232 ? 9.222   0.652   45.744 1.00 44.14  ? 290  LYS B CA  1 
ATOM   4072 C C   . LYS B 1 232 ? 9.913   -0.469  44.951 1.00 41.55  ? 290  LYS B C   1 
ATOM   4073 O O   . LYS B 1 232 ? 10.219  -0.291  43.784 1.00 40.65  ? 290  LYS B O   1 
ATOM   4074 C CB  . LYS B 1 232 ? 10.229  1.409   46.609 1.00 44.44  ? 290  LYS B CB  1 
ATOM   4075 C CG  . LYS B 1 232 ? 10.958  2.527   45.891 1.00 51.45  ? 290  LYS B CG  1 
ATOM   4076 C CD  . LYS B 1 232 ? 11.886  3.291   46.836 1.00 60.65  ? 290  LYS B CD  1 
ATOM   4077 C CE  . LYS B 1 232 ? 12.804  4.248   46.082 1.00 62.96  ? 290  LYS B CE  1 
ATOM   4078 N NZ  . LYS B 1 232 ? 14.095  4.445   46.817 1.00 69.02  ? 290  LYS B NZ  1 
ATOM   4079 N N   . THR B 1 233 ? 10.119  -1.623  45.591 1.00 39.48  ? 291  THR B N   1 
ATOM   4080 C CA  . THR B 1 233 ? 10.708  -2.786  44.951 1.00 38.75  ? 291  THR B CA  1 
ATOM   4081 C C   . THR B 1 233 ? 9.867   -3.212  43.745 1.00 41.47  ? 291  THR B C   1 
ATOM   4082 O O   . THR B 1 233 ? 10.411  -3.478  42.670 1.00 40.94  ? 291  THR B O   1 
ATOM   4083 C CB  . THR B 1 233 ? 10.886  -3.958  45.944 1.00 38.69  ? 291  THR B CB  1 
ATOM   4084 O OG1 . THR B 1 233 ? 11.674  -3.529  47.060 1.00 35.72  ? 291  THR B OG1 1 
ATOM   4085 C CG2 . THR B 1 233 ? 11.579  -5.155  45.279 1.00 35.89  ? 291  THR B CG2 1 
ATOM   4086 N N   . LEU B 1 234 ? 8.542   -3.232  43.915 1.00 42.51  ? 292  LEU B N   1 
ATOM   4087 C CA  . LEU B 1 234 ? 7.611   -3.547  42.821 1.00 39.92  ? 292  LEU B CA  1 
ATOM   4088 C C   . LEU B 1 234 ? 7.583   -2.475  41.747 1.00 39.80  ? 292  LEU B C   1 
ATOM   4089 O O   . LEU B 1 234 ? 7.514   -2.779  40.556 1.00 41.19  ? 292  LEU B O   1 
ATOM   4090 C CB  . LEU B 1 234 ? 6.204   -3.773  43.357 1.00 40.08  ? 292  LEU B CB  1 
ATOM   4091 C CG  . LEU B 1 234 ? 6.053   -4.992  44.277 1.00 41.99  ? 292  LEU B CG  1 
ATOM   4092 C CD1 . LEU B 1 234 ? 4.662   -5.021  44.883 1.00 39.23  ? 292  LEU B CD1 1 
ATOM   4093 C CD2 . LEU B 1 234 ? 6.380   -6.320  43.571 1.00 39.01  ? 292  LEU B CD2 1 
ATOM   4094 N N   . GLY B 1 235 ? 7.635   -1.217  42.159 1.00 38.97  ? 293  GLY B N   1 
ATOM   4095 C CA  . GLY B 1 235 ? 7.742   -0.121  41.206 1.00 37.55  ? 293  GLY B CA  1 
ATOM   4096 C C   . GLY B 1 235 ? 8.960   -0.297  40.330 1.00 38.73  ? 293  GLY B C   1 
ATOM   4097 O O   . GLY B 1 235 ? 8.855   -0.134  39.119 1.00 37.27  ? 293  GLY B O   1 
ATOM   4098 N N   . ILE B 1 236 ? 10.100  -0.653  40.950 1.00 39.93  ? 294  ILE B N   1 
ATOM   4099 C CA  . ILE B 1 236 ? 11.384  -0.866  40.245 1.00 39.85  ? 294  ILE B CA  1 
ATOM   4100 C C   . ILE B 1 236 ? 11.271  -2.018  39.224 1.00 39.71  ? 294  ILE B C   1 
ATOM   4101 O O   . ILE B 1 236 ? 11.672  -1.878  38.059 1.00 40.40  ? 294  ILE B O   1 
ATOM   4102 C CB  . ILE B 1 236 ? 12.580  -1.083  41.242 1.00 39.79  ? 294  ILE B CB  1 
ATOM   4103 C CG1 . ILE B 1 236 ? 12.875  0.198   42.041 1.00 37.83  ? 294  ILE B CG1 1 
ATOM   4104 C CG2 . ILE B 1 236 ? 13.841  -1.531  40.503 1.00 37.99  ? 294  ILE B CG2 1 
ATOM   4105 C CD1 . ILE B 1 236 ? 13.706  -0.029  43.294 1.00 39.72  ? 294  ILE B CD1 1 
ATOM   4106 N N   . ILE B 1 237 ? 10.688  -3.134  39.664 1.00 38.25  ? 295  ILE B N   1 
ATOM   4107 C CA  . ILE B 1 237 ? 10.441  -4.290  38.807 1.00 37.32  ? 295  ILE B CA  1 
ATOM   4108 C C   . ILE B 1 237 ? 9.681   -3.880  37.548 1.00 37.40  ? 295  ILE B C   1 
ATOM   4109 O O   . ILE B 1 237 ? 10.043  -4.279  36.461 1.00 39.31  ? 295  ILE B O   1 
ATOM   4110 C CB  . ILE B 1 237 ? 9.663   -5.373  39.555 1.00 36.87  ? 295  ILE B CB  1 
ATOM   4111 C CG1 . ILE B 1 237 ? 10.529  -6.017  40.638 1.00 41.05  ? 295  ILE B CG1 1 
ATOM   4112 C CG2 . ILE B 1 237 ? 9.096   -6.402  38.607 1.00 38.35  ? 295  ILE B CG2 1 
ATOM   4113 C CD1 . ILE B 1 237 ? 11.705  -6.786  40.152 1.00 45.62  ? 295  ILE B CD1 1 
ATOM   4114 N N   . MET B 1 238 ? 8.657   -3.052  37.706 1.00 38.64  ? 296  MET B N   1 
ATOM   4115 C CA  . MET B 1 238 ? 7.832   -2.571  36.585 1.00 37.43  ? 296  MET B CA  1 
ATOM   4116 C C   . MET B 1 238 ? 8.554   -1.536  35.743 1.00 37.93  ? 296  MET B C   1 
ATOM   4117 O O   . MET B 1 238 ? 8.337   -1.454  34.535 1.00 38.62  ? 296  MET B O   1 
ATOM   4118 C CB  . MET B 1 238 ? 6.523   -1.959  37.100 1.00 36.41  ? 296  MET B CB  1 
ATOM   4119 C CG  . MET B 1 238 ? 5.681   -2.912  37.923 1.00 37.22  ? 296  MET B CG  1 
ATOM   4120 S SD  . MET B 1 238 ? 4.293   -2.068  38.694 1.00 44.27  ? 296  MET B SD  1 
ATOM   4121 C CE  . MET B 1 238 ? 3.643   -3.375  39.749 1.00 33.49  ? 296  MET B CE  1 
ATOM   4122 N N   . GLY B 1 239 ? 9.402   -0.736  36.382 1.00 38.34  ? 297  GLY B N   1 
ATOM   4123 C CA  . GLY B 1 239 ? 10.135  0.306   35.678 1.00 37.91  ? 297  GLY B CA  1 
ATOM   4124 C C   . GLY B 1 239 ? 11.221  -0.302  34.821 1.00 36.88  ? 297  GLY B C   1 
ATOM   4125 O O   . GLY B 1 239 ? 11.372  0.040   33.648 1.00 36.73  ? 297  GLY B O   1 
ATOM   4126 N N   . VAL B 1 240 ? 11.967  -1.227  35.405 1.00 36.30  ? 298  VAL B N   1 
ATOM   4127 C CA  . VAL B 1 240 ? 13.046  -1.870  34.671 1.00 36.51  ? 298  VAL B CA  1 
ATOM   4128 C C   . VAL B 1 240 ? 12.479  -2.657  33.462 1.00 35.53  ? 298  VAL B C   1 
ATOM   4129 O O   . VAL B 1 240 ? 12.981  -2.539  32.337 1.00 34.76  ? 298  VAL B O   1 
ATOM   4130 C CB  . VAL B 1 240 ? 13.927  -2.719  35.617 1.00 35.68  ? 298  VAL B CB  1 
ATOM   4131 C CG1 . VAL B 1 240 ? 14.885  -3.610  34.822 1.00 33.86  ? 298  VAL B CG1 1 
ATOM   4132 C CG2 . VAL B 1 240 ? 14.698  -1.793  36.572 1.00 30.51  ? 298  VAL B CG2 1 
ATOM   4133 N N   . PHE B 1 241 ? 11.411  -3.415  33.705 1.00 33.79  ? 299  PHE B N   1 
ATOM   4134 C CA  . PHE B 1 241 ? 10.712  -4.148  32.655 1.00 31.27  ? 299  PHE B CA  1 
ATOM   4135 C C   . PHE B 1 241 ? 10.274  -3.266  31.480 1.00 32.28  ? 299  PHE B C   1 
ATOM   4136 O O   . PHE B 1 241 ? 10.478  -3.628  30.325 1.00 33.19  ? 299  PHE B O   1 
ATOM   4137 C CB  . PHE B 1 241 ? 9.507   -4.881  33.225 1.00 28.27  ? 299  PHE B CB  1 
ATOM   4138 C CG  . PHE B 1 241 ? 8.746   -5.669  32.196 1.00 26.78  ? 299  PHE B CG  1 
ATOM   4139 C CD1 . PHE B 1 241 ? 7.797   -5.039  31.348 1.00 23.26  ? 299  PHE B CD1 1 
ATOM   4140 C CD2 . PHE B 1 241 ? 8.967   -7.032  32.067 1.00 19.76  ? 299  PHE B CD2 1 
ATOM   4141 C CE1 . PHE B 1 241 ? 7.095   -5.767  30.387 1.00 20.58  ? 299  PHE B CE1 1 
ATOM   4142 C CE2 . PHE B 1 241 ? 8.281   -7.772  31.109 1.00 24.27  ? 299  PHE B CE2 1 
ATOM   4143 C CZ  . PHE B 1 241 ? 7.326   -7.136  30.261 1.00 22.29  ? 299  PHE B CZ  1 
ATOM   4144 N N   . THR B 1 242 ? 9.655   -2.128  31.773 1.00 33.31  ? 300  THR B N   1 
ATOM   4145 C CA  . THR B 1 242 ? 9.310   -1.142  30.744 1.00 33.86  ? 300  THR B CA  1 
ATOM   4146 C C   . THR B 1 242 ? 10.570  -0.678  29.977 1.00 36.19  ? 300  THR B C   1 
ATOM   4147 O O   . THR B 1 242 ? 10.572  -0.650  28.739 1.00 34.87  ? 300  THR B O   1 
ATOM   4148 C CB  . THR B 1 242 ? 8.571   0.074   31.374 1.00 33.54  ? 300  THR B CB  1 
ATOM   4149 O OG1 . THR B 1 242 ? 7.436   -0.393  32.102 1.00 29.39  ? 300  THR B OG1 1 
ATOM   4150 C CG2 . THR B 1 242 ? 8.114   1.091   30.329 1.00 30.87  ? 300  THR B CG2 1 
ATOM   4151 N N   . LEU B 1 243 ? 11.639  -0.346  30.714 1.00 37.84  ? 301  LEU B N   1 
ATOM   4152 C CA  . LEU B 1 243 ? 12.887  0.114   30.104 1.00 38.32  ? 301  LEU B CA  1 
ATOM   4153 C C   . LEU B 1 243 ? 13.505  -0.965  29.234 1.00 37.52  ? 301  LEU B C   1 
ATOM   4154 O O   . LEU B 1 243 ? 14.058  -0.657  28.189 1.00 37.08  ? 301  LEU B O   1 
ATOM   4155 C CB  . LEU B 1 243 ? 13.898  0.574   31.156 1.00 40.39  ? 301  LEU B CB  1 
ATOM   4156 C CG  . LEU B 1 243 ? 13.592  1.798   32.025 1.00 44.62  ? 301  LEU B CG  1 
ATOM   4157 C CD1 . LEU B 1 243 ? 14.735  1.970   33.038 1.00 50.15  ? 301  LEU B CD1 1 
ATOM   4158 C CD2 . LEU B 1 243 ? 13.381  3.072   31.195 1.00 44.69  ? 301  LEU B CD2 1 
ATOM   4159 N N   . CYS B 1 244 ? 13.408  -2.222  29.658 1.00 35.93  ? 302  CYS B N   1 
ATOM   4160 C CA  . CYS B 1 244 ? 13.985  -3.305  28.884 1.00 36.18  ? 302  CYS B CA  1 
ATOM   4161 C C   . CYS B 1 244 ? 13.218  -3.628  27.594 1.00 36.96  ? 302  CYS B C   1 
ATOM   4162 O O   . CYS B 1 244 ? 13.821  -4.083  26.617 1.00 38.18  ? 302  CYS B O   1 
ATOM   4163 C CB  . CYS B 1 244 ? 14.167  -4.564  29.732 1.00 37.42  ? 302  CYS B CB  1 
ATOM   4164 S SG  . CYS B 1 244 ? 15.483  -4.464  30.993 1.00 42.69  ? 302  CYS B SG  1 
ATOM   4165 N N   . TRP B 1 245 ? 11.905  -3.399  27.575 1.00 35.52  ? 303  TRP B N   1 
ATOM   4166 C CA  . TRP B 1 245 ? 11.077  -3.838  26.438 1.00 31.40  ? 303  TRP B CA  1 
ATOM   4167 C C   . TRP B 1 245 ? 10.541  -2.700  25.569 1.00 31.20  ? 303  TRP B C   1 
ATOM   4168 O O   . TRP B 1 245 ? 10.311  -2.879  24.385 1.00 32.26  ? 303  TRP B O   1 
ATOM   4169 C CB  . TRP B 1 245 ? 9.921   -4.702  26.924 1.00 28.01  ? 303  TRP B CB  1 
ATOM   4170 C CG  . TRP B 1 245 ? 10.280  -6.126  27.200 1.00 25.53  ? 303  TRP B CG  1 
ATOM   4171 C CD1 . TRP B 1 245 ? 10.313  -6.733  28.416 1.00 21.68  ? 303  TRP B CD1 1 
ATOM   4172 C CD2 . TRP B 1 245 ? 10.640  -7.143  26.232 1.00 21.13  ? 303  TRP B CD2 1 
ATOM   4173 N NE1 . TRP B 1 245 ? 10.671  -8.061  28.273 1.00 19.47  ? 303  TRP B NE1 1 
ATOM   4174 C CE2 . TRP B 1 245 ? 10.873  -8.334  26.945 1.00 13.94  ? 303  TRP B CE2 1 
ATOM   4175 C CE3 . TRP B 1 245 ? 10.794  -7.151  24.836 1.00 21.85  ? 303  TRP B CE3 1 
ATOM   4176 C CZ2 . TRP B 1 245 ? 11.252  -9.523  26.319 1.00 15.94  ? 303  TRP B CZ2 1 
ATOM   4177 C CZ3 . TRP B 1 245 ? 11.174  -8.341  24.212 1.00 21.05  ? 303  TRP B CZ3 1 
ATOM   4178 C CH2 . TRP B 1 245 ? 11.391  -9.513  24.956 1.00 12.81  ? 303  TRP B CH2 1 
ATOM   4179 N N   . LEU B 1 246 ? 10.323  -1.530  26.146 1.00 30.47  ? 304  LEU B N   1 
ATOM   4180 C CA  . LEU B 1 246 ? 9.879   -0.401  25.343 1.00 30.88  ? 304  LEU B CA  1 
ATOM   4181 C C   . LEU B 1 246 ? 10.770  -0.143  24.100 1.00 33.97  ? 304  LEU B C   1 
ATOM   4182 O O   . LEU B 1 246 ? 10.230  0.049   23.001 1.00 36.20  ? 304  LEU B O   1 
ATOM   4183 C CB  . LEU B 1 246 ? 9.709   0.862   26.205 1.00 29.47  ? 304  LEU B CB  1 
ATOM   4184 C CG  . LEU B 1 246 ? 9.124   2.150   25.611 1.00 30.77  ? 304  LEU B CG  1 
ATOM   4185 C CD1 . LEU B 1 246 ? 7.836   1.914   24.798 1.00 30.52  ? 304  LEU B CD1 1 
ATOM   4186 C CD2 . LEU B 1 246 ? 8.903   3.218   26.708 1.00 29.91  ? 304  LEU B CD2 1 
ATOM   4187 N N   . PRO B 1 247 ? 12.127  -0.133  24.244 1.00 35.23  ? 305  PRO B N   1 
ATOM   4188 C CA  . PRO B 1 247 ? 12.857  0.216   23.018 1.00 34.79  ? 305  PRO B CA  1 
ATOM   4189 C C   . PRO B 1 247 ? 12.465  -0.717  21.862 1.00 34.59  ? 305  PRO B C   1 
ATOM   4190 O O   . PRO B 1 247 ? 12.136  -0.226  20.775 1.00 33.17  ? 305  PRO B O   1 
ATOM   4191 C CB  . PRO B 1 247 ? 14.330  0.041   23.413 1.00 34.30  ? 305  PRO B CB  1 
ATOM   4192 C CG  . PRO B 1 247 ? 14.349  0.244   24.878 1.00 35.38  ? 305  PRO B CG  1 
ATOM   4193 C CD  . PRO B 1 247 ? 13.059  -0.386  25.360 1.00 36.10  ? 305  PRO B CD  1 
ATOM   4194 N N   . PHE B 1 248 ? 12.448  -2.033  22.111 1.00 33.08  ? 306  PHE B N   1 
ATOM   4195 C CA  . PHE B 1 248 ? 12.064  -2.992  21.084 1.00 32.05  ? 306  PHE B CA  1 
ATOM   4196 C C   . PHE B 1 248 ? 10.702  -2.712  20.495 1.00 33.78  ? 306  PHE B C   1 
ATOM   4197 O O   . PHE B 1 248 ? 10.580  -2.602  19.274 1.00 37.15  ? 306  PHE B O   1 
ATOM   4198 C CB  . PHE B 1 248 ? 12.066  -4.412  21.590 1.00 32.49  ? 306  PHE B CB  1 
ATOM   4199 C CG  . PHE B 1 248 ? 11.551  -5.402  20.577 1.00 33.87  ? 306  PHE B CG  1 
ATOM   4200 C CD1 . PHE B 1 248 ? 12.382  -5.881  19.580 1.00 31.07  ? 306  PHE B CD1 1 
ATOM   4201 C CD2 . PHE B 1 248 ? 10.219  -5.845  20.615 1.00 39.12  ? 306  PHE B CD2 1 
ATOM   4202 C CE1 . PHE B 1 248 ? 11.911  -6.793  18.639 1.00 34.57  ? 306  PHE B CE1 1 
ATOM   4203 C CE2 . PHE B 1 248 ? 9.728   -6.771  19.668 1.00 36.41  ? 306  PHE B CE2 1 
ATOM   4204 C CZ  . PHE B 1 248 ? 10.581  -7.249  18.683 1.00 32.89  ? 306  PHE B CZ  1 
ATOM   4205 N N   . PHE B 1 249 ? 9.682   -2.600  21.351 1.00 30.62  ? 307  PHE B N   1 
ATOM   4206 C CA  . PHE B 1 249 ? 8.324   -2.338  20.881 1.00 27.69  ? 307  PHE B CA  1 
ATOM   4207 C C   . PHE B 1 249 ? 8.111   -0.996  20.182 1.00 28.39  ? 307  PHE B C   1 
ATOM   4208 O O   . PHE B 1 249 ? 7.221   -0.888  19.344 1.00 27.71  ? 307  PHE B O   1 
ATOM   4209 C CB  . PHE B 1 249 ? 7.294   -2.543  21.994 1.00 27.23  ? 307  PHE B CB  1 
ATOM   4210 C CG  . PHE B 1 249 ? 7.016   -3.967  22.266 1.00 19.55  ? 307  PHE B CG  1 
ATOM   4211 C CD1 . PHE B 1 249 ? 6.405   -4.746  21.299 1.00 14.36  ? 307  PHE B CD1 1 
ATOM   4212 C CD2 . PHE B 1 249 ? 7.420   -4.556  23.461 1.00 20.52  ? 307  PHE B CD2 1 
ATOM   4213 C CE1 . PHE B 1 249 ? 6.178   -6.088  21.514 1.00 13.45  ? 307  PHE B CE1 1 
ATOM   4214 C CE2 . PHE B 1 249 ? 7.191   -5.925  23.710 1.00 15.17  ? 307  PHE B CE2 1 
ATOM   4215 C CZ  . PHE B 1 249 ? 6.575   -6.692  22.725 1.00 12.43  ? 307  PHE B CZ  1 
ATOM   4216 N N   . LEU B 1 250 ? 8.893   0.025   20.527 1.00 30.30  ? 308  LEU B N   1 
ATOM   4217 C CA  . LEU B 1 250 ? 8.892   1.270   19.741 1.00 31.79  ? 308  LEU B CA  1 
ATOM   4218 C C   . LEU B 1 250 ? 9.430   0.961   18.346 1.00 32.11  ? 308  LEU B C   1 
ATOM   4219 O O   . LEU B 1 250 ? 8.809   1.268   17.331 1.00 30.42  ? 308  LEU B O   1 
ATOM   4220 C CB  . LEU B 1 250 ? 9.735   2.358   20.418 1.00 32.51  ? 308  LEU B CB  1 
ATOM   4221 C CG  . LEU B 1 250 ? 9.161   3.194   21.583 1.00 35.51  ? 308  LEU B CG  1 
ATOM   4222 C CD1 . LEU B 1 250 ? 10.228  4.186   22.117 1.00 32.36  ? 308  LEU B CD1 1 
ATOM   4223 C CD2 . LEU B 1 250 ? 7.821   3.925   21.244 1.00 24.66  ? 308  LEU B CD2 1 
ATOM   4224 N N   . VAL B 1 251 ? 10.578  0.302   18.309 1.00 34.57  ? 309  VAL B N   1 
ATOM   4225 C CA  . VAL B 1 251 ? 11.205  -0.071  17.039 1.00 37.31  ? 309  VAL B CA  1 
ATOM   4226 C C   . VAL B 1 251 ? 10.294  -0.970  16.166 1.00 37.56  ? 309  VAL B C   1 
ATOM   4227 O O   . VAL B 1 251 ? 10.206  -0.790  14.961 1.00 36.67  ? 309  VAL B O   1 
ATOM   4228 C CB  . VAL B 1 251 ? 12.643  -0.632  17.283 1.00 36.86  ? 309  VAL B CB  1 
ATOM   4229 C CG1 . VAL B 1 251 ? 12.970  -1.789  16.375 1.00 35.04  ? 309  VAL B CG1 1 
ATOM   4230 C CG2 . VAL B 1 251 ? 13.652  0.489   17.145 1.00 32.14  ? 309  VAL B CG2 1 
ATOM   4231 N N   . ASN B 1 252 ? 9.600   -1.913  16.798 1.00 38.92  ? 310  ASN B N   1 
ATOM   4232 C CA  . ASN B 1 252 ? 8.693   -2.825  16.104 1.00 38.58  ? 310  ASN B CA  1 
ATOM   4233 C C   . ASN B 1 252 ? 7.649   -2.054  15.298 1.00 39.40  ? 310  ASN B C   1 
ATOM   4234 O O   . ASN B 1 252 ? 7.277   -2.461  14.213 1.00 40.05  ? 310  ASN B O   1 
ATOM   4235 C CB  . ASN B 1 252 ? 8.014   -3.759  17.116 1.00 38.15  ? 310  ASN B CB  1 
ATOM   4236 C CG  . ASN B 1 252 ? 7.354   -4.970  16.460 1.00 40.32  ? 310  ASN B CG  1 
ATOM   4237 O OD1 . ASN B 1 252 ? 7.816   -5.467  15.436 1.00 44.86  ? 310  ASN B OD1 1 
ATOM   4238 N ND2 . ASN B 1 252 ? 6.282   -5.462  17.066 1.00 34.46  ? 310  ASN B ND2 1 
ATOM   4239 N N   . ILE B 1 253 ? 7.214   -0.921  15.839 1.00 40.18  ? 311  ILE B N   1 
ATOM   4240 C CA  . ILE B 1 253 ? 6.176   -0.103  15.255 1.00 40.70  ? 311  ILE B CA  1 
ATOM   4241 C C   . ILE B 1 253 ? 6.750   0.778   14.159 1.00 44.02  ? 311  ILE B C   1 
ATOM   4242 O O   . ILE B 1 253 ? 6.141   0.911   13.102 1.00 46.59  ? 311  ILE B O   1 
ATOM   4243 C CB  . ILE B 1 253 ? 5.474   0.764   16.350 1.00 41.60  ? 311  ILE B CB  1 
ATOM   4244 C CG1 . ILE B 1 253 ? 4.655   -0.125  17.308 1.00 42.73  ? 311  ILE B CG1 1 
ATOM   4245 C CG2 . ILE B 1 253 ? 4.629   1.917   15.745 1.00 38.02  ? 311  ILE B CG2 1 
ATOM   4246 C CD1 . ILE B 1 253 ? 3.474   -0.885  16.659 1.00 42.66  ? 311  ILE B CD1 1 
ATOM   4247 N N   . VAL B 1 254 ? 7.917   1.376   14.400 1.00 45.19  ? 312  VAL B N   1 
ATOM   4248 C CA  . VAL B 1 254 ? 8.530   2.290   13.420 1.00 44.66  ? 312  VAL B CA  1 
ATOM   4249 C C   . VAL B 1 254 ? 8.924   1.566   12.128 1.00 45.48  ? 312  VAL B C   1 
ATOM   4250 O O   . VAL B 1 254 ? 8.899   2.154   11.048 1.00 43.09  ? 312  VAL B O   1 
ATOM   4251 C CB  . VAL B 1 254 ? 9.731   3.069   14.010 1.00 44.83  ? 312  VAL B CB  1 
ATOM   4252 C CG1 . VAL B 1 254 ? 10.418  3.910   12.927 1.00 42.70  ? 312  VAL B CG1 1 
ATOM   4253 C CG2 . VAL B 1 254 ? 9.275   3.959   15.181 1.00 39.99  ? 312  VAL B CG2 1 
ATOM   4254 N N   . ASN B 1 255 ? 9.260   0.284   12.243 1.00 47.40  ? 313  ASN B N   1 
ATOM   4255 C CA  . ASN B 1 255 ? 9.442   -0.566  11.072 1.00 50.75  ? 313  ASN B CA  1 
ATOM   4256 C C   . ASN B 1 255 ? 8.265   -0.605  10.109 1.00 51.69  ? 313  ASN B C   1 
ATOM   4257 O O   . ASN B 1 255 ? 8.441   -0.862  8.916  1.00 52.71  ? 313  ASN B O   1 
ATOM   4258 C CB  . ASN B 1 255 ? 9.751   -1.987  11.488 1.00 52.69  ? 313  ASN B CB  1 
ATOM   4259 C CG  . ASN B 1 255 ? 11.140  -2.381  11.132 1.00 57.83  ? 313  ASN B CG  1 
ATOM   4260 O OD1 . ASN B 1 255 ? 11.802  -1.690  10.358 1.00 61.67  ? 313  ASN B OD1 1 
ATOM   4261 N ND2 . ASN B 1 255 ? 11.606  -3.498  11.686 1.00 62.95  ? 313  ASN B ND2 1 
ATOM   4262 N N   . VAL B 1 256 ? 7.068   -0.374  10.638 1.00 51.01  ? 314  VAL B N   1 
ATOM   4263 C CA  . VAL B 1 256 ? 5.854   -0.408  9.843  1.00 49.60  ? 314  VAL B CA  1 
ATOM   4264 C C   . VAL B 1 256 ? 5.822   0.804   8.906  1.00 50.51  ? 314  VAL B C   1 
ATOM   4265 O O   . VAL B 1 256 ? 5.519   0.674   7.725  1.00 50.04  ? 314  VAL B O   1 
ATOM   4266 C CB  . VAL B 1 256 ? 4.599   -0.484  10.760 1.00 49.00  ? 314  VAL B CB  1 
ATOM   4267 C CG1 . VAL B 1 256 ? 3.314   -0.260  9.974  1.00 46.11  ? 314  VAL B CG1 1 
ATOM   4268 C CG2 . VAL B 1 256 ? 4.565   -1.815  11.533 1.00 44.33  ? 314  VAL B CG2 1 
ATOM   4269 N N   . PHE B 1 257 ? 6.177   1.969   9.434  1.00 52.73  ? 315  PHE B N   1 
ATOM   4270 C CA  . PHE B 1 257 ? 6.124   3.222   8.670  1.00 55.44  ? 315  PHE B CA  1 
ATOM   4271 C C   . PHE B 1 257 ? 7.389   3.541   7.858  1.00 57.83  ? 315  PHE B C   1 
ATOM   4272 O O   . PHE B 1 257 ? 7.313   4.307   6.903  1.00 58.55  ? 315  PHE B O   1 
ATOM   4273 C CB  . PHE B 1 257 ? 5.719   4.398   9.578  1.00 54.80  ? 315  PHE B CB  1 
ATOM   4274 C CG  . PHE B 1 257 ? 4.382   4.205   10.241 1.00 55.89  ? 315  PHE B CG  1 
ATOM   4275 C CD1 . PHE B 1 257 ? 3.195   4.412   9.530  1.00 58.98  ? 315  PHE B CD1 1 
ATOM   4276 C CD2 . PHE B 1 257 ? 4.299   3.779   11.563 1.00 56.58  ? 315  PHE B CD2 1 
ATOM   4277 C CE1 . PHE B 1 257 ? 1.936   4.208   10.137 1.00 58.50  ? 315  PHE B CE1 1 
ATOM   4278 C CE2 . PHE B 1 257 ? 3.050   3.573   12.180 1.00 57.00  ? 315  PHE B CE2 1 
ATOM   4279 C CZ  . PHE B 1 257 ? 1.867   3.786   11.462 1.00 55.59  ? 315  PHE B CZ  1 
ATOM   4280 N N   . ASN B 1 258 ? 8.530   2.951   8.234  1.00 61.32  ? 316  ASN B N   1 
ATOM   4281 C CA  . ASN B 1 258 ? 9.809   3.088   7.510  1.00 62.85  ? 316  ASN B CA  1 
ATOM   4282 C C   . ASN B 1 258 ? 10.701  1.849   7.679  1.00 64.22  ? 316  ASN B C   1 
ATOM   4283 O O   . ASN B 1 258 ? 11.319  1.655   8.738  1.00 63.12  ? 316  ASN B O   1 
ATOM   4284 C CB  . ASN B 1 258 ? 10.559  4.338   7.992  1.00 64.09  ? 316  ASN B CB  1 
ATOM   4285 C CG  . ASN B 1 258 ? 11.456  4.946   6.918  1.00 64.22  ? 316  ASN B CG  1 
ATOM   4286 O OD1 . ASN B 1 258 ? 12.301  4.271   6.319  1.00 62.29  ? 316  ASN B OD1 1 
ATOM   4287 N ND2 . ASN B 1 258 ? 11.276  6.238   6.682  1.00 63.78  ? 316  ASN B ND2 1 
ATOM   4288 N N   . ARG B 1 259 ? 10.772  1.015   6.639  1.00 66.80  ? 317  ARG B N   1 
ATOM   4289 C CA  . ARG B 1 259 ? 11.545  -0.237  6.706  1.00 69.56  ? 317  ARG B CA  1 
ATOM   4290 C C   . ARG B 1 259 ? 13.065  -0.029  6.715  1.00 69.64  ? 317  ARG B C   1 
ATOM   4291 O O   . ARG B 1 259 ? 13.809  -0.900  7.170  1.00 69.89  ? 317  ARG B O   1 
ATOM   4292 C CB  . ARG B 1 259 ? 11.120  -1.239  5.617  1.00 70.72  ? 317  ARG B CB  1 
ATOM   4293 C CG  . ARG B 1 259 ? 9.662   -1.676  5.741  1.00 77.14  ? 317  ARG B CG  1 
ATOM   4294 C CD  . ARG B 1 259 ? 9.475   -3.201  5.812  1.00 85.64  ? 317  ARG B CD  1 
ATOM   4295 N NE  . ARG B 1 259 ? 8.176   -3.538  6.417  1.00 91.41  ? 317  ARG B NE  1 
ATOM   4296 C CZ  . ARG B 1 259 ? 7.768   -4.763  6.757  1.00 94.00  ? 317  ARG B CZ  1 
ATOM   4297 N NH1 . ARG B 1 259 ? 8.535   -5.836  6.562  1.00 94.71  ? 317  ARG B NH1 1 
ATOM   4298 N NH2 . ARG B 1 259 ? 6.569   -4.916  7.297  1.00 94.54  ? 317  ARG B NH2 1 
ATOM   4299 N N   . ASP B 1 260 ? 13.512  1.129   6.231  1.00 69.72  ? 318  ASP B N   1 
ATOM   4300 C CA  . ASP B 1 260 ? 14.924  1.499   6.278  1.00 69.53  ? 318  ASP B CA  1 
ATOM   4301 C C   . ASP B 1 260 ? 15.391  1.988   7.646  1.00 68.46  ? 318  ASP B C   1 
ATOM   4302 O O   . ASP B 1 260 ? 16.395  1.500   8.169  1.00 70.23  ? 318  ASP B O   1 
ATOM   4303 C CB  . ASP B 1 260 ? 15.250  2.554   5.214  1.00 70.74  ? 318  ASP B CB  1 
ATOM   4304 C CG  . ASP B 1 260 ? 16.090  1.996   4.066  1.00 75.81  ? 318  ASP B CG  1 
ATOM   4305 O OD1 . ASP B 1 260 ? 16.734  0.930   4.226  1.00 76.41  ? 318  ASP B OD1 1 
ATOM   4306 O OD2 . ASP B 1 260 ? 16.119  2.642   2.995  1.00 80.98  ? 318  ASP B OD2 1 
ATOM   4307 N N   . LEU B 1 261 ? 14.654  2.933   8.224  1.00 66.16  ? 319  LEU B N   1 
ATOM   4308 C CA  . LEU B 1 261 ? 15.126  3.728   9.367  1.00 65.09  ? 319  LEU B CA  1 
ATOM   4309 C C   . LEU B 1 261 ? 15.945  3.014   10.443 1.00 64.64  ? 319  LEU B C   1 
ATOM   4310 O O   . LEU B 1 261 ? 16.907  3.576   10.951 1.00 65.99  ? 319  LEU B O   1 
ATOM   4311 C CB  . LEU B 1 261 ? 13.967  4.495   10.023 1.00 65.00  ? 319  LEU B CB  1 
ATOM   4312 C CG  . LEU B 1 261 ? 14.326  5.769   10.802 1.00 65.84  ? 319  LEU B CG  1 
ATOM   4313 C CD1 . LEU B 1 261 ? 14.826  6.880   9.864  1.00 68.59  ? 319  LEU B CD1 1 
ATOM   4314 C CD2 . LEU B 1 261 ? 13.147  6.267   11.621 1.00 64.37  ? 319  LEU B CD2 1 
ATOM   4315 N N   . VAL B 1 262 ? 15.566  1.791   10.800 1.00 63.35  ? 320  VAL B N   1 
ATOM   4316 C CA  . VAL B 1 262 ? 16.227  1.098   11.907 1.00 61.47  ? 320  VAL B CA  1 
ATOM   4317 C C   . VAL B 1 262 ? 17.094  -0.071  11.436 1.00 60.55  ? 320  VAL B C   1 
ATOM   4318 O O   . VAL B 1 262 ? 16.611  -0.971  10.740 1.00 60.77  ? 320  VAL B O   1 
ATOM   4319 C CB  . VAL B 1 262 ? 15.217  0.703   13.030 1.00 61.67  ? 320  VAL B CB  1 
ATOM   4320 C CG1 . VAL B 1 262 ? 15.647  -0.555  13.780 1.00 61.88  ? 320  VAL B CG1 1 
ATOM   4321 C CG2 . VAL B 1 262 ? 15.060  1.855   14.000 1.00 60.87  ? 320  VAL B CG2 1 
ATOM   4322 N N   . PRO B 1 263 ? 18.391  -0.047  11.801 1.00 59.12  ? 321  PRO B N   1 
ATOM   4323 C CA  . PRO B 1 263 ? 19.273  -1.128  11.381 1.00 58.04  ? 321  PRO B CA  1 
ATOM   4324 C C   . PRO B 1 263 ? 18.890  -2.499  11.957 1.00 58.28  ? 321  PRO B C   1 
ATOM   4325 O O   . PRO B 1 263 ? 18.514  -2.627  13.128 1.00 58.37  ? 321  PRO B O   1 
ATOM   4326 C CB  . PRO B 1 263 ? 20.667  -0.674  11.854 1.00 56.63  ? 321  PRO B CB  1 
ATOM   4327 C CG  . PRO B 1 263 ? 20.448  0.440   12.797 1.00 56.18  ? 321  PRO B CG  1 
ATOM   4328 C CD  . PRO B 1 263 ? 19.127  1.055   12.457 1.00 58.91  ? 321  PRO B CD  1 
ATOM   4329 N N   . ASP B 1 264 ? 18.975  -3.497  11.088 1.00 58.51  ? 322  ASP B N   1 
ATOM   4330 C CA  . ASP B 1 264 ? 18.736  -4.901  11.382 1.00 59.68  ? 322  ASP B CA  1 
ATOM   4331 C C   . ASP B 1 264 ? 19.331  -5.368  12.727 1.00 59.08  ? 322  ASP B C   1 
ATOM   4332 O O   . ASP B 1 264 ? 18.668  -6.057  13.498 1.00 60.61  ? 322  ASP B O   1 
ATOM   4333 C CB  . ASP B 1 264 ? 19.327  -5.718  10.224 1.00 61.16  ? 322  ASP B CB  1 
ATOM   4334 C CG  . ASP B 1 264 ? 18.612  -7.032  9.997  1.00 68.41  ? 322  ASP B CG  1 
ATOM   4335 O OD1 . ASP B 1 264 ? 18.713  -7.934  10.865 1.00 74.78  ? 322  ASP B OD1 1 
ATOM   4336 O OD2 . ASP B 1 264 ? 17.967  -7.173  8.928  1.00 72.21  ? 322  ASP B OD2 1 
ATOM   4337 N N   . TRP B 1 265 ? 20.578  -4.989  12.997 1.00 57.78  ? 323  TRP B N   1 
ATOM   4338 C CA  . TRP B 1 265 ? 21.286  -5.393  14.212 1.00 55.22  ? 323  TRP B CA  1 
ATOM   4339 C C   . TRP B 1 265 ? 20.706  -4.744  15.478 1.00 53.12  ? 323  TRP B C   1 
ATOM   4340 O O   . TRP B 1 265 ? 20.772  -5.333  16.563 1.00 53.02  ? 323  TRP B O   1 
ATOM   4341 C CB  . TRP B 1 265 ? 22.804  -5.105  14.092 1.00 55.31  ? 323  TRP B CB  1 
ATOM   4342 C CG  . TRP B 1 265 ? 23.163  -3.645  13.822 1.00 56.07  ? 323  TRP B CG  1 
ATOM   4343 C CD1 . TRP B 1 265 ? 23.351  -3.065  12.600 1.00 55.28  ? 323  TRP B CD1 1 
ATOM   4344 C CD2 . TRP B 1 265 ? 23.375  -2.600  14.798 1.00 60.58  ? 323  TRP B CD2 1 
ATOM   4345 N NE1 . TRP B 1 265 ? 23.668  -1.731  12.748 1.00 59.65  ? 323  TRP B NE1 1 
ATOM   4346 C CE2 . TRP B 1 265 ? 23.683  -1.415  14.082 1.00 62.24  ? 323  TRP B CE2 1 
ATOM   4347 C CE3 . TRP B 1 265 ? 23.331  -2.547  16.203 1.00 61.62  ? 323  TRP B CE3 1 
ATOM   4348 C CZ2 . TRP B 1 265 ? 23.946  -0.188  14.724 1.00 62.65  ? 323  TRP B CZ2 1 
ATOM   4349 C CZ3 . TRP B 1 265 ? 23.591  -1.322  16.842 1.00 62.02  ? 323  TRP B CZ3 1 
ATOM   4350 C CH2 . TRP B 1 265 ? 23.894  -0.164  16.098 1.00 62.32  ? 323  TRP B CH2 1 
ATOM   4351 N N   . LEU B 1 266 ? 20.144  -3.542  15.338 1.00 50.30  ? 324  LEU B N   1 
ATOM   4352 C CA  . LEU B 1 266 ? 19.609  -2.796  16.480 1.00 49.48  ? 324  LEU B CA  1 
ATOM   4353 C C   . LEU B 1 266 ? 18.297  -3.415  16.973 1.00 49.08  ? 324  LEU B C   1 
ATOM   4354 O O   . LEU B 1 266 ? 18.083  -3.595  18.180 1.00 50.43  ? 324  LEU B O   1 
ATOM   4355 C CB  . LEU B 1 266 ? 19.430  -1.309  16.136 1.00 48.41  ? 324  LEU B CB  1 
ATOM   4356 C CG  . LEU B 1 266 ? 19.199  -0.371  17.329 1.00 47.80  ? 324  LEU B CG  1 
ATOM   4357 C CD1 . LEU B 1 266 ? 20.405  -0.314  18.259 1.00 45.59  ? 324  LEU B CD1 1 
ATOM   4358 C CD2 . LEU B 1 266 ? 18.803  1.019   16.864 1.00 48.05  ? 324  LEU B CD2 1 
ATOM   4359 N N   . PHE B 1 267 ? 17.434  -3.734  16.018 1.00 47.44  ? 325  PHE B N   1 
ATOM   4360 C CA  . PHE B 1 267 ? 16.231  -4.509  16.245 1.00 46.87  ? 325  PHE B CA  1 
ATOM   4361 C C   . PHE B 1 267 ? 16.561  -5.761  17.080 1.00 45.52  ? 325  PHE B C   1 
ATOM   4362 O O   . PHE B 1 267 ? 15.975  -5.978  18.138 1.00 45.44  ? 325  PHE B O   1 
ATOM   4363 C CB  . PHE B 1 267 ? 15.644  -4.884  14.877 1.00 47.24  ? 325  PHE B CB  1 
ATOM   4364 C CG  . PHE B 1 267 ? 14.309  -5.558  14.935 1.00 49.70  ? 325  PHE B CG  1 
ATOM   4365 C CD1 . PHE B 1 267 ? 14.216  -6.943  15.134 1.00 50.20  ? 325  PHE B CD1 1 
ATOM   4366 C CD2 . PHE B 1 267 ? 13.137  -4.820  14.755 1.00 52.43  ? 325  PHE B CD2 1 
ATOM   4367 C CE1 . PHE B 1 267 ? 12.977  -7.580  15.174 1.00 48.97  ? 325  PHE B CE1 1 
ATOM   4368 C CE2 . PHE B 1 267 ? 11.885  -5.440  14.792 1.00 50.02  ? 325  PHE B CE2 1 
ATOM   4369 C CZ  . PHE B 1 267 ? 11.801  -6.818  14.999 1.00 50.89  ? 325  PHE B CZ  1 
ATOM   4370 N N   . VAL B 1 268 ? 17.514  -6.565  16.609 1.00 42.93  ? 326  VAL B N   1 
ATOM   4371 C CA  . VAL B 1 268 ? 17.931  -7.776  17.323 1.00 40.33  ? 326  VAL B CA  1 
ATOM   4372 C C   . VAL B 1 268 ? 18.520  -7.481  18.698 1.00 40.48  ? 326  VAL B C   1 
ATOM   4373 O O   . VAL B 1 268 ? 18.300  -8.245  19.649 1.00 41.30  ? 326  VAL B O   1 
ATOM   4374 C CB  . VAL B 1 268 ? 18.917  -8.623  16.490 1.00 37.88  ? 326  VAL B CB  1 
ATOM   4375 C CG1 . VAL B 1 268 ? 19.487  -9.761  17.319 1.00 35.01  ? 326  VAL B CG1 1 
ATOM   4376 C CG2 . VAL B 1 268 ? 18.206  -9.181  15.275 1.00 38.16  ? 326  VAL B CG2 1 
ATOM   4377 N N   . ALA B 1 269 ? 19.265  -6.380  18.803 1.00 39.98  ? 327  ALA B N   1 
ATOM   4378 C CA  . ALA B 1 269 ? 19.811  -5.942  20.094 1.00 40.11  ? 327  ALA B CA  1 
ATOM   4379 C C   . ALA B 1 269 ? 18.689  -5.616  21.092 1.00 37.95  ? 327  ALA B C   1 
ATOM   4380 O O   . ALA B 1 269 ? 18.649  -6.135  22.217 1.00 35.86  ? 327  ALA B O   1 
ATOM   4381 C CB  . ALA B 1 269 ? 20.714  -4.738  19.902 1.00 41.39  ? 327  ALA B CB  1 
ATOM   4382 N N   . PHE B 1 270 ? 17.769  -4.767  20.652 1.00 36.59  ? 328  PHE B N   1 
ATOM   4383 C CA  . PHE B 1 270 ? 16.636  -4.375  21.477 1.00 36.16  ? 328  PHE B CA  1 
ATOM   4384 C C   . PHE B 1 270 ? 15.798  -5.563  21.964 1.00 34.22  ? 328  PHE B C   1 
ATOM   4385 O O   . PHE B 1 270 ? 15.209  -5.510  23.037 1.00 36.54  ? 328  PHE B O   1 
ATOM   4386 C CB  . PHE B 1 270 ? 15.800  -3.322  20.756 1.00 34.64  ? 328  PHE B CB  1 
ATOM   4387 C CG  . PHE B 1 270 ? 16.413  -1.937  20.786 1.00 39.26  ? 328  PHE B CG  1 
ATOM   4388 C CD1 . PHE B 1 270 ? 17.248  -1.543  21.839 1.00 42.28  ? 328  PHE B CD1 1 
ATOM   4389 C CD2 . PHE B 1 270 ? 16.152  -1.019  19.772 1.00 38.64  ? 328  PHE B CD2 1 
ATOM   4390 C CE1 . PHE B 1 270 ? 17.801  -0.254  21.878 1.00 38.76  ? 328  PHE B CE1 1 
ATOM   4391 C CE2 . PHE B 1 270 ? 16.696  0.266   19.814 1.00 36.27  ? 328  PHE B CE2 1 
ATOM   4392 C CZ  . PHE B 1 270 ? 17.519  0.647   20.866 1.00 34.94  ? 328  PHE B CZ  1 
ATOM   4393 N N   . ASN B 1 271 ? 15.799  -6.645  21.202 1.00 30.59  ? 329  ASN B N   1 
ATOM   4394 C CA  . ASN B 1 271 ? 15.107  -7.851  21.588 1.00 30.31  ? 329  ASN B CA  1 
ATOM   4395 C C   . ASN B 1 271 ? 15.909  -8.634  22.602 1.00 32.07  ? 329  ASN B C   1 
ATOM   4396 O O   . ASN B 1 271 ? 15.328  -9.320  23.454 1.00 34.42  ? 329  ASN B O   1 
ATOM   4397 C CB  . ASN B 1 271 ? 14.813  -8.715  20.363 1.00 30.10  ? 329  ASN B CB  1 
ATOM   4398 C CG  . ASN B 1 271 ? 13.703  -9.759  20.604 1.00 32.93  ? 329  ASN B CG  1 
ATOM   4399 O OD1 . ASN B 1 271 ? 12.972  -10.100 19.669 1.00 31.18  ? 329  ASN B OD1 1 
ATOM   4400 N ND2 . ASN B 1 271 ? 13.595  -10.288 21.839 1.00 26.41  ? 329  ASN B ND2 1 
ATOM   4401 N N   . TRP B 1 272 ? 17.237  -8.555  22.512 1.00 31.86  ? 330  TRP B N   1 
ATOM   4402 C CA  . TRP B 1 272 ? 18.104  -9.176  23.528 1.00 31.52  ? 330  TRP B CA  1 
ATOM   4403 C C   . TRP B 1 272 ? 18.041  -8.420  24.854 1.00 31.88  ? 330  TRP B C   1 
ATOM   4404 O O   . TRP B 1 272 ? 18.135  -9.037  25.934 1.00 32.44  ? 330  TRP B O   1 
ATOM   4405 C CB  . TRP B 1 272 ? 19.566  -9.344  23.033 1.00 31.87  ? 330  TRP B CB  1 
ATOM   4406 C CG  . TRP B 1 272 ? 19.727  -10.632 22.280 1.00 25.45  ? 330  TRP B CG  1 
ATOM   4407 C CD1 . TRP B 1 272 ? 19.653  -10.811 20.918 1.00 23.56  ? 330  TRP B CD1 1 
ATOM   4408 C CD2 . TRP B 1 272 ? 19.908  -11.930 22.847 1.00 18.62  ? 330  TRP B CD2 1 
ATOM   4409 N NE1 . TRP B 1 272 ? 19.790  -12.147 20.608 1.00 24.77  ? 330  TRP B NE1 1 
ATOM   4410 C CE2 . TRP B 1 272 ? 19.941  -12.857 21.771 1.00 18.39  ? 330  TRP B CE2 1 
ATOM   4411 C CE3 . TRP B 1 272 ? 20.037  -12.406 24.160 1.00 18.92  ? 330  TRP B CE3 1 
ATOM   4412 C CZ2 . TRP B 1 272 ? 20.117  -14.218 21.963 1.00 21.06  ? 330  TRP B CZ2 1 
ATOM   4413 C CZ3 . TRP B 1 272 ? 20.197  -13.775 24.358 1.00 21.44  ? 330  TRP B CZ3 1 
ATOM   4414 C CH2 . TRP B 1 272 ? 20.244  -14.666 23.257 1.00 26.52  ? 330  TRP B CH2 1 
ATOM   4415 N N   . LEU B 1 273 ? 17.888  -7.091  24.775 1.00 29.76  ? 331  LEU B N   1 
ATOM   4416 C CA  . LEU B 1 273 ? 17.706  -6.303  25.985 1.00 30.12  ? 331  LEU B CA  1 
ATOM   4417 C C   . LEU B 1 273 ? 16.447  -6.816  26.711 1.00 32.52  ? 331  LEU B C   1 
ATOM   4418 O O   . LEU B 1 273 ? 16.420  -6.936  27.952 1.00 35.53  ? 331  LEU B O   1 
ATOM   4419 C CB  . LEU B 1 273 ? 17.622  -4.808  25.679 1.00 28.21  ? 331  LEU B CB  1 
ATOM   4420 C CG  . LEU B 1 273 ? 17.345  -3.863  26.852 1.00 25.77  ? 331  LEU B CG  1 
ATOM   4421 C CD1 . LEU B 1 273 ? 18.339  -4.023  27.989 1.00 26.10  ? 331  LEU B CD1 1 
ATOM   4422 C CD2 . LEU B 1 273 ? 17.286  -2.419  26.375 1.00 25.59  ? 331  LEU B CD2 1 
ATOM   4423 N N   . GLY B 1 274 ? 15.425  -7.142  25.923 1.00 29.93  ? 332  GLY B N   1 
ATOM   4424 C CA  . GLY B 1 274 ? 14.225  -7.759  26.432 1.00 28.62  ? 332  GLY B CA  1 
ATOM   4425 C C   . GLY B 1 274 ? 14.514  -9.063  27.150 1.00 30.13  ? 332  GLY B C   1 
ATOM   4426 O O   . GLY B 1 274 ? 14.050  -9.274  28.277 1.00 30.57  ? 332  GLY B O   1 
ATOM   4427 N N   . TYR B 1 275 ? 15.273  -9.948  26.510 1.00 30.19  ? 333  TYR B N   1 
ATOM   4428 C CA  . TYR B 1 275 ? 15.598  -11.218 27.134 1.00 31.89  ? 333  TYR B CA  1 
ATOM   4429 C C   . TYR B 1 275 ? 16.347  -11.008 28.439 1.00 32.18  ? 333  TYR B C   1 
ATOM   4430 O O   . TYR B 1 275 ? 16.140  -11.740 29.415 1.00 31.34  ? 333  TYR B O   1 
ATOM   4431 C CB  . TYR B 1 275 ? 16.452  -12.070 26.215 1.00 35.06  ? 333  TYR B CB  1 
ATOM   4432 C CG  . TYR B 1 275 ? 15.795  -12.526 24.931 1.00 40.33  ? 333  TYR B CG  1 
ATOM   4433 C CD1 . TYR B 1 275 ? 14.393  -12.468 24.754 1.00 37.21  ? 333  TYR B CD1 1 
ATOM   4434 C CD2 . TYR B 1 275 ? 16.580  -13.025 23.881 1.00 42.14  ? 333  TYR B CD2 1 
ATOM   4435 C CE1 . TYR B 1 275 ? 13.791  -12.907 23.569 1.00 34.13  ? 333  TYR B CE1 1 
ATOM   4436 C CE2 . TYR B 1 275 ? 15.989  -13.457 22.693 1.00 46.26  ? 333  TYR B CE2 1 
ATOM   4437 C CZ  . TYR B 1 275 ? 14.591  -13.398 22.551 1.00 42.67  ? 333  TYR B CZ  1 
ATOM   4438 O OH  . TYR B 1 275 ? 14.032  -13.833 21.383 1.00 42.75  ? 333  TYR B OH  1 
ATOM   4439 N N   . ALA B 1 276 ? 17.220  -9.997  28.436 1.00 33.03  ? 334  ALA B N   1 
ATOM   4440 C CA  . ALA B 1 276 ? 18.092  -9.680  29.557 1.00 31.47  ? 334  ALA B CA  1 
ATOM   4441 C C   . ALA B 1 276 ? 17.313  -9.403  30.843 1.00 32.92  ? 334  ALA B C   1 
ATOM   4442 O O   . ALA B 1 276 ? 17.809  -9.704  31.948 1.00 33.28  ? 334  ALA B O   1 
ATOM   4443 C CB  . ALA B 1 276 ? 18.963  -8.494  29.195 1.00 31.19  ? 334  ALA B CB  1 
ATOM   4444 N N   . ASN B 1 277 ? 16.095  -8.858  30.690 1.00 32.35  ? 335  ASN B N   1 
ATOM   4445 C CA  . ASN B 1 277 ? 15.208  -8.540  31.814 1.00 32.25  ? 335  ASN B CA  1 
ATOM   4446 C C   . ASN B 1 277 ? 14.913  -9.735  32.711 1.00 30.89  ? 335  ASN B C   1 
ATOM   4447 O O   . ASN B 1 277 ? 14.669  -9.574  33.910 1.00 32.11  ? 335  ASN B O   1 
ATOM   4448 C CB  . ASN B 1 277 ? 13.899  -7.898  31.324 1.00 34.26  ? 335  ASN B CB  1 
ATOM   4449 C CG  . ASN B 1 277 ? 12.921  -7.585  32.469 1.00 34.19  ? 335  ASN B CG  1 
ATOM   4450 O OD1 . ASN B 1 277 ? 13.092  -6.622  33.204 1.00 39.03  ? 335  ASN B OD1 1 
ATOM   4451 N ND2 . ASN B 1 277 ? 11.897  -8.405  32.610 1.00 31.21  ? 335  ASN B ND2 1 
ATOM   4452 N N   . SER B 1 278 ? 14.963  -10.927 32.131 1.00 29.50  ? 336  SER B N   1 
ATOM   4453 C CA  . SER B 1 278 ? 14.657  -12.165 32.849 1.00 30.08  ? 336  SER B CA  1 
ATOM   4454 C C   . SER B 1 278 ? 15.676  -12.540 33.910 1.00 31.57  ? 336  SER B C   1 
ATOM   4455 O O   . SER B 1 278 ? 15.476  -13.507 34.676 1.00 29.61  ? 336  SER B O   1 
ATOM   4456 C CB  . SER B 1 278 ? 14.523  -13.325 31.875 1.00 31.99  ? 336  SER B CB  1 
ATOM   4457 O OG  . SER B 1 278 ? 13.358  -13.196 31.075 1.00 33.31  ? 336  SER B OG  1 
ATOM   4458 N N   . ALA B 1 279 ? 16.756  -11.761 33.956 1.00 33.30  ? 337  ALA B N   1 
ATOM   4459 C CA  . ALA B 1 279 ? 17.889  -12.019 34.830 1.00 33.45  ? 337  ALA B CA  1 
ATOM   4460 C C   . ALA B 1 279 ? 17.879  -11.012 35.976 1.00 34.81  ? 337  ALA B C   1 
ATOM   4461 O O   . ALA B 1 279 ? 18.563  -11.195 36.983 1.00 34.85  ? 337  ALA B O   1 
ATOM   4462 C CB  . ALA B 1 279 ? 19.185  -11.889 34.026 1.00 31.40  ? 337  ALA B CB  1 
ATOM   4463 N N   . MET B 1 280 ? 17.095  -9.948  35.819 1.00 35.06  ? 338  MET B N   1 
ATOM   4464 C CA  . MET B 1 280 ? 17.213  -8.793  36.701 1.00 37.59  ? 338  MET B CA  1 
ATOM   4465 C C   . MET B 1 280 ? 16.426  -8.862  38.011 1.00 36.96  ? 338  MET B C   1 
ATOM   4466 O O   . MET B 1 280 ? 16.913  -8.417  39.058 1.00 36.24  ? 338  MET B O   1 
ATOM   4467 C CB  . MET B 1 280 ? 16.909  -7.508  35.931 1.00 39.40  ? 338  MET B CB  1 
ATOM   4468 C CG  . MET B 1 280 ? 17.969  -7.187  34.876 1.00 40.96  ? 338  MET B CG  1 
ATOM   4469 S SD  . MET B 1 280 ? 17.462  -5.860  33.769 1.00 49.02  ? 338  MET B SD  1 
ATOM   4470 C CE  . MET B 1 280 ? 18.569  -6.088  32.378 1.00 49.71  ? 338  MET B CE  1 
ATOM   4471 N N   . ASN B 1 281 ? 15.235  -9.454  37.952 1.00 36.68  ? 339  ASN B N   1 
ATOM   4472 C CA  . ASN B 1 281 ? 14.327  -9.518  39.110 1.00 36.33  ? 339  ASN B CA  1 
ATOM   4473 C C   . ASN B 1 281 ? 14.902  -10.205 40.343 1.00 35.50  ? 339  ASN B C   1 
ATOM   4474 O O   . ASN B 1 281 ? 14.678  -9.723  41.444 1.00 35.20  ? 339  ASN B O   1 
ATOM   4475 C CB  . ASN B 1 281 ? 12.968  -10.153 38.753 1.00 36.50  ? 339  ASN B CB  1 
ATOM   4476 C CG  . ASN B 1 281 ? 12.089  -9.252  37.902 1.00 36.36  ? 339  ASN B CG  1 
ATOM   4477 O OD1 . ASN B 1 281 ? 12.514  -8.198  37.416 1.00 34.03  ? 339  ASN B OD1 1 
ATOM   4478 N ND2 . ASN B 1 281 ? 10.841  -9.667  37.726 1.00 38.08  ? 339  ASN B ND2 1 
ATOM   4479 N N   . PRO B 1 282 ? 15.622  -11.337 40.176 1.00 35.31  ? 340  PRO B N   1 
ATOM   4480 C CA  . PRO B 1 282 ? 16.210  -11.932 41.389 1.00 37.65  ? 340  PRO B CA  1 
ATOM   4481 C C   . PRO B 1 282 ? 17.208  -11.001 42.090 1.00 39.43  ? 340  PRO B C   1 
ATOM   4482 O O   . PRO B 1 282 ? 17.256  -10.975 43.322 1.00 39.95  ? 340  PRO B O   1 
ATOM   4483 C CB  . PRO B 1 282 ? 16.894  -13.198 40.868 1.00 36.16  ? 340  PRO B CB  1 
ATOM   4484 C CG  . PRO B 1 282 ? 16.069  -13.570 39.675 1.00 35.51  ? 340  PRO B CG  1 
ATOM   4485 C CD  . PRO B 1 282 ? 15.699  -12.260 39.031 1.00 34.08  ? 340  PRO B CD  1 
ATOM   4486 N N   . ILE B 1 283 ? 17.967  -10.230 41.313 1.00 39.49  ? 341  ILE B N   1 
ATOM   4487 C CA  . ILE B 1 283 ? 18.929  -9.299  41.885 1.00 40.33  ? 341  ILE B CA  1 
ATOM   4488 C C   . ILE B 1 283 ? 18.139  -8.233  42.634 1.00 42.72  ? 341  ILE B C   1 
ATOM   4489 O O   . ILE B 1 283 ? 18.413  -7.966  43.807 1.00 44.66  ? 341  ILE B O   1 
ATOM   4490 C CB  . ILE B 1 283 ? 19.873  -8.668  40.802 1.00 38.47  ? 341  ILE B CB  1 
ATOM   4491 C CG1 . ILE B 1 283 ? 20.851  -9.707  40.269 1.00 36.67  ? 341  ILE B CG1 1 
ATOM   4492 C CG2 . ILE B 1 283 ? 20.637  -7.468  41.349 1.00 35.00  ? 341  ILE B CG2 1 
ATOM   4493 C CD1 . ILE B 1 283 ? 21.195  -9.495  38.812 1.00 41.39  ? 341  ILE B CD1 1 
ATOM   4494 N N   . ILE B 1 284 ? 17.151  -7.654  41.953 1.00 42.81  ? 342  ILE B N   1 
ATOM   4495 C CA  . ILE B 1 284 ? 16.313  -6.584  42.500 1.00 42.66  ? 342  ILE B CA  1 
ATOM   4496 C C   . ILE B 1 284 ? 15.623  -6.965  43.828 1.00 44.34  ? 342  ILE B C   1 
ATOM   4497 O O   . ILE B 1 284 ? 15.444  -6.113  44.700 1.00 44.17  ? 342  ILE B O   1 
ATOM   4498 C CB  . ILE B 1 284 ? 15.275  -6.122  41.455 1.00 42.69  ? 342  ILE B CB  1 
ATOM   4499 C CG1 . ILE B 1 284 ? 15.999  -5.458  40.273 1.00 40.33  ? 342  ILE B CG1 1 
ATOM   4500 C CG2 . ILE B 1 284 ? 14.205  -5.190  42.085 1.00 39.84  ? 342  ILE B CG2 1 
ATOM   4501 C CD1 . ILE B 1 284 ? 15.113  -5.056  39.097 1.00 34.24  ? 342  ILE B CD1 1 
ATOM   4502 N N   . TYR B 1 285 ? 15.274  -8.241  43.989 1.00 44.81  ? 343  TYR B N   1 
ATOM   4503 C CA  . TYR B 1 285 ? 14.697  -8.734  45.250 1.00 46.51  ? 343  TYR B CA  1 
ATOM   4504 C C   . TYR B 1 285 ? 15.675  -8.749  46.437 1.00 48.98  ? 343  TYR B C   1 
ATOM   4505 O O   . TYR B 1 285 ? 15.270  -8.990  47.573 1.00 50.48  ? 343  TYR B O   1 
ATOM   4506 C CB  . TYR B 1 285 ? 14.069  -10.132 45.081 1.00 44.92  ? 343  TYR B CB  1 
ATOM   4507 C CG  . TYR B 1 285 ? 12.948  -10.211 44.061 1.00 41.92  ? 343  TYR B CG  1 
ATOM   4508 C CD1 . TYR B 1 285 ? 12.123  -9.114  43.802 1.00 39.04  ? 343  TYR B CD1 1 
ATOM   4509 C CD2 . TYR B 1 285 ? 12.726  -11.378 43.343 1.00 41.85  ? 343  TYR B CD2 1 
ATOM   4510 C CE1 . TYR B 1 285 ? 11.103  -9.181  42.863 1.00 36.63  ? 343  TYR B CE1 1 
ATOM   4511 C CE2 . TYR B 1 285 ? 11.712  -11.457 42.400 1.00 38.56  ? 343  TYR B CE2 1 
ATOM   4512 C CZ  . TYR B 1 285 ? 10.905  -10.360 42.166 1.00 38.48  ? 343  TYR B CZ  1 
ATOM   4513 O OH  . TYR B 1 285 ? 9.904   -10.447 41.231 1.00 36.01  ? 343  TYR B OH  1 
ATOM   4514 N N   . CYS B 1 286 ? 16.953  -8.493  46.185 1.00 50.81  ? 344  CYS B N   1 
ATOM   4515 C CA  . CYS B 1 286 ? 17.939  -8.457  47.269 1.00 54.25  ? 344  CYS B CA  1 
ATOM   4516 C C   . CYS B 1 286 ? 17.846  -7.166  48.075 1.00 54.21  ? 344  CYS B C   1 
ATOM   4517 O O   . CYS B 1 286 ? 18.594  -6.958  49.029 1.00 56.25  ? 344  CYS B O   1 
ATOM   4518 C CB  . CYS B 1 286 ? 19.355  -8.708  46.741 1.00 54.42  ? 344  CYS B CB  1 
ATOM   4519 S SG  . CYS B 1 286 ? 19.499  -10.379 46.094 1.00 58.77  ? 344  CYS B SG  1 
ATOM   4520 N N   . ARG B 1 287 ? 16.905  -6.314  47.683 1.00 53.95  ? 345  ARG B N   1 
ATOM   4521 C CA  . ARG B 1 287 ? 16.498  -5.161  48.471 1.00 53.01  ? 345  ARG B CA  1 
ATOM   4522 C C   . ARG B 1 287 ? 15.781  -5.612  49.735 1.00 53.14  ? 345  ARG B C   1 
ATOM   4523 O O   . ARG B 1 287 ? 15.659  -4.848  50.696 1.00 53.49  ? 345  ARG B O   1 
ATOM   4524 C CB  . ARG B 1 287 ? 15.551  -4.291  47.653 1.00 51.28  ? 345  ARG B CB  1 
ATOM   4525 C CG  . ARG B 1 287 ? 16.234  -3.431  46.627 1.00 49.96  ? 345  ARG B CG  1 
ATOM   4526 C CD  . ARG B 1 287 ? 15.217  -2.676  45.796 1.00 51.60  ? 345  ARG B CD  1 
ATOM   4527 N NE  . ARG B 1 287 ? 14.167  -2.093  46.631 1.00 53.75  ? 345  ARG B NE  1 
ATOM   4528 C CZ  . ARG B 1 287 ? 14.153  -0.835  47.069 1.00 52.32  ? 345  ARG B CZ  1 
ATOM   4529 N NH1 . ARG B 1 287 ? 15.128  0.000   46.753 1.00 52.89  ? 345  ARG B NH1 1 
ATOM   4530 N NH2 . ARG B 1 287 ? 13.156  -0.406  47.824 1.00 52.22  ? 345  ARG B NH2 1 
ATOM   4531 N N   . SER B 1 288 ? 15.296  -6.850  49.720 1.00 53.50  ? 346  SER B N   1 
ATOM   4532 C CA  . SER B 1 288 ? 14.519  -7.388  50.822 1.00 54.48  ? 346  SER B CA  1 
ATOM   4533 C C   . SER B 1 288 ? 15.363  -8.287  51.702 1.00 55.43  ? 346  SER B C   1 
ATOM   4534 O O   . SER B 1 288 ? 15.908  -9.281  51.218 1.00 54.71  ? 346  SER B O   1 
ATOM   4535 C CB  . SER B 1 288 ? 13.297  -8.147  50.293 1.00 54.93  ? 346  SER B CB  1 
ATOM   4536 O OG  . SER B 1 288 ? 12.766  -9.035  51.270 1.00 56.12  ? 346  SER B OG  1 
ATOM   4537 N N   . PRO B 1 289 ? 15.471  -7.936  53.000 1.00 58.14  ? 347  PRO B N   1 
ATOM   4538 C CA  . PRO B 1 289 ? 16.105  -8.750  54.050 1.00 60.18  ? 347  PRO B CA  1 
ATOM   4539 C C   . PRO B 1 289 ? 15.725  -10.231 53.994 1.00 61.85  ? 347  PRO B C   1 
ATOM   4540 O O   . PRO B 1 289 ? 16.602  -11.098 54.063 1.00 63.05  ? 347  PRO B O   1 
ATOM   4541 C CB  . PRO B 1 289 ? 15.570  -8.120  55.342 1.00 60.38  ? 347  PRO B CB  1 
ATOM   4542 C CG  . PRO B 1 289 ? 15.362  -6.680  54.992 1.00 58.98  ? 347  PRO B CG  1 
ATOM   4543 C CD  . PRO B 1 289 ? 15.058  -6.611  53.511 1.00 58.26  ? 347  PRO B CD  1 
ATOM   4544 N N   . ASP B 1 290 ? 14.429  -10.502 53.852 1.00 64.30  ? 348  ASP B N   1 
ATOM   4545 C CA  . ASP B 1 290 ? 13.883  -11.866 53.824 1.00 67.06  ? 348  ASP B CA  1 
ATOM   4546 C C   . ASP B 1 290 ? 14.380  -12.728 52.669 1.00 67.28  ? 348  ASP B C   1 
ATOM   4547 O O   . ASP B 1 290 ? 14.792  -13.870 52.886 1.00 68.24  ? 348  ASP B O   1 
ATOM   4548 C CB  . ASP B 1 290 ? 12.360  -11.816 53.814 1.00 67.55  ? 348  ASP B CB  1 
ATOM   4549 C CG  . ASP B 1 290 ? 11.806  -11.283 55.106 1.00 71.95  ? 348  ASP B CG  1 
ATOM   4550 O OD1 . ASP B 1 290 ? 11.570  -12.087 56.034 1.00 74.47  ? 348  ASP B OD1 1 
ATOM   4551 O OD2 . ASP B 1 290 ? 11.625  -10.052 55.198 1.00 76.25  ? 348  ASP B OD2 1 
ATOM   4552 N N   . PHE B 1 291 ? 14.325  -12.176 51.455 1.00 66.79  ? 349  PHE B N   1 
ATOM   4553 C CA  . PHE B 1 291 ? 14.837  -12.839 50.253 1.00 66.57  ? 349  PHE B CA  1 
ATOM   4554 C C   . PHE B 1 291 ? 16.336  -13.110 50.366 1.00 67.07  ? 349  PHE B C   1 
ATOM   4555 O O   . PHE B 1 291 ? 16.797  -14.231 50.119 1.00 67.01  ? 349  PHE B O   1 
ATOM   4556 C CB  . PHE B 1 291 ? 14.530  -12.007 48.995 1.00 65.81  ? 349  PHE B CB  1 
ATOM   4557 C CG  . PHE B 1 291 ? 13.166  -12.272 48.404 1.00 61.53  ? 349  PHE B CG  1 
ATOM   4558 C CD1 . PHE B 1 291 ? 12.921  -13.431 47.658 1.00 59.09  ? 349  PHE B CD1 1 
ATOM   4559 C CD2 . PHE B 1 291 ? 12.125  -11.371 48.596 1.00 58.18  ? 349  PHE B CD2 1 
ATOM   4560 C CE1 . PHE B 1 291 ? 11.659  -13.682 47.115 1.00 54.92  ? 349  PHE B CE1 1 
ATOM   4561 C CE2 . PHE B 1 291 ? 10.851  -11.617 48.055 1.00 56.27  ? 349  PHE B CE2 1 
ATOM   4562 C CZ  . PHE B 1 291 ? 10.623  -12.770 47.314 1.00 52.87  ? 349  PHE B CZ  1 
ATOM   4563 N N   . ARG B 1 292 ? 17.076  -12.077 50.762 1.00 67.30  ? 350  ARG B N   1 
ATOM   4564 C CA  . ARG B 1 292 ? 18.511  -12.164 50.989 1.00 68.36  ? 350  ARG B CA  1 
ATOM   4565 C C   . ARG B 1 292 ? 18.860  -13.328 51.928 1.00 68.60  ? 350  ARG B C   1 
ATOM   4566 O O   . ARG B 1 292 ? 19.709  -14.163 51.600 1.00 67.55  ? 350  ARG B O   1 
ATOM   4567 C CB  . ARG B 1 292 ? 19.003  -10.834 51.553 1.00 68.60  ? 350  ARG B CB  1 
ATOM   4568 C CG  . ARG B 1 292 ? 20.315  -10.334 50.977 1.00 71.23  ? 350  ARG B CG  1 
ATOM   4569 C CD  . ARG B 1 292 ? 20.408  -8.817  51.096 1.00 73.81  ? 350  ARG B CD  1 
ATOM   4570 N NE  . ARG B 1 292 ? 19.919  -8.345  52.395 1.00 78.41  ? 350  ARG B NE  1 
ATOM   4571 C CZ  . ARG B 1 292 ? 19.390  -7.144  52.625 1.00 78.19  ? 350  ARG B CZ  1 
ATOM   4572 N NH1 . ARG B 1 292 ? 19.268  -6.256  51.647 1.00 75.93  ? 350  ARG B NH1 1 
ATOM   4573 N NH2 . ARG B 1 292 ? 18.977  -6.830  53.846 1.00 79.38  ? 350  ARG B NH2 1 
ATOM   4574 N N   . LYS B 1 293 ? 18.176  -13.391 53.074 1.00 69.83  ? 351  LYS B N   1 
ATOM   4575 C CA  . LYS B 1 293 ? 18.362  -14.465 54.060 1.00 70.74  ? 351  LYS B CA  1 
ATOM   4576 C C   . LYS B 1 293 ? 17.995  -15.850 53.536 1.00 70.24  ? 351  LYS B C   1 
ATOM   4577 O O   . LYS B 1 293 ? 18.666  -16.835 53.856 1.00 70.88  ? 351  LYS B O   1 
ATOM   4578 C CB  . LYS B 1 293 ? 17.610  -14.155 55.364 1.00 72.24  ? 351  LYS B CB  1 
ATOM   4579 C CG  . LYS B 1 293 ? 18.546  -13.775 56.517 1.00 77.67  ? 351  LYS B CG  1 
ATOM   4580 C CD  . LYS B 1 293 ? 18.054  -12.581 57.318 1.00 81.97  ? 351  LYS B CD  1 
ATOM   4581 C CE  . LYS B 1 293 ? 19.233  -11.836 57.936 1.00 84.13  ? 351  LYS B CE  1 
ATOM   4582 N NZ  . LYS B 1 293 ? 18.816  -10.544 58.553 1.00 87.56  ? 351  LYS B NZ  1 
ATOM   4583 N N   . ALA B 1 294 ? 16.940  -15.919 52.728 1.00 69.34  ? 352  ALA B N   1 
ATOM   4584 C CA  . ALA B 1 294 ? 16.516  -17.173 52.119 1.00 69.34  ? 352  ALA B CA  1 
ATOM   4585 C C   . ALA B 1 294 ? 17.497  -17.624 51.039 1.00 70.22  ? 352  ALA B C   1 
ATOM   4586 O O   . ALA B 1 294 ? 17.727  -18.822 50.871 1.00 69.75  ? 352  ALA B O   1 
ATOM   4587 C CB  . ALA B 1 294 ? 15.122  -17.038 51.551 1.00 68.36  ? 352  ALA B CB  1 
ATOM   4588 N N   . PHE B 1 295 ? 18.066  -16.654 50.318 1.00 71.98  ? 353  PHE B N   1 
ATOM   4589 C CA  . PHE B 1 295 ? 19.077  -16.911 49.290 1.00 73.30  ? 353  PHE B CA  1 
ATOM   4590 C C   . PHE B 1 295 ? 20.340  -17.476 49.910 1.00 75.41  ? 353  PHE B C   1 
ATOM   4591 O O   . PHE B 1 295 ? 20.839  -18.508 49.462 1.00 75.93  ? 353  PHE B O   1 
ATOM   4592 C CB  . PHE B 1 295 ? 19.429  -15.637 48.509 1.00 72.40  ? 353  PHE B CB  1 
ATOM   4593 C CG  . PHE B 1 295 ? 18.361  -15.186 47.542 1.00 70.58  ? 353  PHE B CG  1 
ATOM   4594 C CD1 . PHE B 1 295 ? 17.408  -16.075 47.051 1.00 67.84  ? 353  PHE B CD1 1 
ATOM   4595 C CD2 . PHE B 1 295 ? 18.329  -13.863 47.096 1.00 70.80  ? 353  PHE B CD2 1 
ATOM   4596 C CE1 . PHE B 1 295 ? 16.423  -15.643 46.150 1.00 66.41  ? 353  PHE B CE1 1 
ATOM   4597 C CE2 . PHE B 1 295 ? 17.345  -13.426 46.189 1.00 67.87  ? 353  PHE B CE2 1 
ATOM   4598 C CZ  . PHE B 1 295 ? 16.394  -14.319 45.720 1.00 64.20  ? 353  PHE B CZ  1 
ATOM   4599 N N   . LYS B 1 296 ? 20.845  -16.791 50.940 1.00 77.91  ? 354  LYS B N   1 
ATOM   4600 C CA  . LYS B 1 296 ? 22.042  -17.221 51.672 1.00 79.62  ? 354  LYS B CA  1 
ATOM   4601 C C   . LYS B 1 296 ? 21.871  -18.603 52.293 1.00 80.58  ? 354  LYS B C   1 
ATOM   4602 O O   . LYS B 1 296 ? 22.801  -19.411 52.271 1.00 81.16  ? 354  LYS B O   1 
ATOM   4603 C CB  . LYS B 1 296 ? 22.448  -16.183 52.725 1.00 79.62  ? 354  LYS B CB  1 
ATOM   4604 C CG  . LYS B 1 296 ? 23.397  -15.125 52.179 1.00 80.88  ? 354  LYS B CG  1 
ATOM   4605 C CD  . LYS B 1 296 ? 23.281  -13.796 52.901 1.00 80.46  ? 354  LYS B CD  1 
ATOM   4606 C CE  . LYS B 1 296 ? 24.010  -12.717 52.112 1.00 81.60  ? 354  LYS B CE  1 
ATOM   4607 N NZ  . LYS B 1 296 ? 23.838  -11.357 52.688 1.00 82.74  ? 354  LYS B NZ  1 
ATOM   4608 N N   . ARG B 1 297 ? 20.677  -18.882 52.813 1.00 81.29  ? 355  ARG B N   1 
ATOM   4609 C CA  . ARG B 1 297 ? 20.389  -20.184 53.404 1.00 82.73  ? 355  ARG B CA  1 
ATOM   4610 C C   . ARG B 1 297 ? 20.320  -21.288 52.348 1.00 83.51  ? 355  ARG B C   1 
ATOM   4611 O O   . ARG B 1 297 ? 20.834  -22.383 52.561 1.00 84.07  ? 355  ARG B O   1 
ATOM   4612 C CB  . ARG B 1 297 ? 19.096  -20.139 54.219 1.00 83.19  ? 355  ARG B CB  1 
ATOM   4613 C CG  . ARG B 1 297 ? 18.787  -21.430 54.975 1.00 84.85  ? 355  ARG B CG  1 
ATOM   4614 C CD  . ARG B 1 297 ? 17.308  -21.538 55.294 1.00 86.45  ? 355  ARG B CD  1 
ATOM   4615 N NE  . ARG B 1 297 ? 16.489  -21.300 54.106 1.00 87.84  ? 355  ARG B NE  1 
ATOM   4616 C CZ  . ARG B 1 297 ? 15.179  -21.513 54.030 1.00 87.68  ? 355  ARG B CZ  1 
ATOM   4617 N NH1 . ARG B 1 297 ? 14.510  -21.985 55.077 1.00 89.23  ? 355  ARG B NH1 1 
ATOM   4618 N NH2 . ARG B 1 297 ? 14.536  -21.256 52.899 1.00 84.07  ? 355  ARG B NH2 1 
ATOM   4619 N N   . LEU B 1 298 ? 19.691  -20.994 51.214 1.00 84.34  ? 356  LEU B N   1 
ATOM   4620 C CA  . LEU B 1 298 ? 19.519  -21.988 50.157 1.00 85.06  ? 356  LEU B CA  1 
ATOM   4621 C C   . LEU B 1 298 ? 20.837  -22.409 49.531 1.00 87.13  ? 356  LEU B C   1 
ATOM   4622 O O   . LEU B 1 298 ? 21.043  -23.590 49.248 1.00 87.74  ? 356  LEU B O   1 
ATOM   4623 C CB  . LEU B 1 298 ? 18.570  -21.479 49.075 1.00 83.94  ? 356  LEU B CB  1 
ATOM   4624 C CG  . LEU B 1 298 ? 17.071  -21.661 49.313 1.00 81.50  ? 356  LEU B CG  1 
ATOM   4625 C CD1 . LEU B 1 298 ? 16.312  -20.738 48.392 1.00 80.47  ? 356  LEU B CD1 1 
ATOM   4626 C CD2 . LEU B 1 298 ? 16.632  -23.108 49.107 1.00 79.58  ? 356  LEU B CD2 1 
ATOM   4627 N N   . LEU B 1 299 ? 21.726  -21.439 49.330 1.00 89.26  ? 357  LEU B N   1 
ATOM   4628 C CA  . LEU B 1 299 ? 23.026  -21.683 48.698 1.00 91.26  ? 357  LEU B CA  1 
ATOM   4629 C C   . LEU B 1 299 ? 24.017  -22.453 49.608 1.00 92.86  ? 357  LEU B C   1 
ATOM   4630 O O   . LEU B 1 299 ? 25.125  -22.801 49.176 1.00 93.35  ? 357  LEU B O   1 
ATOM   4631 C CB  . LEU B 1 299 ? 23.628  -20.361 48.175 1.00 91.04  ? 357  LEU B CB  1 
ATOM   4632 C CG  . LEU B 1 299 ? 22.874  -19.587 47.072 1.00 89.10  ? 357  LEU B CG  1 
ATOM   4633 C CD1 . LEU B 1 299 ? 23.237  -18.108 47.071 1.00 88.23  ? 357  LEU B CD1 1 
ATOM   4634 C CD2 . LEU B 1 299 ? 23.089  -20.185 45.687 1.00 87.59  ? 357  LEU B CD2 1 
ATOM   4635 N N   . ALA B 1 300 ? 23.595  -22.725 50.851 1.00 93.53  ? 358  ALA B N   1 
ATOM   4636 C CA  . ALA B 1 300 ? 24.348  -23.532 51.832 1.00 93.69  ? 358  ALA B CA  1 
ATOM   4637 C C   . ALA B 1 300 ? 25.795  -23.077 52.029 1.00 94.00  ? 358  ALA B C   1 
ATOM   4638 O O   . ALA B 1 300 ? 26.048  -22.006 52.585 1.00 94.24  ? 358  ALA B O   1 
ATOM   4639 C CB  . ALA B 1 300 ? 24.285  -25.033 51.478 1.00 93.16  ? 358  ALA B CB  1 
HETATM 4640 C CAA . Y01 C 2 .   ? -8.508  -6.112  23.866 1.00 36.46  ? 401  Y01 A CAA 1 
HETATM 4641 C CBA . Y01 C 2 .   ? -9.009  -5.985  22.443 1.00 32.92  ? 401  Y01 A CBA 1 
HETATM 4642 C CAB . Y01 C 2 .   ? -8.824  -7.337  21.736 1.00 33.96  ? 401  Y01 A CAB 1 
HETATM 4643 C CAN . Y01 C 2 .   ? -8.248  -4.833  21.753 1.00 35.20  ? 401  Y01 A CAN 1 
HETATM 4644 C CAJ . Y01 C 2 .   ? -8.995  -4.242  20.566 1.00 35.65  ? 401  Y01 A CAJ 1 
HETATM 4645 C CAO . Y01 C 2 .   ? -8.408  -2.899  20.087 1.00 36.67  ? 401  Y01 A CAO 1 
HETATM 4646 C CBB . Y01 C 2 .   ? -8.917  -2.696  18.659 1.00 40.04  ? 401  Y01 A CBB 1 
HETATM 4647 C CAC . Y01 C 2 .   ? -10.409 -2.324  18.669 1.00 46.04  ? 401  Y01 A CAC 1 
HETATM 4648 C CBE . Y01 C 2 .   ? -8.146  -1.694  17.762 1.00 37.13  ? 401  Y01 A CBE 1 
HETATM 4649 C CAP . Y01 C 2 .   ? -7.286  -0.655  18.502 1.00 33.22  ? 401  Y01 A CAP 1 
HETATM 4650 C CAQ . Y01 C 2 .   ? -6.253  -0.233  17.426 1.00 36.48  ? 401  Y01 A CAQ 1 
HETATM 4651 C CBG . Y01 C 2 .   ? -6.640  -1.049  16.157 1.00 34.35  ? 401  Y01 A CBG 1 
HETATM 4652 C CBI . Y01 C 2 .   ? -7.180  -2.352  16.722 1.00 32.25  ? 401  Y01 A CBI 1 
HETATM 4653 C CAE . Y01 C 2 .   ? -6.124  -3.290  17.347 1.00 25.50  ? 401  Y01 A CAE 1 
HETATM 4654 C CAU . Y01 C 2 .   ? -7.881  -3.072  15.570 1.00 33.61  ? 401  Y01 A CAU 1 
HETATM 4655 C CAS . Y01 C 2 .   ? -6.887  -3.462  14.450 1.00 31.57  ? 401  Y01 A CAS 1 
HETATM 4656 C CBF . Y01 C 2 .   ? -6.034  -2.253  13.960 1.00 35.51  ? 401  Y01 A CBF 1 
HETATM 4657 C CBD . Y01 C 2 .   ? -5.543  -1.308  15.114 1.00 36.79  ? 401  Y01 A CBD 1 
HETATM 4658 C CAK . Y01 C 2 .   ? -4.988  0.007   14.540 1.00 35.73  ? 401  Y01 A CAK 1 
HETATM 4659 C CAI . Y01 C 2 .   ? -4.235  -0.219  13.387 1.00 37.16  ? 401  Y01 A CAI 1 
HETATM 4660 C CAZ . Y01 C 2 .   ? -4.103  -1.401  12.652 1.00 35.38  ? 401  Y01 A CAZ 1 
HETATM 4661 C CAV . Y01 C 2 .   ? -3.225  -1.404  11.390 1.00 39.15  ? 401  Y01 A CAV 1 
HETATM 4662 C CBH . Y01 C 2 .   ? -4.842  -2.680  13.077 1.00 33.48  ? 401  Y01 A CBH 1 
HETATM 4663 C CAD . Y01 C 2 .   ? -3.862  -3.580  13.847 1.00 29.21  ? 401  Y01 A CAD 1 
HETATM 4664 C CAT . Y01 C 2 .   ? -5.373  -3.417  11.826 1.00 39.63  ? 401  Y01 A CAT 1 
HETATM 4665 C CAR . Y01 C 2 .   ? -4.392  -3.423  10.648 1.00 42.51  ? 401  Y01 A CAR 1 
HETATM 4666 C CBC . Y01 C 2 .   ? -4.104  -1.950  10.267 1.00 46.23  ? 401  Y01 A CBC 1 
HETATM 4667 O OAW . Y01 C 2 .   ? -3.709  -1.709  8.871  1.00 52.25  ? 401  Y01 A OAW 1 
HETATM 4668 C CAY . Y01 C 2 .   ? -2.624  -2.355  8.447  1.00 54.12  ? 401  Y01 A CAY 1 
HETATM 4669 O OAG . Y01 C 2 .   ? -1.976  -3.003  9.265  1.00 58.89  ? 401  Y01 A OAG 1 
HETATM 4670 C CAM . Y01 C 2 .   ? -2.267  -2.269  6.960  1.00 56.11  ? 401  Y01 A CAM 1 
HETATM 4671 C CAL . Y01 C 2 .   ? -0.781  -2.549  6.750  1.00 61.29  ? 401  Y01 A CAL 1 
HETATM 4672 C CAX . Y01 C 2 .   ? -0.489  -3.097  5.355  1.00 66.69  ? 401  Y01 A CAX 1 
HETATM 4673 O OAH . Y01 C 2 .   ? 0.074   -2.312  4.560  1.00 66.08  ? 401  Y01 A OAH 1 
HETATM 4674 O OAF . Y01 C 2 .   ? -0.807  -4.290  5.129  1.00 70.93  ? 401  Y01 A OAF 1 
HETATM 4675 C CAA . Y01 D 2 .   ? -18.216 -16.955 11.328 1.00 58.33  ? 402  Y01 A CAA 1 
HETATM 4676 C CBA . Y01 D 2 .   ? -19.053 -16.156 10.337 1.00 61.57  ? 402  Y01 A CBA 1 
HETATM 4677 C CAB . Y01 D 2 .   ? -20.282 -16.975 9.938  1.00 60.14  ? 402  Y01 A CAB 1 
HETATM 4678 C CAN . Y01 D 2 .   ? -18.214 -15.734 9.115  1.00 64.62  ? 402  Y01 A CAN 1 
HETATM 4679 C CAJ . Y01 D 2 .   ? -17.970 -14.215 9.062  1.00 65.75  ? 402  Y01 A CAJ 1 
HETATM 4680 C CAO . Y01 D 2 .   ? -17.831 -13.713 7.613  1.00 67.26  ? 402  Y01 A CAO 1 
HETATM 4681 C CBB . Y01 D 2 .   ? -16.543 -12.874 7.384  1.00 68.99  ? 402  Y01 A CBB 1 
HETATM 4682 C CAC . Y01 D 2 .   ? -15.452 -13.758 6.740  1.00 67.62  ? 402  Y01 A CAC 1 
HETATM 4683 C CBE . Y01 D 2 .   ? -16.872 -11.532 6.620  1.00 67.83  ? 402  Y01 A CBE 1 
HETATM 4684 C CAP . Y01 D 2 .   ? -17.483 -10.471 7.581  1.00 66.05  ? 402  Y01 A CAP 1 
HETATM 4685 C CAQ . Y01 D 2 .   ? -17.029 -9.100  7.032  1.00 67.34  ? 402  Y01 A CAQ 1 
HETATM 4686 C CBG . Y01 D 2 .   ? -16.549 -9.462  5.624  1.00 67.57  ? 402  Y01 A CBG 1 
HETATM 4687 C CBI . Y01 D 2 .   ? -15.738 -10.736 5.897  1.00 67.60  ? 402  Y01 A CBI 1 
HETATM 4688 C CAE . Y01 D 2 .   ? -14.498 -10.488 6.790  1.00 68.32  ? 402  Y01 A CAE 1 
HETATM 4689 C CAU . Y01 D 2 .   ? -15.325 -11.341 4.529  1.00 67.57  ? 402  Y01 A CAU 1 
HETATM 4690 C CAS . Y01 D 2 .   ? -14.609 -10.341 3.590  1.00 67.12  ? 402  Y01 A CAS 1 
HETATM 4691 C CBF . Y01 D 2 .   ? -15.310 -8.955  3.464  1.00 69.71  ? 402  Y01 A CBF 1 
HETATM 4692 C CBD . Y01 D 2 .   ? -15.753 -8.392  4.852  1.00 67.75  ? 402  Y01 A CBD 1 
HETATM 4693 C CAK . Y01 D 2 .   ? -16.541 -7.072  4.725  1.00 66.45  ? 402  Y01 A CAK 1 
HETATM 4694 C CAI . Y01 D 2 .   ? -16.004 -6.191  3.784  1.00 66.81  ? 402  Y01 A CAI 1 
HETATM 4695 C CAZ . Y01 D 2 .   ? -15.059 -6.486  2.798  1.00 70.96  ? 402  Y01 A CAZ 1 
HETATM 4696 C CAV . Y01 D 2 .   ? -14.624 -5.361  1.836  1.00 73.51  ? 402  Y01 A CAV 1 
HETATM 4697 C CBH . Y01 D 2 .   ? -14.460 -7.925  2.651  1.00 72.42  ? 402  Y01 A CBH 1 
HETATM 4698 C CAD . Y01 D 2 .   ? -12.996 -7.921  3.149  1.00 73.81  ? 402  Y01 A CAD 1 
HETATM 4699 C CAT . Y01 D 2 .   ? -14.479 -8.285  1.138  1.00 73.31  ? 402  Y01 A CAT 1 
HETATM 4700 C CAR . Y01 D 2 .   ? -13.910 -7.171  0.215  1.00 75.33  ? 402  Y01 A CAR 1 
HETATM 4701 C CBC . Y01 D 2 .   ? -14.675 -5.835  0.362  1.00 76.57  ? 402  Y01 A CBC 1 
HETATM 4702 O OAW . Y01 D 2 .   ? -14.174 -4.782  -0.508 1.00 82.25  ? 402  Y01 A OAW 1 
HETATM 4703 C CAY . Y01 D 2 .   ? -14.842 -4.577  -1.706 1.00 89.30  ? 402  Y01 A CAY 1 
HETATM 4704 O OAG . Y01 D 2 .   ? -14.159 -4.298  -2.700 1.00 92.50  ? 402  Y01 A OAG 1 
HETATM 4705 C CAM . Y01 D 2 .   ? -16.397 -4.635  -1.847 1.00 90.56  ? 402  Y01 A CAM 1 
HETATM 4706 C CAL . Y01 D 2 .   ? -17.079 -3.419  -1.173 1.00 91.70  ? 402  Y01 A CAL 1 
HETATM 4707 C CAX . Y01 D 2 .   ? -18.332 -2.885  -1.896 1.00 89.60  ? 402  Y01 A CAX 1 
HETATM 4708 O OAH . Y01 D 2 .   ? -19.425 -3.380  -1.544 1.00 87.78  ? 402  Y01 A OAH 1 
HETATM 4709 O OAF . Y01 D 2 .   ? -18.178 -1.957  -2.731 1.00 88.83  ? 402  Y01 A OAF 1 
HETATM 4710 C C9  . 2CV E 3 .   ? -10.559 -16.290 28.405 1.00 23.27  ? 501  2CV A C9  1 
HETATM 4711 C C12 . 2CV E 3 .   ? -10.814 -16.688 29.857 1.00 28.62  ? 501  2CV A C12 1 
HETATM 4712 C C15 . 2CV E 3 .   ? -9.963  -17.864 30.298 1.00 26.52  ? 501  2CV A C15 1 
HETATM 4713 C C18 . 2CV E 3 .   ? -10.410 -18.310 31.665 1.00 31.12  ? 501  2CV A C18 1 
HETATM 4714 C C21 . 2CV E 3 .   ? -9.742  -19.638 31.992 1.00 37.63  ? 501  2CV A C21 1 
HETATM 4715 C C24 . 2CV E 3 .   ? -9.772  -19.903 33.490 1.00 39.04  ? 501  2CV A C24 1 
HETATM 4716 C C27 . 2CV E 3 .   ? -10.265 -21.315 33.738 1.00 41.79  ? 501  2CV A C27 1 
HETATM 4717 C C30 . 2CV E 3 .   ? -10.693 -21.495 35.199 1.00 47.27  ? 501  2CV A C30 1 
HETATM 4718 N N33 . 2CV E 3 .   ? -11.418 -22.592 35.505 1.00 50.25  ? 501  2CV A N33 1 
HETATM 4719 O O34 . 2CV E 3 .   ? -10.410 -20.614 36.009 1.00 51.45  ? 501  2CV A O34 1 
HETATM 4720 C C35 . 2CV E 3 .   ? -11.640 -23.710 34.565 1.00 55.08  ? 501  2CV A C35 1 
HETATM 4721 C C36 . 2CV E 3 .   ? -11.816 -22.955 36.893 1.00 54.42  ? 501  2CV A C36 1 
HETATM 4722 C C37 . 2CV E 3 .   ? -12.657 -21.948 37.727 1.00 55.97  ? 501  2CV A C37 1 
HETATM 4723 C C40 . 2CV E 3 .   ? -13.912 -22.604 38.321 1.00 61.00  ? 501  2CV A C40 1 
HETATM 4724 C C41 . 2CV E 3 .   ? -13.647 -23.349 39.642 1.00 64.19  ? 501  2CV A C41 1 
HETATM 4725 C C42 . 2CV E 3 .   ? -14.548 -22.857 40.790 1.00 70.31  ? 501  2CV A C42 1 
HETATM 4726 C C43 . 2CV E 3 .   ? -14.422 -21.349 41.081 1.00 73.52  ? 501  2CV A C43 1 
HETATM 4727 O O44 . 2CV E 3 .   ? -13.081 -21.022 41.464 1.00 74.13  ? 501  2CV A O44 1 
HETATM 4728 O O47 . 2CV E 3 .   ? -13.060 -20.815 36.974 1.00 47.90  ? 501  2CV A O47 1 
HETATM 4729 O O49 . 2CV E 3 .   ? -14.473 -23.523 37.372 1.00 64.24  ? 501  2CV A O49 1 
HETATM 4730 O O51 . 2CV E 3 .   ? -12.277 -23.280 40.030 1.00 63.13  ? 501  2CV A O51 1 
HETATM 4731 O O53 . 2CV E 3 .   ? -14.250 -23.615 41.974 1.00 73.69  ? 501  2CV A O53 1 
HETATM 4732 C C60 . 2CV E 3 .   ? -12.447 -23.428 33.314 1.00 57.27  ? 501  2CV A C60 1 
HETATM 4733 O O63 . 2CV E 3 .   ? -11.842 -24.243 32.309 1.00 57.84  ? 501  2CV A O63 1 
HETATM 4734 C C1  . 2CV E 3 .   ? -11.520 -15.162 28.070 1.00 25.42  ? 501  2CV A C1  1 
HETATM 4735 C C0  . 2CV E 3 .   ? -10.974 -14.283 26.944 1.00 29.09  ? 501  2CV A C0  1 
HETATM 4736 C C9  . 2CV F 3 .   ? -17.099 9.859   15.807 1.00 36.92  ? 502  2CV A C9  1 
HETATM 4737 C C12 . 2CV F 3 .   ? -17.498 10.904  16.868 1.00 42.42  ? 502  2CV A C12 1 
HETATM 4738 C C15 . 2CV F 3 .   ? -18.366 12.002  16.226 1.00 46.63  ? 502  2CV A C15 1 
HETATM 4739 C C18 . 2CV F 3 .   ? -18.897 13.010  17.257 1.00 44.93  ? 502  2CV A C18 1 
HETATM 4740 C C21 . 2CV F 3 .   ? -19.047 14.410  16.637 1.00 42.31  ? 502  2CV A C21 1 
HETATM 4741 C C9  . 2CV G 3 .   ? -10.612 -9.656  41.879 1.00 70.62  ? 503  2CV A C9  1 
HETATM 4742 C C12 . 2CV G 3 .   ? -11.087 -11.114 41.720 1.00 68.42  ? 503  2CV A C12 1 
HETATM 4743 C C15 . 2CV G 3 .   ? -12.256 -11.431 42.651 1.00 66.26  ? 503  2CV A C15 1 
HETATM 4744 C C18 . 2CV G 3 .   ? -13.304 -12.303 41.954 1.00 65.27  ? 503  2CV A C18 1 
HETATM 4745 C C21 . 2CV G 3 .   ? -14.718 -11.961 42.455 1.00 67.91  ? 503  2CV A C21 1 
HETATM 4746 C C24 . 2CV G 3 .   ? -15.210 -12.927 43.537 1.00 70.57  ? 503  2CV A C24 1 
HETATM 4747 C C27 . 2CV G 3 .   ? -16.484 -12.416 44.227 1.00 76.52  ? 503  2CV A C27 1 
HETATM 4748 C C30 . 2CV G 3 .   ? -17.411 -13.585 44.623 1.00 83.88  ? 503  2CV A C30 1 
HETATM 4749 N N33 . 2CV G 3 .   ? -18.306 -13.388 45.627 1.00 87.96  ? 503  2CV A N33 1 
HETATM 4750 O O34 . 2CV G 3 .   ? -17.288 -14.655 44.025 1.00 86.79  ? 503  2CV A O34 1 
HETATM 4751 C C35 . 2CV G 3 .   ? -18.463 -12.083 46.330 1.00 89.74  ? 503  2CV A C35 1 
HETATM 4752 C C36 . 2CV G 3 .   ? -19.247 -14.468 46.032 1.00 90.34  ? 503  2CV A C36 1 
HETATM 4753 C C37 . 2CV G 3 .   ? -18.552 -15.583 46.841 1.00 92.77  ? 503  2CV A C37 1 
HETATM 4754 C C40 . 2CV G 3 .   ? -19.432 -16.841 46.919 1.00 93.30  ? 503  2CV A C40 1 
HETATM 4755 O O47 . 2CV G 3 .   ? -18.246 -15.118 48.164 1.00 93.10  ? 503  2CV A O47 1 
HETATM 4756 O O49 . 2CV G 3 .   ? -18.609 -18.012 46.991 1.00 92.55  ? 503  2CV A O49 1 
HETATM 4757 C C60 . 2CV G 3 .   ? -17.918 -12.120 47.778 1.00 89.08  ? 503  2CV A C60 1 
HETATM 4758 O O63 . 2CV G 3 .   ? -18.461 -11.046 48.564 1.00 86.70  ? 503  2CV A O63 1 
HETATM 4759 C C1  . 2CV G 3 .   ? -9.512  -9.293  40.865 1.00 69.57  ? 503  2CV A C1  1 
HETATM 4760 C C0  . 2CV G 3 .   ? -9.176  -7.805  40.928 1.00 66.86  ? 503  2CV A C0  1 
HETATM 4761 C C9  . 2CV H 3 .   ? -36.427 -14.032 26.992 1.00 43.72  ? 504  2CV A C9  1 
HETATM 4762 C C12 . 2CV H 3 .   ? -37.683 -13.146 26.819 1.00 44.90  ? 504  2CV A C12 1 
HETATM 4763 C C15 . 2CV H 3 .   ? -37.375 -11.776 26.189 1.00 46.98  ? 504  2CV A C15 1 
HETATM 4764 C C18 . 2CV H 3 .   ? -37.859 -11.714 24.729 1.00 51.71  ? 504  2CV A C18 1 
HETATM 4765 C C21 . 2CV H 3 .   ? -38.162 -10.277 24.281 1.00 57.09  ? 504  2CV A C21 1 
HETATM 4766 C C24 . 2CV H 3 .   ? -38.451 -10.183 22.775 1.00 61.44  ? 504  2CV A C24 1 
HETATM 4767 C C27 . 2CV H 3 .   ? -37.380 -9.328  22.099 1.00 70.88  ? 504  2CV A C27 1 
HETATM 4768 C C30 . 2CV H 3 .   ? -37.895 -8.163  21.212 1.00 78.26  ? 504  2CV A C30 1 
HETATM 4769 N N33 . 2CV H 3 .   ? -38.134 -6.972  21.806 1.00 84.59  ? 504  2CV A N33 1 
HETATM 4770 O O34 . 2CV H 3 .   ? -37.980 -8.330  19.995 1.00 77.40  ? 504  2CV A O34 1 
HETATM 4771 C C35 . 2CV H 3 .   ? -38.034 -6.770  23.278 1.00 86.46  ? 504  2CV A C35 1 
HETATM 4772 C C36 . 2CV H 3 .   ? -38.626 -5.812  21.017 1.00 85.29  ? 504  2CV A C36 1 
HETATM 4773 C C37 . 2CV H 3 .   ? -37.488 -5.154  20.209 1.00 88.92  ? 504  2CV A C37 1 
HETATM 4774 C C40 . 2CV H 3 .   ? -37.064 -3.784  20.792 1.00 92.12  ? 504  2CV A C40 1 
HETATM 4775 C C41 . 2CV H 3 .   ? -36.361 -2.823  19.786 1.00 93.96  ? 504  2CV A C41 1 
HETATM 4776 C C42 . 2CV H 3 .   ? -36.438 -1.345  20.228 1.00 94.71  ? 504  2CV A C42 1 
HETATM 4777 C C43 . 2CV H 3 .   ? -35.946 -0.396  19.127 1.00 94.23  ? 504  2CV A C43 1 
HETATM 4778 O O44 . 2CV H 3 .   ? -36.308 0.957   19.473 1.00 95.02  ? 504  2CV A O44 1 
HETATM 4779 O O47 . 2CV H 3 .   ? -37.914 -5.018  18.852 1.00 88.68  ? 504  2CV A O47 1 
HETATM 4780 O O49 . 2CV H 3 .   ? -36.172 -4.027  21.886 1.00 92.59  ? 504  2CV A O49 1 
HETATM 4781 O O51 . 2CV H 3 .   ? -36.928 -2.935  18.471 1.00 94.39  ? 504  2CV A O51 1 
HETATM 4782 O O53 . 2CV H 3 .   ? -35.656 -1.125  21.409 1.00 96.52  ? 504  2CV A O53 1 
HETATM 4783 C C60 . 2CV H 3 .   ? -36.617 -6.400  23.754 1.00 85.77  ? 504  2CV A C60 1 
HETATM 4784 O O63 . 2CV H 3 .   ? -36.418 -6.916  25.076 1.00 84.80  ? 504  2CV A O63 1 
HETATM 4785 C C1  . 2CV H 3 .   ? -36.538 -14.964 28.226 1.00 40.71  ? 504  2CV A C1  1 
HETATM 4786 C C0  . 2CV H 3 .   ? -36.110 -16.422 27.964 1.00 32.74  ? 504  2CV A C0  1 
HETATM 4787 C C9  . 2CV I 3 .   ? -12.168 -14.746 10.500 1.00 68.07  ? 505  2CV A C9  1 
HETATM 4788 C C12 . 2CV I 3 .   ? -11.349 -14.002 9.432  1.00 73.13  ? 505  2CV A C12 1 
HETATM 4789 C C15 . 2CV I 3 .   ? -10.091 -14.795 9.057  1.00 77.07  ? 505  2CV A C15 1 
HETATM 4790 C C18 . 2CV I 3 .   ? -8.904  -13.870 8.779  1.00 80.72  ? 505  2CV A C18 1 
HETATM 4791 C C21 . 2CV I 3 .   ? -7.762  -14.637 8.093  1.00 85.99  ? 505  2CV A C21 1 
HETATM 4792 C C24 . 2CV I 3 .   ? -6.771  -13.691 7.405  1.00 90.60  ? 505  2CV A C24 1 
HETATM 4793 C C27 . 2CV I 3 .   ? -7.423  -12.984 6.206  1.00 95.25  ? 505  2CV A C27 1 
HETATM 4794 C C30 . 2CV I 3 .   ? -6.654  -13.275 4.913  1.00 99.28  ? 505  2CV A C30 1 
HETATM 4795 N N33 . 2CV I 3 .   ? -6.094  -12.224 4.295  1.00 99.95  ? 505  2CV A N33 1 
HETATM 4796 O O34 . 2CV I 3 .   ? -6.599  -14.430 4.485  1.00 102.93 ? 505  2CV A O34 1 
HETATM 4797 C C35 . 2CV I 3 .   ? -6.167  -10.856 4.858  1.00 97.82  ? 505  2CV A C35 1 
HETATM 4798 C C36 . 2CV I 3 .   ? -5.304  -12.419 3.064  1.00 102.74 ? 505  2CV A C36 1 
HETATM 4799 C C37 . 2CV I 3 .   ? -6.213  -12.556 1.840  1.00 104.97 ? 505  2CV A C37 1 
HETATM 4800 C C40 . 2CV I 3 .   ? -5.842  -13.797 0.999  1.00 106.53 ? 505  2CV A C40 1 
HETATM 4801 C C41 . 2CV I 3 .   ? -4.427  -13.733 0.361  1.00 106.94 ? 505  2CV A C41 1 
HETATM 4802 C C42 . 2CV I 3 .   ? -4.350  -12.846 -0.909 1.00 105.45 ? 505  2CV A C42 1 
HETATM 4803 C C43 . 2CV I 3 .   ? -3.408  -13.402 -1.984 1.00 104.11 ? 505  2CV A C43 1 
HETATM 4804 O O44 . 2CV I 3 .   ? -4.051  -13.326 -3.258 1.00 103.78 ? 505  2CV A O44 1 
HETATM 4805 O O47 . 2CV I 3 .   ? -6.130  -11.353 1.067  1.00 107.67 ? 505  2CV A O47 1 
HETATM 4806 O O49 . 2CV I 3 .   ? -6.855  -14.057 0.006  1.00 108.43 ? 505  2CV A O49 1 
HETATM 4807 O O51 . 2CV I 3 .   ? -3.981  -15.075 0.093  1.00 108.55 ? 505  2CV A O51 1 
HETATM 4808 O O53 . 2CV I 3 .   ? -3.910  -11.535 -0.536 1.00 105.13 ? 505  2CV A O53 1 
HETATM 4809 C C60 . 2CV I 3 .   ? -6.735  -9.845  3.859  1.00 94.60  ? 505  2CV A C60 1 
HETATM 4810 O O63 . 2CV I 3 .   ? -6.721  -8.553  4.457  1.00 93.60  ? 505  2CV A O63 1 
HETATM 4811 C C1  . 2CV I 3 .   ? -13.606 -14.997 10.022 1.00 61.39  ? 505  2CV A C1  1 
HETATM 4812 C C0  . 2CV I 3 .   ? -14.536 -15.411 11.168 1.00 54.24  ? 505  2CV A C0  1 
HETATM 4813 O O3  . Y00 J 4 .   ? -33.522 -16.734 26.443 1.00 70.83  ? 601  Y00 A O3  1 
HETATM 4814 C C16 . Y00 J 4 .   ? -32.228 -16.485 26.129 1.00 66.18  ? 601  Y00 A C16 1 
HETATM 4815 C C15 . Y00 J 4 .   ? -31.212 -16.867 27.004 1.00 65.84  ? 601  Y00 A C15 1 
HETATM 4816 C C14 . Y00 J 4 .   ? -29.881 -16.607 26.680 1.00 66.04  ? 601  Y00 A C14 1 
HETATM 4817 C C17 . Y00 J 4 .   ? -31.933 -15.858 24.925 1.00 65.96  ? 601  Y00 A C17 1 
HETATM 4818 C C18 . Y00 J 4 .   ? -30.605 -15.598 24.599 1.00 67.04  ? 601  Y00 A C18 1 
HETATM 4819 C C13 . Y00 J 4 .   ? -29.574 -15.971 25.470 1.00 66.24  ? 601  Y00 A C13 1 
HETATM 4820 C C12 . Y00 J 4 .   ? -28.144 -15.656 25.067 1.00 60.77  ? 601  Y00 A C12 1 
HETATM 4821 C C11 . Y00 J 4 .   ? -27.113 -16.400 25.907 1.00 51.88  ? 601  Y00 A C11 1 
HETATM 4822 C C9  . Y00 J 4 .   ? -25.703 -16.275 25.338 1.00 46.45  ? 601  Y00 A C9  1 
HETATM 4823 C C10 . Y00 J 4 .   ? -25.527 -17.034 24.023 1.00 45.15  ? 601  Y00 A C10 1 
HETATM 4824 N N1  . Y00 J 4 .   ? -25.320 -14.885 25.195 1.00 42.52  ? 601  Y00 A N1  1 
HETATM 4825 C C8  . Y00 J 4 .   ? -23.927 -14.537 25.432 1.00 40.72  ? 601  Y00 A C8  1 
HETATM 4826 C C1  . Y00 J 4 .   ? -23.748 -13.064 25.758 1.00 41.73  ? 601  Y00 A C1  1 
HETATM 4827 C C2  . Y00 J 4 .   ? -22.302 -12.695 25.988 1.00 46.87  ? 601  Y00 A C2  1 
HETATM 4828 C C7  . Y00 J 4 .   ? -21.636 -13.146 27.129 1.00 45.41  ? 601  Y00 A C7  1 
HETATM 4829 C C6  . Y00 J 4 .   ? -20.313 -12.783 27.314 1.00 47.63  ? 601  Y00 A C6  1 
HETATM 4830 O O1  . Y00 J 4 .   ? -19.627 -13.202 28.407 1.00 52.29  ? 601  Y00 A O1  1 
HETATM 4831 C C5  . Y00 J 4 .   ? -19.638 -11.929 26.312 1.00 49.49  ? 601  Y00 A C5  1 
HETATM 4832 O O2  . Y00 J 4 .   ? -18.336 -11.584 26.501 1.00 57.37  ? 601  Y00 A O2  1 
HETATM 4833 C C4  . Y00 J 4 .   ? -20.332 -11.494 25.193 1.00 47.03  ? 601  Y00 A C4  1 
HETATM 4834 C C3  . Y00 J 4 .   ? -21.656 -11.885 25.039 1.00 48.76  ? 601  Y00 A C3  1 
HETATM 4835 C CAA . Y01 K 2 .   ? -5.247  -6.815  25.664 1.00 32.43  ? 401  Y01 B CAA 1 
HETATM 4836 C CBA . Y01 K 2 .   ? -4.887  -7.769  26.776 1.00 27.23  ? 401  Y01 B CBA 1 
HETATM 4837 C CAB . Y01 K 2 .   ? -5.227  -9.204  26.339 1.00 25.09  ? 401  Y01 B CAB 1 
HETATM 4838 C CAN . Y01 K 2 .   ? -5.614  -7.350  28.046 1.00 31.27  ? 401  Y01 B CAN 1 
HETATM 4839 C CAJ . Y01 K 2 .   ? -4.831  -7.698  29.308 1.00 35.49  ? 401  Y01 B CAJ 1 
HETATM 4840 C CAO . Y01 K 2 .   ? -5.453  -7.033  30.553 1.00 38.64  ? 401  Y01 B CAO 1 
HETATM 4841 C CBB . Y01 K 2 .   ? -4.914  -7.768  31.798 1.00 40.37  ? 401  Y01 B CBB 1 
HETATM 4842 C CAC . Y01 K 2 .   ? -3.471  -7.320  32.096 1.00 40.13  ? 401  Y01 B CAC 1 
HETATM 4843 C CBE . Y01 K 2 .   ? -5.771  -7.730  33.117 1.00 37.12  ? 401  Y01 B CBE 1 
HETATM 4844 C CAP . Y01 K 2 .   ? -6.593  -6.442  33.388 1.00 34.80  ? 401  Y01 B CAP 1 
HETATM 4845 C CAQ . Y01 K 2 .   ? -7.622  -6.886  34.459 1.00 34.18  ? 401  Y01 B CAQ 1 
HETATM 4846 C CBG . Y01 K 2 .   ? -7.309  -8.388  34.687 1.00 34.34  ? 401  Y01 B CBG 1 
HETATM 4847 C CBI . Y01 K 2 .   ? -6.795  -8.876  33.328 1.00 35.57  ? 401  Y01 B CBI 1 
HETATM 4848 C CAE . Y01 K 2 .   ? -7.874  -8.973  32.222 1.00 34.09  ? 401  Y01 B CAE 1 
HETATM 4849 C CAU . Y01 K 2 .   ? -6.147  -10.253 33.549 1.00 37.29  ? 401  Y01 B CAU 1 
HETATM 4850 C CAS . Y01 K 2 .   ? -7.105  -11.268 34.213 1.00 36.50  ? 401  Y01 B CAS 1 
HETATM 4851 C CBF . Y01 K 2 .   ? -7.965  -10.725 35.394 1.00 36.27  ? 401  Y01 B CBF 1 
HETATM 4852 C CBD . Y01 K 2 .   ? -8.462  -9.273  35.187 1.00 32.83  ? 401  Y01 B CBD 1 
HETATM 4853 C CAK . Y01 K 2 .   ? -9.125  -8.693  36.443 1.00 30.62  ? 401  Y01 B CAK 1 
HETATM 4854 C CAI . Y01 K 2 .   ? -9.911  -9.627  37.098 1.00 32.59  ? 401  Y01 B CAI 1 
HETATM 4855 C CAZ . Y01 K 2 .   ? -9.988  -10.997 36.849 1.00 38.74  ? 401  Y01 B CAZ 1 
HETATM 4856 C CAV . Y01 K 2 .   ? -10.916 -11.849 37.729 1.00 42.08  ? 401  Y01 B CAV 1 
HETATM 4857 C CBH . Y01 K 2 .   ? -9.136  -11.671 35.745 1.00 36.92  ? 401  Y01 B CBH 1 
HETATM 4858 C CAD . Y01 K 2 .   ? -9.997  -11.959 34.510 1.00 35.35  ? 401  Y01 B CAD 1 
HETATM 4859 C CAT . Y01 K 2 .   ? -8.598  -13.010 36.280 1.00 39.90  ? 401  Y01 B CAT 1 
HETATM 4860 C CAR . Y01 K 2 .   ? -9.660  -13.807 37.044 1.00 44.17  ? 401  Y01 B CAR 1 
HETATM 4861 C CBC . Y01 K 2 .   ? -10.050 -12.974 38.288 1.00 50.86  ? 401  Y01 B CBC 1 
HETATM 4862 O OAW . Y01 K 2 .   ? -10.595 -13.619 39.515 1.00 57.21  ? 401  Y01 B OAW 1 
HETATM 4863 C CAY . Y01 K 2 .   ? -11.440 -14.638 39.319 1.00 53.81  ? 401  Y01 B CAY 1 
HETATM 4864 O OAG . Y01 K 2 .   ? -12.180 -14.613 38.347 1.00 57.59  ? 401  Y01 B OAG 1 
HETATM 4865 C CAM . Y01 K 2 .   ? -11.524 -15.750 40.334 1.00 52.64  ? 401  Y01 B CAM 1 
HETATM 4866 C CAL . Y01 K 2 .   ? -12.962 -15.753 40.836 1.00 54.87  ? 401  Y01 B CAL 1 
HETATM 4867 C CAX . Y01 K 2 .   ? -13.461 -17.126 41.247 1.00 57.92  ? 401  Y01 B CAX 1 
HETATM 4868 O OAH . Y01 K 2 .   ? -14.114 -17.158 42.312 1.00 58.08  ? 401  Y01 B OAH 1 
HETATM 4869 O OAF . Y01 K 2 .   ? -13.210 -18.098 40.489 1.00 58.40  ? 401  Y01 B OAF 1 
HETATM 4870 C CAA . Y01 L 2 .   ? 3.966   -23.641 27.381 1.00 56.38  ? 402  Y01 B CAA 1 
HETATM 4871 C CBA . Y01 L 2 .   ? 5.134   -23.348 28.327 1.00 54.12  ? 402  Y01 B CBA 1 
HETATM 4872 C CAB . Y01 L 2 .   ? 6.413   -23.954 27.757 1.00 54.55  ? 402  Y01 B CAB 1 
HETATM 4873 C CAN . Y01 L 2 .   ? 4.863   -23.889 29.741 1.00 53.16  ? 402  Y01 B CAN 1 
HETATM 4874 C CAJ . Y01 L 2 .   ? 3.892   -22.990 30.517 1.00 49.42  ? 402  Y01 B CAJ 1 
HETATM 4875 C CAO . Y01 L 2 .   ? 3.944   -23.317 32.003 1.00 48.07  ? 402  Y01 B CAO 1 
HETATM 4876 C CBB . Y01 L 2 .   ? 2.632   -22.990 32.735 1.00 49.93  ? 402  Y01 B CBB 1 
HETATM 4877 C CAC . Y01 L 2 .   ? 1.645   -24.155 32.611 1.00 48.49  ? 402  Y01 B CAC 1 
HETATM 4878 C CBE . Y01 L 2 .   ? 2.974   -22.599 34.191 1.00 51.16  ? 402  Y01 B CBE 1 
HETATM 4879 C CAP . Y01 L 2 .   ? 3.725   -21.245 34.180 1.00 54.14  ? 402  Y01 B CAP 1 
HETATM 4880 C CAQ . Y01 L 2 .   ? 3.237   -20.473 35.414 1.00 54.51  ? 402  Y01 B CAQ 1 
HETATM 4881 C CBG . Y01 L 2 .   ? 2.677   -21.620 36.246 1.00 54.99  ? 402  Y01 B CBG 1 
HETATM 4882 C CBI . Y01 L 2 .   ? 1.821   -22.365 35.208 1.00 54.79  ? 402  Y01 B CBI 1 
HETATM 4883 C CAE . Y01 L 2 .   ? 0.646   -21.519 34.639 1.00 55.10  ? 402  Y01 B CAE 1 
HETATM 4884 C CAU . Y01 L 2 .   ? 1.296   -23.665 35.869 1.00 55.19  ? 402  Y01 B CAU 1 
HETATM 4885 C CAS . Y01 L 2 .   ? 0.594   -23.442 37.239 1.00 55.35  ? 402  Y01 B CAS 1 
HETATM 4886 C CBF . Y01 L 2 .   ? 1.350   -22.489 38.216 1.00 57.23  ? 402  Y01 B CBF 1 
HETATM 4887 C CBD . Y01 L 2 .   ? 1.910   -21.223 37.511 1.00 54.93  ? 402  Y01 B CBD 1 
HETATM 4888 C CAK . Y01 L 2 .   ? 2.801   -20.400 38.446 1.00 54.48  ? 402  Y01 B CAK 1 
HETATM 4889 C CAI . Y01 L 2 .   ? 2.266   -20.258 39.718 1.00 54.44  ? 402  Y01 B CAI 1 
HETATM 4890 C CAZ . Y01 L 2 .   ? 1.218   -20.985 40.262 1.00 56.92  ? 402  Y01 B CAZ 1 
HETATM 4891 C CAV . Y01 L 2 .   ? 0.797   -20.653 41.688 1.00 61.43  ? 402  Y01 B CAV 1 
HETATM 4892 C CBH . Y01 L 2 .   ? 0.505   -22.112 39.464 1.00 58.41  ? 402  Y01 B CBH 1 
HETATM 4893 C CAD . Y01 L 2 .   ? -0.906  -21.630 39.058 1.00 58.35  ? 402  Y01 B CAD 1 
HETATM 4894 C CAT . Y01 L 2 .   ? 0.389   -23.335 40.395 1.00 61.79  ? 402  Y01 B CAT 1 
HETATM 4895 C CAR . Y01 L 2 .   ? -0.206  -22.978 41.772 1.00 64.33  ? 402  Y01 B CAR 1 
HETATM 4896 C CBC . Y01 L 2 .   ? 0.677   -21.938 42.510 1.00 68.54  ? 402  Y01 B CBC 1 
HETATM 4897 O OAW . Y01 L 2 .   ? 0.165   -21.580 43.818 1.00 77.23  ? 402  Y01 B OAW 1 
HETATM 4898 C CAY . Y01 L 2 .   ? 0.126   -22.626 44.697 1.00 81.16  ? 402  Y01 B CAY 1 
HETATM 4899 O OAG . Y01 L 2 .   ? -0.974  -22.932 45.164 1.00 82.60  ? 402  Y01 B OAG 1 
HETATM 4900 C CAM . Y01 L 2 .   ? 1.421   -23.402 45.071 1.00 81.74  ? 402  Y01 B CAM 1 
HETATM 4901 C CAL . Y01 L 2 .   ? 1.778   -23.306 46.562 1.00 83.40  ? 402  Y01 B CAL 1 
HETATM 4902 C CAX . Y01 L 2 .   ? 0.662   -23.889 47.449 1.00 84.34  ? 402  Y01 B CAX 1 
HETATM 4903 O OAH . Y01 L 2 .   ? -0.060  -23.066 48.063 1.00 83.28  ? 402  Y01 B OAH 1 
HETATM 4904 O OAF . Y01 L 2 .   ? 0.540   -25.138 47.473 1.00 83.72  ? 402  Y01 B OAF 1 
HETATM 4905 C C9  . 2CV M 3 .   ? -3.584  -11.101 15.273 1.00 30.04  ? 501  2CV B C9  1 
HETATM 4906 C C12 . 2CV M 3 .   ? -3.284  -10.306 13.995 1.00 31.76  ? 501  2CV B C12 1 
HETATM 4907 C C15 . 2CV M 3 .   ? -3.860  -11.048 12.782 1.00 31.39  ? 501  2CV B C15 1 
HETATM 4908 C C18 . 2CV M 3 .   ? -3.732  -10.213 11.517 1.00 33.62  ? 501  2CV B C18 1 
HETATM 4909 C C21 . 2CV M 3 .   ? -4.321  -10.947 10.305 1.00 40.50  ? 501  2CV B C21 1 
HETATM 4910 C C24 . 2CV M 3 .   ? -4.118  -10.152 9.008  1.00 42.45  ? 501  2CV B C24 1 
HETATM 4911 C C27 . 2CV M 3 .   ? -3.565  -11.061 7.909  1.00 43.93  ? 501  2CV B C27 1 
HETATM 4912 C C30 . 2CV M 3 .   ? -3.219  -10.298 6.623  1.00 49.17  ? 501  2CV B C30 1 
HETATM 4913 N N33 . 2CV M 3 .   ? -2.444  -10.903 5.695  1.00 55.12  ? 501  2CV B N33 1 
HETATM 4914 O O34 . 2CV M 3 .   ? -3.659  -9.161  6.459  1.00 48.88  ? 501  2CV B O34 1 
HETATM 4915 C C35 . 2CV M 3 .   ? -1.877  -12.289 5.735  1.00 53.72  ? 501  2CV B C35 1 
HETATM 4916 C C36 . 2CV M 3 .   ? -2.124  -10.167 4.453  1.00 57.82  ? 501  2CV B C36 1 
HETATM 4917 C C37 . 2CV M 3 .   ? -0.847  -9.339  4.606  1.00 58.82  ? 501  2CV B C37 1 
HETATM 4918 C C40 . 2CV M 3 .   ? -1.161  -7.854  4.486  1.00 62.05  ? 501  2CV B C40 1 
HETATM 4919 O O47 . 2CV M 3 .   ? 0.057   -9.705  3.555  1.00 58.60  ? 501  2CV B O47 1 
HETATM 4920 O O49 . 2CV M 3 .   ? -0.530  -7.332  3.303  1.00 66.56  ? 501  2CV B O49 1 
HETATM 4921 C C60 . 2CV M 3 .   ? -2.310  -13.191 6.896  1.00 54.36  ? 501  2CV B C60 1 
HETATM 4922 O O63 . 2CV M 3 .   ? -3.313  -14.114 6.444  1.00 58.34  ? 501  2CV B O63 1 
HETATM 4923 C C1  . 2CV M 3 .   ? -3.018  -10.379 16.488 1.00 34.65  ? 501  2CV B C1  1 
HETATM 4924 C C0  . 2CV M 3 .   ? -3.025  -11.247 17.746 1.00 36.18  ? 501  2CV B C0  1 
HETATM 4925 C C9  . 2CV N 3 .   ? 4.827   1.654   42.630 1.00 53.10  ? 502  2CV B C9  1 
HETATM 4926 C C12 . 2CV N 3 .   ? 4.872   2.948   43.459 1.00 56.85  ? 502  2CV B C12 1 
HETATM 4927 C C15 . 2CV N 3 .   ? 5.526   2.752   44.846 1.00 62.27  ? 502  2CV B C15 1 
HETATM 4928 C C18 . 2CV N 3 .   ? 5.371   4.005   45.733 1.00 64.97  ? 502  2CV B C18 1 
HETATM 4929 C C21 . 2CV N 3 .   ? 6.143   3.927   47.058 1.00 68.25  ? 502  2CV B C21 1 
HETATM 4930 C C24 . 2CV N 3 .   ? 6.428   5.330   47.613 1.00 74.78  ? 502  2CV B C24 1 
HETATM 4931 C C27 . 2CV N 3 .   ? 7.839   5.449   48.224 1.00 82.82  ? 502  2CV B C27 1 
HETATM 4932 C C30 . 2CV N 3 .   ? 8.563   6.773   47.838 1.00 92.48  ? 502  2CV B C30 1 
HETATM 4933 N N33 . 2CV N 3 .   ? 9.343   7.349   48.786 1.00 97.18  ? 502  2CV B N33 1 
HETATM 4934 O O34 . 2CV N 3 .   ? 8.426   7.246   46.703 1.00 94.01  ? 502  2CV B O34 1 
HETATM 4935 C C35 . 2CV N 3 .   ? 9.522   6.752   50.141 1.00 96.39  ? 502  2CV B C35 1 
HETATM 4936 C C36 . 2CV N 3 .   ? 10.089  8.601   48.490 1.00 96.42  ? 502  2CV B C36 1 
HETATM 4937 C C60 . 2CV N 3 .   ? 8.806   7.564   51.240 1.00 92.82  ? 502  2CV B C60 1 
HETATM 4938 O O63 . 2CV N 3 .   ? 7.750   6.785   51.811 1.00 86.70  ? 502  2CV B O63 1 
HETATM 4939 C C1  . 2CV N 3 .   ? 3.429   1.015   42.654 1.00 50.68  ? 502  2CV B C1  1 
HETATM 4940 C C0  . 2CV N 3 .   ? 3.481   -0.523  42.668 1.00 44.28  ? 502  2CV B C0  1 
HETATM 4941 C C9  . 2CV O 3 .   ? -1.733  1.593   8.199  1.00 75.78  ? 503  2CV B C9  1 
HETATM 4942 C C12 . 2CV O 3 .   ? -0.206  1.670   8.015  1.00 79.43  ? 503  2CV B C12 1 
HETATM 4943 C C15 . 2CV O 3 .   ? 0.240   1.786   6.539  1.00 82.33  ? 503  2CV B C15 1 
HETATM 4944 C C18 . 2CV O 3 .   ? 1.775   1.841   6.408  1.00 85.25  ? 503  2CV B C18 1 
HETATM 4945 C C21 . 2CV O 3 .   ? 2.228   2.472   5.076  1.00 89.58  ? 503  2CV B C21 1 
HETATM 4946 C C24 . 2CV O 3 .   ? 3.758   2.709   5.036  1.00 94.00  ? 503  2CV B C24 1 
HETATM 4947 C C27 . 2CV O 3 .   ? 4.274   3.073   3.619  1.00 96.53  ? 503  2CV B C27 1 
HETATM 4948 C C30 . 2CV O 3 .   ? 4.866   4.506   3.552  1.00 99.21  ? 503  2CV B C30 1 
HETATM 4949 N N33 . 2CV O 3 .   ? 5.494   4.859   2.411  1.00 100.62 ? 503  2CV B N33 1 
HETATM 4950 O O34 . 2CV O 3 .   ? 4.749   5.265   4.518  1.00 100.02 ? 503  2CV B O34 1 
HETATM 4951 C C35 . 2CV O 3 .   ? 5.606   3.935   1.261  1.00 101.59 ? 503  2CV B C35 1 
HETATM 4952 C C36 . 2CV O 3 .   ? 6.076   6.213   2.251  1.00 99.61  ? 503  2CV B C36 1 
HETATM 4953 C C60 . 2CV O 3 .   ? 7.074   3.661   0.904  1.00 100.41 ? 503  2CV B C60 1 
HETATM 4954 O O63 . 2CV O 3 .   ? 7.221   2.260   0.644  1.00 100.69 ? 503  2CV B O63 1 
HETATM 4955 C C1  . 2CV O 3 .   ? -2.189  2.550   9.317  1.00 75.65  ? 503  2CV B C1  1 
HETATM 4956 C C0  . 2CV O 3 .   ? -3.630  2.290   9.788  1.00 74.80  ? 503  2CV B C0  1 
HETATM 4957 C C15 . 2CV P 3 .   ? 23.935  -9.576  18.652 1.00 49.84  ? 504  2CV B C15 1 
HETATM 4958 C C18 . 2CV P 3 .   ? 24.081  -10.316 19.994 1.00 50.82  ? 504  2CV B C18 1 
HETATM 4959 C C21 . 2CV P 3 .   ? 23.498  -9.532  21.181 1.00 51.00  ? 504  2CV B C21 1 
HETATM 4960 C C24 . 2CV P 3 .   ? 23.354  -10.439 22.422 1.00 54.56  ? 504  2CV B C24 1 
HETATM 4961 C C27 . 2CV P 3 .   ? 24.062  -9.858  23.668 1.00 58.55  ? 504  2CV B C27 1 
HETATM 4962 C C30 . 2CV P 3 .   ? 23.883  -10.731 24.930 1.00 61.74  ? 504  2CV B C30 1 
HETATM 4963 N N33 . 2CV P 3 .   ? 23.602  -10.071 26.057 1.00 60.95  ? 504  2CV B N33 1 
HETATM 4964 O O34 . 2CV P 3 .   ? 24.007  -11.954 24.877 1.00 64.93  ? 504  2CV B O34 1 
HETATM 4965 C C9  . 2CV Q 3 .   ? -1.497  -21.776 29.488 1.00 43.29  ? 505  2CV B C9  1 
HETATM 4966 C C12 . 2CV Q 3 .   ? -2.263  -22.666 30.465 1.00 44.98  ? 505  2CV B C12 1 
HETATM 4967 C C15 . 2CV Q 3 .   ? -3.780  -22.529 30.283 1.00 49.60  ? 505  2CV B C15 1 
HETATM 4968 C C18 . 2CV Q 3 .   ? -4.523  -22.319 31.619 1.00 50.12  ? 505  2CV B C18 1 
HETATM 4969 C C21 . 2CV Q 3 .   ? -5.573  -23.414 31.807 1.00 56.50  ? 505  2CV B C21 1 
HETATM 4970 C C24 . 2CV Q 3 .   ? -6.925  -22.873 32.275 1.00 64.25  ? 505  2CV B C24 1 
HETATM 4971 C C27 . 2CV Q 3 .   ? -7.023  -22.929 33.809 1.00 74.39  ? 505  2CV B C27 1 
HETATM 4972 C C30 . 2CV Q 3 .   ? -7.864  -24.110 34.360 1.00 80.37  ? 505  2CV B C30 1 
HETATM 4973 N N33 . 2CV Q 3 .   ? -8.108  -24.084 35.685 1.00 82.97  ? 505  2CV B N33 1 
HETATM 4974 O O34 . 2CV Q 3 .   ? -8.248  -25.009 33.609 1.00 82.10  ? 505  2CV B O34 1 
HETATM 4975 C C35 . 2CV Q 3 .   ? -7.673  -22.926 36.503 1.00 83.89  ? 505  2CV B C35 1 
HETATM 4976 C C36 . 2CV Q 3 .   ? -8.933  -25.133 36.333 1.00 87.77  ? 505  2CV B C36 1 
HETATM 4977 C C37 . 2CV Q 3 .   ? -8.225  -26.506 36.421 1.00 93.23  ? 505  2CV B C37 1 
HETATM 4978 C C40 . 2CV Q 3 .   ? -9.078  -27.605 37.118 1.00 95.81  ? 505  2CV B C40 1 
HETATM 4979 C C41 . 2CV Q 3 .   ? -9.945  -27.099 38.305 1.00 96.98  ? 505  2CV B C41 1 
HETATM 4980 C C42 . 2CV Q 3 .   ? -9.425  -27.430 39.723 1.00 96.34  ? 505  2CV B C42 1 
HETATM 4981 C C43 . 2CV Q 3 .   ? -10.287 -26.762 40.805 1.00 94.55  ? 505  2CV B C43 1 
HETATM 4982 O O44 . 2CV Q 3 .   ? -11.336 -27.651 41.198 1.00 91.35  ? 505  2CV B O44 1 
HETATM 4983 O O47 . 2CV Q 3 .   ? -6.964  -26.363 37.078 1.00 94.51  ? 505  2CV B O47 1 
HETATM 4984 O O49 . 2CV Q 3 .   ? -8.255  -28.716 37.511 1.00 97.21  ? 505  2CV B O49 1 
HETATM 4985 O O51 . 2CV Q 3 .   ? -11.248 -27.662 38.142 1.00 99.09  ? 505  2CV B O51 1 
HETATM 4986 O O53 . 2CV Q 3 .   ? -8.079  -26.984 39.892 1.00 97.28  ? 505  2CV B O53 1 
HETATM 4987 C C60 . 2CV Q 3 .   ? -7.005  -23.306 37.823 1.00 85.59  ? 505  2CV B C60 1 
HETATM 4988 O O63 . 2CV Q 3 .   ? -7.263  -22.268 38.772 1.00 88.56  ? 505  2CV B O63 1 
HETATM 4989 C C1  . 2CV Q 3 .   ? -0.251  -22.498 28.982 1.00 46.44  ? 505  2CV B C1  1 
HETATM 4990 C C0  . 2CV Q 3 .   ? 0.618   -21.583 28.118 1.00 48.04  ? 505  2CV B C0  1 
HETATM 4991 O O3  . Y00 R 4 .   ? 19.134  -13.670 17.450 1.00 53.49  ? 601  Y00 B O3  1 
HETATM 4992 C C16 . Y00 R 4 .   ? 17.823  -13.335 17.455 1.00 49.46  ? 601  Y00 B C16 1 
HETATM 4993 C C15 . Y00 R 4 .   ? 17.205  -13.009 16.254 1.00 51.06  ? 601  Y00 B C15 1 
HETATM 4994 C C14 . Y00 R 4 .   ? 15.857  -12.664 16.231 1.00 52.99  ? 601  Y00 B C14 1 
HETATM 4995 C C17 . Y00 R 4 .   ? 17.106  -13.326 18.644 1.00 52.70  ? 601  Y00 B C17 1 
HETATM 4996 C C18 . Y00 R 4 .   ? 15.751  -12.975 18.630 1.00 54.05  ? 601  Y00 B C18 1 
HETATM 4997 C C13 . Y00 R 4 .   ? 15.129  -12.645 17.421 1.00 52.03  ? 601  Y00 B C13 1 
HETATM 4998 C C12 . Y00 R 4 .   ? 13.673  -12.256 17.370 1.00 47.62  ? 601  Y00 B C12 1 
HETATM 4999 C C11 . Y00 R 4 .   ? 12.823  -13.406 17.861 1.00 41.29  ? 601  Y00 B C11 1 
HETATM 5000 C C9  . Y00 R 4 .   ? 11.344  -13.137 17.673 1.00 40.99  ? 601  Y00 B C9  1 
HETATM 5001 C C10 . Y00 R 4 .   ? 10.641  -14.487 17.628 1.00 38.84  ? 601  Y00 B C10 1 
HETATM 5002 N N1  . Y00 R 4 .   ? 10.843  -12.316 18.775 1.00 40.30  ? 601  Y00 B N1  1 
HETATM 5003 C C8  . Y00 R 4 .   ? 9.533   -11.693 18.757 1.00 31.19  ? 601  Y00 B C8  1 
HETATM 5004 C C1  . Y00 R 4 .   ? 9.342   -10.736 19.935 1.00 37.22  ? 601  Y00 B C1  1 
HETATM 5005 C C2  . Y00 R 4 .   ? 7.897   -10.269 19.995 1.00 38.62  ? 601  Y00 B C2  1 
HETATM 5006 C C7  . Y00 R 4 .   ? 7.332   -9.685  18.855 1.00 38.79  ? 601  Y00 B C7  1 
HETATM 5007 C C6  . Y00 R 4 .   ? 6.011   -9.263  18.876 1.00 38.00  ? 601  Y00 B C6  1 
HETATM 5008 O O1  . Y00 R 4 .   ? 5.434   -8.692  17.791 1.00 36.66  ? 601  Y00 B O1  1 
HETATM 5009 C C5  . Y00 R 4 .   ? 5.226   -9.437  20.117 1.00 39.46  ? 601  Y00 B C5  1 
HETATM 5010 O O2  . Y00 R 4 .   ? 3.943   -9.015  20.111 1.00 39.13  ? 601  Y00 B O2  1 
HETATM 5011 C C4  . Y00 R 4 .   ? 5.815   -10.022 21.246 1.00 37.84  ? 601  Y00 B C4  1 
HETATM 5012 C C3  . Y00 R 4 .   ? 7.147   -10.434 21.170 1.00 37.54  ? 601  Y00 B C3  1 
HETATM 5013 O O   . HOH S 5 .   ? -25.326 -2.288  10.759 1.00 37.72  ? 2001 HOH A O   1 
HETATM 5014 O O   . HOH S 5 .   ? -23.703 -4.134  15.248 1.00 54.57  ? 2002 HOH A O   1 
HETATM 5015 O O   . HOH S 5 .   ? -34.292 -24.464 20.179 1.00 52.27  ? 2003 HOH A O   1 
HETATM 5016 O O   . HOH S 5 .   ? -30.878 -30.104 21.754 1.00 49.31  ? 2004 HOH A O   1 
HETATM 5017 O O   . HOH S 5 .   ? -24.269 -10.913 19.168 1.00 22.55  ? 2005 HOH A O   1 
HETATM 5018 O O   . HOH S 5 .   ? -24.037 -8.387  18.063 1.00 42.75  ? 2006 HOH A O   1 
HETATM 5019 O O   . HOH S 5 .   ? -23.484 -6.804  15.905 1.00 37.37  ? 2007 HOH A O   1 
HETATM 5020 O O   . HOH S 5 .   ? -12.319 -6.780  21.408 1.00 43.03  ? 2008 HOH A O   1 
HETATM 5021 O O   . HOH S 5 .   ? -16.957 -18.935 39.104 1.00 58.37  ? 2009 HOH A O   1 
HETATM 5022 O O   . HOH S 5 .   ? -15.097 -16.557 24.092 1.00 28.12  ? 2010 HOH A O   1 
HETATM 5023 O O   . HOH S 5 .   ? -25.523 1.324   17.099 1.00 36.89  ? 2011 HOH A O   1 
HETATM 5024 O O   . HOH S 5 .   ? -28.080 -4.376  27.208 1.00 38.06  ? 2012 HOH A O   1 
HETATM 5025 O O   . HOH S 5 .   ? -26.730 -6.902  18.013 1.00 37.36  ? 2013 HOH A O   1 
HETATM 5026 O O   . HOH S 5 .   ? -25.025 -4.992  17.552 1.00 29.17  ? 2014 HOH A O   1 
HETATM 5027 O O   . HOH S 5 .   ? -27.529 -1.919  13.492 1.00 39.03  ? 2015 HOH A O   1 
HETATM 5028 O O   . HOH S 5 .   ? -32.528 -2.769  10.039 1.00 51.03  ? 2016 HOH A O   1 
HETATM 5029 O O   . HOH S 5 .   ? -23.785 -1.487  15.134 1.00 51.27  ? 2017 HOH A O   1 
HETATM 5030 O O   . HOH S 5 .   ? -23.368 -0.771  9.586  1.00 56.63  ? 2018 HOH A O   1 
HETATM 5031 O O   . HOH S 5 .   ? -0.105  -5.985  6.827  1.00 31.15  ? 2019 HOH A O   1 
HETATM 5032 O O   . HOH S 5 .   ? -13.880 -18.858 37.895 1.00 43.46  ? 2020 HOH A O   1 
HETATM 5033 O O   . HOH T 5 .   ? 9.937   -11.535 32.187 1.00 39.57  ? 2001 HOH B O   1 
HETATM 5034 O O   . HOH T 5 .   ? 11.341  -12.786 37.597 1.00 42.01  ? 2002 HOH B O   1 
HETATM 5035 O O   . HOH T 5 .   ? 19.836  -22.151 15.165 1.00 34.08  ? 2003 HOH B O   1 
HETATM 5036 O O   . HOH T 5 .   ? 16.513  -25.309 10.513 1.00 49.12  ? 2004 HOH B O   1 
HETATM 5037 O O   . HOH T 5 .   ? 11.193  -28.326 13.851 1.00 45.29  ? 2005 HOH B O   1 
HETATM 5038 O O   . HOH T 5 .   ? 10.180  -13.228 25.698 1.00 43.36  ? 2006 HOH B O   1 
HETATM 5039 O O   . HOH T 5 .   ? 10.032  -11.994 28.189 1.00 40.68  ? 2007 HOH B O   1 
HETATM 5040 O O   . HOH T 5 .   ? 9.574   -13.278 30.269 1.00 34.16  ? 2008 HOH B O   1 
HETATM 5041 O O   . HOH T 5 .   ? -12.135 -2.905  53.358 1.00 97.94  ? 2009 HOH B O   1 
HETATM 5042 O O   . HOH T 5 .   ? -3.236  -18.899 20.569 1.00 42.63  ? 2010 HOH B O   1 
HETATM 5043 O O   . HOH T 5 .   ? 3.052   -5.809  5.592  1.00 43.33  ? 2011 HOH B O   1 
HETATM 5044 O O   . HOH T 5 .   ? 1.001   -14.308 18.094 1.00 20.99  ? 2012 HOH B O   1 
HETATM 5045 O O   . HOH T 5 .   ? 13.902  -3.217  24.086 1.00 21.06  ? 2013 HOH B O   1 
HETATM 5046 O O   . HOH T 5 .   ? 10.686  -9.928  30.604 1.00 33.51  ? 2014 HOH B O   1 
HETATM 5047 O O   . HOH T 5 .   ? 12.753  -11.537 29.356 1.00 44.31  ? 2015 HOH B O   1 
HETATM 5048 O O   . HOH T 5 .   ? 18.946  -13.587 38.088 1.00 36.72  ? 2016 HOH B O   1 
HETATM 5049 O O   . HOH T 5 .   ? 9.110   -8.284  35.878 1.00 43.45  ? 2017 HOH B O   1 
HETATM 5050 O O   . HOH T 5 .   ? 14.014  -11.105 36.115 1.00 31.34  ? 2018 HOH B O   1 
HETATM 5051 O O   . HOH T 5 .   ? 11.874  -6.312  35.751 1.00 37.33  ? 2019 HOH B O   1 
HETATM 5052 O O   . HOH T 5 .   ? 9.772   -12.676 39.805 1.00 25.92  ? 2020 HOH B O   1 
HETATM 5053 O O   . HOH T 5 .   ? 6.650   -8.335  15.722 1.00 55.33  ? 2021 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   31  ?   ?   ?   A . n 
A 1 2   GLY 2   32  ?   ?   ?   A . n 
A 1 3   ALA 3   33  33  ALA ALA A . n 
A 1 4   GLU 4   34  34  GLU GLU A . n 
A 1 5   LEU 5   35  35  LEU LEU A . n 
A 1 6   LEU 6   36  36  LEU LEU A . n 
A 1 7   SER 7   37  37  SER SER A . n 
A 1 8   GLN 8   38  38  GLN GLN A . n 
A 1 9   GLN 9   39  39  GLN GLN A . n 
A 1 10  TRP 10  40  40  TRP TRP A . n 
A 1 11  GLU 11  41  41  GLU GLU A . n 
A 1 12  ALA 12  42  42  ALA ALA A . n 
A 1 13  GLY 13  43  43  GLY GLY A . n 
A 1 14  MET 14  44  44  MET MET A . n 
A 1 15  SER 15  45  45  SER SER A . n 
A 1 16  LEU 16  46  46  LEU LEU A . n 
A 1 17  LEU 17  47  47  LEU LEU A . n 
A 1 18  MET 18  48  48  MET MET A . n 
A 1 19  ALA 19  49  49  ALA ALA A . n 
A 1 20  LEU 20  50  50  LEU LEU A . n 
A 1 21  VAL 21  51  51  VAL VAL A . n 
A 1 22  VAL 22  52  52  VAL VAL A . n 
A 1 23  LEU 23  53  53  LEU LEU A . n 
A 1 24  LEU 24  54  54  LEU LEU A . n 
A 1 25  ILE 25  55  55  ILE ILE A . n 
A 1 26  VAL 26  56  56  VAL VAL A . n 
A 1 27  ALA 27  57  57  ALA ALA A . n 
A 1 28  GLY 28  58  58  GLY GLY A . n 
A 1 29  ASN 29  59  59  ASN ASN A . n 
A 1 30  VAL 30  60  60  VAL VAL A . n 
A 1 31  LEU 31  61  61  LEU LEU A . n 
A 1 32  VAL 32  62  62  VAL VAL A . n 
A 1 33  ILE 33  63  63  ILE ILE A . n 
A 1 34  ALA 34  64  64  ALA ALA A . n 
A 1 35  ALA 35  65  65  ALA ALA A . n 
A 1 36  ILE 36  66  66  ILE ILE A . n 
A 1 37  GLY 37  67  67  GLY GLY A . n 
A 1 38  SER 38  68  68  SER SER A . n 
A 1 39  THR 39  69  69  THR THR A . n 
A 1 40  GLN 40  70  70  GLN GLN A . n 
A 1 41  ARG 41  71  71  ARG ARG A . n 
A 1 42  LEU 42  72  72  LEU LEU A . n 
A 1 43  GLN 43  73  73  GLN GLN A . n 
A 1 44  THR 44  74  74  THR THR A . n 
A 1 45  LEU 45  75  75  LEU LEU A . n 
A 1 46  THR 46  76  76  THR THR A . n 
A 1 47  ASN 47  77  77  ASN ASN A . n 
A 1 48  LEU 48  78  78  LEU LEU A . n 
A 1 49  PHE 49  79  79  PHE PHE A . n 
A 1 50  ILE 50  80  80  ILE ILE A . n 
A 1 51  THR 51  81  81  THR THR A . n 
A 1 52  SER 52  82  82  SER SER A . n 
A 1 53  LEU 53  83  83  LEU LEU A . n 
A 1 54  ALA 54  84  84  ALA ALA A . n 
A 1 55  CYS 55  85  85  CYS CYS A . n 
A 1 56  ALA 56  86  86  ALA ALA A . n 
A 1 57  ASP 57  87  87  ASP ASP A . n 
A 1 58  LEU 58  88  88  LEU LEU A . n 
A 1 59  VAL 59  89  89  VAL VAL A . n 
A 1 60  VAL 60  90  90  VAL VAL A . n 
A 1 61  GLY 61  91  91  GLY GLY A . n 
A 1 62  LEU 62  92  92  LEU LEU A . n 
A 1 63  LEU 63  93  93  LEU LEU A . n 
A 1 64  VAL 64  94  94  VAL VAL A . n 
A 1 65  VAL 65  95  95  VAL VAL A . n 
A 1 66  PRO 66  96  96  PRO PRO A . n 
A 1 67  PHE 67  97  97  PHE PHE A . n 
A 1 68  GLY 68  98  98  GLY GLY A . n 
A 1 69  ALA 69  99  99  ALA ALA A . n 
A 1 70  THR 70  100 100 THR THR A . n 
A 1 71  LEU 71  101 101 LEU LEU A . n 
A 1 72  VAL 72  102 102 VAL VAL A . n 
A 1 73  VAL 73  103 103 VAL VAL A . n 
A 1 74  ARG 74  104 104 ARG ARG A . n 
A 1 75  GLY 75  105 105 GLY GLY A . n 
A 1 76  THR 76  106 106 THR THR A . n 
A 1 77  TRP 77  107 107 TRP TRP A . n 
A 1 78  LEU 78  108 108 LEU LEU A . n 
A 1 79  TRP 79  109 109 TRP TRP A . n 
A 1 80  GLY 80  110 110 GLY GLY A . n 
A 1 81  SER 81  111 111 SER SER A . n 
A 1 82  PHE 82  112 112 PHE PHE A . n 
A 1 83  LEU 83  113 113 LEU LEU A . n 
A 1 84  CYS 84  114 114 CYS CYS A . n 
A 1 85  GLU 85  115 115 GLU GLU A . n 
A 1 86  LEU 86  116 116 LEU LEU A . n 
A 1 87  TRP 87  117 117 TRP TRP A . n 
A 1 88  THR 88  118 118 THR THR A . n 
A 1 89  SER 89  119 119 SER SER A . n 
A 1 90  LEU 90  120 120 LEU LEU A . n 
A 1 91  ASP 91  121 121 ASP ASP A . n 
A 1 92  VAL 92  122 122 VAL VAL A . n 
A 1 93  LEU 93  123 123 LEU LEU A . n 
A 1 94  CYS 94  124 124 CYS CYS A . n 
A 1 95  VAL 95  125 125 VAL VAL A . n 
A 1 96  THR 96  126 126 THR THR A . n 
A 1 97  ALA 97  127 127 ALA ALA A . n 
A 1 98  SER 98  128 128 SER SER A . n 
A 1 99  ILE 99  129 129 ILE ILE A . n 
A 1 100 GLU 100 130 130 GLU GLU A . n 
A 1 101 THR 101 131 131 THR THR A . n 
A 1 102 LEU 102 132 132 LEU LEU A . n 
A 1 103 CYS 103 133 133 CYS CYS A . n 
A 1 104 VAL 104 134 134 VAL VAL A . n 
A 1 105 ILE 105 135 135 ILE ILE A . n 
A 1 106 ALA 106 136 136 ALA ALA A . n 
A 1 107 ILE 107 137 137 ILE ILE A . n 
A 1 108 ASP 108 138 138 ASP ASP A . n 
A 1 109 ARG 109 139 139 ARG ARG A . n 
A 1 110 TYR 110 140 140 TYR TYR A . n 
A 1 111 LEU 111 141 141 LEU LEU A . n 
A 1 112 ALA 112 142 142 ALA ALA A . n 
A 1 113 ILE 113 143 143 ILE ILE A . n 
A 1 114 THR 114 144 144 THR THR A . n 
A 1 115 SER 115 145 145 SER SER A . n 
A 1 116 PRO 116 146 146 PRO PRO A . n 
A 1 117 PHE 117 147 147 PHE PHE A . n 
A 1 118 ARG 118 148 148 ARG ARG A . n 
A 1 119 TYR 119 149 149 TYR TYR A . n 
A 1 120 GLN 120 150 150 GLN GLN A . n 
A 1 121 SER 121 151 151 SER SER A . n 
A 1 122 LEU 122 152 152 LEU LEU A . n 
A 1 123 MET 123 153 153 MET MET A . n 
A 1 124 THR 124 154 154 THR THR A . n 
A 1 125 ARG 125 155 155 ARG ARG A . n 
A 1 126 ALA 126 156 156 ALA ALA A . n 
A 1 127 ARG 127 157 157 ARG ARG A . n 
A 1 128 ALA 128 158 158 ALA ALA A . n 
A 1 129 LYS 129 159 159 LYS LYS A . n 
A 1 130 VAL 130 160 160 VAL VAL A . n 
A 1 131 ILE 131 161 161 ILE ILE A . n 
A 1 132 ILE 132 162 162 ILE ILE A . n 
A 1 133 CYS 133 163 163 CYS CYS A . n 
A 1 134 THR 134 164 164 THR THR A . n 
A 1 135 VAL 135 165 165 VAL VAL A . n 
A 1 136 TRP 136 166 166 TRP TRP A . n 
A 1 137 ALA 137 167 167 ALA ALA A . n 
A 1 138 ILE 138 168 168 ILE ILE A . n 
A 1 139 SER 139 169 169 SER SER A . n 
A 1 140 ALA 140 170 170 ALA ALA A . n 
A 1 141 LEU 141 171 171 LEU LEU A . n 
A 1 142 VAL 142 172 172 VAL VAL A . n 
A 1 143 SER 143 173 173 SER SER A . n 
A 1 144 PHE 144 174 174 PHE PHE A . n 
A 1 145 LEU 145 175 175 LEU LEU A . n 
A 1 146 PRO 146 176 176 PRO PRO A . n 
A 1 147 ILE 147 177 177 ILE ILE A . n 
A 1 148 MET 148 178 178 MET MET A . n 
A 1 149 MET 149 179 179 MET MET A . n 
A 1 150 HIS 150 180 180 HIS HIS A . n 
A 1 151 TRP 151 181 181 TRP TRP A . n 
A 1 152 TRP 152 182 182 TRP TRP A . n 
A 1 153 ARG 153 183 183 ARG ARG A . n 
A 1 154 ASP 154 184 184 ASP ASP A . n 
A 1 155 GLU 155 185 185 GLU GLU A . n 
A 1 156 ASP 156 186 186 ASP ASP A . n 
A 1 157 PRO 157 187 187 PRO PRO A . n 
A 1 158 GLN 158 188 188 GLN GLN A . n 
A 1 159 ALA 159 189 189 ALA ALA A . n 
A 1 160 LEU 160 190 190 LEU LEU A . n 
A 1 161 LYS 161 191 191 LYS LYS A . n 
A 1 162 CYS 162 192 192 CYS CYS A . n 
A 1 163 TYR 163 193 193 TYR TYR A . n 
A 1 164 GLN 164 194 194 GLN GLN A . n 
A 1 165 ASP 165 195 195 ASP ASP A . n 
A 1 166 PRO 166 196 196 PRO PRO A . n 
A 1 167 GLY 167 197 197 GLY GLY A . n 
A 1 168 CYS 168 198 198 CYS CYS A . n 
A 1 169 CYS 169 199 199 CYS CYS A . n 
A 1 170 ASP 170 200 200 ASP ASP A . n 
A 1 171 PHE 171 201 201 PHE PHE A . n 
A 1 172 VAL 172 202 202 VAL VAL A . n 
A 1 173 THR 173 203 203 THR THR A . n 
A 1 174 ASN 174 204 204 ASN ASN A . n 
A 1 175 ARG 175 205 205 ARG ARG A . n 
A 1 176 ALA 176 206 206 ALA ALA A . n 
A 1 177 TYR 177 207 207 TYR TYR A . n 
A 1 178 ALA 178 208 208 ALA ALA A . n 
A 1 179 ILE 179 209 209 ILE ILE A . n 
A 1 180 ALA 180 210 210 ALA ALA A . n 
A 1 181 SER 181 211 211 SER SER A . n 
A 1 182 SER 182 212 212 SER SER A . n 
A 1 183 ILE 183 213 213 ILE ILE A . n 
A 1 184 ILE 184 214 214 ILE ILE A . n 
A 1 185 SER 185 215 215 SER SER A . n 
A 1 186 PHE 186 216 216 PHE PHE A . n 
A 1 187 TYR 187 217 217 TYR TYR A . n 
A 1 188 ILE 188 218 218 ILE ILE A . n 
A 1 189 PRO 189 219 219 PRO PRO A . n 
A 1 190 LEU 190 220 220 LEU LEU A . n 
A 1 191 LEU 191 221 221 LEU LEU A . n 
A 1 192 ILE 192 222 222 ILE ILE A . n 
A 1 193 MET 193 223 223 MET MET A . n 
A 1 194 ILE 194 224 224 ILE ILE A . n 
A 1 195 PHE 195 225 225 PHE PHE A . n 
A 1 196 VAL 196 226 226 VAL VAL A . n 
A 1 197 ALA 197 227 227 ALA ALA A . n 
A 1 198 LEU 198 228 228 LEU LEU A . n 
A 1 199 ARG 199 229 229 ARG ARG A . n 
A 1 200 VAL 200 230 230 VAL VAL A . n 
A 1 201 TYR 201 231 231 TYR TYR A . n 
A 1 202 ARG 202 232 232 ARG ARG A . n 
A 1 203 GLU 203 233 233 GLU GLU A . n 
A 1 204 ALA 204 234 234 ALA ALA A . n 
A 1 205 LYS 205 235 235 LYS LYS A . n 
A 1 206 GLU 206 236 236 GLU GLU A . n 
A 1 207 GLN 207 237 237 GLN GLN A . n 
A 1 208 ILE 208 266 ?   ?   ?   A . n 
A 1 209 ARG 209 267 ?   ?   ?   A . n 
A 1 210 LYS 210 268 ?   ?   ?   A . n 
A 1 211 ILE 211 269 ?   ?   ?   A . n 
A 1 212 ASP 212 270 ?   ?   ?   A . n 
A 1 213 ARG 213 271 ?   ?   ?   A . n 
A 1 214 ALA 214 272 ?   ?   ?   A . n 
A 1 215 SER 215 273 ?   ?   ?   A . n 
A 1 216 LYS 216 274 ?   ?   ?   A . n 
A 1 217 ARG 217 275 ?   ?   ?   A . n 
A 1 218 LYS 218 276 ?   ?   ?   A . n 
A 1 219 THR 219 277 ?   ?   ?   A . n 
A 1 220 SER 220 278 278 SER SER A . n 
A 1 221 ARG 221 279 279 ARG ARG A . n 
A 1 222 VAL 222 280 280 VAL VAL A . n 
A 1 223 MET 223 281 281 MET MET A . n 
A 1 224 LEU 224 282 282 LEU LEU A . n 
A 1 225 MET 225 283 283 MET MET A . n 
A 1 226 ARG 226 284 284 ARG ARG A . n 
A 1 227 GLU 227 285 285 GLU GLU A . n 
A 1 228 HIS 228 286 286 HIS HIS A . n 
A 1 229 LYS 229 287 287 LYS LYS A . n 
A 1 230 ALA 230 288 288 ALA ALA A . n 
A 1 231 LEU 231 289 289 LEU LEU A . n 
A 1 232 LYS 232 290 290 LYS LYS A . n 
A 1 233 THR 233 291 291 THR THR A . n 
A 1 234 LEU 234 292 292 LEU LEU A . n 
A 1 235 GLY 235 293 293 GLY GLY A . n 
A 1 236 ILE 236 294 294 ILE ILE A . n 
A 1 237 ILE 237 295 295 ILE ILE A . n 
A 1 238 MET 238 296 296 MET MET A . n 
A 1 239 GLY 239 297 297 GLY GLY A . n 
A 1 240 VAL 240 298 298 VAL VAL A . n 
A 1 241 PHE 241 299 299 PHE PHE A . n 
A 1 242 THR 242 300 300 THR THR A . n 
A 1 243 LEU 243 301 301 LEU LEU A . n 
A 1 244 CYS 244 302 302 CYS CYS A . n 
A 1 245 TRP 245 303 303 TRP TRP A . n 
A 1 246 LEU 246 304 304 LEU LEU A . n 
A 1 247 PRO 247 305 305 PRO PRO A . n 
A 1 248 PHE 248 306 306 PHE PHE A . n 
A 1 249 PHE 249 307 307 PHE PHE A . n 
A 1 250 LEU 250 308 308 LEU LEU A . n 
A 1 251 VAL 251 309 309 VAL VAL A . n 
A 1 252 ASN 252 310 310 ASN ASN A . n 
A 1 253 ILE 253 311 311 ILE ILE A . n 
A 1 254 VAL 254 312 312 VAL VAL A . n 
A 1 255 ASN 255 313 313 ASN ASN A . n 
A 1 256 VAL 256 314 314 VAL VAL A . n 
A 1 257 PHE 257 315 315 PHE PHE A . n 
A 1 258 ASN 258 316 316 ASN ASN A . n 
A 1 259 ARG 259 317 317 ARG ARG A . n 
A 1 260 ASP 260 318 318 ASP ASP A . n 
A 1 261 LEU 261 319 319 LEU LEU A . n 
A 1 262 VAL 262 320 320 VAL VAL A . n 
A 1 263 PRO 263 321 321 PRO PRO A . n 
A 1 264 ASP 264 322 322 ASP ASP A . n 
A 1 265 TRP 265 323 323 TRP TRP A . n 
A 1 266 LEU 266 324 324 LEU LEU A . n 
A 1 267 PHE 267 325 325 PHE PHE A . n 
A 1 268 VAL 268 326 326 VAL VAL A . n 
A 1 269 ALA 269 327 327 ALA ALA A . n 
A 1 270 PHE 270 328 328 PHE PHE A . n 
A 1 271 ASN 271 329 329 ASN ASN A . n 
A 1 272 TRP 272 330 330 TRP TRP A . n 
A 1 273 LEU 273 331 331 LEU LEU A . n 
A 1 274 GLY 274 332 332 GLY GLY A . n 
A 1 275 TYR 275 333 333 TYR TYR A . n 
A 1 276 ALA 276 334 334 ALA ALA A . n 
A 1 277 ASN 277 335 335 ASN ASN A . n 
A 1 278 SER 278 336 336 SER SER A . n 
A 1 279 ALA 279 337 337 ALA ALA A . n 
A 1 280 MET 280 338 338 MET MET A . n 
A 1 281 ASN 281 339 339 ASN ASN A . n 
A 1 282 PRO 282 340 340 PRO PRO A . n 
A 1 283 ILE 283 341 341 ILE ILE A . n 
A 1 284 ILE 284 342 342 ILE ILE A . n 
A 1 285 TYR 285 343 343 TYR TYR A . n 
A 1 286 CYS 286 344 344 CYS CYS A . n 
A 1 287 ARG 287 345 345 ARG ARG A . n 
A 1 288 SER 288 346 346 SER SER A . n 
A 1 289 PRO 289 347 347 PRO PRO A . n 
A 1 290 ASP 290 348 348 ASP ASP A . n 
A 1 291 PHE 291 349 349 PHE PHE A . n 
A 1 292 ARG 292 350 350 ARG ARG A . n 
A 1 293 LYS 293 351 351 LYS LYS A . n 
A 1 294 ALA 294 352 352 ALA ALA A . n 
A 1 295 PHE 295 353 353 PHE PHE A . n 
A 1 296 LYS 296 354 354 LYS LYS A . n 
A 1 297 ARG 297 355 355 ARG ARG A . n 
A 1 298 LEU 298 356 356 LEU LEU A . n 
A 1 299 LEU 299 357 357 LEU LEU A . n 
A 1 300 ALA 300 358 358 ALA ALA A . n 
A 1 301 PHE 301 359 ?   ?   ?   A . n 
A 1 302 PRO 302 360 ?   ?   ?   A . n 
A 1 303 ARG 303 361 ?   ?   ?   A . n 
A 1 304 LYS 304 362 ?   ?   ?   A . n 
A 1 305 ALA 305 363 ?   ?   ?   A . n 
A 1 306 ASP 306 364 ?   ?   ?   A . n 
A 1 307 ARG 307 365 ?   ?   ?   A . n 
A 1 308 ARG 308 366 ?   ?   ?   A . n 
A 1 309 LEU 309 367 ?   ?   ?   A . n 
A 1 310 HIS 310 368 ?   ?   ?   A . n 
A 1 311 HIS 311 369 ?   ?   ?   A . n 
A 1 312 HIS 312 370 ?   ?   ?   A . n 
A 1 313 HIS 313 371 ?   ?   ?   A . n 
A 1 314 HIS 314 372 ?   ?   ?   A . n 
A 1 315 HIS 315 373 ?   ?   ?   A . n 
B 1 1   MET 1   31  ?   ?   ?   B . n 
B 1 2   GLY 2   32  ?   ?   ?   B . n 
B 1 3   ALA 3   33  33  ALA ALA B . n 
B 1 4   GLU 4   34  34  GLU GLU B . n 
B 1 5   LEU 5   35  35  LEU LEU B . n 
B 1 6   LEU 6   36  36  LEU LEU B . n 
B 1 7   SER 7   37  37  SER SER B . n 
B 1 8   GLN 8   38  38  GLN GLN B . n 
B 1 9   GLN 9   39  39  GLN GLN B . n 
B 1 10  TRP 10  40  40  TRP TRP B . n 
B 1 11  GLU 11  41  41  GLU GLU B . n 
B 1 12  ALA 12  42  42  ALA ALA B . n 
B 1 13  GLY 13  43  43  GLY GLY B . n 
B 1 14  MET 14  44  44  MET MET B . n 
B 1 15  SER 15  45  45  SER SER B . n 
B 1 16  LEU 16  46  46  LEU LEU B . n 
B 1 17  LEU 17  47  47  LEU LEU B . n 
B 1 18  MET 18  48  48  MET MET B . n 
B 1 19  ALA 19  49  49  ALA ALA B . n 
B 1 20  LEU 20  50  50  LEU LEU B . n 
B 1 21  VAL 21  51  51  VAL VAL B . n 
B 1 22  VAL 22  52  52  VAL VAL B . n 
B 1 23  LEU 23  53  53  LEU LEU B . n 
B 1 24  LEU 24  54  54  LEU LEU B . n 
B 1 25  ILE 25  55  55  ILE ILE B . n 
B 1 26  VAL 26  56  56  VAL VAL B . n 
B 1 27  ALA 27  57  57  ALA ALA B . n 
B 1 28  GLY 28  58  58  GLY GLY B . n 
B 1 29  ASN 29  59  59  ASN ASN B . n 
B 1 30  VAL 30  60  60  VAL VAL B . n 
B 1 31  LEU 31  61  61  LEU LEU B . n 
B 1 32  VAL 32  62  62  VAL VAL B . n 
B 1 33  ILE 33  63  63  ILE ILE B . n 
B 1 34  ALA 34  64  64  ALA ALA B . n 
B 1 35  ALA 35  65  65  ALA ALA B . n 
B 1 36  ILE 36  66  66  ILE ILE B . n 
B 1 37  GLY 37  67  67  GLY GLY B . n 
B 1 38  SER 38  68  68  SER SER B . n 
B 1 39  THR 39  69  69  THR THR B . n 
B 1 40  GLN 40  70  70  GLN GLN B . n 
B 1 41  ARG 41  71  71  ARG ARG B . n 
B 1 42  LEU 42  72  72  LEU LEU B . n 
B 1 43  GLN 43  73  73  GLN GLN B . n 
B 1 44  THR 44  74  74  THR THR B . n 
B 1 45  LEU 45  75  75  LEU LEU B . n 
B 1 46  THR 46  76  76  THR THR B . n 
B 1 47  ASN 47  77  77  ASN ASN B . n 
B 1 48  LEU 48  78  78  LEU LEU B . n 
B 1 49  PHE 49  79  79  PHE PHE B . n 
B 1 50  ILE 50  80  80  ILE ILE B . n 
B 1 51  THR 51  81  81  THR THR B . n 
B 1 52  SER 52  82  82  SER SER B . n 
B 1 53  LEU 53  83  83  LEU LEU B . n 
B 1 54  ALA 54  84  84  ALA ALA B . n 
B 1 55  CYS 55  85  85  CYS CYS B . n 
B 1 56  ALA 56  86  86  ALA ALA B . n 
B 1 57  ASP 57  87  87  ASP ASP B . n 
B 1 58  LEU 58  88  88  LEU LEU B . n 
B 1 59  VAL 59  89  89  VAL VAL B . n 
B 1 60  VAL 60  90  90  VAL VAL B . n 
B 1 61  GLY 61  91  91  GLY GLY B . n 
B 1 62  LEU 62  92  92  LEU LEU B . n 
B 1 63  LEU 63  93  93  LEU LEU B . n 
B 1 64  VAL 64  94  94  VAL VAL B . n 
B 1 65  VAL 65  95  95  VAL VAL B . n 
B 1 66  PRO 66  96  96  PRO PRO B . n 
B 1 67  PHE 67  97  97  PHE PHE B . n 
B 1 68  GLY 68  98  98  GLY GLY B . n 
B 1 69  ALA 69  99  99  ALA ALA B . n 
B 1 70  THR 70  100 100 THR THR B . n 
B 1 71  LEU 71  101 101 LEU LEU B . n 
B 1 72  VAL 72  102 102 VAL VAL B . n 
B 1 73  VAL 73  103 103 VAL VAL B . n 
B 1 74  ARG 74  104 104 ARG ARG B . n 
B 1 75  GLY 75  105 105 GLY GLY B . n 
B 1 76  THR 76  106 106 THR THR B . n 
B 1 77  TRP 77  107 107 TRP TRP B . n 
B 1 78  LEU 78  108 108 LEU LEU B . n 
B 1 79  TRP 79  109 109 TRP TRP B . n 
B 1 80  GLY 80  110 110 GLY GLY B . n 
B 1 81  SER 81  111 111 SER SER B . n 
B 1 82  PHE 82  112 112 PHE PHE B . n 
B 1 83  LEU 83  113 113 LEU LEU B . n 
B 1 84  CYS 84  114 114 CYS CYS B . n 
B 1 85  GLU 85  115 115 GLU GLU B . n 
B 1 86  LEU 86  116 116 LEU LEU B . n 
B 1 87  TRP 87  117 117 TRP TRP B . n 
B 1 88  THR 88  118 118 THR THR B . n 
B 1 89  SER 89  119 119 SER SER B . n 
B 1 90  LEU 90  120 120 LEU LEU B . n 
B 1 91  ASP 91  121 121 ASP ASP B . n 
B 1 92  VAL 92  122 122 VAL VAL B . n 
B 1 93  LEU 93  123 123 LEU LEU B . n 
B 1 94  CYS 94  124 124 CYS CYS B . n 
B 1 95  VAL 95  125 125 VAL VAL B . n 
B 1 96  THR 96  126 126 THR THR B . n 
B 1 97  ALA 97  127 127 ALA ALA B . n 
B 1 98  SER 98  128 128 SER SER B . n 
B 1 99  ILE 99  129 129 ILE ILE B . n 
B 1 100 GLU 100 130 130 GLU GLU B . n 
B 1 101 THR 101 131 131 THR THR B . n 
B 1 102 LEU 102 132 132 LEU LEU B . n 
B 1 103 CYS 103 133 133 CYS CYS B . n 
B 1 104 VAL 104 134 134 VAL VAL B . n 
B 1 105 ILE 105 135 135 ILE ILE B . n 
B 1 106 ALA 106 136 136 ALA ALA B . n 
B 1 107 ILE 107 137 137 ILE ILE B . n 
B 1 108 ASP 108 138 138 ASP ASP B . n 
B 1 109 ARG 109 139 139 ARG ARG B . n 
B 1 110 TYR 110 140 140 TYR TYR B . n 
B 1 111 LEU 111 141 141 LEU LEU B . n 
B 1 112 ALA 112 142 142 ALA ALA B . n 
B 1 113 ILE 113 143 143 ILE ILE B . n 
B 1 114 THR 114 144 144 THR THR B . n 
B 1 115 SER 115 145 145 SER SER B . n 
B 1 116 PRO 116 146 146 PRO PRO B . n 
B 1 117 PHE 117 147 147 PHE PHE B . n 
B 1 118 ARG 118 148 148 ARG ARG B . n 
B 1 119 TYR 119 149 149 TYR TYR B . n 
B 1 120 GLN 120 150 150 GLN GLN B . n 
B 1 121 SER 121 151 151 SER SER B . n 
B 1 122 LEU 122 152 152 LEU LEU B . n 
B 1 123 MET 123 153 153 MET MET B . n 
B 1 124 THR 124 154 154 THR THR B . n 
B 1 125 ARG 125 155 155 ARG ARG B . n 
B 1 126 ALA 126 156 156 ALA ALA B . n 
B 1 127 ARG 127 157 157 ARG ARG B . n 
B 1 128 ALA 128 158 158 ALA ALA B . n 
B 1 129 LYS 129 159 159 LYS LYS B . n 
B 1 130 VAL 130 160 160 VAL VAL B . n 
B 1 131 ILE 131 161 161 ILE ILE B . n 
B 1 132 ILE 132 162 162 ILE ILE B . n 
B 1 133 CYS 133 163 163 CYS CYS B . n 
B 1 134 THR 134 164 164 THR THR B . n 
B 1 135 VAL 135 165 165 VAL VAL B . n 
B 1 136 TRP 136 166 166 TRP TRP B . n 
B 1 137 ALA 137 167 167 ALA ALA B . n 
B 1 138 ILE 138 168 168 ILE ILE B . n 
B 1 139 SER 139 169 169 SER SER B . n 
B 1 140 ALA 140 170 170 ALA ALA B . n 
B 1 141 LEU 141 171 171 LEU LEU B . n 
B 1 142 VAL 142 172 172 VAL VAL B . n 
B 1 143 SER 143 173 173 SER SER B . n 
B 1 144 PHE 144 174 174 PHE PHE B . n 
B 1 145 LEU 145 175 175 LEU LEU B . n 
B 1 146 PRO 146 176 176 PRO PRO B . n 
B 1 147 ILE 147 177 177 ILE ILE B . n 
B 1 148 MET 148 178 178 MET MET B . n 
B 1 149 MET 149 179 179 MET MET B . n 
B 1 150 HIS 150 180 180 HIS HIS B . n 
B 1 151 TRP 151 181 181 TRP TRP B . n 
B 1 152 TRP 152 182 182 TRP TRP B . n 
B 1 153 ARG 153 183 183 ARG ARG B . n 
B 1 154 ASP 154 184 184 ASP ASP B . n 
B 1 155 GLU 155 185 185 GLU GLU B . n 
B 1 156 ASP 156 186 186 ASP ASP B . n 
B 1 157 PRO 157 187 187 PRO PRO B . n 
B 1 158 GLN 158 188 188 GLN GLN B . n 
B 1 159 ALA 159 189 189 ALA ALA B . n 
B 1 160 LEU 160 190 190 LEU LEU B . n 
B 1 161 LYS 161 191 191 LYS LYS B . n 
B 1 162 CYS 162 192 192 CYS CYS B . n 
B 1 163 TYR 163 193 193 TYR TYR B . n 
B 1 164 GLN 164 194 194 GLN GLN B . n 
B 1 165 ASP 165 195 195 ASP ASP B . n 
B 1 166 PRO 166 196 196 PRO PRO B . n 
B 1 167 GLY 167 197 197 GLY GLY B . n 
B 1 168 CYS 168 198 198 CYS CYS B . n 
B 1 169 CYS 169 199 199 CYS CYS B . n 
B 1 170 ASP 170 200 200 ASP ASP B . n 
B 1 171 PHE 171 201 201 PHE PHE B . n 
B 1 172 VAL 172 202 202 VAL VAL B . n 
B 1 173 THR 173 203 203 THR THR B . n 
B 1 174 ASN 174 204 204 ASN ASN B . n 
B 1 175 ARG 175 205 205 ARG ARG B . n 
B 1 176 ALA 176 206 206 ALA ALA B . n 
B 1 177 TYR 177 207 207 TYR TYR B . n 
B 1 178 ALA 178 208 208 ALA ALA B . n 
B 1 179 ILE 179 209 209 ILE ILE B . n 
B 1 180 ALA 180 210 210 ALA ALA B . n 
B 1 181 SER 181 211 211 SER SER B . n 
B 1 182 SER 182 212 212 SER SER B . n 
B 1 183 ILE 183 213 213 ILE ILE B . n 
B 1 184 ILE 184 214 214 ILE ILE B . n 
B 1 185 SER 185 215 215 SER SER B . n 
B 1 186 PHE 186 216 216 PHE PHE B . n 
B 1 187 TYR 187 217 217 TYR TYR B . n 
B 1 188 ILE 188 218 218 ILE ILE B . n 
B 1 189 PRO 189 219 219 PRO PRO B . n 
B 1 190 LEU 190 220 220 LEU LEU B . n 
B 1 191 LEU 191 221 221 LEU LEU B . n 
B 1 192 ILE 192 222 222 ILE ILE B . n 
B 1 193 MET 193 223 223 MET MET B . n 
B 1 194 ILE 194 224 224 ILE ILE B . n 
B 1 195 PHE 195 225 225 PHE PHE B . n 
B 1 196 VAL 196 226 226 VAL VAL B . n 
B 1 197 ALA 197 227 227 ALA ALA B . n 
B 1 198 LEU 198 228 228 LEU LEU B . n 
B 1 199 ARG 199 229 229 ARG ARG B . n 
B 1 200 VAL 200 230 230 VAL VAL B . n 
B 1 201 TYR 201 231 231 TYR TYR B . n 
B 1 202 ARG 202 232 232 ARG ARG B . n 
B 1 203 GLU 203 233 233 GLU GLU B . n 
B 1 204 ALA 204 234 234 ALA ALA B . n 
B 1 205 LYS 205 235 235 LYS LYS B . n 
B 1 206 GLU 206 236 236 GLU GLU B . n 
B 1 207 GLN 207 237 237 GLN GLN B . n 
B 1 208 ILE 208 238 238 ILE ILE B . n 
B 1 209 ARG 209 239 239 ARG ARG B . n 
B 1 210 LYS 210 240 240 LYS LYS B . n 
B 1 211 ILE 211 241 241 ILE ILE B . n 
B 1 212 ASP 212 242 242 ASP ASP B . n 
B 1 213 ARG 213 243 243 ARG ARG B . n 
B 1 214 ALA 214 272 272 ALA ALA B . n 
B 1 215 SER 215 273 273 SER SER B . n 
B 1 216 LYS 216 274 274 LYS LYS B . n 
B 1 217 ARG 217 275 275 ARG ARG B . n 
B 1 218 LYS 218 276 276 LYS LYS B . n 
B 1 219 THR 219 277 277 THR THR B . n 
B 1 220 SER 220 278 278 SER SER B . n 
B 1 221 ARG 221 279 279 ARG ARG B . n 
B 1 222 VAL 222 280 280 VAL VAL B . n 
B 1 223 MET 223 281 281 MET MET B . n 
B 1 224 LEU 224 282 282 LEU LEU B . n 
B 1 225 MET 225 283 283 MET MET B . n 
B 1 226 ARG 226 284 284 ARG ARG B . n 
B 1 227 GLU 227 285 285 GLU GLU B . n 
B 1 228 HIS 228 286 286 HIS HIS B . n 
B 1 229 LYS 229 287 287 LYS LYS B . n 
B 1 230 ALA 230 288 288 ALA ALA B . n 
B 1 231 LEU 231 289 289 LEU LEU B . n 
B 1 232 LYS 232 290 290 LYS LYS B . n 
B 1 233 THR 233 291 291 THR THR B . n 
B 1 234 LEU 234 292 292 LEU LEU B . n 
B 1 235 GLY 235 293 293 GLY GLY B . n 
B 1 236 ILE 236 294 294 ILE ILE B . n 
B 1 237 ILE 237 295 295 ILE ILE B . n 
B 1 238 MET 238 296 296 MET MET B . n 
B 1 239 GLY 239 297 297 GLY GLY B . n 
B 1 240 VAL 240 298 298 VAL VAL B . n 
B 1 241 PHE 241 299 299 PHE PHE B . n 
B 1 242 THR 242 300 300 THR THR B . n 
B 1 243 LEU 243 301 301 LEU LEU B . n 
B 1 244 CYS 244 302 302 CYS CYS B . n 
B 1 245 TRP 245 303 303 TRP TRP B . n 
B 1 246 LEU 246 304 304 LEU LEU B . n 
B 1 247 PRO 247 305 305 PRO PRO B . n 
B 1 248 PHE 248 306 306 PHE PHE B . n 
B 1 249 PHE 249 307 307 PHE PHE B . n 
B 1 250 LEU 250 308 308 LEU LEU B . n 
B 1 251 VAL 251 309 309 VAL VAL B . n 
B 1 252 ASN 252 310 310 ASN ASN B . n 
B 1 253 ILE 253 311 311 ILE ILE B . n 
B 1 254 VAL 254 312 312 VAL VAL B . n 
B 1 255 ASN 255 313 313 ASN ASN B . n 
B 1 256 VAL 256 314 314 VAL VAL B . n 
B 1 257 PHE 257 315 315 PHE PHE B . n 
B 1 258 ASN 258 316 316 ASN ASN B . n 
B 1 259 ARG 259 317 317 ARG ARG B . n 
B 1 260 ASP 260 318 318 ASP ASP B . n 
B 1 261 LEU 261 319 319 LEU LEU B . n 
B 1 262 VAL 262 320 320 VAL VAL B . n 
B 1 263 PRO 263 321 321 PRO PRO B . n 
B 1 264 ASP 264 322 322 ASP ASP B . n 
B 1 265 TRP 265 323 323 TRP TRP B . n 
B 1 266 LEU 266 324 324 LEU LEU B . n 
B 1 267 PHE 267 325 325 PHE PHE B . n 
B 1 268 VAL 268 326 326 VAL VAL B . n 
B 1 269 ALA 269 327 327 ALA ALA B . n 
B 1 270 PHE 270 328 328 PHE PHE B . n 
B 1 271 ASN 271 329 329 ASN ASN B . n 
B 1 272 TRP 272 330 330 TRP TRP B . n 
B 1 273 LEU 273 331 331 LEU LEU B . n 
B 1 274 GLY 274 332 332 GLY GLY B . n 
B 1 275 TYR 275 333 333 TYR TYR B . n 
B 1 276 ALA 276 334 334 ALA ALA B . n 
B 1 277 ASN 277 335 335 ASN ASN B . n 
B 1 278 SER 278 336 336 SER SER B . n 
B 1 279 ALA 279 337 337 ALA ALA B . n 
B 1 280 MET 280 338 338 MET MET B . n 
B 1 281 ASN 281 339 339 ASN ASN B . n 
B 1 282 PRO 282 340 340 PRO PRO B . n 
B 1 283 ILE 283 341 341 ILE ILE B . n 
B 1 284 ILE 284 342 342 ILE ILE B . n 
B 1 285 TYR 285 343 343 TYR TYR B . n 
B 1 286 CYS 286 344 344 CYS CYS B . n 
B 1 287 ARG 287 345 345 ARG ARG B . n 
B 1 288 SER 288 346 346 SER SER B . n 
B 1 289 PRO 289 347 347 PRO PRO B . n 
B 1 290 ASP 290 348 348 ASP ASP B . n 
B 1 291 PHE 291 349 349 PHE PHE B . n 
B 1 292 ARG 292 350 350 ARG ARG B . n 
B 1 293 LYS 293 351 351 LYS LYS B . n 
B 1 294 ALA 294 352 352 ALA ALA B . n 
B 1 295 PHE 295 353 353 PHE PHE B . n 
B 1 296 LYS 296 354 354 LYS LYS B . n 
B 1 297 ARG 297 355 355 ARG ARG B . n 
B 1 298 LEU 298 356 356 LEU LEU B . n 
B 1 299 LEU 299 357 357 LEU LEU B . n 
B 1 300 ALA 300 358 358 ALA ALA B . n 
B 1 301 PHE 301 359 ?   ?   ?   B . n 
B 1 302 PRO 302 360 ?   ?   ?   B . n 
B 1 303 ARG 303 361 ?   ?   ?   B . n 
B 1 304 LYS 304 362 ?   ?   ?   B . n 
B 1 305 ALA 305 363 ?   ?   ?   B . n 
B 1 306 ASP 306 364 ?   ?   ?   B . n 
B 1 307 ARG 307 365 ?   ?   ?   B . n 
B 1 308 ARG 308 366 ?   ?   ?   B . n 
B 1 309 LEU 309 367 ?   ?   ?   B . n 
B 1 310 HIS 310 368 ?   ?   ?   B . n 
B 1 311 HIS 311 369 ?   ?   ?   B . n 
B 1 312 HIS 312 370 ?   ?   ?   B . n 
B 1 313 HIS 313 371 ?   ?   ?   B . n 
B 1 314 HIS 314 372 ?   ?   ?   B . n 
B 1 315 HIS 315 373 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 Y01 1  401  401  Y01 Y01 A . 
D 2 Y01 1  402  402  Y01 Y01 A . 
E 3 2CV 1  501  501  2CV 2CV A . 
F 3 2CV 1  502  502  2CV 2CV A . 
G 3 2CV 1  503  503  2CV 2CV A . 
H 3 2CV 1  504  504  2CV 2CV A . 
I 3 2CV 1  505  505  2CV 2CV A . 
J 4 Y00 1  601  601  Y00 Y00 A . 
K 2 Y01 1  401  401  Y01 Y01 B . 
L 2 Y01 1  402  402  Y01 Y01 B . 
M 3 2CV 1  501  501  2CV 2CV B . 
N 3 2CV 1  502  502  2CV 2CV B . 
O 3 2CV 1  503  503  2CV 2CV B . 
P 3 2CV 1  504  504  2CV 2CV B . 
Q 3 2CV 1  505  505  2CV 2CV B . 
R 4 Y00 1  601  601  Y00 Y00 B . 
S 5 HOH 1  2001 2001 HOH HOH A . 
S 5 HOH 2  2002 2002 HOH HOH A . 
S 5 HOH 3  2003 2003 HOH HOH A . 
S 5 HOH 4  2004 2004 HOH HOH A . 
S 5 HOH 5  2005 2005 HOH HOH A . 
S 5 HOH 6  2006 2006 HOH HOH A . 
S 5 HOH 7  2007 2007 HOH HOH A . 
S 5 HOH 8  2008 2008 HOH HOH A . 
S 5 HOH 9  2009 2009 HOH HOH A . 
S 5 HOH 10 2010 2010 HOH HOH A . 
S 5 HOH 11 2011 2011 HOH HOH A . 
S 5 HOH 12 2012 2012 HOH HOH A . 
S 5 HOH 13 2013 2013 HOH HOH A . 
S 5 HOH 14 2014 2014 HOH HOH A . 
S 5 HOH 15 2015 2015 HOH HOH A . 
S 5 HOH 16 2016 2016 HOH HOH A . 
S 5 HOH 17 2017 2017 HOH HOH A . 
S 5 HOH 18 2018 2018 HOH HOH A . 
S 5 HOH 19 2019 2019 HOH HOH A . 
S 5 HOH 20 2020 2020 HOH HOH A . 
T 5 HOH 1  2001 2001 HOH HOH B . 
T 5 HOH 2  2002 2002 HOH HOH B . 
T 5 HOH 3  2003 2003 HOH HOH B . 
T 5 HOH 4  2004 2004 HOH HOH B . 
T 5 HOH 5  2005 2005 HOH HOH B . 
T 5 HOH 6  2006 2006 HOH HOH B . 
T 5 HOH 7  2007 2007 HOH HOH B . 
T 5 HOH 8  2008 2008 HOH HOH B . 
T 5 HOH 9  2009 2009 HOH HOH B . 
T 5 HOH 10 2010 2010 HOH HOH B . 
T 5 HOH 11 2011 2011 HOH HOH B . 
T 5 HOH 12 2012 2012 HOH HOH B . 
T 5 HOH 13 2013 2013 HOH HOH B . 
T 5 HOH 14 2014 2014 HOH HOH B . 
T 5 HOH 15 2015 2015 HOH HOH B . 
T 5 HOH 16 2016 2016 HOH HOH B . 
T 5 HOH 17 2017 2017 HOH HOH B . 
T 5 HOH 18 2018 2018 HOH HOH B . 
T 5 HOH 19 2019 2019 HOH HOH B . 
T 5 HOH 20 2020 2020 HOH HOH B . 
T 5 HOH 21 2021 2021 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,J,S                     
2 1 B,K,L,M,N,O,P,Q,R,T                     
3 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 3350  ? 
3 MORE         -20.5 ? 
3 'SSA (A^2)'  29760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-30 
2 'Structure model' 1 1 2011-08-17 
3 'Structure model' 1 2 2019-04-03 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'              
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Data collection'           
4 3 'Structure model' 'Experimental preparation'  
5 3 'Structure model' Other                       
6 3 'Structure model' 'Source and taxonomy'       
7 4 'Structure model' 'Data collection'           
8 4 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_PDB_rev        
2 3 'Structure model' database_PDB_rev_record 
3 3 'Structure model' entity_src_gen          
4 3 'Structure model' exptl_crystal_grow      
5 3 'Structure model' pdbx_database_proc      
6 3 'Structure model' pdbx_database_status    
7 4 'Structure model' exptl_crystal_grow      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'     
2 3 'Structure model' '_exptl_crystal_grow.temp'                    
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4 4 'Structure model' '_exptl_crystal_grow.method'                  
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0109 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2Y01 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ARG  68 TO SER
ENGINEERED RESIDUE IN CHAIN A, MET  90 TO VAL
ENGINEERED RESIDUE IN CHAIN A, CYS 116 TO LEU
ENGINEERED RESIDUE IN CHAIN A, TYR 227 TO ALA
ENGINEERED RESIDUE IN CHAIN A, ALA 282 TO LEU
ENGINEERED RESIDUE IN CHAIN A, PHE 327 TO ALA
ENGINEERED RESIDUE IN CHAIN A, PHE 338 TO MET
ENGINEERED RESIDUE IN CHAIN A, CYS 358 TO ALA
ENGINEERED RESIDUE IN CHAIN B, ARG  68 TO SER
ENGINEERED RESIDUE IN CHAIN B, MET  90 TO VAL
ENGINEERED RESIDUE IN CHAIN B, CYS 116 TO LEU
ENGINEERED RESIDUE IN CHAIN B, TYR 227 TO ALA
ENGINEERED RESIDUE IN CHAIN B, ALA 282 TO LEU
ENGINEERED RESIDUE IN CHAIN B, PHE 327 TO ALA
ENGINEERED RESIDUE IN CHAIN B, PHE 338 TO MET
ENGINEERED RESIDUE IN CHAIN B, CYS 358 TO ALA
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE FOLLOWING MUTATIONS WERE MADE TO IMPROVE
THERMOSTABILITY R68S,M90V,Y227A,A282L,F327A,F338M  THE
FOLLOWING MUTATIONS WERE MADE TO IMPROVE EXPRESSION AND
HELP CRYSTALLISATION C116L, C358A
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 73  ? ? -91.88  30.74  
2  1 GLN A 194 ? ? -100.07 50.29  
3  1 ASP A 195 ? ? -160.30 106.53 
4  1 PHE A 201 ? ? -101.82 74.23  
5  1 PHE A 216 ? ? -128.28 -63.68 
6  1 GLU A 236 ? ? -74.92  42.94  
7  1 ARG A 279 ? ? -38.27  -35.83 
8  1 ASN A 316 ? ? -162.49 104.47 
9  1 SER B 145 ? ? -168.06 62.09  
10 1 PHE B 216 ? ? -126.64 -60.22 
11 1 LYS B 240 ? ? 74.67   -3.53  
12 1 SER B 273 ? ? -59.70  -6.93  
13 1 THR B 277 ? ? -131.56 -51.07 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 83  ? CD1 ? A LEU 53 CD1 
2  1 N 1 A 2CV 502 ? C24 ? F 2CV 1  C24 
3  1 N 1 A 2CV 502 ? C27 ? F 2CV 1  C27 
4  1 N 1 A 2CV 502 ? C30 ? F 2CV 1  C30 
5  1 N 1 A 2CV 502 ? N33 ? F 2CV 1  N33 
6  1 N 1 A 2CV 502 ? O34 ? F 2CV 1  O34 
7  1 N 1 A 2CV 502 ? C35 ? F 2CV 1  C35 
8  1 N 1 A 2CV 502 ? C36 ? F 2CV 1  C36 
9  1 N 1 A 2CV 502 ? C37 ? F 2CV 1  C37 
10 1 N 1 A 2CV 502 ? C40 ? F 2CV 1  C40 
11 1 N 1 A 2CV 502 ? C41 ? F 2CV 1  C41 
12 1 N 1 A 2CV 502 ? C42 ? F 2CV 1  C42 
13 1 N 1 A 2CV 502 ? C43 ? F 2CV 1  C43 
14 1 N 1 A 2CV 502 ? O44 ? F 2CV 1  O44 
15 1 N 1 A 2CV 502 ? O47 ? F 2CV 1  O47 
16 1 N 1 A 2CV 502 ? O49 ? F 2CV 1  O49 
17 1 N 1 A 2CV 502 ? O51 ? F 2CV 1  O51 
18 1 N 1 A 2CV 502 ? O53 ? F 2CV 1  O53 
19 1 N 1 A 2CV 502 ? C60 ? F 2CV 1  C60 
20 1 N 1 A 2CV 502 ? O63 ? F 2CV 1  O63 
21 1 N 1 A 2CV 502 ? C1  ? F 2CV 1  C1  
22 1 N 1 A 2CV 502 ? C0  ? F 2CV 1  C0  
23 1 N 1 A 2CV 503 ? C41 ? G 2CV 1  C41 
24 1 N 1 A 2CV 503 ? C42 ? G 2CV 1  C42 
25 1 N 1 A 2CV 503 ? C43 ? G 2CV 1  C43 
26 1 N 1 A 2CV 503 ? O44 ? G 2CV 1  O44 
27 1 N 1 A 2CV 503 ? O51 ? G 2CV 1  O51 
28 1 N 1 A 2CV 503 ? O53 ? G 2CV 1  O53 
29 1 N 1 B 2CV 501 ? C41 ? M 2CV 1  C41 
30 1 N 1 B 2CV 501 ? C42 ? M 2CV 1  C42 
31 1 N 1 B 2CV 501 ? C43 ? M 2CV 1  C43 
32 1 N 1 B 2CV 501 ? O44 ? M 2CV 1  O44 
33 1 N 1 B 2CV 501 ? O51 ? M 2CV 1  O51 
34 1 N 1 B 2CV 501 ? O53 ? M 2CV 1  O53 
35 1 N 1 B 2CV 502 ? C37 ? N 2CV 1  C37 
36 1 N 1 B 2CV 502 ? C40 ? N 2CV 1  C40 
37 1 N 1 B 2CV 502 ? C41 ? N 2CV 1  C41 
38 1 N 1 B 2CV 502 ? C42 ? N 2CV 1  C42 
39 1 N 1 B 2CV 502 ? C43 ? N 2CV 1  C43 
40 1 N 1 B 2CV 502 ? O44 ? N 2CV 1  O44 
41 1 N 1 B 2CV 502 ? O47 ? N 2CV 1  O47 
42 1 N 1 B 2CV 502 ? O49 ? N 2CV 1  O49 
43 1 N 1 B 2CV 502 ? O51 ? N 2CV 1  O51 
44 1 N 1 B 2CV 502 ? O53 ? N 2CV 1  O53 
45 1 N 1 B 2CV 503 ? C37 ? O 2CV 1  C37 
46 1 N 1 B 2CV 503 ? C40 ? O 2CV 1  C40 
47 1 N 1 B 2CV 503 ? C41 ? O 2CV 1  C41 
48 1 N 1 B 2CV 503 ? C42 ? O 2CV 1  C42 
49 1 N 1 B 2CV 503 ? C43 ? O 2CV 1  C43 
50 1 N 1 B 2CV 503 ? O44 ? O 2CV 1  O44 
51 1 N 1 B 2CV 503 ? O47 ? O 2CV 1  O47 
52 1 N 1 B 2CV 503 ? O49 ? O 2CV 1  O49 
53 1 N 1 B 2CV 503 ? O51 ? O 2CV 1  O51 
54 1 N 1 B 2CV 503 ? O53 ? O 2CV 1  O53 
55 1 N 1 B 2CV 504 ? C9  ? P 2CV 1  C9  
56 1 N 1 B 2CV 504 ? C12 ? P 2CV 1  C12 
57 1 N 1 B 2CV 504 ? C35 ? P 2CV 1  C35 
58 1 N 1 B 2CV 504 ? C36 ? P 2CV 1  C36 
59 1 N 1 B 2CV 504 ? C37 ? P 2CV 1  C37 
60 1 N 1 B 2CV 504 ? C40 ? P 2CV 1  C40 
61 1 N 1 B 2CV 504 ? C41 ? P 2CV 1  C41 
62 1 N 1 B 2CV 504 ? C42 ? P 2CV 1  C42 
63 1 N 1 B 2CV 504 ? C43 ? P 2CV 1  C43 
64 1 N 1 B 2CV 504 ? O44 ? P 2CV 1  O44 
65 1 N 1 B 2CV 504 ? O47 ? P 2CV 1  O47 
66 1 N 1 B 2CV 504 ? O49 ? P 2CV 1  O49 
67 1 N 1 B 2CV 504 ? O51 ? P 2CV 1  O51 
68 1 N 1 B 2CV 504 ? O53 ? P 2CV 1  O53 
69 1 N 1 B 2CV 504 ? C60 ? P 2CV 1  C60 
70 1 N 1 B 2CV 504 ? O63 ? P 2CV 1  O63 
71 1 N 1 B 2CV 504 ? C1  ? P 2CV 1  C1  
72 1 N 1 B 2CV 504 ? C0  ? P 2CV 1  C0  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 31  ? A MET 1   
2  1 Y 1 A GLY 32  ? A GLY 2   
3  1 Y 1 A ILE 266 ? A ILE 208 
4  1 Y 1 A ARG 267 ? A ARG 209 
5  1 Y 1 A LYS 268 ? A LYS 210 
6  1 Y 1 A ILE 269 ? A ILE 211 
7  1 Y 1 A ASP 270 ? A ASP 212 
8  1 Y 1 A ARG 271 ? A ARG 213 
9  1 Y 1 A ALA 272 ? A ALA 214 
10 1 Y 1 A SER 273 ? A SER 215 
11 1 Y 1 A LYS 274 ? A LYS 216 
12 1 Y 1 A ARG 275 ? A ARG 217 
13 1 Y 1 A LYS 276 ? A LYS 218 
14 1 Y 1 A THR 277 ? A THR 219 
15 1 Y 1 A PHE 359 ? A PHE 301 
16 1 Y 1 A PRO 360 ? A PRO 302 
17 1 Y 1 A ARG 361 ? A ARG 303 
18 1 Y 1 A LYS 362 ? A LYS 304 
19 1 Y 1 A ALA 363 ? A ALA 305 
20 1 Y 1 A ASP 364 ? A ASP 306 
21 1 Y 1 A ARG 365 ? A ARG 307 
22 1 Y 1 A ARG 366 ? A ARG 308 
23 1 Y 1 A LEU 367 ? A LEU 309 
24 1 Y 1 A HIS 368 ? A HIS 310 
25 1 Y 1 A HIS 369 ? A HIS 311 
26 1 Y 1 A HIS 370 ? A HIS 312 
27 1 Y 1 A HIS 371 ? A HIS 313 
28 1 Y 1 A HIS 372 ? A HIS 314 
29 1 Y 1 A HIS 373 ? A HIS 315 
30 1 Y 1 B MET 31  ? B MET 1   
31 1 Y 1 B GLY 32  ? B GLY 2   
32 1 Y 1 B PHE 359 ? B PHE 301 
33 1 Y 1 B PRO 360 ? B PRO 302 
34 1 Y 1 B ARG 361 ? B ARG 303 
35 1 Y 1 B LYS 362 ? B LYS 304 
36 1 Y 1 B ALA 363 ? B ALA 305 
37 1 Y 1 B ASP 364 ? B ASP 306 
38 1 Y 1 B ARG 365 ? B ARG 307 
39 1 Y 1 B ARG 366 ? B ARG 308 
40 1 Y 1 B LEU 367 ? B LEU 309 
41 1 Y 1 B HIS 368 ? B HIS 310 
42 1 Y 1 B HIS 369 ? B HIS 311 
43 1 Y 1 B HIS 370 ? B HIS 312 
44 1 Y 1 B HIS 371 ? B HIS 313 
45 1 Y 1 B HIS 372 ? B HIS 314 
46 1 Y 1 B HIS 373 ? B HIS 315 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHOLESTEROL HEMISUCCINATE' Y01 
3 HEGA-10                     2CV 
4 DOBUTAMINE                  Y00 
5 water                       HOH 
#