data_2Y05
# 
_entry.id   2Y05 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y05         
PDBE  EBI-46509    
WWPDB D_1290046509 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1ZSV 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF HUMAN NADP-DEPENDENT LEUKOTRIENE B4 12-HYDROXYDEHYDROGENASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y05 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yue, W.W.'      1  
'Shafqat, N.'    2  
'Krojer, T.'     3  
'Pike, A.C.W.'   4  
'von Delft, F.'  5  
'Sethi, R.'      6  
'Savitsky, P.'   7  
'Johansson, C.'  8  
'Arrowsmith, C.' 9  
'Weigelt, J.'    10 
'Edwards, A.'    11 
'Bountra, C.'    12 
'Oppermann, U.'  13 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human Leukotriene B4 12-Hydroxydehydrogenase in Complex with Nadp and Raloxifene' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yue, W.W.'      1  
primary 'Shafqat, N.'    2  
primary 'Krojer, T.'     3  
primary 'Pike, A.C.W.'   4  
primary 'von Delft, F.'  5  
primary 'Sethi, R.'      6  
primary 'Savitsky, P.'   7  
primary 'Johansson, C.'  8  
primary 'Arrowsmith, C.' 9  
primary 'Weigelt, J.'    10 
primary 'Edwards, A.'    11 
primary 'Bountra, C.'    12 
primary 'Oppermann, U.'  13 
# 
_cell.entry_id           2Y05 
_cell.length_a           93.274 
_cell.length_b           116.599 
_cell.length_c           154.607 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y05 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROSTAGLANDIN REDUCTASE 1'                        35757.516 4   '1.3.1.-, 1.3.1.48, 1.3.1.74' ? 
'MDR DOMAIN, RESIDUES 4-329' ? 
2 non-polymer syn 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 743.405   4   ?                             ? ? ? 
3 non-polymer syn RALOXIFENE                                         473.583   2   ?                             ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                     35.453    5   ?                             ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                     62.068    9   ?                             ? ? ? 
6 water       nat water                                              18.015    438 ?                             ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;15-OXOPROSTAGLANDIN 13-REDUCTASE, NADP-DEPENDENT LEUKOTRIENE B4 12-HYDROXYDEHYDROGENASE, PRG-1, LEUKOTRIENE B4 12-HYDROXYDEHYDROGENASE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPK
GTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQI
AKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGA
ISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDN
LGKTIVKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPK
GTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQI
AKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGA
ISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDN
LGKTIVKA
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   THR n 
1 4   LYS n 
1 5   THR n 
1 6   TRP n 
1 7   THR n 
1 8   LEU n 
1 9   LYS n 
1 10  LYS n 
1 11  HIS n 
1 12  PHE n 
1 13  VAL n 
1 14  GLY n 
1 15  TYR n 
1 16  PRO n 
1 17  THR n 
1 18  ASN n 
1 19  SER n 
1 20  ASP n 
1 21  PHE n 
1 22  GLU n 
1 23  LEU n 
1 24  LYS n 
1 25  THR n 
1 26  SER n 
1 27  GLU n 
1 28  LEU n 
1 29  PRO n 
1 30  PRO n 
1 31  LEU n 
1 32  LYS n 
1 33  ASN n 
1 34  GLY n 
1 35  GLU n 
1 36  VAL n 
1 37  LEU n 
1 38  LEU n 
1 39  GLU n 
1 40  ALA n 
1 41  LEU n 
1 42  PHE n 
1 43  LEU n 
1 44  THR n 
1 45  VAL n 
1 46  ASP n 
1 47  PRO n 
1 48  TYR n 
1 49  MET n 
1 50  ARG n 
1 51  VAL n 
1 52  ALA n 
1 53  ALA n 
1 54  LYS n 
1 55  ARG n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  GLY n 
1 60  ASP n 
1 61  THR n 
1 62  MET n 
1 63  MET n 
1 64  GLY n 
1 65  GLN n 
1 66  GLN n 
1 67  VAL n 
1 68  ALA n 
1 69  LYS n 
1 70  VAL n 
1 71  VAL n 
1 72  GLU n 
1 73  SER n 
1 74  LYS n 
1 75  ASN n 
1 76  VAL n 
1 77  ALA n 
1 78  LEU n 
1 79  PRO n 
1 80  LYS n 
1 81  GLY n 
1 82  THR n 
1 83  ILE n 
1 84  VAL n 
1 85  LEU n 
1 86  ALA n 
1 87  SER n 
1 88  PRO n 
1 89  GLY n 
1 90  TRP n 
1 91  THR n 
1 92  THR n 
1 93  HIS n 
1 94  SER n 
1 95  ILE n 
1 96  SER n 
1 97  ASP n 
1 98  GLY n 
1 99  LYS n 
1 100 ASP n 
1 101 LEU n 
1 102 GLU n 
1 103 LYS n 
1 104 LEU n 
1 105 LEU n 
1 106 THR n 
1 107 GLU n 
1 108 TRP n 
1 109 PRO n 
1 110 ASP n 
1 111 THR n 
1 112 ILE n 
1 113 PRO n 
1 114 LEU n 
1 115 SER n 
1 116 LEU n 
1 117 ALA n 
1 118 LEU n 
1 119 GLY n 
1 120 THR n 
1 121 VAL n 
1 122 GLY n 
1 123 MET n 
1 124 PRO n 
1 125 GLY n 
1 126 LEU n 
1 127 THR n 
1 128 ALA n 
1 129 TYR n 
1 130 PHE n 
1 131 GLY n 
1 132 LEU n 
1 133 LEU n 
1 134 GLU n 
1 135 ILE n 
1 136 CYS n 
1 137 GLY n 
1 138 VAL n 
1 139 LYS n 
1 140 GLY n 
1 141 GLY n 
1 142 GLU n 
1 143 THR n 
1 144 VAL n 
1 145 MET n 
1 146 VAL n 
1 147 ASN n 
1 148 ALA n 
1 149 ALA n 
1 150 ALA n 
1 151 GLY n 
1 152 ALA n 
1 153 VAL n 
1 154 GLY n 
1 155 SER n 
1 156 VAL n 
1 157 VAL n 
1 158 GLY n 
1 159 GLN n 
1 160 ILE n 
1 161 ALA n 
1 162 LYS n 
1 163 LEU n 
1 164 LYS n 
1 165 GLY n 
1 166 CYS n 
1 167 LYS n 
1 168 VAL n 
1 169 VAL n 
1 170 GLY n 
1 171 ALA n 
1 172 VAL n 
1 173 GLY n 
1 174 SER n 
1 175 ASP n 
1 176 GLU n 
1 177 LYS n 
1 178 VAL n 
1 179 ALA n 
1 180 TYR n 
1 181 LEU n 
1 182 GLN n 
1 183 LYS n 
1 184 LEU n 
1 185 GLY n 
1 186 PHE n 
1 187 ASP n 
1 188 VAL n 
1 189 VAL n 
1 190 PHE n 
1 191 ASN n 
1 192 TYR n 
1 193 LYS n 
1 194 THR n 
1 195 VAL n 
1 196 GLU n 
1 197 SER n 
1 198 LEU n 
1 199 GLU n 
1 200 GLU n 
1 201 THR n 
1 202 LEU n 
1 203 LYS n 
1 204 LYS n 
1 205 ALA n 
1 206 SER n 
1 207 PRO n 
1 208 ASP n 
1 209 GLY n 
1 210 TYR n 
1 211 ASP n 
1 212 CYS n 
1 213 TYR n 
1 214 PHE n 
1 215 ASP n 
1 216 ASN n 
1 217 VAL n 
1 218 GLY n 
1 219 GLY n 
1 220 GLU n 
1 221 PHE n 
1 222 SER n 
1 223 ASN n 
1 224 THR n 
1 225 VAL n 
1 226 ILE n 
1 227 GLY n 
1 228 GLN n 
1 229 MET n 
1 230 LYS n 
1 231 LYS n 
1 232 PHE n 
1 233 GLY n 
1 234 ARG n 
1 235 ILE n 
1 236 ALA n 
1 237 ILE n 
1 238 CYS n 
1 239 GLY n 
1 240 ALA n 
1 241 ILE n 
1 242 SER n 
1 243 THR n 
1 244 TYR n 
1 245 ASN n 
1 246 ARG n 
1 247 THR n 
1 248 GLY n 
1 249 PRO n 
1 250 LEU n 
1 251 PRO n 
1 252 PRO n 
1 253 GLY n 
1 254 PRO n 
1 255 PRO n 
1 256 PRO n 
1 257 GLU n 
1 258 ILE n 
1 259 VAL n 
1 260 ILE n 
1 261 TYR n 
1 262 GLN n 
1 263 GLU n 
1 264 LEU n 
1 265 ARG n 
1 266 MET n 
1 267 GLU n 
1 268 ALA n 
1 269 PHE n 
1 270 VAL n 
1 271 VAL n 
1 272 TYR n 
1 273 ARG n 
1 274 TRP n 
1 275 GLN n 
1 276 GLY n 
1 277 ASP n 
1 278 ALA n 
1 279 ARG n 
1 280 GLN n 
1 281 LYS n 
1 282 ALA n 
1 283 LEU n 
1 284 LYS n 
1 285 ASP n 
1 286 LEU n 
1 287 LEU n 
1 288 LYS n 
1 289 TRP n 
1 290 VAL n 
1 291 LEU n 
1 292 GLU n 
1 293 GLY n 
1 294 LYS n 
1 295 ILE n 
1 296 GLN n 
1 297 TYR n 
1 298 LYS n 
1 299 GLU n 
1 300 TYR n 
1 301 ILE n 
1 302 ILE n 
1 303 GLU n 
1 304 GLY n 
1 305 PHE n 
1 306 GLU n 
1 307 ASN n 
1 308 MET n 
1 309 PRO n 
1 310 ALA n 
1 311 ALA n 
1 312 PHE n 
1 313 MET n 
1 314 GLY n 
1 315 MET n 
1 316 LEU n 
1 317 LYS n 
1 318 GLY n 
1 319 ASP n 
1 320 ASN n 
1 321 LEU n 
1 322 GLY n 
1 323 LYS n 
1 324 THR n 
1 325 ILE n 
1 326 VAL n 
1 327 LYS n 
1 328 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              R3-PRARE2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PNIC28-BSA4 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTGR1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q14914 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Y05 A 3 ? 328 ? Q14914 4 ? 329 ? 4 329 
2 1 2Y05 B 3 ? 328 ? Q14914 4 ? 329 ? 4 329 
3 1 2Y05 C 3 ? 328 ? Q14914 4 ? 329 ? 4 329 
4 1 2Y05 D 3 ? 328 ? Q14914 4 ? 329 ? 4 329 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y05 SER A 1  ? UNP Q14914 ?   ?  'expression tag' 2  1  
1 2Y05 MET A 2  ? UNP Q14914 ?   ?  'expression tag' 3  2  
1 2Y05 SER A 26 ? UNP Q14914 ALA 27 variant          27 3  
2 2Y05 SER B 1  ? UNP Q14914 ?   ?  'expression tag' 2  4  
2 2Y05 MET B 2  ? UNP Q14914 ?   ?  'expression tag' 3  5  
2 2Y05 SER B 26 ? UNP Q14914 ALA 27 variant          27 6  
3 2Y05 SER C 1  ? UNP Q14914 ?   ?  'expression tag' 2  7  
3 2Y05 MET C 2  ? UNP Q14914 ?   ?  'expression tag' 3  8  
3 2Y05 SER C 26 ? UNP Q14914 ALA 27 variant          27 9  
4 2Y05 SER D 1  ? UNP Q14914 ?   ?  'expression tag' 2  10 
4 2Y05 MET D 2  ? UNP Q14914 ?   ?  'expression tag' 3  11 
4 2Y05 SER D 26 ? UNP Q14914 ALA 27 variant          27 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                                            
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                                            
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                                            
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                                            
'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                                     ?                                            'Cl -1' 
35.453  
CYS 'L-peptide linking' y CYSTEINE                                           ?                                            
'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                     'ETHYLENE GLYCOL'                            
'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                                          ?                                            
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                                            
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                                            
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ?                                            
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                              ?                                            'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                                            
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                                            
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                                            
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                                            
'C5 H11 N O2 S'     149.211 
NAP non-polymer         . 'NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 
;2'-MONOPHOSPHOADENOSINE 5'-DIPHOSPHORIBOSE
;
'C21 H28 N7 O17 P3' 743.405 
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                                            
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                                            
'C5 H9 N O2'        115.130 
RAL non-polymer         . RALOXIFENE                                         ?                                            
'C28 H27 N O4 S'    473.583 
SER 'L-peptide linking' y SERINE                                             ?                                            
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                          ?                                            
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                                            
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                                            
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                             ?                                            
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2Y05 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.34 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 10K, 8% ETGLY, 0.1M HEPES, PH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2008-07-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9788 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.9788 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y05 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             59.50 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   82606 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.0 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        5.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.32 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           0.52 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.60 
_reflns_shell.pdbx_redundancy        3.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y05 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77068 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             59.55 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    94.08 
_refine.ls_R_factor_obs                          0.19570 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19383 
_refine.ls_R_factor_R_free                       0.23085 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4025 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               22.235 
_refine.aniso_B[1][1]                            0.15 
_refine.aniso_B[2][2]                            -0.21 
_refine.aniso_B[3][3]                            0.06 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZSV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.247 
_refine.pdbx_overall_ESU_R_Free                  0.196 
_refine.overall_SU_ML                            0.127 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             4.943 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9909 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         301 
_refine_hist.number_atoms_solvent             438 
_refine_hist.number_atoms_total               10648 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        59.55 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 10461 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 7016  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.430  2.017  ? 14207 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.870  3.003  ? 17107 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.114  5.000  ? 1318  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.048 25.125 ? 361   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.835 15.000 ? 1763  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.386 15.000 ? 27    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 1618  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 11350 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1901  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.463  3.000  ? 6499  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.644  3.000  ? 2697  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.507  5.000  ? 10454 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.033  7.000  ? 3962  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.989  11.000 ? 3748  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 4059 0.26 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
2 B 4059 0.30 0.50 'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 
3 C 4059 0.30 0.50 'medium positional' 1 3 'X-RAY DIFFRACTION' ? ? ? 
4 D 4059 0.25 0.50 'medium positional' 1 4 'X-RAY DIFFRACTION' ? ? ? 
1 A 4059 1.07 2.00 'medium thermal'    1 5 'X-RAY DIFFRACTION' ? ? ? 
2 B 4059 1.26 2.00 'medium thermal'    1 6 'X-RAY DIFFRACTION' ? ? ? 
3 C 4059 1.02 2.00 'medium thermal'    1 7 'X-RAY DIFFRACTION' ? ? ? 
4 D 4059 0.98 2.00 'medium thermal'    1 8 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.number_reflns_R_work             5754 
_refine_ls_shell.R_factor_R_work                  0.249 
_refine_ls_shell.percent_reflns_obs               96.26 
_refine_ls_shell.R_factor_R_free                  0.307 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             271 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 2 A 329 1 4 ? ? ? ? ? ? ? ? 1 ? 
2 B 2 B 329 1 4 ? ? ? ? ? ? ? ? 1 ? 
3 C 2 C 329 1 4 ? ? ? ? ? ? ? ? 1 ? 
4 D 2 D 329 1 4 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2Y05 
_struct.title                     
'Crystal structure of human leukotriene B4 12-hydroxydehydrogenase in complex with NADP and raloxifene' 
_struct.pdbx_descriptor           'PROSTAGLANDIN REDUCTASE 1 (E.C.1.3.1.-, 1.3.1.48, 1.3.1.74)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y05 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 2 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 4 ? 
V  N N 2 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 17  ? SER A 19  ? THR A 18  SER A 20  5 ? 3  
HELX_P HELX_P2  2  PRO A 47  ? ALA A 53  ? PRO A 48  ALA A 54  1 ? 7  
HELX_P HELX_P3  3  LYS A 54  ? LEU A 56  ? LYS A 55  LEU A 57  5 ? 3  
HELX_P HELX_P4  4  PRO A 113 ? GLY A 119 ? PRO A 114 GLY A 120 5 ? 7  
HELX_P HELX_P5  5  GLY A 122 ? GLU A 134 ? GLY A 123 GLU A 135 1 ? 13 
HELX_P HELX_P6  6  GLY A 151 ? LYS A 164 ? GLY A 152 LYS A 165 1 ? 14 
HELX_P HELX_P7  7  SER A 174 ? GLY A 185 ? SER A 175 GLY A 186 1 ? 12 
HELX_P HELX_P8  8  SER A 197 ? SER A 206 ? SER A 198 SER A 207 1 ? 10 
HELX_P HELX_P9  9  GLY A 218 ? GLY A 227 ? GLY A 219 GLY A 228 1 ? 10 
HELX_P HELX_P10 10 ALA A 240 ? ASN A 245 ? ALA A 241 ASN A 246 1 ? 6  
HELX_P HELX_P11 11 PRO A 255 ? GLN A 262 ? PRO A 256 GLN A 263 1 ? 8  
HELX_P HELX_P12 12 VAL A 270 ? TRP A 274 ? VAL A 271 TRP A 275 5 ? 5  
HELX_P HELX_P13 13 GLN A 275 ? GLU A 292 ? GLN A 276 GLU A 293 1 ? 18 
HELX_P HELX_P14 14 ASN A 307 ? LYS A 317 ? ASN A 308 LYS A 318 1 ? 11 
HELX_P HELX_P15 15 THR B 17  ? SER B 19  ? THR B 18  SER B 20  5 ? 3  
HELX_P HELX_P16 16 PRO B 47  ? ALA B 53  ? PRO B 48  ALA B 54  1 ? 7  
HELX_P HELX_P17 17 LYS B 54  ? LEU B 56  ? LYS B 55  LEU B 57  5 ? 3  
HELX_P HELX_P18 18 PRO B 113 ? GLY B 119 ? PRO B 114 GLY B 120 5 ? 7  
HELX_P HELX_P19 19 GLY B 122 ? GLU B 134 ? GLY B 123 GLU B 135 1 ? 13 
HELX_P HELX_P20 20 GLY B 151 ? LYS B 164 ? GLY B 152 LYS B 165 1 ? 14 
HELX_P HELX_P21 21 SER B 174 ? GLY B 185 ? SER B 175 GLY B 186 1 ? 12 
HELX_P HELX_P22 22 SER B 197 ? SER B 206 ? SER B 198 SER B 207 1 ? 10 
HELX_P HELX_P23 23 GLY B 218 ? GLY B 227 ? GLY B 219 GLY B 228 1 ? 10 
HELX_P HELX_P24 24 ALA B 240 ? TYR B 244 ? ALA B 241 TYR B 245 5 ? 5  
HELX_P HELX_P25 25 PRO B 255 ? GLN B 262 ? PRO B 256 GLN B 263 1 ? 8  
HELX_P HELX_P26 26 VAL B 270 ? TRP B 274 ? VAL B 271 TRP B 275 5 ? 5  
HELX_P HELX_P27 27 GLN B 275 ? GLU B 292 ? GLN B 276 GLU B 293 1 ? 18 
HELX_P HELX_P28 28 ASN B 307 ? LYS B 317 ? ASN B 308 LYS B 318 1 ? 11 
HELX_P HELX_P29 29 THR C 17  ? SER C 19  ? THR C 18  SER C 20  5 ? 3  
HELX_P HELX_P30 30 PRO C 47  ? ALA C 53  ? PRO C 48  ALA C 54  1 ? 7  
HELX_P HELX_P31 31 LYS C 54  ? LEU C 56  ? LYS C 55  LEU C 57  5 ? 3  
HELX_P HELX_P32 32 PRO C 113 ? GLY C 119 ? PRO C 114 GLY C 120 5 ? 7  
HELX_P HELX_P33 33 GLY C 122 ? GLU C 134 ? GLY C 123 GLU C 135 1 ? 13 
HELX_P HELX_P34 34 GLY C 151 ? LYS C 164 ? GLY C 152 LYS C 165 1 ? 14 
HELX_P HELX_P35 35 SER C 174 ? GLY C 185 ? SER C 175 GLY C 186 1 ? 12 
HELX_P HELX_P36 36 SER C 197 ? SER C 206 ? SER C 198 SER C 207 1 ? 10 
HELX_P HELX_P37 37 GLY C 218 ? GLY C 227 ? GLY C 219 GLY C 228 1 ? 10 
HELX_P HELX_P38 38 ALA C 240 ? TYR C 244 ? ALA C 241 TYR C 245 5 ? 5  
HELX_P HELX_P39 39 PRO C 255 ? GLN C 262 ? PRO C 256 GLN C 263 1 ? 8  
HELX_P HELX_P40 40 VAL C 270 ? TRP C 274 ? VAL C 271 TRP C 275 5 ? 5  
HELX_P HELX_P41 41 GLN C 275 ? GLU C 292 ? GLN C 276 GLU C 293 1 ? 18 
HELX_P HELX_P42 42 ASN C 307 ? LYS C 317 ? ASN C 308 LYS C 318 1 ? 11 
HELX_P HELX_P43 43 THR D 17  ? SER D 19  ? THR D 18  SER D 20  5 ? 3  
HELX_P HELX_P44 44 PRO D 47  ? ALA D 53  ? PRO D 48  ALA D 54  1 ? 7  
HELX_P HELX_P45 45 LYS D 54  ? LEU D 56  ? LYS D 55  LEU D 57  5 ? 3  
HELX_P HELX_P46 46 PRO D 113 ? GLY D 119 ? PRO D 114 GLY D 120 5 ? 7  
HELX_P HELX_P47 47 GLY D 122 ? GLU D 134 ? GLY D 123 GLU D 135 1 ? 13 
HELX_P HELX_P48 48 GLY D 151 ? LYS D 164 ? GLY D 152 LYS D 165 1 ? 14 
HELX_P HELX_P49 49 SER D 174 ? GLY D 185 ? SER D 175 GLY D 186 1 ? 12 
HELX_P HELX_P50 50 SER D 197 ? SER D 206 ? SER D 198 SER D 207 1 ? 10 
HELX_P HELX_P51 51 GLY D 218 ? GLY D 227 ? GLY D 219 GLY D 228 1 ? 10 
HELX_P HELX_P52 52 ALA D 240 ? TYR D 244 ? ALA D 241 TYR D 245 5 ? 5  
HELX_P HELX_P53 53 PRO D 255 ? GLN D 262 ? PRO D 256 GLN D 263 1 ? 8  
HELX_P HELX_P54 54 VAL D 270 ? TRP D 274 ? VAL D 271 TRP D 275 5 ? 5  
HELX_P HELX_P55 55 GLN D 275 ? GLU D 292 ? GLN D 276 GLU D 293 1 ? 18 
HELX_P HELX_P56 56 ASN D 307 ? LYS D 317 ? ASN D 308 LYS D 318 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
AC ? 6 ? 
AD ? 5 ? 
AE ? 6 ? 
BA ? 2 ? 
BB ? 2 ? 
BC ? 6 ? 
BD ? 5 ? 
BE ? 6 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 6 ? 
CD ? 5 ? 
CE ? 6 ? 
DA ? 2 ? 
DB ? 2 ? 
DC ? 6 ? 
DD ? 5 ? 
DE ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AE 5 6 ? parallel      
BA 1 2 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BC 5 6 ? parallel      
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BE 1 2 ? parallel      
BE 2 3 ? parallel      
BE 3 4 ? parallel      
BE 4 5 ? parallel      
BE 5 6 ? parallel      
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CC 3 4 ? anti-parallel 
CC 4 5 ? anti-parallel 
CC 5 6 ? parallel      
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CD 3 4 ? anti-parallel 
CD 4 5 ? anti-parallel 
CE 1 2 ? parallel      
CE 2 3 ? parallel      
CE 3 4 ? parallel      
CE 4 5 ? parallel      
CE 5 6 ? parallel      
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
DC 4 5 ? anti-parallel 
DC 5 6 ? parallel      
DD 1 2 ? anti-parallel 
DD 2 3 ? anti-parallel 
DD 3 4 ? anti-parallel 
DD 4 5 ? anti-parallel 
DE 1 2 ? parallel      
DE 2 3 ? parallel      
DE 3 4 ? parallel      
DE 4 5 ? parallel      
DE 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 2   ? LEU A 8   ? MET A 3   LEU A 9   
AA 2 PHE A 21  ? GLU A 27  ? PHE A 22  GLU A 28  
AB 1 HIS A 93  ? SER A 96  ? HIS A 94  SER A 97  
AB 2 VAL A 36  ? THR A 44  ? VAL A 37  THR A 45  
AC 1 GLU A 102 ? LYS A 103 ? GLU A 103 LYS A 104 
AC 2 ILE A 83  ? ALA A 86  ? ILE A 84  ALA A 87  
AC 3 GLN A 66  ? SER A 73  ? GLN A 67  SER A 74  
AC 4 VAL A 36  ? THR A 44  ? VAL A 37  THR A 45  
AC 5 LYS A 323 ? LYS A 327 ? LYS A 324 LYS A 328 
AC 6 GLU A 299 ? GLU A 303 ? GLU A 300 GLU A 304 
AD 1 GLU A 102 ? LYS A 103 ? GLU A 103 LYS A 104 
AD 2 ILE A 83  ? ALA A 86  ? ILE A 84  ALA A 87  
AD 3 GLN A 66  ? SER A 73  ? GLN A 67  SER A 74  
AD 4 VAL A 36  ? THR A 44  ? VAL A 37  THR A 45  
AD 5 HIS A 93  ? SER A 96  ? HIS A 94  SER A 97  
AE 1 VAL A 188 ? ASN A 191 ? VAL A 189 ASN A 192 
AE 2 LYS A 167 ? VAL A 172 ? LYS A 168 VAL A 173 
AE 3 THR A 143 ? VAL A 146 ? THR A 144 VAL A 147 
AE 4 TYR A 210 ? ASP A 215 ? TYR A 211 ASP A 216 
AE 5 MET A 229 ? ILE A 237 ? MET A 230 ILE A 238 
AE 6 ARG A 265 ? ALA A 268 ? ARG A 266 ALA A 269 
BA 1 MET B 2   ? LEU B 8   ? MET B 3   LEU B 9   
BA 2 PHE B 21  ? GLU B 27  ? PHE B 22  GLU B 28  
BB 1 HIS B 93  ? SER B 96  ? HIS B 94  SER B 97  
BB 2 VAL B 36  ? THR B 44  ? VAL B 37  THR B 45  
BC 1 GLU B 102 ? LYS B 103 ? GLU B 103 LYS B 104 
BC 2 ILE B 83  ? ALA B 86  ? ILE B 84  ALA B 87  
BC 3 GLN B 66  ? SER B 73  ? GLN B 67  SER B 74  
BC 4 VAL B 36  ? THR B 44  ? VAL B 37  THR B 45  
BC 5 LYS B 323 ? LYS B 327 ? LYS B 324 LYS B 328 
BC 6 GLU B 299 ? GLU B 303 ? GLU B 300 GLU B 304 
BD 1 GLU B 102 ? LYS B 103 ? GLU B 103 LYS B 104 
BD 2 ILE B 83  ? ALA B 86  ? ILE B 84  ALA B 87  
BD 3 GLN B 66  ? SER B 73  ? GLN B 67  SER B 74  
BD 4 VAL B 36  ? THR B 44  ? VAL B 37  THR B 45  
BD 5 HIS B 93  ? SER B 96  ? HIS B 94  SER B 97  
BE 1 VAL B 188 ? ASN B 191 ? VAL B 189 ASN B 192 
BE 2 LYS B 167 ? VAL B 172 ? LYS B 168 VAL B 173 
BE 3 THR B 143 ? VAL B 146 ? THR B 144 VAL B 147 
BE 4 TYR B 210 ? ASP B 215 ? TYR B 211 ASP B 216 
BE 5 MET B 229 ? ILE B 237 ? MET B 230 ILE B 238 
BE 6 ARG B 265 ? ALA B 268 ? ARG B 266 ALA B 269 
CA 1 MET C 2   ? LEU C 8   ? MET C 3   LEU C 9   
CA 2 PHE C 21  ? GLU C 27  ? PHE C 22  GLU C 28  
CB 1 HIS C 93  ? SER C 96  ? HIS C 94  SER C 97  
CB 2 VAL C 36  ? THR C 44  ? VAL C 37  THR C 45  
CC 1 GLU C 102 ? LYS C 103 ? GLU C 103 LYS C 104 
CC 2 ILE C 83  ? ALA C 86  ? ILE C 84  ALA C 87  
CC 3 GLN C 66  ? SER C 73  ? GLN C 67  SER C 74  
CC 4 VAL C 36  ? THR C 44  ? VAL C 37  THR C 45  
CC 5 LYS C 323 ? LYS C 327 ? LYS C 324 LYS C 328 
CC 6 GLU C 299 ? GLU C 303 ? GLU C 300 GLU C 304 
CD 1 GLU C 102 ? LYS C 103 ? GLU C 103 LYS C 104 
CD 2 ILE C 83  ? ALA C 86  ? ILE C 84  ALA C 87  
CD 3 GLN C 66  ? SER C 73  ? GLN C 67  SER C 74  
CD 4 VAL C 36  ? THR C 44  ? VAL C 37  THR C 45  
CD 5 HIS C 93  ? SER C 96  ? HIS C 94  SER C 97  
CE 1 VAL C 188 ? ASN C 191 ? VAL C 189 ASN C 192 
CE 2 LYS C 167 ? VAL C 172 ? LYS C 168 VAL C 173 
CE 3 THR C 143 ? VAL C 146 ? THR C 144 VAL C 147 
CE 4 TYR C 210 ? ASP C 215 ? TYR C 211 ASP C 216 
CE 5 MET C 229 ? ILE C 237 ? MET C 230 ILE C 238 
CE 6 ARG C 265 ? ALA C 268 ? ARG C 266 ALA C 269 
DA 1 MET D 2   ? LEU D 8   ? MET D 3   LEU D 9   
DA 2 PHE D 21  ? GLU D 27  ? PHE D 22  GLU D 28  
DB 1 HIS D 93  ? SER D 96  ? HIS D 94  SER D 97  
DB 2 VAL D 36  ? THR D 44  ? VAL D 37  THR D 45  
DC 1 GLU D 102 ? LYS D 103 ? GLU D 103 LYS D 104 
DC 2 ILE D 83  ? ALA D 86  ? ILE D 84  ALA D 87  
DC 3 GLN D 66  ? SER D 73  ? GLN D 67  SER D 74  
DC 4 VAL D 36  ? THR D 44  ? VAL D 37  THR D 45  
DC 5 LYS D 323 ? LYS D 327 ? LYS D 324 LYS D 328 
DC 6 GLU D 299 ? GLU D 303 ? GLU D 300 GLU D 304 
DD 1 GLU D 102 ? LYS D 103 ? GLU D 103 LYS D 104 
DD 2 ILE D 83  ? ALA D 86  ? ILE D 84  ALA D 87  
DD 3 GLN D 66  ? SER D 73  ? GLN D 67  SER D 74  
DD 4 VAL D 36  ? THR D 44  ? VAL D 37  THR D 45  
DD 5 HIS D 93  ? SER D 96  ? HIS D 94  SER D 97  
DE 1 VAL D 188 ? ASN D 191 ? VAL D 189 ASN D 192 
DE 2 LYS D 167 ? VAL D 172 ? LYS D 168 VAL D 173 
DE 3 THR D 143 ? VAL D 146 ? THR D 144 VAL D 147 
DE 4 TYR D 210 ? ASP D 215 ? TYR D 211 ASP D 216 
DE 5 MET D 229 ? ILE D 237 ? MET D 230 ILE D 238 
DE 6 ARG D 265 ? ALA D 268 ? ARG D 266 ALA D 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 7   ? N THR A 8   O GLU A 22  ? O GLU A 23  
AB 1 2 N SER A 96  ? N SER A 97  O VAL A 36  ? O VAL A 37  
AC 1 2 N GLU A 102 ? N GLU A 103 O LEU A 85  ? O LEU A 86  
AC 2 3 N ALA A 86  ? N ALA A 87  O GLN A 66  ? O GLN A 67  
AC 3 4 N VAL A 71  ? N VAL A 72  O LEU A 37  ? O LEU A 38  
AC 4 5 N LEU A 43  ? N LEU A 44  O VAL A 326 ? O VAL A 327 
AC 5 6 N ILE A 325 ? N ILE A 326 O TYR A 300 ? O TYR A 301 
AD 1 2 N GLU A 102 ? N GLU A 103 O LEU A 85  ? O LEU A 86  
AD 2 3 N ALA A 86  ? N ALA A 87  O GLN A 66  ? O GLN A 67  
AD 3 4 N VAL A 71  ? N VAL A 72  O LEU A 37  ? O LEU A 38  
AD 4 5 N LEU A 38  ? N LEU A 39  O SER A 94  ? O SER A 95  
AE 1 2 N VAL A 188 ? N VAL A 189 O VAL A 168 ? O VAL A 169 
AE 2 3 N VAL A 169 ? N VAL A 170 O VAL A 144 ? O VAL A 145 
AE 3 4 O THR A 143 ? O THR A 144 N ASP A 211 ? N ASP A 212 
AE 4 5 O TYR A 210 ? O TYR A 211 N LYS A 230 ? N LYS A 231 
AE 5 6 N ILE A 235 ? N ILE A 236 O ARG A 265 ? O ARG A 266 
BA 1 2 N THR B 7   ? N THR B 8   O GLU B 22  ? O GLU B 23  
BB 1 2 N SER B 96  ? N SER B 97  O VAL B 36  ? O VAL B 37  
BC 1 2 N GLU B 102 ? N GLU B 103 O LEU B 85  ? O LEU B 86  
BC 2 3 N ALA B 86  ? N ALA B 87  O GLN B 66  ? O GLN B 67  
BC 3 4 N VAL B 71  ? N VAL B 72  O LEU B 37  ? O LEU B 38  
BC 4 5 N LEU B 43  ? N LEU B 44  O VAL B 326 ? O VAL B 327 
BC 5 6 N ILE B 325 ? N ILE B 326 O TYR B 300 ? O TYR B 301 
BD 1 2 N GLU B 102 ? N GLU B 103 O LEU B 85  ? O LEU B 86  
BD 2 3 N ALA B 86  ? N ALA B 87  O GLN B 66  ? O GLN B 67  
BD 3 4 N VAL B 71  ? N VAL B 72  O LEU B 37  ? O LEU B 38  
BD 4 5 N LEU B 38  ? N LEU B 39  O SER B 94  ? O SER B 95  
BE 1 2 N VAL B 188 ? N VAL B 189 O VAL B 168 ? O VAL B 169 
BE 2 3 N VAL B 169 ? N VAL B 170 O VAL B 144 ? O VAL B 145 
BE 3 4 O THR B 143 ? O THR B 144 N ASP B 211 ? N ASP B 212 
BE 4 5 O TYR B 210 ? O TYR B 211 N LYS B 230 ? N LYS B 231 
BE 5 6 N ILE B 235 ? N ILE B 236 O ARG B 265 ? O ARG B 266 
CA 1 2 N THR C 7   ? N THR C 8   O GLU C 22  ? O GLU C 23  
CB 1 2 N SER C 96  ? N SER C 97  O VAL C 36  ? O VAL C 37  
CC 1 2 N GLU C 102 ? N GLU C 103 O LEU C 85  ? O LEU C 86  
CC 2 3 N ALA C 86  ? N ALA C 87  O GLN C 66  ? O GLN C 67  
CC 3 4 N VAL C 71  ? N VAL C 72  O LEU C 37  ? O LEU C 38  
CC 4 5 N LEU C 43  ? N LEU C 44  O VAL C 326 ? O VAL C 327 
CC 5 6 N ILE C 325 ? N ILE C 326 O TYR C 300 ? O TYR C 301 
CD 1 2 N GLU C 102 ? N GLU C 103 O LEU C 85  ? O LEU C 86  
CD 2 3 N ALA C 86  ? N ALA C 87  O GLN C 66  ? O GLN C 67  
CD 3 4 N VAL C 71  ? N VAL C 72  O LEU C 37  ? O LEU C 38  
CD 4 5 N LEU C 38  ? N LEU C 39  O SER C 94  ? O SER C 95  
CE 1 2 N VAL C 188 ? N VAL C 189 O VAL C 168 ? O VAL C 169 
CE 2 3 N VAL C 169 ? N VAL C 170 O VAL C 144 ? O VAL C 145 
CE 3 4 O THR C 143 ? O THR C 144 N ASP C 211 ? N ASP C 212 
CE 4 5 O TYR C 210 ? O TYR C 211 N LYS C 230 ? N LYS C 231 
CE 5 6 N ILE C 235 ? N ILE C 236 O ARG C 265 ? O ARG C 266 
DA 1 2 N THR D 7   ? N THR D 8   O GLU D 22  ? O GLU D 23  
DB 1 2 N SER D 96  ? N SER D 97  O VAL D 36  ? O VAL D 37  
DC 1 2 N GLU D 102 ? N GLU D 103 O LEU D 85  ? O LEU D 86  
DC 2 3 N ALA D 86  ? N ALA D 87  O GLN D 66  ? O GLN D 67  
DC 3 4 N VAL D 71  ? N VAL D 72  O LEU D 37  ? O LEU D 38  
DC 4 5 N LEU D 43  ? N LEU D 44  O VAL D 326 ? O VAL D 327 
DC 5 6 N ILE D 325 ? N ILE D 326 O TYR D 300 ? O TYR D 301 
DD 1 2 N GLU D 102 ? N GLU D 103 O LEU D 85  ? O LEU D 86  
DD 2 3 N ALA D 86  ? N ALA D 87  O GLN D 66  ? O GLN D 67  
DD 3 4 N VAL D 71  ? N VAL D 72  O LEU D 37  ? O LEU D 38  
DD 4 5 N LEU D 38  ? N LEU D 39  O SER D 94  ? O SER D 95  
DE 1 2 N VAL D 188 ? N VAL D 189 O VAL D 168 ? O VAL D 169 
DE 2 3 N VAL D 169 ? N VAL D 170 O VAL D 144 ? O VAL D 145 
DE 3 4 O THR D 143 ? O THR D 144 N ASP D 211 ? N ASP D 212 
DE 4 5 O TYR D 210 ? O TYR D 211 N LYS D 230 ? N LYS D 231 
DE 5 6 N ILE D 235 ? N ILE D 236 O ARG D 265 ? O ARG D 266 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 35 'BINDING SITE FOR RESIDUE NAP A 701'  
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE RAL A 801'  
AC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE RAL A 802'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 1330'  
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 1331' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 1332' 
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1333'  
AC8 Software ? ? ? ? 34 'BINDING SITE FOR RESIDUE NAP B 701'  
AC9 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 1330'  
BC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL B 1331'  
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 1332' 
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE EDO B 1333' 
BC4 Software ? ? ? ? 35 'BINDING SITE FOR RESIDUE NAP C 701'  
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO C 1330' 
BC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE EDO C 1331' 
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO C 1332' 
BC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL C 1333'  
BC9 Software ? ? ? ? 35 'BINDING SITE FOR RESIDUE NAP D 701'  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D 1330' 
CC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO D 1331' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 35 PRO A  47  ? PRO A 48   . ? 1_555 ? 
2   AC1 35 MET A  123 ? MET A 124  . ? 1_555 ? 
3   AC1 35 THR A  127 ? THR A 128  . ? 1_555 ? 
4   AC1 35 GLY A  151 ? GLY A 152  . ? 1_555 ? 
5   AC1 35 ALA A  152 ? ALA A 153  . ? 1_555 ? 
6   AC1 35 VAL A  153 ? VAL A 154  . ? 1_555 ? 
7   AC1 35 VAL A  172 ? VAL A 173  . ? 1_555 ? 
8   AC1 35 GLY A  173 ? GLY A 174  . ? 1_555 ? 
9   AC1 35 LYS A  177 ? LYS A 178  . ? 1_555 ? 
10  AC1 35 TYR A  192 ? TYR A 193  . ? 1_555 ? 
11  AC1 35 ASN A  216 ? ASN A 217  . ? 1_555 ? 
12  AC1 35 VAL A  217 ? VAL A 218  . ? 1_555 ? 
13  AC1 35 CYS A  238 ? CYS A 239  . ? 1_555 ? 
14  AC1 35 GLY A  239 ? GLY A 240  . ? 1_555 ? 
15  AC1 35 ALA A  240 ? ALA A 241  . ? 1_555 ? 
16  AC1 35 ILE A  241 ? ILE A 242  . ? 1_555 ? 
17  AC1 35 SER A  242 ? SER A 243  . ? 1_555 ? 
18  AC1 35 TYR A  244 ? TYR A 245  . ? 1_555 ? 
19  AC1 35 PHE A  269 ? PHE A 270  . ? 1_555 ? 
20  AC1 35 VAL A  270 ? VAL A 271  . ? 1_555 ? 
21  AC1 35 VAL A  271 ? VAL A 272  . ? 1_555 ? 
22  AC1 35 MET A  315 ? MET A 316  . ? 1_555 ? 
23  AC1 35 LEU A  316 ? LEU A 317  . ? 1_555 ? 
24  AC1 35 GLY A  318 ? GLY A 319  . ? 1_555 ? 
25  AC1 35 ASN A  320 ? ASN A 321  . ? 1_555 ? 
26  AC1 35 RAL F  .   ? RAL A 801  . ? 1_555 ? 
27  AC1 35 HOH Y  .   ? HOH A 2091 . ? 1_555 ? 
28  AC1 35 HOH Y  .   ? HOH A 2092 . ? 1_555 ? 
29  AC1 35 HOH Y  .   ? HOH A 2093 . ? 1_555 ? 
30  AC1 35 HOH Y  .   ? HOH A 2094 . ? 1_555 ? 
31  AC1 35 HOH Y  .   ? HOH A 2095 . ? 1_555 ? 
32  AC1 35 HOH Y  .   ? HOH A 2096 . ? 1_555 ? 
33  AC1 35 HOH Y  .   ? HOH A 2097 . ? 1_555 ? 
34  AC1 35 HOH Y  .   ? HOH A 2098 . ? 1_555 ? 
35  AC1 35 HOH Y  .   ? HOH A 2099 . ? 1_555 ? 
36  AC2 11 TYR A  48  ? TYR A 49   . ? 1_555 ? 
37  AC2 11 ARG A  55  ? ARG A 56   . ? 1_555 ? 
38  AC2 11 SER A  87  ? SER A 88   . ? 1_555 ? 
39  AC2 11 TYR A  272 ? TYR A 273  . ? 1_555 ? 
40  AC2 11 NAP E  .   ? NAP A 701  . ? 1_555 ? 
41  AC2 11 RAL G  .   ? RAL A 802  . ? 1_555 ? 
42  AC2 11 CL  K  .   ? CL  A 1333 . ? 1_555 ? 
43  AC2 11 HOH Y  .   ? HOH A 2100 . ? 1_555 ? 
44  AC2 11 VAL B  76  ? VAL B 77   . ? 1_555 ? 
45  AC2 11 GLU B  257 ? GLU B 258  . ? 4_555 ? 
46  AC2 11 TYR B  261 ? TYR B 262  . ? 4_555 ? 
47  AC3 12 TYR A  272 ? TYR A 273  . ? 1_555 ? 
48  AC3 12 ARG A  273 ? ARG A 274  . ? 1_555 ? 
49  AC3 12 RAL F  .   ? RAL A 801  . ? 1_555 ? 
50  AC3 12 ASN B  33  ? ASN B 34   . ? 1_555 ? 
51  AC3 12 GLY B  34  ? GLY B 35   . ? 1_555 ? 
52  AC3 12 LYS B  74  ? LYS B 75   . ? 1_555 ? 
53  AC3 12 ASN B  75  ? ASN B 76   . ? 1_555 ? 
54  AC3 12 VAL B  76  ? VAL B 77   . ? 1_555 ? 
55  AC3 12 ASP B  97  ? ASP B 98   . ? 1_555 ? 
56  AC3 12 LYS B  231 ? LYS B 232  . ? 4_555 ? 
57  AC3 12 TYR B  261 ? TYR B 262  . ? 4_555 ? 
58  AC3 12 GLU B  263 ? GLU B 264  . ? 4_555 ? 
59  AC4 3  GLN A  65  ? GLN A 66   . ? 1_555 ? 
60  AC4 3  ALA A  86  ? ALA A 87   . ? 1_555 ? 
61  AC4 3  SER A  87  ? SER A 88   . ? 1_555 ? 
62  AC5 3  LYS A  230 ? LYS A 231  . ? 1_555 ? 
63  AC5 3  LYS A  231 ? LYS A 232  . ? 1_555 ? 
64  AC5 3  GLN A  262 ? GLN A 263  . ? 1_555 ? 
65  AC6 5  LEU A  126 ? LEU A 127  . ? 1_555 ? 
66  AC6 5  VAL A  271 ? VAL A 272  . ? 1_555 ? 
67  AC6 5  TYR A  272 ? TYR A 273  . ? 1_555 ? 
68  AC6 5  TRP A  274 ? TRP A 275  . ? 1_555 ? 
69  AC6 5  ARG A  279 ? ARG A 280  . ? 1_555 ? 
70  AC7 1  RAL F  .   ? RAL A 801  . ? 1_555 ? 
71  AC8 34 PRO B  47  ? PRO B 48   . ? 1_555 ? 
72  AC8 34 MET B  123 ? MET B 124  . ? 1_555 ? 
73  AC8 34 THR B  127 ? THR B 128  . ? 1_555 ? 
74  AC8 34 GLY B  151 ? GLY B 152  . ? 1_555 ? 
75  AC8 34 ALA B  152 ? ALA B 153  . ? 1_555 ? 
76  AC8 34 VAL B  153 ? VAL B 154  . ? 1_555 ? 
77  AC8 34 VAL B  172 ? VAL B 173  . ? 1_555 ? 
78  AC8 34 GLY B  173 ? GLY B 174  . ? 1_555 ? 
79  AC8 34 LYS B  177 ? LYS B 178  . ? 1_555 ? 
80  AC8 34 TYR B  192 ? TYR B 193  . ? 1_555 ? 
81  AC8 34 ASN B  216 ? ASN B 217  . ? 1_555 ? 
82  AC8 34 VAL B  217 ? VAL B 218  . ? 1_555 ? 
83  AC8 34 CYS B  238 ? CYS B 239  . ? 1_555 ? 
84  AC8 34 GLY B  239 ? GLY B 240  . ? 1_555 ? 
85  AC8 34 ILE B  241 ? ILE B 242  . ? 1_555 ? 
86  AC8 34 SER B  242 ? SER B 243  . ? 1_555 ? 
87  AC8 34 TYR B  244 ? TYR B 245  . ? 1_555 ? 
88  AC8 34 PHE B  269 ? PHE B 270  . ? 1_555 ? 
89  AC8 34 VAL B  270 ? VAL B 271  . ? 1_555 ? 
90  AC8 34 VAL B  271 ? VAL B 272  . ? 1_555 ? 
91  AC8 34 MET B  315 ? MET B 316  . ? 1_555 ? 
92  AC8 34 LEU B  316 ? LEU B 317  . ? 1_555 ? 
93  AC8 34 GLY B  318 ? GLY B 319  . ? 1_555 ? 
94  AC8 34 ASN B  320 ? ASN B 321  . ? 1_555 ? 
95  AC8 34 HOH Z  .   ? HOH B 2063 . ? 1_555 ? 
96  AC8 34 HOH Z  .   ? HOH B 2126 . ? 1_555 ? 
97  AC8 34 HOH Z  .   ? HOH B 2128 . ? 1_555 ? 
98  AC8 34 HOH Z  .   ? HOH B 2129 . ? 1_555 ? 
99  AC8 34 HOH Z  .   ? HOH B 2131 . ? 1_555 ? 
100 AC8 34 HOH Z  .   ? HOH B 2132 . ? 1_555 ? 
101 AC8 34 HOH Z  .   ? HOH B 2133 . ? 1_555 ? 
102 AC8 34 HOH Z  .   ? HOH B 2134 . ? 1_555 ? 
103 AC8 34 HOH Z  .   ? HOH B 2135 . ? 1_555 ? 
104 AC8 34 HOH Z  .   ? HOH B 2136 . ? 1_555 ? 
105 AC9 2  LYS B  99  ? LYS B 100  . ? 1_555 ? 
106 AC9 2  LYS B  231 ? LYS B 232  . ? 4_555 ? 
107 BC1 1  LYS B  288 ? LYS B 289  . ? 1_555 ? 
108 BC2 5  GLN B  65  ? GLN B 66   . ? 1_555 ? 
109 BC2 5  ALA B  86  ? ALA B 87   . ? 1_555 ? 
110 BC2 5  SER B  87  ? SER B 88   . ? 1_555 ? 
111 BC2 5  ASP B  100 ? ASP B 101  . ? 1_555 ? 
112 BC2 5  GLU B  102 ? GLU B 103  . ? 1_555 ? 
113 BC3 8  TYR B  15  ? TYR B 16   . ? 1_555 ? 
114 BC3 8  SER B  242 ? SER B 243  . ? 1_555 ? 
115 BC3 8  ASN B  245 ? ASN B 246  . ? 1_555 ? 
116 BC3 8  ARG B  246 ? ARG B 247  . ? 1_555 ? 
117 BC3 8  HOH Z  .   ? HOH B 2137 . ? 1_555 ? 
118 BC3 8  HOH Z  .   ? HOH B 2138 . ? 1_555 ? 
119 BC3 8  VAL C  13  ? VAL C 14   . ? 3_545 ? 
120 BC3 8  THR C  247 ? THR C 248  . ? 3_545 ? 
121 BC4 35 PRO C  47  ? PRO C 48   . ? 1_555 ? 
122 BC4 35 MET C  123 ? MET C 124  . ? 1_555 ? 
123 BC4 35 THR C  127 ? THR C 128  . ? 1_555 ? 
124 BC4 35 GLY C  151 ? GLY C 152  . ? 1_555 ? 
125 BC4 35 ALA C  152 ? ALA C 153  . ? 1_555 ? 
126 BC4 35 VAL C  153 ? VAL C 154  . ? 1_555 ? 
127 BC4 35 VAL C  172 ? VAL C 173  . ? 1_555 ? 
128 BC4 35 GLY C  173 ? GLY C 174  . ? 1_555 ? 
129 BC4 35 LYS C  177 ? LYS C 178  . ? 1_555 ? 
130 BC4 35 TYR C  192 ? TYR C 193  . ? 1_555 ? 
131 BC4 35 ASN C  216 ? ASN C 217  . ? 1_555 ? 
132 BC4 35 VAL C  217 ? VAL C 218  . ? 1_555 ? 
133 BC4 35 CYS C  238 ? CYS C 239  . ? 1_555 ? 
134 BC4 35 GLY C  239 ? GLY C 240  . ? 1_555 ? 
135 BC4 35 ILE C  241 ? ILE C 242  . ? 1_555 ? 
136 BC4 35 SER C  242 ? SER C 243  . ? 1_555 ? 
137 BC4 35 TYR C  244 ? TYR C 245  . ? 1_555 ? 
138 BC4 35 PHE C  269 ? PHE C 270  . ? 1_555 ? 
139 BC4 35 VAL C  270 ? VAL C 271  . ? 1_555 ? 
140 BC4 35 VAL C  271 ? VAL C 272  . ? 1_555 ? 
141 BC4 35 MET C  315 ? MET C 316  . ? 1_555 ? 
142 BC4 35 LEU C  316 ? LEU C 317  . ? 1_555 ? 
143 BC4 35 GLY C  318 ? GLY C 319  . ? 1_555 ? 
144 BC4 35 ASN C  320 ? ASN C 321  . ? 1_555 ? 
145 BC4 35 HOH AA .   ? HOH C 2004 . ? 1_555 ? 
146 BC4 35 HOH AA .   ? HOH C 2078 . ? 1_555 ? 
147 BC4 35 HOH AA .   ? HOH C 2079 . ? 1_555 ? 
148 BC4 35 HOH AA .   ? HOH C 2080 . ? 1_555 ? 
149 BC4 35 HOH AA .   ? HOH C 2081 . ? 1_555 ? 
150 BC4 35 HOH AA .   ? HOH C 2082 . ? 1_555 ? 
151 BC4 35 HOH AA .   ? HOH C 2083 . ? 1_555 ? 
152 BC4 35 HOH AA .   ? HOH C 2084 . ? 1_555 ? 
153 BC4 35 HOH AA .   ? HOH C 2085 . ? 1_555 ? 
154 BC4 35 HOH AA .   ? HOH C 2086 . ? 1_555 ? 
155 BC4 35 HOH AA .   ? HOH C 2087 . ? 1_555 ? 
156 BC5 4  GLN C  275 ? GLN C 276  . ? 1_555 ? 
157 BC5 4  GLY C  276 ? GLY C 277  . ? 1_555 ? 
158 BC5 4  ASP C  277 ? ASP C 278  . ? 1_555 ? 
159 BC5 4  ALA C  278 ? ALA C 279  . ? 1_555 ? 
160 BC6 8  LEU C  85  ? LEU C 86   . ? 1_555 ? 
161 BC6 8  GLU C  102 ? GLU C 103  . ? 1_555 ? 
162 BC6 8  LEU C  104 ? LEU C 105  . ? 1_555 ? 
163 BC6 8  LEU C  105 ? LEU C 106  . ? 1_555 ? 
164 BC6 8  ALA C  117 ? ALA C 118  . ? 1_555 ? 
165 BC6 8  VAL C  121 ? VAL C 122  . ? 1_555 ? 
166 BC6 8  GLY C  122 ? GLY C 123  . ? 1_555 ? 
167 BC6 8  LEU C  283 ? LEU C 284  . ? 1_555 ? 
168 BC7 3  SER C  197 ? SER C 198  . ? 1_555 ? 
169 BC7 3  LEU C  198 ? LEU C 199  . ? 1_555 ? 
170 BC7 3  GLU C  199 ? GLU C 200  . ? 1_555 ? 
171 BC8 1  GLU C  58  ? GLU C 59   . ? 1_555 ? 
172 BC9 35 PRO D  47  ? PRO D 48   . ? 1_555 ? 
173 BC9 35 MET D  123 ? MET D 124  . ? 1_555 ? 
174 BC9 35 THR D  127 ? THR D 128  . ? 1_555 ? 
175 BC9 35 GLY D  151 ? GLY D 152  . ? 1_555 ? 
176 BC9 35 ALA D  152 ? ALA D 153  . ? 1_555 ? 
177 BC9 35 VAL D  153 ? VAL D 154  . ? 1_555 ? 
178 BC9 35 VAL D  172 ? VAL D 173  . ? 1_555 ? 
179 BC9 35 GLY D  173 ? GLY D 174  . ? 1_555 ? 
180 BC9 35 LYS D  177 ? LYS D 178  . ? 1_555 ? 
181 BC9 35 TYR D  192 ? TYR D 193  . ? 1_555 ? 
182 BC9 35 ASN D  216 ? ASN D 217  . ? 1_555 ? 
183 BC9 35 VAL D  217 ? VAL D 218  . ? 1_555 ? 
184 BC9 35 CYS D  238 ? CYS D 239  . ? 1_555 ? 
185 BC9 35 GLY D  239 ? GLY D 240  . ? 1_555 ? 
186 BC9 35 ILE D  241 ? ILE D 242  . ? 1_555 ? 
187 BC9 35 SER D  242 ? SER D 243  . ? 1_555 ? 
188 BC9 35 TYR D  244 ? TYR D 245  . ? 1_555 ? 
189 BC9 35 PHE D  269 ? PHE D 270  . ? 1_555 ? 
190 BC9 35 VAL D  270 ? VAL D 271  . ? 1_555 ? 
191 BC9 35 VAL D  271 ? VAL D 272  . ? 1_555 ? 
192 BC9 35 MET D  315 ? MET D 316  . ? 1_555 ? 
193 BC9 35 LEU D  316 ? LEU D 317  . ? 1_555 ? 
194 BC9 35 GLY D  318 ? GLY D 319  . ? 1_555 ? 
195 BC9 35 ASN D  320 ? ASN D 321  . ? 1_555 ? 
196 BC9 35 HOH BA .   ? HOH D 2011 . ? 1_555 ? 
197 BC9 35 HOH BA .   ? HOH D 2064 . ? 1_555 ? 
198 BC9 35 HOH BA .   ? HOH D 2103 . ? 1_555 ? 
199 BC9 35 HOH BA .   ? HOH D 2104 . ? 1_555 ? 
200 BC9 35 HOH BA .   ? HOH D 2105 . ? 1_555 ? 
201 BC9 35 HOH BA .   ? HOH D 2106 . ? 1_555 ? 
202 BC9 35 HOH BA .   ? HOH D 2107 . ? 1_555 ? 
203 BC9 35 HOH BA .   ? HOH D 2108 . ? 1_555 ? 
204 BC9 35 HOH BA .   ? HOH D 2109 . ? 1_555 ? 
205 BC9 35 HOH BA .   ? HOH D 2110 . ? 1_555 ? 
206 BC9 35 HOH BA .   ? HOH D 2111 . ? 1_555 ? 
207 CC1 5  GLN D  65  ? GLN D 66   . ? 1_555 ? 
208 CC1 5  ALA D  86  ? ALA D 87   . ? 1_555 ? 
209 CC1 5  SER D  87  ? SER D 88   . ? 1_555 ? 
210 CC1 5  ASP D  100 ? ASP D 101  . ? 1_555 ? 
211 CC1 5  GLU D  102 ? GLU D 103  . ? 1_555 ? 
212 CC2 5  GLU D  102 ? GLU D 103  . ? 1_555 ? 
213 CC2 5  LYS D  103 ? LYS D 104  . ? 1_555 ? 
214 CC2 5  LEU D  104 ? LEU D 105  . ? 1_555 ? 
215 CC2 5  LEU D  105 ? LEU D 106  . ? 1_555 ? 
216 CC2 5  VAL D  121 ? VAL D 122  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y05 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y05 
_atom_sites.fract_transf_matrix[1][1]   0.010721 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008576 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006468 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 1   ? 28.839  65.648  40.789  1.00 49.81 ? 2    SER A N   1 
ATOM   2     C  CA  . SER A  1 1   ? 30.066  65.378  39.970  1.00 49.52 ? 2    SER A CA  1 
ATOM   3     C  C   . SER A  1 1   ? 29.765  65.334  38.460  1.00 47.46 ? 2    SER A C   1 
ATOM   4     O  O   . SER A  1 1   ? 29.028  64.456  37.977  1.00 46.12 ? 2    SER A O   1 
ATOM   5     C  CB  . SER A  1 1   ? 30.697  64.058  40.387  1.00 50.05 ? 2    SER A CB  1 
ATOM   6     O  OG  . SER A  1 1   ? 31.745  63.722  39.491  1.00 53.55 ? 2    SER A OG  1 
ATOM   7     N  N   . MET A  1 2   ? 30.352  66.279  37.724  1.00 45.49 ? 3    MET A N   1 
ATOM   8     C  CA  . MET A  1 2   ? 30.167  66.366  36.270  1.00 44.48 ? 3    MET A CA  1 
ATOM   9     C  C   . MET A  1 2   ? 31.385  65.813  35.505  1.00 41.90 ? 3    MET A C   1 
ATOM   10    O  O   . MET A  1 2   ? 32.501  65.781  36.037  1.00 42.87 ? 3    MET A O   1 
ATOM   11    C  CB  . MET A  1 2   ? 29.922  67.824  35.870  1.00 43.53 ? 3    MET A CB  1 
ATOM   12    C  CG  . MET A  1 2   ? 28.702  68.450  36.542  1.00 48.62 ? 3    MET A CG  1 
ATOM   13    S  SD  . MET A  1 2   ? 27.142  67.768  35.911  1.00 53.52 ? 3    MET A SD  1 
ATOM   14    C  CE  . MET A  1 2   ? 27.019  68.670  34.365  1.00 52.71 ? 3    MET A CE  1 
ATOM   15    N  N   . THR A  1 3   ? 31.164  65.385  34.260  1.00 38.71 ? 4    THR A N   1 
ATOM   16    C  CA  . THR A  1 3   ? 32.279  65.109  33.343  1.00 36.38 ? 4    THR A CA  1 
ATOM   17    C  C   . THR A  1 3   ? 32.102  65.827  32.012  1.00 34.36 ? 4    THR A C   1 
ATOM   18    O  O   . THR A  1 3   ? 30.995  66.248  31.665  1.00 33.45 ? 4    THR A O   1 
ATOM   19    C  CB  . THR A  1 3   ? 32.464  63.610  33.062  1.00 35.12 ? 4    THR A CB  1 
ATOM   20    O  OG1 . THR A  1 3   ? 33.708  63.421  32.390  1.00 38.32 ? 4    THR A OG1 1 
ATOM   21    C  CG2 . THR A  1 3   ? 31.348  63.081  32.181  1.00 34.69 ? 4    THR A CG2 1 
ATOM   22    N  N   . LYS A  1 4   ? 33.213  65.957  31.287  1.00 31.55 ? 5    LYS A N   1 
ATOM   23    C  CA  . LYS A  1 4   ? 33.213  66.448  29.912  1.00 31.97 ? 5    LYS A CA  1 
ATOM   24    C  C   . LYS A  1 4   ? 33.662  65.282  29.037  1.00 29.55 ? 5    LYS A C   1 
ATOM   25    O  O   . LYS A  1 4   ? 34.582  64.575  29.393  1.00 29.50 ? 5    LYS A O   1 
ATOM   26    C  CB  . LYS A  1 4   ? 34.137  67.678  29.778  1.00 32.15 ? 5    LYS A CB  1 
ATOM   27    C  CG  . LYS A  1 4   ? 33.525  68.991  30.321  1.00 35.69 ? 5    LYS A CG  1 
ATOM   28    C  CD  . LYS A  1 4   ? 34.515  70.168  30.377  1.00 40.75 ? 5    LYS A CD  1 
ATOM   29    N  N   . THR A  1 5   ? 32.978  65.019  27.932  1.00 29.21 ? 6    THR A N   1 
ATOM   30    C  CA  . THR A  1 5   ? 33.336  63.862  27.096  1.00 27.30 ? 6    THR A CA  1 
ATOM   31    C  C   . THR A  1 5   ? 33.317  64.203  25.618  1.00 27.41 ? 6    THR A C   1 
ATOM   32    O  O   . THR A  1 5   ? 32.360  64.802  25.123  1.00 27.59 ? 6    THR A O   1 
ATOM   33    C  CB  . THR A  1 5   ? 32.402  62.675  27.369  1.00 27.65 ? 6    THR A CB  1 
ATOM   34    O  OG1 . THR A  1 5   ? 32.319  62.465  28.792  1.00 30.80 ? 6    THR A OG1 1 
ATOM   35    C  CG2 . THR A  1 5   ? 32.912  61.398  26.694  1.00 29.25 ? 6    THR A CG2 1 
ATOM   36    N  N   . TRP A  1 6   ? 34.375  63.831  24.893  1.00 25.44 ? 7    TRP A N   1 
ATOM   37    C  CA  . TRP A  1 6   ? 34.339  64.033  23.454  1.00 23.06 ? 7    TRP A CA  1 
ATOM   38    C  C   . TRP A  1 6   ? 33.734  62.806  22.788  1.00 23.00 ? 7    TRP A C   1 
ATOM   39    O  O   . TRP A  1 6   ? 34.219  61.693  22.987  1.00 23.72 ? 7    TRP A O   1 
ATOM   40    C  CB  . TRP A  1 6   ? 35.742  64.313  22.908  1.00 24.25 ? 7    TRP A CB  1 
ATOM   41    C  CG  . TRP A  1 6   ? 36.191  65.721  23.031  1.00 21.40 ? 7    TRP A CG  1 
ATOM   42    C  CD1 . TRP A  1 6   ? 37.174  66.193  23.849  1.00 22.32 ? 7    TRP A CD1 1 
ATOM   43    C  CD2 . TRP A  1 6   ? 35.691  66.854  22.298  1.00 20.27 ? 7    TRP A CD2 1 
ATOM   44    N  NE1 . TRP A  1 6   ? 37.310  67.556  23.682  1.00 21.86 ? 7    TRP A NE1 1 
ATOM   45    C  CE2 . TRP A  1 6   ? 36.418  67.981  22.728  1.00 22.86 ? 7    TRP A CE2 1 
ATOM   46    C  CE3 . TRP A  1 6   ? 34.699  67.022  21.320  1.00 23.89 ? 7    TRP A CE3 1 
ATOM   47    C  CZ2 . TRP A  1 6   ? 36.192  69.267  22.207  1.00 24.72 ? 7    TRP A CZ2 1 
ATOM   48    C  CZ3 . TRP A  1 6   ? 34.479  68.307  20.793  1.00 20.69 ? 7    TRP A CZ3 1 
ATOM   49    C  CH2 . TRP A  1 6   ? 35.224  69.410  21.251  1.00 22.17 ? 7    TRP A CH2 1 
ATOM   50    N  N   . THR A  1 7   ? 32.681  63.019  21.993  1.00 23.70 ? 8    THR A N   1 
ATOM   51    C  CA  . THR A  1 7   ? 32.004  61.960  21.258  1.00 23.43 ? 8    THR A CA  1 
ATOM   52    C  C   . THR A  1 7   ? 32.188  62.164  19.757  1.00 26.31 ? 8    THR A C   1 
ATOM   53    O  O   . THR A  1 7   ? 32.465  63.288  19.295  1.00 26.66 ? 8    THR A O   1 
ATOM   54    C  CB  . THR A  1 7   ? 30.498  61.917  21.551  1.00 26.24 ? 8    THR A CB  1 
ATOM   55    O  OG1 . THR A  1 7   ? 29.838  63.061  20.964  1.00 27.11 ? 8    THR A OG1 1 
ATOM   56    C  CG2 . THR A  1 7   ? 30.212  61.826  23.088  1.00 21.56 ? 8    THR A CG2 1 
ATOM   57    N  N   . LEU A  1 8   ? 32.045  61.073  19.006  1.00 24.24 ? 9    LEU A N   1 
ATOM   58    C  CA  . LEU A  1 8   ? 32.070  61.110  17.566  1.00 24.31 ? 9    LEU A CA  1 
ATOM   59    C  C   . LEU A  1 8   ? 30.669  61.400  17.012  1.00 26.50 ? 9    LEU A C   1 
ATOM   60    O  O   . LEU A  1 8   ? 29.823  60.512  16.992  1.00 30.29 ? 9    LEU A O   1 
ATOM   61    C  CB  . LEU A  1 8   ? 32.586  59.768  17.029  1.00 25.00 ? 9    LEU A CB  1 
ATOM   62    C  CG  . LEU A  1 8   ? 32.678  59.559  15.510  1.00 24.46 ? 9    LEU A CG  1 
ATOM   63    C  CD1 . LEU A  1 8   ? 33.917  60.174  14.940  1.00 21.33 ? 9    LEU A CD1 1 
ATOM   64    C  CD2 . LEU A  1 8   ? 32.662  58.083  15.184  1.00 24.45 ? 9    LEU A CD2 1 
ATOM   65    N  N   . LYS A  1 9   ? 30.439  62.630  16.551  1.00 26.23 ? 10   LYS A N   1 
ATOM   66    C  CA  . LYS A  1 9   ? 29.145  63.039  16.028  1.00 28.29 ? 10   LYS A CA  1 
ATOM   67    C  C   . LYS A  1 9   ? 28.939  62.379  14.687  1.00 27.82 ? 10   LYS A C   1 
ATOM   68    O  O   . LYS A  1 9   ? 27.861  61.852  14.409  1.00 29.62 ? 10   LYS A O   1 
ATOM   69    C  CB  . LYS A  1 9   ? 29.043  64.568  15.867  1.00 30.06 ? 10   LYS A CB  1 
ATOM   70    C  CG  . LYS A  1 9   ? 27.611  65.077  15.639  1.00 33.01 ? 10   LYS A CG  1 
ATOM   71    C  CD  . LYS A  1 9   ? 27.573  66.598  15.389  1.00 41.12 ? 10   LYS A CD  1 
ATOM   72    C  CE  . LYS A  1 9   ? 27.558  66.919  13.873  1.00 43.43 ? 10   LYS A CE  1 
ATOM   73    N  NZ  . LYS A  1 9   ? 27.905  68.335  13.530  1.00 40.13 ? 10   LYS A NZ  1 
ATOM   74    N  N   . LYS A  1 10  ? 29.990  62.372  13.874  1.00 27.89 ? 11   LYS A N   1 
ATOM   75    C  CA  . LYS A  1 10  ? 29.922  61.808  12.538  1.00 27.05 ? 11   LYS A CA  1 
ATOM   76    C  C   . LYS A  1 10  ? 31.236  61.083  12.186  1.00 24.76 ? 11   LYS A C   1 
ATOM   77    O  O   . LYS A  1 10  ? 32.327  61.550  12.519  1.00 23.32 ? 11   LYS A O   1 
ATOM   78    C  CB  . LYS A  1 10  ? 29.625  62.928  11.534  1.00 28.13 ? 11   LYS A CB  1 
ATOM   79    C  CG  . LYS A  1 10  ? 28.752  62.529  10.362  1.00 38.84 ? 11   LYS A CG  1 
ATOM   80    C  CD  . LYS A  1 10  ? 27.250  62.678  10.664  1.00 45.22 ? 11   LYS A CD  1 
ATOM   81    N  N   . HIS A  1 11  ? 31.107  59.952  11.504  1.00 23.87 ? 12   HIS A N   1 
ATOM   82    C  CA  . HIS A  1 11  ? 32.247  59.217  11.019  1.00 24.21 ? 12   HIS A CA  1 
ATOM   83    C  C   . HIS A  1 11  ? 33.078  60.121  10.096  1.00 23.58 ? 12   HIS A C   1 
ATOM   84    O  O   . HIS A  1 11  ? 32.551  60.911  9.311   1.00 23.64 ? 12   HIS A O   1 
ATOM   85    C  CB  . HIS A  1 11  ? 31.821  57.923  10.297  1.00 23.71 ? 12   HIS A CB  1 
ATOM   86    C  CG  . HIS A  1 11  ? 31.431  56.811  11.227  1.00 27.15 ? 12   HIS A CG  1 
ATOM   87    N  ND1 . HIS A  1 11  ? 32.340  56.170  12.042  1.00 25.33 ? 12   HIS A ND1 1 
ATOM   88    C  CD2 . HIS A  1 11  ? 30.226  56.250  11.496  1.00 25.64 ? 12   HIS A CD2 1 
ATOM   89    C  CE1 . HIS A  1 11  ? 31.719  55.245  12.748  1.00 26.00 ? 12   HIS A CE1 1 
ATOM   90    N  NE2 . HIS A  1 11  ? 30.433  55.280  12.443  1.00 28.01 ? 12   HIS A NE2 1 
ATOM   91    N  N   . PHE A  1 12  ? 34.386  59.985  10.211  1.00 21.39 ? 13   PHE A N   1 
ATOM   92    C  CA  . PHE A  1 12  ? 35.308  60.792  9.441   1.00 20.68 ? 13   PHE A CA  1 
ATOM   93    C  C   . PHE A  1 12  ? 35.273  60.422  7.970   1.00 21.85 ? 13   PHE A C   1 
ATOM   94    O  O   . PHE A  1 12  ? 35.218  59.230  7.613   1.00 22.41 ? 13   PHE A O   1 
ATOM   95    C  CB  . PHE A  1 12  ? 36.726  60.625  9.964   1.00 17.78 ? 13   PHE A CB  1 
ATOM   96    C  CG  . PHE A  1 12  ? 36.842  60.744  11.451  1.00 19.60 ? 13   PHE A CG  1 
ATOM   97    C  CD1 . PHE A  1 12  ? 36.293  61.835  12.121  1.00 18.76 ? 13   PHE A CD1 1 
ATOM   98    C  CD2 . PHE A  1 12  ? 37.507  59.771  12.194  1.00 15.87 ? 13   PHE A CD2 1 
ATOM   99    C  CE1 . PHE A  1 12  ? 36.409  61.937  13.507  1.00 21.95 ? 13   PHE A CE1 1 
ATOM   100   C  CE2 . PHE A  1 12  ? 37.640  59.892  13.576  1.00 15.66 ? 13   PHE A CE2 1 
ATOM   101   C  CZ  . PHE A  1 12  ? 37.077  60.965  14.228  1.00 17.33 ? 13   PHE A CZ  1 
ATOM   102   N  N   . VAL A  1 13  ? 35.311  61.450  7.122   1.00 20.99 ? 14   VAL A N   1 
ATOM   103   C  CA  . VAL A  1 13  ? 35.567  61.282  5.694   1.00 21.85 ? 14   VAL A CA  1 
ATOM   104   C  C   . VAL A  1 13  ? 36.887  61.995  5.394   1.00 21.48 ? 14   VAL A C   1 
ATOM   105   O  O   . VAL A  1 13  ? 37.000  63.213  5.553   1.00 19.45 ? 14   VAL A O   1 
ATOM   106   C  CB  . VAL A  1 13  ? 34.417  61.867  4.809   1.00 21.82 ? 14   VAL A CB  1 
ATOM   107   C  CG1 . VAL A  1 13  ? 34.686  61.578  3.347   1.00 22.63 ? 14   VAL A CG1 1 
ATOM   108   C  CG2 . VAL A  1 13  ? 33.045  61.270  5.213   1.00 22.29 ? 14   VAL A CG2 1 
ATOM   109   N  N   . GLY A  1 14  ? 37.887  61.223  4.975   1.00 19.11 ? 15   GLY A N   1 
ATOM   110   C  CA  . GLY A  1 14  ? 39.227  61.737  4.809   1.00 17.74 ? 15   GLY A CA  1 
ATOM   111   C  C   . GLY A  1 14  ? 39.824  61.971  6.170   1.00 18.69 ? 15   GLY A C   1 
ATOM   112   O  O   . GLY A  1 14  ? 39.762  61.109  7.083   1.00 22.23 ? 15   GLY A O   1 
ATOM   113   N  N   . TYR A  1 15  ? 40.388  63.150  6.339   1.00 20.06 ? 16   TYR A N   1 
ATOM   114   C  CA  . TYR A  1 15  ? 40.779  63.600  7.658   1.00 19.82 ? 16   TYR A CA  1 
ATOM   115   C  C   . TYR A  1 15  ? 39.550  64.063  8.378   1.00 20.16 ? 16   TYR A C   1 
ATOM   116   O  O   . TYR A  1 15  ? 38.569  64.552  7.750   1.00 20.85 ? 16   TYR A O   1 
ATOM   117   C  CB  . TYR A  1 15  ? 41.772  64.752  7.599   1.00 19.46 ? 16   TYR A CB  1 
ATOM   118   C  CG  . TYR A  1 15  ? 43.125  64.368  7.105   1.00 20.84 ? 16   TYR A CG  1 
ATOM   119   C  CD1 . TYR A  1 15  ? 44.091  63.862  7.977   1.00 19.81 ? 16   TYR A CD1 1 
ATOM   120   C  CD2 . TYR A  1 15  ? 43.458  64.523  5.764   1.00 23.93 ? 16   TYR A CD2 1 
ATOM   121   C  CE1 . TYR A  1 15  ? 45.343  63.501  7.511   1.00 21.95 ? 16   TYR A CE1 1 
ATOM   122   C  CE2 . TYR A  1 15  ? 44.714  64.197  5.294   1.00 26.36 ? 16   TYR A CE2 1 
ATOM   123   C  CZ  . TYR A  1 15  ? 45.652  63.691  6.171   1.00 24.16 ? 16   TYR A CZ  1 
ATOM   124   O  OH  . TYR A  1 15  ? 46.879  63.366  5.684   1.00 21.91 ? 16   TYR A OH  1 
ATOM   125   N  N   . PRO A  1 16  ? 39.579  63.935  9.702   1.00 18.55 ? 17   PRO A N   1 
ATOM   126   C  CA  . PRO A  1 16  ? 38.485  64.498  10.465  1.00 20.26 ? 17   PRO A CA  1 
ATOM   127   C  C   . PRO A  1 16  ? 38.488  66.031  10.378  1.00 20.82 ? 17   PRO A C   1 
ATOM   128   O  O   . PRO A  1 16  ? 39.525  66.659  10.006  1.00 19.32 ? 17   PRO A O   1 
ATOM   129   C  CB  . PRO A  1 16  ? 38.797  64.057  11.896  1.00 19.33 ? 17   PRO A CB  1 
ATOM   130   C  CG  . PRO A  1 16  ? 39.816  63.008  11.762  1.00 22.37 ? 17   PRO A CG  1 
ATOM   131   C  CD  . PRO A  1 16  ? 40.603  63.360  10.562  1.00 15.87 ? 17   PRO A CD  1 
ATOM   132   N  N   . THR A  1 17  ? 37.343  66.612  10.713  1.00 19.14 ? 18   THR A N   1 
ATOM   133   C  CA  . THR A  1 17  ? 37.231  68.062  10.934  1.00 20.02 ? 18   THR A CA  1 
ATOM   134   C  C   . THR A  1 17  ? 36.440  68.277  12.235  1.00 21.07 ? 18   THR A C   1 
ATOM   135   O  O   . THR A  1 17  ? 35.933  67.327  12.807  1.00 18.26 ? 18   THR A O   1 
ATOM   136   C  CB  . THR A  1 17  ? 36.589  68.779  9.721   1.00 21.38 ? 18   THR A CB  1 
ATOM   137   O  OG1 . THR A  1 17  ? 36.516  70.190  9.961   1.00 22.48 ? 18   THR A OG1 1 
ATOM   138   C  CG2 . THR A  1 17  ? 35.194  68.233  9.405   1.00 16.95 ? 18   THR A CG2 1 
ATOM   139   N  N   . ASN A  1 18  ? 36.324  69.517  12.704  1.00 22.55 ? 19   ASN A N   1 
ATOM   140   C  CA  . ASN A  1 18  ? 35.804  69.762  14.062  1.00 22.73 ? 19   ASN A CA  1 
ATOM   141   C  C   . ASN A  1 18  ? 34.371  69.336  14.222  1.00 23.92 ? 19   ASN A C   1 
ATOM   142   O  O   . ASN A  1 18  ? 33.988  68.793  15.264  1.00 24.31 ? 19   ASN A O   1 
ATOM   143   C  CB  . ASN A  1 18  ? 35.945  71.235  14.457  1.00 25.13 ? 19   ASN A CB  1 
ATOM   144   C  CG  . ASN A  1 18  ? 37.362  71.727  14.315  1.00 22.15 ? 19   ASN A CG  1 
ATOM   145   O  OD1 . ASN A  1 18  ? 38.103  71.850  15.285  1.00 25.67 ? 19   ASN A OD1 1 
ATOM   146   N  ND2 . ASN A  1 18  ? 37.758  71.961  13.091  1.00 19.77 ? 19   ASN A ND2 1 
ATOM   147   N  N   . SER A  1 19  ? 33.573  69.537  13.178  1.00 23.34 ? 20   SER A N   1 
ATOM   148   C  CA  . SER A  1 19  ? 32.161  69.184  13.255  1.00 23.91 ? 20   SER A CA  1 
ATOM   149   C  C   . SER A  1 19  ? 31.892  67.677  13.349  1.00 24.49 ? 20   SER A C   1 
ATOM   150   O  O   . SER A  1 19  ? 30.740  67.298  13.608  1.00 23.22 ? 20   SER A O   1 
ATOM   151   C  CB  . SER A  1 19  ? 31.397  69.792  12.077  1.00 24.48 ? 20   SER A CB  1 
ATOM   152   O  OG  . SER A  1 19  ? 31.900  69.294  10.836  1.00 31.13 ? 20   SER A OG  1 
ATOM   153   N  N   . ASP A  1 20  ? 32.920  66.830  13.152  1.00 24.32 ? 21   ASP A N   1 
ATOM   154   C  CA  . ASP A  1 20  ? 32.801  65.360  13.347  1.00 23.30 ? 21   ASP A CA  1 
ATOM   155   C  C   . ASP A  1 20  ? 32.759  64.939  14.826  1.00 24.90 ? 21   ASP A C   1 
ATOM   156   O  O   . ASP A  1 20  ? 32.303  63.820  15.171  1.00 24.02 ? 21   ASP A O   1 
ATOM   157   C  CB  . ASP A  1 20  ? 33.956  64.616  12.650  1.00 23.23 ? 21   ASP A CB  1 
ATOM   158   C  CG  . ASP A  1 20  ? 33.948  64.807  11.153  1.00 25.26 ? 21   ASP A CG  1 
ATOM   159   O  OD1 . ASP A  1 20  ? 32.831  64.986  10.578  1.00 21.96 ? 21   ASP A OD1 1 
ATOM   160   O  OD2 . ASP A  1 20  ? 35.059  64.811  10.570  1.00 20.82 ? 21   ASP A OD2 1 
ATOM   161   N  N   . PHE A  1 21  ? 33.268  65.831  15.675  1.00 25.38 ? 22   PHE A N   1 
ATOM   162   C  CA  . PHE A  1 21  ? 33.326  65.655  17.117  1.00 24.02 ? 22   PHE A CA  1 
ATOM   163   C  C   . PHE A  1 21  ? 32.252  66.515  17.833  1.00 27.14 ? 22   PHE A C   1 
ATOM   164   O  O   . PHE A  1 21  ? 31.858  67.585  17.363  1.00 25.89 ? 22   PHE A O   1 
ATOM   165   C  CB  . PHE A  1 21  ? 34.698  66.075  17.627  1.00 23.83 ? 22   PHE A CB  1 
ATOM   166   C  CG  . PHE A  1 21  ? 35.847  65.389  16.952  1.00 21.01 ? 22   PHE A CG  1 
ATOM   167   C  CD1 . PHE A  1 21  ? 36.360  65.873  15.772  1.00 22.29 ? 22   PHE A CD1 1 
ATOM   168   C  CD2 . PHE A  1 21  ? 36.424  64.266  17.507  1.00 23.11 ? 22   PHE A CD2 1 
ATOM   169   C  CE1 . PHE A  1 21  ? 37.424  65.239  15.142  1.00 18.27 ? 22   PHE A CE1 1 
ATOM   170   C  CE2 . PHE A  1 21  ? 37.496  63.637  16.886  1.00 23.47 ? 22   PHE A CE2 1 
ATOM   171   C  CZ  . PHE A  1 21  ? 37.996  64.135  15.708  1.00 18.05 ? 22   PHE A CZ  1 
ATOM   172   N  N   . GLU A  1 22  ? 31.772  66.036  18.973  1.00 27.81 ? 23   GLU A N   1 
ATOM   173   C  CA  . GLU A  1 22  ? 30.827  66.811  19.777  1.00 29.62 ? 23   GLU A CA  1 
ATOM   174   C  C   . GLU A  1 22  ? 31.139  66.579  21.232  1.00 27.89 ? 23   GLU A C   1 
ATOM   175   O  O   . GLU A  1 22  ? 31.274  65.450  21.656  1.00 27.99 ? 23   GLU A O   1 
ATOM   176   C  CB  . GLU A  1 22  ? 29.370  66.416  19.499  1.00 28.22 ? 23   GLU A CB  1 
ATOM   177   C  CG  . GLU A  1 22  ? 28.392  67.110  20.463  1.00 34.35 ? 23   GLU A CG  1 
ATOM   178   C  CD  . GLU A  1 22  ? 26.957  67.133  19.965  1.00 37.61 ? 23   GLU A CD  1 
ATOM   179   O  OE1 . GLU A  1 22  ? 26.396  66.057  19.695  1.00 40.18 ? 23   GLU A OE1 1 
ATOM   180   O  OE2 . GLU A  1 22  ? 26.392  68.236  19.851  1.00 48.72 ? 23   GLU A OE2 1 
ATOM   181   N  N   . LEU A  1 23  ? 31.243  67.658  21.981  1.00 29.72 ? 24   LEU A N   1 
ATOM   182   C  CA  . LEU A  1 23  ? 31.574  67.611  23.390  1.00 31.22 ? 24   LEU A CA  1 
ATOM   183   C  C   . LEU A  1 23  ? 30.250  67.609  24.186  1.00 33.67 ? 24   LEU A C   1 
ATOM   184   O  O   . LEU A  1 23  ? 29.365  68.442  23.941  1.00 33.28 ? 24   LEU A O   1 
ATOM   185   C  CB  . LEU A  1 23  ? 32.436  68.825  23.741  1.00 31.41 ? 24   LEU A CB  1 
ATOM   186   C  CG  . LEU A  1 23  ? 32.904  69.111  25.183  1.00 34.36 ? 24   LEU A CG  1 
ATOM   187   C  CD1 . LEU A  1 23  ? 33.916  68.128  25.610  1.00 32.57 ? 24   LEU A CD1 1 
ATOM   188   C  CD2 . LEU A  1 23  ? 33.494  70.519  25.276  1.00 35.21 ? 24   LEU A CD2 1 
ATOM   189   N  N   . LYS A  1 24  ? 30.112  66.658  25.113  1.00 35.51 ? 25   LYS A N   1 
ATOM   190   C  CA  . LYS A  1 24  ? 28.916  66.553  25.960  1.00 35.93 ? 25   LYS A CA  1 
ATOM   191   C  C   . LYS A  1 24  ? 29.327  66.705  27.399  1.00 35.82 ? 25   LYS A C   1 
ATOM   192   O  O   . LYS A  1 24  ? 30.311  66.090  27.824  1.00 35.56 ? 25   LYS A O   1 
ATOM   193   C  CB  . LYS A  1 24  ? 28.243  65.187  25.780  1.00 36.27 ? 25   LYS A CB  1 
ATOM   194   C  CG  . LYS A  1 24  ? 27.835  64.910  24.328  1.00 41.48 ? 25   LYS A CG  1 
ATOM   195   C  CD  . LYS A  1 24  ? 26.714  63.898  24.201  1.00 46.13 ? 25   LYS A CD  1 
ATOM   196   C  CE  . LYS A  1 24  ? 25.982  64.075  22.876  1.00 51.14 ? 25   LYS A CE  1 
ATOM   197   N  NZ  . LYS A  1 24  ? 25.162  62.878  22.551  1.00 51.83 ? 25   LYS A NZ  1 
ATOM   198   N  N   . THR A  1 25  ? 28.578  67.519  28.139  1.00 35.13 ? 26   THR A N   1 
ATOM   199   C  CA  . THR A  1 25  ? 28.701  67.590  29.591  1.00 36.24 ? 26   THR A CA  1 
ATOM   200   C  C   . THR A  1 25  ? 27.629  66.698  30.190  1.00 36.83 ? 26   THR A C   1 
ATOM   201   O  O   . THR A  1 25  ? 26.476  66.755  29.753  1.00 35.78 ? 26   THR A O   1 
ATOM   202   C  CB  . THR A  1 25  ? 28.497  69.000  30.128  1.00 36.41 ? 26   THR A CB  1 
ATOM   203   O  OG1 . THR A  1 25  ? 29.380  69.911  29.454  1.00 38.08 ? 26   THR A OG1 1 
ATOM   204   C  CG2 . THR A  1 25  ? 28.784  69.024  31.623  1.00 38.68 ? 26   THR A CG2 1 
ATOM   205   N  N   . SER A  1 26  ? 28.012  65.904  31.194  1.00 37.12 ? 27   SER A N   1 
ATOM   206   C  CA  . SER A  1 26  ? 27.205  64.784  31.671  1.00 37.75 ? 27   SER A CA  1 
ATOM   207   C  C   . SER A  1 26  ? 27.397  64.571  33.168  1.00 38.06 ? 27   SER A C   1 
ATOM   208   O  O   . SER A  1 26  ? 28.448  64.905  33.706  1.00 39.62 ? 27   SER A O   1 
ATOM   209   C  CB  . SER A  1 26  ? 27.620  63.515  30.922  1.00 38.68 ? 27   SER A CB  1 
ATOM   210   O  OG  . SER A  1 26  ? 26.693  62.465  31.069  1.00 44.71 ? 27   SER A OG  1 
ATOM   211   N  N   . GLU A  1 27  ? 26.375  64.015  33.826  1.00 37.79 ? 28   GLU A N   1 
ATOM   212   C  CA  . GLU A  1 27  ? 26.403  63.797  35.261  1.00 38.16 ? 28   GLU A CA  1 
ATOM   213   C  C   . GLU A  1 27  ? 26.819  62.377  35.529  1.00 37.49 ? 28   GLU A C   1 
ATOM   214   O  O   . GLU A  1 27  ? 26.328  61.450  34.875  1.00 38.54 ? 28   GLU A O   1 
ATOM   215   C  CB  . GLU A  1 27  ? 25.026  64.059  35.890  1.00 40.04 ? 28   GLU A CB  1 
ATOM   216   N  N   . LEU A  1 28  ? 27.736  62.208  36.479  1.00 35.57 ? 29   LEU A N   1 
ATOM   217   C  CA  . LEU A  1 28  ? 28.140  60.871  36.930  1.00 36.51 ? 29   LEU A CA  1 
ATOM   218   C  C   . LEU A  1 28  ? 27.274  60.448  38.127  1.00 37.77 ? 29   LEU A C   1 
ATOM   219   O  O   . LEU A  1 28  ? 26.930  61.286  38.975  1.00 36.41 ? 29   LEU A O   1 
ATOM   220   C  CB  . LEU A  1 28  ? 29.628  60.865  37.337  1.00 35.63 ? 29   LEU A CB  1 
ATOM   221   C  CG  . LEU A  1 28  ? 30.661  61.050  36.197  1.00 37.46 ? 29   LEU A CG  1 
ATOM   222   C  CD1 . LEU A  1 28  ? 32.070  61.130  36.751  1.00 34.20 ? 29   LEU A CD1 1 
ATOM   223   C  CD2 . LEU A  1 28  ? 30.579  59.940  35.139  1.00 33.19 ? 29   LEU A CD2 1 
ATOM   224   N  N   . PRO A  1 29  ? 26.930  59.149  38.216  1.00 39.93 ? 30   PRO A N   1 
ATOM   225   C  CA  . PRO A  1 29  ? 26.295  58.674  39.446  1.00 41.32 ? 30   PRO A CA  1 
ATOM   226   C  C   . PRO A  1 29  ? 27.288  58.651  40.621  1.00 43.56 ? 30   PRO A C   1 
ATOM   227   O  O   . PRO A  1 29  ? 28.488  58.884  40.408  1.00 44.87 ? 30   PRO A O   1 
ATOM   228   C  CB  . PRO A  1 29  ? 25.805  57.271  39.076  1.00 41.10 ? 30   PRO A CB  1 
ATOM   229   C  CG  . PRO A  1 29  ? 26.638  56.833  37.938  1.00 41.88 ? 30   PRO A CG  1 
ATOM   230   C  CD  . PRO A  1 29  ? 27.086  58.078  37.213  1.00 41.66 ? 30   PRO A CD  1 
ATOM   231   N  N   . PRO A  1 30  ? 26.796  58.422  41.862  1.00 44.36 ? 31   PRO A N   1 
ATOM   232   C  CA  . PRO A  1 30  ? 27.728  58.326  42.996  1.00 43.61 ? 31   PRO A CA  1 
ATOM   233   C  C   . PRO A  1 30  ? 28.542  57.050  42.924  1.00 41.82 ? 31   PRO A C   1 
ATOM   234   O  O   . PRO A  1 30  ? 28.154  56.108  42.203  1.00 39.96 ? 31   PRO A O   1 
ATOM   235   C  CB  . PRO A  1 30  ? 26.813  58.296  44.235  1.00 44.06 ? 31   PRO A CB  1 
ATOM   236   C  CG  . PRO A  1 30  ? 25.429  58.564  43.739  1.00 45.56 ? 31   PRO A CG  1 
ATOM   237   C  CD  . PRO A  1 30  ? 25.404  58.185  42.282  1.00 45.41 ? 31   PRO A CD  1 
ATOM   238   N  N   . LEU A  1 31  ? 29.668  57.036  43.644  1.00 41.17 ? 32   LEU A N   1 
ATOM   239   C  CA  . LEU A  1 31  ? 30.480  55.821  43.781  1.00 40.02 ? 32   LEU A CA  1 
ATOM   240   C  C   . LEU A  1 31  ? 29.705  54.755  44.539  1.00 41.43 ? 32   LEU A C   1 
ATOM   241   O  O   . LEU A  1 31  ? 29.023  55.056  45.529  1.00 43.35 ? 32   LEU A O   1 
ATOM   242   C  CB  . LEU A  1 31  ? 31.785  56.107  44.537  1.00 39.95 ? 32   LEU A CB  1 
ATOM   243   C  CG  . LEU A  1 31  ? 32.798  57.002  43.841  1.00 38.76 ? 32   LEU A CG  1 
ATOM   244   C  CD1 . LEU A  1 31  ? 33.990  57.334  44.755  1.00 38.47 ? 32   LEU A CD1 1 
ATOM   245   C  CD2 . LEU A  1 31  ? 33.261  56.336  42.560  1.00 38.63 ? 32   LEU A CD2 1 
ATOM   246   N  N   . LYS A  1 32  ? 29.784  53.519  44.048  1.00 42.98 ? 33   LYS A N   1 
ATOM   247   C  CA  . LYS A  1 32  ? 29.413  52.335  44.831  1.00 43.76 ? 33   LYS A CA  1 
ATOM   248   C  C   . LYS A  1 32  ? 30.657  51.754  45.513  1.00 44.38 ? 33   LYS A C   1 
ATOM   249   O  O   . LYS A  1 32  ? 31.794  52.107  45.180  1.00 44.69 ? 33   LYS A O   1 
ATOM   250   C  CB  . LYS A  1 32  ? 28.772  51.261  43.947  1.00 43.76 ? 33   LYS A CB  1 
ATOM   251   C  CG  . LYS A  1 32  ? 27.442  51.688  43.315  1.00 47.48 ? 33   LYS A CG  1 
ATOM   252   C  CD  . LYS A  1 32  ? 26.958  50.667  42.275  1.00 50.43 ? 33   LYS A CD  1 
ATOM   253   C  CE  . LYS A  1 32  ? 25.769  51.202  41.469  1.00 53.83 ? 33   LYS A CE  1 
ATOM   254   N  NZ  . LYS A  1 32  ? 25.686  50.553  40.118  1.00 52.62 ? 33   LYS A NZ  1 
ATOM   255   N  N   . ASN A  1 33  ? 30.425  50.870  46.482  1.00 44.58 ? 34   ASN A N   1 
ATOM   256   C  CA  . ASN A  1 33  ? 31.505  50.211  47.224  1.00 43.65 ? 34   ASN A CA  1 
ATOM   257   C  C   . ASN A  1 33  ? 32.466  49.667  46.199  1.00 41.01 ? 34   ASN A C   1 
ATOM   258   O  O   . ASN A  1 33  ? 32.025  49.018  45.252  1.00 39.92 ? 34   ASN A O   1 
ATOM   259   C  CB  . ASN A  1 33  ? 30.957  49.048  48.095  1.00 43.84 ? 34   ASN A CB  1 
ATOM   260   C  CG  . ASN A  1 33  ? 31.667  48.916  49.458  1.00 48.98 ? 34   ASN A CG  1 
ATOM   261   O  OD1 . ASN A  1 33  ? 32.638  49.631  49.762  1.00 49.49 ? 34   ASN A OD1 1 
ATOM   262   N  ND2 . ASN A  1 33  ? 31.161  47.994  50.294  1.00 50.39 ? 34   ASN A ND2 1 
ATOM   263   N  N   . GLY A  1 34  ? 33.761  49.949  46.370  1.00 40.26 ? 35   GLY A N   1 
ATOM   264   C  CA  . GLY A  1 34  ? 34.813  49.370  45.495  1.00 38.46 ? 35   GLY A CA  1 
ATOM   265   C  C   . GLY A  1 34  ? 35.051  50.092  44.164  1.00 37.53 ? 35   GLY A C   1 
ATOM   266   O  O   . GLY A  1 34  ? 35.640  49.510  43.249  1.00 39.54 ? 35   GLY A O   1 
ATOM   267   N  N   . GLU A  1 35  ? 34.592  51.346  44.063  1.00 34.94 ? 36   GLU A N   1 
ATOM   268   C  CA  . GLU A  1 35  ? 34.742  52.175  42.864  1.00 32.74 ? 36   GLU A CA  1 
ATOM   269   C  C   . GLU A  1 35  ? 35.558  53.444  43.191  1.00 31.44 ? 36   GLU A C   1 
ATOM   270   O  O   . GLU A  1 35  ? 35.726  53.796  44.361  1.00 32.23 ? 36   GLU A O   1 
ATOM   271   C  CB  . GLU A  1 35  ? 33.374  52.595  42.304  1.00 31.06 ? 36   GLU A CB  1 
ATOM   272   C  CG  . GLU A  1 35  ? 32.594  51.490  41.631  1.00 31.06 ? 36   GLU A CG  1 
ATOM   273   C  CD  . GLU A  1 35  ? 31.247  51.962  41.017  1.00 34.45 ? 36   GLU A CD  1 
ATOM   274   O  OE1 . GLU A  1 35  ? 30.683  53.003  41.456  1.00 31.87 ? 36   GLU A OE1 1 
ATOM   275   O  OE2 . GLU A  1 35  ? 30.755  51.287  40.082  1.00 36.29 ? 36   GLU A OE2 1 
ATOM   276   N  N   . VAL A  1 36  ? 36.084  54.110  42.157  1.00 30.33 ? 37   VAL A N   1 
ATOM   277   C  CA  . VAL A  1 36  ? 36.784  55.396  42.345  1.00 28.62 ? 37   VAL A CA  1 
ATOM   278   C  C   . VAL A  1 36  ? 36.382  56.412  41.277  1.00 29.97 ? 37   VAL A C   1 
ATOM   279   O  O   . VAL A  1 36  ? 35.880  56.031  40.196  1.00 31.25 ? 37   VAL A O   1 
ATOM   280   C  CB  . VAL A  1 36  ? 38.316  55.233  42.322  1.00 28.14 ? 37   VAL A CB  1 
ATOM   281   C  CG1 . VAL A  1 36  ? 38.776  54.196  43.394  1.00 22.82 ? 37   VAL A CG1 1 
ATOM   282   C  CG2 . VAL A  1 36  ? 38.779  54.838  40.932  1.00 24.50 ? 37   VAL A CG2 1 
ATOM   283   N  N   . LEU A  1 37  ? 36.581  57.693  41.597  1.00 29.21 ? 38   LEU A N   1 
ATOM   284   C  CA  . LEU A  1 37  ? 36.386  58.779  40.641  1.00 29.37 ? 38   LEU A CA  1 
ATOM   285   C  C   . LEU A  1 37  ? 37.739  59.270  40.187  1.00 29.69 ? 38   LEU A C   1 
ATOM   286   O  O   . LEU A  1 37  ? 38.558  59.750  40.991  1.00 29.70 ? 38   LEU A O   1 
ATOM   287   C  CB  . LEU A  1 37  ? 35.605  59.941  41.254  1.00 30.04 ? 38   LEU A CB  1 
ATOM   288   C  CG  . LEU A  1 37  ? 35.183  61.059  40.298  1.00 31.20 ? 38   LEU A CG  1 
ATOM   289   C  CD1 . LEU A  1 37  ? 34.374  60.504  39.169  1.00 29.15 ? 38   LEU A CD1 1 
ATOM   290   C  CD2 . LEU A  1 37  ? 34.399  62.188  41.018  1.00 33.84 ? 38   LEU A CD2 1 
ATOM   291   N  N   . LEU A  1 38  ? 37.950  59.146  38.879  1.00 30.16 ? 39   LEU A N   1 
ATOM   292   C  CA  . LEU A  1 38  ? 39.221  59.451  38.231  1.00 28.13 ? 39   LEU A CA  1 
ATOM   293   C  C   . LEU A  1 38  ? 39.163  60.799  37.539  1.00 27.28 ? 39   LEU A C   1 
ATOM   294   O  O   . LEU A  1 38  ? 38.213  61.080  36.799  1.00 30.25 ? 39   LEU A O   1 
ATOM   295   C  CB  . LEU A  1 38  ? 39.539  58.356  37.214  1.00 26.85 ? 39   LEU A CB  1 
ATOM   296   C  CG  . LEU A  1 38  ? 40.101  57.062  37.812  1.00 29.49 ? 39   LEU A CG  1 
ATOM   297   C  CD1 . LEU A  1 38  ? 40.351  55.994  36.728  1.00 25.66 ? 39   LEU A CD1 1 
ATOM   298   C  CD2 . LEU A  1 38  ? 41.400  57.396  38.574  1.00 24.63 ? 39   LEU A CD2 1 
ATOM   299   N  N   . GLU A  1 39  ? 40.168  61.632  37.782  1.00 26.18 ? 40   GLU A N   1 
ATOM   300   C  CA  . GLU A  1 39  ? 40.267  62.929  37.127  1.00 26.99 ? 40   GLU A CA  1 
ATOM   301   C  C   . GLU A  1 39  ? 41.406  62.857  36.125  1.00 26.86 ? 40   GLU A C   1 
ATOM   302   O  O   . GLU A  1 39  ? 42.564  62.626  36.520  1.00 26.57 ? 40   GLU A O   1 
ATOM   303   C  CB  . GLU A  1 39  ? 40.551  64.072  38.114  1.00 26.80 ? 40   GLU A CB  1 
ATOM   304   C  CG  . GLU A  1 39  ? 40.661  65.427  37.396  1.00 31.30 ? 40   GLU A CG  1 
ATOM   305   C  CD  . GLU A  1 39  ? 40.827  66.627  38.306  1.00 43.04 ? 40   GLU A CD  1 
ATOM   306   O  OE1 . GLU A  1 39  ? 41.149  66.442  39.498  1.00 44.24 ? 40   GLU A OE1 1 
ATOM   307   O  OE2 . GLU A  1 39  ? 40.641  67.770  37.811  1.00 48.10 ? 40   GLU A OE2 1 
ATOM   308   N  N   . ALA A  1 40  ? 41.099  63.078  34.846  1.00 24.99 ? 41   ALA A N   1 
ATOM   309   C  CA  . ALA A  1 40  ? 42.142  63.053  33.816  1.00 25.00 ? 41   ALA A CA  1 
ATOM   310   C  C   . ALA A  1 40  ? 43.165  64.167  34.086  1.00 24.88 ? 41   ALA A C   1 
ATOM   311   O  O   . ALA A  1 40  ? 42.773  65.312  34.376  1.00 24.01 ? 41   ALA A O   1 
ATOM   312   C  CB  . ALA A  1 40  ? 41.523  63.215  32.411  1.00 23.99 ? 41   ALA A CB  1 
ATOM   313   N  N   . LEU A  1 41  ? 44.457  63.820  33.990  1.00 25.50 ? 42   LEU A N   1 
ATOM   314   C  CA  . LEU A  1 41  ? 45.588  64.793  34.032  1.00 25.77 ? 42   LEU A CA  1 
ATOM   315   C  C   . LEU A  1 41  ? 46.247  65.024  32.637  1.00 25.70 ? 42   LEU A C   1 
ATOM   316   O  O   . LEU A  1 41  ? 46.476  66.170  32.209  1.00 25.83 ? 42   LEU A O   1 
ATOM   317   C  CB  . LEU A  1 41  ? 46.665  64.287  35.014  1.00 26.58 ? 42   LEU A CB  1 
ATOM   318   C  CG  . LEU A  1 41  ? 46.380  64.243  36.541  1.00 29.98 ? 42   LEU A CG  1 
ATOM   319   C  CD1 . LEU A  1 41  ? 47.571  63.667  37.345  1.00 27.35 ? 42   LEU A CD1 1 
ATOM   320   C  CD2 . LEU A  1 41  ? 46.051  65.641  37.069  1.00 27.92 ? 42   LEU A CD2 1 
ATOM   321   N  N   . PHE A  1 42  ? 46.574  63.915  31.967  1.00 24.65 ? 43   PHE A N   1 
ATOM   322   C  CA  . PHE A  1 42  ? 47.177  63.884  30.626  1.00 24.78 ? 43   PHE A CA  1 
ATOM   323   C  C   . PHE A  1 42  ? 46.392  62.869  29.798  1.00 24.50 ? 43   PHE A C   1 
ATOM   324   O  O   . PHE A  1 42  ? 46.057  61.802  30.287  1.00 25.47 ? 43   PHE A O   1 
ATOM   325   C  CB  . PHE A  1 42  ? 48.665  63.455  30.686  1.00 25.45 ? 43   PHE A CB  1 
ATOM   326   C  CG  . PHE A  1 42  ? 49.560  64.445  31.408  1.00 26.08 ? 43   PHE A CG  1 
ATOM   327   C  CD1 . PHE A  1 42  ? 49.961  65.619  30.786  1.00 27.14 ? 43   PHE A CD1 1 
ATOM   328   C  CD2 . PHE A  1 42  ? 49.957  64.223  32.725  1.00 27.87 ? 43   PHE A CD2 1 
ATOM   329   C  CE1 . PHE A  1 42  ? 50.762  66.561  31.457  1.00 30.37 ? 43   PHE A CE1 1 
ATOM   330   C  CE2 . PHE A  1 42  ? 50.760  65.161  33.406  1.00 29.60 ? 43   PHE A CE2 1 
ATOM   331   C  CZ  . PHE A  1 42  ? 51.163  66.327  32.764  1.00 28.35 ? 43   PHE A CZ  1 
ATOM   332   N  N   . LEU A  1 43  ? 46.068  63.214  28.561  1.00 23.62 ? 44   LEU A N   1 
ATOM   333   C  CA  . LEU A  1 43  ? 45.366  62.282  27.663  1.00 23.74 ? 44   LEU A CA  1 
ATOM   334   C  C   . LEU A  1 43  ? 46.167  62.201  26.368  1.00 22.84 ? 44   LEU A C   1 
ATOM   335   O  O   . LEU A  1 43  ? 46.756  63.190  25.924  1.00 21.68 ? 44   LEU A O   1 
ATOM   336   C  CB  . LEU A  1 43  ? 43.927  62.735  27.364  1.00 22.64 ? 44   LEU A CB  1 
ATOM   337   C  CG  . LEU A  1 43  ? 42.963  63.134  28.510  1.00 23.85 ? 44   LEU A CG  1 
ATOM   338   C  CD1 . LEU A  1 43  ? 43.000  64.642  28.831  1.00 20.09 ? 44   LEU A CD1 1 
ATOM   339   C  CD2 . LEU A  1 43  ? 41.540  62.749  28.122  1.00 15.01 ? 44   LEU A CD2 1 
ATOM   340   N  N   . THR A  1 44  ? 46.186  61.014  25.784  1.00 21.92 ? 45   THR A N   1 
ATOM   341   C  CA  . THR A  1 44  ? 46.871  60.781  24.534  1.00 20.37 ? 45   THR A CA  1 
ATOM   342   C  C   . THR A  1 44  ? 45.891  60.785  23.374  1.00 21.36 ? 45   THR A C   1 
ATOM   343   O  O   . THR A  1 44  ? 44.707  60.495  23.540  1.00 18.53 ? 45   THR A O   1 
ATOM   344   C  CB  . THR A  1 44  ? 47.609  59.460  24.572  1.00 21.77 ? 45   THR A CB  1 
ATOM   345   O  OG1 . THR A  1 44  ? 48.343  59.292  23.356  1.00 22.65 ? 45   THR A OG1 1 
ATOM   346   C  CG2 . THR A  1 44  ? 46.624  58.304  24.799  1.00 17.86 ? 45   THR A CG2 1 
ATOM   347   N  N   . VAL A  1 45  ? 46.399  61.190  22.218  1.00 20.07 ? 46   VAL A N   1 
ATOM   348   C  CA  . VAL A  1 45  ? 45.743  60.982  20.955  1.00 17.99 ? 46   VAL A CA  1 
ATOM   349   C  C   . VAL A  1 45  ? 46.763  60.135  20.152  1.00 19.83 ? 46   VAL A C   1 
ATOM   350   O  O   . VAL A  1 45  ? 47.973  60.259  20.338  1.00 17.50 ? 46   VAL A O   1 
ATOM   351   C  CB  . VAL A  1 45  ? 45.357  62.329  20.277  1.00 20.72 ? 46   VAL A CB  1 
ATOM   352   C  CG1 . VAL A  1 45  ? 44.286  63.079  21.110  1.00 18.72 ? 46   VAL A CG1 1 
ATOM   353   C  CG2 . VAL A  1 45  ? 46.584  63.220  20.080  1.00 17.85 ? 46   VAL A CG2 1 
ATOM   354   N  N   . ASP A  1 46  ? 46.265  59.210  19.340  1.00 19.53 ? 47   ASP A N   1 
ATOM   355   C  CA  . ASP A  1 46  ? 47.110  58.214  18.687  1.00 19.21 ? 47   ASP A CA  1 
ATOM   356   C  C   . ASP A  1 46  ? 46.497  57.873  17.328  1.00 19.25 ? 47   ASP A C   1 
ATOM   357   O  O   . ASP A  1 46  ? 45.270  57.844  17.182  1.00 19.00 ? 47   ASP A O   1 
ATOM   358   C  CB  . ASP A  1 46  ? 47.200  56.926  19.518  1.00 19.05 ? 47   ASP A CB  1 
ATOM   359   C  CG  . ASP A  1 46  ? 47.846  57.129  20.899  1.00 21.17 ? 47   ASP A CG  1 
ATOM   360   O  OD1 . ASP A  1 46  ? 49.085  57.046  21.012  1.00 14.63 ? 47   ASP A OD1 1 
ATOM   361   O  OD2 . ASP A  1 46  ? 47.100  57.319  21.898  1.00 21.60 ? 47   ASP A OD2 1 
ATOM   362   N  N   . PRO A  1 47  ? 47.341  57.612  16.326  1.00 19.39 ? 48   PRO A N   1 
ATOM   363   C  CA  . PRO A  1 47  ? 46.835  57.256  15.000  1.00 17.78 ? 48   PRO A CA  1 
ATOM   364   C  C   . PRO A  1 47  ? 45.843  56.108  14.969  1.00 17.23 ? 48   PRO A C   1 
ATOM   365   O  O   . PRO A  1 47  ? 44.930  56.166  14.159  1.00 16.64 ? 48   PRO A O   1 
ATOM   366   C  CB  . PRO A  1 47  ? 48.086  56.880  14.228  1.00 17.42 ? 48   PRO A CB  1 
ATOM   367   C  CG  . PRO A  1 47  ? 49.179  57.633  14.897  1.00 20.60 ? 48   PRO A CG  1 
ATOM   368   C  CD  . PRO A  1 47  ? 48.806  57.668  16.363  1.00 19.47 ? 48   PRO A CD  1 
ATOM   369   N  N   . TYR A  1 48  ? 46.017  55.067  15.798  1.00 17.30 ? 49   TYR A N   1 
ATOM   370   C  CA  . TYR A  1 48  ? 45.059  53.930  15.784  1.00 16.20 ? 49   TYR A CA  1 
ATOM   371   C  C   . TYR A  1 48  ? 43.637  54.425  16.001  1.00 16.84 ? 49   TYR A C   1 
ATOM   372   O  O   . TYR A  1 48  ? 42.695  53.808  15.535  1.00 18.66 ? 49   TYR A O   1 
ATOM   373   C  CB  . TYR A  1 48  ? 45.390  52.845  16.827  1.00 17.37 ? 49   TYR A CB  1 
ATOM   374   C  CG  . TYR A  1 48  ? 44.944  53.173  18.255  1.00 17.75 ? 49   TYR A CG  1 
ATOM   375   C  CD1 . TYR A  1 48  ? 43.617  53.017  18.648  1.00 22.00 ? 49   TYR A CD1 1 
ATOM   376   C  CD2 . TYR A  1 48  ? 45.845  53.660  19.191  1.00 18.38 ? 49   TYR A CD2 1 
ATOM   377   C  CE1 . TYR A  1 48  ? 43.199  53.340  19.939  1.00 22.61 ? 49   TYR A CE1 1 
ATOM   378   C  CE2 . TYR A  1 48  ? 45.456  53.979  20.475  1.00 19.85 ? 49   TYR A CE2 1 
ATOM   379   C  CZ  . TYR A  1 48  ? 44.126  53.817  20.854  1.00 23.99 ? 49   TYR A CZ  1 
ATOM   380   O  OH  . TYR A  1 48  ? 43.721  54.134  22.133  1.00 21.01 ? 49   TYR A OH  1 
ATOM   381   N  N   . MET A  1 49  ? 43.459  55.525  16.710  1.00 17.29 ? 50   MET A N   1 
ATOM   382   C  CA  . MET A  1 49  ? 42.098  56.048  16.914  1.00 17.20 ? 50   MET A CA  1 
ATOM   383   C  C   . MET A  1 49  ? 41.406  56.413  15.611  1.00 17.55 ? 50   MET A C   1 
ATOM   384   O  O   . MET A  1 49  ? 40.181  56.371  15.517  1.00 15.62 ? 50   MET A O   1 
ATOM   385   C  CB  . MET A  1 49  ? 42.111  57.243  17.832  1.00 18.88 ? 50   MET A CB  1 
ATOM   386   C  CG  . MET A  1 49  ? 42.747  56.967  19.162  1.00 19.24 ? 50   MET A CG  1 
ATOM   387   S  SD  . MET A  1 49  ? 42.987  58.487  20.057  1.00 21.40 ? 50   MET A SD  1 
ATOM   388   C  CE  . MET A  1 49  ? 43.781  57.856  21.500  1.00 14.27 ? 50   MET A CE  1 
ATOM   389   N  N   . ARG A  1 50  ? 42.168  56.761  14.579  1.00 19.74 ? 51   ARG A N   1 
ATOM   390   C  CA  . ARG A  1 50  ? 41.527  57.093  13.315  1.00 18.56 ? 51   ARG A CA  1 
ATOM   391   C  C   . ARG A  1 50  ? 40.836  55.843  12.728  1.00 19.42 ? 51   ARG A C   1 
ATOM   392   O  O   . ARG A  1 50  ? 39.785  55.944  12.089  1.00 17.41 ? 51   ARG A O   1 
ATOM   393   C  CB  . ARG A  1 50  ? 42.520  57.681  12.325  1.00 17.66 ? 51   ARG A CB  1 
ATOM   394   C  CG  . ARG A  1 50  ? 41.998  57.846  10.880  1.00 18.24 ? 51   ARG A CG  1 
ATOM   395   C  CD  . ARG A  1 50  ? 40.887  58.870  10.806  1.00 20.05 ? 51   ARG A CD  1 
ATOM   396   N  NE  . ARG A  1 50  ? 40.307  59.064  9.474   1.00 19.88 ? 51   ARG A NE  1 
ATOM   397   C  CZ  . ARG A  1 50  ? 39.363  58.303  8.917   1.00 21.94 ? 51   ARG A CZ  1 
ATOM   398   N  NH1 . ARG A  1 50  ? 38.878  57.217  9.540   1.00 19.96 ? 51   ARG A NH1 1 
ATOM   399   N  NH2 . ARG A  1 50  ? 38.887  58.642  7.720   1.00 23.83 ? 51   ARG A NH2 1 
ATOM   400   N  N   . VAL A  1 51  ? 41.463  54.687  12.912  1.00 20.17 ? 52   VAL A N   1 
ATOM   401   C  CA  . VAL A  1 51  ? 40.950  53.428  12.379  1.00 19.78 ? 52   VAL A CA  1 
ATOM   402   C  C   . VAL A  1 51  ? 39.873  52.850  13.307  1.00 19.12 ? 52   VAL A C   1 
ATOM   403   O  O   . VAL A  1 51  ? 38.809  52.440  12.849  1.00 18.95 ? 52   VAL A O   1 
ATOM   404   C  CB  . VAL A  1 51  ? 42.095  52.384  12.186  1.00 21.36 ? 52   VAL A CB  1 
ATOM   405   C  CG1 . VAL A  1 51  ? 41.563  51.119  11.553  1.00 21.22 ? 52   VAL A CG1 1 
ATOM   406   C  CG2 . VAL A  1 51  ? 43.219  52.952  11.325  1.00 19.86 ? 52   VAL A CG2 1 
ATOM   407   N  N   . ALA A  1 52  ? 40.152  52.804  14.603  1.00 18.42 ? 53   ALA A N   1 
ATOM   408   C  CA  . ALA A  1 52  ? 39.224  52.225  15.575  1.00 20.06 ? 53   ALA A CA  1 
ATOM   409   C  C   . ALA A  1 52  ? 37.925  53.008  15.628  1.00 20.42 ? 53   ALA A C   1 
ATOM   410   O  O   . ALA A  1 52  ? 36.871  52.420  15.912  1.00 19.77 ? 53   ALA A O   1 
ATOM   411   C  CB  . ALA A  1 52  ? 39.851  52.104  16.977  1.00 18.04 ? 53   ALA A CB  1 
ATOM   412   N  N   . ALA A  1 53  ? 37.986  54.300  15.293  1.00 18.43 ? 54   ALA A N   1 
ATOM   413   C  CA  . ALA A  1 53  ? 36.788  55.128  15.260  1.00 20.97 ? 54   ALA A CA  1 
ATOM   414   C  C   . ALA A  1 53  ? 35.768  54.676  14.207  1.00 21.42 ? 54   ALA A C   1 
ATOM   415   O  O   . ALA A  1 53  ? 34.594  54.959  14.348  1.00 18.26 ? 54   ALA A O   1 
ATOM   416   C  CB  . ALA A  1 53  ? 37.149  56.598  15.059  1.00 19.14 ? 54   ALA A CB  1 
ATOM   417   N  N   . LYS A  1 54  ? 36.221  53.988  13.158  1.00 23.56 ? 55   LYS A N   1 
ATOM   418   C  CA  . LYS A  1 54  ? 35.314  53.428  12.168  1.00 27.12 ? 55   LYS A CA  1 
ATOM   419   C  C   . LYS A  1 54  ? 34.357  52.353  12.755  1.00 27.84 ? 55   LYS A C   1 
ATOM   420   O  O   . LYS A  1 54  ? 33.299  52.099  12.184  1.00 28.24 ? 55   LYS A O   1 
ATOM   421   C  CB  . LYS A  1 54  ? 36.097  52.849  10.980  1.00 27.76 ? 55   LYS A CB  1 
ATOM   422   C  CG  . LYS A  1 54  ? 36.655  53.903  10.001  1.00 38.07 ? 55   LYS A CG  1 
ATOM   423   C  CD  . LYS A  1 54  ? 38.083  53.635  9.487   1.00 43.80 ? 55   LYS A CD  1 
ATOM   424   C  CE  . LYS A  1 54  ? 38.326  52.258  8.941   1.00 47.66 ? 55   LYS A CE  1 
ATOM   425   N  NZ  . LYS A  1 54  ? 38.459  52.194  7.484   1.00 48.62 ? 55   LYS A NZ  1 
ATOM   426   N  N   . ARG A  1 55  ? 34.727  51.736  13.876  1.00 27.01 ? 56   ARG A N   1 
ATOM   427   C  CA  . ARG A  1 55  ? 33.889  50.706  14.524  1.00 29.00 ? 56   ARG A CA  1 
ATOM   428   C  C   . ARG A  1 55  ? 32.842  51.263  15.476  1.00 29.42 ? 56   ARG A C   1 
ATOM   429   O  O   . ARG A  1 55  ? 31.999  50.511  15.947  1.00 28.70 ? 56   ARG A O   1 
ATOM   430   C  CB  . ARG A  1 55  ? 34.752  49.722  15.312  1.00 28.88 ? 56   ARG A CB  1 
ATOM   431   C  CG  . ARG A  1 55  ? 35.875  49.075  14.506  1.00 32.53 ? 56   ARG A CG  1 
ATOM   432   C  CD  . ARG A  1 55  ? 35.373  48.338  13.251  1.00 36.71 ? 56   ARG A CD  1 
ATOM   433   N  NE  . ARG A  1 55  ? 36.427  48.379  12.240  1.00 48.12 ? 56   ARG A NE  1 
ATOM   434   C  CZ  . ARG A  1 55  ? 36.330  48.851  11.000  1.00 46.43 ? 56   ARG A CZ  1 
ATOM   435   N  NH1 . ARG A  1 55  ? 35.180  49.304  10.498  1.00 47.11 ? 56   ARG A NH1 1 
ATOM   436   N  NH2 . ARG A  1 55  ? 37.411  48.825  10.231  1.00 54.49 ? 56   ARG A NH2 1 
ATOM   437   N  N   . LEU A  1 56  ? 32.889  52.565  15.764  1.00 27.34 ? 57   LEU A N   1 
ATOM   438   C  CA  . LEU A  1 56  ? 31.996  53.141  16.742  1.00 27.59 ? 57   LEU A CA  1 
ATOM   439   C  C   . LEU A  1 56  ? 30.686  53.448  16.061  1.00 29.88 ? 57   LEU A C   1 
ATOM   440   O  O   . LEU A  1 56  ? 30.614  53.502  14.829  1.00 29.61 ? 57   LEU A O   1 
ATOM   441   C  CB  . LEU A  1 56  ? 32.577  54.431  17.348  1.00 28.29 ? 57   LEU A CB  1 
ATOM   442   C  CG  . LEU A  1 56  ? 33.901  54.444  18.117  1.00 26.80 ? 57   LEU A CG  1 
ATOM   443   C  CD1 . LEU A  1 56  ? 34.273  55.897  18.481  1.00 21.54 ? 57   LEU A CD1 1 
ATOM   444   C  CD2 . LEU A  1 56  ? 33.897  53.568  19.382  1.00 21.41 ? 57   LEU A CD2 1 
ATOM   445   N  N   . LYS A  1 57  ? 29.643  53.638  16.864  1.00 31.42 ? 58   LYS A N   1 
ATOM   446   C  CA  . LYS A  1 57  ? 28.374  54.191  16.374  1.00 31.88 ? 58   LYS A CA  1 
ATOM   447   C  C   . LYS A  1 57  ? 28.404  55.689  16.642  1.00 29.67 ? 58   LYS A C   1 
ATOM   448   O  O   . LYS A  1 57  ? 28.959  56.140  17.644  1.00 29.19 ? 58   LYS A O   1 
ATOM   449   C  CB  . LYS A  1 57  ? 27.154  53.590  17.112  1.00 34.46 ? 58   LYS A CB  1 
ATOM   450   C  CG  . LYS A  1 57  ? 27.011  52.042  17.123  1.00 40.80 ? 58   LYS A CG  1 
ATOM   451   C  CD  . LYS A  1 57  ? 26.853  51.388  15.718  1.00 49.83 ? 58   LYS A CD  1 
ATOM   452   C  CE  . LYS A  1 57  ? 26.038  50.036  15.738  1.00 51.49 ? 58   LYS A CE  1 
ATOM   453   N  NZ  . LYS A  1 57  ? 26.186  49.146  16.953  1.00 33.35 ? 58   LYS A NZ  1 
ATOM   454   N  N   . GLU A  1 58  ? 27.774  56.466  15.779  1.00 29.78 ? 59   GLU A N   1 
ATOM   455   C  CA  . GLU A  1 58  ? 27.685  57.910  15.997  1.00 31.46 ? 59   GLU A CA  1 
ATOM   456   C  C   . GLU A  1 58  ? 27.021  58.180  17.365  1.00 31.81 ? 59   GLU A C   1 
ATOM   457   O  O   . GLU A  1 58  ? 26.039  57.521  17.732  1.00 33.03 ? 59   GLU A O   1 
ATOM   458   C  CB  . GLU A  1 58  ? 26.981  58.587  14.800  1.00 32.84 ? 59   GLU A CB  1 
ATOM   459   C  CG  . GLU A  1 58  ? 27.879  58.554  13.549  1.00 38.65 ? 59   GLU A CG  1 
ATOM   460   C  CD  . GLU A  1 58  ? 27.210  58.967  12.220  1.00 49.64 ? 59   GLU A CD  1 
ATOM   461   O  OE1 . GLU A  1 58  ? 25.987  59.249  12.197  1.00 46.84 ? 59   GLU A OE1 1 
ATOM   462   O  OE2 . GLU A  1 58  ? 27.946  59.008  11.185  1.00 50.76 ? 59   GLU A OE2 1 
ATOM   463   N  N   . GLY A  1 59  ? 27.623  59.082  18.141  1.00 29.90 ? 60   GLY A N   1 
ATOM   464   C  CA  . GLY A  1 59  ? 27.241  59.326  19.525  1.00 26.94 ? 60   GLY A CA  1 
ATOM   465   C  C   . GLY A  1 59  ? 28.153  58.661  20.552  1.00 25.70 ? 60   GLY A C   1 
ATOM   466   O  O   . GLY A  1 59  ? 28.136  59.025  21.721  1.00 25.77 ? 60   GLY A O   1 
ATOM   467   N  N   . ASP A  1 60  ? 28.926  57.661  20.136  1.00 25.56 ? 61   ASP A N   1 
ATOM   468   C  CA  . ASP A  1 60  ? 29.827  56.948  21.055  1.00 25.14 ? 61   ASP A CA  1 
ATOM   469   C  C   . ASP A  1 60  ? 30.975  57.827  21.510  1.00 24.72 ? 61   ASP A C   1 
ATOM   470   O  O   . ASP A  1 60  ? 31.373  58.753  20.811  1.00 25.14 ? 61   ASP A O   1 
ATOM   471   C  CB  . ASP A  1 60  ? 30.439  55.716  20.377  1.00 27.15 ? 61   ASP A CB  1 
ATOM   472   C  CG  . ASP A  1 60  ? 29.478  54.520  20.292  1.00 30.61 ? 61   ASP A CG  1 
ATOM   473   O  OD1 . ASP A  1 60  ? 28.388  54.588  20.887  1.00 30.23 ? 61   ASP A OD1 1 
ATOM   474   O  OD2 . ASP A  1 60  ? 29.846  53.502  19.638  1.00 30.71 ? 61   ASP A OD2 1 
ATOM   475   N  N   . THR A  1 61  ? 31.549  57.483  22.654  1.00 24.49 ? 62   THR A N   1 
ATOM   476   C  CA  . THR A  1 61  ? 32.727  58.168  23.174  1.00 23.14 ? 62   THR A CA  1 
ATOM   477   C  C   . THR A  1 61  ? 34.006  57.780  22.421  1.00 23.62 ? 62   THR A C   1 
ATOM   478   O  O   . THR A  1 61  ? 34.230  56.598  22.147  1.00 21.78 ? 62   THR A O   1 
ATOM   479   C  CB  . THR A  1 61  ? 32.920  57.808  24.645  1.00 23.43 ? 62   THR A CB  1 
ATOM   480   O  OG1 . THR A  1 61  ? 31.772  58.252  25.378  1.00 29.93 ? 62   THR A OG1 1 
ATOM   481   C  CG2 . THR A  1 61  ? 34.186  58.475  25.216  1.00 23.42 ? 62   THR A CG2 1 
ATOM   482   N  N   . MET A  1 62  ? 34.865  58.757  22.121  1.00 22.31 ? 63   MET A N   1 
ATOM   483   C  CA  . MET A  1 62  ? 36.143  58.453  21.462  1.00 23.02 ? 63   MET A CA  1 
ATOM   484   C  C   . MET A  1 62  ? 36.993  57.616  22.411  1.00 21.59 ? 63   MET A C   1 
ATOM   485   O  O   . MET A  1 62  ? 36.984  57.850  23.616  1.00 23.76 ? 63   MET A O   1 
ATOM   486   C  CB  . MET A  1 62  ? 36.892  59.737  21.043  1.00 22.04 ? 63   MET A CB  1 
ATOM   487   C  CG  . MET A  1 62  ? 36.339  60.370  19.786  1.00 24.45 ? 63   MET A CG  1 
ATOM   488   S  SD  . MET A  1 62  ? 36.558  59.390  18.277  1.00 23.18 ? 63   MET A SD  1 
ATOM   489   C  CE  . MET A  1 62  ? 38.349  59.273  18.224  1.00 22.04 ? 63   MET A CE  1 
ATOM   490   N  N   . MET A  1 63  ? 37.680  56.601  21.889  1.00 21.72 ? 64   MET A N   1 
ATOM   491   C  CA  . MET A  1 63  ? 38.496  55.716  22.740  1.00 20.60 ? 64   MET A CA  1 
ATOM   492   C  C   . MET A  1 63  ? 39.853  56.335  23.001  1.00 21.29 ? 64   MET A C   1 
ATOM   493   O  O   . MET A  1 63  ? 40.315  57.164  22.219  1.00 19.90 ? 64   MET A O   1 
ATOM   494   C  CB  . MET A  1 63  ? 38.685  54.353  22.092  1.00 22.25 ? 64   MET A CB  1 
ATOM   495   C  CG  . MET A  1 63  ? 39.678  54.320  20.923  1.00 22.96 ? 64   MET A CG  1 
ATOM   496   S  SD  . MET A  1 63  ? 39.157  55.355  19.595  1.00 23.98 ? 64   MET A SD  1 
ATOM   497   C  CE  . MET A  1 63  ? 37.736  54.437  18.983  1.00 17.19 ? 64   MET A CE  1 
ATOM   498   N  N   . GLY A  1 64  ? 40.502  55.904  24.082  1.00 22.17 ? 65   GLY A N   1 
ATOM   499   C  CA  . GLY A  1 64  ? 41.842  56.363  24.409  1.00 20.56 ? 65   GLY A CA  1 
ATOM   500   C  C   . GLY A  1 64  ? 42.239  56.253  25.877  1.00 23.79 ? 65   GLY A C   1 
ATOM   501   O  O   . GLY A  1 64  ? 41.374  56.203  26.793  1.00 21.26 ? 65   GLY A O   1 
ATOM   502   N  N   . GLN A  1 65  ? 43.567  56.270  26.085  1.00 23.27 ? 66   GLN A N   1 
ATOM   503   C  CA  . GLN A  1 65  ? 44.201  56.189  27.399  1.00 22.63 ? 66   GLN A CA  1 
ATOM   504   C  C   . GLN A  1 65  ? 44.511  57.582  27.981  1.00 24.27 ? 66   GLN A C   1 
ATOM   505   O  O   . GLN A  1 65  ? 44.561  58.597  27.258  1.00 22.96 ? 66   GLN A O   1 
ATOM   506   C  CB  . GLN A  1 65  ? 45.481  55.351  27.280  1.00 23.50 ? 66   GLN A CB  1 
ATOM   507   C  CG  . GLN A  1 65  ? 46.012  54.772  28.560  1.00 22.39 ? 66   GLN A CG  1 
ATOM   508   C  CD  . GLN A  1 65  ? 47.266  53.973  28.332  1.00 19.29 ? 66   GLN A CD  1 
ATOM   509   O  OE1 . GLN A  1 65  ? 48.163  54.398  27.612  1.00 24.97 ? 66   GLN A OE1 1 
ATOM   510   N  NE2 . GLN A  1 65  ? 47.338  52.819  28.926  1.00 18.20 ? 66   GLN A NE2 1 
ATOM   511   N  N   . GLN A  1 66  ? 44.682  57.625  29.300  1.00 24.09 ? 67   GLN A N   1 
ATOM   512   C  CA  . GLN A  1 66  ? 44.997  58.856  30.012  1.00 23.12 ? 67   GLN A CA  1 
ATOM   513   C  C   . GLN A  1 66  ? 45.761  58.505  31.272  1.00 24.83 ? 67   GLN A C   1 
ATOM   514   O  O   . GLN A  1 66  ? 45.701  57.364  31.754  1.00 26.99 ? 67   GLN A O   1 
ATOM   515   C  CB  . GLN A  1 66  ? 43.720  59.645  30.377  1.00 24.27 ? 67   GLN A CB  1 
ATOM   516   C  CG  . GLN A  1 66  ? 42.764  58.939  31.341  1.00 24.50 ? 67   GLN A CG  1 
ATOM   517   C  CD  . GLN A  1 66  ? 41.489  59.734  31.673  1.00 29.65 ? 67   GLN A CD  1 
ATOM   518   O  OE1 . GLN A  1 66  ? 41.124  59.849  32.850  1.00 28.00 ? 67   GLN A OE1 1 
ATOM   519   N  NE2 . GLN A  1 66  ? 40.812  60.284  30.648  1.00 23.43 ? 67   GLN A NE2 1 
ATOM   520   N  N   . VAL A  1 67  ? 46.508  59.474  31.780  1.00 24.58 ? 68   VAL A N   1 
ATOM   521   C  CA  . VAL A  1 67  ? 47.028  59.418  33.139  1.00 24.62 ? 68   VAL A CA  1 
ATOM   522   C  C   . VAL A  1 67  ? 45.984  60.129  33.979  1.00 24.18 ? 68   VAL A C   1 
ATOM   523   O  O   . VAL A  1 67  ? 45.580  61.240  33.650  1.00 24.48 ? 68   VAL A O   1 
ATOM   524   C  CB  . VAL A  1 67  ? 48.393  60.126  33.275  1.00 25.18 ? 68   VAL A CB  1 
ATOM   525   C  CG1 . VAL A  1 67  ? 48.796  60.232  34.744  1.00 21.40 ? 68   VAL A CG1 1 
ATOM   526   C  CG2 . VAL A  1 67  ? 49.465  59.385  32.473  1.00 25.28 ? 68   VAL A CG2 1 
ATOM   527   N  N   . ALA A  1 68  ? 45.516  59.460  35.030  1.00 26.09 ? 69   ALA A N   1 
ATOM   528   C  CA  . ALA A  1 68  ? 44.483  60.007  35.921  1.00 25.93 ? 69   ALA A CA  1 
ATOM   529   C  C   . ALA A  1 68  ? 44.931  59.939  37.362  1.00 27.70 ? 69   ALA A C   1 
ATOM   530   O  O   . ALA A  1 68  ? 45.793  59.114  37.749  1.00 27.07 ? 69   ALA A O   1 
ATOM   531   C  CB  . ALA A  1 68  ? 43.157  59.252  35.776  1.00 22.41 ? 69   ALA A CB  1 
ATOM   532   N  N   . LYS A  1 69  ? 44.330  60.815  38.153  1.00 27.53 ? 70   LYS A N   1 
ATOM   533   C  CA  . LYS A  1 69  ? 44.508  60.808  39.592  1.00 28.67 ? 70   LYS A CA  1 
ATOM   534   C  C   . LYS A  1 69  ? 43.160  60.388  40.172  1.00 28.55 ? 70   LYS A C   1 
ATOM   535   O  O   . LYS A  1 69  ? 42.111  60.790  39.656  1.00 26.58 ? 70   LYS A O   1 
ATOM   536   C  CB  . LYS A  1 69  ? 44.922  62.204  40.074  1.00 29.29 ? 70   LYS A CB  1 
ATOM   537   C  CG  . LYS A  1 69  ? 45.307  62.292  41.584  1.00 33.30 ? 70   LYS A CG  1 
ATOM   538   C  CD  . LYS A  1 69  ? 45.650  63.736  41.992  1.00 34.53 ? 70   LYS A CD  1 
ATOM   539   N  N   . VAL A  1 70  ? 43.192  59.550  41.212  1.00 30.60 ? 71   VAL A N   1 
ATOM   540   C  CA  . VAL A  1 70  ? 41.985  59.203  41.977  1.00 29.96 ? 71   VAL A CA  1 
ATOM   541   C  C   . VAL A  1 70  ? 41.607  60.405  42.876  1.00 31.16 ? 71   VAL A C   1 
ATOM   542   O  O   . VAL A  1 70  ? 42.403  60.817  43.734  1.00 30.09 ? 71   VAL A O   1 
ATOM   543   C  CB  . VAL A  1 70  ? 42.201  57.938  42.822  1.00 30.00 ? 71   VAL A CB  1 
ATOM   544   C  CG1 . VAL A  1 70  ? 40.918  57.593  43.623  1.00 31.90 ? 71   VAL A CG1 1 
ATOM   545   C  CG2 . VAL A  1 70  ? 42.631  56.753  41.916  1.00 29.33 ? 71   VAL A CG2 1 
ATOM   546   N  N   . VAL A  1 71  ? 40.418  60.986  42.650  1.00 30.54 ? 72   VAL A N   1 
ATOM   547   C  CA  . VAL A  1 71  ? 39.971  62.126  43.464  1.00 31.67 ? 72   VAL A CA  1 
ATOM   548   C  C   . VAL A  1 71  ? 38.919  61.780  44.557  1.00 33.77 ? 72   VAL A C   1 
ATOM   549   O  O   . VAL A  1 71  ? 38.823  62.495  45.553  1.00 35.16 ? 72   VAL A O   1 
ATOM   550   C  CB  . VAL A  1 71  ? 39.560  63.381  42.596  1.00 31.63 ? 72   VAL A CB  1 
ATOM   551   C  CG1 . VAL A  1 71  ? 40.788  63.922  41.844  1.00 27.28 ? 72   VAL A CG1 1 
ATOM   552   C  CG2 . VAL A  1 71  ? 38.435  63.080  41.658  1.00 27.69 ? 72   VAL A CG2 1 
ATOM   553   N  N   . GLU A  1 72  ? 38.183  60.674  44.392  1.00 34.82 ? 73   GLU A N   1 
ATOM   554   C  CA  . GLU A  1 72  ? 37.307  60.122  45.455  1.00 34.43 ? 73   GLU A CA  1 
ATOM   555   C  C   . GLU A  1 72  ? 37.327  58.600  45.362  1.00 34.80 ? 73   GLU A C   1 
ATOM   556   O  O   . GLU A  1 72  ? 37.471  58.049  44.261  1.00 36.46 ? 73   GLU A O   1 
ATOM   557   C  CB  . GLU A  1 72  ? 35.864  60.649  45.334  1.00 35.26 ? 73   GLU A CB  1 
ATOM   558   C  CG  . GLU A  1 72  ? 35.682  62.149  45.691  1.00 40.14 ? 73   GLU A CG  1 
ATOM   559   N  N   . SER A  1 73  ? 37.199  57.913  46.504  1.00 34.60 ? 74   SER A N   1 
ATOM   560   C  CA  . SER A  1 73  ? 37.443  56.452  46.564  1.00 34.02 ? 74   SER A CA  1 
ATOM   561   C  C   . SER A  1 73  ? 36.652  55.660  47.632  1.00 34.44 ? 74   SER A C   1 
ATOM   562   O  O   . SER A  1 73  ? 36.608  56.049  48.792  1.00 35.30 ? 74   SER A O   1 
ATOM   563   C  CB  . SER A  1 73  ? 38.934  56.183  46.834  1.00 33.01 ? 74   SER A CB  1 
ATOM   564   O  OG  . SER A  1 73  ? 39.156  54.777  46.953  1.00 35.23 ? 74   SER A OG  1 
ATOM   565   N  N   . LYS A  1 74  ? 36.061  54.536  47.223  1.00 34.92 ? 75   LYS A N   1 
ATOM   566   C  CA  . LYS A  1 74  ? 35.585  53.522  48.166  1.00 35.51 ? 75   LYS A CA  1 
ATOM   567   C  C   . LYS A  1 74  ? 36.321  52.223  47.850  1.00 34.61 ? 75   LYS A C   1 
ATOM   568   O  O   . LYS A  1 74  ? 35.712  51.154  47.758  1.00 32.76 ? 75   LYS A O   1 
ATOM   569   C  CB  . LYS A  1 74  ? 34.070  53.309  48.040  1.00 36.22 ? 75   LYS A CB  1 
ATOM   570   C  CG  . LYS A  1 74  ? 33.239  54.563  48.204  1.00 38.62 ? 75   LYS A CG  1 
ATOM   571   C  CD  . LYS A  1 74  ? 31.795  54.292  47.784  1.00 42.63 ? 75   LYS A CD  1 
ATOM   572   N  N   . ASN A  1 75  ? 37.637  52.339  47.650  1.00 35.93 ? 76   ASN A N   1 
ATOM   573   C  CA  . ASN A  1 75  ? 38.487  51.199  47.255  1.00 36.14 ? 76   ASN A CA  1 
ATOM   574   C  C   . ASN A  1 75  ? 39.818  51.388  47.981  1.00 36.87 ? 76   ASN A C   1 
ATOM   575   O  O   . ASN A  1 75  ? 40.533  52.393  47.771  1.00 36.75 ? 76   ASN A O   1 
ATOM   576   C  CB  . ASN A  1 75  ? 38.655  51.146  45.715  1.00 36.86 ? 76   ASN A CB  1 
ATOM   577   C  CG  . ASN A  1 75  ? 39.273  49.827  45.207  1.00 37.63 ? 76   ASN A CG  1 
ATOM   578   O  OD1 . ASN A  1 75  ? 40.435  49.511  45.498  1.00 38.52 ? 76   ASN A OD1 1 
ATOM   579   N  ND2 . ASN A  1 75  ? 38.503  49.076  44.412  1.00 34.12 ? 76   ASN A ND2 1 
ATOM   580   N  N   . VAL A  1 76  ? 40.123  50.449  48.876  1.00 39.13 ? 77   VAL A N   1 
ATOM   581   C  CA  . VAL A  1 76  ? 41.291  50.578  49.772  1.00 37.53 ? 77   VAL A CA  1 
ATOM   582   C  C   . VAL A  1 76  ? 42.584  50.502  48.971  1.00 36.75 ? 77   VAL A C   1 
ATOM   583   O  O   . VAL A  1 76  ? 43.533  51.251  49.227  1.00 39.57 ? 77   VAL A O   1 
ATOM   584   C  CB  . VAL A  1 76  ? 41.272  49.519  50.910  1.00 38.14 ? 77   VAL A CB  1 
ATOM   585   C  CG1 . VAL A  1 76  ? 39.960  49.641  51.730  1.00 40.19 ? 77   VAL A CG1 1 
ATOM   586   C  CG2 . VAL A  1 76  ? 41.457  48.074  50.363  1.00 37.18 ? 77   VAL A CG2 1 
ATOM   587   N  N   . ALA A  1 77  ? 42.591  49.621  47.974  1.00 37.03 ? 78   ALA A N   1 
ATOM   588   C  CA  . ALA A  1 77  ? 43.738  49.438  47.083  1.00 36.08 ? 78   ALA A CA  1 
ATOM   589   C  C   . ALA A  1 77  ? 44.048  50.712  46.313  1.00 36.98 ? 78   ALA A C   1 
ATOM   590   O  O   . ALA A  1 77  ? 45.141  50.857  45.764  1.00 37.64 ? 78   ALA A O   1 
ATOM   591   C  CB  . ALA A  1 77  ? 43.455  48.284  46.101  1.00 35.34 ? 78   ALA A CB  1 
ATOM   592   N  N   . LEU A  1 78  ? 43.083  51.635  46.255  1.00 37.19 ? 79   LEU A N   1 
ATOM   593   C  CA  . LEU A  1 78  ? 43.268  52.892  45.529  1.00 36.43 ? 79   LEU A CA  1 
ATOM   594   C  C   . LEU A  1 78  ? 42.851  54.100  46.354  1.00 36.90 ? 79   LEU A C   1 
ATOM   595   O  O   . LEU A  1 78  ? 41.743  54.606  46.182  1.00 40.21 ? 79   LEU A O   1 
ATOM   596   C  CB  . LEU A  1 78  ? 42.463  52.862  44.218  1.00 36.09 ? 79   LEU A CB  1 
ATOM   597   C  CG  . LEU A  1 78  ? 42.840  51.756  43.226  1.00 36.62 ? 79   LEU A CG  1 
ATOM   598   C  CD1 . LEU A  1 78  ? 41.721  51.566  42.201  1.00 36.05 ? 79   LEU A CD1 1 
ATOM   599   C  CD2 . LEU A  1 78  ? 44.165  52.063  42.556  1.00 31.40 ? 79   LEU A CD2 1 
ATOM   600   N  N   . PRO A  1 79  ? 43.734  54.591  47.239  1.00 35.63 ? 80   PRO A N   1 
ATOM   601   C  CA  . PRO A  1 79  ? 43.413  55.829  47.989  1.00 35.31 ? 80   PRO A CA  1 
ATOM   602   C  C   . PRO A  1 79  ? 43.366  57.090  47.098  1.00 34.93 ? 80   PRO A C   1 
ATOM   603   O  O   . PRO A  1 79  ? 43.815  57.029  45.954  1.00 34.69 ? 80   PRO A O   1 
ATOM   604   C  CB  . PRO A  1 79  ? 44.573  55.933  49.000  1.00 35.30 ? 80   PRO A CB  1 
ATOM   605   C  CG  . PRO A  1 79  ? 45.705  55.160  48.354  1.00 34.67 ? 80   PRO A CG  1 
ATOM   606   C  CD  . PRO A  1 79  ? 45.066  54.052  47.581  1.00 35.19 ? 80   PRO A CD  1 
ATOM   607   N  N   . LYS A  1 80  ? 42.820  58.209  47.607  1.00 34.28 ? 81   LYS A N   1 
ATOM   608   C  CA  . LYS A  1 80  ? 42.873  59.496  46.890  1.00 34.15 ? 81   LYS A CA  1 
ATOM   609   C  C   . LYS A  1 80  ? 44.318  59.832  46.561  1.00 34.62 ? 81   LYS A C   1 
ATOM   610   O  O   . LYS A  1 80  ? 45.218  59.558  47.368  1.00 36.38 ? 81   LYS A O   1 
ATOM   611   C  CB  . LYS A  1 80  ? 42.354  60.657  47.739  1.00 34.80 ? 81   LYS A CB  1 
ATOM   612   C  CG  . LYS A  1 80  ? 40.842  60.802  47.844  1.00 41.63 ? 81   LYS A CG  1 
ATOM   613   C  CD  . LYS A  1 80  ? 40.444  61.962  48.812  1.00 43.61 ? 81   LYS A CD  1 
ATOM   614   N  N   . GLY A  1 81  ? 44.547  60.439  45.392  1.00 33.23 ? 82   GLY A N   1 
ATOM   615   C  CA  . GLY A  1 81  ? 45.886  60.930  45.030  1.00 31.59 ? 82   GLY A CA  1 
ATOM   616   C  C   . GLY A  1 81  ? 46.730  59.893  44.313  1.00 30.75 ? 82   GLY A C   1 
ATOM   617   O  O   . GLY A  1 81  ? 47.776  60.233  43.747  1.00 32.74 ? 82   GLY A O   1 
ATOM   618   N  N   . THR A  1 82  ? 46.295  58.632  44.332  1.00 29.89 ? 83   THR A N   1 
ATOM   619   C  CA  . THR A  1 82  ? 46.906  57.604  43.469  1.00 30.30 ? 83   THR A CA  1 
ATOM   620   C  C   . THR A  1 82  ? 46.844  58.002  41.979  1.00 29.20 ? 83   THR A C   1 
ATOM   621   O  O   . THR A  1 82  ? 45.796  58.447  41.483  1.00 29.49 ? 83   THR A O   1 
ATOM   622   C  CB  . THR A  1 82  ? 46.214  56.260  43.668  1.00 30.03 ? 83   THR A CB  1 
ATOM   623   O  OG1 . THR A  1 82  ? 46.130  56.000  45.076  1.00 32.16 ? 83   THR A OG1 1 
ATOM   624   C  CG2 . THR A  1 82  ? 47.001  55.115  42.984  1.00 29.30 ? 83   THR A CG2 1 
ATOM   625   N  N   . ILE A  1 83  ? 47.981  57.879  41.300  1.00 29.39 ? 84   ILE A N   1 
ATOM   626   C  CA  . ILE A  1 83  ? 48.086  58.128  39.865  1.00 29.01 ? 84   ILE A CA  1 
ATOM   627   C  C   . ILE A  1 83  ? 47.938  56.794  39.100  1.00 29.83 ? 84   ILE A C   1 
ATOM   628   O  O   . ILE A  1 83  ? 48.691  55.863  39.357  1.00 30.70 ? 84   ILE A O   1 
ATOM   629   C  CB  . ILE A  1 83  ? 49.440  58.753  39.514  1.00 29.30 ? 84   ILE A CB  1 
ATOM   630   C  CG1 . ILE A  1 83  ? 49.679  60.032  40.330  1.00 28.31 ? 84   ILE A CG1 1 
ATOM   631   C  CG2 . ILE A  1 83  ? 49.545  59.036  38.005  1.00 26.73 ? 84   ILE A CG2 1 
ATOM   632   C  CD1 . ILE A  1 83  ? 48.654  61.153  40.076  1.00 26.34 ? 84   ILE A CD1 1 
ATOM   633   N  N   . VAL A  1 84  ? 46.984  56.715  38.160  1.00 28.44 ? 85   VAL A N   1 
ATOM   634   C  CA  . VAL A  1 84  ? 46.769  55.496  37.373  1.00 26.95 ? 85   VAL A CA  1 
ATOM   635   C  C   . VAL A  1 84  ? 46.763  55.767  35.868  1.00 28.25 ? 85   VAL A C   1 
ATOM   636   O  O   . VAL A  1 84  ? 46.446  56.876  35.435  1.00 30.35 ? 85   VAL A O   1 
ATOM   637   C  CB  . VAL A  1 84  ? 45.433  54.828  37.734  1.00 26.72 ? 85   VAL A CB  1 
ATOM   638   C  CG1 . VAL A  1 84  ? 45.472  54.296  39.161  1.00 25.65 ? 85   VAL A CG1 1 
ATOM   639   C  CG2 . VAL A  1 84  ? 44.245  55.827  37.532  1.00 24.86 ? 85   VAL A CG2 1 
ATOM   640   N  N   . LEU A  1 85  ? 47.149  54.755  35.088  1.00 26.47 ? 86   LEU A N   1 
ATOM   641   C  CA  . LEU A  1 85  ? 46.823  54.687  33.668  1.00 25.35 ? 86   LEU A CA  1 
ATOM   642   C  C   . LEU A  1 85  ? 45.434  54.088  33.526  1.00 24.67 ? 86   LEU A C   1 
ATOM   643   O  O   . LEU A  1 85  ? 45.146  53.025  34.106  1.00 25.18 ? 86   LEU A O   1 
ATOM   644   C  CB  . LEU A  1 85  ? 47.789  53.774  32.925  1.00 24.70 ? 86   LEU A CB  1 
ATOM   645   C  CG  . LEU A  1 85  ? 49.176  54.302  32.572  1.00 26.29 ? 86   LEU A CG  1 
ATOM   646   C  CD1 . LEU A  1 85  ? 49.895  53.180  31.877  1.00 24.27 ? 86   LEU A CD1 1 
ATOM   647   C  CD2 . LEU A  1 85  ? 49.106  55.514  31.660  1.00 23.37 ? 86   LEU A CD2 1 
ATOM   648   N  N   . ALA A  1 86  ? 44.589  54.742  32.731  1.00 24.15 ? 87   ALA A N   1 
ATOM   649   C  CA  . ALA A  1 86  ? 43.191  54.320  32.553  1.00 24.00 ? 87   ALA A CA  1 
ATOM   650   C  C   . ALA A  1 86  ? 42.736  54.590  31.118  1.00 24.21 ? 87   ALA A C   1 
ATOM   651   O  O   . ALA A  1 86  ? 43.212  55.538  30.466  1.00 24.02 ? 87   ALA A O   1 
ATOM   652   C  CB  . ALA A  1 86  ? 42.295  55.057  33.544  1.00 21.56 ? 87   ALA A CB  1 
ATOM   653   N  N   . SER A  1 87  ? 41.784  53.793  30.637  1.00 23.66 ? 88   SER A N   1 
ATOM   654   C  CA  . SER A  1 87  ? 41.298  53.973  29.278  1.00 23.98 ? 88   SER A CA  1 
ATOM   655   C  C   . SER A  1 87  ? 39.793  54.239  29.167  1.00 24.85 ? 88   SER A C   1 
ATOM   656   O  O   . SER A  1 87  ? 39.075  53.545  28.449  1.00 25.58 ? 88   SER A O   1 
ATOM   657   C  CB  . SER A  1 87  ? 41.728  52.794  28.428  1.00 24.61 ? 88   SER A CB  1 
ATOM   658   O  OG  . SER A  1 87  ? 43.130  52.653  28.507  1.00 25.52 ? 88   SER A OG  1 
ATOM   659   N  N   . PRO A  1 88  ? 39.322  55.293  29.834  1.00 23.76 ? 89   PRO A N   1 
ATOM   660   C  CA  . PRO A  1 88  ? 37.889  55.564  29.763  1.00 23.59 ? 89   PRO A CA  1 
ATOM   661   C  C   . PRO A  1 88  ? 37.499  56.274  28.479  1.00 26.01 ? 89   PRO A C   1 
ATOM   662   O  O   . PRO A  1 88  ? 36.311  56.529  28.271  1.00 25.25 ? 89   PRO A O   1 
ATOM   663   C  CB  . PRO A  1 88  ? 37.640  56.459  30.980  1.00 24.63 ? 89   PRO A CB  1 
ATOM   664   C  CG  . PRO A  1 88  ? 38.981  57.171  31.208  1.00 24.20 ? 89   PRO A CG  1 
ATOM   665   C  CD  . PRO A  1 88  ? 40.030  56.177  30.781  1.00 22.70 ? 89   PRO A CD  1 
ATOM   666   N  N   . GLY A  1 89  ? 38.472  56.572  27.602  1.00 25.74 ? 90   GLY A N   1 
ATOM   667   C  CA  . GLY A  1 89  ? 38.178  57.353  26.404  1.00 24.87 ? 90   GLY A CA  1 
ATOM   668   C  C   . GLY A  1 89  ? 38.369  58.835  26.656  1.00 24.58 ? 90   GLY A C   1 
ATOM   669   O  O   . GLY A  1 89  ? 38.978  59.223  27.647  1.00 23.47 ? 90   GLY A O   1 
ATOM   670   N  N   . TRP A  1 90  ? 37.870  59.681  25.761  1.00 24.17 ? 91   TRP A N   1 
ATOM   671   C  CA  . TRP A  1 90  ? 38.201  61.096  25.872  1.00 24.63 ? 91   TRP A CA  1 
ATOM   672   C  C   . TRP A  1 90  ? 37.206  61.736  26.828  1.00 24.94 ? 91   TRP A C   1 
ATOM   673   O  O   . TRP A  1 90  ? 36.179  62.304  26.409  1.00 24.13 ? 91   TRP A O   1 
ATOM   674   C  CB  . TRP A  1 90  ? 38.167  61.828  24.531  1.00 23.90 ? 91   TRP A CB  1 
ATOM   675   C  CG  . TRP A  1 90  ? 39.038  61.295  23.416  1.00 24.44 ? 91   TRP A CG  1 
ATOM   676   C  CD1 . TRP A  1 90  ? 39.676  60.086  23.336  1.00 22.33 ? 91   TRP A CD1 1 
ATOM   677   C  CD2 . TRP A  1 90  ? 39.283  61.962  22.176  1.00 22.18 ? 91   TRP A CD2 1 
ATOM   678   N  NE1 . TRP A  1 90  ? 40.345  59.980  22.120  1.00 24.06 ? 91   TRP A NE1 1 
ATOM   679   C  CE2 . TRP A  1 90  ? 40.100  61.113  21.389  1.00 22.44 ? 91   TRP A CE2 1 
ATOM   680   C  CE3 . TRP A  1 90  ? 38.886  63.200  21.653  1.00 19.16 ? 91   TRP A CE3 1 
ATOM   681   C  CZ2 . TRP A  1 90  ? 40.522  61.463  20.108  1.00 21.74 ? 91   TRP A CZ2 1 
ATOM   682   C  CZ3 . TRP A  1 90  ? 39.300  63.549  20.370  1.00 22.40 ? 91   TRP A CZ3 1 
ATOM   683   C  CH2 . TRP A  1 90  ? 40.116  62.679  19.615  1.00 21.75 ? 91   TRP A CH2 1 
ATOM   684   N  N   . THR A  1 91  ? 37.525  61.653  28.116  1.00 25.80 ? 92   THR A N   1 
ATOM   685   C  CA  . THR A  1 91  ? 36.631  62.170  29.147  1.00 26.26 ? 92   THR A CA  1 
ATOM   686   C  C   . THR A  1 91  ? 37.450  62.706  30.274  1.00 25.55 ? 92   THR A C   1 
ATOM   687   O  O   . THR A  1 91  ? 38.519  62.146  30.578  1.00 23.63 ? 92   THR A O   1 
ATOM   688   C  CB  . THR A  1 91  ? 35.622  61.093  29.646  1.00 27.25 ? 92   THR A CB  1 
ATOM   689   O  OG1 . THR A  1 91  ? 34.579  61.728  30.398  1.00 33.35 ? 92   THR A OG1 1 
ATOM   690   C  CG2 . THR A  1 91  ? 36.296  60.028  30.493  1.00 23.35 ? 92   THR A CG2 1 
ATOM   691   N  N   . THR A  1 92  ? 36.990  63.821  30.858  1.00 25.39 ? 93   THR A N   1 
ATOM   692   C  CA  . THR A  1 92  ? 37.744  64.474  31.954  1.00 26.51 ? 93   THR A CA  1 
ATOM   693   C  C   . THR A  1 92  ? 37.579  63.748  33.282  1.00 26.59 ? 93   THR A C   1 
ATOM   694   O  O   . THR A  1 92  ? 38.502  63.761  34.106  1.00 30.48 ? 93   THR A O   1 
ATOM   695   C  CB  . THR A  1 92  ? 37.323  65.933  32.185  1.00 26.80 ? 93   THR A CB  1 
ATOM   696   O  OG1 . THR A  1 92  ? 35.904  65.988  32.352  1.00 26.66 ? 93   THR A OG1 1 
ATOM   697   C  CG2 . THR A  1 92  ? 37.733  66.798  31.012  1.00 26.71 ? 93   THR A CG2 1 
ATOM   698   N  N   . HIS A  1 93  ? 36.403  63.160  33.502  1.00 27.05 ? 94   HIS A N   1 
ATOM   699   C  CA  . HIS A  1 93  ? 36.114  62.452  34.741  1.00 29.33 ? 94   HIS A CA  1 
ATOM   700   C  C   . HIS A  1 93  ? 35.428  61.102  34.483  1.00 29.42 ? 94   HIS A C   1 
ATOM   701   O  O   . HIS A  1 93  ? 34.543  60.984  33.613  1.00 30.36 ? 94   HIS A O   1 
ATOM   702   C  CB  . HIS A  1 93  ? 35.241  63.326  35.642  1.00 31.21 ? 94   HIS A CB  1 
ATOM   703   C  CG  . HIS A  1 93  ? 35.915  64.579  36.124  1.00 32.94 ? 94   HIS A CG  1 
ATOM   704   N  ND1 . HIS A  1 93  ? 36.010  65.723  35.356  1.00 42.66 ? 94   HIS A ND1 1 
ATOM   705   C  CD2 . HIS A  1 93  ? 36.493  64.879  37.315  1.00 36.79 ? 94   HIS A CD2 1 
ATOM   706   C  CE1 . HIS A  1 93  ? 36.634  66.667  36.043  1.00 42.32 ? 94   HIS A CE1 1 
ATOM   707   N  NE2 . HIS A  1 93  ? 36.932  66.181  37.238  1.00 40.84 ? 94   HIS A NE2 1 
ATOM   708   N  N   . SER A  1 94  ? 35.830  60.073  35.225  1.00 28.37 ? 95   SER A N   1 
ATOM   709   C  CA  . SER A  1 94  ? 35.229  58.734  35.033  1.00 28.83 ? 95   SER A CA  1 
ATOM   710   C  C   . SER A  1 94  ? 35.255  57.854  36.293  1.00 29.44 ? 95   SER A C   1 
ATOM   711   O  O   . SER A  1 94  ? 36.066  58.057  37.199  1.00 27.84 ? 95   SER A O   1 
ATOM   712   C  CB  . SER A  1 94  ? 35.930  57.980  33.894  1.00 26.96 ? 95   SER A CB  1 
ATOM   713   O  OG  . SER A  1 94  ? 37.268  57.641  34.276  1.00 28.60 ? 95   SER A OG  1 
ATOM   714   N  N   . ILE A  1 95  ? 34.376  56.851  36.284  1.00 31.26 ? 96   ILE A N   1 
ATOM   715   C  CA  . ILE A  1 95  ? 34.152  55.947  37.403  1.00 31.69 ? 96   ILE A CA  1 
ATOM   716   C  C   . ILE A  1 95  ? 34.742  54.596  37.041  1.00 32.61 ? 96   ILE A C   1 
ATOM   717   O  O   . ILE A  1 95  ? 34.391  54.038  36.015  1.00 31.25 ? 96   ILE A O   1 
ATOM   718   C  CB  . ILE A  1 95  ? 32.639  55.768  37.685  1.00 32.42 ? 96   ILE A CB  1 
ATOM   719   C  CG1 . ILE A  1 95  ? 32.059  57.020  38.344  1.00 35.63 ? 96   ILE A CG1 1 
ATOM   720   C  CG2 . ILE A  1 95  ? 32.386  54.555  38.604  1.00 34.02 ? 96   ILE A CG2 1 
ATOM   721   C  CD1 . ILE A  1 95  ? 30.514  57.026  38.397  1.00 34.61 ? 96   ILE A CD1 1 
ATOM   722   N  N   . SER A  1 96  ? 35.649  54.079  37.878  1.00 34.00 ? 97   SER A N   1 
ATOM   723   C  CA  . SER A  1 96  ? 36.212  52.739  37.677  1.00 31.70 ? 97   SER A CA  1 
ATOM   724   C  C   . SER A  1 96  ? 35.917  51.822  38.878  1.00 34.11 ? 97   SER A C   1 
ATOM   725   O  O   . SER A  1 96  ? 35.897  52.288  40.031  1.00 34.47 ? 97   SER A O   1 
ATOM   726   C  CB  . SER A  1 96  ? 37.719  52.868  37.500  1.00 32.16 ? 97   SER A CB  1 
ATOM   727   O  OG  . SER A  1 96  ? 38.345  51.605  37.324  1.00 35.41 ? 97   SER A OG  1 
ATOM   728   N  N   . ASP A  1 97  ? 35.703  50.529  38.604  1.00 35.40 ? 98   ASP A N   1 
ATOM   729   C  CA  . ASP A  1 97  ? 35.761  49.499  39.651  1.00 36.72 ? 98   ASP A CA  1 
ATOM   730   C  C   . ASP A  1 97  ? 37.210  49.104  40.029  1.00 37.75 ? 98   ASP A C   1 
ATOM   731   O  O   . ASP A  1 97  ? 37.404  48.246  40.898  1.00 38.81 ? 98   ASP A O   1 
ATOM   732   C  CB  . ASP A  1 97  ? 34.977  48.237  39.244  1.00 36.79 ? 98   ASP A CB  1 
ATOM   733   C  CG  . ASP A  1 97  ? 35.605  47.495  38.047  1.00 43.07 ? 98   ASP A CG  1 
ATOM   734   O  OD1 . ASP A  1 97  ? 36.743  47.834  37.627  1.00 47.81 ? 98   ASP A OD1 1 
ATOM   735   O  OD2 . ASP A  1 97  ? 34.948  46.568  37.523  1.00 43.09 ? 98   ASP A OD2 1 
ATOM   736   N  N   . GLY A  1 98  ? 38.221  49.689  39.377  1.00 35.95 ? 99   GLY A N   1 
ATOM   737   C  CA  . GLY A  1 98  ? 39.621  49.397  39.731  1.00 35.45 ? 99   GLY A CA  1 
ATOM   738   C  C   . GLY A  1 98  ? 40.253  48.237  38.981  1.00 35.52 ? 99   GLY A C   1 
ATOM   739   O  O   . GLY A  1 98  ? 41.478  48.130  38.910  1.00 37.27 ? 99   GLY A O   1 
ATOM   740   N  N   . LYS A  1 99  ? 39.443  47.358  38.410  1.00 36.98 ? 100  LYS A N   1 
ATOM   741   C  CA  . LYS A  1 99  ? 39.993  46.172  37.743  1.00 39.11 ? 100  LYS A CA  1 
ATOM   742   C  C   . LYS A  1 99  ? 40.733  46.506  36.428  1.00 39.73 ? 100  LYS A C   1 
ATOM   743   O  O   . LYS A  1 99  ? 41.641  45.777  36.022  1.00 39.26 ? 100  LYS A O   1 
ATOM   744   C  CB  . LYS A  1 99  ? 38.885  45.135  37.504  1.00 40.70 ? 100  LYS A CB  1 
ATOM   745   C  CG  . LYS A  1 99  ? 38.279  44.598  38.835  1.00 46.78 ? 100  LYS A CG  1 
ATOM   746   C  CD  . LYS A  1 99  ? 37.947  43.087  38.787  1.00 51.52 ? 100  LYS A CD  1 
ATOM   747   C  CE  . LYS A  1 99  ? 37.831  42.501  40.201  1.00 55.13 ? 100  LYS A CE  1 
ATOM   748   N  NZ  . LYS A  1 99  ? 38.018  41.018  40.228  1.00 54.87 ? 100  LYS A NZ  1 
ATOM   749   N  N   . ASP A  1 100 ? 40.360  47.626  35.804  1.00 38.39 ? 101  ASP A N   1 
ATOM   750   C  CA  . ASP A  1 100 ? 40.912  48.055  34.513  1.00 39.00 ? 101  ASP A CA  1 
ATOM   751   C  C   . ASP A  1 100 ? 42.079  49.062  34.621  1.00 38.30 ? 101  ASP A C   1 
ATOM   752   O  O   . ASP A  1 100 ? 42.591  49.532  33.602  1.00 39.77 ? 101  ASP A O   1 
ATOM   753   C  CB  . ASP A  1 100 ? 39.787  48.681  33.667  1.00 40.72 ? 101  ASP A CB  1 
ATOM   754   C  CG  . ASP A  1 100 ? 39.029  49.794  34.415  1.00 43.89 ? 101  ASP A CG  1 
ATOM   755   O  OD1 . ASP A  1 100 ? 39.402  50.101  35.572  1.00 46.93 ? 101  ASP A OD1 1 
ATOM   756   O  OD2 . ASP A  1 100 ? 38.056  50.355  33.853  1.00 50.41 ? 101  ASP A OD2 1 
ATOM   757   N  N   . LEU A  1 101 ? 42.504  49.382  35.838  1.00 34.92 ? 102  LEU A N   1 
ATOM   758   C  CA  . LEU A  1 101 ? 43.549  50.377  36.038  1.00 33.13 ? 102  LEU A CA  1 
ATOM   759   C  C   . LEU A  1 101 ? 44.950  49.789  36.135  1.00 32.21 ? 102  LEU A C   1 
ATOM   760   O  O   . LEU A  1 101 ? 45.132  48.589  36.330  1.00 32.85 ? 102  LEU A O   1 
ATOM   761   C  CB  . LEU A  1 101 ? 43.245  51.212  37.269  1.00 31.47 ? 102  LEU A CB  1 
ATOM   762   C  CG  . LEU A  1 101 ? 41.858  51.844  37.223  1.00 34.05 ? 102  LEU A CG  1 
ATOM   763   C  CD1 . LEU A  1 101 ? 41.576  52.632  38.520  1.00 31.17 ? 102  LEU A CD1 1 
ATOM   764   C  CD2 . LEU A  1 101 ? 41.698  52.730  35.950  1.00 30.37 ? 102  LEU A CD2 1 
ATOM   765   N  N   . GLU A  1 102 ? 45.940  50.657  35.953  1.00 31.66 ? 103  GLU A N   1 
ATOM   766   C  CA  . GLU A  1 102 ? 47.335  50.270  35.999  1.00 30.55 ? 103  GLU A CA  1 
ATOM   767   C  C   . GLU A  1 102 ? 48.086  51.363  36.749  1.00 31.39 ? 103  GLU A C   1 
ATOM   768   O  O   . GLU A  1 102 ? 48.017  52.556  36.414  1.00 29.69 ? 103  GLU A O   1 
ATOM   769   C  CB  . GLU A  1 102 ? 47.887  50.104  34.577  1.00 31.59 ? 103  GLU A CB  1 
ATOM   770   C  CG  . GLU A  1 102 ? 49.335  49.582  34.461  1.00 35.22 ? 103  GLU A CG  1 
ATOM   771   C  CD  . GLU A  1 102 ? 49.880  49.684  33.010  1.00 40.57 ? 103  GLU A CD  1 
ATOM   772   O  OE1 . GLU A  1 102 ? 49.090  49.474  32.053  1.00 35.47 ? 103  GLU A OE1 1 
ATOM   773   O  OE2 . GLU A  1 102 ? 51.090  49.985  32.831  1.00 34.31 ? 103  GLU A OE2 1 
ATOM   774   N  N   . LYS A  1 103 ? 48.785  50.954  37.791  1.00 31.13 ? 104  LYS A N   1 
ATOM   775   C  CA  . LYS A  1 103 ? 49.609  51.865  38.530  1.00 32.04 ? 104  LYS A CA  1 
ATOM   776   C  C   . LYS A  1 103 ? 50.927  51.926  37.797  1.00 30.74 ? 104  LYS A C   1 
ATOM   777   O  O   . LYS A  1 103 ? 51.339  50.967  37.134  1.00 29.78 ? 104  LYS A O   1 
ATOM   778   C  CB  . LYS A  1 103 ? 49.804  51.382  39.987  1.00 34.32 ? 104  LYS A CB  1 
ATOM   779   C  CG  . LYS A  1 103 ? 48.522  51.428  40.866  1.00 35.80 ? 104  LYS A CG  1 
ATOM   780   C  CD  . LYS A  1 103 ? 48.603  50.501  42.105  1.00 43.94 ? 104  LYS A CD  1 
ATOM   781   C  CE  . LYS A  1 103 ? 47.569  50.909  43.174  1.00 46.11 ? 104  LYS A CE  1 
ATOM   782   N  NZ  . LYS A  1 103 ? 47.721  50.209  44.499  1.00 46.67 ? 104  LYS A NZ  1 
ATOM   783   N  N   . LEU A  1 104 ? 51.594  53.060  37.934  1.00 32.19 ? 105  LEU A N   1 
ATOM   784   C  CA  . LEU A  1 104 ? 52.900  53.257  37.331  1.00 32.81 ? 105  LEU A CA  1 
ATOM   785   C  C   . LEU A  1 104 ? 53.948  52.341  37.926  1.00 33.43 ? 105  LEU A C   1 
ATOM   786   O  O   . LEU A  1 104 ? 53.701  51.665  38.912  1.00 35.03 ? 105  LEU A O   1 
ATOM   787   C  CB  . LEU A  1 104 ? 53.333  54.712  37.478  1.00 32.88 ? 105  LEU A CB  1 
ATOM   788   C  CG  . LEU A  1 104 ? 52.444  55.672  36.694  1.00 35.89 ? 105  LEU A CG  1 
ATOM   789   C  CD1 . LEU A  1 104 ? 53.182  56.978  36.456  1.00 36.94 ? 105  LEU A CD1 1 
ATOM   790   C  CD2 . LEU A  1 104 ? 51.994  55.057  35.362  1.00 32.34 ? 105  LEU A CD2 1 
ATOM   791   N  N   . LEU A  1 105 ? 55.115  52.303  37.293  1.00 34.19 ? 106  LEU A N   1 
ATOM   792   C  CA  . LEU A  1 105 ? 56.228  51.496  37.790  1.00 33.70 ? 106  LEU A CA  1 
ATOM   793   C  C   . LEU A  1 105 ? 56.665  52.069  39.130  1.00 35.47 ? 106  LEU A C   1 
ATOM   794   O  O   . LEU A  1 105 ? 56.676  53.288  39.279  1.00 37.60 ? 106  LEU A O   1 
ATOM   795   C  CB  . LEU A  1 105 ? 57.397  51.564  36.816  1.00 32.05 ? 106  LEU A CB  1 
ATOM   796   C  CG  . LEU A  1 105 ? 57.328  50.872  35.457  1.00 31.75 ? 106  LEU A CG  1 
ATOM   797   C  CD1 . LEU A  1 105 ? 58.630  51.164  34.658  1.00 29.15 ? 106  LEU A CD1 1 
ATOM   798   C  CD2 . LEU A  1 105 ? 57.132  49.385  35.631  1.00 27.60 ? 106  LEU A CD2 1 
ATOM   799   N  N   . THR A  1 106 ? 57.043  51.226  40.093  1.00 37.19 ? 107  THR A N   1 
ATOM   800   C  CA  . THR A  1 106 ? 57.413  51.738  41.439  1.00 38.62 ? 107  THR A CA  1 
ATOM   801   C  C   . THR A  1 106 ? 58.555  52.754  41.360  1.00 39.20 ? 107  THR A C   1 
ATOM   802   O  O   . THR A  1 106 ? 58.512  53.836  41.971  1.00 37.76 ? 107  THR A O   1 
ATOM   803   C  CB  . THR A  1 106 ? 57.876  50.619  42.453  1.00 38.75 ? 107  THR A CB  1 
ATOM   804   O  OG1 . THR A  1 106 ? 57.353  49.337  42.100  1.00 35.59 ? 107  THR A OG1 1 
ATOM   805   C  CG2 . THR A  1 106 ? 57.440  50.988  43.866  1.00 44.84 ? 107  THR A CG2 1 
ATOM   806   N  N   . GLU A  1 107 ? 59.581  52.376  40.598  1.00 40.09 ? 108  GLU A N   1 
ATOM   807   C  CA  . GLU A  1 107 ? 60.801  53.184  40.422  1.00 40.00 ? 108  GLU A CA  1 
ATOM   808   C  C   . GLU A  1 107 ? 60.613  54.454  39.567  1.00 39.78 ? 108  GLU A C   1 
ATOM   809   O  O   . GLU A  1 107 ? 61.591  55.136  39.233  1.00 40.13 ? 108  GLU A O   1 
ATOM   810   C  CB  . GLU A  1 107 ? 61.921  52.313  39.827  1.00 40.76 ? 108  GLU A CB  1 
ATOM   811   C  CG  . GLU A  1 107 ? 61.559  51.532  38.521  1.00 46.53 ? 108  GLU A CG  1 
ATOM   812   C  CD  . GLU A  1 107 ? 60.714  50.264  38.769  1.00 51.13 ? 108  GLU A CD  1 
ATOM   813   O  OE1 . GLU A  1 107 ? 59.492  50.401  39.053  1.00 49.41 ? 108  GLU A OE1 1 
ATOM   814   O  OE2 . GLU A  1 107 ? 61.271  49.139  38.702  1.00 53.24 ? 108  GLU A OE2 1 
ATOM   815   N  N   . TRP A  1 108 ? 59.362  54.761  39.213  1.00 39.46 ? 109  TRP A N   1 
ATOM   816   C  CA  . TRP A  1 108 ? 59.019  55.979  38.477  1.00 37.95 ? 109  TRP A CA  1 
ATOM   817   C  C   . TRP A  1 108 ? 59.395  57.255  39.263  1.00 38.24 ? 109  TRP A C   1 
ATOM   818   O  O   . TRP A  1 108 ? 58.692  57.623  40.201  1.00 38.41 ? 109  TRP A O   1 
ATOM   819   C  CB  . TRP A  1 108 ? 57.513  56.010  38.168  1.00 36.79 ? 109  TRP A CB  1 
ATOM   820   C  CG  . TRP A  1 108 ? 57.189  57.041  37.147  1.00 36.65 ? 109  TRP A CG  1 
ATOM   821   C  CD1 . TRP A  1 108 ? 57.135  58.400  37.321  1.00 37.46 ? 109  TRP A CD1 1 
ATOM   822   C  CD2 . TRP A  1 108 ? 56.909  56.798  35.771  1.00 32.21 ? 109  TRP A CD2 1 
ATOM   823   N  NE1 . TRP A  1 108 ? 56.839  59.013  36.130  1.00 36.10 ? 109  TRP A NE1 1 
ATOM   824   C  CE2 . TRP A  1 108 ? 56.688  58.047  35.165  1.00 35.32 ? 109  TRP A CE2 1 
ATOM   825   C  CE3 . TRP A  1 108 ? 56.821  55.638  34.991  1.00 32.47 ? 109  TRP A CE3 1 
ATOM   826   C  CZ2 . TRP A  1 108 ? 56.392  58.170  33.815  1.00 33.78 ? 109  TRP A CZ2 1 
ATOM   827   C  CZ3 . TRP A  1 108 ? 56.524  55.763  33.658  1.00 31.49 ? 109  TRP A CZ3 1 
ATOM   828   C  CH2 . TRP A  1 108 ? 56.319  57.022  33.081  1.00 33.36 ? 109  TRP A CH2 1 
ATOM   829   N  N   . PRO A  1 109 ? 60.480  57.943  38.859  1.00 38.97 ? 110  PRO A N   1 
ATOM   830   C  CA  . PRO A  1 109 ? 60.929  59.117  39.591  1.00 38.09 ? 110  PRO A CA  1 
ATOM   831   C  C   . PRO A  1 109 ? 60.114  60.341  39.257  1.00 39.29 ? 110  PRO A C   1 
ATOM   832   O  O   . PRO A  1 109 ? 59.467  60.383  38.203  1.00 40.17 ? 110  PRO A O   1 
ATOM   833   C  CB  . PRO A  1 109 ? 62.374  59.306  39.105  1.00 38.35 ? 110  PRO A CB  1 
ATOM   834   C  CG  . PRO A  1 109 ? 62.493  58.540  37.839  1.00 37.46 ? 110  PRO A CG  1 
ATOM   835   C  CD  . PRO A  1 109 ? 61.227  57.778  37.599  1.00 37.97 ? 110  PRO A CD  1 
ATOM   836   N  N   . ASP A  1 110 ? 60.171  61.342  40.137  1.00 39.61 ? 111  ASP A N   1 
ATOM   837   C  CA  . ASP A  1 110 ? 59.393  62.576  39.965  1.00 40.24 ? 111  ASP A CA  1 
ATOM   838   C  C   . ASP A  1 110 ? 60.098  63.575  39.049  1.00 40.30 ? 111  ASP A C   1 
ATOM   839   O  O   . ASP A  1 110 ? 59.593  64.682  38.844  1.00 41.25 ? 111  ASP A O   1 
ATOM   840   C  CB  . ASP A  1 110 ? 59.088  63.221  41.328  1.00 42.13 ? 111  ASP A CB  1 
ATOM   841   N  N   . THR A  1 111 ? 61.248  63.173  38.491  1.00 39.27 ? 112  THR A N   1 
ATOM   842   C  CA  . THR A  1 111 ? 62.042  63.998  37.579  1.00 38.66 ? 112  THR A CA  1 
ATOM   843   C  C   . THR A  1 111 ? 61.651  63.893  36.077  1.00 39.89 ? 112  THR A C   1 
ATOM   844   O  O   . THR A  1 111 ? 62.155  64.679  35.257  1.00 38.50 ? 112  THR A O   1 
ATOM   845   C  CB  . THR A  1 111 ? 63.550  63.613  37.694  1.00 40.41 ? 112  THR A CB  1 
ATOM   846   O  OG1 . THR A  1 111 ? 63.735  62.236  37.330  1.00 39.26 ? 112  THR A OG1 1 
ATOM   847   C  CG2 . THR A  1 111 ? 64.081  63.825  39.149  1.00 40.70 ? 112  THR A CG2 1 
ATOM   848   N  N   . ILE A  1 112 ? 60.792  62.928  35.711  1.00 37.68 ? 113  ILE A N   1 
ATOM   849   C  CA  . ILE A  1 112 ? 60.274  62.828  34.324  1.00 36.29 ? 113  ILE A CA  1 
ATOM   850   C  C   . ILE A  1 112 ? 58.761  63.145  34.301  1.00 35.22 ? 113  ILE A C   1 
ATOM   851   O  O   . ILE A  1 112 ? 58.074  62.978  35.323  1.00 35.53 ? 113  ILE A O   1 
ATOM   852   C  CB  . ILE A  1 112 ? 60.586  61.442  33.681  1.00 37.16 ? 113  ILE A CB  1 
ATOM   853   C  CG1 . ILE A  1 112 ? 59.857  60.307  34.397  1.00 37.58 ? 113  ILE A CG1 1 
ATOM   854   C  CG2 . ILE A  1 112 ? 62.081  61.147  33.713  1.00 36.78 ? 113  ILE A CG2 1 
ATOM   855   C  CD1 . ILE A  1 112 ? 60.338  58.917  33.979  1.00 37.97 ? 113  ILE A CD1 1 
ATOM   856   N  N   . PRO A  1 113 ? 58.233  63.660  33.169  1.00 31.35 ? 114  PRO A N   1 
ATOM   857   C  CA  . PRO A  1 113 ? 56.789  63.957  33.192  1.00 30.80 ? 114  PRO A CA  1 
ATOM   858   C  C   . PRO A  1 113 ? 55.935  62.699  33.330  1.00 28.48 ? 114  PRO A C   1 
ATOM   859   O  O   . PRO A  1 113 ? 56.336  61.636  32.863  1.00 28.03 ? 114  PRO A O   1 
ATOM   860   C  CB  . PRO A  1 113 ? 56.540  64.628  31.835  1.00 32.04 ? 114  PRO A CB  1 
ATOM   861   C  CG  . PRO A  1 113 ? 57.872  65.184  31.436  1.00 33.22 ? 114  PRO A CG  1 
ATOM   862   C  CD  . PRO A  1 113 ? 58.886  64.198  31.969  1.00 31.72 ? 114  PRO A CD  1 
ATOM   863   N  N   . LEU A  1 114 ? 54.784  62.811  33.988  1.00 27.49 ? 115  LEU A N   1 
ATOM   864   C  CA  . LEU A  1 114 ? 53.879  61.661  34.124  1.00 27.99 ? 115  LEU A CA  1 
ATOM   865   C  C   . LEU A  1 114 ? 53.412  61.161  32.738  1.00 25.90 ? 115  LEU A C   1 
ATOM   866   O  O   . LEU A  1 114 ? 53.133  59.989  32.550  1.00 26.50 ? 115  LEU A O   1 
ATOM   867   C  CB  . LEU A  1 114 ? 52.684  61.996  35.005  1.00 28.51 ? 115  LEU A CB  1 
ATOM   868   C  CG  . LEU A  1 114 ? 52.987  62.195  36.504  1.00 32.69 ? 115  LEU A CG  1 
ATOM   869   C  CD1 . LEU A  1 114 ? 51.719  62.649  37.196  1.00 30.71 ? 115  LEU A CD1 1 
ATOM   870   C  CD2 . LEU A  1 114 ? 53.559  60.937  37.179  1.00 27.26 ? 115  LEU A CD2 1 
ATOM   871   N  N   . SER A  1 115 ? 53.406  62.065  31.777  1.00 25.03 ? 116  SER A N   1 
ATOM   872   C  CA  . SER A  1 115 ? 52.868  61.811  30.463  1.00 25.10 ? 116  SER A CA  1 
ATOM   873   C  C   . SER A  1 115 ? 53.755  60.912  29.605  1.00 25.01 ? 116  SER A C   1 
ATOM   874   O  O   . SER A  1 115 ? 53.312  60.479  28.550  1.00 26.11 ? 116  SER A O   1 
ATOM   875   C  CB  . SER A  1 115 ? 52.634  63.150  29.768  1.00 24.73 ? 116  SER A CB  1 
ATOM   876   O  OG  . SER A  1 115 ? 53.774  63.969  29.896  1.00 27.13 ? 116  SER A OG  1 
ATOM   877   N  N   . LEU A  1 116 ? 54.985  60.623  30.043  1.00 22.61 ? 117  LEU A N   1 
ATOM   878   C  CA  . LEU A  1 116 ? 55.810  59.665  29.347  1.00 21.99 ? 117  LEU A CA  1 
ATOM   879   C  C   . LEU A  1 116 ? 55.197  58.292  29.483  1.00 21.92 ? 117  LEU A C   1 
ATOM   880   O  O   . LEU A  1 116 ? 55.573  57.358  28.747  1.00 23.14 ? 117  LEU A O   1 
ATOM   881   C  CB  . LEU A  1 116 ? 57.225  59.587  29.921  1.00 20.90 ? 117  LEU A CB  1 
ATOM   882   C  CG  . LEU A  1 116 ? 58.217  60.730  29.735  1.00 27.51 ? 117  LEU A CG  1 
ATOM   883   C  CD1 . LEU A  1 116 ? 59.650  60.132  29.665  1.00 26.75 ? 117  LEU A CD1 1 
ATOM   884   C  CD2 . LEU A  1 116 ? 57.946  61.618  28.533  1.00 25.29 ? 117  LEU A CD2 1 
ATOM   885   N  N   . ALA A  1 117 ? 54.330  58.158  30.485  1.00 20.72 ? 118  ALA A N   1 
ATOM   886   C  CA  . ALA A  1 117 ? 53.554  56.965  30.699  1.00 21.98 ? 118  ALA A CA  1 
ATOM   887   C  C   . ALA A  1 117 ? 52.733  56.642  29.463  1.00 21.50 ? 118  ALA A C   1 
ATOM   888   O  O   . ALA A  1 117 ? 52.366  55.496  29.267  1.00 21.08 ? 118  ALA A O   1 
ATOM   889   C  CB  . ALA A  1 117 ? 52.625  57.131  31.953  1.00 21.62 ? 118  ALA A CB  1 
ATOM   890   N  N   . LEU A  1 118 ? 52.420  57.669  28.665  1.00 22.48 ? 119  LEU A N   1 
ATOM   891   C  CA  . LEU A  1 118 ? 51.656  57.529  27.416  1.00 22.24 ? 119  LEU A CA  1 
ATOM   892   C  C   . LEU A  1 118 ? 52.514  57.541  26.152  1.00 23.59 ? 119  LEU A C   1 
ATOM   893   O  O   . LEU A  1 118 ? 51.990  57.515  25.032  1.00 24.19 ? 119  LEU A O   1 
ATOM   894   C  CB  . LEU A  1 118 ? 50.657  58.665  27.318  1.00 21.69 ? 119  LEU A CB  1 
ATOM   895   C  CG  . LEU A  1 118 ? 49.717  58.809  28.503  1.00 20.70 ? 119  LEU A CG  1 
ATOM   896   C  CD1 . LEU A  1 118 ? 49.053  60.159  28.434  1.00 19.60 ? 119  LEU A CD1 1 
ATOM   897   C  CD2 . LEU A  1 118 ? 48.699  57.665  28.500  1.00 17.38 ? 119  LEU A CD2 1 
ATOM   898   N  N   . GLY A  1 119 ? 53.828  57.604  26.332  1.00 23.86 ? 120  GLY A N   1 
ATOM   899   C  CA  . GLY A  1 119 ? 54.756  57.763  25.238  1.00 21.01 ? 120  GLY A CA  1 
ATOM   900   C  C   . GLY A  1 119 ? 55.911  56.801  25.367  1.00 21.32 ? 120  GLY A C   1 
ATOM   901   O  O   . GLY A  1 119 ? 55.746  55.571  25.231  1.00 22.32 ? 120  GLY A O   1 
ATOM   902   N  N   . THR A  1 120 ? 57.093  57.348  25.603  1.00 20.75 ? 121  THR A N   1 
ATOM   903   C  CA  . THR A  1 120 ? 58.315  56.553  25.557  1.00 21.15 ? 121  THR A CA  1 
ATOM   904   C  C   . THR A  1 120 ? 58.374  55.485  26.668  1.00 22.65 ? 121  THR A C   1 
ATOM   905   O  O   . THR A  1 120 ? 58.943  54.413  26.463  1.00 24.43 ? 121  THR A O   1 
ATOM   906   C  CB  . THR A  1 120 ? 59.569  57.490  25.567  1.00 22.36 ? 121  THR A CB  1 
ATOM   907   O  OG1 . THR A  1 120 ? 59.533  58.327  24.404  1.00 24.24 ? 121  THR A OG1 1 
ATOM   908   C  CG2 . THR A  1 120 ? 60.847  56.705  25.561  1.00 19.47 ? 121  THR A CG2 1 
ATOM   909   N  N   . VAL A  1 121 ? 57.785  55.740  27.834  1.00 22.72 ? 122  VAL A N   1 
ATOM   910   C  CA  . VAL A  1 121 ? 57.718  54.673  28.827  1.00 23.34 ? 122  VAL A CA  1 
ATOM   911   C  C   . VAL A  1 121 ? 56.256  54.190  28.887  1.00 25.29 ? 122  VAL A C   1 
ATOM   912   O  O   . VAL A  1 121 ? 55.601  54.155  29.943  1.00 26.31 ? 122  VAL A O   1 
ATOM   913   C  CB  . VAL A  1 121 ? 58.354  55.065  30.186  1.00 23.63 ? 122  VAL A CB  1 
ATOM   914   C  CG1 . VAL A  1 121 ? 58.587  53.826  31.033  1.00 20.97 ? 122  VAL A CG1 1 
ATOM   915   C  CG2 . VAL A  1 121 ? 59.692  55.784  29.972  1.00 18.90 ? 122  VAL A CG2 1 
ATOM   916   N  N   . GLY A  1 122 ? 55.773  53.808  27.702  1.00 23.05 ? 123  GLY A N   1 
ATOM   917   C  CA  . GLY A  1 122 ? 54.386  53.426  27.497  1.00 22.20 ? 123  GLY A CA  1 
ATOM   918   C  C   . GLY A  1 122 ? 54.187  52.781  26.135  1.00 20.38 ? 123  GLY A C   1 
ATOM   919   O  O   . GLY A  1 122 ? 55.129  52.271  25.538  1.00 20.06 ? 123  GLY A O   1 
ATOM   920   N  N   . MET A  1 123 ? 52.951  52.826  25.644  1.00 20.41 ? 124  MET A N   1 
ATOM   921   C  CA  . MET A  1 123 ? 52.549  51.982  24.544  1.00 18.79 ? 124  MET A CA  1 
ATOM   922   C  C   . MET A  1 123 ? 53.426  52.281  23.319  1.00 17.51 ? 124  MET A C   1 
ATOM   923   O  O   . MET A  1 123 ? 54.022  51.374  22.757  1.00 20.69 ? 124  MET A O   1 
ATOM   924   C  CB  . MET A  1 123 ? 51.027  52.088  24.317  1.00 20.91 ? 124  MET A CB  1 
ATOM   925   C  CG  . MET A  1 123 ? 50.511  51.286  23.148  1.00 21.07 ? 124  MET A CG  1 
ATOM   926   S  SD  . MET A  1 123 ? 50.792  52.215  21.643  1.00 17.86 ? 124  MET A SD  1 
ATOM   927   C  CE  . MET A  1 123 ? 49.292  53.217  21.689  1.00 18.88 ? 124  MET A CE  1 
ATOM   928   N  N   . PRO A  1 124 ? 53.586  53.561  22.952  1.00 17.39 ? 125  PRO A N   1 
ATOM   929   C  CA  . PRO A  1 124 ? 54.423  53.852  21.804  1.00 16.59 ? 125  PRO A CA  1 
ATOM   930   C  C   . PRO A  1 124 ? 55.877  53.446  21.973  1.00 19.18 ? 125  PRO A C   1 
ATOM   931   O  O   . PRO A  1 124 ? 56.502  53.012  21.000  1.00 20.22 ? 125  PRO A O   1 
ATOM   932   C  CB  . PRO A  1 124 ? 54.318  55.365  21.666  1.00 17.41 ? 125  PRO A CB  1 
ATOM   933   C  CG  . PRO A  1 124 ? 53.035  55.711  22.279  1.00 20.29 ? 125  PRO A CG  1 
ATOM   934   C  CD  . PRO A  1 124 ? 52.859  54.754  23.414  1.00 14.96 ? 125  PRO A CD  1 
ATOM   935   N  N   . GLY A  1 125 ? 56.413  53.574  23.189  1.00 19.78 ? 126  GLY A N   1 
ATOM   936   C  CA  . GLY A  1 125 ? 57.750  53.061  23.491  1.00 18.17 ? 126  GLY A CA  1 
ATOM   937   C  C   . GLY A  1 125 ? 57.816  51.551  23.344  1.00 17.79 ? 126  GLY A C   1 
ATOM   938   O  O   . GLY A  1 125 ? 58.766  51.003  22.827  1.00 18.43 ? 126  GLY A O   1 
ATOM   939   N  N   . LEU A  1 126 ? 56.777  50.864  23.790  1.00 18.68 ? 127  LEU A N   1 
ATOM   940   C  CA  . LEU A  1 126 ? 56.755  49.408  23.686  1.00 16.69 ? 127  LEU A CA  1 
ATOM   941   C  C   . LEU A  1 126 ? 56.668  48.975  22.237  1.00 17.27 ? 127  LEU A C   1 
ATOM   942   O  O   . LEU A  1 126 ? 57.336  48.026  21.811  1.00 17.74 ? 127  LEU A O   1 
ATOM   943   C  CB  . LEU A  1 126 ? 55.607  48.837  24.515  1.00 16.70 ? 127  LEU A CB  1 
ATOM   944   C  CG  . LEU A  1 126 ? 55.791  48.991  26.035  1.00 21.87 ? 127  LEU A CG  1 
ATOM   945   C  CD1 . LEU A  1 126 ? 54.521  48.594  26.811  1.00 15.91 ? 127  LEU A CD1 1 
ATOM   946   C  CD2 . LEU A  1 126 ? 56.987  48.195  26.567  1.00 16.41 ? 127  LEU A CD2 1 
ATOM   947   N  N   . THR A  1 127 ? 55.865  49.688  21.456  1.00 17.43 ? 128  THR A N   1 
ATOM   948   C  CA  . THR A  1 127 ? 55.730  49.391  20.041  1.00 15.37 ? 128  THR A CA  1 
ATOM   949   C  C   . THR A  1 127 ? 57.097  49.428  19.355  1.00 16.71 ? 128  THR A C   1 
ATOM   950   O  O   . THR A  1 127 ? 57.444  48.538  18.565  1.00 15.28 ? 128  THR A O   1 
ATOM   951   C  CB  . THR A  1 127 ? 54.823  50.438  19.403  1.00 15.68 ? 128  THR A CB  1 
ATOM   952   O  OG1 . THR A  1 127 ? 53.547  50.400  20.032  1.00 15.96 ? 128  THR A OG1 1 
ATOM   953   C  CG2 . THR A  1 127 ? 54.693  50.249  17.910  1.00 18.10 ? 128  THR A CG2 1 
ATOM   954   N  N   . ALA A  1 128 ? 57.859  50.479  19.653  1.00 16.48 ? 129  ALA A N   1 
ATOM   955   C  CA  . ALA A  1 128 ? 59.187  50.673  19.109  1.00 16.62 ? 129  ALA A CA  1 
ATOM   956   C  C   . ALA A  1 128 ? 60.082  49.524  19.537  1.00 17.91 ? 129  ALA A C   1 
ATOM   957   O  O   . ALA A  1 128 ? 60.676  48.857  18.713  1.00 17.70 ? 129  ALA A O   1 
ATOM   958   C  CB  . ALA A  1 128 ? 59.774  52.027  19.587  1.00 15.38 ? 129  ALA A CB  1 
ATOM   959   N  N   . TYR A  1 129 ? 60.132  49.282  20.841  1.00 20.68 ? 130  TYR A N   1 
ATOM   960   C  CA  . TYR A  1 129 ? 61.001  48.264  21.422  1.00 20.03 ? 130  TYR A CA  1 
ATOM   961   C  C   . TYR A  1 129 ? 60.732  46.898  20.807  1.00 19.96 ? 130  TYR A C   1 
ATOM   962   O  O   . TYR A  1 129 ? 61.628  46.283  20.235  1.00 19.22 ? 130  TYR A O   1 
ATOM   963   C  CB  . TYR A  1 129 ? 60.756  48.267  22.918  1.00 22.28 ? 130  TYR A CB  1 
ATOM   964   C  CG  . TYR A  1 129 ? 61.588  47.331  23.763  1.00 21.29 ? 130  TYR A CG  1 
ATOM   965   C  CD1 . TYR A  1 129 ? 61.312  45.975  23.802  1.00 24.54 ? 130  TYR A CD1 1 
ATOM   966   C  CD2 . TYR A  1 129 ? 62.599  47.821  24.591  1.00 22.17 ? 130  TYR A CD2 1 
ATOM   967   C  CE1 . TYR A  1 129 ? 62.037  45.124  24.611  1.00 25.96 ? 130  TYR A CE1 1 
ATOM   968   C  CE2 . TYR A  1 129 ? 63.323  46.973  25.406  1.00 24.11 ? 130  TYR A CE2 1 
ATOM   969   C  CZ  . TYR A  1 129 ? 63.040  45.625  25.412  1.00 24.69 ? 130  TYR A CZ  1 
ATOM   970   O  OH  . TYR A  1 129 ? 63.767  44.761  26.208  1.00 30.54 ? 130  TYR A OH  1 
ATOM   971   N  N   . PHE A  1 130 ? 59.489  46.430  20.847  1.00 19.84 ? 131  PHE A N   1 
ATOM   972   C  CA  . PHE A  1 130 ? 59.228  45.110  20.270  1.00 19.30 ? 131  PHE A CA  1 
ATOM   973   C  C   . PHE A  1 130 ? 59.290  45.057  18.737  1.00 19.77 ? 131  PHE A C   1 
ATOM   974   O  O   . PHE A  1 130 ? 59.778  44.078  18.162  1.00 17.94 ? 131  PHE A O   1 
ATOM   975   C  CB  . PHE A  1 130 ? 57.926  44.534  20.819  1.00 20.84 ? 131  PHE A CB  1 
ATOM   976   C  CG  . PHE A  1 130 ? 58.041  44.126  22.250  1.00 22.55 ? 131  PHE A CG  1 
ATOM   977   C  CD1 . PHE A  1 130 ? 58.939  43.141  22.615  1.00 23.13 ? 131  PHE A CD1 1 
ATOM   978   C  CD2 . PHE A  1 130 ? 57.301  44.755  23.233  1.00 21.74 ? 131  PHE A CD2 1 
ATOM   979   C  CE1 . PHE A  1 130 ? 59.083  42.795  23.928  1.00 24.93 ? 131  PHE A CE1 1 
ATOM   980   C  CE2 . PHE A  1 130 ? 57.441  44.410  24.531  1.00 21.88 ? 131  PHE A CE2 1 
ATOM   981   C  CZ  . PHE A  1 130 ? 58.316  43.427  24.887  1.00 23.23 ? 131  PHE A CZ  1 
ATOM   982   N  N   . GLY A  1 131 ? 58.841  46.110  18.065  1.00 19.93 ? 132  GLY A N   1 
ATOM   983   C  CA  . GLY A  1 131 ? 58.869  46.098  16.609  1.00 19.79 ? 132  GLY A CA  1 
ATOM   984   C  C   . GLY A  1 131 ? 60.287  45.979  16.094  1.00 20.39 ? 132  GLY A C   1 
ATOM   985   O  O   . GLY A  1 131 ? 60.562  45.200  15.173  1.00 18.01 ? 132  GLY A O   1 
ATOM   986   N  N   . LEU A  1 132 ? 61.199  46.730  16.711  1.00 19.97 ? 133  LEU A N   1 
ATOM   987   C  CA  . LEU A  1 132 ? 62.590  46.781  16.231  1.00 19.70 ? 133  LEU A CA  1 
ATOM   988   C  C   . LEU A  1 132 ? 63.422  45.616  16.686  1.00 19.32 ? 133  LEU A C   1 
ATOM   989   O  O   . LEU A  1 132 ? 64.127  45.034  15.881  1.00 20.58 ? 133  LEU A O   1 
ATOM   990   C  CB  . LEU A  1 132 ? 63.287  48.062  16.669  1.00 20.05 ? 133  LEU A CB  1 
ATOM   991   C  CG  . LEU A  1 132 ? 64.745  48.170  16.204  1.00 20.20 ? 133  LEU A CG  1 
ATOM   992   C  CD1 . LEU A  1 132 ? 64.781  48.384  14.720  1.00 20.22 ? 133  LEU A CD1 1 
ATOM   993   C  CD2 . LEU A  1 132 ? 65.448  49.307  16.930  1.00 22.10 ? 133  LEU A CD2 1 
ATOM   994   N  N   . LEU A  1 133 ? 63.360  45.301  17.977  1.00 21.48 ? 134  LEU A N   1 
ATOM   995   C  CA  . LEU A  1 133 ? 64.197  44.272  18.582  1.00 23.27 ? 134  LEU A CA  1 
ATOM   996   C  C   . LEU A  1 133 ? 63.742  42.828  18.312  1.00 26.51 ? 134  LEU A C   1 
ATOM   997   O  O   . LEU A  1 133 ? 64.601  41.940  18.212  1.00 25.38 ? 134  LEU A O   1 
ATOM   998   C  CB  . LEU A  1 133 ? 64.266  44.490  20.094  1.00 23.39 ? 134  LEU A CB  1 
ATOM   999   C  CG  . LEU A  1 133 ? 64.975  45.793  20.443  1.00 26.56 ? 134  LEU A CG  1 
ATOM   1000  C  CD1 . LEU A  1 133 ? 64.936  46.094  21.898  1.00 23.73 ? 134  LEU A CD1 1 
ATOM   1001  C  CD2 . LEU A  1 133 ? 66.406  45.724  19.962  1.00 24.47 ? 134  LEU A CD2 1 
ATOM   1002  N  N   . GLU A  1 134 ? 62.421  42.597  18.211  1.00 24.52 ? 135  GLU A N   1 
ATOM   1003  C  CA  . GLU A  1 134 ? 61.877  41.257  17.917  1.00 26.87 ? 135  GLU A CA  1 
ATOM   1004  C  C   . GLU A  1 134 ? 61.337  41.074  16.502  1.00 26.39 ? 135  GLU A C   1 
ATOM   1005  O  O   . GLU A  1 134 ? 61.615  40.058  15.874  1.00 28.90 ? 135  GLU A O   1 
ATOM   1006  C  CB  . GLU A  1 134 ? 60.754  40.897  18.886  1.00 27.97 ? 135  GLU A CB  1 
ATOM   1007  C  CG  . GLU A  1 134 ? 61.225  40.666  20.287  1.00 37.61 ? 135  GLU A CG  1 
ATOM   1008  C  CD  . GLU A  1 134 ? 60.411  39.607  21.025  1.00 49.26 ? 135  GLU A CD  1 
ATOM   1009  O  OE1 . GLU A  1 134 ? 59.661  38.834  20.370  1.00 50.16 ? 135  GLU A OE1 1 
ATOM   1010  O  OE2 . GLU A  1 134 ? 60.529  39.565  22.273  1.00 52.58 ? 135  GLU A OE2 1 
ATOM   1011  N  N   . ILE A  1 135 ? 60.562  42.028  15.989  1.00 23.56 ? 136  ILE A N   1 
ATOM   1012  C  CA  . ILE A  1 135 ? 60.027  41.864  14.651  1.00 20.61 ? 136  ILE A CA  1 
ATOM   1013  C  C   . ILE A  1 135 ? 61.079  42.086  13.561  1.00 23.15 ? 136  ILE A C   1 
ATOM   1014  O  O   . ILE A  1 135 ? 61.236  41.248  12.674  1.00 24.59 ? 136  ILE A O   1 
ATOM   1015  C  CB  . ILE A  1 135 ? 58.798  42.729  14.385  1.00 20.78 ? 136  ILE A CB  1 
ATOM   1016  C  CG1 . ILE A  1 135 ? 57.755  42.496  15.471  1.00 21.32 ? 136  ILE A CG1 1 
ATOM   1017  C  CG2 . ILE A  1 135 ? 58.248  42.409  12.957  1.00 14.46 ? 136  ILE A CG2 1 
ATOM   1018  C  CD1 . ILE A  1 135 ? 57.362  41.024  15.625  1.00 17.99 ? 136  ILE A CD1 1 
ATOM   1019  N  N   . CYS A  1 136 ? 61.789  43.207  13.607  1.00 21.91 ? 137  CYS A N   1 
ATOM   1020  C  CA  . CYS A  1 136 ? 62.921  43.395  12.704  1.00 24.90 ? 137  CYS A CA  1 
ATOM   1021  C  C   . CYS A  1 136 ? 64.077  42.482  13.125  1.00 23.63 ? 137  CYS A C   1 
ATOM   1022  O  O   . CYS A  1 136 ? 64.861  42.032  12.317  1.00 23.60 ? 137  CYS A O   1 
ATOM   1023  C  CB  . CYS A  1 136 ? 63.393  44.856  12.679  1.00 25.99 ? 137  CYS A CB  1 
ATOM   1024  S  SG  . CYS A  1 136 ? 62.324  46.056  11.851  1.00 28.21 ? 137  CYS A SG  1 
ATOM   1025  N  N   . GLY A  1 137 ? 64.176  42.212  14.407  1.00 26.63 ? 138  GLY A N   1 
ATOM   1026  C  CA  . GLY A  1 137 ? 65.264  41.383  14.915  1.00 29.84 ? 138  GLY A CA  1 
ATOM   1027  C  C   . GLY A  1 137 ? 66.623  42.044  14.793  1.00 30.11 ? 138  GLY A C   1 
ATOM   1028  O  O   . GLY A  1 137 ? 67.581  41.376  14.429  1.00 29.40 ? 138  GLY A O   1 
ATOM   1029  N  N   . VAL A  1 138 ? 66.737  43.344  15.079  1.00 31.41 ? 139  VAL A N   1 
ATOM   1030  C  CA  . VAL A  1 138 ? 68.073  43.980  14.950  1.00 34.22 ? 139  VAL A CA  1 
ATOM   1031  C  C   . VAL A  1 138 ? 69.099  43.383  15.918  1.00 37.22 ? 139  VAL A C   1 
ATOM   1032  O  O   . VAL A  1 138 ? 68.828  43.219  17.115  1.00 37.34 ? 139  VAL A O   1 
ATOM   1033  C  CB  . VAL A  1 138 ? 68.068  45.522  15.100  1.00 34.90 ? 139  VAL A CB  1 
ATOM   1034  C  CG1 . VAL A  1 138 ? 67.213  46.157  14.033  1.00 33.98 ? 139  VAL A CG1 1 
ATOM   1035  C  CG2 . VAL A  1 138 ? 67.659  45.947  16.493  1.00 30.30 ? 139  VAL A CG2 1 
ATOM   1036  N  N   . LYS A  1 139 ? 70.270  43.045  15.380  1.00 42.19 ? 140  LYS A N   1 
ATOM   1037  C  CA  . LYS A  1 139 ? 71.368  42.427  16.148  1.00 45.21 ? 140  LYS A CA  1 
ATOM   1038  C  C   . LYS A  1 139 ? 72.464  43.443  16.526  1.00 45.07 ? 140  LYS A C   1 
ATOM   1039  O  O   . LYS A  1 139 ? 72.933  43.452  17.680  1.00 46.64 ? 140  LYS A O   1 
ATOM   1040  C  CB  . LYS A  1 139 ? 72.005  41.268  15.343  1.00 47.51 ? 140  LYS A CB  1 
ATOM   1041  C  CG  . LYS A  1 139 ? 71.176  39.966  15.275  1.00 54.30 ? 140  LYS A CG  1 
ATOM   1042  C  CD  . LYS A  1 139 ? 71.053  39.272  16.652  1.00 61.92 ? 140  LYS A CD  1 
ATOM   1043  C  CE  . LYS A  1 139 ? 69.681  38.612  16.859  1.00 64.22 ? 140  LYS A CE  1 
ATOM   1044  N  NZ  . LYS A  1 139 ? 69.397  38.420  18.311  1.00 62.32 ? 140  LYS A NZ  1 
ATOM   1045  N  N   . GLY A  1 140 ? 72.864  44.267  15.544  1.00 41.60 ? 141  GLY A N   1 
ATOM   1046  C  CA  . GLY A  1 140 ? 73.940  45.254  15.681  1.00 38.43 ? 141  GLY A CA  1 
ATOM   1047  C  C   . GLY A  1 140 ? 74.708  45.356  14.383  1.00 37.50 ? 141  GLY A C   1 
ATOM   1048  O  O   . GLY A  1 140 ? 75.010  44.336  13.773  1.00 38.52 ? 141  GLY A O   1 
ATOM   1049  N  N   . GLY A  1 141 ? 75.008  46.578  13.941  1.00 36.67 ? 142  GLY A N   1 
ATOM   1050  C  CA  . GLY A  1 141 ? 75.661  46.805  12.640  1.00 34.99 ? 142  GLY A CA  1 
ATOM   1051  C  C   . GLY A  1 141 ? 74.746  46.922  11.420  1.00 34.78 ? 142  GLY A C   1 
ATOM   1052  O  O   . GLY A  1 141 ? 75.230  47.176  10.301  1.00 36.73 ? 142  GLY A O   1 
ATOM   1053  N  N   . GLU A  1 142 ? 73.434  46.750  11.604  1.00 31.72 ? 143  GLU A N   1 
ATOM   1054  C  CA  . GLU A  1 142 ? 72.489  46.807  10.474  1.00 29.92 ? 143  GLU A CA  1 
ATOM   1055  C  C   . GLU A  1 142 ? 72.145  48.240  10.108  1.00 25.29 ? 143  GLU A C   1 
ATOM   1056  O  O   . GLU A  1 142 ? 72.212  49.126  10.950  1.00 24.14 ? 143  GLU A O   1 
ATOM   1057  C  CB  . GLU A  1 142 ? 71.162  46.097  10.810  1.00 31.35 ? 143  GLU A CB  1 
ATOM   1058  C  CG  . GLU A  1 142 ? 71.260  44.603  11.077  1.00 35.34 ? 143  GLU A CG  1 
ATOM   1059  C  CD  . GLU A  1 142 ? 71.021  44.244  12.535  1.00 45.60 ? 143  GLU A CD  1 
ATOM   1060  O  OE1 . GLU A  1 142 ? 71.504  44.980  13.437  1.00 41.84 ? 143  GLU A OE1 1 
ATOM   1061  O  OE2 . GLU A  1 142 ? 70.359  43.206  12.781  1.00 50.92 ? 143  GLU A OE2 1 
ATOM   1062  N  N   . THR A  1 143 ? 71.749  48.444  8.859   1.00 24.09 ? 144  THR A N   1 
ATOM   1063  C  CA  . THR A  1 143 ? 71.155  49.698  8.418   1.00 24.75 ? 144  THR A CA  1 
ATOM   1064  C  C   . THR A  1 143 ? 69.621  49.597  8.482   1.00 23.69 ? 144  THR A C   1 
ATOM   1065  O  O   . THR A  1 143 ? 69.017  48.752  7.828   1.00 23.14 ? 144  THR A O   1 
ATOM   1066  C  CB  . THR A  1 143 ? 71.579  50.063  7.016   1.00 25.26 ? 144  THR A CB  1 
ATOM   1067  O  OG1 . THR A  1 143 ? 72.995  50.009  6.940   1.00 29.71 ? 144  THR A OG1 1 
ATOM   1068  C  CG2 . THR A  1 143 ? 71.138  51.479  6.655   1.00 25.76 ? 144  THR A CG2 1 
ATOM   1069  N  N   . VAL A  1 144 ? 69.032  50.468  9.303   1.00 22.70 ? 145  VAL A N   1 
ATOM   1070  C  CA  . VAL A  1 144 ? 67.625  50.513  9.582   1.00 21.95 ? 145  VAL A CA  1 
ATOM   1071  C  C   . VAL A  1 144 ? 67.001  51.754  8.943   1.00 22.08 ? 145  VAL A C   1 
ATOM   1072  O  O   . VAL A  1 144 ? 67.454  52.880  9.154   1.00 21.07 ? 145  VAL A O   1 
ATOM   1073  C  CB  . VAL A  1 144 ? 67.378  50.562  11.079  1.00 23.23 ? 145  VAL A CB  1 
ATOM   1074  C  CG1 . VAL A  1 144 ? 65.872  50.539  11.371  1.00 21.05 ? 145  VAL A CG1 1 
ATOM   1075  C  CG2 . VAL A  1 144 ? 68.100  49.406  11.757  1.00 23.39 ? 145  VAL A CG2 1 
ATOM   1076  N  N   . MET A  1 145 ? 65.998  51.528  8.108   1.00 18.27 ? 146  MET A N   1 
ATOM   1077  C  CA  . MET A  1 145 ? 65.179  52.604  7.579   1.00 20.46 ? 146  MET A CA  1 
ATOM   1078  C  C   . MET A  1 145 ? 63.910  52.734  8.439   1.00 18.42 ? 146  MET A C   1 
ATOM   1079  O  O   . MET A  1 145 ? 63.218  51.739  8.724   1.00 16.99 ? 146  MET A O   1 
ATOM   1080  C  CB  . MET A  1 145 ? 64.942  52.353  6.096   1.00 22.27 ? 146  MET A CB  1 
ATOM   1081  C  CG  . MET A  1 145 ? 63.699  52.859  5.476   1.00 31.23 ? 146  MET A CG  1 
ATOM   1082  S  SD  . MET A  1 145 ? 63.402  54.587  5.491   1.00 38.69 ? 146  MET A SD  1 
ATOM   1083  C  CE  . MET A  1 145 ? 61.790  54.566  6.159   1.00 35.42 ? 146  MET A CE  1 
ATOM   1084  N  N   . VAL A  1 146 ? 63.673  53.944  8.934   1.00 18.14 ? 147  VAL A N   1 
ATOM   1085  C  CA  . VAL A  1 146 ? 62.481  54.250  9.749   1.00 19.78 ? 147  VAL A CA  1 
ATOM   1086  C  C   . VAL A  1 146 ? 61.833  55.542  9.280   1.00 19.84 ? 147  VAL A C   1 
ATOM   1087  O  O   . VAL A  1 146 ? 62.487  56.545  9.093   1.00 18.88 ? 147  VAL A O   1 
ATOM   1088  C  CB  . VAL A  1 146 ? 62.787  54.352  11.270  1.00 21.61 ? 147  VAL A CB  1 
ATOM   1089  C  CG1 . VAL A  1 146 ? 63.778  55.475  11.585  1.00 27.03 ? 147  VAL A CG1 1 
ATOM   1090  C  CG2 . VAL A  1 146 ? 61.512  54.563  12.056  1.00 18.14 ? 147  VAL A CG2 1 
ATOM   1091  N  N   . ASN A  1 147 ? 60.531  55.501  9.083   1.00 20.74 ? 148  ASN A N   1 
ATOM   1092  C  CA  . ASN A  1 147 ? 59.800  56.647  8.639   1.00 20.08 ? 148  ASN A CA  1 
ATOM   1093  C  C   . ASN A  1 147 ? 58.960  57.143  9.814   1.00 17.81 ? 148  ASN A C   1 
ATOM   1094  O  O   . ASN A  1 147 ? 59.019  56.570  10.908  1.00 18.23 ? 148  ASN A O   1 
ATOM   1095  C  CB  . ASN A  1 147 ? 59.005  56.318  7.342   1.00 21.00 ? 148  ASN A CB  1 
ATOM   1096  C  CG  . ASN A  1 147 ? 58.158  55.042  7.459   1.00 19.66 ? 148  ASN A CG  1 
ATOM   1097  O  OD1 . ASN A  1 147 ? 57.632  54.739  8.518   1.00 15.65 ? 148  ASN A OD1 1 
ATOM   1098  N  ND2 . ASN A  1 147 ? 58.027  54.306  6.364   1.00 14.84 ? 148  ASN A ND2 1 
ATOM   1099  N  N   . ALA A  1 148 ? 58.211  58.222  9.618   1.00 17.76 ? 149  ALA A N   1 
ATOM   1100  C  CA  . ALA A  1 148 ? 57.652  58.981  10.744  1.00 18.75 ? 149  ALA A CA  1 
ATOM   1101  C  C   . ALA A  1 148 ? 58.668  59.059  11.877  1.00 17.72 ? 149  ALA A C   1 
ATOM   1102  O  O   . ALA A  1 148 ? 58.324  58.850  13.043  1.00 16.07 ? 149  ALA A O   1 
ATOM   1103  C  CB  . ALA A  1 148 ? 56.371  58.344  11.245  1.00 17.97 ? 149  ALA A CB  1 
ATOM   1104  N  N   . ALA A  1 149 ? 59.913  59.352  11.520  1.00 16.29 ? 150  ALA A N   1 
ATOM   1105  C  CA  . ALA A  1 149 ? 61.038  59.130  12.415  1.00 18.90 ? 150  ALA A CA  1 
ATOM   1106  C  C   . ALA A  1 149 ? 61.144  60.157  13.555  1.00 21.30 ? 150  ALA A C   1 
ATOM   1107  O  O   . ALA A  1 149 ? 61.866  59.927  14.505  1.00 23.55 ? 150  ALA A O   1 
ATOM   1108  C  CB  . ALA A  1 149 ? 62.307  59.096  11.643  1.00 17.88 ? 150  ALA A CB  1 
ATOM   1109  N  N   . ALA A  1 150 ? 60.433  61.278  13.466  1.00 22.49 ? 151  ALA A N   1 
ATOM   1110  C  CA  . ALA A  1 150 ? 60.386  62.242  14.569  1.00 22.80 ? 151  ALA A CA  1 
ATOM   1111  C  C   . ALA A  1 150 ? 59.141  62.041  15.431  1.00 23.33 ? 151  ALA A C   1 
ATOM   1112  O  O   . ALA A  1 150 ? 58.925  62.797  16.372  1.00 24.05 ? 151  ALA A O   1 
ATOM   1113  C  CB  . ALA A  1 150 ? 60.430  63.668  14.039  1.00 20.94 ? 151  ALA A CB  1 
ATOM   1114  N  N   . GLY A  1 151 ? 58.325  61.033  15.119  1.00 21.99 ? 152  GLY A N   1 
ATOM   1115  C  CA  . GLY A  1 151 ? 57.087  60.791  15.857  1.00 20.25 ? 152  GLY A CA  1 
ATOM   1116  C  C   . GLY A  1 151 ? 57.325  59.947  17.074  1.00 21.29 ? 152  GLY A C   1 
ATOM   1117  O  O   . GLY A  1 151 ? 58.452  59.492  17.299  1.00 21.18 ? 152  GLY A O   1 
ATOM   1118  N  N   . ALA A  1 152 ? 56.268  59.694  17.851  1.00 20.07 ? 153  ALA A N   1 
ATOM   1119  C  CA  . ALA A  1 152 ? 56.429  58.990  19.141  1.00 21.50 ? 153  ALA A CA  1 
ATOM   1120  C  C   . ALA A  1 152 ? 57.152  57.637  18.998  1.00 20.14 ? 153  ALA A C   1 
ATOM   1121  O  O   . ALA A  1 152 ? 58.135  57.362  19.696  1.00 19.88 ? 153  ALA A O   1 
ATOM   1122  C  CB  . ALA A  1 152 ? 55.057  58.815  19.842  1.00 18.54 ? 153  ALA A CB  1 
ATOM   1123  N  N   . VAL A  1 153 ? 56.686  56.808  18.069  1.00 20.38 ? 154  VAL A N   1 
ATOM   1124  C  CA  . VAL A  1 153 ? 57.256  55.472  17.907  1.00 19.11 ? 154  VAL A CA  1 
ATOM   1125  C  C   . VAL A  1 153 ? 58.608  55.553  17.202  1.00 18.84 ? 154  VAL A C   1 
ATOM   1126  O  O   . VAL A  1 153 ? 59.612  55.072  17.729  1.00 18.99 ? 154  VAL A O   1 
ATOM   1127  C  CB  . VAL A  1 153 ? 56.305  54.535  17.142  1.00 20.83 ? 154  VAL A CB  1 
ATOM   1128  C  CG1 . VAL A  1 153 ? 56.995  53.201  16.823  1.00 17.01 ? 154  VAL A CG1 1 
ATOM   1129  C  CG2 . VAL A  1 153 ? 55.004  54.320  17.941  1.00 14.08 ? 154  VAL A CG2 1 
ATOM   1130  N  N   . GLY A  1 154 ? 58.626  56.161  16.020  1.00 17.74 ? 155  GLY A N   1 
ATOM   1131  C  CA  . GLY A  1 154 ? 59.831  56.200  15.190  1.00 19.71 ? 155  GLY A CA  1 
ATOM   1132  C  C   . GLY A  1 154 ? 61.036  56.893  15.829  1.00 20.86 ? 155  GLY A C   1 
ATOM   1133  O  O   . GLY A  1 154 ? 62.175  56.490  15.582  1.00 21.72 ? 155  GLY A O   1 
ATOM   1134  N  N   . SER A  1 155 ? 60.796  57.935  16.634  1.00 18.87 ? 156  SER A N   1 
ATOM   1135  C  CA  . SER A  1 155 ? 61.884  58.589  17.351  1.00 20.93 ? 156  SER A CA  1 
ATOM   1136  C  C   . SER A  1 155 ? 62.531  57.609  18.317  1.00 20.99 ? 156  SER A C   1 
ATOM   1137  O  O   . SER A  1 155 ? 63.752  57.552  18.434  1.00 22.57 ? 156  SER A O   1 
ATOM   1138  C  CB  . SER A  1 155 ? 61.422  59.889  18.033  1.00 20.75 ? 156  SER A CB  1 
ATOM   1139  O  OG  . SER A  1 155 ? 60.627  59.664  19.188  1.00 25.59 ? 156  SER A OG  1 
ATOM   1140  N  N   . VAL A  1 156 ? 61.717  56.769  18.947  1.00 21.51 ? 157  VAL A N   1 
ATOM   1141  C  CA  . VAL A  1 156 ? 62.235  55.753  19.840  1.00 21.87 ? 157  VAL A CA  1 
ATOM   1142  C  C   . VAL A  1 156 ? 62.907  54.609  19.102  1.00 21.69 ? 157  VAL A C   1 
ATOM   1143  O  O   . VAL A  1 156 ? 63.909  54.091  19.576  1.00 22.05 ? 157  VAL A O   1 
ATOM   1144  C  CB  . VAL A  1 156 ? 61.133  55.225  20.773  1.00 21.76 ? 157  VAL A CB  1 
ATOM   1145  C  CG1 . VAL A  1 156 ? 61.666  54.138  21.672  1.00 21.01 ? 157  VAL A CG1 1 
ATOM   1146  C  CG2 . VAL A  1 156 ? 60.613  56.383  21.595  1.00 20.23 ? 157  VAL A CG2 1 
ATOM   1147  N  N   . VAL A  1 157 ? 62.375  54.228  17.942  1.00 19.61 ? 158  VAL A N   1 
ATOM   1148  C  CA  . VAL A  1 157 ? 63.002  53.179  17.145  1.00 20.35 ? 158  VAL A CA  1 
ATOM   1149  C  C   . VAL A  1 157 ? 64.426  53.567  16.812  1.00 20.36 ? 158  VAL A C   1 
ATOM   1150  O  O   . VAL A  1 157 ? 65.345  52.780  16.998  1.00 21.19 ? 158  VAL A O   1 
ATOM   1151  C  CB  . VAL A  1 157 ? 62.246  52.854  15.820  1.00 18.16 ? 158  VAL A CB  1 
ATOM   1152  C  CG1 . VAL A  1 157 ? 63.184  52.144  14.773  1.00 15.76 ? 158  VAL A CG1 1 
ATOM   1153  C  CG2 . VAL A  1 157 ? 61.045  52.009  16.110  1.00 19.48 ? 158  VAL A CG2 1 
ATOM   1154  N  N   . GLY A  1 158 ? 64.581  54.784  16.316  1.00 22.40 ? 159  GLY A N   1 
ATOM   1155  C  CA  . GLY A  1 158 ? 65.876  55.288  15.885  1.00 24.02 ? 159  GLY A CA  1 
ATOM   1156  C  C   . GLY A  1 158 ? 66.870  55.336  17.026  1.00 23.74 ? 159  GLY A C   1 
ATOM   1157  O  O   . GLY A  1 158 ? 68.021  54.941  16.874  1.00 23.41 ? 159  GLY A O   1 
ATOM   1158  N  N   . GLN A  1 159 ? 66.418  55.780  18.187  1.00 25.11 ? 160  GLN A N   1 
ATOM   1159  C  CA  . GLN A  1 159 ? 67.336  55.907  19.318  1.00 25.67 ? 160  GLN A CA  1 
ATOM   1160  C  C   . GLN A  1 159 ? 67.729  54.523  19.848  1.00 27.36 ? 160  GLN A C   1 
ATOM   1161  O  O   . GLN A  1 159 ? 68.915  54.263  20.094  1.00 27.76 ? 160  GLN A O   1 
ATOM   1162  C  CB  . GLN A  1 159 ? 66.724  56.784  20.389  1.00 25.20 ? 160  GLN A CB  1 
ATOM   1163  C  CG  . GLN A  1 159 ? 66.623  58.255  19.986  1.00 23.99 ? 160  GLN A CG  1 
ATOM   1164  C  CD  . GLN A  1 159 ? 66.081  59.109  21.113  1.00 28.74 ? 160  GLN A CD  1 
ATOM   1165  O  OE1 . GLN A  1 159 ? 66.811  59.454  22.037  1.00 32.28 ? 160  GLN A OE1 1 
ATOM   1166  N  NE2 . GLN A  1 159 ? 64.787  59.422  21.063  1.00 27.07 ? 160  GLN A NE2 1 
ATOM   1167  N  N   . ILE A  1 160 ? 66.750  53.616  19.967  1.00 25.00 ? 161  ILE A N   1 
ATOM   1168  C  CA  . ILE A  1 160 ? 67.057  52.238  20.339  1.00 23.40 ? 161  ILE A CA  1 
ATOM   1169  C  C   . ILE A  1 160 ? 68.029  51.605  19.349  1.00 23.35 ? 161  ILE A C   1 
ATOM   1170  O  O   . ILE A  1 160 ? 68.910  50.858  19.733  1.00 23.78 ? 161  ILE A O   1 
ATOM   1171  C  CB  . ILE A  1 160 ? 65.790  51.317  20.394  1.00 23.62 ? 161  ILE A CB  1 
ATOM   1172  C  CG1 . ILE A  1 160 ? 64.871  51.727  21.524  1.00 23.51 ? 161  ILE A CG1 1 
ATOM   1173  C  CG2 . ILE A  1 160 ? 66.204  49.872  20.539  1.00 18.98 ? 161  ILE A CG2 1 
ATOM   1174  C  CD1 . ILE A  1 160 ? 63.747  50.750  21.759  1.00 23.38 ? 161  ILE A CD1 1 
ATOM   1175  N  N   . ALA A  1 161 ? 67.836  51.872  18.066  1.00 24.33 ? 162  ALA A N   1 
ATOM   1176  C  CA  . ALA A  1 161 ? 68.717  51.332  17.052  1.00 24.35 ? 162  ALA A CA  1 
ATOM   1177  C  C   . ALA A  1 161 ? 70.129  51.901  17.192  1.00 26.55 ? 162  ALA A C   1 
ATOM   1178  O  O   . ALA A  1 161 ? 71.120  51.174  17.022  1.00 28.76 ? 162  ALA A O   1 
ATOM   1179  C  CB  . ALA A  1 161 ? 68.144  51.612  15.645  1.00 22.21 ? 162  ALA A CB  1 
ATOM   1180  N  N   . LYS A  1 162 ? 70.236  53.196  17.486  1.00 27.05 ? 163  LYS A N   1 
ATOM   1181  C  CA  . LYS A  1 162 ? 71.553  53.816  17.649  1.00 27.93 ? 163  LYS A CA  1 
ATOM   1182  C  C   . LYS A  1 162 ? 72.271  53.201  18.853  1.00 29.04 ? 163  LYS A C   1 
ATOM   1183  O  O   . LYS A  1 162 ? 73.442  52.838  18.763  1.00 30.21 ? 163  LYS A O   1 
ATOM   1184  C  CB  . LYS A  1 162 ? 71.448  55.342  17.825  1.00 28.10 ? 163  LYS A CB  1 
ATOM   1185  C  CG  . LYS A  1 162 ? 71.137  56.156  16.565  1.00 24.09 ? 163  LYS A CG  1 
ATOM   1186  C  CD  . LYS A  1 162 ? 72.020  55.833  15.384  1.00 26.22 ? 163  LYS A CD  1 
ATOM   1187  C  CE  . LYS A  1 162 ? 73.536  56.041  15.667  1.00 33.69 ? 163  LYS A CE  1 
ATOM   1188  N  NZ  . LYS A  1 162 ? 74.397  55.650  14.484  1.00 24.02 ? 163  LYS A NZ  1 
ATOM   1189  N  N   . LEU A  1 163 ? 71.570  53.023  19.960  1.00 29.05 ? 164  LEU A N   1 
ATOM   1190  C  CA  . LEU A  1 163 ? 72.247  52.510  21.154  1.00 32.31 ? 164  LEU A CA  1 
ATOM   1191  C  C   . LEU A  1 163 ? 72.661  51.031  21.008  1.00 33.64 ? 164  LEU A C   1 
ATOM   1192  O  O   . LEU A  1 163 ? 73.621  50.590  21.632  1.00 33.82 ? 164  LEU A O   1 
ATOM   1193  C  CB  . LEU A  1 163 ? 71.441  52.802  22.426  1.00 32.65 ? 164  LEU A CB  1 
ATOM   1194  C  CG  . LEU A  1 163 ? 70.164  52.028  22.708  1.00 32.59 ? 164  LEU A CG  1 
ATOM   1195  C  CD1 . LEU A  1 163 ? 70.469  50.658  23.311  1.00 34.29 ? 164  LEU A CD1 1 
ATOM   1196  C  CD2 . LEU A  1 163 ? 69.319  52.844  23.649  1.00 27.08 ? 164  LEU A CD2 1 
ATOM   1197  N  N   . LYS A  1 164 ? 71.981  50.301  20.122  1.00 33.28 ? 165  LYS A N   1 
ATOM   1198  C  CA  . LYS A  1 164 ? 72.407  48.963  19.708  1.00 31.84 ? 165  LYS A CA  1 
ATOM   1199  C  C   . LYS A  1 164 ? 73.452  48.995  18.591  1.00 30.93 ? 165  LYS A C   1 
ATOM   1200  O  O   . LYS A  1 164 ? 73.847  47.945  18.082  1.00 31.26 ? 165  LYS A O   1 
ATOM   1201  C  CB  . LYS A  1 164 ? 71.197  48.127  19.240  1.00 32.35 ? 165  LYS A CB  1 
ATOM   1202  C  CG  . LYS A  1 164 ? 70.200  47.822  20.317  1.00 34.35 ? 165  LYS A CG  1 
ATOM   1203  C  CD  . LYS A  1 164 ? 70.700  46.751  21.308  1.00 37.11 ? 165  LYS A CD  1 
ATOM   1204  C  CE  . LYS A  1 164 ? 69.678  46.583  22.448  1.00 39.92 ? 165  LYS A CE  1 
ATOM   1205  N  NZ  . LYS A  1 164 ? 70.095  45.634  23.524  1.00 41.38 ? 165  LYS A NZ  1 
ATOM   1206  N  N   . GLY A  1 165 ? 73.898  50.176  18.181  1.00 31.49 ? 166  GLY A N   1 
ATOM   1207  C  CA  . GLY A  1 165 ? 74.986  50.246  17.194  1.00 31.83 ? 166  GLY A CA  1 
ATOM   1208  C  C   . GLY A  1 165 ? 74.595  49.984  15.747  1.00 31.29 ? 166  GLY A C   1 
ATOM   1209  O  O   . GLY A  1 165 ? 75.374  49.430  14.999  1.00 35.04 ? 166  GLY A O   1 
ATOM   1210  N  N   . CYS A  1 166 ? 73.397  50.411  15.355  1.00 30.83 ? 167  CYS A N   1 
ATOM   1211  C  CA  . CYS A  1 166 ? 72.912  50.346  13.977  1.00 29.02 ? 167  CYS A CA  1 
ATOM   1212  C  C   . CYS A  1 166 ? 73.042  51.702  13.306  1.00 27.78 ? 167  CYS A C   1 
ATOM   1213  O  O   . CYS A  1 166 ? 73.011  52.730  13.965  1.00 29.15 ? 167  CYS A O   1 
ATOM   1214  C  CB  . CYS A  1 166 ? 71.426  49.942  13.957  1.00 30.17 ? 167  CYS A CB  1 
ATOM   1215  S  SG  . CYS A  1 166 ? 71.016  48.313  14.690  1.00 31.74 ? 167  CYS A SG  1 
ATOM   1216  N  N   . LYS A  1 167 ? 73.141  51.699  11.989  1.00 26.38 ? 168  LYS A N   1 
ATOM   1217  C  CA  . LYS A  1 167 ? 73.003  52.913  11.192  1.00 26.54 ? 168  LYS A CA  1 
ATOM   1218  C  C   . LYS A  1 167 ? 71.516  53.179  10.939  1.00 27.02 ? 168  LYS A C   1 
ATOM   1219  O  O   . LYS A  1 167 ? 70.767  52.256  10.583  1.00 27.73 ? 168  LYS A O   1 
ATOM   1220  C  CB  . LYS A  1 167 ? 73.735  52.737  9.866   1.00 26.49 ? 168  LYS A CB  1 
ATOM   1221  C  CG  . LYS A  1 167 ? 73.679  53.948  8.967   1.00 30.60 ? 168  LYS A CG  1 
ATOM   1222  C  CD  . LYS A  1 167 ? 74.426  53.734  7.666   1.00 34.51 ? 168  LYS A CD  1 
ATOM   1223  C  CE  . LYS A  1 167 ? 74.174  54.885  6.711   1.00 34.37 ? 168  LYS A CE  1 
ATOM   1224  N  NZ  . LYS A  1 167 ? 74.865  54.658  5.434   1.00 37.73 ? 168  LYS A NZ  1 
ATOM   1225  N  N   . VAL A  1 168 ? 71.092  54.426  11.127  1.00 25.44 ? 169  VAL A N   1 
ATOM   1226  C  CA  . VAL A  1 168 ? 69.681  54.794  11.038  1.00 23.67 ? 169  VAL A CA  1 
ATOM   1227  C  C   . VAL A  1 168 ? 69.484  55.827  9.967   1.00 24.35 ? 169  VAL A C   1 
ATOM   1228  O  O   . VAL A  1 168 ? 70.165  56.853  9.959   1.00 24.93 ? 169  VAL A O   1 
ATOM   1229  C  CB  . VAL A  1 168 ? 69.128  55.387  12.368  1.00 24.31 ? 169  VAL A CB  1 
ATOM   1230  C  CG1 . VAL A  1 168 ? 67.713  55.974  12.167  1.00 20.09 ? 169  VAL A CG1 1 
ATOM   1231  C  CG2 . VAL A  1 168 ? 69.099  54.332  13.438  1.00 21.28 ? 169  VAL A CG2 1 
ATOM   1232  N  N   . VAL A  1 169 ? 68.566  55.540  9.053   1.00 21.93 ? 170  VAL A N   1 
ATOM   1233  C  CA  . VAL A  1 169 ? 68.134  56.477  8.040   1.00 22.14 ? 170  VAL A CA  1 
ATOM   1234  C  C   . VAL A  1 169 ? 66.677  56.770  8.357   1.00 23.16 ? 170  VAL A C   1 
ATOM   1235  O  O   . VAL A  1 169 ? 65.864  55.846  8.419   1.00 26.45 ? 170  VAL A O   1 
ATOM   1236  C  CB  . VAL A  1 169 ? 68.235  55.870  6.655   1.00 21.86 ? 170  VAL A CB  1 
ATOM   1237  C  CG1 . VAL A  1 169 ? 67.664  56.804  5.583   1.00 17.76 ? 170  VAL A CG1 1 
ATOM   1238  C  CG2 . VAL A  1 169 ? 69.664  55.465  6.377   1.00 23.61 ? 170  VAL A CG2 1 
ATOM   1239  N  N   . GLY A  1 170 ? 66.364  58.041  8.582   1.00 22.03 ? 171  GLY A N   1 
ATOM   1240  C  CA  . GLY A  1 170 ? 65.049  58.458  8.983   1.00 24.29 ? 171  GLY A CA  1 
ATOM   1241  C  C   . GLY A  1 170 ? 64.440  59.420  7.992   1.00 24.63 ? 171  GLY A C   1 
ATOM   1242  O  O   . GLY A  1 170 ? 65.139  60.263  7.422   1.00 25.81 ? 171  GLY A O   1 
ATOM   1243  N  N   . ALA A  1 171 ? 63.131  59.291  7.798   1.00 21.56 ? 172  ALA A N   1 
ATOM   1244  C  CA  . ALA A  1 171 ? 62.377  60.186  6.941   1.00 22.09 ? 172  ALA A CA  1 
ATOM   1245  C  C   . ALA A  1 171 ? 61.390  60.928  7.818   1.00 20.45 ? 172  ALA A C   1 
ATOM   1246  O  O   . ALA A  1 171 ? 60.790  60.327  8.701   1.00 18.15 ? 172  ALA A O   1 
ATOM   1247  C  CB  . ALA A  1 171 ? 61.632  59.388  5.836   1.00 21.68 ? 172  ALA A CB  1 
ATOM   1248  N  N   . VAL A  1 172 ? 61.233  62.226  7.582   1.00 20.89 ? 173  VAL A N   1 
ATOM   1249  C  CA  . VAL A  1 172 ? 60.274  63.056  8.316   1.00 20.10 ? 173  VAL A CA  1 
ATOM   1250  C  C   . VAL A  1 172 ? 59.650  64.045  7.364   1.00 20.91 ? 173  VAL A C   1 
ATOM   1251  O  O   . VAL A  1 172 ? 60.089  64.155  6.220   1.00 20.27 ? 173  VAL A O   1 
ATOM   1252  C  CB  . VAL A  1 172 ? 60.927  63.805  9.505   1.00 21.68 ? 173  VAL A CB  1 
ATOM   1253  C  CG1 . VAL A  1 172 ? 61.399  62.793  10.570  1.00 15.75 ? 173  VAL A CG1 1 
ATOM   1254  C  CG2 . VAL A  1 172 ? 62.086  64.733  9.017   1.00 18.47 ? 173  VAL A CG2 1 
ATOM   1255  N  N   . GLY A  1 173 ? 58.598  64.737  7.811   1.00 20.24 ? 174  GLY A N   1 
ATOM   1256  C  CA  . GLY A  1 173 ? 57.869  65.647  6.936   1.00 20.45 ? 174  GLY A CA  1 
ATOM   1257  C  C   . GLY A  1 173 ? 58.184  67.143  7.057   1.00 23.30 ? 174  GLY A C   1 
ATOM   1258  O  O   . GLY A  1 173 ? 57.524  67.943  6.390   1.00 20.15 ? 174  GLY A O   1 
ATOM   1259  N  N   . SER A  1 174 ? 59.181  67.518  7.877   1.00 23.59 ? 175  SER A N   1 
ATOM   1260  C  CA  . SER A  1 174 ? 59.582  68.926  8.022   1.00 25.74 ? 175  SER A CA  1 
ATOM   1261  C  C   . SER A  1 174 ? 61.085  69.119  8.272   1.00 26.59 ? 175  SER A C   1 
ATOM   1262  O  O   . SER A  1 174 ? 61.780  68.225  8.781   1.00 22.51 ? 175  SER A O   1 
ATOM   1263  C  CB  . SER A  1 174 ? 58.793  69.607  9.147   1.00 25.47 ? 175  SER A CB  1 
ATOM   1264  O  OG  . SER A  1 174 ? 59.370  69.376  10.422  1.00 22.64 ? 175  SER A OG  1 
ATOM   1265  N  N   . ASP A  1 175 ? 61.588  70.299  7.904   1.00 27.45 ? 176  ASP A N   1 
ATOM   1266  C  CA  . ASP A  1 175 ? 62.998  70.631  8.148   1.00 27.62 ? 176  ASP A CA  1 
ATOM   1267  C  C   . ASP A  1 175 ? 63.287  70.722  9.633   1.00 26.26 ? 176  ASP A C   1 
ATOM   1268  O  O   . ASP A  1 175 ? 64.378  70.373  10.072  1.00 27.33 ? 176  ASP A O   1 
ATOM   1269  C  CB  . ASP A  1 175 ? 63.383  71.927  7.426   1.00 30.31 ? 176  ASP A CB  1 
ATOM   1270  C  CG  . ASP A  1 175 ? 63.264  71.805  5.911   1.00 34.70 ? 176  ASP A CG  1 
ATOM   1271  O  OD1 . ASP A  1 175 ? 63.221  70.656  5.402   1.00 30.64 ? 176  ASP A OD1 1 
ATOM   1272  O  OD2 . ASP A  1 175 ? 63.200  72.852  5.233   1.00 38.51 ? 176  ASP A OD2 1 
ATOM   1273  N  N   . GLU A  1 176 ? 62.298  71.146  10.420  1.00 26.85 ? 177  GLU A N   1 
ATOM   1274  C  CA  . GLU A  1 176 ? 62.462  71.204  11.866  1.00 27.83 ? 177  GLU A CA  1 
ATOM   1275  C  C   . GLU A  1 176 ? 62.724  69.816  12.440  1.00 26.82 ? 177  GLU A C   1 
ATOM   1276  O  O   . GLU A  1 176 ? 63.552  69.663  13.338  1.00 26.82 ? 177  GLU A O   1 
ATOM   1277  C  CB  . GLU A  1 176 ? 61.237  71.822  12.531  1.00 29.40 ? 177  GLU A CB  1 
ATOM   1278  C  CG  . GLU A  1 176 ? 61.292  71.717  14.051  1.00 36.22 ? 177  GLU A CG  1 
ATOM   1279  C  CD  . GLU A  1 176 ? 60.270  72.557  14.759  1.00 47.32 ? 177  GLU A CD  1 
ATOM   1280  O  OE1 . GLU A  1 176 ? 59.504  73.280  14.074  1.00 54.92 ? 177  GLU A OE1 1 
ATOM   1281  O  OE2 . GLU A  1 176 ? 60.227  72.493  16.011  1.00 50.31 ? 177  GLU A OE2 1 
ATOM   1282  N  N   . LYS A  1 177 ? 62.016  68.806  11.928  1.00 24.98 ? 178  LYS A N   1 
ATOM   1283  C  CA  . LYS A  1 177 ? 62.210  67.421  12.391  1.00 23.71 ? 178  LYS A CA  1 
ATOM   1284  C  C   . LYS A  1 177 ? 63.545  66.862  11.908  1.00 22.28 ? 178  LYS A C   1 
ATOM   1285  O  O   . LYS A  1 177 ? 64.216  66.133  12.640  1.00 23.05 ? 178  LYS A O   1 
ATOM   1286  C  CB  . LYS A  1 177 ? 61.046  66.527  11.948  1.00 23.15 ? 178  LYS A CB  1 
ATOM   1287  C  CG  . LYS A  1 177 ? 59.702  66.836  12.628  1.00 23.05 ? 178  LYS A CG  1 
ATOM   1288  C  CD  . LYS A  1 177 ? 58.539  66.154  11.936  1.00 23.20 ? 178  LYS A CD  1 
ATOM   1289  C  CE  . LYS A  1 177 ? 57.200  66.699  12.378  1.00 23.93 ? 178  LYS A CE  1 
ATOM   1290  N  NZ  . LYS A  1 177 ? 56.036  65.814  11.968  1.00 18.71 ? 178  LYS A NZ  1 
ATOM   1291  N  N   . VAL A  1 178 ? 63.939  67.226  10.691  1.00 22.55 ? 179  VAL A N   1 
ATOM   1292  C  CA  . VAL A  1 178 ? 65.245  66.858  10.156  1.00 24.13 ? 179  VAL A CA  1 
ATOM   1293  C  C   . VAL A  1 178 ? 66.321  67.296  11.149  1.00 25.77 ? 179  VAL A C   1 
ATOM   1294  O  O   . VAL A  1 178 ? 67.098  66.475  11.616  1.00 27.59 ? 179  VAL A O   1 
ATOM   1295  C  CB  . VAL A  1 178 ? 65.522  67.462  8.739   1.00 24.59 ? 179  VAL A CB  1 
ATOM   1296  C  CG1 . VAL A  1 178 ? 67.016  67.261  8.292   1.00 20.63 ? 179  VAL A CG1 1 
ATOM   1297  C  CG2 . VAL A  1 178 ? 64.572  66.861  7.683   1.00 22.54 ? 179  VAL A CG2 1 
ATOM   1298  N  N   . ALA A  1 179 ? 66.330  68.572  11.496  1.00 26.64 ? 180  ALA A N   1 
ATOM   1299  C  CA  . ALA A  1 179 ? 67.379  69.128  12.343  1.00 27.36 ? 180  ALA A CA  1 
ATOM   1300  C  C   . ALA A  1 179 ? 67.345  68.526  13.734  1.00 26.96 ? 180  ALA A C   1 
ATOM   1301  O  O   . ALA A  1 179 ? 68.387  68.289  14.335  1.00 27.69 ? 180  ALA A O   1 
ATOM   1302  C  CB  . ALA A  1 179 ? 67.247  70.663  12.423  1.00 27.89 ? 180  ALA A CB  1 
ATOM   1303  N  N   . TYR A  1 180 ? 66.149  68.278  14.257  1.00 27.99 ? 181  TYR A N   1 
ATOM   1304  C  CA  . TYR A  1 180 ? 66.045  67.667  15.572  1.00 27.15 ? 181  TYR A CA  1 
ATOM   1305  C  C   . TYR A  1 180 ? 66.636  66.274  15.567  1.00 27.34 ? 181  TYR A C   1 
ATOM   1306  O  O   . TYR A  1 180 ? 67.386  65.922  16.489  1.00 29.09 ? 181  TYR A O   1 
ATOM   1307  C  CB  . TYR A  1 180 ? 64.599  67.620  16.061  1.00 28.40 ? 181  TYR A CB  1 
ATOM   1308  C  CG  . TYR A  1 180 ? 64.433  66.846  17.355  1.00 28.79 ? 181  TYR A CG  1 
ATOM   1309  C  CD1 . TYR A  1 180 ? 64.694  67.437  18.590  1.00 27.73 ? 181  TYR A CD1 1 
ATOM   1310  C  CD2 . TYR A  1 180 ? 64.017  65.517  17.337  1.00 28.28 ? 181  TYR A CD2 1 
ATOM   1311  C  CE1 . TYR A  1 180 ? 64.538  66.727  19.777  1.00 31.31 ? 181  TYR A CE1 1 
ATOM   1312  C  CE2 . TYR A  1 180 ? 63.846  64.801  18.509  1.00 28.32 ? 181  TYR A CE2 1 
ATOM   1313  C  CZ  . TYR A  1 180 ? 64.108  65.401  19.732  1.00 31.12 ? 181  TYR A CZ  1 
ATOM   1314  O  OH  . TYR A  1 180 ? 63.934  64.666  20.891  1.00 28.36 ? 181  TYR A OH  1 
ATOM   1315  N  N   . LEU A  1 181 ? 66.333  65.476  14.534  1.00 26.24 ? 182  LEU A N   1 
ATOM   1316  C  CA  . LEU A  1 181 ? 66.848  64.103  14.514  1.00 24.97 ? 182  LEU A CA  1 
ATOM   1317  C  C   . LEU A  1 181 ? 68.356  64.057  14.227  1.00 24.15 ? 182  LEU A C   1 
ATOM   1318  O  O   . LEU A  1 181 ? 69.069  63.169  14.722  1.00 23.17 ? 182  LEU A O   1 
ATOM   1319  C  CB  . LEU A  1 181 ? 66.057  63.184  13.575  1.00 24.37 ? 182  LEU A CB  1 
ATOM   1320  C  CG  . LEU A  1 181 ? 64.588  62.883  13.931  1.00 26.82 ? 182  LEU A CG  1 
ATOM   1321  C  CD1 . LEU A  1 181 ? 63.953  61.973  12.862  1.00 18.36 ? 182  LEU A CD1 1 
ATOM   1322  C  CD2 . LEU A  1 181 ? 64.439  62.276  15.337  1.00 15.41 ? 182  LEU A CD2 1 
ATOM   1323  N  N   . GLN A  1 182 ? 68.856  64.987  13.432  1.00 25.62 ? 183  GLN A N   1 
ATOM   1324  C  CA  . GLN A  1 182 ? 70.319  65.061  13.228  1.00 28.89 ? 183  GLN A CA  1 
ATOM   1325  C  C   . GLN A  1 182 ? 71.018  65.383  14.537  1.00 29.57 ? 183  GLN A C   1 
ATOM   1326  O  O   . GLN A  1 182 ? 71.973  64.704  14.905  1.00 30.44 ? 183  GLN A O   1 
ATOM   1327  C  CB  . GLN A  1 182 ? 70.687  66.080  12.164  1.00 28.22 ? 183  GLN A CB  1 
ATOM   1328  C  CG  . GLN A  1 182 ? 70.300  65.617  10.766  1.00 27.48 ? 183  GLN A CG  1 
ATOM   1329  C  CD  . GLN A  1 182 ? 70.331  66.738  9.776   1.00 31.78 ? 183  GLN A CD  1 
ATOM   1330  O  OE1 . GLN A  1 182 ? 70.237  67.907  10.153  1.00 28.38 ? 183  GLN A OE1 1 
ATOM   1331  N  NE2 . GLN A  1 182 ? 70.460  66.399  8.498   1.00 24.56 ? 183  GLN A NE2 1 
ATOM   1332  N  N   . LYS A  1 183 ? 70.498  66.369  15.262  1.00 30.34 ? 184  LYS A N   1 
ATOM   1333  C  CA  . LYS A  1 183 ? 71.050  66.724  16.566  1.00 32.31 ? 184  LYS A CA  1 
ATOM   1334  C  C   . LYS A  1 183 ? 71.072  65.499  17.464  1.00 34.36 ? 184  LYS A C   1 
ATOM   1335  O  O   . LYS A  1 183 ? 72.038  65.271  18.202  1.00 35.81 ? 184  LYS A O   1 
ATOM   1336  C  CB  . LYS A  1 183 ? 70.236  67.852  17.224  1.00 34.47 ? 184  LYS A CB  1 
ATOM   1337  N  N   . LEU A  1 184 ? 70.012  64.697  17.387  1.00 34.32 ? 185  LEU A N   1 
ATOM   1338  C  CA  . LEU A  1 184 ? 69.947  63.436  18.119  1.00 34.04 ? 185  LEU A CA  1 
ATOM   1339  C  C   . LEU A  1 184 ? 71.058  62.462  17.752  1.00 32.98 ? 185  LEU A C   1 
ATOM   1340  O  O   . LEU A  1 184 ? 71.425  61.631  18.569  1.00 34.22 ? 185  LEU A O   1 
ATOM   1341  C  CB  . LEU A  1 184 ? 68.596  62.729  17.916  1.00 34.80 ? 185  LEU A CB  1 
ATOM   1342  C  CG  . LEU A  1 184 ? 67.481  63.094  18.872  1.00 34.94 ? 185  LEU A CG  1 
ATOM   1343  C  CD1 . LEU A  1 184 ? 66.338  62.117  18.687  1.00 35.61 ? 185  LEU A CD1 1 
ATOM   1344  C  CD2 . LEU A  1 184 ? 67.967  63.052  20.293  1.00 37.56 ? 185  LEU A CD2 1 
ATOM   1345  N  N   . GLY A  1 185 ? 71.564  62.533  16.528  1.00 32.04 ? 186  GLY A N   1 
ATOM   1346  C  CA  . GLY A  1 185 ? 72.646  61.640  16.104  1.00 31.54 ? 186  GLY A CA  1 
ATOM   1347  C  C   . GLY A  1 185 ? 72.278  60.601  15.059  1.00 31.25 ? 186  GLY A C   1 
ATOM   1348  O  O   . GLY A  1 185 ? 73.101  59.743  14.745  1.00 34.32 ? 186  GLY A O   1 
ATOM   1349  N  N   . PHE A  1 186 ? 71.070  60.658  14.489  1.00 29.70 ? 187  PHE A N   1 
ATOM   1350  C  CA  . PHE A  1 186 ? 70.722  59.696  13.436  1.00 28.89 ? 187  PHE A CA  1 
ATOM   1351  C  C   . PHE A  1 186 ? 71.679  59.951  12.285  1.00 28.91 ? 187  PHE A C   1 
ATOM   1352  O  O   . PHE A  1 186 ? 71.973  61.098  11.978  1.00 31.07 ? 187  PHE A O   1 
ATOM   1353  C  CB  . PHE A  1 186 ? 69.262  59.828  12.962  1.00 28.85 ? 187  PHE A CB  1 
ATOM   1354  C  CG  . PHE A  1 186 ? 68.217  59.420  13.996  1.00 27.17 ? 187  PHE A CG  1 
ATOM   1355  C  CD1 . PHE A  1 186 ? 68.564  59.078  15.297  1.00 28.00 ? 187  PHE A CD1 1 
ATOM   1356  C  CD2 . PHE A  1 186 ? 66.879  59.386  13.643  1.00 28.08 ? 187  PHE A CD2 1 
ATOM   1357  C  CE1 . PHE A  1 186 ? 67.614  58.714  16.205  1.00 26.63 ? 187  PHE A CE1 1 
ATOM   1358  C  CE2 . PHE A  1 186 ? 65.919  59.048  14.554  1.00 25.88 ? 187  PHE A CE2 1 
ATOM   1359  C  CZ  . PHE A  1 186 ? 66.282  58.709  15.835  1.00 26.88 ? 187  PHE A CZ  1 
ATOM   1360  N  N   . ASP A  1 187 ? 72.160  58.881  11.657  1.00 28.29 ? 188  ASP A N   1 
ATOM   1361  C  CA  . ASP A  1 187 ? 73.171  58.978  10.595  1.00 28.23 ? 188  ASP A CA  1 
ATOM   1362  C  C   . ASP A  1 187 ? 72.718  59.766  9.364   1.00 28.56 ? 188  ASP A C   1 
ATOM   1363  O  O   . ASP A  1 187 ? 73.489  60.562  8.820   1.00 30.28 ? 188  ASP A O   1 
ATOM   1364  C  CB  . ASP A  1 187 ? 73.598  57.590  10.141  1.00 27.86 ? 188  ASP A CB  1 
ATOM   1365  C  CG  . ASP A  1 187 ? 74.022  56.703  11.288  1.00 31.64 ? 188  ASP A CG  1 
ATOM   1366  O  OD1 . ASP A  1 187 ? 73.156  56.406  12.157  1.00 32.69 ? 188  ASP A OD1 1 
ATOM   1367  O  OD2 . ASP A  1 187 ? 75.209  56.294  11.310  1.00 33.63 ? 188  ASP A OD2 1 
ATOM   1368  N  N   . VAL A  1 188 ? 71.499  59.507  8.883   1.00 27.48 ? 189  VAL A N   1 
ATOM   1369  C  CA  . VAL A  1 188 ? 70.929  60.274  7.763   1.00 25.52 ? 189  VAL A CA  1 
ATOM   1370  C  C   . VAL A  1 188 ? 69.466  60.578  8.093   1.00 25.63 ? 189  VAL A C   1 
ATOM   1371  O  O   . VAL A  1 188 ? 68.741  59.709  8.575   1.00 22.44 ? 189  VAL A O   1 
ATOM   1372  C  CB  . VAL A  1 188 ? 70.964  59.506  6.432   1.00 25.42 ? 189  VAL A CB  1 
ATOM   1373  C  CG1 . VAL A  1 188 ? 70.609  60.451  5.239   1.00 23.34 ? 189  VAL A CG1 1 
ATOM   1374  C  CG2 . VAL A  1 188 ? 72.314  58.803  6.202   1.00 27.29 ? 189  VAL A CG2 1 
ATOM   1375  N  N   . VAL A  1 189 ? 69.053  61.811  7.831   1.00 24.43 ? 190  VAL A N   1 
ATOM   1376  C  CA  . VAL A  1 189 ? 67.684  62.248  8.021   1.00 22.35 ? 190  VAL A CA  1 
ATOM   1377  C  C   . VAL A  1 189 ? 67.349  63.187  6.886   1.00 24.09 ? 190  VAL A C   1 
ATOM   1378  O  O   . VAL A  1 189 ? 68.139  64.061  6.554   1.00 26.31 ? 190  VAL A O   1 
ATOM   1379  C  CB  . VAL A  1 189 ? 67.457  62.980  9.352   1.00 24.03 ? 190  VAL A CB  1 
ATOM   1380  C  CG1 . VAL A  1 189 ? 65.962  63.164  9.586   1.00 20.04 ? 190  VAL A CG1 1 
ATOM   1381  C  CG2 . VAL A  1 189 ? 68.101  62.237  10.531  1.00 23.08 ? 190  VAL A CG2 1 
ATOM   1382  N  N   . PHE A  1 190 ? 66.178  62.997  6.286   1.00 24.17 ? 191  PHE A N   1 
ATOM   1383  C  CA  . PHE A  1 190 ? 65.731  63.791  5.159   1.00 22.92 ? 191  PHE A CA  1 
ATOM   1384  C  C   . PHE A  1 190 ? 64.239  64.065  5.249   1.00 21.49 ? 191  PHE A C   1 
ATOM   1385  O  O   . PHE A  1 190 ? 63.521  63.391  5.972   1.00 22.15 ? 191  PHE A O   1 
ATOM   1386  C  CB  . PHE A  1 190 ? 66.069  63.098  3.844   1.00 23.64 ? 191  PHE A CB  1 
ATOM   1387  C  CG  . PHE A  1 190 ? 65.334  61.783  3.610   1.00 24.60 ? 191  PHE A CG  1 
ATOM   1388  C  CD1 . PHE A  1 190 ? 65.874  60.584  4.045   1.00 25.07 ? 191  PHE A CD1 1 
ATOM   1389  C  CD2 . PHE A  1 190 ? 64.123  61.756  2.929   1.00 22.40 ? 191  PHE A CD2 1 
ATOM   1390  C  CE1 . PHE A  1 190 ? 65.226  59.381  3.806   1.00 22.43 ? 191  PHE A CE1 1 
ATOM   1391  C  CE2 . PHE A  1 190 ? 63.460  60.559  2.687   1.00 26.08 ? 191  PHE A CE2 1 
ATOM   1392  C  CZ  . PHE A  1 190 ? 64.013  59.367  3.127   1.00 25.22 ? 191  PHE A CZ  1 
ATOM   1393  N  N   . ASN A  1 191 ? 63.792  65.072  4.513   1.00 20.64 ? 192  ASN A N   1 
ATOM   1394  C  CA  . ASN A  1 191 ? 62.420  65.497  4.498   1.00 20.55 ? 192  ASN A CA  1 
ATOM   1395  C  C   . ASN A  1 191 ? 61.829  64.894  3.244   1.00 22.74 ? 192  ASN A C   1 
ATOM   1396  O  O   . ASN A  1 191 ? 62.152  65.314  2.137   1.00 19.93 ? 192  ASN A O   1 
ATOM   1397  C  CB  . ASN A  1 191 ? 62.352  67.016  4.449   1.00 22.68 ? 192  ASN A CB  1 
ATOM   1398  C  CG  . ASN A  1 191 ? 60.927  67.565  4.448   1.00 26.35 ? 192  ASN A CG  1 
ATOM   1399  O  OD1 . ASN A  1 191 ? 59.956  66.910  4.008   1.00 24.98 ? 192  ASN A OD1 1 
ATOM   1400  N  ND2 . ASN A  1 191 ? 60.797  68.811  4.930   1.00 24.01 ? 192  ASN A ND2 1 
ATOM   1401  N  N   . TYR A  1 192 ? 60.950  63.911  3.417   1.00 22.53 ? 193  TYR A N   1 
ATOM   1402  C  CA  . TYR A  1 192 ? 60.360  63.217  2.284   1.00 23.24 ? 193  TYR A CA  1 
ATOM   1403  C  C   . TYR A  1 192 ? 59.425  64.093  1.440   1.00 24.10 ? 193  TYR A C   1 
ATOM   1404  O  O   . TYR A  1 192 ? 59.051  63.714  0.331   1.00 25.51 ? 193  TYR A O   1 
ATOM   1405  C  CB  . TYR A  1 192 ? 59.635  61.935  2.754   1.00 21.46 ? 193  TYR A CB  1 
ATOM   1406  C  CG  . TYR A  1 192 ? 58.350  62.189  3.501   1.00 19.12 ? 193  TYR A CG  1 
ATOM   1407  C  CD1 . TYR A  1 192 ? 57.150  62.393  2.812   1.00 21.86 ? 193  TYR A CD1 1 
ATOM   1408  C  CD2 . TYR A  1 192 ? 58.325  62.221  4.893   1.00 13.38 ? 193  TYR A CD2 1 
ATOM   1409  C  CE1 . TYR A  1 192 ? 55.962  62.641  3.493   1.00 21.27 ? 193  TYR A CE1 1 
ATOM   1410  C  CE2 . TYR A  1 192 ? 57.127  62.474  5.588   1.00 16.04 ? 193  TYR A CE2 1 
ATOM   1411  C  CZ  . TYR A  1 192 ? 55.962  62.683  4.874   1.00 18.10 ? 193  TYR A CZ  1 
ATOM   1412  O  OH  . TYR A  1 192 ? 54.772  62.930  5.521   1.00 22.22 ? 193  TYR A OH  1 
ATOM   1413  N  N   . LYS A  1 193 ? 59.014  65.237  1.956   1.00 25.72 ? 194  LYS A N   1 
ATOM   1414  C  CA  . LYS A  1 193 ? 58.140  66.136  1.186   1.00 27.58 ? 194  LYS A CA  1 
ATOM   1415  C  C   . LYS A  1 193 ? 58.906  67.034  0.217   1.00 28.90 ? 194  LYS A C   1 
ATOM   1416  O  O   . LYS A  1 193 ? 58.300  67.587  -0.705  1.00 29.54 ? 194  LYS A O   1 
ATOM   1417  C  CB  . LYS A  1 193 ? 57.298  67.014  2.112   1.00 28.45 ? 194  LYS A CB  1 
ATOM   1418  C  CG  . LYS A  1 193 ? 56.384  66.239  3.028   1.00 31.16 ? 194  LYS A CG  1 
ATOM   1419  C  CD  . LYS A  1 193 ? 55.478  67.155  3.829   1.00 31.22 ? 194  LYS A CD  1 
ATOM   1420  C  CE  . LYS A  1 193 ? 54.516  66.318  4.665   1.00 32.57 ? 194  LYS A CE  1 
ATOM   1421  N  NZ  . LYS A  1 193 ? 53.830  67.079  5.734   1.00 28.69 ? 194  LYS A NZ  1 
ATOM   1422  N  N   . THR A  1 194 ? 60.216  67.179  0.410   1.00 28.18 ? 195  THR A N   1 
ATOM   1423  C  CA  . THR A  1 194 ? 60.993  68.128  -0.382  1.00 31.18 ? 195  THR A CA  1 
ATOM   1424  C  C   . THR A  1 194 ? 62.149  67.520  -1.212  1.00 34.71 ? 195  THR A C   1 
ATOM   1425  O  O   . THR A  1 194 ? 62.674  68.179  -2.121  1.00 34.36 ? 195  THR A O   1 
ATOM   1426  C  CB  . THR A  1 194 ? 61.538  69.302  0.490   1.00 29.75 ? 195  THR A CB  1 
ATOM   1427  O  OG1 . THR A  1 194 ? 62.481  68.815  1.444   1.00 30.35 ? 195  THR A OG1 1 
ATOM   1428  C  CG2 . THR A  1 194 ? 60.402  70.013  1.237   1.00 28.50 ? 195  THR A CG2 1 
ATOM   1429  N  N   . VAL A  1 195 ? 62.549  66.280  -0.949  1.00 35.13 ? 196  VAL A N   1 
ATOM   1430  C  CA  . VAL A  1 195 ? 63.649  65.723  -1.737  1.00 34.17 ? 196  VAL A CA  1 
ATOM   1431  C  C   . VAL A  1 195 ? 63.174  65.581  -3.179  1.00 34.91 ? 196  VAL A C   1 
ATOM   1432  O  O   . VAL A  1 195 ? 61.986  65.423  -3.430  1.00 33.39 ? 196  VAL A O   1 
ATOM   1433  C  CB  . VAL A  1 195 ? 64.169  64.397  -1.156  1.00 35.32 ? 196  VAL A CB  1 
ATOM   1434  C  CG1 . VAL A  1 195 ? 64.811  64.660  0.219   1.00 33.76 ? 196  VAL A CG1 1 
ATOM   1435  C  CG2 . VAL A  1 195 ? 63.054  63.356  -1.055  1.00 27.42 ? 196  VAL A CG2 1 
ATOM   1436  N  N   . GLU A  1 196 ? 64.091  65.669  -4.133  1.00 37.07 ? 197  GLU A N   1 
ATOM   1437  C  CA  . GLU A  1 196 ? 63.688  65.560  -5.542  1.00 37.90 ? 197  GLU A CA  1 
ATOM   1438  C  C   . GLU A  1 196 ? 63.190  64.161  -5.885  1.00 36.55 ? 197  GLU A C   1 
ATOM   1439  O  O   . GLU A  1 196 ? 62.184  64.020  -6.574  1.00 36.36 ? 197  GLU A O   1 
ATOM   1440  C  CB  . GLU A  1 196 ? 64.830  65.940  -6.488  1.00 39.53 ? 197  GLU A CB  1 
ATOM   1441  C  CG  . GLU A  1 196 ? 64.549  65.534  -7.950  1.00 45.39 ? 197  GLU A CG  1 
ATOM   1442  C  CD  . GLU A  1 196 ? 65.467  66.207  -8.964  1.00 52.55 ? 197  GLU A CD  1 
ATOM   1443  O  OE1 . GLU A  1 196 ? 66.393  66.958  -8.555  1.00 48.47 ? 197  GLU A OE1 1 
ATOM   1444  O  OE2 . GLU A  1 196 ? 65.244  65.979  -10.180 1.00 53.31 ? 197  GLU A OE2 1 
ATOM   1445  N  N   . SER A  1 197 ? 63.912  63.132  -5.433  1.00 34.98 ? 198  SER A N   1 
ATOM   1446  C  CA  . SER A  1 197 ? 63.485  61.751  -5.653  1.00 32.89 ? 198  SER A CA  1 
ATOM   1447  C  C   . SER A  1 197 ? 63.704  60.929  -4.394  1.00 31.12 ? 198  SER A C   1 
ATOM   1448  O  O   . SER A  1 197 ? 64.818  60.866  -3.854  1.00 28.09 ? 198  SER A O   1 
ATOM   1449  C  CB  . SER A  1 197 ? 64.233  61.121  -6.821  1.00 33.18 ? 198  SER A CB  1 
ATOM   1450  O  OG  . SER A  1 197 ? 63.895  59.742  -6.974  1.00 33.55 ? 198  SER A OG  1 
ATOM   1451  N  N   . LEU A  1 198 ? 62.625  60.308  -3.923  1.00 29.38 ? 199  LEU A N   1 
ATOM   1452  C  CA  . LEU A  1 198 ? 62.705  59.477  -2.742  1.00 28.07 ? 199  LEU A CA  1 
ATOM   1453  C  C   . LEU A  1 198 ? 63.695  58.373  -3.034  1.00 25.99 ? 199  LEU A C   1 
ATOM   1454  O  O   . LEU A  1 198 ? 64.587  58.111  -2.240  1.00 24.29 ? 199  LEU A O   1 
ATOM   1455  C  CB  . LEU A  1 198 ? 61.329  58.901  -2.382  1.00 27.23 ? 199  LEU A CB  1 
ATOM   1456  C  CG  . LEU A  1 198 ? 61.267  57.976  -1.174  1.00 21.38 ? 199  LEU A CG  1 
ATOM   1457  C  CD1 . LEU A  1 198 ? 61.954  58.629  -0.008  1.00 18.75 ? 199  LEU A CD1 1 
ATOM   1458  C  CD2 . LEU A  1 198 ? 59.810  57.644  -0.835  1.00 20.54 ? 199  LEU A CD2 1 
ATOM   1459  N  N   . GLU A  1 199 ? 63.564  57.765  -4.203  1.00 27.28 ? 200  GLU A N   1 
ATOM   1460  C  CA  . GLU A  1 199 ? 64.410  56.626  -4.582  1.00 29.24 ? 200  GLU A CA  1 
ATOM   1461  C  C   . GLU A  1 199 ? 65.875  57.000  -4.527  1.00 28.89 ? 200  GLU A C   1 
ATOM   1462  O  O   . GLU A  1 199 ? 66.692  56.264  -3.975  1.00 26.33 ? 200  GLU A O   1 
ATOM   1463  C  CB  . GLU A  1 199 ? 64.024  56.135  -5.992  1.00 31.06 ? 200  GLU A CB  1 
ATOM   1464  C  CG  . GLU A  1 199 ? 64.821  54.950  -6.510  1.00 36.54 ? 200  GLU A CG  1 
ATOM   1465  C  CD  . GLU A  1 199 ? 64.403  54.488  -7.914  1.00 43.99 ? 200  GLU A CD  1 
ATOM   1466  O  OE1 . GLU A  1 199 ? 63.283  54.793  -8.381  1.00 48.84 ? 200  GLU A OE1 1 
ATOM   1467  O  OE2 . GLU A  1 199 ? 65.212  53.805  -8.556  1.00 46.69 ? 200  GLU A OE2 1 
ATOM   1468  N  N   . GLU A  1 200 ? 66.211  58.151  -5.111  1.00 30.31 ? 201  GLU A N   1 
ATOM   1469  C  CA  . GLU A  1 200 ? 67.610  58.580  -5.187  1.00 30.65 ? 201  GLU A CA  1 
ATOM   1470  C  C   . GLU A  1 200 ? 68.112  58.938  -3.818  1.00 28.32 ? 201  GLU A C   1 
ATOM   1471  O  O   . GLU A  1 200 ? 69.235  58.623  -3.482  1.00 28.60 ? 201  GLU A O   1 
ATOM   1472  C  CB  . GLU A  1 200 ? 67.784  59.770  -6.144  1.00 33.48 ? 201  GLU A CB  1 
ATOM   1473  C  CG  . GLU A  1 200 ? 67.666  59.390  -7.634  1.00 43.98 ? 201  GLU A CG  1 
ATOM   1474  C  CD  . GLU A  1 200 ? 67.748  60.592  -8.590  1.00 53.85 ? 201  GLU A CD  1 
ATOM   1475  O  OE1 . GLU A  1 200 ? 68.346  61.630  -8.215  1.00 60.44 ? 201  GLU A OE1 1 
ATOM   1476  O  OE2 . GLU A  1 200 ? 67.213  60.486  -9.722  1.00 59.93 ? 201  GLU A OE2 1 
ATOM   1477  N  N   . THR A  1 201 ? 67.271  59.583  -3.015  1.00 27.84 ? 202  THR A N   1 
ATOM   1478  C  CA  . THR A  1 201 ? 67.678  59.954  -1.673  1.00 27.15 ? 202  THR A CA  1 
ATOM   1479  C  C   . THR A  1 201 ? 67.966  58.734  -0.845  1.00 26.66 ? 202  THR A C   1 
ATOM   1480  O  O   . THR A  1 201 ? 68.976  58.695  -0.111  1.00 23.85 ? 202  THR A O   1 
ATOM   1481  C  CB  . THR A  1 201 ? 66.613  60.739  -0.948  1.00 27.51 ? 202  THR A CB  1 
ATOM   1482  O  OG1 . THR A  1 201 ? 66.399  61.970  -1.625  1.00 25.94 ? 202  THR A OG1 1 
ATOM   1483  C  CG2 . THR A  1 201 ? 67.042  60.994  0.495   1.00 23.95 ? 202  THR A CG2 1 
ATOM   1484  N  N   . LEU A  1 202 ? 67.077  57.738  -0.945  1.00 26.39 ? 203  LEU A N   1 
ATOM   1485  C  CA  . LEU A  1 202 ? 67.276  56.478  -0.207  1.00 24.88 ? 203  LEU A CA  1 
ATOM   1486  C  C   . LEU A  1 202 ? 68.536  55.765  -0.660  1.00 24.24 ? 203  LEU A C   1 
ATOM   1487  O  O   . LEU A  1 202 ? 69.233  55.155  0.150   1.00 23.61 ? 203  LEU A O   1 
ATOM   1488  C  CB  . LEU A  1 202 ? 66.080  55.555  -0.357  1.00 23.36 ? 203  LEU A CB  1 
ATOM   1489  C  CG  . LEU A  1 202 ? 64.853  55.997  0.438   1.00 24.61 ? 203  LEU A CG  1 
ATOM   1490  C  CD1 . LEU A  1 202 ? 63.613  55.289  -0.111  1.00 21.04 ? 203  LEU A CD1 1 
ATOM   1491  C  CD2 . LEU A  1 202 ? 65.056  55.757  1.949   1.00 20.08 ? 203  LEU A CD2 1 
ATOM   1492  N  N   . LYS A  1 203 ? 68.823  55.841  -1.956  1.00 26.69 ? 204  LYS A N   1 
ATOM   1493  C  CA  . LYS A  1 203 ? 70.039  55.242  -2.505  1.00 31.70 ? 204  LYS A CA  1 
ATOM   1494  C  C   . LYS A  1 203 ? 71.286  55.961  -1.977  1.00 32.47 ? 204  LYS A C   1 
ATOM   1495  O  O   . LYS A  1 203 ? 72.237  55.315  -1.557  1.00 34.20 ? 204  LYS A O   1 
ATOM   1496  C  CB  . LYS A  1 203 ? 69.987  55.234  -4.029  1.00 32.88 ? 204  LYS A CB  1 
ATOM   1497  C  CG  . LYS A  1 203 ? 71.179  54.582  -4.720  1.00 44.09 ? 204  LYS A CG  1 
ATOM   1498  C  CD  . LYS A  1 203 ? 71.236  53.068  -4.508  1.00 51.62 ? 204  LYS A CD  1 
ATOM   1499  C  CE  . LYS A  1 203 ? 72.337  52.433  -5.365  1.00 54.85 ? 204  LYS A CE  1 
ATOM   1500  N  NZ  . LYS A  1 203 ? 72.752  51.096  -4.847  1.00 56.51 ? 204  LYS A NZ  1 
ATOM   1501  N  N   . LYS A  1 204 ? 71.275  57.291  -1.970  1.00 34.35 ? 205  LYS A N   1 
ATOM   1502  C  CA  . LYS A  1 204 ? 72.424  58.057  -1.439  1.00 35.22 ? 205  LYS A CA  1 
ATOM   1503  C  C   . LYS A  1 204 ? 72.612  57.814  0.052   1.00 33.19 ? 205  LYS A C   1 
ATOM   1504  O  O   . LYS A  1 204 ? 73.750  57.722  0.547   1.00 34.54 ? 205  LYS A O   1 
ATOM   1505  C  CB  . LYS A  1 204 ? 72.266  59.572  -1.710  1.00 37.18 ? 205  LYS A CB  1 
ATOM   1506  C  CG  . LYS A  1 204 ? 72.863  60.039  -3.042  1.00 39.91 ? 205  LYS A CG  1 
ATOM   1507  N  N   . ALA A  1 205 ? 71.500  57.688  0.769   1.00 29.60 ? 206  ALA A N   1 
ATOM   1508  C  CA  . ALA A  1 205 ? 71.554  57.450  2.196   1.00 28.54 ? 206  ALA A CA  1 
ATOM   1509  C  C   . ALA A  1 205 ? 72.207  56.107  2.539   1.00 27.93 ? 206  ALA A C   1 
ATOM   1510  O  O   . ALA A  1 205 ? 72.862  55.980  3.558   1.00 27.83 ? 206  ALA A O   1 
ATOM   1511  C  CB  . ALA A  1 205 ? 70.141  57.540  2.803   1.00 26.93 ? 206  ALA A CB  1 
ATOM   1512  N  N   . SER A  1 206 ? 71.965  55.093  1.710   1.00 29.92 ? 207  SER A N   1 
ATOM   1513  C  CA  . SER A  1 206 ? 72.558  53.777  1.899   1.00 30.41 ? 207  SER A CA  1 
ATOM   1514  C  C   . SER A  1 206 ? 72.705  53.099  0.550   1.00 32.42 ? 207  SER A C   1 
ATOM   1515  O  O   . SER A  1 206 ? 71.787  52.424  0.089   1.00 32.34 ? 207  SER A O   1 
ATOM   1516  C  CB  . SER A  1 206 ? 71.723  52.908  2.843   1.00 30.87 ? 207  SER A CB  1 
ATOM   1517  O  OG  . SER A  1 206 ? 72.496  51.812  3.335   1.00 28.75 ? 207  SER A OG  1 
ATOM   1518  N  N   . PRO A  1 207 ? 73.864  53.298  -0.103  1.00 33.65 ? 208  PRO A N   1 
ATOM   1519  C  CA  . PRO A  1 207 ? 74.135  52.637  -1.379  1.00 32.99 ? 208  PRO A CA  1 
ATOM   1520  C  C   . PRO A  1 207 ? 73.989  51.110  -1.355  1.00 32.16 ? 208  PRO A C   1 
ATOM   1521  O  O   . PRO A  1 207 ? 73.544  50.535  -2.346  1.00 32.37 ? 208  PRO A O   1 
ATOM   1522  C  CB  . PRO A  1 207 ? 75.587  53.037  -1.687  1.00 32.52 ? 208  PRO A CB  1 
ATOM   1523  C  CG  . PRO A  1 207 ? 75.801  54.319  -0.977  1.00 34.08 ? 208  PRO A CG  1 
ATOM   1524  C  CD  . PRO A  1 207 ? 74.929  54.254  0.265   1.00 35.41 ? 208  PRO A CD  1 
ATOM   1525  N  N   . ASP A  1 208 ? 74.363  50.475  -0.246  1.00 31.95 ? 209  ASP A N   1 
ATOM   1526  C  CA  . ASP A  1 208 ? 74.280  49.014  -0.100  1.00 33.70 ? 209  ASP A CA  1 
ATOM   1527  C  C   . ASP A  1 208 ? 72.854  48.488  0.217   1.00 33.05 ? 209  ASP A C   1 
ATOM   1528  O  O   . ASP A  1 208 ? 72.638  47.268  0.278   1.00 31.13 ? 209  ASP A O   1 
ATOM   1529  C  CB  . ASP A  1 208 ? 75.227  48.547  1.026   1.00 36.55 ? 209  ASP A CB  1 
ATOM   1530  C  CG  . ASP A  1 208 ? 76.716  48.623  0.639   1.00 46.83 ? 209  ASP A CG  1 
ATOM   1531  O  OD1 . ASP A  1 208 ? 77.064  48.329  -0.520  1.00 50.49 ? 209  ASP A OD1 1 
ATOM   1532  O  OD2 . ASP A  1 208 ? 77.548  48.960  1.518   1.00 58.85 ? 209  ASP A OD2 1 
ATOM   1533  N  N   . GLY A  1 209 ? 71.908  49.397  0.474   1.00 30.61 ? 210  GLY A N   1 
ATOM   1534  C  CA  . GLY A  1 209 ? 70.512  49.029  0.761   1.00 28.28 ? 210  GLY A CA  1 
ATOM   1535  C  C   . GLY A  1 209 ? 70.227  48.897  2.249   1.00 27.09 ? 210  GLY A C   1 
ATOM   1536  O  O   . GLY A  1 209 ? 71.035  49.297  3.101   1.00 26.61 ? 210  GLY A O   1 
ATOM   1537  N  N   . TYR A  1 210 ? 69.072  48.314  2.565   1.00 25.45 ? 211  TYR A N   1 
ATOM   1538  C  CA  . TYR A  1 210 ? 68.577  48.273  3.940   1.00 24.24 ? 211  TYR A CA  1 
ATOM   1539  C  C   . TYR A  1 210 ? 68.349  46.858  4.468   1.00 23.28 ? 211  TYR A C   1 
ATOM   1540  O  O   . TYR A  1 210 ? 67.759  46.033  3.790   1.00 24.17 ? 211  TYR A O   1 
ATOM   1541  C  CB  . TYR A  1 210 ? 67.296  49.091  4.026   1.00 24.12 ? 211  TYR A CB  1 
ATOM   1542  C  CG  . TYR A  1 210 ? 67.556  50.532  3.679   1.00 24.60 ? 211  TYR A CG  1 
ATOM   1543  C  CD1 . TYR A  1 210 ? 67.501  50.970  2.362   1.00 22.93 ? 211  TYR A CD1 1 
ATOM   1544  C  CD2 . TYR A  1 210 ? 67.906  51.445  4.662   1.00 24.37 ? 211  TYR A CD2 1 
ATOM   1545  C  CE1 . TYR A  1 210 ? 67.779  52.273  2.031   1.00 24.76 ? 211  TYR A CE1 1 
ATOM   1546  C  CE2 . TYR A  1 210 ? 68.166  52.766  4.341   1.00 23.61 ? 211  TYR A CE2 1 
ATOM   1547  C  CZ  . TYR A  1 210 ? 68.097  53.176  3.031   1.00 23.99 ? 211  TYR A CZ  1 
ATOM   1548  O  OH  . TYR A  1 210 ? 68.366  54.484  2.713   1.00 24.61 ? 211  TYR A OH  1 
ATOM   1549  N  N   . ASP A  1 211 ? 68.842  46.594  5.677   1.00 22.77 ? 212  ASP A N   1 
ATOM   1550  C  CA  . ASP A  1 211 ? 68.628  45.334  6.356   1.00 21.85 ? 212  ASP A CA  1 
ATOM   1551  C  C   . ASP A  1 211 ? 67.232  45.267  6.953   1.00 22.33 ? 212  ASP A C   1 
ATOM   1552  O  O   . ASP A  1 211 ? 66.592  44.209  6.898   1.00 21.74 ? 212  ASP A O   1 
ATOM   1553  C  CB  . ASP A  1 211 ? 69.648  45.143  7.480   1.00 23.78 ? 212  ASP A CB  1 
ATOM   1554  C  CG  . ASP A  1 211 ? 71.092  45.143  6.973   1.00 26.38 ? 212  ASP A CG  1 
ATOM   1555  O  OD1 . ASP A  1 211 ? 71.550  44.115  6.467   1.00 23.90 ? 212  ASP A OD1 1 
ATOM   1556  O  OD2 . ASP A  1 211 ? 71.757  46.186  7.070   1.00 30.44 ? 212  ASP A OD2 1 
ATOM   1557  N  N   . CYS A  1 212 ? 66.783  46.383  7.538   1.00 21.71 ? 213  CYS A N   1 
ATOM   1558  C  CA  . CYS A  1 212 ? 65.533  46.456  8.260   1.00 19.93 ? 213  CYS A CA  1 
ATOM   1559  C  C   . CYS A  1 212 ? 64.732  47.726  7.918   1.00 21.16 ? 213  CYS A C   1 
ATOM   1560  O  O   . CYS A  1 212 ? 65.290  48.821  7.704   1.00 18.06 ? 213  CYS A O   1 
ATOM   1561  C  CB  . CYS A  1 212 ? 65.799  46.446  9.742   1.00 21.05 ? 213  CYS A CB  1 
ATOM   1562  S  SG  . CYS A  1 212 ? 66.695  45.027  10.345  1.00 28.73 ? 213  CYS A SG  1 
ATOM   1563  N  N   . TYR A  1 213 ? 63.414  47.571  7.902   1.00 19.59 ? 214  TYR A N   1 
ATOM   1564  C  CA  . TYR A  1 213 ? 62.496  48.665  7.619   1.00 18.25 ? 214  TYR A CA  1 
ATOM   1565  C  C   . TYR A  1 213 ? 61.424  48.606  8.689   1.00 18.13 ? 214  TYR A C   1 
ATOM   1566  O  O   . TYR A  1 213 ? 60.675  47.633  8.762   1.00 16.06 ? 214  TYR A O   1 
ATOM   1567  C  CB  . TYR A  1 213 ? 61.916  48.502  6.221   1.00 15.82 ? 214  TYR A CB  1 
ATOM   1568  C  CG  . TYR A  1 213 ? 60.883  49.536  5.775   1.00 21.23 ? 214  TYR A CG  1 
ATOM   1569  C  CD1 . TYR A  1 213 ? 60.923  50.870  6.233   1.00 18.28 ? 214  TYR A CD1 1 
ATOM   1570  C  CD2 . TYR A  1 213 ? 59.926  49.210  4.816   1.00 17.56 ? 214  TYR A CD2 1 
ATOM   1571  C  CE1 . TYR A  1 213 ? 60.016  51.810  5.809   1.00 16.09 ? 214  TYR A CE1 1 
ATOM   1572  C  CE2 . TYR A  1 213 ? 59.019  50.174  4.361   1.00 17.86 ? 214  TYR A CE2 1 
ATOM   1573  C  CZ  . TYR A  1 213 ? 59.068  51.459  4.879   1.00 17.41 ? 214  TYR A CZ  1 
ATOM   1574  O  OH  . TYR A  1 213 ? 58.197  52.403  4.442   1.00 17.31 ? 214  TYR A OH  1 
ATOM   1575  N  N   . PHE A  1 214 ? 61.438  49.606  9.564   1.00 15.60 ? 215  PHE A N   1 
ATOM   1576  C  CA  . PHE A  1 214 ? 60.432  49.803  10.556  1.00 16.19 ? 215  PHE A CA  1 
ATOM   1577  C  C   . PHE A  1 214 ? 59.422  50.763  9.920   1.00 16.80 ? 215  PHE A C   1 
ATOM   1578  O  O   . PHE A  1 214 ? 59.634  51.987  9.885   1.00 16.50 ? 215  PHE A O   1 
ATOM   1579  C  CB  . PHE A  1 214 ? 61.029  50.384  11.859  1.00 13.44 ? 215  PHE A CB  1 
ATOM   1580  C  CG  . PHE A  1 214 ? 60.079  50.335  13.034  1.00 18.03 ? 215  PHE A CG  1 
ATOM   1581  C  CD1 . PHE A  1 214 ? 58.956  51.155  13.076  1.00 15.95 ? 215  PHE A CD1 1 
ATOM   1582  C  CD2 . PHE A  1 214 ? 60.264  49.427  14.051  1.00 17.20 ? 215  PHE A CD2 1 
ATOM   1583  C  CE1 . PHE A  1 214 ? 58.072  51.091  14.115  1.00 18.19 ? 215  PHE A CE1 1 
ATOM   1584  C  CE2 . PHE A  1 214 ? 59.377  49.360  15.116  1.00 18.21 ? 215  PHE A CE2 1 
ATOM   1585  C  CZ  . PHE A  1 214 ? 58.268  50.203  15.148  1.00 16.33 ? 215  PHE A CZ  1 
ATOM   1586  N  N   . ASP A  1 215 ? 58.327  50.202  9.410   1.00 15.82 ? 216  ASP A N   1 
ATOM   1587  C  CA  . ASP A  1 215 ? 57.408  50.956  8.581   1.00 15.45 ? 216  ASP A CA  1 
ATOM   1588  C  C   . ASP A  1 215 ? 56.203  51.405  9.410   1.00 16.80 ? 216  ASP A C   1 
ATOM   1589  O  O   . ASP A  1 215 ? 55.440  50.584  9.921   1.00 14.70 ? 216  ASP A O   1 
ATOM   1590  C  CB  . ASP A  1 215 ? 56.981  50.102  7.389   1.00 14.64 ? 216  ASP A CB  1 
ATOM   1591  C  CG  . ASP A  1 215 ? 56.044  50.814  6.444   1.00 19.53 ? 216  ASP A CG  1 
ATOM   1592  O  OD1 . ASP A  1 215 ? 55.926  52.077  6.479   1.00 17.62 ? 216  ASP A OD1 1 
ATOM   1593  O  OD2 . ASP A  1 215 ? 55.398  50.075  5.663   1.00 20.02 ? 216  ASP A OD2 1 
ATOM   1594  N  N   . ASN A  1 216 ? 56.075  52.726  9.526   1.00 16.86 ? 217  ASN A N   1 
ATOM   1595  C  CA  . ASN A  1 216 ? 54.934  53.417  10.120  1.00 16.25 ? 217  ASN A CA  1 
ATOM   1596  C  C   . ASN A  1 216 ? 53.994  53.984  9.092   1.00 16.27 ? 217  ASN A C   1 
ATOM   1597  O  O   . ASN A  1 216 ? 52.930  54.511  9.466   1.00 17.69 ? 217  ASN A O   1 
ATOM   1598  C  CB  . ASN A  1 216 ? 55.440  54.603  10.969  1.00 16.85 ? 217  ASN A CB  1 
ATOM   1599  C  CG  . ASN A  1 216 ? 56.136  54.147  12.242  1.00 17.57 ? 217  ASN A CG  1 
ATOM   1600  O  OD1 . ASN A  1 216 ? 55.623  53.290  12.952  1.00 16.41 ? 217  ASN A OD1 1 
ATOM   1601  N  ND2 . ASN A  1 216 ? 57.333  54.695  12.511  1.00 17.52 ? 217  ASN A ND2 1 
ATOM   1602  N  N   . VAL A  1 217 ? 54.367  53.922  7.816   1.00 15.30 ? 218  VAL A N   1 
ATOM   1603  C  CA  . VAL A  1 217 ? 53.682  54.753  6.804   1.00 17.16 ? 218  VAL A CA  1 
ATOM   1604  C  C   . VAL A  1 217 ? 52.912  54.024  5.709   1.00 16.35 ? 218  VAL A C   1 
ATOM   1605  O  O   . VAL A  1 217 ? 51.792  54.423  5.383   1.00 14.83 ? 218  VAL A O   1 
ATOM   1606  C  CB  . VAL A  1 217 ? 54.669  55.732  6.145   1.00 16.81 ? 218  VAL A CB  1 
ATOM   1607  C  CG1 . VAL A  1 217 ? 53.999  56.460  4.939   1.00 13.88 ? 218  VAL A CG1 1 
ATOM   1608  C  CG2 . VAL A  1 217 ? 55.163  56.722  7.209   1.00 16.13 ? 218  VAL A CG2 1 
ATOM   1609  N  N   . GLY A  1 218 ? 53.521  52.986  5.144   1.00 17.38 ? 219  GLY A N   1 
ATOM   1610  C  CA  . GLY A  1 218 ? 52.901  52.182  4.097   1.00 17.10 ? 219  GLY A CA  1 
ATOM   1611  C  C   . GLY A  1 218 ? 52.733  52.934  2.792   1.00 18.80 ? 219  GLY A C   1 
ATOM   1612  O  O   . GLY A  1 218 ? 53.406  53.942  2.562   1.00 16.61 ? 219  GLY A O   1 
ATOM   1613  N  N   . GLY A  1 219 ? 51.840  52.428  1.930   1.00 17.89 ? 220  GLY A N   1 
ATOM   1614  C  CA  . GLY A  1 219 ? 51.557  53.066  0.644   1.00 17.92 ? 220  GLY A CA  1 
ATOM   1615  C  C   . GLY A  1 219 ? 52.793  53.169  -0.237  1.00 19.10 ? 220  GLY A C   1 
ATOM   1616  O  O   . GLY A  1 219 ? 53.697  52.349  -0.126  1.00 21.28 ? 220  GLY A O   1 
ATOM   1617  N  N   . GLU A  1 220 ? 52.819  54.197  -1.086  1.00 19.62 ? 221  GLU A N   1 
ATOM   1618  C  CA  . GLU A  1 220 ? 53.867  54.451  -2.085  1.00 22.68 ? 221  GLU A CA  1 
ATOM   1619  C  C   . GLU A  1 220 ? 55.249  54.632  -1.498  1.00 19.56 ? 221  GLU A C   1 
ATOM   1620  O  O   . GLU A  1 220 ? 56.237  54.237  -2.111  1.00 20.21 ? 221  GLU A O   1 
ATOM   1621  C  CB  . GLU A  1 220 ? 53.551  55.734  -2.899  1.00 24.02 ? 221  GLU A CB  1 
ATOM   1622  C  CG  . GLU A  1 220 ? 52.310  55.660  -3.779  1.00 31.10 ? 221  GLU A CG  1 
ATOM   1623  C  CD  . GLU A  1 220 ? 52.471  54.791  -5.040  1.00 39.07 ? 221  GLU A CD  1 
ATOM   1624  O  OE1 . GLU A  1 220 ? 53.470  54.039  -5.199  1.00 42.22 ? 221  GLU A OE1 1 
ATOM   1625  O  OE2 . GLU A  1 220 ? 51.567  54.870  -5.892  1.00 41.72 ? 221  GLU A OE2 1 
ATOM   1626  N  N   . PHE A  1 221 ? 55.334  55.265  -0.341  1.00 19.03 ? 222  PHE A N   1 
ATOM   1627  C  CA  . PHE A  1 221 ? 56.615  55.385  0.337   1.00 18.78 ? 222  PHE A CA  1 
ATOM   1628  C  C   . PHE A  1 221 ? 57.245  53.991  0.545   1.00 19.05 ? 222  PHE A C   1 
ATOM   1629  O  O   . PHE A  1 221 ? 58.423  53.795  0.275   1.00 19.04 ? 222  PHE A O   1 
ATOM   1630  C  CB  . PHE A  1 221 ? 56.463  56.113  1.683   1.00 20.66 ? 222  PHE A CB  1 
ATOM   1631  C  CG  . PHE A  1 221 ? 57.782  56.522  2.316   1.00 19.15 ? 222  PHE A CG  1 
ATOM   1632  C  CD1 . PHE A  1 221 ? 58.571  55.597  2.978   1.00 19.17 ? 222  PHE A CD1 1 
ATOM   1633  C  CD2 . PHE A  1 221 ? 58.243  57.838  2.227   1.00 25.91 ? 222  PHE A CD2 1 
ATOM   1634  C  CE1 . PHE A  1 221 ? 59.781  55.976  3.575   1.00 20.60 ? 222  PHE A CE1 1 
ATOM   1635  C  CE2 . PHE A  1 221 ? 59.478  58.217  2.798   1.00 21.22 ? 222  PHE A CE2 1 
ATOM   1636  C  CZ  . PHE A  1 221 ? 60.235  57.292  3.470   1.00 20.01 ? 222  PHE A CZ  1 
ATOM   1637  N  N   . SER A  1 222 ? 56.457  53.028  1.004   1.00 17.72 ? 223  SER A N   1 
ATOM   1638  C  CA  . SER A  1 222 ? 56.973  51.682  1.259   1.00 16.62 ? 223  SER A CA  1 
ATOM   1639  C  C   . SER A  1 222 ? 57.303  50.938  -0.028  1.00 15.78 ? 223  SER A C   1 
ATOM   1640  O  O   . SER A  1 222 ? 58.268  50.174  -0.070  1.00 18.36 ? 223  SER A O   1 
ATOM   1641  C  CB  . SER A  1 222 ? 55.999  50.892  2.114   1.00 13.86 ? 223  SER A CB  1 
ATOM   1642  O  OG  . SER A  1 222 ? 55.873  51.521  3.372   1.00 15.52 ? 223  SER A OG  1 
ATOM   1643  N  N   . ASN A  1 223 ? 56.537  51.192  -1.075  1.00 16.63 ? 224  ASN A N   1 
ATOM   1644  C  CA  . ASN A  1 223 ? 56.767  50.568  -2.366  1.00 19.46 ? 224  ASN A CA  1 
ATOM   1645  C  C   . ASN A  1 223 ? 58.170  50.907  -2.827  1.00 19.86 ? 224  ASN A C   1 
ATOM   1646  O  O   . ASN A  1 223 ? 58.904  50.026  -3.273  1.00 19.82 ? 224  ASN A O   1 
ATOM   1647  C  CB  . ASN A  1 223 ? 55.733  51.025  -3.410  1.00 18.74 ? 224  ASN A CB  1 
ATOM   1648  C  CG  . ASN A  1 223 ? 54.346  50.443  -3.172  1.00 18.57 ? 224  ASN A CG  1 
ATOM   1649  O  OD1 . ASN A  1 223 ? 54.165  49.501  -2.399  1.00 18.74 ? 224  ASN A OD1 1 
ATOM   1650  N  ND2 . ASN A  1 223 ? 53.356  51.012  -3.837  1.00 15.57 ? 224  ASN A ND2 1 
ATOM   1651  N  N   . THR A  1 224 ? 58.549  52.175  -2.657  1.00 19.84 ? 225  THR A N   1 
ATOM   1652  C  CA  . THR A  1 224 ? 59.887  52.647  -2.953  1.00 18.65 ? 225  THR A CA  1 
ATOM   1653  C  C   . THR A  1 224 ? 60.962  52.056  -2.046  1.00 20.62 ? 225  THR A C   1 
ATOM   1654  O  O   . THR A  1 224 ? 62.004  51.631  -2.538  1.00 23.21 ? 225  THR A O   1 
ATOM   1655  C  CB  . THR A  1 224 ? 59.956  54.210  -2.885  1.00 19.95 ? 225  THR A CB  1 
ATOM   1656  O  OG1 . THR A  1 224 ? 59.029  54.734  -3.811  1.00 18.16 ? 225  THR A OG1 1 
ATOM   1657  C  CG2 . THR A  1 224 ? 61.348  54.746  -3.268  1.00 17.63 ? 225  THR A CG2 1 
ATOM   1658  N  N   . VAL A  1 225 ? 60.746  52.051  -0.729  1.00 18.60 ? 226  VAL A N   1 
ATOM   1659  C  CA  . VAL A  1 225 ? 61.723  51.446  0.179   1.00 17.84 ? 226  VAL A CA  1 
ATOM   1660  C  C   . VAL A  1 225 ? 61.953  49.948  -0.121  1.00 18.79 ? 226  VAL A C   1 
ATOM   1661  O  O   . VAL A  1 225 ? 63.086  49.445  -0.095  1.00 18.94 ? 226  VAL A O   1 
ATOM   1662  C  CB  . VAL A  1 225 ? 61.289  51.628  1.655   1.00 20.29 ? 226  VAL A CB  1 
ATOM   1663  C  CG1 . VAL A  1 225 ? 62.211  50.834  2.610   1.00 13.44 ? 226  VAL A CG1 1 
ATOM   1664  C  CG2 . VAL A  1 225 ? 61.235  53.129  2.022   1.00 17.08 ? 226  VAL A CG2 1 
ATOM   1665  N  N   . ILE A  1 226 ? 60.878  49.240  -0.435  1.00 18.65 ? 227  ILE A N   1 
ATOM   1666  C  CA  . ILE A  1 226 ? 60.973  47.827  -0.763  1.00 18.97 ? 227  ILE A CA  1 
ATOM   1667  C  C   . ILE A  1 226 ? 61.948  47.593  -1.939  1.00 20.95 ? 227  ILE A C   1 
ATOM   1668  O  O   . ILE A  1 226 ? 62.670  46.637  -1.951  1.00 20.56 ? 227  ILE A O   1 
ATOM   1669  C  CB  . ILE A  1 226 ? 59.592  47.275  -1.066  1.00 20.52 ? 227  ILE A CB  1 
ATOM   1670  C  CG1 . ILE A  1 226 ? 58.866  46.944  0.245   1.00 20.40 ? 227  ILE A CG1 1 
ATOM   1671  C  CG2 . ILE A  1 226 ? 59.680  46.080  -2.002  1.00 19.03 ? 227  ILE A CG2 1 
ATOM   1672  C  CD1 . ILE A  1 226 ? 57.408  46.597  0.037   1.00 26.20 ? 227  ILE A CD1 1 
ATOM   1673  N  N   . GLY A  1 227 ? 61.989  48.506  -2.898  1.00 22.20 ? 228  GLY A N   1 
ATOM   1674  C  CA  . GLY A  1 227 ? 62.963  48.426  -3.979  1.00 22.62 ? 228  GLY A CA  1 
ATOM   1675  C  C   . GLY A  1 227 ? 64.408  48.560  -3.540  1.00 23.32 ? 228  GLY A C   1 
ATOM   1676  O  O   . GLY A  1 227 ? 65.296  48.370  -4.341  1.00 24.53 ? 228  GLY A O   1 
ATOM   1677  N  N   . GLN A  1 228 ? 64.661  48.906  -2.282  1.00 23.51 ? 229  GLN A N   1 
ATOM   1678  C  CA  . GLN A  1 228 ? 66.045  49.019  -1.805  1.00 24.18 ? 229  GLN A CA  1 
ATOM   1679  C  C   . GLN A  1 228 ? 66.347  48.183  -0.569  1.00 22.71 ? 229  GLN A C   1 
ATOM   1680  O  O   . GLN A  1 228 ? 67.368  48.386  0.076   1.00 24.94 ? 229  GLN A O   1 
ATOM   1681  C  CB  . GLN A  1 228 ? 66.393  50.481  -1.570  1.00 24.17 ? 229  GLN A CB  1 
ATOM   1682  C  CG  . GLN A  1 228 ? 66.309  51.303  -2.881  1.00 31.97 ? 229  GLN A CG  1 
ATOM   1683  C  CD  . GLN A  1 228 ? 66.986  52.643  -2.782  1.00 37.11 ? 229  GLN A CD  1 
ATOM   1684  O  OE1 . GLN A  1 228 ? 67.924  52.829  -2.007  1.00 38.07 ? 229  GLN A OE1 1 
ATOM   1685  N  NE2 . GLN A  1 228 ? 66.510  53.594  -3.568  1.00 42.79 ? 229  GLN A NE2 1 
ATOM   1686  N  N   . MET A  1 229 ? 65.486  47.227  -0.251  1.00 21.39 ? 230  MET A N   1 
ATOM   1687  C  CA  . MET A  1 229 ? 65.792  46.276  0.806   1.00 22.59 ? 230  MET A CA  1 
ATOM   1688  C  C   . MET A  1 229 ? 66.875  45.318  0.317   1.00 21.98 ? 230  MET A C   1 
ATOM   1689  O  O   . MET A  1 229 ? 66.904  44.962  -0.855  1.00 21.31 ? 230  MET A O   1 
ATOM   1690  C  CB  . MET A  1 229 ? 64.552  45.488  1.229   1.00 22.78 ? 230  MET A CB  1 
ATOM   1691  C  CG  . MET A  1 229 ? 63.433  46.328  1.849   1.00 19.02 ? 230  MET A CG  1 
ATOM   1692  S  SD  . MET A  1 229 ? 63.915  47.223  3.305   1.00 21.38 ? 230  MET A SD  1 
ATOM   1693  C  CE  . MET A  1 229 ? 64.285  45.916  4.449   1.00 16.23 ? 230  MET A CE  1 
ATOM   1694  N  N   . LYS A  1 230 ? 67.771  44.934  1.214   1.00 21.06 ? 231  LYS A N   1 
ATOM   1695  C  CA  . LYS A  1 230 ? 68.724  43.849  0.928   1.00 22.83 ? 231  LYS A CA  1 
ATOM   1696  C  C   . LYS A  1 230 ? 68.001  42.512  0.893   1.00 22.46 ? 231  LYS A C   1 
ATOM   1697  O  O   . LYS A  1 230 ? 66.900  42.376  1.457   1.00 18.20 ? 231  LYS A O   1 
ATOM   1698  C  CB  . LYS A  1 230 ? 69.802  43.765  2.016   1.00 22.38 ? 231  LYS A CB  1 
ATOM   1699  C  CG  . LYS A  1 230 ? 70.681  44.999  2.134   1.00 28.16 ? 231  LYS A CG  1 
ATOM   1700  C  CD  . LYS A  1 230 ? 71.818  44.809  3.148   1.00 37.57 ? 231  LYS A CD  1 
ATOM   1701  C  CE  . LYS A  1 230 ? 72.452  46.156  3.520   1.00 43.52 ? 231  LYS A CE  1 
ATOM   1702  N  NZ  . LYS A  1 230 ? 73.371  46.090  4.710   1.00 42.99 ? 231  LYS A NZ  1 
ATOM   1703  N  N   . LYS A  1 231 ? 68.638  41.530  0.247   1.00 21.42 ? 232  LYS A N   1 
ATOM   1704  C  CA  . LYS A  1 231 ? 68.132  40.168  0.210   1.00 23.28 ? 232  LYS A CA  1 
ATOM   1705  C  C   . LYS A  1 231 ? 67.880  39.711  1.636   1.00 21.54 ? 232  LYS A C   1 
ATOM   1706  O  O   . LYS A  1 231 ? 68.680  39.999  2.536   1.00 22.13 ? 232  LYS A O   1 
ATOM   1707  C  CB  . LYS A  1 231 ? 69.149  39.247  -0.483  1.00 25.65 ? 232  LYS A CB  1 
ATOM   1708  C  CG  . LYS A  1 231 ? 68.616  37.887  -0.899  1.00 31.75 ? 232  LYS A CG  1 
ATOM   1709  C  CD  . LYS A  1 231 ? 69.468  37.323  -2.074  1.00 39.76 ? 232  LYS A CD  1 
ATOM   1710  C  CE  . LYS A  1 231 ? 69.441  35.790  -2.135  1.00 45.65 ? 232  LYS A CE  1 
ATOM   1711  N  NZ  . LYS A  1 231 ? 70.526  35.190  -3.004  1.00 47.03 ? 232  LYS A NZ  1 
ATOM   1712  N  N   . PHE A  1 232 ? 66.760  39.022  1.838   1.00 19.44 ? 233  PHE A N   1 
ATOM   1713  C  CA  . PHE A  1 232 ? 66.306  38.586  3.149   1.00 18.46 ? 233  PHE A CA  1 
ATOM   1714  C  C   . PHE A  1 232 ? 66.006  39.736  4.093   1.00 17.05 ? 233  PHE A C   1 
ATOM   1715  O  O   . PHE A  1 232 ? 65.936  39.547  5.293   1.00 20.01 ? 233  PHE A O   1 
ATOM   1716  C  CB  . PHE A  1 232 ? 67.297  37.594  3.809   1.00 19.88 ? 233  PHE A CB  1 
ATOM   1717  C  CG  . PHE A  1 232 ? 67.734  36.469  2.902   1.00 23.10 ? 233  PHE A CG  1 
ATOM   1718  C  CD1 . PHE A  1 232 ? 66.800  35.599  2.347   1.00 20.91 ? 233  PHE A CD1 1 
ATOM   1719  C  CD2 . PHE A  1 232 ? 69.084  36.268  2.622   1.00 27.48 ? 233  PHE A CD2 1 
ATOM   1720  C  CE1 . PHE A  1 232 ? 67.211  34.566  1.490   1.00 25.21 ? 233  PHE A CE1 1 
ATOM   1721  C  CE2 . PHE A  1 232 ? 69.509  35.224  1.787   1.00 27.77 ? 233  PHE A CE2 1 
ATOM   1722  C  CZ  . PHE A  1 232 ? 68.579  34.384  1.212   1.00 25.53 ? 233  PHE A CZ  1 
ATOM   1723  N  N   . GLY A  1 233 ? 65.799  40.930  3.573   1.00 18.47 ? 234  GLY A N   1 
ATOM   1724  C  CA  . GLY A  1 233 ? 65.472  42.058  4.426   1.00 18.34 ? 234  GLY A CA  1 
ATOM   1725  C  C   . GLY A  1 233 ? 64.205  41.847  5.224   1.00 19.21 ? 234  GLY A C   1 
ATOM   1726  O  O   . GLY A  1 233 ? 63.280  41.148  4.773   1.00 20.48 ? 234  GLY A O   1 
ATOM   1727  N  N   . ARG A  1 234 ? 64.140  42.462  6.397   1.00 18.63 ? 235  ARG A N   1 
ATOM   1728  C  CA  . ARG A  1 234 ? 62.999  42.313  7.289   1.00 18.70 ? 235  ARG A CA  1 
ATOM   1729  C  C   . ARG A  1 234 ? 62.244  43.621  7.447   1.00 19.27 ? 235  ARG A C   1 
ATOM   1730  O  O   . ARG A  1 234 ? 62.825  44.660  7.778   1.00 19.42 ? 235  ARG A O   1 
ATOM   1731  C  CB  . ARG A  1 234 ? 63.468  41.827  8.666   1.00 20.14 ? 235  ARG A CB  1 
ATOM   1732  C  CG  . ARG A  1 234 ? 64.209  40.470  8.628   1.00 24.90 ? 235  ARG A CG  1 
ATOM   1733  C  CD  . ARG A  1 234 ? 65.295  40.415  9.669   1.00 38.36 ? 235  ARG A CD  1 
ATOM   1734  N  NE  . ARG A  1 234 ? 66.593  40.897  9.174   1.00 45.19 ? 235  ARG A NE  1 
ATOM   1735  C  CZ  . ARG A  1 234 ? 67.557  41.460  9.918   1.00 47.17 ? 235  ARG A CZ  1 
ATOM   1736  N  NH1 . ARG A  1 234 ? 67.402  41.690  11.228  1.00 43.44 ? 235  ARG A NH1 1 
ATOM   1737  N  NH2 . ARG A  1 234 ? 68.693  41.824  9.327   1.00 48.31 ? 235  ARG A NH2 1 
ATOM   1738  N  N   . ILE A  1 235 ? 60.943  43.562  7.213   1.00 19.60 ? 236  ILE A N   1 
ATOM   1739  C  CA  . ILE A  1 235 ? 60.076  44.709  7.332   1.00 18.26 ? 236  ILE A CA  1 
ATOM   1740  C  C   . ILE A  1 235 ? 59.182  44.457  8.520   1.00 17.43 ? 236  ILE A C   1 
ATOM   1741  O  O   . ILE A  1 235 ? 58.482  43.427  8.567   1.00 17.64 ? 236  ILE A O   1 
ATOM   1742  C  CB  . ILE A  1 235 ? 59.222  44.900  6.072   1.00 18.23 ? 236  ILE A CB  1 
ATOM   1743  C  CG1 . ILE A  1 235 ? 60.099  45.094  4.834   1.00 20.61 ? 236  ILE A CG1 1 
ATOM   1744  C  CG2 . ILE A  1 235 ? 58.255  46.094  6.230   1.00 16.23 ? 236  ILE A CG2 1 
ATOM   1745  C  CD1 . ILE A  1 235 ? 59.305  45.328  3.628   1.00 16.84 ? 236  ILE A CD1 1 
ATOM   1746  N  N   . ALA A  1 236 ? 59.206  45.366  9.492   1.00 14.72 ? 237  ALA A N   1 
ATOM   1747  C  CA  . ALA A  1 236 ? 58.171  45.360  10.538  1.00 16.81 ? 237  ALA A CA  1 
ATOM   1748  C  C   . ALA A  1 236 ? 57.071  46.314  10.113  1.00 16.02 ? 237  ALA A C   1 
ATOM   1749  O  O   . ALA A  1 236 ? 57.316  47.513  9.959   1.00 14.54 ? 237  ALA A O   1 
ATOM   1750  C  CB  . ALA A  1 236 ? 58.731  45.742  11.897  1.00 16.23 ? 237  ALA A CB  1 
ATOM   1751  N  N   . ILE A  1 237 ? 55.879  45.756  9.914   1.00 15.28 ? 238  ILE A N   1 
ATOM   1752  C  CA  . ILE A  1 237 ? 54.677  46.507  9.587   1.00 16.99 ? 238  ILE A CA  1 
ATOM   1753  C  C   . ILE A  1 237 ? 54.005  46.932  10.866  1.00 17.64 ? 238  ILE A C   1 
ATOM   1754  O  O   . ILE A  1 237 ? 53.173  46.204  11.471  1.00 15.59 ? 238  ILE A O   1 
ATOM   1755  C  CB  . ILE A  1 237 ? 53.674  45.687  8.676   1.00 18.08 ? 238  ILE A CB  1 
ATOM   1756  C  CG1 . ILE A  1 237 ? 54.408  45.206  7.408   1.00 19.48 ? 238  ILE A CG1 1 
ATOM   1757  C  CG2 . ILE A  1 237 ? 52.473  46.571  8.322   1.00 16.21 ? 238  ILE A CG2 1 
ATOM   1758  C  CD1 . ILE A  1 237 ? 53.651  44.222  6.492   1.00 18.60 ? 238  ILE A CD1 1 
ATOM   1759  N  N   . CYS A  1 238 ? 54.356  48.142  11.269  1.00 16.19 ? 239  CYS A N   1 
ATOM   1760  C  CA  . CYS A  1 238 ? 53.921  48.691  12.525  1.00 15.60 ? 239  CYS A CA  1 
ATOM   1761  C  C   . CYS A  1 238 ? 52.668  49.505  12.271  1.00 16.03 ? 239  CYS A C   1 
ATOM   1762  O  O   . CYS A  1 238 ? 51.693  49.380  12.987  1.00 13.66 ? 239  CYS A O   1 
ATOM   1763  C  CB  . CYS A  1 238 ? 55.033  49.580  13.129  1.00 16.78 ? 239  CYS A CB  1 
ATOM   1764  S  SG  . CYS A  1 238 ? 54.514  50.541  14.546  1.00 19.67 ? 239  CYS A SG  1 
ATOM   1765  N  N   . GLY A  1 239 ? 52.701  50.335  11.241  1.00 16.93 ? 240  GLY A N   1 
ATOM   1766  C  CA  . GLY A  1 239 ? 51.539  51.135  10.859  1.00 16.69 ? 240  GLY A CA  1 
ATOM   1767  C  C   . GLY A  1 239 ? 51.565  51.493  9.394   1.00 15.07 ? 240  GLY A C   1 
ATOM   1768  O  O   . GLY A  1 239 ? 52.508  51.164  8.681   1.00 14.26 ? 240  GLY A O   1 
ATOM   1769  N  N   . ALA A  1 240 ? 50.524  52.168  8.949   1.00 14.71 ? 241  ALA A N   1 
ATOM   1770  C  CA  . ALA A  1 240 ? 50.384  52.562  7.544   1.00 15.52 ? 241  ALA A CA  1 
ATOM   1771  C  C   . ALA A  1 240 ? 49.636  53.875  7.506   1.00 14.56 ? 241  ALA A C   1 
ATOM   1772  O  O   . ALA A  1 240 ? 48.572  53.997  6.864   1.00 17.60 ? 241  ALA A O   1 
ATOM   1773  C  CB  . ALA A  1 240 ? 49.598  51.472  6.719   1.00 14.46 ? 241  ALA A CB  1 
ATOM   1774  N  N   . ILE A  1 241 ? 50.187  54.871  8.174   1.00 15.30 ? 242  ILE A N   1 
ATOM   1775  C  CA  . ILE A  1 241 ? 49.437  56.102  8.425   1.00 16.78 ? 242  ILE A CA  1 
ATOM   1776  C  C   . ILE A  1 241 ? 49.056  56.857  7.142   1.00 16.86 ? 242  ILE A C   1 
ATOM   1777  O  O   . ILE A  1 241 ? 48.052  57.569  7.125   1.00 18.74 ? 242  ILE A O   1 
ATOM   1778  C  CB  . ILE A  1 241 ? 50.149  57.011  9.472   1.00 17.89 ? 242  ILE A CB  1 
ATOM   1779  C  CG1 . ILE A  1 241 ? 49.168  58.081  10.009  1.00 17.28 ? 242  ILE A CG1 1 
ATOM   1780  C  CG2 . ILE A  1 241 ? 51.454  57.659  8.875   1.00 12.58 ? 242  ILE A CG2 1 
ATOM   1781  C  CD1 . ILE A  1 241 ? 49.705  58.847  11.203  1.00 14.63 ? 242  ILE A CD1 1 
ATOM   1782  N  N   . SER A  1 242 ? 49.786  56.650  6.044   1.00 17.16 ? 243  SER A N   1 
ATOM   1783  C  CA  . SER A  1 242 ? 49.444  57.298  4.768   1.00 16.78 ? 243  SER A CA  1 
ATOM   1784  C  C   . SER A  1 242 ? 48.126  56.811  4.199   1.00 17.37 ? 243  SER A C   1 
ATOM   1785  O  O   . SER A  1 242 ? 47.586  57.464  3.336   1.00 18.55 ? 243  SER A O   1 
ATOM   1786  C  CB  . SER A  1 242 ? 50.529  57.047  3.713   1.00 17.72 ? 243  SER A CB  1 
ATOM   1787  O  OG  . SER A  1 242 ? 50.598  55.669  3.352   1.00 18.76 ? 243  SER A OG  1 
ATOM   1788  N  N   . THR A  1 243 ? 47.623  55.667  4.669   1.00 17.63 ? 244  THR A N   1 
ATOM   1789  C  CA  . THR A  1 243 ? 46.322  55.152  4.236   1.00 16.49 ? 244  THR A CA  1 
ATOM   1790  C  C   . THR A  1 243 ? 45.151  55.445  5.192   1.00 18.64 ? 244  THR A C   1 
ATOM   1791  O  O   . THR A  1 243 ? 44.000  55.296  4.805   1.00 17.77 ? 244  THR A O   1 
ATOM   1792  C  CB  . THR A  1 243 ? 46.367  53.619  4.043   1.00 16.55 ? 244  THR A CB  1 
ATOM   1793  O  OG1 . THR A  1 243 ? 46.366  52.987  5.318   1.00 16.19 ? 244  THR A OG1 1 
ATOM   1794  C  CG2 . THR A  1 243 ? 47.611  53.200  3.271   1.00 12.89 ? 244  THR A CG2 1 
ATOM   1795  N  N   . TYR A  1 244 ? 45.406  55.833  6.441   1.00 19.64 ? 245  TYR A N   1 
ATOM   1796  C  CA  . TYR A  1 244 ? 44.300  55.912  7.417   1.00 18.65 ? 245  TYR A CA  1 
ATOM   1797  C  C   . TYR A  1 244 ? 43.269  56.990  7.097   1.00 18.78 ? 245  TYR A C   1 
ATOM   1798  O  O   . TYR A  1 244 ? 42.100  56.841  7.446   1.00 18.78 ? 245  TYR A O   1 
ATOM   1799  C  CB  . TYR A  1 244 ? 44.785  56.196  8.845   1.00 21.05 ? 245  TYR A CB  1 
ATOM   1800  C  CG  . TYR A  1 244 ? 45.772  55.227  9.448   1.00 17.70 ? 245  TYR A CG  1 
ATOM   1801  C  CD1 . TYR A  1 244 ? 46.069  54.011  8.843   1.00 17.72 ? 245  TYR A CD1 1 
ATOM   1802  C  CD2 . TYR A  1 244 ? 46.387  55.526  10.657  1.00 16.03 ? 245  TYR A CD2 1 
ATOM   1803  C  CE1 . TYR A  1 244 ? 46.969  53.155  9.404   1.00 20.22 ? 245  TYR A CE1 1 
ATOM   1804  C  CE2 . TYR A  1 244 ? 47.293  54.663  11.223  1.00 13.16 ? 245  TYR A CE2 1 
ATOM   1805  C  CZ  . TYR A  1 244 ? 47.595  53.488  10.575  1.00 18.06 ? 245  TYR A CZ  1 
ATOM   1806  O  OH  . TYR A  1 244 ? 48.526  52.613  11.096  1.00 15.68 ? 245  TYR A OH  1 
ATOM   1807  N  N   . ASN A  1 245 ? 43.707  58.072  6.469   1.00 19.83 ? 246  ASN A N   1 
ATOM   1808  C  CA  . ASN A  1 245 ? 42.840  59.192  6.147   1.00 22.05 ? 246  ASN A CA  1 
ATOM   1809  C  C   . ASN A  1 245 ? 42.622  59.334  4.639   1.00 26.70 ? 246  ASN A C   1 
ATOM   1810  O  O   . ASN A  1 245 ? 42.112  60.363  4.201   1.00 27.80 ? 246  ASN A O   1 
ATOM   1811  C  CB  . ASN A  1 245 ? 43.459  60.489  6.682   1.00 19.39 ? 246  ASN A CB  1 
ATOM   1812  C  CG  . ASN A  1 245 ? 43.643  60.483  8.198   1.00 21.81 ? 246  ASN A CG  1 
ATOM   1813  O  OD1 . ASN A  1 245 ? 42.673  60.658  8.956   1.00 17.76 ? 246  ASN A OD1 1 
ATOM   1814  N  ND2 . ASN A  1 245 ? 44.899  60.338  8.651   1.00 14.18 ? 246  ASN A ND2 1 
ATOM   1815  N  N   . ARG A  1 246 ? 42.983  58.303  3.860   1.00 29.47 ? 247  ARG A N   1 
ATOM   1816  C  CA  A ARG A  1 246 ? 42.973  58.374  2.383   0.20 31.59 ? 247  ARG A CA  1 
ATOM   1817  C  CA  B ARG A  1 246 ? 42.981  58.391  2.397   0.80 33.10 ? 247  ARG A CA  1 
ATOM   1818  C  C   . ARG A  1 246 ? 41.564  58.186  1.835   1.00 33.88 ? 247  ARG A C   1 
ATOM   1819  O  O   . ARG A  1 246 ? 40.845  57.291  2.269   1.00 35.50 ? 247  ARG A O   1 
ATOM   1820  C  CB  A ARG A  1 246 ? 43.936  57.339  1.749   0.20 31.50 ? 247  ARG A CB  1 
ATOM   1821  C  CB  B ARG A  1 246 ? 43.951  57.345  1.834   0.80 34.64 ? 247  ARG A CB  1 
ATOM   1822  C  CG  A ARG A  1 246 ? 43.298  56.077  1.087   0.20 28.73 ? 247  ARG A CG  1 
ATOM   1823  C  CG  B ARG A  1 246 ? 44.312  57.455  0.346   0.80 34.39 ? 247  ARG A CG  1 
ATOM   1824  C  CD  A ARG A  1 246 ? 42.977  54.984  2.100   0.20 25.04 ? 247  ARG A CD  1 
ATOM   1825  C  CD  B ARG A  1 246 ? 45.097  56.188  -0.064  0.80 36.12 ? 247  ARG A CD  1 
ATOM   1826  N  NE  A ARG A  1 246 ? 42.068  53.961  1.593   0.20 22.19 ? 247  ARG A NE  1 
ATOM   1827  N  NE  B ARG A  1 246 ? 45.101  55.957  -1.505  0.80 32.08 ? 247  ARG A NE  1 
ATOM   1828  C  CZ  A ARG A  1 246 ? 41.752  52.852  2.259   0.20 15.45 ? 247  ARG A CZ  1 
ATOM   1829  C  CZ  B ARG A  1 246 ? 46.016  56.426  -2.351  0.80 29.62 ? 247  ARG A CZ  1 
ATOM   1830  N  NH1 A ARG A  1 246 ? 42.290  52.620  3.444   0.20 13.91 ? 247  ARG A NH1 1 
ATOM   1831  N  NH1 B ARG A  1 246 ? 47.030  57.184  -1.927  0.80 23.45 ? 247  ARG A NH1 1 
ATOM   1832  N  NH2 A ARG A  1 246 ? 40.903  51.976  1.742   0.20 12.57 ? 247  ARG A NH2 1 
ATOM   1833  N  NH2 B ARG A  1 246 ? 45.901  56.145  -3.642  0.80 27.40 ? 247  ARG A NH2 1 
ATOM   1834  N  N   . THR A  1 247 ? 41.176  59.028  0.866   1.00 36.79 ? 248  THR A N   1 
ATOM   1835  C  CA  . THR A  1 247 ? 39.811  59.016  0.347   1.00 38.92 ? 248  THR A CA  1 
ATOM   1836  C  C   . THR A  1 247 ? 39.516  57.827  -0.592  1.00 42.91 ? 248  THR A C   1 
ATOM   1837  O  O   . THR A  1 247 ? 38.583  57.044  -0.340  1.00 46.51 ? 248  THR A O   1 
ATOM   1838  C  CB  . THR A  1 247 ? 39.353  60.422  -0.262  1.00 38.82 ? 248  THR A CB  1 
ATOM   1839  O  OG1 . THR A  1 247 ? 40.433  61.136  -0.912  1.00 25.15 ? 248  THR A OG1 1 
ATOM   1840  C  CG2 . THR A  1 247 ? 38.770  61.275  0.867   1.00 38.58 ? 248  THR A CG2 1 
ATOM   1841  N  N   . GLY A  1 248 ? 40.301  57.666  -1.647  1.00 41.28 ? 249  GLY A N   1 
ATOM   1842  C  CA  . GLY A  1 248 ? 39.995  56.609  -2.633  1.00 41.63 ? 249  GLY A CA  1 
ATOM   1843  C  C   . GLY A  1 248 ? 40.243  55.166  -2.184  1.00 38.69 ? 249  GLY A C   1 
ATOM   1844  O  O   . GLY A  1 248 ? 40.187  54.858  -1.001  1.00 38.66 ? 249  GLY A O   1 
ATOM   1845  N  N   . PRO A  1 249 ? 40.470  54.261  -3.150  1.00 35.65 ? 250  PRO A N   1 
ATOM   1846  C  CA  . PRO A  1 249 ? 41.105  52.973  -2.887  1.00 32.53 ? 250  PRO A CA  1 
ATOM   1847  C  C   . PRO A  1 249 ? 42.609  53.121  -2.577  1.00 27.35 ? 250  PRO A C   1 
ATOM   1848  O  O   . PRO A  1 249 ? 43.224  54.159  -2.844  1.00 23.63 ? 250  PRO A O   1 
ATOM   1849  C  CB  . PRO A  1 249 ? 40.903  52.190  -4.210  1.00 34.95 ? 250  PRO A CB  1 
ATOM   1850  C  CG  . PRO A  1 249 ? 39.922  53.000  -5.022  1.00 36.22 ? 250  PRO A CG  1 
ATOM   1851  C  CD  . PRO A  1 249 ? 40.073  54.406  -4.560  1.00 36.34 ? 250  PRO A CD  1 
ATOM   1852  N  N   . LEU A  1 250 ? 43.181  52.078  -1.997  1.00 25.87 ? 251  LEU A N   1 
ATOM   1853  C  CA  . LEU A  1 250 ? 44.586  52.070  -1.619  1.00 25.08 ? 251  LEU A CA  1 
ATOM   1854  C  C   . LEU A  1 250 ? 45.484  52.304  -2.820  1.00 24.43 ? 251  LEU A C   1 
ATOM   1855  O  O   . LEU A  1 250 ? 45.088  52.078  -3.947  1.00 22.46 ? 251  LEU A O   1 
ATOM   1856  C  CB  . LEU A  1 250 ? 44.949  50.726  -0.996  1.00 25.49 ? 251  LEU A CB  1 
ATOM   1857  C  CG  . LEU A  1 250 ? 44.341  50.546  0.395   1.00 26.73 ? 251  LEU A CG  1 
ATOM   1858  C  CD1 . LEU A  1 250 ? 44.333  49.058  0.767   1.00 26.48 ? 251  LEU A CD1 1 
ATOM   1859  C  CD2 . LEU A  1 250 ? 45.108  51.409  1.411   1.00 20.57 ? 251  LEU A CD2 1 
ATOM   1860  N  N   . PRO A  1 251 ? 46.708  52.761  -2.581  1.00 23.82 ? 252  PRO A N   1 
ATOM   1861  C  CA  . PRO A  1 251 ? 47.626  52.841  -3.716  1.00 24.72 ? 252  PRO A CA  1 
ATOM   1862  C  C   . PRO A  1 251 ? 48.070  51.441  -4.189  1.00 25.34 ? 252  PRO A C   1 
ATOM   1863  O  O   . PRO A  1 251 ? 47.842  50.458  -3.493  1.00 21.92 ? 252  PRO A O   1 
ATOM   1864  C  CB  . PRO A  1 251 ? 48.812  53.635  -3.161  1.00 25.37 ? 252  PRO A CB  1 
ATOM   1865  C  CG  . PRO A  1 251 ? 48.705  53.520  -1.682  1.00 26.45 ? 252  PRO A CG  1 
ATOM   1866  C  CD  . PRO A  1 251 ? 47.312  53.175  -1.310  1.00 20.72 ? 252  PRO A CD  1 
ATOM   1867  N  N   . PRO A  1 252 ? 48.699  51.358  -5.365  1.00 26.27 ? 253  PRO A N   1 
ATOM   1868  C  CA  . PRO A  1 252 ? 49.211  50.062  -5.804  1.00 27.54 ? 253  PRO A CA  1 
ATOM   1869  C  C   . PRO A  1 252 ? 50.072  49.402  -4.740  1.00 26.32 ? 253  PRO A C   1 
ATOM   1870  O  O   . PRO A  1 252 ? 50.822  50.088  -4.041  1.00 22.90 ? 253  PRO A O   1 
ATOM   1871  C  CB  . PRO A  1 252 ? 50.104  50.405  -6.995  1.00 27.47 ? 253  PRO A CB  1 
ATOM   1872  C  CG  . PRO A  1 252 ? 49.806  51.841  -7.357  1.00 30.65 ? 253  PRO A CG  1 
ATOM   1873  C  CD  . PRO A  1 252 ? 48.914  52.439  -6.347  1.00 27.95 ? 253  PRO A CD  1 
ATOM   1874  N  N   . GLY A  1 253 ? 49.994  48.082  -4.653  1.00 26.45 ? 254  GLY A N   1 
ATOM   1875  C  CA  . GLY A  1 253 ? 50.887  47.305  -3.798  1.00 25.14 ? 254  GLY A CA  1 
ATOM   1876  C  C   . GLY A  1 253 ? 52.308  47.307  -4.344  1.00 25.40 ? 254  GLY A C   1 
ATOM   1877  O  O   . GLY A  1 253 ? 52.545  47.833  -5.410  1.00 24.74 ? 254  GLY A O   1 
ATOM   1878  N  N   . PRO A  1 254 ? 53.268  46.727  -3.599  1.00 26.99 ? 255  PRO A N   1 
ATOM   1879  C  CA  . PRO A  1 254 ? 54.682  46.654  -4.008  1.00 29.51 ? 255  PRO A CA  1 
ATOM   1880  C  C   . PRO A  1 254 ? 54.946  45.701  -5.192  1.00 28.45 ? 255  PRO A C   1 
ATOM   1881  O  O   . PRO A  1 254 ? 54.194  44.753  -5.389  1.00 21.11 ? 255  PRO A O   1 
ATOM   1882  C  CB  . PRO A  1 254 ? 55.388  46.115  -2.765  1.00 29.89 ? 255  PRO A CB  1 
ATOM   1883  C  CG  . PRO A  1 254 ? 54.343  45.483  -1.940  1.00 31.85 ? 255  PRO A CG  1 
ATOM   1884  C  CD  . PRO A  1 254 ? 52.999  45.991  -2.356  1.00 29.29 ? 255  PRO A CD  1 
ATOM   1885  N  N   . PRO A  1 255 ? 56.016  45.956  -5.966  1.00 29.85 ? 256  PRO A N   1 
ATOM   1886  C  CA  . PRO A  1 255 ? 56.303  45.123  -7.133  1.00 28.95 ? 256  PRO A CA  1 
ATOM   1887  C  C   . PRO A  1 255 ? 56.664  43.691  -6.694  1.00 26.04 ? 256  PRO A C   1 
ATOM   1888  O  O   . PRO A  1 255 ? 57.666  43.498  -6.002  1.00 24.56 ? 256  PRO A O   1 
ATOM   1889  C  CB  . PRO A  1 255 ? 57.492  45.838  -7.807  1.00 29.26 ? 256  PRO A CB  1 
ATOM   1890  C  CG  . PRO A  1 255 ? 57.574  47.153  -7.151  1.00 31.12 ? 256  PRO A CG  1 
ATOM   1891  C  CD  . PRO A  1 255 ? 57.088  46.935  -5.753  1.00 31.01 ? 256  PRO A CD  1 
ATOM   1892  N  N   . PRO A  1 256 ? 55.833  42.708  -7.069  1.00 24.90 ? 257  PRO A N   1 
ATOM   1893  C  CA  . PRO A  1 256 ? 55.980  41.336  -6.602  1.00 24.62 ? 257  PRO A CA  1 
ATOM   1894  C  C   . PRO A  1 256 ? 57.322  40.720  -6.941  1.00 24.03 ? 257  PRO A C   1 
ATOM   1895  O  O   . PRO A  1 256 ? 57.891  40.003  -6.117  1.00 23.37 ? 257  PRO A O   1 
ATOM   1896  C  CB  . PRO A  1 256 ? 54.880  40.603  -7.349  1.00 24.74 ? 257  PRO A CB  1 
ATOM   1897  C  CG  . PRO A  1 256 ? 53.868  41.639  -7.610  1.00 28.15 ? 257  PRO A CG  1 
ATOM   1898  C  CD  . PRO A  1 256 ? 54.684  42.824  -7.987  1.00 25.49 ? 257  PRO A CD  1 
ATOM   1899  N  N   . GLU A  1 257 ? 57.828  41.017  -8.130  1.00 23.15 ? 258  GLU A N   1 
ATOM   1900  C  CA  . GLU A  1 257 ? 59.100  40.478  -8.584  1.00 25.71 ? 258  GLU A CA  1 
ATOM   1901  C  C   . GLU A  1 257 ? 60.222  40.906  -7.647  1.00 24.29 ? 258  GLU A C   1 
ATOM   1902  O  O   . GLU A  1 257 ? 61.166  40.142  -7.431  1.00 23.57 ? 258  GLU A O   1 
ATOM   1903  C  CB  . GLU A  1 257 ? 59.412  40.937  -10.030 1.00 27.58 ? 258  GLU A CB  1 
ATOM   1904  C  CG  . GLU A  1 257 ? 59.750  42.422  -10.139 1.00 39.17 ? 258  GLU A CG  1 
ATOM   1905  C  CD  . GLU A  1 257 ? 59.525  43.012  -11.529 1.00 56.77 ? 258  GLU A CD  1 
ATOM   1906  O  OE1 . GLU A  1 257 ? 60.025  42.430  -12.521 1.00 59.23 ? 258  GLU A OE1 1 
ATOM   1907  O  OE2 . GLU A  1 257 ? 58.865  44.081  -11.621 1.00 64.30 ? 258  GLU A OE2 1 
ATOM   1908  N  N   . ILE A  1 258 ? 60.130  42.121  -7.090  1.00 22.33 ? 259  ILE A N   1 
ATOM   1909  C  CA  . ILE A  1 258 ? 61.182  42.605  -6.191  1.00 20.99 ? 259  ILE A CA  1 
ATOM   1910  C  C   . ILE A  1 258 ? 61.068  41.972  -4.815  1.00 19.59 ? 259  ILE A C   1 
ATOM   1911  O  O   . ILE A  1 258 ? 62.084  41.593  -4.201  1.00 19.81 ? 259  ILE A O   1 
ATOM   1912  C  CB  . ILE A  1 258 ? 61.167  44.137  -6.049  1.00 22.63 ? 259  ILE A CB  1 
ATOM   1913  C  CG1 . ILE A  1 258 ? 61.576  44.806  -7.376  1.00 26.28 ? 259  ILE A CG1 1 
ATOM   1914  C  CG2 . ILE A  1 258 ? 62.085  44.589  -4.886  1.00 19.64 ? 259  ILE A CG2 1 
ATOM   1915  C  CD1 . ILE A  1 258 ? 61.267  46.339  -7.449  1.00 28.05 ? 259  ILE A CD1 1 
ATOM   1916  N  N   . VAL A  1 259 ? 59.841  41.901  -4.312  1.00 18.44 ? 260  VAL A N   1 
ATOM   1917  C  CA  . VAL A  1 259 ? 59.567  41.253  -3.038  1.00 17.10 ? 260  VAL A CA  1 
ATOM   1918  C  C   . VAL A  1 259 ? 60.018  39.788  -3.094  1.00 16.81 ? 260  VAL A C   1 
ATOM   1919  O  O   . VAL A  1 259 ? 60.604  39.280  -2.137  1.00 17.40 ? 260  VAL A O   1 
ATOM   1920  C  CB  . VAL A  1 259 ? 58.071  41.329  -2.664  1.00 17.63 ? 260  VAL A CB  1 
ATOM   1921  C  CG1 . VAL A  1 259 ? 57.748  40.420  -1.449  1.00 17.27 ? 260  VAL A CG1 1 
ATOM   1922  C  CG2 . VAL A  1 259 ? 57.658  42.778  -2.378  1.00 16.61 ? 260  VAL A CG2 1 
ATOM   1923  N  N   . ILE A  1 260 ? 59.772  39.118  -4.213  1.00 16.31 ? 261  ILE A N   1 
ATOM   1924  C  CA  . ILE A  1 260 ? 60.150  37.707  -4.338  1.00 18.48 ? 261  ILE A CA  1 
ATOM   1925  C  C   . ILE A  1 260 ? 61.659  37.530  -4.493  1.00 19.64 ? 261  ILE A C   1 
ATOM   1926  O  O   . ILE A  1 260 ? 62.265  36.817  -3.726  1.00 19.75 ? 261  ILE A O   1 
ATOM   1927  C  CB  . ILE A  1 260 ? 59.422  37.028  -5.473  1.00 19.57 ? 261  ILE A CB  1 
ATOM   1928  C  CG1 . ILE A  1 260 ? 57.930  36.918  -5.134  1.00 19.37 ? 261  ILE A CG1 1 
ATOM   1929  C  CG2 . ILE A  1 260 ? 59.997  35.603  -5.757  1.00 18.23 ? 261  ILE A CG2 1 
ATOM   1930  C  CD1 . ILE A  1 260 ? 57.079  36.635  -6.330  1.00 16.89 ? 261  ILE A CD1 1 
ATOM   1931  N  N   . TYR A  1 261 ? 62.252  38.213  -5.459  1.00 20.62 ? 262  TYR A N   1 
ATOM   1932  C  CA  . TYR A  1 261 ? 63.696  38.127  -5.723  1.00 22.81 ? 262  TYR A CA  1 
ATOM   1933  C  C   . TYR A  1 261 ? 64.563  38.549  -4.533  1.00 20.60 ? 262  TYR A C   1 
ATOM   1934  O  O   . TYR A  1 261 ? 65.624  37.951  -4.305  1.00 21.71 ? 262  TYR A O   1 
ATOM   1935  C  CB  . TYR A  1 261 ? 64.011  38.938  -6.984  1.00 24.73 ? 262  TYR A CB  1 
ATOM   1936  C  CG  . TYR A  1 261 ? 65.376  38.793  -7.599  1.00 35.79 ? 262  TYR A CG  1 
ATOM   1937  C  CD1 . TYR A  1 261 ? 66.436  39.614  -7.198  1.00 51.90 ? 262  TYR A CD1 1 
ATOM   1938  C  CD2 . TYR A  1 261 ? 65.596  37.898  -8.658  1.00 54.58 ? 262  TYR A CD2 1 
ATOM   1939  C  CE1 . TYR A  1 261 ? 67.707  39.508  -7.794  1.00 60.39 ? 262  TYR A CE1 1 
ATOM   1940  C  CE2 . TYR A  1 261 ? 66.864  37.785  -9.267  1.00 59.08 ? 262  TYR A CE2 1 
ATOM   1941  C  CZ  . TYR A  1 261 ? 67.911  38.592  -8.828  1.00 63.51 ? 262  TYR A CZ  1 
ATOM   1942  O  OH  . TYR A  1 261 ? 69.158  38.489  -9.415  1.00 69.40 ? 262  TYR A OH  1 
ATOM   1943  N  N   . GLN A  1 262 ? 64.121  39.539  -3.757  1.00 18.29 ? 263  GLN A N   1 
ATOM   1944  C  CA  . GLN A  1 262 ? 64.849  39.936  -2.543  1.00 19.37 ? 263  GLN A CA  1 
ATOM   1945  C  C   . GLN A  1 262 ? 64.453  39.120  -1.318  1.00 19.89 ? 263  GLN A C   1 
ATOM   1946  O  O   . GLN A  1 262 ? 64.979  39.345  -0.228  1.00 19.29 ? 263  GLN A O   1 
ATOM   1947  C  CB  . GLN A  1 262 ? 64.674  41.436  -2.236  1.00 19.45 ? 263  GLN A CB  1 
ATOM   1948  C  CG  . GLN A  1 262 ? 65.289  42.366  -3.286  1.00 23.20 ? 263  GLN A CG  1 
ATOM   1949  C  CD  . GLN A  1 262 ? 66.754  42.041  -3.567  1.00 25.20 ? 263  GLN A CD  1 
ATOM   1950  O  OE1 . GLN A  1 262 ? 67.070  41.260  -4.470  1.00 28.62 ? 263  GLN A OE1 1 
ATOM   1951  N  NE2 . GLN A  1 262 ? 67.651  42.630  -2.780  1.00 22.20 ? 263  GLN A NE2 1 
ATOM   1952  N  N   . GLU A  1 263 ? 63.517  38.189  -1.502  1.00 19.44 ? 264  GLU A N   1 
ATOM   1953  C  CA  . GLU A  1 263 ? 63.151  37.215  -0.478  1.00 18.38 ? 264  GLU A CA  1 
ATOM   1954  C  C   . GLU A  1 263 ? 62.822  37.904  0.842   1.00 17.46 ? 264  GLU A C   1 
ATOM   1955  O  O   . GLU A  1 263 ? 63.335  37.542  1.894   1.00 17.04 ? 264  GLU A O   1 
ATOM   1956  C  CB  . GLU A  1 263 ? 64.281  36.181  -0.329  1.00 19.95 ? 264  GLU A CB  1 
ATOM   1957  C  CG  . GLU A  1 263 ? 64.585  35.446  -1.638  1.00 19.07 ? 264  GLU A CG  1 
ATOM   1958  C  CD  . GLU A  1 263 ? 65.326  34.123  -1.470  1.00 19.49 ? 264  GLU A CD  1 
ATOM   1959  O  OE1 . GLU A  1 263 ? 64.804  33.207  -0.807  1.00 18.49 ? 264  GLU A OE1 1 
ATOM   1960  O  OE2 . GLU A  1 263 ? 66.422  33.994  -2.041  1.00 22.15 ? 264  GLU A OE2 1 
ATOM   1961  N  N   . LEU A  1 264 ? 61.951  38.911  0.779   1.00 17.82 ? 265  LEU A N   1 
ATOM   1962  C  CA  . LEU A  1 264 ? 61.634  39.714  1.956   1.00 16.51 ? 265  LEU A CA  1 
ATOM   1963  C  C   . LEU A  1 264 ? 60.702  39.006  2.937   1.00 17.86 ? 265  LEU A C   1 
ATOM   1964  O  O   . LEU A  1 264 ? 59.841  38.215  2.558   1.00 17.08 ? 265  LEU A O   1 
ATOM   1965  C  CB  . LEU A  1 264 ? 61.014  41.046  1.532   1.00 18.10 ? 265  LEU A CB  1 
ATOM   1966  C  CG  . LEU A  1 264 ? 61.825  41.926  0.567   1.00 22.20 ? 265  LEU A CG  1 
ATOM   1967  C  CD1 . LEU A  1 264 ? 61.051  43.231  0.212   1.00 14.66 ? 265  LEU A CD1 1 
ATOM   1968  C  CD2 . LEU A  1 264 ? 63.162  42.241  1.194   1.00 17.48 ? 265  LEU A CD2 1 
ATOM   1969  N  N   . ARG A  1 265 ? 60.921  39.290  4.214   1.00 20.13 ? 266  ARG A N   1 
ATOM   1970  C  CA  . ARG A  1 265 ? 60.073  38.876  5.308   1.00 22.12 ? 266  ARG A CA  1 
ATOM   1971  C  C   . ARG A  1 265 ? 59.365  40.119  5.841   1.00 22.02 ? 266  ARG A C   1 
ATOM   1972  O  O   . ARG A  1 265 ? 60.005  41.115  6.159   1.00 21.25 ? 266  ARG A O   1 
ATOM   1973  C  CB  . ARG A  1 265 ? 60.951  38.302  6.407   1.00 24.45 ? 266  ARG A CB  1 
ATOM   1974  C  CG  . ARG A  1 265 ? 60.234  37.688  7.581   1.00 33.51 ? 266  ARG A CG  1 
ATOM   1975  C  CD  . ARG A  1 265 ? 61.267  37.215  8.613   1.00 42.27 ? 266  ARG A CD  1 
ATOM   1976  N  NE  . ARG A  1 265 ? 60.646  36.647  9.807   1.00 48.50 ? 266  ARG A NE  1 
ATOM   1977  C  CZ  . ARG A  1 265 ? 60.098  37.356  10.798  1.00 54.84 ? 266  ARG A CZ  1 
ATOM   1978  N  NH1 . ARG A  1 265 ? 60.080  38.694  10.775  1.00 49.09 ? 266  ARG A NH1 1 
ATOM   1979  N  NH2 . ARG A  1 265 ? 59.554  36.707  11.833  1.00 55.15 ? 266  ARG A NH2 1 
ATOM   1980  N  N   . MET A  1 266 ? 58.050  40.057  5.931   1.00 21.22 ? 267  MET A N   1 
ATOM   1981  C  CA  . MET A  1 266 ? 57.260  41.200  6.347   1.00 23.70 ? 267  MET A CA  1 
ATOM   1982  C  C   . MET A  1 266 ? 56.250  40.737  7.360   1.00 23.85 ? 267  MET A C   1 
ATOM   1983  O  O   . MET A  1 266 ? 55.449  39.858  7.072   1.00 27.00 ? 267  MET A O   1 
ATOM   1984  C  CB  . MET A  1 266 ? 56.560  41.804  5.151   1.00 23.08 ? 267  MET A CB  1 
ATOM   1985  C  CG  . MET A  1 266 ? 57.447  41.842  3.916   1.00 29.63 ? 267  MET A CG  1 
ATOM   1986  S  SD  . MET A  1 266 ? 56.643  42.721  2.594   1.00 34.18 ? 267  MET A SD  1 
ATOM   1987  C  CE  . MET A  1 266 ? 57.712  42.419  1.216   1.00 43.20 ? 267  MET A CE  1 
ATOM   1988  N  N   . GLU A  1 267 ? 56.316  41.306  8.559   1.00 21.14 ? 268  GLU A N   1 
ATOM   1989  C  CA  . GLU A  1 267 ? 55.457  40.908  9.635   1.00 19.50 ? 268  GLU A CA  1 
ATOM   1990  C  C   . GLU A  1 267 ? 54.832  42.119  10.296  1.00 17.37 ? 268  GLU A C   1 
ATOM   1991  O  O   . GLU A  1 267 ? 55.539  43.050  10.698  1.00 13.67 ? 268  GLU A O   1 
ATOM   1992  C  CB  . GLU A  1 267 ? 56.220  40.113  10.706  1.00 19.36 ? 268  GLU A CB  1 
ATOM   1993  C  CG  . GLU A  1 267 ? 55.241  39.411  11.664  1.00 23.06 ? 268  GLU A CG  1 
ATOM   1994  C  CD  . GLU A  1 267 ? 55.900  38.621  12.792  1.00 30.31 ? 268  GLU A CD  1 
ATOM   1995  O  OE1 . GLU A  1 267 ? 57.037  38.126  12.607  1.00 31.05 ? 268  GLU A OE1 1 
ATOM   1996  O  OE2 . GLU A  1 267 ? 55.243  38.497  13.856  1.00 30.55 ? 268  GLU A OE2 1 
ATOM   1997  N  N   . ALA A  1 268 ? 53.510  42.056  10.456  1.00 14.97 ? 269  ALA A N   1 
ATOM   1998  C  CA  . ALA A  1 268 ? 52.763  43.060  11.169  1.00 15.66 ? 269  ALA A CA  1 
ATOM   1999  C  C   . ALA A  1 268 ? 52.577  42.612  12.607  1.00 16.42 ? 269  ALA A C   1 
ATOM   2000  O  O   . ALA A  1 268 ? 52.512  41.416  12.888  1.00 19.80 ? 269  ALA A O   1 
ATOM   2001  C  CB  . ALA A  1 268 ? 51.417  43.306  10.478  1.00 15.47 ? 269  ALA A CB  1 
ATOM   2002  N  N   . PHE A  1 269 ? 52.496  43.564  13.525  1.00 16.35 ? 270  PHE A N   1 
ATOM   2003  C  CA  . PHE A  1 269 ? 52.304  43.239  14.938  1.00 18.93 ? 270  PHE A CA  1 
ATOM   2004  C  C   . PHE A  1 269 ? 51.419  44.265  15.602  1.00 17.78 ? 270  PHE A C   1 
ATOM   2005  O  O   . PHE A  1 269 ? 51.269  45.385  15.098  1.00 17.93 ? 270  PHE A O   1 
ATOM   2006  C  CB  . PHE A  1 269 ? 53.669  43.211  15.649  1.00 21.46 ? 270  PHE A CB  1 
ATOM   2007  C  CG  . PHE A  1 269 ? 54.382  44.535  15.631  1.00 18.18 ? 270  PHE A CG  1 
ATOM   2008  C  CD1 . PHE A  1 269 ? 55.023  44.978  14.478  1.00 15.92 ? 270  PHE A CD1 1 
ATOM   2009  C  CD2 . PHE A  1 269 ? 54.373  45.358  16.754  1.00 16.54 ? 270  PHE A CD2 1 
ATOM   2010  C  CE1 . PHE A  1 269 ? 55.668  46.224  14.459  1.00 18.31 ? 270  PHE A CE1 1 
ATOM   2011  C  CE2 . PHE A  1 269 ? 55.044  46.598  16.757  1.00 17.20 ? 270  PHE A CE2 1 
ATOM   2012  C  CZ  . PHE A  1 269 ? 55.690  47.029  15.621  1.00 16.75 ? 270  PHE A CZ  1 
ATOM   2013  N  N   . VAL A  1 270 ? 50.847  43.885  16.734  1.00 17.51 ? 271  VAL A N   1 
ATOM   2014  C  CA  . VAL A  1 270 ? 50.157  44.826  17.606  1.00 18.93 ? 271  VAL A CA  1 
ATOM   2015  C  C   . VAL A  1 270 ? 50.846  44.778  18.974  1.00 19.17 ? 271  VAL A C   1 
ATOM   2016  O  O   . VAL A  1 270 ? 51.080  43.711  19.513  1.00 19.12 ? 271  VAL A O   1 
ATOM   2017  C  CB  . VAL A  1 270 ? 48.658  44.513  17.742  1.00 21.26 ? 271  VAL A CB  1 
ATOM   2018  C  CG1 . VAL A  1 270 ? 48.009  45.504  18.693  1.00 19.49 ? 271  VAL A CG1 1 
ATOM   2019  C  CG2 . VAL A  1 270 ? 47.964  44.572  16.383  1.00 19.89 ? 271  VAL A CG2 1 
ATOM   2020  N  N   . VAL A  1 271 ? 51.159  45.944  19.530  1.00 20.58 ? 272  VAL A N   1 
ATOM   2021  C  CA  . VAL A  1 271 ? 51.961  46.090  20.761  1.00 19.53 ? 272  VAL A CA  1 
ATOM   2022  C  C   . VAL A  1 271 ? 51.405  45.293  21.943  1.00 19.82 ? 272  VAL A C   1 
ATOM   2023  O  O   . VAL A  1 271 ? 52.153  44.704  22.735  1.00 21.48 ? 272  VAL A O   1 
ATOM   2024  C  CB  . VAL A  1 271 ? 52.135  47.598  21.118  1.00 20.91 ? 272  VAL A CB  1 
ATOM   2025  C  CG1 . VAL A  1 271 ? 50.775  48.252  21.437  1.00 17.23 ? 272  VAL A CG1 1 
ATOM   2026  C  CG2 . VAL A  1 271 ? 53.132  47.791  22.274  1.00 20.96 ? 272  VAL A CG2 1 
ATOM   2027  N  N   . TYR A  1 272 ? 50.089  45.214  22.034  1.00 22.44 ? 273  TYR A N   1 
ATOM   2028  C  CA  . TYR A  1 272 ? 49.434  44.517  23.133  1.00 21.52 ? 273  TYR A CA  1 
ATOM   2029  C  C   . TYR A  1 272 ? 49.682  43.004  23.145  1.00 21.26 ? 273  TYR A C   1 
ATOM   2030  O  O   . TYR A  1 272 ? 49.401  42.350  24.137  1.00 23.16 ? 273  TYR A O   1 
ATOM   2031  C  CB  . TYR A  1 272 ? 47.943  44.847  23.153  1.00 23.10 ? 273  TYR A CB  1 
ATOM   2032  C  CG  . TYR A  1 272 ? 47.696  46.332  23.116  1.00 20.65 ? 273  TYR A CG  1 
ATOM   2033  C  CD1 . TYR A  1 272 ? 47.864  47.108  24.245  1.00 22.20 ? 273  TYR A CD1 1 
ATOM   2034  C  CD2 . TYR A  1 272 ? 47.288  46.958  21.936  1.00 21.18 ? 273  TYR A CD2 1 
ATOM   2035  C  CE1 . TYR A  1 272 ? 47.645  48.495  24.207  1.00 24.53 ? 273  TYR A CE1 1 
ATOM   2036  C  CE2 . TYR A  1 272 ? 47.059  48.312  21.879  1.00 22.30 ? 273  TYR A CE2 1 
ATOM   2037  C  CZ  . TYR A  1 272 ? 47.261  49.089  23.018  1.00 26.36 ? 273  TYR A CZ  1 
ATOM   2038  O  OH  . TYR A  1 272 ? 47.023  50.437  22.964  1.00 21.69 ? 273  TYR A OH  1 
ATOM   2039  N  N   . ARG A  1 273 ? 50.243  42.466  22.068  1.00 21.72 ? 274  ARG A N   1 
ATOM   2040  C  CA  . ARG A  1 273 ? 50.775  41.099  22.041  1.00 23.14 ? 274  ARG A CA  1 
ATOM   2041  C  C   . ARG A  1 273 ? 51.680  40.767  23.227  1.00 23.34 ? 274  ARG A C   1 
ATOM   2042  O  O   . ARG A  1 273 ? 51.567  39.681  23.814  1.00 21.86 ? 274  ARG A O   1 
ATOM   2043  C  CB  . ARG A  1 273 ? 51.599  40.845  20.763  1.00 21.56 ? 274  ARG A CB  1 
ATOM   2044  C  CG  . ARG A  1 273 ? 52.016  39.375  20.625  1.00 24.83 ? 274  ARG A CG  1 
ATOM   2045  C  CD  . ARG A  1 273 ? 53.119  39.152  19.634  1.00 23.59 ? 274  ARG A CD  1 
ATOM   2046  N  NE  . ARG A  1 273 ? 52.732  39.614  18.305  1.00 24.62 ? 274  ARG A NE  1 
ATOM   2047  C  CZ  . ARG A  1 273 ? 53.431  39.385  17.210  1.00 22.09 ? 274  ARG A CZ  1 
ATOM   2048  N  NH1 . ARG A  1 273 ? 54.560  38.683  17.280  1.00 26.54 ? 274  ARG A NH1 1 
ATOM   2049  N  NH2 . ARG A  1 273 ? 53.005  39.858  16.048  1.00 24.74 ? 274  ARG A NH2 1 
ATOM   2050  N  N   . TRP A  1 274 ? 52.591  41.688  23.558  1.00 24.38 ? 275  TRP A N   1 
ATOM   2051  C  CA  . TRP A  1 274 ? 53.578  41.440  24.633  1.00 24.68 ? 275  TRP A CA  1 
ATOM   2052  C  C   . TRP A  1 274 ? 53.040  41.865  25.994  1.00 24.57 ? 275  TRP A C   1 
ATOM   2053  O  O   . TRP A  1 274 ? 52.740  43.037  26.226  1.00 24.72 ? 275  TRP A O   1 
ATOM   2054  C  CB  . TRP A  1 274 ? 54.911  42.129  24.309  1.00 24.71 ? 275  TRP A CB  1 
ATOM   2055  C  CG  . TRP A  1 274 ? 55.604  41.506  23.119  1.00 22.57 ? 275  TRP A CG  1 
ATOM   2056  C  CD1 . TRP A  1 274 ? 56.465  40.463  23.133  1.00 22.61 ? 275  TRP A CD1 1 
ATOM   2057  C  CD2 . TRP A  1 274 ? 55.483  41.908  21.750  1.00 16.20 ? 275  TRP A CD2 1 
ATOM   2058  N  NE1 . TRP A  1 274 ? 56.886  40.176  21.861  1.00 27.51 ? 275  TRP A NE1 1 
ATOM   2059  C  CE2 . TRP A  1 274 ? 56.288  41.045  20.990  1.00 21.95 ? 275  TRP A CE2 1 
ATOM   2060  C  CE3 . TRP A  1 274 ? 54.741  42.886  21.096  1.00 20.71 ? 275  TRP A CE3 1 
ATOM   2061  C  CZ2 . TRP A  1 274 ? 56.381  41.135  19.599  1.00 21.14 ? 275  TRP A CZ2 1 
ATOM   2062  C  CZ3 . TRP A  1 274 ? 54.841  42.986  19.723  1.00 24.13 ? 275  TRP A CZ3 1 
ATOM   2063  C  CH2 . TRP A  1 274 ? 55.663  42.119  18.989  1.00 20.16 ? 275  TRP A CH2 1 
ATOM   2064  N  N   . GLN A  1 275 ? 52.904  40.899  26.899  1.00 26.68 ? 276  GLN A N   1 
ATOM   2065  C  CA  . GLN A  1 275 ? 52.289  41.140  28.205  1.00 28.79 ? 276  GLN A CA  1 
ATOM   2066  C  C   . GLN A  1 275 ? 53.203  40.604  29.305  1.00 29.28 ? 276  GLN A C   1 
ATOM   2067  O  O   . GLN A  1 275 ? 54.299  40.126  29.015  1.00 29.49 ? 276  GLN A O   1 
ATOM   2068  C  CB  . GLN A  1 275 ? 50.902  40.474  28.285  1.00 30.39 ? 276  GLN A CB  1 
ATOM   2069  C  CG  . GLN A  1 275 ? 49.800  41.128  27.421  1.00 33.08 ? 276  GLN A CG  1 
ATOM   2070  C  CD  . GLN A  1 275 ? 49.396  42.548  27.866  1.00 39.12 ? 276  GLN A CD  1 
ATOM   2071  O  OE1 . GLN A  1 275 ? 49.397  42.881  29.065  1.00 40.89 ? 276  GLN A OE1 1 
ATOM   2072  N  NE2 . GLN A  1 275 ? 49.031  43.389  26.880  1.00 40.90 ? 276  GLN A NE2 1 
ATOM   2073  N  N   . GLY A  1 276 ? 52.747  40.716  30.558  1.00 30.68 ? 277  GLY A N   1 
ATOM   2074  C  CA  . GLY A  1 276 ? 53.427  40.126  31.710  1.00 30.25 ? 277  GLY A CA  1 
ATOM   2075  C  C   . GLY A  1 276 ? 54.900  40.505  31.811  1.00 30.44 ? 277  GLY A C   1 
ATOM   2076  O  O   . GLY A  1 276 ? 55.268  41.677  31.625  1.00 29.80 ? 277  GLY A O   1 
ATOM   2077  N  N   . ASP A  1 277 ? 55.740  39.510  32.081  1.00 28.87 ? 278  ASP A N   1 
ATOM   2078  C  CA  . ASP A  1 277 ? 57.165  39.744  32.327  1.00 29.44 ? 278  ASP A CA  1 
ATOM   2079  C  C   . ASP A  1 277 ? 57.879  40.398  31.161  1.00 27.91 ? 278  ASP A C   1 
ATOM   2080  O  O   . ASP A  1 277 ? 58.622  41.345  31.349  1.00 28.99 ? 278  ASP A O   1 
ATOM   2081  C  CB  . ASP A  1 277 ? 57.865  38.429  32.688  1.00 31.61 ? 278  ASP A CB  1 
ATOM   2082  C  CG  . ASP A  1 277 ? 57.595  37.986  34.131  1.00 37.69 ? 278  ASP A CG  1 
ATOM   2083  O  OD1 . ASP A  1 277 ? 56.891  38.691  34.890  1.00 33.42 ? 278  ASP A OD1 1 
ATOM   2084  O  OD2 . ASP A  1 277 ? 58.109  36.910  34.497  1.00 48.39 ? 278  ASP A OD2 1 
ATOM   2085  N  N   . ALA A  1 278 ? 57.661  39.882  29.956  1.00 28.99 ? 279  ALA A N   1 
ATOM   2086  C  CA  . ALA A  1 278 ? 58.230  40.461  28.738  1.00 27.11 ? 279  ALA A CA  1 
ATOM   2087  C  C   . ALA A  1 278 ? 57.932  41.956  28.619  1.00 25.30 ? 279  ALA A C   1 
ATOM   2088  O  O   . ALA A  1 278 ? 58.803  42.728  28.285  1.00 24.74 ? 279  ALA A O   1 
ATOM   2089  C  CB  . ALA A  1 278 ? 57.713  39.721  27.523  1.00 28.37 ? 279  ALA A CB  1 
ATOM   2090  N  N   . ARG A  1 279 ? 56.706  42.353  28.943  1.00 24.59 ? 280  ARG A N   1 
ATOM   2091  C  CA  . ARG A  1 279 ? 56.290  43.743  28.868  1.00 23.77 ? 280  ARG A CA  1 
ATOM   2092  C  C   . ARG A  1 279 ? 56.923  44.552  29.994  1.00 26.54 ? 280  ARG A C   1 
ATOM   2093  O  O   . ARG A  1 279 ? 57.469  45.629  29.760  1.00 26.32 ? 280  ARG A O   1 
ATOM   2094  C  CB  . ARG A  1 279 ? 54.773  43.843  28.950  1.00 24.60 ? 280  ARG A CB  1 
ATOM   2095  C  CG  . ARG A  1 279 ? 54.244  45.241  29.034  1.00 22.72 ? 280  ARG A CG  1 
ATOM   2096  C  CD  . ARG A  1 279 ? 52.729  45.279  29.076  1.00 24.46 ? 280  ARG A CD  1 
ATOM   2097  N  NE  . ARG A  1 279 ? 52.300  46.669  29.181  1.00 25.11 ? 280  ARG A NE  1 
ATOM   2098  C  CZ  . ARG A  1 279 ? 52.088  47.331  30.318  1.00 30.79 ? 280  ARG A CZ  1 
ATOM   2099  N  NH1 . ARG A  1 279 ? 52.255  46.752  31.504  1.00 29.66 ? 280  ARG A NH1 1 
ATOM   2100  N  NH2 . ARG A  1 279 ? 51.727  48.606  30.259  1.00 30.98 ? 280  ARG A NH2 1 
ATOM   2101  N  N   . GLN A  1 280 ? 56.844  44.032  31.213  1.00 26.47 ? 281  GLN A N   1 
ATOM   2102  C  CA  . GLN A  1 280 ? 57.440  44.697  32.359  1.00 29.27 ? 281  GLN A CA  1 
ATOM   2103  C  C   . GLN A  1 280 ? 58.949  44.960  32.167  1.00 28.13 ? 281  GLN A C   1 
ATOM   2104  O  O   . GLN A  1 280 ? 59.411  46.070  32.406  1.00 28.20 ? 281  GLN A O   1 
ATOM   2105  C  CB  . GLN A  1 280 ? 57.187  43.894  33.642  1.00 30.21 ? 281  GLN A CB  1 
ATOM   2106  C  CG  . GLN A  1 280 ? 57.285  44.723  34.912  1.00 38.40 ? 281  GLN A CG  1 
ATOM   2107  C  CD  . GLN A  1 280 ? 56.077  45.630  35.152  1.00 42.72 ? 281  GLN A CD  1 
ATOM   2108  O  OE1 . GLN A  1 280 ? 55.227  45.801  34.283  1.00 44.76 ? 281  GLN A OE1 1 
ATOM   2109  N  NE2 . GLN A  1 280 ? 56.001  46.204  36.351  1.00 42.69 ? 281  GLN A NE2 1 
ATOM   2110  N  N   . LYS A  1 281 ? 59.704  43.949  31.740  1.00 27.24 ? 282  LYS A N   1 
ATOM   2111  C  CA  . LYS A  1 281 ? 61.109  44.133  31.403  1.00 27.73 ? 282  LYS A CA  1 
ATOM   2112  C  C   . LYS A  1 281 ? 61.312  45.229  30.352  1.00 28.47 ? 282  LYS A C   1 
ATOM   2113  O  O   . LYS A  1 281 ? 62.274  46.000  30.434  1.00 29.57 ? 282  LYS A O   1 
ATOM   2114  C  CB  . LYS A  1 281 ? 61.706  42.833  30.857  1.00 29.30 ? 282  LYS A CB  1 
ATOM   2115  C  CG  . LYS A  1 281 ? 63.237  42.885  30.671  1.00 36.01 ? 282  LYS A CG  1 
ATOM   2116  C  CD  . LYS A  1 281 ? 63.784  41.576  30.091  1.00 44.78 ? 282  LYS A CD  1 
ATOM   2117  N  N   . ALA A  1 282 ? 60.438  45.281  29.342  1.00 25.65 ? 283  ALA A N   1 
ATOM   2118  C  CA  . ALA A  1 282 ? 60.606  46.261  28.275  1.00 24.02 ? 283  ALA A CA  1 
ATOM   2119  C  C   . ALA A  1 282 ? 60.456  47.639  28.853  1.00 23.64 ? 283  ALA A C   1 
ATOM   2120  O  O   . ALA A  1 282 ? 61.226  48.526  28.516  1.00 23.08 ? 283  ALA A O   1 
ATOM   2121  C  CB  . ALA A  1 282 ? 59.579  46.043  27.118  1.00 24.04 ? 283  ALA A CB  1 
ATOM   2122  N  N   . LEU A  1 283 ? 59.442  47.814  29.711  1.00 23.61 ? 284  LEU A N   1 
ATOM   2123  C  CA  . LEU A  1 283 ? 59.163  49.107  30.335  1.00 24.91 ? 284  LEU A CA  1 
ATOM   2124  C  C   . LEU A  1 283 ? 60.330  49.565  31.216  1.00 26.44 ? 284  LEU A C   1 
ATOM   2125  O  O   . LEU A  1 283 ? 60.759  50.732  31.157  1.00 26.89 ? 284  LEU A O   1 
ATOM   2126  C  CB  . LEU A  1 283 ? 57.883  49.049  31.165  1.00 25.32 ? 284  LEU A CB  1 
ATOM   2127  C  CG  . LEU A  1 283 ? 56.534  49.079  30.439  1.00 26.49 ? 284  LEU A CG  1 
ATOM   2128  C  CD1 . LEU A  1 283 ? 55.354  48.809  31.396  1.00 19.61 ? 284  LEU A CD1 1 
ATOM   2129  C  CD2 . LEU A  1 283 ? 56.382  50.428  29.737  1.00 24.04 ? 284  LEU A CD2 1 
ATOM   2130  N  N   . LYS A  1 284 ? 60.843  48.648  32.033  1.00 27.83 ? 285  LYS A N   1 
ATOM   2131  C  CA  . LYS A  1 284 ? 62.003  48.953  32.871  1.00 27.72 ? 285  LYS A CA  1 
ATOM   2132  C  C   . LYS A  1 284 ? 63.224  49.290  32.010  1.00 27.78 ? 285  LYS A C   1 
ATOM   2133  O  O   . LYS A  1 284 ? 63.988  50.180  32.378  1.00 28.94 ? 285  LYS A O   1 
ATOM   2134  C  CB  . LYS A  1 284 ? 62.303  47.813  33.855  1.00 27.88 ? 285  LYS A CB  1 
ATOM   2135  C  CG  . LYS A  1 284 ? 61.198  47.586  34.914  1.00 29.71 ? 285  LYS A CG  1 
ATOM   2136  C  CD  . LYS A  1 284 ? 61.419  46.285  35.730  1.00 36.43 ? 285  LYS A CD  1 
ATOM   2137  C  CE  . LYS A  1 284 ? 60.473  46.201  36.944  1.00 42.73 ? 285  LYS A CE  1 
ATOM   2138  N  NZ  . LYS A  1 284 ? 60.612  44.950  37.780  1.00 45.33 ? 285  LYS A NZ  1 
ATOM   2139  N  N   . ASP A  1 285 ? 63.411  48.614  30.869  1.00 27.05 ? 286  ASP A N   1 
ATOM   2140  C  CA  . ASP A  1 285 ? 64.520  48.976  29.971  1.00 27.04 ? 286  ASP A CA  1 
ATOM   2141  C  C   . ASP A  1 285 ? 64.356  50.387  29.397  1.00 27.86 ? 286  ASP A C   1 
ATOM   2142  O  O   . ASP A  1 285 ? 65.334  51.114  29.254  1.00 29.21 ? 286  ASP A O   1 
ATOM   2143  C  CB  . ASP A  1 285 ? 64.677  47.993  28.802  1.00 28.16 ? 286  ASP A CB  1 
ATOM   2144  C  CG  . ASP A  1 285 ? 65.369  46.689  29.193  1.00 29.84 ? 286  ASP A CG  1 
ATOM   2145  O  OD1 . ASP A  1 285 ? 65.705  46.519  30.383  1.00 31.38 ? 286  ASP A OD1 1 
ATOM   2146  O  OD2 . ASP A  1 285 ? 65.582  45.823  28.308  1.00 29.34 ? 286  ASP A OD2 1 
ATOM   2147  N  N   . LEU A  1 286 ? 63.123  50.761  29.051  1.00 27.86 ? 287  LEU A N   1 
ATOM   2148  C  CA  . LEU A  1 286 ? 62.850  52.062  28.448  1.00 26.71 ? 287  LEU A CA  1 
ATOM   2149  C  C   . LEU A  1 286 ? 63.072  53.169  29.477  1.00 27.23 ? 287  LEU A C   1 
ATOM   2150  O  O   . LEU A  1 286 ? 63.717  54.176  29.166  1.00 26.31 ? 287  LEU A O   1 
ATOM   2151  C  CB  . LEU A  1 286 ? 61.420  52.139  27.877  1.00 24.72 ? 287  LEU A CB  1 
ATOM   2152  C  CG  . LEU A  1 286 ? 61.197  51.342  26.570  1.00 29.21 ? 287  LEU A CG  1 
ATOM   2153  C  CD1 . LEU A  1 286 ? 59.710  51.016  26.330  1.00 21.80 ? 287  LEU A CD1 1 
ATOM   2154  C  CD2 . LEU A  1 286 ? 61.792  52.081  25.355  1.00 17.33 ? 287  LEU A CD2 1 
ATOM   2155  N  N   . LEU A  1 287 ? 62.512  52.994  30.677  1.00 27.30 ? 288  LEU A N   1 
ATOM   2156  C  CA  . LEU A  1 287 ? 62.713  53.949  31.772  1.00 28.35 ? 288  LEU A CA  1 
ATOM   2157  C  C   . LEU A  1 287 ? 64.210  54.105  32.046  1.00 28.43 ? 288  LEU A C   1 
ATOM   2158  O  O   . LEU A  1 287 ? 64.728  55.217  32.029  1.00 30.15 ? 288  LEU A O   1 
ATOM   2159  C  CB  . LEU A  1 287 ? 61.997  53.495  33.054  1.00 28.01 ? 288  LEU A CB  1 
ATOM   2160  C  CG  . LEU A  1 287 ? 62.189  54.358  34.328  1.00 28.91 ? 288  LEU A CG  1 
ATOM   2161  C  CD1 . LEU A  1 287 ? 61.764  55.782  34.108  1.00 25.79 ? 288  LEU A CD1 1 
ATOM   2162  C  CD2 . LEU A  1 287 ? 61.455  53.788  35.548  1.00 25.61 ? 288  LEU A CD2 1 
ATOM   2163  N  N   . LYS A  1 288 ? 64.901  52.988  32.282  1.00 30.09 ? 289  LYS A N   1 
ATOM   2164  C  CA  . LYS A  1 288 ? 66.372  53.010  32.437  1.00 30.11 ? 289  LYS A CA  1 
ATOM   2165  C  C   . LYS A  1 288 ? 66.993  53.884  31.370  1.00 31.46 ? 289  LYS A C   1 
ATOM   2166  O  O   . LYS A  1 288 ? 67.637  54.903  31.677  1.00 34.15 ? 289  LYS A O   1 
ATOM   2167  C  CB  . LYS A  1 288 ? 66.953  51.595  32.367  1.00 30.91 ? 289  LYS A CB  1 
ATOM   2168  C  CG  . LYS A  1 288 ? 68.461  51.484  32.634  1.00 33.97 ? 289  LYS A CG  1 
ATOM   2169  C  CD  . LYS A  1 288 ? 68.955  50.050  32.405  1.00 35.84 ? 289  LYS A CD  1 
ATOM   2170  N  N   . TRP A  1 289 ? 66.778  53.522  30.108  1.00 31.06 ? 290  TRP A N   1 
ATOM   2171  C  CA  . TRP A  1 289 ? 67.402  54.255  29.009  1.00 29.17 ? 290  TRP A CA  1 
ATOM   2172  C  C   . TRP A  1 289 ? 67.109  55.752  29.044  1.00 28.59 ? 290  TRP A C   1 
ATOM   2173  O  O   . TRP A  1 289 ? 67.982  56.567  28.732  1.00 32.39 ? 290  TRP A O   1 
ATOM   2174  C  CB  . TRP A  1 289 ? 66.999  53.668  27.650  1.00 28.87 ? 290  TRP A CB  1 
ATOM   2175  C  CG  . TRP A  1 289 ? 67.650  52.378  27.361  1.00 30.99 ? 290  TRP A CG  1 
ATOM   2176  C  CD1 . TRP A  1 289 ? 68.856  51.960  27.821  1.00 32.03 ? 290  TRP A CD1 1 
ATOM   2177  C  CD2 . TRP A  1 289 ? 67.148  51.318  26.535  1.00 31.15 ? 290  TRP A CD2 1 
ATOM   2178  N  NE1 . TRP A  1 289 ? 69.144  50.708  27.337  1.00 34.02 ? 290  TRP A NE1 1 
ATOM   2179  C  CE2 . TRP A  1 289 ? 68.107  50.287  26.552  1.00 31.44 ? 290  TRP A CE2 1 
ATOM   2180  C  CE3 . TRP A  1 289 ? 65.981  51.138  25.785  1.00 31.19 ? 290  TRP A CE3 1 
ATOM   2181  C  CZ2 . TRP A  1 289 ? 67.937  49.090  25.850  1.00 31.17 ? 290  TRP A CZ2 1 
ATOM   2182  C  CZ3 . TRP A  1 289 ? 65.811  49.944  25.090  1.00 26.15 ? 290  TRP A CZ3 1 
ATOM   2183  C  CH2 . TRP A  1 289 ? 66.788  48.948  25.116  1.00 27.76 ? 290  TRP A CH2 1 
ATOM   2184  N  N   . VAL A  1 290 ? 65.894  56.125  29.405  1.00 28.07 ? 291  VAL A N   1 
ATOM   2185  C  CA  . VAL A  1 290 ? 65.556  57.528  29.489  1.00 29.64 ? 291  VAL A CA  1 
ATOM   2186  C  C   . VAL A  1 290 ? 66.325  58.170  30.653  1.00 34.16 ? 291  VAL A C   1 
ATOM   2187  O  O   . VAL A  1 290 ? 66.930  59.231  30.475  1.00 33.56 ? 291  VAL A O   1 
ATOM   2188  C  CB  . VAL A  1 290 ? 64.039  57.755  29.629  1.00 30.46 ? 291  VAL A CB  1 
ATOM   2189  C  CG1 . VAL A  1 290 ? 63.756  59.180  30.108  1.00 28.74 ? 291  VAL A CG1 1 
ATOM   2190  C  CG2 . VAL A  1 290 ? 63.326  57.473  28.285  1.00 27.76 ? 291  VAL A CG2 1 
ATOM   2191  N  N   . LEU A  1 291 ? 66.343  57.511  31.824  1.00 34.95 ? 292  LEU A N   1 
ATOM   2192  C  CA  . LEU A  1 291 ? 67.115  58.032  32.964  1.00 35.93 ? 292  LEU A CA  1 
ATOM   2193  C  C   . LEU A  1 291 ? 68.596  58.198  32.648  1.00 37.04 ? 292  LEU A C   1 
ATOM   2194  O  O   . LEU A  1 291 ? 69.221  59.113  33.181  1.00 38.22 ? 292  LEU A O   1 
ATOM   2195  C  CB  . LEU A  1 291 ? 66.933  57.171  34.218  1.00 35.80 ? 292  LEU A CB  1 
ATOM   2196  C  CG  . LEU A  1 291 ? 65.507  57.197  34.780  1.00 33.38 ? 292  LEU A CG  1 
ATOM   2197  C  CD1 . LEU A  1 291 ? 65.383  56.350  36.046  1.00 33.65 ? 292  LEU A CD1 1 
ATOM   2198  C  CD2 . LEU A  1 291 ? 65.074  58.621  35.018  1.00 35.09 ? 292  LEU A CD2 1 
ATOM   2199  N  N   . GLU A  1 292 ? 69.136  57.351  31.763  1.00 37.48 ? 293  GLU A N   1 
ATOM   2200  C  CA  . GLU A  1 292 ? 70.558  57.419  31.381  1.00 36.44 ? 293  GLU A CA  1 
ATOM   2201  C  C   . GLU A  1 292 ? 70.859  58.372  30.241  1.00 36.54 ? 293  GLU A C   1 
ATOM   2202  O  O   . GLU A  1 292 ? 72.015  58.476  29.825  1.00 39.21 ? 293  GLU A O   1 
ATOM   2203  C  CB  . GLU A  1 292 ? 71.071  56.048  30.951  1.00 35.51 ? 293  GLU A CB  1 
ATOM   2204  C  CG  . GLU A  1 292 ? 71.106  55.033  32.038  1.00 40.01 ? 293  GLU A CG  1 
ATOM   2205  C  CD  . GLU A  1 292 ? 71.633  53.688  31.563  1.00 45.94 ? 293  GLU A CD  1 
ATOM   2206  O  OE1 . GLU A  1 292 ? 71.957  53.545  30.354  1.00 47.87 ? 293  GLU A OE1 1 
ATOM   2207  O  OE2 . GLU A  1 292 ? 71.720  52.770  32.414  1.00 47.30 ? 293  GLU A OE2 1 
ATOM   2208  N  N   . GLY A  1 293 ? 69.837  59.012  29.680  1.00 36.99 ? 294  GLY A N   1 
ATOM   2209  C  CA  . GLY A  1 293 ? 70.023  59.912  28.534  1.00 34.57 ? 294  GLY A CA  1 
ATOM   2210  C  C   . GLY A  1 293 ? 70.289  59.227  27.205  1.00 34.25 ? 294  GLY A C   1 
ATOM   2211  O  O   . GLY A  1 293 ? 70.541  59.903  26.197  1.00 35.78 ? 294  GLY A O   1 
ATOM   2212  N  N   . LYS A  1 294 ? 70.232  57.894  27.174  1.00 34.87 ? 295  LYS A N   1 
ATOM   2213  C  CA  . LYS A  1 294 ? 70.420  57.155  25.922  1.00 35.72 ? 295  LYS A CA  1 
ATOM   2214  C  C   . LYS A  1 294 ? 69.187  57.296  25.016  1.00 33.37 ? 295  LYS A C   1 
ATOM   2215  O  O   . LYS A  1 294 ? 69.282  57.136  23.788  1.00 33.56 ? 295  LYS A O   1 
ATOM   2216  C  CB  . LYS A  1 294 ? 70.728  55.683  26.188  1.00 38.18 ? 295  LYS A CB  1 
ATOM   2217  C  CG  . LYS A  1 294 ? 72.100  55.420  26.811  1.00 41.67 ? 295  LYS A CG  1 
ATOM   2218  C  CD  . LYS A  1 294 ? 72.362  53.917  26.879  1.00 46.65 ? 295  LYS A CD  1 
ATOM   2219  C  CE  . LYS A  1 294 ? 73.811  53.567  27.181  1.00 49.14 ? 295  LYS A CE  1 
ATOM   2220  N  NZ  . LYS A  1 294 ? 73.941  52.104  27.474  1.00 50.53 ? 295  LYS A NZ  1 
ATOM   2221  N  N   . ILE A  1 295 ? 68.051  57.618  25.633  1.00 30.66 ? 296  ILE A N   1 
ATOM   2222  C  CA  . ILE A  1 295 ? 66.847  57.983  24.907  1.00 29.06 ? 296  ILE A CA  1 
ATOM   2223  C  C   . ILE A  1 295 ? 66.355  59.311  25.440  1.00 29.00 ? 296  ILE A C   1 
ATOM   2224  O  O   . ILE A  1 295 ? 65.933  59.420  26.590  1.00 28.09 ? 296  ILE A O   1 
ATOM   2225  C  CB  . ILE A  1 295 ? 65.693  56.945  25.063  1.00 27.18 ? 296  ILE A CB  1 
ATOM   2226  C  CG1 . ILE A  1 295 ? 65.994  55.642  24.322  1.00 28.58 ? 296  ILE A CG1 1 
ATOM   2227  C  CG2 . ILE A  1 295 ? 64.388  57.507  24.512  1.00 21.50 ? 296  ILE A CG2 1 
ATOM   2228  C  CD1 . ILE A  1 295 ? 64.956  54.536  24.629  1.00 27.91 ? 296  ILE A CD1 1 
ATOM   2229  N  N   . GLN A  1 296 ? 66.422  60.325  24.598  1.00 29.59 ? 297  GLN A N   1 
ATOM   2230  C  CA  A GLN A  1 296 ? 65.886  61.627  24.937  0.50 31.08 ? 297  GLN A CA  1 
ATOM   2231  C  CA  B GLN A  1 296 ? 65.890  61.626  24.952  0.50 30.93 ? 297  GLN A CA  1 
ATOM   2232  C  C   . GLN A  1 296 ? 64.402  61.647  24.624  1.00 31.61 ? 297  GLN A C   1 
ATOM   2233  O  O   . GLN A  1 296 ? 63.935  60.929  23.752  1.00 31.84 ? 297  GLN A O   1 
ATOM   2234  C  CB  A GLN A  1 296 ? 66.586  62.719  24.133  0.50 31.50 ? 297  GLN A CB  1 
ATOM   2235  C  CB  B GLN A  1 296 ? 66.617  62.741  24.192  0.50 31.28 ? 297  GLN A CB  1 
ATOM   2236  C  CG  A GLN A  1 296 ? 68.101  62.732  24.287  0.50 34.48 ? 297  GLN A CG  1 
ATOM   2237  C  CG  B GLN A  1 296 ? 68.151  62.749  24.353  0.50 33.25 ? 297  GLN A CG  1 
ATOM   2238  C  CD  A GLN A  1 296 ? 68.661  64.138  24.275  0.50 36.64 ? 297  GLN A CD  1 
ATOM   2239  C  CD  B GLN A  1 296 ? 68.626  63.153  25.746  0.50 34.26 ? 297  GLN A CD  1 
ATOM   2240  O  OE1 A GLN A  1 296 ? 68.203  65.004  25.020  0.50 40.67 ? 297  GLN A OE1 1 
ATOM   2241  O  OE1 B GLN A  1 296 ? 68.163  64.139  26.322  0.50 34.68 ? 297  GLN A OE1 1 
ATOM   2242  N  NE2 A GLN A  1 296 ? 69.660  64.373  23.431  0.50 39.94 ? 297  GLN A NE2 1 
ATOM   2243  N  NE2 B GLN A  1 296 ? 69.573  62.394  26.281  0.50 37.49 ? 297  GLN A NE2 1 
ATOM   2244  N  N   . TYR A  1 297 ? 63.668  62.486  25.321  1.00 33.59 ? 298  TYR A N   1 
ATOM   2245  C  CA  . TYR A  1 297 ? 62.260  62.622  25.062  1.00 35.06 ? 298  TYR A CA  1 
ATOM   2246  C  C   . TYR A  1 297 ? 61.949  64.038  24.654  1.00 35.61 ? 298  TYR A C   1 
ATOM   2247  O  O   . TYR A  1 297 ? 62.604  64.984  25.097  1.00 36.05 ? 298  TYR A O   1 
ATOM   2248  C  CB  . TYR A  1 297 ? 61.446  62.209  26.291  1.00 35.27 ? 298  TYR A CB  1 
ATOM   2249  C  CG  . TYR A  1 297 ? 61.640  63.039  27.545  1.00 37.60 ? 298  TYR A CG  1 
ATOM   2250  C  CD1 . TYR A  1 297 ? 60.859  64.166  27.781  1.00 40.25 ? 298  TYR A CD1 1 
ATOM   2251  C  CD2 . TYR A  1 297 ? 62.556  62.668  28.517  1.00 42.57 ? 298  TYR A CD2 1 
ATOM   2252  C  CE1 . TYR A  1 297 ? 61.010  64.922  28.941  1.00 43.08 ? 298  TYR A CE1 1 
ATOM   2253  C  CE2 . TYR A  1 297 ? 62.708  63.418  29.693  1.00 44.80 ? 298  TYR A CE2 1 
ATOM   2254  C  CZ  . TYR A  1 297 ? 61.923  64.537  29.893  1.00 44.32 ? 298  TYR A CZ  1 
ATOM   2255  O  OH  . TYR A  1 297 ? 62.056  65.299  31.030  1.00 52.64 ? 298  TYR A OH  1 
ATOM   2256  N  N   . LYS A  1 298 ? 60.975  64.175  23.772  1.00 34.72 ? 299  LYS A N   1 
ATOM   2257  C  CA  . LYS A  1 298 ? 60.316  65.444  23.585  1.00 36.28 ? 299  LYS A CA  1 
ATOM   2258  C  C   . LYS A  1 298 ? 58.832  65.190  23.421  1.00 34.54 ? 299  LYS A C   1 
ATOM   2259  O  O   . LYS A  1 298 ? 58.415  64.169  22.868  1.00 34.63 ? 299  LYS A O   1 
ATOM   2260  C  CB  . LYS A  1 298 ? 60.871  66.209  22.376  1.00 38.51 ? 299  LYS A CB  1 
ATOM   2261  C  CG  . LYS A  1 298 ? 60.866  67.730  22.574  1.00 40.59 ? 299  LYS A CG  1 
ATOM   2262  C  CD  . LYS A  1 298 ? 61.640  68.451  21.478  1.00 47.84 ? 299  LYS A CD  1 
ATOM   2263  C  CE  . LYS A  1 298 ? 62.168  69.819  21.939  1.00 51.79 ? 299  LYS A CE  1 
ATOM   2264  N  NZ  . LYS A  1 298 ? 63.322  69.719  22.926  1.00 51.46 ? 299  LYS A NZ  1 
ATOM   2265  N  N   . GLU A  1 299 ? 58.043  66.127  23.910  1.00 30.75 ? 300  GLU A N   1 
ATOM   2266  C  CA  . GLU A  1 299 ? 56.619  66.009  23.853  1.00 29.45 ? 300  GLU A CA  1 
ATOM   2267  C  C   . GLU A  1 299 ? 56.070  67.190  23.132  1.00 29.27 ? 300  GLU A C   1 
ATOM   2268  O  O   . GLU A  1 299 ? 56.705  68.244  23.052  1.00 29.39 ? 300  GLU A O   1 
ATOM   2269  C  CB  . GLU A  1 299 ? 56.036  65.942  25.250  1.00 29.59 ? 300  GLU A CB  1 
ATOM   2270  C  CG  . GLU A  1 299 ? 56.541  64.786  26.052  1.00 26.88 ? 300  GLU A CG  1 
ATOM   2271  C  CD  . GLU A  1 299 ? 55.924  64.753  27.428  1.00 31.92 ? 300  GLU A CD  1 
ATOM   2272  O  OE1 . GLU A  1 299 ? 56.181  65.692  28.226  1.00 32.14 ? 300  GLU A OE1 1 
ATOM   2273  O  OE2 . GLU A  1 299 ? 55.163  63.804  27.705  1.00 27.81 ? 300  GLU A OE2 1 
ATOM   2274  N  N   . TYR A  1 300 ? 54.888  66.994  22.576  1.00 26.35 ? 301  TYR A N   1 
ATOM   2275  C  CA  . TYR A  1 300 ? 54.208  68.018  21.845  1.00 26.21 ? 301  TYR A CA  1 
ATOM   2276  C  C   . TYR A  1 300 ? 52.889  68.162  22.583  1.00 26.91 ? 301  TYR A C   1 
ATOM   2277  O  O   . TYR A  1 300 ? 51.960  67.365  22.385  1.00 23.55 ? 301  TYR A O   1 
ATOM   2278  C  CB  . TYR A  1 300 ? 54.036  67.595  20.371  1.00 25.11 ? 301  TYR A CB  1 
ATOM   2279  C  CG  . TYR A  1 300 ? 53.363  68.633  19.477  1.00 23.10 ? 301  TYR A CG  1 
ATOM   2280  C  CD1 . TYR A  1 300 ? 54.065  69.730  18.963  1.00 27.08 ? 301  TYR A CD1 1 
ATOM   2281  C  CD2 . TYR A  1 300 ? 52.033  68.500  19.125  1.00 25.18 ? 301  TYR A CD2 1 
ATOM   2282  C  CE1 . TYR A  1 300 ? 53.419  70.681  18.143  1.00 28.88 ? 301  TYR A CE1 1 
ATOM   2283  C  CE2 . TYR A  1 300 ? 51.396  69.416  18.317  1.00 26.00 ? 301  TYR A CE2 1 
ATOM   2284  C  CZ  . TYR A  1 300 ? 52.074  70.499  17.822  1.00 30.82 ? 301  TYR A CZ  1 
ATOM   2285  O  OH  . TYR A  1 300 ? 51.368  71.377  17.033  1.00 29.07 ? 301  TYR A OH  1 
ATOM   2286  N  N   . ILE A  1 301 ? 52.833  69.165  23.460  1.00 27.89 ? 302  ILE A N   1 
ATOM   2287  C  CA  . ILE A  1 301 ? 51.768  69.280  24.444  1.00 28.31 ? 302  ILE A CA  1 
ATOM   2288  C  C   . ILE A  1 301 ? 50.739  70.278  23.962  1.00 28.19 ? 302  ILE A C   1 
ATOM   2289  O  O   . ILE A  1 301 ? 51.078  71.381  23.564  1.00 29.58 ? 302  ILE A O   1 
ATOM   2290  C  CB  . ILE A  1 301 ? 52.326  69.774  25.799  1.00 31.00 ? 302  ILE A CB  1 
ATOM   2291  C  CG1 . ILE A  1 301 ? 53.441  68.859  26.315  1.00 32.94 ? 302  ILE A CG1 1 
ATOM   2292  C  CG2 . ILE A  1 301 ? 51.202  69.922  26.844  1.00 27.54 ? 302  ILE A CG2 1 
ATOM   2293  C  CD1 . ILE A  1 301 ? 52.945  67.573  26.864  1.00 39.74 ? 302  ILE A CD1 1 
ATOM   2294  N  N   . ILE A  1 302 ? 49.476  69.885  23.990  1.00 29.05 ? 303  ILE A N   1 
ATOM   2295  C  CA  . ILE A  1 302 ? 48.367  70.773  23.665  1.00 28.16 ? 303  ILE A CA  1 
ATOM   2296  C  C   . ILE A  1 302 ? 47.601  70.962  24.966  1.00 29.47 ? 303  ILE A C   1 
ATOM   2297  O  O   . ILE A  1 302 ? 47.381  70.001  25.710  1.00 29.62 ? 303  ILE A O   1 
ATOM   2298  C  CB  . ILE A  1 302 ? 47.478  70.185  22.550  1.00 28.32 ? 303  ILE A CB  1 
ATOM   2299  C  CG1 . ILE A  1 302 ? 48.142  70.408  21.189  1.00 30.91 ? 303  ILE A CG1 1 
ATOM   2300  C  CG2 . ILE A  1 302 ? 46.097  70.864  22.513  1.00 28.10 ? 303  ILE A CG2 1 
ATOM   2301  C  CD1 . ILE A  1 302 ? 48.363  69.180  20.408  1.00 36.29 ? 303  ILE A CD1 1 
ATOM   2302  N  N   . GLU A  1 303 ? 47.248  72.211  25.251  1.00 28.96 ? 304  GLU A N   1 
ATOM   2303  C  CA  . GLU A  1 303 ? 46.676  72.595  26.524  1.00 29.36 ? 304  GLU A CA  1 
ATOM   2304  C  C   . GLU A  1 303 ? 45.167  72.693  26.394  1.00 27.88 ? 304  GLU A C   1 
ATOM   2305  O  O   . GLU A  1 303 ? 44.644  73.403  25.519  1.00 27.17 ? 304  GLU A O   1 
ATOM   2306  C  CB  . GLU A  1 303 ? 47.249  73.947  26.972  1.00 31.63 ? 304  GLU A CB  1 
ATOM   2307  C  CG  . GLU A  1 303 ? 48.775  73.943  27.104  1.00 38.17 ? 304  GLU A CG  1 
ATOM   2308  C  CD  . GLU A  1 303 ? 49.269  74.407  28.475  1.00 46.65 ? 304  GLU A CD  1 
ATOM   2309  O  OE1 . GLU A  1 303 ? 49.088  75.605  28.814  1.00 49.46 ? 304  GLU A OE1 1 
ATOM   2310  O  OE2 . GLU A  1 303 ? 49.851  73.572  29.205  1.00 48.82 ? 304  GLU A OE2 1 
ATOM   2311  N  N   . GLY A  1 304 ? 44.463  71.968  27.257  1.00 27.67 ? 305  GLY A N   1 
ATOM   2312  C  CA  . GLY A  1 304 ? 43.017  72.088  27.329  1.00 27.19 ? 305  GLY A CA  1 
ATOM   2313  C  C   . GLY A  1 304 ? 42.291  70.948  26.634  1.00 25.78 ? 305  GLY A C   1 
ATOM   2314  O  O   . GLY A  1 304 ? 42.419  70.735  25.425  1.00 25.78 ? 305  GLY A O   1 
ATOM   2315  N  N   . PHE A  1 305 ? 41.504  70.241  27.425  1.00 23.88 ? 306  PHE A N   1 
ATOM   2316  C  CA  . PHE A  1 305 ? 40.720  69.118  26.979  1.00 24.50 ? 306  PHE A CA  1 
ATOM   2317  C  C   . PHE A  1 305 ? 39.844  69.468  25.804  1.00 25.90 ? 306  PHE A C   1 
ATOM   2318  O  O   . PHE A  1 305 ? 39.553  68.599  24.982  1.00 25.66 ? 306  PHE A O   1 
ATOM   2319  C  CB  . PHE A  1 305 ? 39.861  68.627  28.151  1.00 24.22 ? 306  PHE A CB  1 
ATOM   2320  C  CG  . PHE A  1 305 ? 38.931  67.499  27.811  1.00 23.89 ? 306  PHE A CG  1 
ATOM   2321  C  CD1 . PHE A  1 305 ? 39.367  66.190  27.863  1.00 23.79 ? 306  PHE A CD1 1 
ATOM   2322  C  CD2 . PHE A  1 305 ? 37.613  67.750  27.458  1.00 23.37 ? 306  PHE A CD2 1 
ATOM   2323  C  CE1 . PHE A  1 305 ? 38.522  65.154  27.585  1.00 19.50 ? 306  PHE A CE1 1 
ATOM   2324  C  CE2 . PHE A  1 305 ? 36.744  66.697  27.159  1.00 24.00 ? 306  PHE A CE2 1 
ATOM   2325  C  CZ  . PHE A  1 305 ? 37.202  65.402  27.230  1.00 22.71 ? 306  PHE A CZ  1 
ATOM   2326  N  N   . GLU A  1 306 ? 39.401  70.726  25.762  1.00 27.39 ? 307  GLU A N   1 
ATOM   2327  C  CA  . GLU A  1 306 ? 38.564  71.270  24.701  1.00 28.92 ? 307  GLU A CA  1 
ATOM   2328  C  C   . GLU A  1 306 ? 39.251  71.353  23.343  1.00 27.47 ? 307  GLU A C   1 
ATOM   2329  O  O   . GLU A  1 306 ? 38.590  71.543  22.314  1.00 26.76 ? 307  GLU A O   1 
ATOM   2330  C  CB  . GLU A  1 306 ? 38.054  72.672  25.087  1.00 30.13 ? 307  GLU A CB  1 
ATOM   2331  C  CG  . GLU A  1 306 ? 39.162  73.723  25.381  1.00 40.89 ? 307  GLU A CG  1 
ATOM   2332  C  CD  . GLU A  1 306 ? 39.639  73.801  26.857  1.00 47.68 ? 307  GLU A CD  1 
ATOM   2333  O  OE1 . GLU A  1 306 ? 39.219  72.982  27.726  1.00 47.40 ? 307  GLU A OE1 1 
ATOM   2334  O  OE2 . GLU A  1 306 ? 40.454  74.718  27.128  1.00 53.52 ? 307  GLU A OE2 1 
ATOM   2335  N  N   . ASN A  1 307 ? 40.575  71.244  23.342  1.00 27.23 ? 308  ASN A N   1 
ATOM   2336  C  CA  . ASN A  1 307 ? 41.353  71.200  22.104  1.00 26.25 ? 308  ASN A CA  1 
ATOM   2337  C  C   . ASN A  1 307 ? 41.785  69.775  21.741  1.00 26.04 ? 308  ASN A C   1 
ATOM   2338  O  O   . ASN A  1 307 ? 42.686  69.601  20.921  1.00 26.36 ? 308  ASN A O   1 
ATOM   2339  C  CB  . ASN A  1 307 ? 42.594  72.087  22.240  1.00 27.03 ? 308  ASN A CB  1 
ATOM   2340  C  CG  . ASN A  1 307 ? 42.244  73.529  22.531  1.00 29.15 ? 308  ASN A CG  1 
ATOM   2341  O  OD1 . ASN A  1 307 ? 41.499  74.134  21.786  1.00 28.92 ? 308  ASN A OD1 1 
ATOM   2342  N  ND2 . ASN A  1 307 ? 42.781  74.080  23.618  1.00 22.93 ? 308  ASN A ND2 1 
ATOM   2343  N  N   . MET A  1 308 ? 41.165  68.757  22.344  1.00 22.96 ? 309  MET A N   1 
ATOM   2344  C  CA  . MET A  1 308 ? 41.618  67.387  22.115  1.00 22.62 ? 309  MET A CA  1 
ATOM   2345  C  C   . MET A  1 308 ? 41.446  66.980  20.647  1.00 20.26 ? 309  MET A C   1 
ATOM   2346  O  O   . MET A  1 308 ? 42.352  66.402  20.074  1.00 19.58 ? 309  MET A O   1 
ATOM   2347  C  CB  . MET A  1 308 ? 40.947  66.389  23.061  1.00 23.04 ? 309  MET A CB  1 
ATOM   2348  C  CG  . MET A  1 308 ? 41.660  65.071  23.128  1.00 25.77 ? 309  MET A CG  1 
ATOM   2349  S  SD  . MET A  1 308 ? 41.203  64.066  24.530  1.00 28.17 ? 309  MET A SD  1 
ATOM   2350  C  CE  . MET A  1 308 ? 42.011  62.508  24.150  1.00 21.50 ? 309  MET A CE  1 
ATOM   2351  N  N   . PRO A  1 309 ? 40.311  67.325  20.033  1.00 17.80 ? 310  PRO A N   1 
ATOM   2352  C  CA  . PRO A  1 309 ? 40.141  67.043  18.619  1.00 19.40 ? 310  PRO A CA  1 
ATOM   2353  C  C   . PRO A  1 309 ? 41.225  67.691  17.762  1.00 20.24 ? 310  PRO A C   1 
ATOM   2354  O  O   . PRO A  1 309 ? 41.783  67.042  16.856  1.00 18.87 ? 310  PRO A O   1 
ATOM   2355  C  CB  . PRO A  1 309 ? 38.772  67.645  18.304  1.00 20.97 ? 310  PRO A CB  1 
ATOM   2356  C  CG  . PRO A  1 309 ? 38.024  67.567  19.639  1.00 20.88 ? 310  PRO A CG  1 
ATOM   2357  C  CD  . PRO A  1 309 ? 39.090  67.866  20.644  1.00 20.15 ? 310  PRO A CD  1 
ATOM   2358  N  N   . ALA A  1 310 ? 41.531  68.947  18.054  1.00 19.43 ? 311  ALA A N   1 
ATOM   2359  C  CA  . ALA A  1 310 ? 42.563  69.654  17.309  1.00 21.55 ? 311  ALA A CA  1 
ATOM   2360  C  C   . ALA A  1 310 ? 43.922  68.963  17.456  1.00 20.27 ? 311  ALA A C   1 
ATOM   2361  O  O   . ALA A  1 310 ? 44.679  68.893  16.494  1.00 20.66 ? 311  ALA A O   1 
ATOM   2362  C  CB  . ALA A  1 310 ? 42.647  71.120  17.721  1.00 20.17 ? 311  ALA A CB  1 
ATOM   2363  N  N   . ALA A  1 311 ? 44.193  68.419  18.632  1.00 18.32 ? 312  ALA A N   1 
ATOM   2364  C  CA  . ALA A  1 311 ? 45.470  67.770  18.901  1.00 18.69 ? 312  ALA A CA  1 
ATOM   2365  C  C   . ALA A  1 311 ? 45.604  66.472  18.083  1.00 17.79 ? 312  ALA A C   1 
ATOM   2366  O  O   . ALA A  1 311 ? 46.669  66.147  17.573  1.00 18.55 ? 312  ALA A O   1 
ATOM   2367  C  CB  . ALA A  1 311 ? 45.586  67.476  20.383  1.00 15.07 ? 312  ALA A CB  1 
ATOM   2368  N  N   . PHE A  1 312 ? 44.483  65.774  17.951  1.00 18.19 ? 313  PHE A N   1 
ATOM   2369  C  CA  . PHE A  1 312 ? 44.378  64.535  17.216  1.00 16.79 ? 313  PHE A CA  1 
ATOM   2370  C  C   . PHE A  1 312 ? 44.569  64.827  15.754  1.00 15.67 ? 313  PHE A C   1 
ATOM   2371  O  O   . PHE A  1 312 ? 45.395  64.225  15.106  1.00 17.32 ? 313  PHE A O   1 
ATOM   2372  C  CB  . PHE A  1 312 ? 42.989  63.939  17.486  1.00 18.06 ? 313  PHE A CB  1 
ATOM   2373  C  CG  . PHE A  1 312 ? 42.684  62.685  16.723  1.00 15.03 ? 313  PHE A CG  1 
ATOM   2374  C  CD1 . PHE A  1 312 ? 43.550  61.583  16.758  1.00 14.20 ? 313  PHE A CD1 1 
ATOM   2375  C  CD2 . PHE A  1 312 ? 41.490  62.575  16.028  1.00 14.81 ? 313  PHE A CD2 1 
ATOM   2376  C  CE1 . PHE A  1 312 ? 43.225  60.407  16.069  1.00 17.28 ? 313  PHE A CE1 1 
ATOM   2377  C  CE2 . PHE A  1 312 ? 41.149  61.396  15.353  1.00 15.95 ? 313  PHE A CE2 1 
ATOM   2378  C  CZ  . PHE A  1 312 ? 42.022  60.323  15.365  1.00 16.71 ? 313  PHE A CZ  1 
ATOM   2379  N  N   . MET A  1 313 ? 43.818  65.787  15.249  1.00 17.30 ? 314  MET A N   1 
ATOM   2380  C  CA  . MET A  1 313 ? 43.886  66.186  13.852  1.00 17.82 ? 314  MET A CA  1 
ATOM   2381  C  C   . MET A  1 313 ? 45.269  66.669  13.409  1.00 18.52 ? 314  MET A C   1 
ATOM   2382  O  O   . MET A  1 313 ? 45.675  66.363  12.314  1.00 16.65 ? 314  MET A O   1 
ATOM   2383  C  CB  . MET A  1 313 ? 42.828  67.248  13.545  1.00 17.52 ? 314  MET A CB  1 
ATOM   2384  C  CG  . MET A  1 313 ? 41.419  66.650  13.491  1.00 20.64 ? 314  MET A CG  1 
ATOM   2385  S  SD  . MET A  1 313 ? 40.124  67.858  13.090  1.00 24.40 ? 314  MET A SD  1 
ATOM   2386  C  CE  . MET A  1 313 ? 39.887  68.636  14.684  1.00 22.46 ? 314  MET A CE  1 
ATOM   2387  N  N   . GLY A  1 314 ? 45.989  67.384  14.272  1.00 19.37 ? 315  GLY A N   1 
ATOM   2388  C  CA  . GLY A  1 314 ? 47.275  67.953  13.920  1.00 18.70 ? 315  GLY A CA  1 
ATOM   2389  C  C   . GLY A  1 314 ? 48.324  66.880  13.863  1.00 18.77 ? 315  GLY A C   1 
ATOM   2390  O  O   . GLY A  1 314 ? 49.160  66.878  12.976  1.00 19.87 ? 315  GLY A O   1 
ATOM   2391  N  N   . MET A  1 315 ? 48.280  65.954  14.817  1.00 19.63 ? 316  MET A N   1 
ATOM   2392  C  CA  . MET A  1 315 ? 49.168  64.790  14.782  1.00 20.03 ? 316  MET A CA  1 
ATOM   2393  C  C   . MET A  1 315 ? 49.013  63.983  13.477  1.00 17.44 ? 316  MET A C   1 
ATOM   2394  O  O   . MET A  1 315 ? 49.997  63.631  12.830  1.00 16.52 ? 316  MET A O   1 
ATOM   2395  C  CB  . MET A  1 315 ? 48.915  63.922  16.008  1.00 20.77 ? 316  MET A CB  1 
ATOM   2396  C  CG  . MET A  1 315 ? 49.692  62.628  16.082  1.00 25.84 ? 316  MET A CG  1 
ATOM   2397  S  SD  . MET A  1 315 ? 48.813  61.243  15.333  1.00 35.06 ? 316  MET A SD  1 
ATOM   2398  C  CE  . MET A  1 315 ? 47.337  61.095  16.349  1.00 21.16 ? 316  MET A CE  1 
ATOM   2399  N  N   . LEU A  1 316 ? 47.779  63.710  13.078  1.00 16.88 ? 317  LEU A N   1 
ATOM   2400  C  CA  . LEU A  1 316 ? 47.551  62.975  11.844  1.00 17.32 ? 317  LEU A CA  1 
ATOM   2401  C  C   . LEU A  1 316 ? 48.102  63.766  10.669  1.00 16.52 ? 317  LEU A C   1 
ATOM   2402  O  O   . LEU A  1 316 ? 48.620  63.186  9.727   1.00 14.81 ? 317  LEU A O   1 
ATOM   2403  C  CB  . LEU A  1 316 ? 46.076  62.678  11.638  1.00 16.14 ? 317  LEU A CB  1 
ATOM   2404  C  CG  . LEU A  1 316 ? 45.341  61.809  12.655  1.00 16.75 ? 317  LEU A CG  1 
ATOM   2405  C  CD1 . LEU A  1 316 ? 43.852  61.850  12.327  1.00 15.41 ? 317  LEU A CD1 1 
ATOM   2406  C  CD2 . LEU A  1 316 ? 45.878  60.361  12.631  1.00 15.80 ? 317  LEU A CD2 1 
ATOM   2407  N  N   . LYS A  1 317 ? 48.014  65.094  10.747  1.00 16.69 ? 318  LYS A N   1 
ATOM   2408  C  CA  . LYS A  1 317 ? 48.579  65.965  9.726   1.00 18.77 ? 318  LYS A CA  1 
ATOM   2409  C  C   . LYS A  1 317 ? 50.056  66.317  9.919   1.00 19.50 ? 318  LYS A C   1 
ATOM   2410  O  O   . LYS A  1 317 ? 50.572  67.112  9.164   1.00 19.04 ? 318  LYS A O   1 
ATOM   2411  C  CB  . LYS A  1 317 ? 47.730  67.240  9.582   1.00 19.39 ? 318  LYS A CB  1 
ATOM   2412  C  CG  . LYS A  1 317 ? 46.308  66.936  9.083   1.00 23.43 ? 318  LYS A CG  1 
ATOM   2413  C  CD  . LYS A  1 317 ? 45.495  68.155  8.776   1.00 26.51 ? 318  LYS A CD  1 
ATOM   2414  C  CE  . LYS A  1 317 ? 44.030  67.761  8.567   1.00 23.16 ? 318  LYS A CE  1 
ATOM   2415  N  NZ  . LYS A  1 317 ? 43.230  68.865  8.048   1.00 16.35 ? 318  LYS A NZ  1 
ATOM   2416  N  N   . GLY A  1 318 ? 50.742  65.767  10.917  1.00 19.05 ? 319  GLY A N   1 
ATOM   2417  C  CA  . GLY A  1 318 ? 52.185  66.006  11.021  1.00 20.10 ? 319  GLY A CA  1 
ATOM   2418  C  C   . GLY A  1 318 ? 52.650  67.239  11.809  1.00 19.89 ? 319  GLY A C   1 
ATOM   2419  O  O   . GLY A  1 318 ? 53.800  67.584  11.745  1.00 17.58 ? 319  GLY A O   1 
ATOM   2420  N  N   . ASP A  1 319 ? 51.770  67.879  12.573  1.00 20.08 ? 320  ASP A N   1 
ATOM   2421  C  CA  . ASP A  1 319 ? 52.169  69.021  13.420  1.00 22.19 ? 320  ASP A CA  1 
ATOM   2422  C  C   . ASP A  1 319 ? 53.200  68.650  14.492  1.00 22.45 ? 320  ASP A C   1 
ATOM   2423  O  O   . ASP A  1 319 ? 54.055  69.433  14.845  1.00 22.43 ? 320  ASP A O   1 
ATOM   2424  C  CB  . ASP A  1 319 ? 50.963  69.622  14.151  1.00 22.87 ? 320  ASP A CB  1 
ATOM   2425  C  CG  . ASP A  1 319 ? 49.968  70.325  13.231  1.00 23.13 ? 320  ASP A CG  1 
ATOM   2426  O  OD1 . ASP A  1 319 ? 50.183  70.451  12.020  1.00 28.43 ? 320  ASP A OD1 1 
ATOM   2427  O  OD2 . ASP A  1 319 ? 48.936  70.783  13.755  1.00 31.89 ? 320  ASP A OD2 1 
ATOM   2428  N  N   . ASN A  1 320 ? 53.104  67.450  15.023  1.00 21.91 ? 321  ASN A N   1 
ATOM   2429  C  CA  . ASN A  1 320 ? 53.806  67.106  16.229  1.00 22.22 ? 321  ASN A CA  1 
ATOM   2430  C  C   . ASN A  1 320 ? 55.246  66.692  16.020  1.00 24.44 ? 321  ASN A C   1 
ATOM   2431  O  O   . ASN A  1 320 ? 55.553  65.997  15.070  1.00 24.82 ? 321  ASN A O   1 
ATOM   2432  C  CB  . ASN A  1 320 ? 53.070  65.959  16.947  1.00 22.46 ? 321  ASN A CB  1 
ATOM   2433  C  CG  . ASN A  1 320 ? 53.033  64.663  16.116  1.00 19.96 ? 321  ASN A CG  1 
ATOM   2434  O  OD1 . ASN A  1 320 ? 52.424  64.618  15.041  1.00 16.75 ? 321  ASN A OD1 1 
ATOM   2435  N  ND2 . ASN A  1 320 ? 53.675  63.607  16.627  1.00 18.49 ? 321  ASN A ND2 1 
ATOM   2436  N  N   . LEU A  1 321 ? 56.103  67.090  16.962  1.00 24.99 ? 322  LEU A N   1 
ATOM   2437  C  CA  . LEU A  1 321 ? 57.447  66.546  17.116  1.00 25.56 ? 322  LEU A CA  1 
ATOM   2438  C  C   . LEU A  1 321 ? 57.461  65.824  18.448  1.00 24.16 ? 322  LEU A C   1 
ATOM   2439  O  O   . LEU A  1 321 ? 57.189  66.426  19.461  1.00 26.46 ? 322  LEU A O   1 
ATOM   2440  C  CB  . LEU A  1 321 ? 58.462  67.683  17.122  1.00 26.55 ? 322  LEU A CB  1 
ATOM   2441  C  CG  . LEU A  1 321 ? 59.930  67.349  17.405  1.00 34.48 ? 322  LEU A CG  1 
ATOM   2442  C  CD1 . LEU A  1 321 ? 60.683  67.055  16.136  1.00 39.42 ? 322  LEU A CD1 1 
ATOM   2443  C  CD2 . LEU A  1 321 ? 60.603  68.529  18.126  1.00 41.96 ? 322  LEU A CD2 1 
ATOM   2444  N  N   . GLY A  1 322 ? 57.767  64.533  18.464  1.00 23.76 ? 323  GLY A N   1 
ATOM   2445  C  CA  . GLY A  1 322 ? 57.597  63.731  19.670  1.00 23.32 ? 323  GLY A CA  1 
ATOM   2446  C  C   . GLY A  1 322 ? 56.125  63.419  19.933  1.00 22.95 ? 323  GLY A C   1 
ATOM   2447  O  O   . GLY A  1 322 ? 55.272  63.712  19.091  1.00 20.71 ? 323  GLY A O   1 
ATOM   2448  N  N   . LYS A  1 323 ? 55.843  62.818  21.092  1.00 21.57 ? 324  LYS A N   1 
ATOM   2449  C  CA  . LYS A  1 323 ? 54.501  62.347  21.434  1.00 21.60 ? 324  LYS A CA  1 
ATOM   2450  C  C   . LYS A  1 323 ? 53.497  63.471  21.680  1.00 22.68 ? 324  LYS A C   1 
ATOM   2451  O  O   . LYS A  1 323 ? 53.734  64.378  22.478  1.00 23.78 ? 324  LYS A O   1 
ATOM   2452  C  CB  . LYS A  1 323 ? 54.555  61.448  22.664  1.00 21.60 ? 324  LYS A CB  1 
ATOM   2453  C  CG  . LYS A  1 323 ? 53.185  60.944  23.130  1.00 22.56 ? 324  LYS A CG  1 
ATOM   2454  C  CD  . LYS A  1 323 ? 52.641  59.808  22.208  1.00 19.27 ? 324  LYS A CD  1 
ATOM   2455  C  CE  . LYS A  1 323 ? 51.187  59.510  22.510  1.00 18.08 ? 324  LYS A CE  1 
ATOM   2456  N  NZ  . LYS A  1 323 ? 50.284  60.411  21.746  1.00 15.50 ? 324  LYS A NZ  1 
ATOM   2457  N  N   . THR A  1 324 ? 52.377  63.385  20.975  1.00 21.82 ? 325  THR A N   1 
ATOM   2458  C  CA  . THR A  1 324 ? 51.246  64.286  21.124  1.00 19.76 ? 325  THR A CA  1 
ATOM   2459  C  C   . THR A  1 324 ? 50.509  63.949  22.408  1.00 20.69 ? 325  THR A C   1 
ATOM   2460  O  O   . THR A  1 324 ? 50.021  62.823  22.583  1.00 21.40 ? 325  THR A O   1 
ATOM   2461  C  CB  . THR A  1 324 ? 50.285  64.148  19.923  1.00 19.82 ? 325  THR A CB  1 
ATOM   2462  O  OG1 . THR A  1 324 ? 51.031  64.238  18.700  1.00 17.30 ? 325  THR A OG1 1 
ATOM   2463  C  CG2 . THR A  1 324 ? 49.204  65.217  19.923  1.00 17.04 ? 325  THR A CG2 1 
ATOM   2464  N  N   . ILE A  1 325 ? 50.455  64.932  23.309  1.00 21.84 ? 326  ILE A N   1 
ATOM   2465  C  CA  . ILE A  1 325 ? 49.780  64.833  24.598  1.00 21.72 ? 326  ILE A CA  1 
ATOM   2466  C  C   . ILE A  1 325 ? 48.864  66.022  24.794  1.00 21.57 ? 326  ILE A C   1 
ATOM   2467  O  O   . ILE A  1 325 ? 49.200  67.146  24.412  1.00 21.59 ? 326  ILE A O   1 
ATOM   2468  C  CB  . ILE A  1 325 ? 50.798  64.834  25.745  1.00 23.78 ? 326  ILE A CB  1 
ATOM   2469  C  CG1 . ILE A  1 325 ? 51.754  63.649  25.607  1.00 20.85 ? 326  ILE A CG1 1 
ATOM   2470  C  CG2 . ILE A  1 325 ? 50.082  64.847  27.088  1.00 22.68 ? 326  ILE A CG2 1 
ATOM   2471  C  CD1 . ILE A  1 325 ? 51.263  62.376  26.181  1.00 19.81 ? 326  ILE A CD1 1 
ATOM   2472  N  N   . VAL A  1 326 ? 47.681  65.775  25.348  1.00 22.77 ? 327  VAL A N   1 
ATOM   2473  C  CA  . VAL A  1 326 ? 46.793  66.839  25.754  1.00 22.59 ? 327  VAL A CA  1 
ATOM   2474  C  C   . VAL A  1 326 ? 46.886  67.009  27.274  1.00 26.04 ? 327  VAL A C   1 
ATOM   2475  O  O   . VAL A  1 326 ? 46.679  66.053  28.024  1.00 24.61 ? 327  VAL A O   1 
ATOM   2476  C  CB  . VAL A  1 326 ? 45.337  66.556  25.374  1.00 24.48 ? 327  VAL A CB  1 
ATOM   2477  C  CG1 . VAL A  1 326 ? 44.389  67.480  26.162  1.00 22.67 ? 327  VAL A CG1 1 
ATOM   2478  C  CG2 . VAL A  1 326 ? 45.151  66.737  23.870  1.00 24.38 ? 327  VAL A CG2 1 
ATOM   2479  N  N   . LYS A  1 327 ? 47.194  68.226  27.724  1.00 26.74 ? 328  LYS A N   1 
ATOM   2480  C  CA  . LYS A  1 327 ? 47.225  68.524  29.161  1.00 28.21 ? 328  LYS A CA  1 
ATOM   2481  C  C   . LYS A  1 327 ? 45.861  69.055  29.608  1.00 27.61 ? 328  LYS A C   1 
ATOM   2482  O  O   . LYS A  1 327 ? 45.353  70.077  29.093  1.00 26.73 ? 328  LYS A O   1 
ATOM   2483  C  CB  . LYS A  1 327 ? 48.333  69.527  29.514  1.00 29.48 ? 328  LYS A CB  1 
ATOM   2484  C  CG  . LYS A  1 327 ? 48.487  69.754  31.025  1.00 33.50 ? 328  LYS A CG  1 
ATOM   2485  C  CD  . LYS A  1 327 ? 49.632  70.708  31.358  1.00 39.42 ? 328  LYS A CD  1 
ATOM   2486  C  CE  . LYS A  1 327 ? 49.700  70.965  32.881  1.00 45.21 ? 328  LYS A CE  1 
ATOM   2487  N  NZ  . LYS A  1 327 ? 50.321  72.295  33.205  1.00 49.23 ? 328  LYS A NZ  1 
ATOM   2488  N  N   . ALA A  1 328 ? 45.271  68.351  30.560  1.00 27.97 ? 329  ALA A N   1 
ATOM   2489  C  CA  . ALA A  1 328 ? 43.970  68.727  31.097  1.00 29.07 ? 329  ALA A CA  1 
ATOM   2490  C  C   . ALA A  1 328 ? 44.124  69.875  32.089  1.00 30.36 ? 329  ALA A C   1 
ATOM   2491  O  O   . ALA A  1 328 ? 43.414  70.869  31.980  1.00 34.13 ? 329  ALA A O   1 
ATOM   2492  C  CB  . ALA A  1 328 ? 43.343  67.551  31.772  1.00 28.90 ? 329  ALA A CB  1 
ATOM   2493  N  N   . SER B  1 1   ? 30.095  38.463  37.634  1.00 48.31 ? 2    SER B N   1 
ATOM   2494  C  CA  . SER B  1 1   ? 29.577  38.373  36.230  1.00 49.35 ? 2    SER B CA  1 
ATOM   2495  C  C   . SER B  1 1   ? 28.676  37.134  36.064  1.00 46.99 ? 2    SER B C   1 
ATOM   2496  O  O   . SER B  1 1   ? 29.164  36.002  35.960  1.00 46.62 ? 2    SER B O   1 
ATOM   2497  C  CB  . SER B  1 1   ? 30.732  38.334  35.230  1.00 49.42 ? 2    SER B CB  1 
ATOM   2498  O  OG  . SER B  1 1   ? 30.242  38.405  33.898  1.00 51.29 ? 2    SER B OG  1 
ATOM   2499  N  N   . MET B  1 2   ? 27.365  37.356  36.056  1.00 43.50 ? 3    MET B N   1 
ATOM   2500  C  CA  . MET B  1 2   ? 26.416  36.252  36.076  1.00 43.13 ? 3    MET B CA  1 
ATOM   2501  C  C   . MET B  1 2   ? 25.585  36.190  34.795  1.00 40.33 ? 3    MET B C   1 
ATOM   2502  O  O   . MET B  1 2   ? 25.436  37.189  34.087  1.00 39.95 ? 3    MET B O   1 
ATOM   2503  C  CB  . MET B  1 2   ? 25.474  36.376  37.287  1.00 43.85 ? 3    MET B CB  1 
ATOM   2504  C  CG  . MET B  1 2   ? 26.166  36.467  38.662  1.00 47.83 ? 3    MET B CG  1 
ATOM   2505  S  SD  . MET B  1 2   ? 27.143  35.013  39.108  1.00 51.06 ? 3    MET B SD  1 
ATOM   2506  C  CE  . MET B  1 2   ? 25.904  33.942  39.854  1.00 51.46 ? 3    MET B CE  1 
ATOM   2507  N  N   . THR B  1 3   ? 25.031  35.009  34.525  1.00 37.25 ? 4    THR B N   1 
ATOM   2508  C  CA  . THR B  1 3   ? 24.031  34.831  33.487  1.00 34.01 ? 4    THR B CA  1 
ATOM   2509  C  C   . THR B  1 3   ? 22.919  33.894  33.918  1.00 31.98 ? 4    THR B C   1 
ATOM   2510  O  O   . THR B  1 3   ? 23.130  33.016  34.738  1.00 31.92 ? 4    THR B O   1 
ATOM   2511  C  CB  . THR B  1 3   ? 24.649  34.280  32.191  1.00 33.78 ? 4    THR B CB  1 
ATOM   2512  O  OG1 . THR B  1 3   ? 23.705  34.429  31.122  1.00 35.08 ? 4    THR B OG1 1 
ATOM   2513  C  CG2 . THR B  1 3   ? 25.039  32.820  32.340  1.00 29.48 ? 4    THR B CG2 1 
ATOM   2514  N  N   . LYS B  1 4   ? 21.736  34.092  33.342  1.00 30.21 ? 5    LYS B N   1 
ATOM   2515  C  CA  . LYS B  1 4   ? 20.634  33.146  33.464  1.00 30.44 ? 5    LYS B CA  1 
ATOM   2516  C  C   . LYS B  1 4   ? 20.413  32.433  32.120  1.00 28.34 ? 5    LYS B C   1 
ATOM   2517  O  O   . LYS B  1 4   ? 20.432  33.063  31.063  1.00 27.49 ? 5    LYS B O   1 
ATOM   2518  C  CB  . LYS B  1 4   ? 19.347  33.860  33.905  1.00 30.50 ? 5    LYS B CB  1 
ATOM   2519  C  CG  . LYS B  1 4   ? 19.439  34.570  35.254  1.00 35.16 ? 5    LYS B CG  1 
ATOM   2520  C  CD  . LYS B  1 4   ? 18.204  35.466  35.499  1.00 41.15 ? 5    LYS B CD  1 
ATOM   2521  N  N   . THR B  1 5   ? 20.158  31.130  32.189  1.00 27.52 ? 6    THR B N   1 
ATOM   2522  C  CA  . THR B  1 5   ? 20.104  30.255  31.036  1.00 27.75 ? 6    THR B CA  1 
ATOM   2523  C  C   . THR B  1 5   ? 18.912  29.288  31.144  1.00 27.90 ? 6    THR B C   1 
ATOM   2524  O  O   . THR B  1 5   ? 18.735  28.628  32.173  1.00 28.42 ? 6    THR B O   1 
ATOM   2525  C  CB  . THR B  1 5   ? 21.387  29.401  30.946  1.00 27.12 ? 6    THR B CB  1 
ATOM   2526  O  OG1 . THR B  1 5   ? 22.531  30.259  30.966  1.00 26.17 ? 6    THR B OG1 1 
ATOM   2527  C  CG2 . THR B  1 5   ? 21.383  28.552  29.683  1.00 27.35 ? 6    THR B CG2 1 
ATOM   2528  N  N   . TRP B  1 6   ? 18.098  29.230  30.090  1.00 25.62 ? 7    TRP B N   1 
ATOM   2529  C  CA  . TRP B  1 6   ? 17.028  28.238  29.981  1.00 22.03 ? 7    TRP B CA  1 
ATOM   2530  C  C   . TRP B  1 6   ? 17.585  26.978  29.340  1.00 21.11 ? 7    TRP B C   1 
ATOM   2531  O  O   . TRP B  1 6   ? 18.053  27.024  28.213  1.00 23.17 ? 7    TRP B O   1 
ATOM   2532  C  CB  . TRP B  1 6   ? 15.886  28.787  29.142  1.00 21.74 ? 7    TRP B CB  1 
ATOM   2533  C  CG  . TRP B  1 6   ? 14.951  29.643  29.891  1.00 21.58 ? 7    TRP B CG  1 
ATOM   2534  C  CD1 . TRP B  1 6   ? 14.762  30.970  29.731  1.00 22.80 ? 7    TRP B CD1 1 
ATOM   2535  C  CD2 . TRP B  1 6   ? 14.078  29.235  30.942  1.00 19.99 ? 7    TRP B CD2 1 
ATOM   2536  N  NE1 . TRP B  1 6   ? 13.832  31.426  30.608  1.00 21.13 ? 7    TRP B NE1 1 
ATOM   2537  C  CE2 . TRP B  1 6   ? 13.386  30.373  31.364  1.00 23.62 ? 7    TRP B CE2 1 
ATOM   2538  C  CE3 . TRP B  1 6   ? 13.832  28.013  31.582  1.00 25.20 ? 7    TRP B CE3 1 
ATOM   2539  C  CZ2 . TRP B  1 6   ? 12.433  30.332  32.380  1.00 24.49 ? 7    TRP B CZ2 1 
ATOM   2540  C  CZ3 . TRP B  1 6   ? 12.896  27.961  32.591  1.00 18.42 ? 7    TRP B CZ3 1 
ATOM   2541  C  CH2 . TRP B  1 6   ? 12.201  29.112  32.981  1.00 25.92 ? 7    TRP B CH2 1 
ATOM   2542  N  N   . THR B  1 7   ? 17.547  25.864  30.069  1.00 21.48 ? 8    THR B N   1 
ATOM   2543  C  CA  . THR B  1 7   ? 18.011  24.565  29.601  1.00 23.01 ? 8    THR B CA  1 
ATOM   2544  C  C   . THR B  1 7   ? 16.825  23.595  29.393  1.00 24.59 ? 8    THR B C   1 
ATOM   2545  O  O   . THR B  1 7   ? 15.753  23.759  29.997  1.00 26.66 ? 8    THR B O   1 
ATOM   2546  C  CB  . THR B  1 7   ? 18.976  23.904  30.625  1.00 24.87 ? 8    THR B CB  1 
ATOM   2547  O  OG1 . THR B  1 7   ? 18.287  23.694  31.857  1.00 24.56 ? 8    THR B OG1 1 
ATOM   2548  C  CG2 . THR B  1 7   ? 20.201  24.789  30.902  1.00 22.30 ? 8    THR B CG2 1 
ATOM   2549  N  N   . LEU B  1 8   ? 17.045  22.600  28.542  1.00 23.98 ? 9    LEU B N   1 
ATOM   2550  C  CA  . LEU B  1 8   ? 16.093  21.532  28.274  1.00 25.46 ? 9    LEU B CA  1 
ATOM   2551  C  C   . LEU B  1 8   ? 16.228  20.494  29.357  1.00 25.42 ? 9    LEU B C   1 
ATOM   2552  O  O   . LEU B  1 8   ? 17.234  19.786  29.408  1.00 26.91 ? 9    LEU B O   1 
ATOM   2553  C  CB  . LEU B  1 8   ? 16.372  20.868  26.907  1.00 24.72 ? 9    LEU B CB  1 
ATOM   2554  C  CG  . LEU B  1 8   ? 15.428  19.729  26.490  1.00 25.67 ? 9    LEU B CG  1 
ATOM   2555  C  CD1 . LEU B  1 8   ? 14.112  20.255  25.918  1.00 18.42 ? 9    LEU B CD1 1 
ATOM   2556  C  CD2 . LEU B  1 8   ? 16.091  18.800  25.509  1.00 20.55 ? 9    LEU B CD2 1 
ATOM   2557  N  N   . LYS B  1 9   ? 15.227  20.410  30.231  1.00 26.73 ? 10   LYS B N   1 
ATOM   2558  C  CA  . LYS B  1 9   ? 15.263  19.428  31.323  1.00 27.64 ? 10   LYS B CA  1 
ATOM   2559  C  C   . LYS B  1 9   ? 14.861  18.048  30.805  1.00 27.44 ? 10   LYS B C   1 
ATOM   2560  O  O   . LYS B  1 9   ? 15.437  17.047  31.195  1.00 26.92 ? 10   LYS B O   1 
ATOM   2561  C  CB  . LYS B  1 9   ? 14.382  19.852  32.502  1.00 28.97 ? 10   LYS B CB  1 
ATOM   2562  C  CG  . LYS B  1 9   ? 14.682  19.068  33.804  1.00 34.25 ? 10   LYS B CG  1 
ATOM   2563  C  CD  . LYS B  1 9   ? 13.937  19.655  35.005  1.00 40.37 ? 10   LYS B CD  1 
ATOM   2564  N  N   . LYS B  1 10  ? 13.886  17.991  29.904  1.00 26.62 ? 11   LYS B N   1 
ATOM   2565  C  CA  . LYS B  1 10  ? 13.474  16.698  29.352  1.00 27.41 ? 11   LYS B CA  1 
ATOM   2566  C  C   . LYS B  1 10  ? 12.984  16.862  27.922  1.00 24.43 ? 11   LYS B C   1 
ATOM   2567  O  O   . LYS B  1 10  ? 12.389  17.886  27.565  1.00 25.08 ? 11   LYS B O   1 
ATOM   2568  C  CB  . LYS B  1 10  ? 12.401  16.050  30.248  1.00 29.41 ? 11   LYS B CB  1 
ATOM   2569  C  CG  . LYS B  1 10  ? 12.491  14.506  30.319  1.00 38.90 ? 11   LYS B CG  1 
ATOM   2570  C  CD  . LYS B  1 10  ? 11.628  13.898  31.447  1.00 48.29 ? 11   LYS B CD  1 
ATOM   2571  N  N   . HIS B  1 11  ? 13.241  15.860  27.098  1.00 23.91 ? 12   HIS B N   1 
ATOM   2572  C  CA  . HIS B  1 11  ? 12.807  15.894  25.702  1.00 23.05 ? 12   HIS B CA  1 
ATOM   2573  C  C   . HIS B  1 11  ? 11.297  16.010  25.580  1.00 23.48 ? 12   HIS B C   1 
ATOM   2574  O  O   . HIS B  1 11  ? 10.546  15.422  26.352  1.00 23.89 ? 12   HIS B O   1 
ATOM   2575  C  CB  . HIS B  1 11  ? 13.328  14.693  24.938  1.00 24.04 ? 12   HIS B CB  1 
ATOM   2576  C  CG  . HIS B  1 11  ? 14.768  14.823  24.552  1.00 26.77 ? 12   HIS B CG  1 
ATOM   2577  N  ND1 . HIS B  1 11  ? 15.194  15.694  23.570  1.00 26.45 ? 12   HIS B ND1 1 
ATOM   2578  C  CD2 . HIS B  1 11  ? 15.880  14.210  25.022  1.00 27.51 ? 12   HIS B CD2 1 
ATOM   2579  C  CE1 . HIS B  1 11  ? 16.509  15.606  23.451  1.00 26.23 ? 12   HIS B CE1 1 
ATOM   2580  N  NE2 . HIS B  1 11  ? 16.950  14.714  24.319  1.00 27.06 ? 12   HIS B NE2 1 
ATOM   2581  N  N   . PHE B  1 12  ? 10.851  16.794  24.614  1.00 22.85 ? 13   PHE B N   1 
ATOM   2582  C  CA  . PHE B  1 12  ? 9.431   17.084  24.501  1.00 22.52 ? 13   PHE B CA  1 
ATOM   2583  C  C   . PHE B  1 12  ? 8.674   15.836  24.064  1.00 22.01 ? 13   PHE B C   1 
ATOM   2584  O  O   . PHE B  1 12  ? 9.212   14.978  23.373  1.00 21.61 ? 13   PHE B O   1 
ATOM   2585  C  CB  . PHE B  1 12  ? 9.186   18.234  23.517  1.00 21.17 ? 13   PHE B CB  1 
ATOM   2586  C  CG  . PHE B  1 12  ? 10.014  19.469  23.793  1.00 21.02 ? 13   PHE B CG  1 
ATOM   2587  C  CD1 . PHE B  1 12  ? 9.975   20.082  25.034  1.00 20.91 ? 13   PHE B CD1 1 
ATOM   2588  C  CD2 . PHE B  1 12  ? 10.814  20.012  22.808  1.00 19.03 ? 13   PHE B CD2 1 
ATOM   2589  C  CE1 . PHE B  1 12  ? 10.738  21.231  25.289  1.00 23.90 ? 13   PHE B CE1 1 
ATOM   2590  C  CE2 . PHE B  1 12  ? 11.565  21.171  23.041  1.00 19.05 ? 13   PHE B CE2 1 
ATOM   2591  C  CZ  . PHE B  1 12  ? 11.529  21.773  24.279  1.00 23.16 ? 13   PHE B CZ  1 
ATOM   2592  N  N   . VAL B  1 13  ? 7.415   15.771  24.477  1.00 22.79 ? 14   VAL B N   1 
ATOM   2593  C  CA  . VAL B  1 13  ? 6.489   14.714  24.083  1.00 21.59 ? 14   VAL B CA  1 
ATOM   2594  C  C   . VAL B  1 13  ? 5.174   15.436  23.874  1.00 20.72 ? 14   VAL B C   1 
ATOM   2595  O  O   . VAL B  1 13  ? 4.564   15.953  24.830  1.00 21.41 ? 14   VAL B O   1 
ATOM   2596  C  CB  . VAL B  1 13  ? 6.396   13.655  25.197  1.00 23.42 ? 14   VAL B CB  1 
ATOM   2597  C  CG1 . VAL B  1 13  ? 5.348   12.568  24.870  1.00 23.79 ? 14   VAL B CG1 1 
ATOM   2598  C  CG2 . VAL B  1 13  ? 7.774   13.025  25.440  1.00 21.54 ? 14   VAL B CG2 1 
ATOM   2599  N  N   . GLY B  1 14  ? 4.752   15.554  22.623  1.00 18.24 ? 15   GLY B N   1 
ATOM   2600  C  CA  . GLY B  1 14  ? 3.698   16.485  22.283  1.00 17.63 ? 15   GLY B CA  1 
ATOM   2601  C  C   . GLY B  1 14  ? 4.198   17.914  22.440  1.00 19.18 ? 15   GLY B C   1 
ATOM   2602  O  O   . GLY B  1 14  ? 5.392   18.173  22.323  1.00 20.62 ? 15   GLY B O   1 
ATOM   2603  N  N   . TYR B  1 15  ? 3.298   18.845  22.718  1.00 19.51 ? 16   TYR B N   1 
ATOM   2604  C  CA  . TYR B  1 15  ? 3.715   20.196  23.023  1.00 20.90 ? 16   TYR B CA  1 
ATOM   2605  C  C   . TYR B  1 15  ? 4.677   20.228  24.202  1.00 22.26 ? 16   TYR B C   1 
ATOM   2606  O  O   . TYR B  1 15  ? 4.589   19.394  25.104  1.00 23.36 ? 16   TYR B O   1 
ATOM   2607  C  CB  . TYR B  1 15  ? 2.536   21.123  23.280  1.00 19.11 ? 16   TYR B CB  1 
ATOM   2608  C  CG  . TYR B  1 15  ? 1.786   21.434  22.015  1.00 24.24 ? 16   TYR B CG  1 
ATOM   2609  C  CD1 . TYR B  1 15  ? 2.250   22.403  21.118  1.00 25.06 ? 16   TYR B CD1 1 
ATOM   2610  C  CD2 . TYR B  1 15  ? 0.621   20.758  21.703  1.00 21.87 ? 16   TYR B CD2 1 
ATOM   2611  C  CE1 . TYR B  1 15  ? 1.563   22.685  19.953  1.00 21.43 ? 16   TYR B CE1 1 
ATOM   2612  C  CE2 . TYR B  1 15  ? -0.063  21.030  20.551  1.00 28.66 ? 16   TYR B CE2 1 
ATOM   2613  C  CZ  . TYR B  1 15  ? 0.412   21.981  19.674  1.00 26.38 ? 16   TYR B CZ  1 
ATOM   2614  O  OH  . TYR B  1 15  ? -0.295  22.219  18.527  1.00 26.77 ? 16   TYR B OH  1 
ATOM   2615  N  N   . PRO B  1 16  ? 5.667   21.145  24.153  1.00 21.73 ? 17   PRO B N   1 
ATOM   2616  C  CA  . PRO B  1 16  ? 6.401   21.381  25.381  1.00 21.28 ? 17   PRO B CA  1 
ATOM   2617  C  C   . PRO B  1 16  ? 5.446   21.837  26.501  1.00 19.31 ? 17   PRO B C   1 
ATOM   2618  O  O   . PRO B  1 16  ? 4.407   22.459  26.240  1.00 19.54 ? 17   PRO B O   1 
ATOM   2619  C  CB  . PRO B  1 16  ? 7.383   22.504  24.999  1.00 21.25 ? 17   PRO B CB  1 
ATOM   2620  C  CG  . PRO B  1 16  ? 7.512   22.419  23.469  1.00 21.53 ? 17   PRO B CG  1 
ATOM   2621  C  CD  . PRO B  1 16  ? 6.129   22.007  23.048  1.00 21.52 ? 17   PRO B CD  1 
ATOM   2622  N  N   . THR B  1 17  ? 5.813   21.499  27.728  1.00 19.44 ? 18   THR B N   1 
ATOM   2623  C  CA  . THR B  1 17  ? 5.163   22.013  28.943  1.00 21.65 ? 18   THR B CA  1 
ATOM   2624  C  C   . THR B  1 17  ? 6.244   22.679  29.834  1.00 23.06 ? 18   THR B C   1 
ATOM   2625  O  O   . THR B  1 17  ? 7.452   22.469  29.618  1.00 22.97 ? 18   THR B O   1 
ATOM   2626  C  CB  . THR B  1 17  ? 4.490   20.847  29.713  1.00 20.20 ? 18   THR B CB  1 
ATOM   2627  O  OG1 . THR B  1 17  ? 5.498   19.991  30.266  1.00 19.87 ? 18   THR B OG1 1 
ATOM   2628  C  CG2 . THR B  1 17  ? 3.625   20.006  28.752  1.00 18.96 ? 18   THR B CG2 1 
ATOM   2629  N  N   . ASN B  1 18  ? 5.821   23.443  30.845  1.00 23.28 ? 19   ASN B N   1 
ATOM   2630  C  CA  . ASN B  1 18  ? 6.768   24.114  31.763  1.00 23.75 ? 19   ASN B CA  1 
ATOM   2631  C  C   . ASN B  1 18  ? 7.827   23.190  32.353  1.00 23.78 ? 19   ASN B C   1 
ATOM   2632  O  O   . ASN B  1 18  ? 8.969   23.583  32.498  1.00 24.02 ? 19   ASN B O   1 
ATOM   2633  C  CB  . ASN B  1 18  ? 6.026   24.834  32.903  1.00 23.28 ? 19   ASN B CB  1 
ATOM   2634  C  CG  . ASN B  1 18  ? 5.229   25.984  32.421  1.00 22.30 ? 19   ASN B CG  1 
ATOM   2635  O  OD1 . ASN B  1 18  ? 5.347   26.390  31.263  1.00 27.83 ? 19   ASN B OD1 1 
ATOM   2636  N  ND2 . ASN B  1 18  ? 4.397   26.538  33.290  1.00 21.37 ? 19   ASN B ND2 1 
ATOM   2637  N  N   . SER B  1 19  ? 7.471   21.948  32.666  1.00 24.85 ? 20   SER B N   1 
ATOM   2638  C  CA  . SER B  1 19  ? 8.408   21.060  33.355  1.00 24.71 ? 20   SER B CA  1 
ATOM   2639  C  C   . SER B  1 19  ? 9.517   20.497  32.460  1.00 24.61 ? 20   SER B C   1 
ATOM   2640  O  O   . SER B  1 19  ? 10.437  19.846  32.959  1.00 23.70 ? 20   SER B O   1 
ATOM   2641  C  CB  . SER B  1 19  ? 7.657   19.905  34.048  1.00 27.21 ? 20   SER B CB  1 
ATOM   2642  O  OG  . SER B  1 19  ? 7.188   18.950  33.111  1.00 32.03 ? 20   SER B OG  1 
ATOM   2643  N  N   . ASP B  1 20  ? 9.435   20.739  31.151  1.00 24.93 ? 21   ASP B N   1 
ATOM   2644  C  CA  . ASP B  1 20  ? 10.488  20.322  30.236  1.00 23.39 ? 21   ASP B CA  1 
ATOM   2645  C  C   . ASP B  1 20  ? 11.676  21.296  30.242  1.00 24.99 ? 21   ASP B C   1 
ATOM   2646  O  O   . ASP B  1 20  ? 12.754  20.962  29.742  1.00 26.25 ? 21   ASP B O   1 
ATOM   2647  C  CB  . ASP B  1 20  ? 9.951   20.239  28.808  1.00 24.58 ? 21   ASP B CB  1 
ATOM   2648  C  CG  . ASP B  1 20  ? 8.845   19.208  28.638  1.00 21.75 ? 21   ASP B CG  1 
ATOM   2649  O  OD1 . ASP B  1 20  ? 8.875   18.175  29.313  1.00 22.57 ? 21   ASP B OD1 1 
ATOM   2650  O  OD2 . ASP B  1 20  ? 7.937   19.453  27.827  1.00 20.74 ? 21   ASP B OD2 1 
ATOM   2651  N  N   . PHE B  1 21  ? 11.461  22.493  30.788  1.00 24.70 ? 22   PHE B N   1 
ATOM   2652  C  CA  . PHE B  1 21  ? 12.474  23.542  30.869  1.00 26.34 ? 22   PHE B CA  1 
ATOM   2653  C  C   . PHE B  1 21  ? 12.953  23.796  32.302  1.00 27.82 ? 22   PHE B C   1 
ATOM   2654  O  O   . PHE B  1 21  ? 12.178  23.720  33.256  1.00 28.77 ? 22   PHE B O   1 
ATOM   2655  C  CB  . PHE B  1 21  ? 11.915  24.856  30.347  1.00 24.56 ? 22   PHE B CB  1 
ATOM   2656  C  CG  . PHE B  1 21  ? 11.313  24.752  29.001  1.00 22.67 ? 22   PHE B CG  1 
ATOM   2657  C  CD1 . PHE B  1 21  ? 9.967   24.422  28.863  1.00 23.33 ? 22   PHE B CD1 1 
ATOM   2658  C  CD2 . PHE B  1 21  ? 12.077  25.020  27.864  1.00 21.96 ? 22   PHE B CD2 1 
ATOM   2659  C  CE1 . PHE B  1 21  ? 9.372   24.330  27.596  1.00 21.39 ? 22   PHE B CE1 1 
ATOM   2660  C  CE2 . PHE B  1 21  ? 11.520  24.923  26.608  1.00 24.00 ? 22   PHE B CE2 1 
ATOM   2661  C  CZ  . PHE B  1 21  ? 10.145  24.583  26.467  1.00 22.47 ? 22   PHE B CZ  1 
ATOM   2662  N  N   . GLU B  1 22  ? 14.231  24.150  32.430  1.00 29.66 ? 23   GLU B N   1 
ATOM   2663  C  CA  . GLU B  1 22  ? 14.817  24.511  33.721  1.00 28.53 ? 23   GLU B CA  1 
ATOM   2664  C  C   . GLU B  1 22  ? 15.728  25.733  33.598  1.00 27.98 ? 23   GLU B C   1 
ATOM   2665  O  O   . GLU B  1 22  ? 16.693  25.728  32.822  1.00 26.94 ? 23   GLU B O   1 
ATOM   2666  C  CB  . GLU B  1 22  ? 15.585  23.339  34.305  1.00 28.15 ? 23   GLU B CB  1 
ATOM   2667  C  CG  . GLU B  1 22  ? 16.280  23.710  35.617  1.00 33.53 ? 23   GLU B CG  1 
ATOM   2668  C  CD  . GLU B  1 22  ? 16.641  22.521  36.451  1.00 38.54 ? 23   GLU B CD  1 
ATOM   2669  O  OE1 . GLU B  1 22  ? 16.967  21.449  35.877  1.00 35.26 ? 23   GLU B OE1 1 
ATOM   2670  O  OE2 . GLU B  1 22  ? 16.593  22.676  37.694  1.00 49.17 ? 23   GLU B OE2 1 
ATOM   2671  N  N   . LEU B  1 23  ? 15.398  26.762  34.373  1.00 28.75 ? 24   LEU B N   1 
ATOM   2672  C  CA  . LEU B  1 23  ? 16.209  27.964  34.508  1.00 30.79 ? 24   LEU B CA  1 
ATOM   2673  C  C   . LEU B  1 23  ? 17.388  27.687  35.433  1.00 33.35 ? 24   LEU B C   1 
ATOM   2674  O  O   . LEU B  1 23  ? 17.207  27.203  36.567  1.00 32.25 ? 24   LEU B O   1 
ATOM   2675  C  CB  . LEU B  1 23  ? 15.365  29.099  35.075  1.00 30.05 ? 24   LEU B CB  1 
ATOM   2676  C  CG  . LEU B  1 23  ? 15.951  30.514  35.172  1.00 34.37 ? 24   LEU B CG  1 
ATOM   2677  C  CD1 . LEU B  1 23  ? 16.659  30.912  33.908  1.00 31.37 ? 24   LEU B CD1 1 
ATOM   2678  C  CD2 . LEU B  1 23  ? 14.835  31.541  35.491  1.00 33.59 ? 24   LEU B CD2 1 
ATOM   2679  N  N   . LYS B  1 24  ? 18.594  27.945  34.928  1.00 34.15 ? 25   LYS B N   1 
ATOM   2680  C  CA  . LYS B  1 24  ? 19.802  27.871  35.741  1.00 34.78 ? 25   LYS B CA  1 
ATOM   2681  C  C   . LYS B  1 24  ? 20.531  29.214  35.750  1.00 35.02 ? 25   LYS B C   1 
ATOM   2682  O  O   . LYS B  1 24  ? 20.580  29.927  34.738  1.00 33.60 ? 25   LYS B O   1 
ATOM   2683  C  CB  . LYS B  1 24  ? 20.712  26.745  35.259  1.00 34.66 ? 25   LYS B CB  1 
ATOM   2684  C  CG  . LYS B  1 24  ? 20.139  25.345  35.556  1.00 40.80 ? 25   LYS B CG  1 
ATOM   2685  C  CD  . LYS B  1 24  ? 21.124  24.207  35.234  1.00 45.02 ? 25   LYS B CD  1 
ATOM   2686  C  CE  . LYS B  1 24  ? 20.464  22.836  35.382  1.00 48.62 ? 25   LYS B CE  1 
ATOM   2687  N  NZ  . LYS B  1 24  ? 21.323  21.689  34.944  1.00 49.59 ? 25   LYS B NZ  1 
ATOM   2688  N  N   . THR B  1 25  ? 21.069  29.563  36.916  1.00 36.16 ? 26   THR B N   1 
ATOM   2689  C  CA  . THR B  1 25  ? 21.905  30.755  37.093  1.00 35.44 ? 26   THR B CA  1 
ATOM   2690  C  C   . THR B  1 25  ? 23.355  30.260  37.135  1.00 35.92 ? 26   THR B C   1 
ATOM   2691  O  O   . THR B  1 25  ? 23.634  29.180  37.651  1.00 33.54 ? 26   THR B O   1 
ATOM   2692  C  CB  . THR B  1 25  ? 21.507  31.518  38.367  1.00 36.49 ? 26   THR B CB  1 
ATOM   2693  O  OG1 . THR B  1 25  ? 20.381  32.365  38.088  1.00 35.25 ? 26   THR B OG1 1 
ATOM   2694  C  CG2 . THR B  1 25  ? 22.645  32.378  38.897  1.00 38.92 ? 26   THR B CG2 1 
ATOM   2695  N  N   . SER B  1 26  ? 24.265  31.037  36.555  1.00 35.41 ? 27   SER B N   1 
ATOM   2696  C  CA  . SER B  1 26  ? 25.624  30.578  36.307  1.00 37.08 ? 27   SER B CA  1 
ATOM   2697  C  C   . SER B  1 26  ? 26.622  31.744  36.410  1.00 37.63 ? 27   SER B C   1 
ATOM   2698  O  O   . SER B  1 26  ? 26.243  32.905  36.215  1.00 35.73 ? 27   SER B O   1 
ATOM   2699  C  CB  . SER B  1 26  ? 25.675  29.970  34.906  1.00 36.83 ? 27   SER B CB  1 
ATOM   2700  O  OG  . SER B  1 26  ? 26.565  28.890  34.840  1.00 43.90 ? 27   SER B OG  1 
ATOM   2701  N  N   . GLU B  1 27  ? 27.882  31.433  36.720  1.00 38.19 ? 28   GLU B N   1 
ATOM   2702  C  CA  . GLU B  1 27  ? 28.961  32.435  36.696  1.00 39.11 ? 28   GLU B CA  1 
ATOM   2703  C  C   . GLU B  1 27  ? 29.791  32.290  35.431  1.00 37.95 ? 28   GLU B C   1 
ATOM   2704  O  O   . GLU B  1 27  ? 30.195  31.182  35.077  1.00 38.04 ? 28   GLU B O   1 
ATOM   2705  C  CB  . GLU B  1 27  ? 29.890  32.278  37.901  1.00 39.37 ? 28   GLU B CB  1 
ATOM   2706  N  N   . LEU B  1 28  ? 30.050  33.409  34.761  1.00 37.26 ? 29   LEU B N   1 
ATOM   2707  C  CA  . LEU B  1 28  ? 30.954  33.432  33.590  1.00 36.81 ? 29   LEU B CA  1 
ATOM   2708  C  C   . LEU B  1 28  ? 32.383  33.816  34.017  1.00 35.55 ? 29   LEU B C   1 
ATOM   2709  O  O   . LEU B  1 28  ? 32.558  34.642  34.918  1.00 32.34 ? 29   LEU B O   1 
ATOM   2710  C  CB  . LEU B  1 28  ? 30.436  34.431  32.545  1.00 35.61 ? 29   LEU B CB  1 
ATOM   2711  C  CG  . LEU B  1 28  ? 29.091  34.097  31.882  1.00 36.58 ? 29   LEU B CG  1 
ATOM   2712  C  CD1 . LEU B  1 28  ? 28.528  35.304  31.134  1.00 32.36 ? 29   LEU B CD1 1 
ATOM   2713  C  CD2 . LEU B  1 28  ? 29.234  32.889  30.964  1.00 31.80 ? 29   LEU B CD2 1 
ATOM   2714  N  N   . PRO B  1 29  ? 33.402  33.236  33.370  1.00 36.90 ? 30   PRO B N   1 
ATOM   2715  C  CA  . PRO B  1 29  ? 34.791  33.616  33.663  1.00 39.43 ? 30   PRO B CA  1 
ATOM   2716  C  C   . PRO B  1 29  ? 35.141  35.027  33.140  1.00 40.92 ? 30   PRO B C   1 
ATOM   2717  O  O   . PRO B  1 29  ? 34.327  35.657  32.460  1.00 39.55 ? 30   PRO B O   1 
ATOM   2718  C  CB  . PRO B  1 29  ? 35.606  32.535  32.958  1.00 39.97 ? 30   PRO B CB  1 
ATOM   2719  C  CG  . PRO B  1 29  ? 34.732  32.048  31.859  1.00 41.10 ? 30   PRO B CG  1 
ATOM   2720  C  CD  . PRO B  1 29  ? 33.311  32.262  32.272  1.00 38.36 ? 30   PRO B CD  1 
ATOM   2721  N  N   . PRO B  1 30  ? 36.335  35.538  33.477  1.00 43.50 ? 31   PRO B N   1 
ATOM   2722  C  CA  . PRO B  1 30  ? 36.668  36.882  32.960  1.00 43.00 ? 31   PRO B CA  1 
ATOM   2723  C  C   . PRO B  1 30  ? 36.962  36.840  31.462  1.00 40.54 ? 31   PRO B C   1 
ATOM   2724  O  O   . PRO B  1 30  ? 37.326  35.793  30.943  1.00 39.43 ? 31   PRO B O   1 
ATOM   2725  C  CB  . PRO B  1 30  ? 37.914  37.286  33.762  1.00 43.68 ? 31   PRO B CB  1 
ATOM   2726  C  CG  . PRO B  1 30  ? 38.474  36.004  34.351  1.00 45.18 ? 31   PRO B CG  1 
ATOM   2727  C  CD  . PRO B  1 30  ? 37.481  34.879  34.131  1.00 44.11 ? 31   PRO B CD  1 
ATOM   2728  N  N   . LEU B  1 31  ? 36.775  37.958  30.774  1.00 40.23 ? 32   LEU B N   1 
ATOM   2729  C  CA  . LEU B  1 31  ? 37.105  38.035  29.345  1.00 39.17 ? 32   LEU B CA  1 
ATOM   2730  C  C   . LEU B  1 31  ? 38.586  37.793  29.101  1.00 39.51 ? 32   LEU B C   1 
ATOM   2731  O  O   . LEU B  1 31  ? 39.432  38.293  29.844  1.00 40.74 ? 32   LEU B O   1 
ATOM   2732  C  CB  . LEU B  1 31  ? 36.748  39.408  28.782  1.00 38.33 ? 32   LEU B CB  1 
ATOM   2733  C  CG  . LEU B  1 31  ? 35.277  39.778  28.637  1.00 36.41 ? 32   LEU B CG  1 
ATOM   2734  C  CD1 . LEU B  1 31  ? 35.171  41.142  27.996  1.00 32.61 ? 32   LEU B CD1 1 
ATOM   2735  C  CD2 . LEU B  1 31  ? 34.536  38.732  27.812  1.00 36.95 ? 32   LEU B CD2 1 
ATOM   2736  N  N   . LYS B  1 32  ? 38.887  37.008  28.074  1.00 40.03 ? 33   LYS B N   1 
ATOM   2737  C  CA  . LYS B  1 32  ? 40.230  36.941  27.500  1.00 41.16 ? 33   LYS B CA  1 
ATOM   2738  C  C   . LYS B  1 32  ? 40.379  37.957  26.365  1.00 42.43 ? 33   LYS B C   1 
ATOM   2739  O  O   . LYS B  1 32  ? 39.387  38.458  25.810  1.00 41.78 ? 33   LYS B O   1 
ATOM   2740  C  CB  . LYS B  1 32  ? 40.526  35.551  26.944  1.00 41.87 ? 33   LYS B CB  1 
ATOM   2741  C  CG  . LYS B  1 32  ? 40.517  34.429  27.983  1.00 45.41 ? 33   LYS B CG  1 
ATOM   2742  C  CD  . LYS B  1 32  ? 40.646  33.052  27.295  1.00 49.32 ? 33   LYS B CD  1 
ATOM   2743  C  CE  . LYS B  1 32  ? 40.672  31.895  28.299  1.00 53.10 ? 33   LYS B CE  1 
ATOM   2744  N  NZ  . LYS B  1 32  ? 39.334  31.539  28.841  1.00 51.60 ? 33   LYS B NZ  1 
ATOM   2745  N  N   . ASN B  1 33  ? 41.628  38.256  26.022  1.00 41.81 ? 34   ASN B N   1 
ATOM   2746  C  CA  . ASN B  1 33  ? 41.909  39.215  24.976  1.00 40.78 ? 34   ASN B CA  1 
ATOM   2747  C  C   . ASN B  1 33  ? 41.226  38.783  23.677  1.00 37.10 ? 34   ASN B C   1 
ATOM   2748  O  O   . ASN B  1 33  ? 41.295  37.629  23.291  1.00 34.21 ? 34   ASN B O   1 
ATOM   2749  C  CB  . ASN B  1 33  ? 43.431  39.380  24.796  1.00 40.97 ? 34   ASN B CB  1 
ATOM   2750  C  CG  . ASN B  1 33  ? 44.074  40.222  25.905  1.00 44.57 ? 34   ASN B CG  1 
ATOM   2751  O  OD1 . ASN B  1 33  ? 43.472  41.171  26.434  1.00 43.28 ? 34   ASN B OD1 1 
ATOM   2752  N  ND2 . ASN B  1 33  ? 45.309  39.883  26.248  1.00 42.42 ? 34   ASN B ND2 1 
ATOM   2753  N  N   . GLY B  1 34  ? 40.529  39.715  23.035  1.00 36.43 ? 35   GLY B N   1 
ATOM   2754  C  CA  . GLY B  1 34  ? 39.763  39.420  21.810  1.00 34.92 ? 35   GLY B CA  1 
ATOM   2755  C  C   . GLY B  1 34  ? 38.301  39.049  22.035  1.00 33.80 ? 35   GLY B C   1 
ATOM   2756  O  O   . GLY B  1 34  ? 37.522  38.944  21.074  1.00 33.55 ? 35   GLY B O   1 
ATOM   2757  N  N   . GLU B  1 35  ? 37.911  38.845  23.290  1.00 31.62 ? 36   GLU B N   1 
ATOM   2758  C  CA  . GLU B  1 35  ? 36.521  38.462  23.599  1.00 31.37 ? 36   GLU B CA  1 
ATOM   2759  C  C   . GLU B  1 35  ? 35.666  39.645  24.014  1.00 29.19 ? 36   GLU B C   1 
ATOM   2760  O  O   . GLU B  1 35  ? 36.192  40.700  24.410  1.00 30.24 ? 36   GLU B O   1 
ATOM   2761  C  CB  . GLU B  1 35  ? 36.483  37.397  24.690  1.00 31.66 ? 36   GLU B CB  1 
ATOM   2762  C  CG  . GLU B  1 35  ? 37.223  36.138  24.313  1.00 29.90 ? 36   GLU B CG  1 
ATOM   2763  C  CD  . GLU B  1 35  ? 37.114  35.071  25.368  1.00 31.56 ? 36   GLU B CD  1 
ATOM   2764  O  OE1 . GLU B  1 35  ? 37.103  35.422  26.554  1.00 26.14 ? 36   GLU B OE1 1 
ATOM   2765  O  OE2 . GLU B  1 35  ? 37.048  33.879  25.006  1.00 37.63 ? 36   GLU B OE2 1 
ATOM   2766  N  N   . VAL B  1 36  ? 34.350  39.473  23.906  1.00 26.91 ? 37   VAL B N   1 
ATOM   2767  C  CA  . VAL B  1 36  ? 33.403  40.459  24.429  1.00 25.38 ? 37   VAL B CA  1 
ATOM   2768  C  C   . VAL B  1 36  ? 32.330  39.801  25.283  1.00 24.89 ? 37   VAL B C   1 
ATOM   2769  O  O   . VAL B  1 36  ? 32.112  38.602  25.183  1.00 23.91 ? 37   VAL B O   1 
ATOM   2770  C  CB  . VAL B  1 36  ? 32.725  41.276  23.326  1.00 23.78 ? 37   VAL B CB  1 
ATOM   2771  C  CG1 . VAL B  1 36  ? 33.746  41.984  22.499  1.00 19.77 ? 37   VAL B CG1 1 
ATOM   2772  C  CG2 . VAL B  1 36  ? 31.823  40.401  22.467  1.00 20.24 ? 37   VAL B CG2 1 
ATOM   2773  N  N   . LEU B  1 37  ? 31.699  40.601  26.147  1.00 25.65 ? 38   LEU B N   1 
ATOM   2774  C  CA  . LEU B  1 37  ? 30.597  40.141  26.989  1.00 26.75 ? 38   LEU B CA  1 
ATOM   2775  C  C   . LEU B  1 37  ? 29.341  40.708  26.399  1.00 25.30 ? 38   LEU B C   1 
ATOM   2776  O  O   . LEU B  1 37  ? 29.246  41.923  26.203  1.00 23.08 ? 38   LEU B O   1 
ATOM   2777  C  CB  . LEU B  1 37  ? 30.733  40.607  28.431  1.00 28.06 ? 38   LEU B CB  1 
ATOM   2778  C  CG  . LEU B  1 37  ? 29.604  40.212  29.396  1.00 29.14 ? 38   LEU B CG  1 
ATOM   2779  C  CD1 . LEU B  1 37  ? 29.444  38.693  29.436  1.00 27.62 ? 38   LEU B CD1 1 
ATOM   2780  C  CD2 . LEU B  1 37  ? 29.868  40.778  30.802  1.00 32.60 ? 38   LEU B CD2 1 
ATOM   2781  N  N   . LEU B  1 38  ? 28.395  39.822  26.101  1.00 23.39 ? 39   LEU B N   1 
ATOM   2782  C  CA  . LEU B  1 38  ? 27.154  40.207  25.427  1.00 24.26 ? 39   LEU B CA  1 
ATOM   2783  C  C   . LEU B  1 38  ? 25.983  40.167  26.394  1.00 23.14 ? 39   LEU B C   1 
ATOM   2784  O  O   . LEU B  1 38  ? 25.848  39.238  27.173  1.00 26.02 ? 39   LEU B O   1 
ATOM   2785  C  CB  . LEU B  1 38  ? 26.885  39.267  24.257  1.00 24.49 ? 39   LEU B CB  1 
ATOM   2786  C  CG  . LEU B  1 38  ? 27.882  39.225  23.094  1.00 26.28 ? 39   LEU B CG  1 
ATOM   2787  C  CD1 . LEU B  1 38  ? 27.354  38.273  22.046  1.00 23.53 ? 39   LEU B CD1 1 
ATOM   2788  C  CD2 . LEU B  1 38  ? 28.153  40.621  22.473  1.00 19.75 ? 39   LEU B CD2 1 
ATOM   2789  N  N   . GLU B  1 39  ? 25.147  41.188  26.338  1.00 23.06 ? 40   GLU B N   1 
ATOM   2790  C  CA  . GLU B  1 39  ? 23.933  41.242  27.115  1.00 24.49 ? 40   GLU B CA  1 
ATOM   2791  C  C   . GLU B  1 39  ? 22.767  41.193  26.159  1.00 21.90 ? 40   GLU B C   1 
ATOM   2792  O  O   . GLU B  1 39  ? 22.649  42.052  25.295  1.00 18.66 ? 40   GLU B O   1 
ATOM   2793  C  CB  . GLU B  1 39  ? 23.871  42.536  27.890  1.00 24.95 ? 40   GLU B CB  1 
ATOM   2794  C  CG  . GLU B  1 39  ? 22.544  42.802  28.565  1.00 30.71 ? 40   GLU B CG  1 
ATOM   2795  C  CD  . GLU B  1 39  ? 22.690  43.809  29.674  1.00 39.94 ? 40   GLU B CD  1 
ATOM   2796  O  OE1 . GLU B  1 39  ? 22.588  45.001  29.366  1.00 36.22 ? 40   GLU B OE1 1 
ATOM   2797  O  OE2 . GLU B  1 39  ? 22.955  43.399  30.834  1.00 45.95 ? 40   GLU B OE2 1 
ATOM   2798  N  N   . ALA B  1 40  ? 21.891  40.221  26.350  1.00 20.66 ? 41   ALA B N   1 
ATOM   2799  C  CA  . ALA B  1 40  ? 20.741  40.073  25.472  1.00 22.54 ? 41   ALA B CA  1 
ATOM   2800  C  C   . ALA B  1 40  ? 19.780  41.228  25.690  1.00 21.57 ? 41   ALA B C   1 
ATOM   2801  O  O   . ALA B  1 40  ? 19.504  41.597  26.818  1.00 22.19 ? 41   ALA B O   1 
ATOM   2802  C  CB  . ALA B  1 40  ? 20.036  38.725  25.722  1.00 21.08 ? 41   ALA B CB  1 
ATOM   2803  N  N   . LEU B  1 41  ? 19.304  41.794  24.592  1.00 22.30 ? 42   LEU B N   1 
ATOM   2804  C  CA  . LEU B  1 41  ? 18.303  42.843  24.593  1.00 24.97 ? 42   LEU B CA  1 
ATOM   2805  C  C   . LEU B  1 41  ? 16.946  42.284  24.155  1.00 23.76 ? 42   LEU B C   1 
ATOM   2806  O  O   . LEU B  1 41  ? 15.958  42.541  24.794  1.00 24.16 ? 42   LEU B O   1 
ATOM   2807  C  CB  . LEU B  1 41  ? 18.688  43.947  23.620  1.00 24.87 ? 42   LEU B CB  1 
ATOM   2808  C  CG  . LEU B  1 41  ? 19.872  44.824  23.977  1.00 25.90 ? 42   LEU B CG  1 
ATOM   2809  C  CD1 . LEU B  1 41  ? 20.232  45.694  22.784  1.00 24.42 ? 42   LEU B CD1 1 
ATOM   2810  C  CD2 . LEU B  1 41  ? 19.517  45.676  25.196  1.00 28.06 ? 42   LEU B CD2 1 
ATOM   2811  N  N   . PHE B  1 42  ? 16.933  41.543  23.051  1.00 23.57 ? 43   PHE B N   1 
ATOM   2812  C  CA  . PHE B  1 42  ? 15.747  40.833  22.556  1.00 23.58 ? 43   PHE B CA  1 
ATOM   2813  C  C   . PHE B  1 42  ? 16.175  39.435  22.118  1.00 24.40 ? 43   PHE B C   1 
ATOM   2814  O  O   . PHE B  1 42  ? 17.228  39.287  21.477  1.00 25.41 ? 43   PHE B O   1 
ATOM   2815  C  CB  . PHE B  1 42  ? 15.125  41.550  21.374  1.00 21.63 ? 43   PHE B CB  1 
ATOM   2816  C  CG  . PHE B  1 42  ? 14.669  42.944  21.675  1.00 24.46 ? 43   PHE B CG  1 
ATOM   2817  C  CD1 . PHE B  1 42  ? 13.399  43.185  22.174  1.00 25.39 ? 43   PHE B CD1 1 
ATOM   2818  C  CD2 . PHE B  1 42  ? 15.502  44.029  21.434  1.00 27.48 ? 43   PHE B CD2 1 
ATOM   2819  C  CE1 . PHE B  1 42  ? 12.969  44.487  22.435  1.00 28.71 ? 43   PHE B CE1 1 
ATOM   2820  C  CE2 . PHE B  1 42  ? 15.080  45.321  21.684  1.00 26.00 ? 43   PHE B CE2 1 
ATOM   2821  C  CZ  . PHE B  1 42  ? 13.822  45.555  22.190  1.00 28.63 ? 43   PHE B CZ  1 
ATOM   2822  N  N   . LEU B  1 43  ? 15.382  38.424  22.481  1.00 22.07 ? 44   LEU B N   1 
ATOM   2823  C  CA  . LEU B  1 43  ? 15.632  37.028  22.097  1.00 22.48 ? 44   LEU B CA  1 
ATOM   2824  C  C   . LEU B  1 43  ? 14.443  36.523  21.299  1.00 22.44 ? 44   LEU B C   1 
ATOM   2825  O  O   . LEU B  1 43  ? 13.309  36.975  21.498  1.00 18.64 ? 44   LEU B O   1 
ATOM   2826  C  CB  . LEU B  1 43  ? 15.843  36.129  23.316  1.00 20.94 ? 44   LEU B CB  1 
ATOM   2827  C  CG  . LEU B  1 43  ? 16.886  36.557  24.350  1.00 20.50 ? 44   LEU B CG  1 
ATOM   2828  C  CD1 . LEU B  1 43  ? 16.237  37.481  25.389  1.00 20.76 ? 44   LEU B CD1 1 
ATOM   2829  C  CD2 . LEU B  1 43  ? 17.533  35.341  25.007  1.00 15.77 ? 44   LEU B CD2 1 
ATOM   2830  N  N   . THR B  1 44  ? 14.711  35.597  20.379  1.00 21.98 ? 45   THR B N   1 
ATOM   2831  C  CA  . THR B  1 44  ? 13.666  35.032  19.532  1.00 19.65 ? 45   THR B CA  1 
ATOM   2832  C  C   . THR B  1 44  ? 13.331  33.636  19.982  1.00 18.11 ? 45   THR B C   1 
ATOM   2833  O  O   . THR B  1 44  ? 14.156  32.945  20.567  1.00 14.71 ? 45   THR B O   1 
ATOM   2834  C  CB  . THR B  1 44  ? 14.059  35.027  18.043  1.00 22.45 ? 45   THR B CB  1 
ATOM   2835  O  OG1 . THR B  1 44  ? 13.000  34.438  17.261  1.00 21.63 ? 45   THR B OG1 1 
ATOM   2836  C  CG2 . THR B  1 44  ? 15.363  34.261  17.831  1.00 18.56 ? 45   THR B CG2 1 
ATOM   2837  N  N   . VAL B  1 45  ? 12.082  33.250  19.767  1.00 19.37 ? 46   VAL B N   1 
ATOM   2838  C  CA  . VAL B  1 45  ? 11.692  31.855  19.814  1.00 18.46 ? 46   VAL B CA  1 
ATOM   2839  C  C   . VAL B  1 45  ? 11.085  31.513  18.445  1.00 16.78 ? 46   VAL B C   1 
ATOM   2840  O  O   . VAL B  1 45  ? 10.484  32.365  17.795  1.00 17.78 ? 46   VAL B O   1 
ATOM   2841  C  CB  . VAL B  1 45  ? 10.702  31.547  20.969  1.00 20.83 ? 46   VAL B CB  1 
ATOM   2842  C  CG1 . VAL B  1 45  ? 11.349  31.791  22.298  1.00 17.71 ? 46   VAL B CG1 1 
ATOM   2843  C  CG2 . VAL B  1 45  ? 9.421   32.326  20.815  1.00 13.69 ? 46   VAL B CG2 1 
ATOM   2844  N  N   . ASP B  1 46  ? 11.290  30.286  17.991  1.00 16.78 ? 47   ASP B N   1 
ATOM   2845  C  CA  . ASP B  1 46  ? 11.020  29.921  16.594  1.00 17.98 ? 47   ASP B CA  1 
ATOM   2846  C  C   . ASP B  1 46  ? 10.620  28.452  16.482  1.00 17.47 ? 47   ASP B C   1 
ATOM   2847  O  O   . ASP B  1 46  ? 11.092  27.611  17.245  1.00 17.08 ? 47   ASP B O   1 
ATOM   2848  C  CB  . ASP B  1 46  ? 12.265  30.119  15.701  1.00 17.08 ? 47   ASP B CB  1 
ATOM   2849  C  CG  . ASP B  1 46  ? 12.730  31.568  15.650  1.00 19.48 ? 47   ASP B CG  1 
ATOM   2850  O  OD1 . ASP B  1 46  ? 12.242  32.353  14.792  1.00 13.62 ? 47   ASP B OD1 1 
ATOM   2851  O  OD2 . ASP B  1 46  ? 13.564  31.907  16.513  1.00 19.57 ? 47   ASP B OD2 1 
ATOM   2852  N  N   . PRO B  1 47  ? 9.803   28.133  15.489  1.00 17.53 ? 48   PRO B N   1 
ATOM   2853  C  CA  . PRO B  1 47  ? 9.371   26.737  15.348  1.00 18.44 ? 48   PRO B CA  1 
ATOM   2854  C  C   . PRO B  1 47  ? 10.491  25.717  15.205  1.00 17.77 ? 48   PRO B C   1 
ATOM   2855  O  O   . PRO B  1 47  ? 10.370  24.618  15.746  1.00 17.43 ? 48   PRO B O   1 
ATOM   2856  C  CB  . PRO B  1 47  ? 8.450   26.779  14.123  1.00 18.24 ? 48   PRO B CB  1 
ATOM   2857  C  CG  . PRO B  1 47  ? 7.846   28.175  14.183  1.00 19.00 ? 48   PRO B CG  1 
ATOM   2858  C  CD  . PRO B  1 47  ? 8.994   29.052  14.679  1.00 18.91 ? 48   PRO B CD  1 
ATOM   2859  N  N   . TYR B  1 48  ? 11.605  26.074  14.564  1.00 18.13 ? 49   TYR B N   1 
ATOM   2860  C  CA  . TYR B  1 48  ? 12.690  25.095  14.367  1.00 17.24 ? 49   TYR B CA  1 
ATOM   2861  C  C   . TYR B  1 48  ? 13.200  24.547  15.689  1.00 16.25 ? 49   TYR B C   1 
ATOM   2862  O  O   . TYR B  1 48  ? 13.721  23.426  15.751  1.00 18.35 ? 49   TYR B O   1 
ATOM   2863  C  CB  . TYR B  1 48  ? 13.868  25.645  13.511  1.00 15.62 ? 49   TYR B CB  1 
ATOM   2864  C  CG  . TYR B  1 48  ? 14.839  26.544  14.260  1.00 17.06 ? 49   TYR B CG  1 
ATOM   2865  C  CD1 . TYR B  1 48  ? 15.870  26.006  15.057  1.00 21.39 ? 49   TYR B CD1 1 
ATOM   2866  C  CD2 . TYR B  1 48  ? 14.737  27.922  14.173  1.00 18.85 ? 49   TYR B CD2 1 
ATOM   2867  C  CE1 . TYR B  1 48  ? 16.779  26.846  15.751  1.00 19.99 ? 49   TYR B CE1 1 
ATOM   2868  C  CE2 . TYR B  1 48  ? 15.628  28.770  14.881  1.00 20.64 ? 49   TYR B CE2 1 
ATOM   2869  C  CZ  . TYR B  1 48  ? 16.643  28.228  15.647  1.00 19.25 ? 49   TYR B CZ  1 
ATOM   2870  O  OH  . TYR B  1 48  ? 17.495  29.075  16.318  1.00 22.66 ? 49   TYR B OH  1 
ATOM   2871  N  N   . MET B  1 49  ? 13.054  25.314  16.755  1.00 16.73 ? 50   MET B N   1 
ATOM   2872  C  CA  . MET B  1 49  ? 13.541  24.866  18.067  1.00 17.59 ? 50   MET B CA  1 
ATOM   2873  C  C   . MET B  1 49  ? 12.815  23.606  18.566  1.00 17.92 ? 50   MET B C   1 
ATOM   2874  O  O   . MET B  1 49  ? 13.413  22.749  19.226  1.00 17.54 ? 50   MET B O   1 
ATOM   2875  C  CB  . MET B  1 49  ? 13.376  25.997  19.076  1.00 19.80 ? 50   MET B CB  1 
ATOM   2876  C  CG  . MET B  1 49  ? 14.228  27.230  18.743  1.00 18.55 ? 50   MET B CG  1 
ATOM   2877  S  SD  . MET B  1 49  ? 13.804  28.601  19.793  1.00 19.41 ? 50   MET B SD  1 
ATOM   2878  C  CE  . MET B  1 49  ? 14.925  29.868  19.104  1.00 16.03 ? 50   MET B CE  1 
ATOM   2879  N  N   . ARG B  1 50  ? 11.529  23.499  18.248  1.00 17.11 ? 51   ARG B N   1 
ATOM   2880  C  CA  . ARG B  1 50  ? 10.761  22.307  18.624  1.00 18.19 ? 51   ARG B CA  1 
ATOM   2881  C  C   . ARG B  1 50  ? 11.321  21.070  17.931  1.00 17.35 ? 51   ARG B C   1 
ATOM   2882  O  O   . ARG B  1 50  ? 11.325  19.997  18.481  1.00 20.41 ? 51   ARG B O   1 
ATOM   2883  C  CB  . ARG B  1 50  ? 9.270   22.486  18.291  1.00 12.93 ? 51   ARG B CB  1 
ATOM   2884  C  CG  . ARG B  1 50  ? 8.402   21.240  18.537  1.00 18.58 ? 51   ARG B CG  1 
ATOM   2885  C  CD  . ARG B  1 50  ? 8.445   20.803  19.981  1.00 19.70 ? 51   ARG B CD  1 
ATOM   2886  N  NE  . ARG B  1 50  ? 7.656   19.615  20.234  1.00 17.68 ? 51   ARG B NE  1 
ATOM   2887  C  CZ  . ARG B  1 50  ? 8.104   18.359  20.144  1.00 20.09 ? 51   ARG B CZ  1 
ATOM   2888  N  NH1 . ARG B  1 50  ? 9.353   18.078  19.773  1.00 17.26 ? 51   ARG B NH1 1 
ATOM   2889  N  NH2 . ARG B  1 50  ? 7.275   17.365  20.412  1.00 19.11 ? 51   ARG B NH2 1 
ATOM   2890  N  N   . VAL B  1 51  ? 11.795  21.233  16.710  1.00 19.68 ? 52   VAL B N   1 
ATOM   2891  C  CA  . VAL B  1 51  ? 12.397  20.131  15.967  1.00 20.79 ? 52   VAL B CA  1 
ATOM   2892  C  C   . VAL B  1 51  ? 13.827  19.902  16.385  1.00 20.93 ? 52   VAL B C   1 
ATOM   2893  O  O   . VAL B  1 51  ? 14.211  18.764  16.618  1.00 20.78 ? 52   VAL B O   1 
ATOM   2894  C  CB  . VAL B  1 51  ? 12.380  20.391  14.435  1.00 22.92 ? 52   VAL B CB  1 
ATOM   2895  C  CG1 . VAL B  1 51  ? 13.086  19.256  13.699  1.00 23.88 ? 52   VAL B CG1 1 
ATOM   2896  C  CG2 . VAL B  1 51  ? 10.950  20.571  13.933  1.00 21.94 ? 52   VAL B CG2 1 
ATOM   2897  N  N   . ALA B  1 52  ? 14.626  20.972  16.471  1.00 21.45 ? 53   ALA B N   1 
ATOM   2898  C  CA  . ALA B  1 52  ? 16.066  20.821  16.722  1.00 20.60 ? 53   ALA B CA  1 
ATOM   2899  C  C   . ALA B  1 52  ? 16.375  20.312  18.120  1.00 21.48 ? 53   ALA B C   1 
ATOM   2900  O  O   . ALA B  1 52  ? 17.417  19.687  18.319  1.00 23.65 ? 53   ALA B O   1 
ATOM   2901  C  CB  . ALA B  1 52  ? 16.820  22.167  16.459  1.00 20.87 ? 53   ALA B CB  1 
ATOM   2902  N  N   . ALA B  1 53  ? 15.493  20.590  19.093  1.00 21.96 ? 54   ALA B N   1 
ATOM   2903  C  CA  . ALA B  1 53  ? 15.678  20.172  20.500  1.00 22.04 ? 54   ALA B CA  1 
ATOM   2904  C  C   . ALA B  1 53  ? 15.961  18.681  20.666  1.00 23.36 ? 54   ALA B C   1 
ATOM   2905  O  O   . ALA B  1 53  ? 16.583  18.271  21.652  1.00 20.61 ? 54   ALA B O   1 
ATOM   2906  C  CB  . ALA B  1 53  ? 14.446  20.560  21.378  1.00 20.32 ? 54   ALA B CB  1 
ATOM   2907  N  N   . LYS B  1 54  ? 15.510  17.879  19.704  1.00 25.05 ? 55   LYS B N   1 
ATOM   2908  C  CA  . LYS B  1 54  ? 15.779  16.436  19.681  1.00 28.61 ? 55   LYS B CA  1 
ATOM   2909  C  C   . LYS B  1 54  ? 17.280  16.091  19.633  1.00 28.55 ? 55   LYS B C   1 
ATOM   2910  O  O   . LYS B  1 54  ? 17.706  15.024  20.061  1.00 29.03 ? 55   LYS B O   1 
ATOM   2911  C  CB  . LYS B  1 54  ? 15.051  15.791  18.475  1.00 30.17 ? 55   LYS B CB  1 
ATOM   2912  C  CG  . LYS B  1 54  ? 13.507  15.985  18.492  1.00 41.11 ? 55   LYS B CG  1 
ATOM   2913  C  CD  . LYS B  1 54  ? 12.810  15.520  17.176  1.00 46.49 ? 55   LYS B CD  1 
ATOM   2914  C  CE  . LYS B  1 54  ? 11.290  15.700  17.275  1.00 50.63 ? 55   LYS B CE  1 
ATOM   2915  N  NZ  . LYS B  1 54  ? 10.495  14.532  16.768  1.00 55.24 ? 55   LYS B NZ  1 
ATOM   2916  N  N   . ARG B  1 55  ? 18.078  16.980  19.070  1.00 29.50 ? 56   ARG B N   1 
ATOM   2917  C  CA  . ARG B  1 55  ? 19.516  16.771  19.015  1.00 30.82 ? 56   ARG B CA  1 
ATOM   2918  C  C   . ARG B  1 55  ? 20.232  17.111  20.349  1.00 30.63 ? 56   ARG B C   1 
ATOM   2919  O  O   . ARG B  1 55  ? 21.337  16.654  20.581  1.00 30.94 ? 56   ARG B O   1 
ATOM   2920  C  CB  . ARG B  1 55  ? 20.119  17.541  17.829  1.00 31.71 ? 56   ARG B CB  1 
ATOM   2921  C  CG  . ARG B  1 55  ? 20.182  16.719  16.504  1.00 40.91 ? 56   ARG B CG  1 
ATOM   2922  C  CD  . ARG B  1 55  ? 19.016  16.947  15.538  1.00 55.34 ? 56   ARG B CD  1 
ATOM   2923  N  NE  . ARG B  1 55  ? 19.213  18.109  14.651  1.00 66.62 ? 56   ARG B NE  1 
ATOM   2924  C  CZ  . ARG B  1 55  ? 18.524  18.346  13.525  1.00 72.70 ? 56   ARG B CZ  1 
ATOM   2925  N  NH1 . ARG B  1 55  ? 17.578  17.505  13.108  1.00 75.80 ? 56   ARG B NH1 1 
ATOM   2926  N  NH2 . ARG B  1 55  ? 18.785  19.429  12.798  1.00 74.39 ? 56   ARG B NH2 1 
ATOM   2927  N  N   . LEU B  1 56  ? 19.599  17.881  21.233  1.00 29.67 ? 57   LEU B N   1 
ATOM   2928  C  CA  . LEU B  1 56  ? 20.224  18.257  22.507  1.00 29.03 ? 57   LEU B CA  1 
ATOM   2929  C  C   . LEU B  1 56  ? 20.347  17.071  23.476  1.00 31.61 ? 57   LEU B C   1 
ATOM   2930  O  O   . LEU B  1 56  ? 19.610  16.090  23.370  1.00 31.57 ? 57   LEU B O   1 
ATOM   2931  C  CB  . LEU B  1 56  ? 19.418  19.369  23.180  1.00 28.49 ? 57   LEU B CB  1 
ATOM   2932  C  CG  . LEU B  1 56  ? 19.308  20.686  22.403  1.00 27.98 ? 57   LEU B CG  1 
ATOM   2933  C  CD1 . LEU B  1 56  ? 18.434  21.642  23.183  1.00 23.17 ? 57   LEU B CD1 1 
ATOM   2934  C  CD2 . LEU B  1 56  ? 20.685  21.325  22.098  1.00 21.03 ? 57   LEU B CD2 1 
ATOM   2935  N  N   . LYS B  1 57  ? 21.311  17.148  24.392  1.00 32.46 ? 58   LYS B N   1 
ATOM   2936  C  CA  . LYS B  1 57  ? 21.341  16.263  25.550  1.00 32.88 ? 58   LYS B CA  1 
ATOM   2937  C  C   . LYS B  1 57  ? 20.543  16.979  26.627  1.00 31.53 ? 58   LYS B C   1 
ATOM   2938  O  O   . LYS B  1 57  ? 20.477  18.218  26.635  1.00 29.78 ? 58   LYS B O   1 
ATOM   2939  C  CB  . LYS B  1 57  ? 22.779  16.008  26.044  1.00 33.41 ? 58   LYS B CB  1 
ATOM   2940  C  CG  . LYS B  1 57  ? 23.655  15.183  25.088  1.00 41.01 ? 58   LYS B CG  1 
ATOM   2941  C  CD  . LYS B  1 57  ? 23.381  13.678  25.196  1.00 53.01 ? 58   LYS B CD  1 
ATOM   2942  C  CE  . LYS B  1 57  ? 24.357  12.842  24.357  1.00 57.54 ? 58   LYS B CE  1 
ATOM   2943  N  NZ  . LYS B  1 57  ? 24.013  12.818  22.905  1.00 58.83 ? 58   LYS B NZ  1 
ATOM   2944  N  N   . GLU B  1 58  ? 19.956  16.222  27.547  1.00 30.55 ? 59   GLU B N   1 
ATOM   2945  C  CA  . GLU B  1 58  ? 19.196  16.841  28.645  1.00 32.05 ? 59   GLU B CA  1 
ATOM   2946  C  C   . GLU B  1 58  ? 20.198  17.631  29.488  1.00 30.88 ? 59   GLU B C   1 
ATOM   2947  O  O   . GLU B  1 58  ? 21.300  17.159  29.755  1.00 31.08 ? 59   GLU B O   1 
ATOM   2948  C  CB  . GLU B  1 58  ? 18.391  15.789  29.469  1.00 33.30 ? 59   GLU B CB  1 
ATOM   2949  C  CG  . GLU B  1 58  ? 17.476  14.910  28.582  1.00 38.97 ? 59   GLU B CG  1 
ATOM   2950  C  CD  . GLU B  1 58  ? 16.431  14.053  29.318  1.00 49.48 ? 59   GLU B CD  1 
ATOM   2951  O  OE1 . GLU B  1 58  ? 16.635  13.686  30.498  1.00 50.11 ? 59   GLU B OE1 1 
ATOM   2952  O  OE2 . GLU B  1 58  ? 15.394  13.726  28.679  1.00 52.26 ? 59   GLU B OE2 1 
ATOM   2953  N  N   . GLY B  1 59  ? 19.838  18.858  29.848  1.00 29.82 ? 60   GLY B N   1 
ATOM   2954  C  CA  . GLY B  1 59  ? 20.779  19.764  30.521  1.00 27.60 ? 60   GLY B CA  1 
ATOM   2955  C  C   . GLY B  1 59  ? 21.352  20.854  29.614  1.00 26.88 ? 60   GLY B C   1 
ATOM   2956  O  O   . GLY B  1 59  ? 21.796  21.896  30.100  1.00 26.39 ? 60   GLY B O   1 
ATOM   2957  N  N   . ASP B  1 60  ? 21.330  20.633  28.299  1.00 26.51 ? 61   ASP B N   1 
ATOM   2958  C  CA  . ASP B  1 60  ? 21.863  21.613  27.344  1.00 25.69 ? 61   ASP B CA  1 
ATOM   2959  C  C   . ASP B  1 60  ? 20.991  22.841  27.275  1.00 24.49 ? 61   ASP B C   1 
ATOM   2960  O  O   . ASP B  1 60  ? 19.770  22.798  27.520  1.00 26.18 ? 61   ASP B O   1 
ATOM   2961  C  CB  . ASP B  1 60  ? 21.947  21.042  25.923  1.00 28.68 ? 61   ASP B CB  1 
ATOM   2962  C  CG  . ASP B  1 60  ? 23.026  19.996  25.753  1.00 28.60 ? 61   ASP B CG  1 
ATOM   2963  O  OD1 . ASP B  1 60  ? 23.849  19.854  26.667  1.00 32.75 ? 61   ASP B OD1 1 
ATOM   2964  O  OD2 . ASP B  1 60  ? 23.031  19.310  24.690  1.00 28.51 ? 61   ASP B OD2 1 
ATOM   2965  N  N   . THR B  1 61  ? 21.641  23.933  26.911  1.00 22.73 ? 62   THR B N   1 
ATOM   2966  C  CA  . THR B  1 61  ? 20.993  25.204  26.644  1.00 23.51 ? 62   THR B CA  1 
ATOM   2967  C  C   . THR B  1 61  ? 20.102  25.123  25.409  1.00 20.98 ? 62   THR B C   1 
ATOM   2968  O  O   . THR B  1 61  ? 20.487  24.515  24.419  1.00 19.80 ? 62   THR B O   1 
ATOM   2969  C  CB  . THR B  1 61  ? 22.058  26.266  26.421  1.00 24.62 ? 62   THR B CB  1 
ATOM   2970  O  OG1 . THR B  1 61  ? 22.900  26.292  27.572  1.00 26.02 ? 62   THR B OG1 1 
ATOM   2971  C  CG2 . THR B  1 61  ? 21.443  27.635  26.183  1.00 22.57 ? 62   THR B CG2 1 
ATOM   2972  N  N   . MET B  1 62  ? 18.904  25.701  25.486  1.00 19.91 ? 63   MET B N   1 
ATOM   2973  C  CA  . MET B  1 62  ? 18.041  25.785  24.315  1.00 21.79 ? 63   MET B CA  1 
ATOM   2974  C  C   . MET B  1 62  ? 18.699  26.682  23.266  1.00 22.81 ? 63   MET B C   1 
ATOM   2975  O  O   . MET B  1 62  ? 19.241  27.719  23.613  1.00 23.55 ? 63   MET B O   1 
ATOM   2976  C  CB  . MET B  1 62  ? 16.687  26.355  24.670  1.00 21.07 ? 63   MET B CB  1 
ATOM   2977  C  CG  . MET B  1 62  ? 15.783  25.389  25.378  1.00 23.02 ? 63   MET B CG  1 
ATOM   2978  S  SD  . MET B  1 62  ? 15.285  24.007  24.367  1.00 25.49 ? 63   MET B SD  1 
ATOM   2979  C  CE  . MET B  1 62  ? 14.445  24.797  22.997  1.00 18.81 ? 63   MET B CE  1 
ATOM   2980  N  N   . MET B  1 63  ? 18.623  26.289  21.995  1.00 21.99 ? 64   MET B N   1 
ATOM   2981  C  CA  . MET B  1 63  ? 19.302  27.022  20.949  1.00 22.07 ? 64   MET B CA  1 
ATOM   2982  C  C   . MET B  1 63  ? 18.496  28.244  20.567  1.00 21.93 ? 64   MET B C   1 
ATOM   2983  O  O   . MET B  1 63  ? 17.253  28.258  20.664  1.00 22.02 ? 64   MET B O   1 
ATOM   2984  C  CB  . MET B  1 63  ? 19.572  26.135  19.724  1.00 22.75 ? 64   MET B CB  1 
ATOM   2985  C  CG  . MET B  1 63  ? 18.336  25.801  18.854  1.00 23.47 ? 64   MET B CG  1 
ATOM   2986  S  SD  . MET B  1 63  ? 17.157  24.700  19.687  1.00 23.82 ? 64   MET B SD  1 
ATOM   2987  C  CE  . MET B  1 63  ? 18.132  23.213  19.663  1.00 17.28 ? 64   MET B CE  1 
ATOM   2988  N  N   . GLY B  1 64  ? 19.191  29.271  20.096  1.00 20.22 ? 65   GLY B N   1 
ATOM   2989  C  CA  . GLY B  1 64  ? 18.493  30.425  19.552  1.00 20.47 ? 65   GLY B CA  1 
ATOM   2990  C  C   . GLY B  1 64  ? 19.330  31.653  19.304  1.00 20.73 ? 65   GLY B C   1 
ATOM   2991  O  O   . GLY B  1 64  ? 20.429  31.768  19.820  1.00 19.64 ? 65   GLY B O   1 
ATOM   2992  N  N   . GLN B  1 65  ? 18.757  32.583  18.544  1.00 20.43 ? 66   GLN B N   1 
ATOM   2993  C  CA  . GLN B  1 65  ? 19.389  33.850  18.215  1.00 21.07 ? 66   GLN B CA  1 
ATOM   2994  C  C   . GLN B  1 65  ? 18.874  34.971  19.132  1.00 21.39 ? 66   GLN B C   1 
ATOM   2995  O  O   . GLN B  1 65  ? 17.776  34.874  19.665  1.00 20.64 ? 66   GLN B O   1 
ATOM   2996  C  CB  . GLN B  1 65  ? 19.100  34.192  16.749  1.00 20.16 ? 66   GLN B CB  1 
ATOM   2997  C  CG  . GLN B  1 65  ? 19.909  35.342  16.192  1.00 19.13 ? 66   GLN B CG  1 
ATOM   2998  C  CD  . GLN B  1 65  ? 19.730  35.507  14.695  1.00 17.89 ? 66   GLN B CD  1 
ATOM   2999  O  OE1 . GLN B  1 65  ? 18.605  35.579  14.185  1.00 19.64 ? 66   GLN B OE1 1 
ATOM   3000  N  NE2 . GLN B  1 65  ? 20.843  35.576  13.978  1.00 18.42 ? 66   GLN B NE2 1 
ATOM   3001  N  N   . GLN B  1 66  ? 19.671  36.030  19.295  1.00 23.03 ? 67   GLN B N   1 
ATOM   3002  C  CA  . GLN B  1 66  ? 19.265  37.250  20.045  1.00 23.19 ? 67   GLN B CA  1 
ATOM   3003  C  C   . GLN B  1 66  ? 19.886  38.499  19.424  1.00 21.44 ? 67   GLN B C   1 
ATOM   3004  O  O   . GLN B  1 66  ? 20.923  38.427  18.763  1.00 22.70 ? 67   GLN B O   1 
ATOM   3005  C  CB  . GLN B  1 66  ? 19.631  37.154  21.555  1.00 22.63 ? 67   GLN B CB  1 
ATOM   3006  C  CG  . GLN B  1 66  ? 21.105  36.962  21.801  1.00 23.29 ? 67   GLN B CG  1 
ATOM   3007  C  CD  . GLN B  1 66  ? 21.512  36.780  23.261  1.00 25.56 ? 67   GLN B CD  1 
ATOM   3008  O  OE1 . GLN B  1 66  ? 22.290  37.567  23.795  1.00 18.26 ? 67   GLN B OE1 1 
ATOM   3009  N  NE2 . GLN B  1 66  ? 21.037  35.717  23.886  1.00 21.89 ? 67   GLN B NE2 1 
ATOM   3010  N  N   . VAL B  1 67  ? 19.240  39.643  19.609  1.00 22.17 ? 68   VAL B N   1 
ATOM   3011  C  CA  . VAL B  1 67  ? 19.929  40.919  19.471  1.00 21.24 ? 68   VAL B CA  1 
ATOM   3012  C  C   . VAL B  1 67  ? 20.617  41.202  20.835  1.00 23.20 ? 68   VAL B C   1 
ATOM   3013  O  O   . VAL B  1 67  ? 19.975  41.147  21.892  1.00 23.29 ? 68   VAL B O   1 
ATOM   3014  C  CB  . VAL B  1 67  ? 18.976  42.064  19.090  1.00 22.29 ? 68   VAL B CB  1 
ATOM   3015  C  CG1 . VAL B  1 67  ? 19.752  43.402  18.993  1.00 15.81 ? 68   VAL B CG1 1 
ATOM   3016  C  CG2 . VAL B  1 67  ? 18.221  41.770  17.774  1.00 17.05 ? 68   VAL B CG2 1 
ATOM   3017  N  N   . ALA B  1 68  ? 21.921  41.469  20.820  1.00 24.17 ? 69   ALA B N   1 
ATOM   3018  C  CA  . ALA B  1 68  ? 22.677  41.731  22.053  1.00 22.76 ? 69   ALA B CA  1 
ATOM   3019  C  C   . ALA B  1 68  ? 23.535  42.984  21.924  1.00 24.21 ? 69   ALA B C   1 
ATOM   3020  O  O   . ALA B  1 68  ? 23.861  43.403  20.814  1.00 22.38 ? 69   ALA B O   1 
ATOM   3021  C  CB  . ALA B  1 68  ? 23.560  40.565  22.390  1.00 20.52 ? 69   ALA B CB  1 
ATOM   3022  N  N   . LYS B  1 69  ? 23.861  43.562  23.084  1.00 25.29 ? 70   LYS B N   1 
ATOM   3023  C  CA  . LYS B  1 69  ? 24.751  44.705  23.226  1.00 26.14 ? 70   LYS B CA  1 
ATOM   3024  C  C   . LYS B  1 69  ? 26.059  44.252  23.876  1.00 25.40 ? 70   LYS B C   1 
ATOM   3025  O  O   . LYS B  1 69  ? 26.041  43.510  24.868  1.00 21.27 ? 70   LYS B O   1 
ATOM   3026  C  CB  . LYS B  1 69  ? 24.099  45.781  24.100  1.00 27.53 ? 70   LYS B CB  1 
ATOM   3027  C  CG  . LYS B  1 69  ? 24.960  47.069  24.300  1.00 31.98 ? 70   LYS B CG  1 
ATOM   3028  C  CD  . LYS B  1 69  ? 24.086  48.326  24.469  1.00 30.66 ? 70   LYS B CD  1 
ATOM   3029  N  N   . VAL B  1 70  ? 27.184  44.680  23.299  1.00 24.48 ? 71   VAL B N   1 
ATOM   3030  C  CA  . VAL B  1 70  ? 28.487  44.483  23.927  1.00 26.34 ? 71   VAL B CA  1 
ATOM   3031  C  C   . VAL B  1 70  ? 28.560  45.405  25.134  1.00 26.53 ? 71   VAL B C   1 
ATOM   3032  O  O   . VAL B  1 70  ? 28.415  46.620  24.997  1.00 25.96 ? 71   VAL B O   1 
ATOM   3033  C  CB  . VAL B  1 70  ? 29.644  44.812  22.969  1.00 26.35 ? 71   VAL B CB  1 
ATOM   3034  C  CG1 . VAL B  1 70  ? 30.959  44.937  23.728  1.00 29.51 ? 71   VAL B CG1 1 
ATOM   3035  C  CG2 . VAL B  1 70  ? 29.741  43.766  21.898  1.00 24.90 ? 71   VAL B CG2 1 
ATOM   3036  N  N   . VAL B  1 71  ? 28.750  44.827  26.312  1.00 26.83 ? 72   VAL B N   1 
ATOM   3037  C  CA  . VAL B  1 71  ? 28.799  45.611  27.553  1.00 28.77 ? 72   VAL B CA  1 
ATOM   3038  C  C   . VAL B  1 71  ? 30.184  45.587  28.200  1.00 29.80 ? 72   VAL B C   1 
ATOM   3039  O  O   . VAL B  1 71  ? 30.468  46.391  29.058  1.00 27.83 ? 72   VAL B O   1 
ATOM   3040  C  CB  . VAL B  1 71  ? 27.741  45.158  28.594  1.00 27.70 ? 72   VAL B CB  1 
ATOM   3041  C  CG1 . VAL B  1 71  ? 26.342  45.593  28.135  1.00 24.73 ? 72   VAL B CG1 1 
ATOM   3042  C  CG2 . VAL B  1 71  ? 27.839  43.684  28.858  1.00 22.40 ? 72   VAL B CG2 1 
ATOM   3043  N  N   . GLU B  1 72  ? 31.013  44.635  27.795  1.00 31.66 ? 73   GLU B N   1 
ATOM   3044  C  CA  . GLU B  1 72  ? 32.435  44.664  28.085  1.00 33.55 ? 73   GLU B CA  1 
ATOM   3045  C  C   . GLU B  1 72  ? 33.153  44.103  26.860  1.00 32.92 ? 73   GLU B C   1 
ATOM   3046  O  O   . GLU B  1 72  ? 32.698  43.122  26.242  1.00 32.76 ? 73   GLU B O   1 
ATOM   3047  C  CB  . GLU B  1 72  ? 32.768  43.845  29.335  1.00 34.80 ? 73   GLU B CB  1 
ATOM   3048  C  CG  . GLU B  1 72  ? 33.995  44.326  30.086  1.00 42.66 ? 73   GLU B CG  1 
ATOM   3049  C  CD  . GLU B  1 72  ? 34.570  43.265  31.047  1.00 52.68 ? 73   GLU B CD  1 
ATOM   3050  O  OE1 . GLU B  1 72  ? 33.784  42.445  31.588  1.00 56.48 ? 73   GLU B OE1 1 
ATOM   3051  O  OE2 . GLU B  1 72  ? 35.812  43.255  31.255  1.00 51.32 ? 73   GLU B OE2 1 
ATOM   3052  N  N   . SER B  1 73  ? 34.268  44.730  26.515  1.00 30.67 ? 74   SER B N   1 
ATOM   3053  C  CA  . SER B  1 73  ? 34.981  44.399  25.307  1.00 31.82 ? 74   SER B CA  1 
ATOM   3054  C  C   . SER B  1 73  ? 36.481  44.391  25.502  1.00 30.83 ? 74   SER B C   1 
ATOM   3055  O  O   . SER B  1 73  ? 37.039  45.377  25.954  1.00 30.59 ? 74   SER B O   1 
ATOM   3056  C  CB  . SER B  1 73  ? 34.655  45.434  24.232  1.00 31.56 ? 74   SER B CB  1 
ATOM   3057  O  OG  . SER B  1 73  ? 35.361  45.131  23.053  1.00 30.39 ? 74   SER B OG  1 
ATOM   3058  N  N   . LYS B  1 74  ? 37.117  43.286  25.148  1.00 30.46 ? 75   LYS B N   1 
ATOM   3059  C  CA  . LYS B  1 74  ? 38.541  43.276  24.887  1.00 31.61 ? 75   LYS B CA  1 
ATOM   3060  C  C   . LYS B  1 74  ? 38.818  43.082  23.382  1.00 30.88 ? 75   LYS B C   1 
ATOM   3061  O  O   . LYS B  1 74  ? 39.728  42.348  22.966  1.00 27.31 ? 75   LYS B O   1 
ATOM   3062  C  CB  . LYS B  1 74  ? 39.222  42.205  25.715  1.00 32.36 ? 75   LYS B CB  1 
ATOM   3063  C  CG  . LYS B  1 74  ? 39.352  42.560  27.175  1.00 35.86 ? 75   LYS B CG  1 
ATOM   3064  C  CD  . LYS B  1 74  ? 40.212  41.512  27.878  1.00 42.64 ? 75   LYS B CD  1 
ATOM   3065  C  CE  . LYS B  1 74  ? 40.763  42.003  29.204  1.00 46.12 ? 75   LYS B CE  1 
ATOM   3066  N  NZ  . LYS B  1 74  ? 40.109  41.337  30.331  1.00 41.40 ? 75   LYS B NZ  1 
ATOM   3067  N  N   . ASN B  1 75  ? 38.048  43.778  22.554  1.00 31.25 ? 76   ASN B N   1 
ATOM   3068  C  CA  . ASN B  1 75  ? 38.208  43.647  21.105  1.00 32.15 ? 76   ASN B CA  1 
ATOM   3069  C  C   . ASN B  1 75  ? 37.882  44.947  20.380  1.00 30.43 ? 76   ASN B C   1 
ATOM   3070  O  O   . ASN B  1 75  ? 36.712  45.320  20.302  1.00 24.88 ? 76   ASN B O   1 
ATOM   3071  C  CB  . ASN B  1 75  ? 37.330  42.497  20.587  1.00 30.87 ? 76   ASN B CB  1 
ATOM   3072  C  CG  . ASN B  1 75  ? 37.658  42.107  19.146  1.00 32.33 ? 76   ASN B CG  1 
ATOM   3073  O  OD1 . ASN B  1 75  ? 37.904  42.955  18.296  1.00 31.62 ? 76   ASN B OD1 1 
ATOM   3074  N  ND2 . ASN B  1 75  ? 37.670  40.818  18.876  1.00 30.59 ? 76   ASN B ND2 1 
ATOM   3075  N  N   . VAL B  1 76  ? 38.909  45.617  19.843  1.00 31.20 ? 77   VAL B N   1 
ATOM   3076  C  CA  . VAL B  1 76  ? 38.729  46.948  19.222  1.00 31.57 ? 77   VAL B CA  1 
ATOM   3077  C  C   . VAL B  1 76  ? 37.775  46.952  18.034  1.00 30.67 ? 77   VAL B C   1 
ATOM   3078  O  O   . VAL B  1 76  ? 37.209  48.002  17.706  1.00 31.02 ? 77   VAL B O   1 
ATOM   3079  C  CB  . VAL B  1 76  ? 40.067  47.632  18.737  1.00 33.69 ? 77   VAL B CB  1 
ATOM   3080  C  CG1 . VAL B  1 76  ? 40.771  48.299  19.889  1.00 39.89 ? 77   VAL B CG1 1 
ATOM   3081  C  CG2 . VAL B  1 76  ? 40.987  46.644  18.022  1.00 28.93 ? 77   VAL B CG2 1 
ATOM   3082  N  N   . ALA B  1 77  ? 37.613  45.802  17.377  1.00 29.95 ? 78   ALA B N   1 
ATOM   3083  C  CA  . ALA B  1 77  ? 36.613  45.661  16.300  1.00 30.02 ? 78   ALA B CA  1 
ATOM   3084  C  C   . ALA B  1 77  ? 35.196  45.665  16.837  1.00 28.12 ? 78   ALA B C   1 
ATOM   3085  O  O   . ALA B  1 77  ? 34.283  45.909  16.084  1.00 24.73 ? 78   ALA B O   1 
ATOM   3086  C  CB  . ALA B  1 77  ? 36.838  44.418  15.459  1.00 28.27 ? 78   ALA B CB  1 
ATOM   3087  N  N   . LEU B  1 78  ? 35.028  45.389  18.125  1.00 29.00 ? 79   LEU B N   1 
ATOM   3088  C  CA  . LEU B  1 78  ? 33.698  45.323  18.745  1.00 31.90 ? 79   LEU B CA  1 
ATOM   3089  C  C   . LEU B  1 78  ? 33.673  46.134  20.036  1.00 30.62 ? 79   LEU B C   1 
ATOM   3090  O  O   . LEU B  1 78  ? 33.695  45.587  21.128  1.00 30.61 ? 79   LEU B O   1 
ATOM   3091  C  CB  . LEU B  1 78  ? 33.304  43.865  19.020  1.00 31.82 ? 79   LEU B CB  1 
ATOM   3092  C  CG  . LEU B  1 78  ? 33.054  42.998  17.781  1.00 34.47 ? 79   LEU B CG  1 
ATOM   3093  C  CD1 . LEU B  1 78  ? 33.119  41.519  18.123  1.00 35.04 ? 79   LEU B CD1 1 
ATOM   3094  C  CD2 . LEU B  1 78  ? 31.727  43.340  17.106  1.00 30.68 ? 79   LEU B CD2 1 
ATOM   3095  N  N   . PRO B  1 79  ? 33.635  47.453  19.916  1.00 30.11 ? 80   PRO B N   1 
ATOM   3096  C  CA  . PRO B  1 79  ? 33.641  48.262  21.133  1.00 30.94 ? 80   PRO B CA  1 
ATOM   3097  C  C   . PRO B  1 79  ? 32.339  48.181  21.937  1.00 28.11 ? 80   PRO B C   1 
ATOM   3098  O  O   . PRO B  1 79  ? 31.310  47.773  21.402  1.00 25.98 ? 80   PRO B O   1 
ATOM   3099  C  CB  . PRO B  1 79  ? 33.882  49.686  20.604  1.00 32.24 ? 80   PRO B CB  1 
ATOM   3100  C  CG  . PRO B  1 79  ? 33.337  49.664  19.208  1.00 31.70 ? 80   PRO B CG  1 
ATOM   3101  C  CD  . PRO B  1 79  ? 33.584  48.262  18.691  1.00 29.59 ? 80   PRO B CD  1 
ATOM   3102  N  N   . LYS B  1 80  ? 32.422  48.556  23.213  1.00 28.48 ? 81   LYS B N   1 
ATOM   3103  C  CA  . LYS B  1 80  ? 31.266  48.753  24.101  1.00 30.38 ? 81   LYS B CA  1 
ATOM   3104  C  C   . LYS B  1 80  ? 30.127  49.453  23.373  1.00 29.32 ? 81   LYS B C   1 
ATOM   3105  O  O   . LYS B  1 80  ? 30.345  50.400  22.611  1.00 27.11 ? 81   LYS B O   1 
ATOM   3106  C  CB  . LYS B  1 80  ? 31.633  49.590  25.340  1.00 31.76 ? 81   LYS B CB  1 
ATOM   3107  C  CG  . LYS B  1 80  ? 31.905  48.819  26.617  1.00 39.11 ? 81   LYS B CG  1 
ATOM   3108  C  CD  . LYS B  1 80  ? 32.143  49.764  27.828  1.00 41.31 ? 81   LYS B CD  1 
ATOM   3109  N  N   . GLY B  1 81  ? 28.912  48.971  23.598  1.00 28.01 ? 82   GLY B N   1 
ATOM   3110  C  CA  . GLY B  1 81  ? 27.728  49.543  22.954  1.00 27.13 ? 82   GLY B CA  1 
ATOM   3111  C  C   . GLY B  1 81  ? 27.396  49.000  21.576  1.00 24.89 ? 82   GLY B C   1 
ATOM   3112  O  O   . GLY B  1 81  ? 26.325  49.286  21.052  1.00 23.49 ? 82   GLY B O   1 
ATOM   3113  N  N   . THR B  1 82  ? 28.318  48.256  20.966  1.00 24.13 ? 83   THR B N   1 
ATOM   3114  C  CA  . THR B  1 82  ? 28.054  47.621  19.682  1.00 25.63 ? 83   THR B CA  1 
ATOM   3115  C  C   . THR B  1 82  ? 26.862  46.635  19.785  1.00 25.01 ? 83   THR B C   1 
ATOM   3116  O  O   . THR B  1 82  ? 26.824  45.794  20.657  1.00 23.66 ? 83   THR B O   1 
ATOM   3117  C  CB  . THR B  1 82  ? 29.287  46.814  19.128  1.00 27.65 ? 83   THR B CB  1 
ATOM   3118  O  OG1 . THR B  1 82  ? 30.423  47.671  18.963  1.00 25.53 ? 83   THR B OG1 1 
ATOM   3119  C  CG2 . THR B  1 82  ? 28.940  46.194  17.770  1.00 25.32 ? 83   THR B CG2 1 
ATOM   3120  N  N   . ILE B  1 83  ? 25.909  46.784  18.881  1.00 25.36 ? 84   ILE B N   1 
ATOM   3121  C  CA  . ILE B  1 83  ? 24.719  45.950  18.788  1.00 26.63 ? 84   ILE B CA  1 
ATOM   3122  C  C   . ILE B  1 83  ? 24.997  44.842  17.790  1.00 25.44 ? 84   ILE B C   1 
ATOM   3123  O  O   . ILE B  1 83  ? 25.458  45.110  16.679  1.00 28.17 ? 84   ILE B O   1 
ATOM   3124  C  CB  . ILE B  1 83  ? 23.501  46.781  18.306  1.00 25.21 ? 84   ILE B CB  1 
ATOM   3125  C  CG1 . ILE B  1 83  ? 23.300  47.990  19.224  1.00 26.08 ? 84   ILE B CG1 1 
ATOM   3126  C  CG2 . ILE B  1 83  ? 22.194  45.919  18.227  1.00 26.09 ? 84   ILE B CG2 1 
ATOM   3127  C  CD1 . ILE B  1 83  ? 23.069  47.665  20.625  1.00 22.83 ? 84   ILE B CD1 1 
ATOM   3128  N  N   . VAL B  1 84  ? 24.768  43.604  18.202  1.00 24.57 ? 85   VAL B N   1 
ATOM   3129  C  CA  . VAL B  1 84  ? 24.987  42.455  17.333  1.00 24.93 ? 85   VAL B CA  1 
ATOM   3130  C  C   . VAL B  1 84  ? 23.848  41.434  17.383  1.00 24.63 ? 85   VAL B C   1 
ATOM   3131  O  O   . VAL B  1 84  ? 23.091  41.370  18.349  1.00 25.11 ? 85   VAL B O   1 
ATOM   3132  C  CB  . VAL B  1 84  ? 26.321  41.717  17.665  1.00 24.46 ? 85   VAL B CB  1 
ATOM   3133  C  CG1 . VAL B  1 84  ? 27.513  42.676  17.580  1.00 25.08 ? 85   VAL B CG1 1 
ATOM   3134  C  CG2 . VAL B  1 84  ? 26.267  41.060  19.017  1.00 23.35 ? 85   VAL B CG2 1 
ATOM   3135  N  N   . LEU B  1 85  ? 23.762  40.638  16.328  1.00 22.76 ? 86   LEU B N   1 
ATOM   3136  C  CA  . LEU B  1 85  ? 23.064  39.381  16.361  1.00 22.51 ? 86   LEU B CA  1 
ATOM   3137  C  C   . LEU B  1 85  ? 24.069  38.317  16.840  1.00 20.92 ? 86   LEU B C   1 
ATOM   3138  O  O   . LEU B  1 85  ? 25.219  38.306  16.423  1.00 19.87 ? 86   LEU B O   1 
ATOM   3139  C  CB  . LEU B  1 85  ? 22.511  39.038  14.978  1.00 23.25 ? 86   LEU B CB  1 
ATOM   3140  C  CG  . LEU B  1 85  ? 21.303  39.833  14.470  1.00 23.96 ? 86   LEU B CG  1 
ATOM   3141  C  CD1 . LEU B  1 85  ? 21.028  39.551  12.985  1.00 20.91 ? 86   LEU B CD1 1 
ATOM   3142  C  CD2 . LEU B  1 85  ? 20.038  39.538  15.289  1.00 26.87 ? 86   LEU B CD2 1 
ATOM   3143  N  N   . ALA B  1 86  ? 23.635  37.457  17.754  1.00 20.82 ? 87   ALA B N   1 
ATOM   3144  C  CA  . ALA B  1 86  ? 24.445  36.347  18.254  1.00 19.27 ? 87   ALA B CA  1 
ATOM   3145  C  C   . ALA B  1 86  ? 23.519  35.189  18.541  1.00 18.50 ? 87   ALA B C   1 
ATOM   3146  O  O   . ALA B  1 86  ? 22.340  35.409  18.835  1.00 18.41 ? 87   ALA B O   1 
ATOM   3147  C  CB  . ALA B  1 86  ? 25.163  36.740  19.517  1.00 17.49 ? 87   ALA B CB  1 
ATOM   3148  N  N   . SER B  1 87  ? 24.044  33.971  18.492  1.00 19.86 ? 88   SER B N   1 
ATOM   3149  C  CA  . SER B  1 87  ? 23.255  32.763  18.805  1.00 20.78 ? 88   SER B CA  1 
ATOM   3150  C  C   . SER B  1 87  ? 23.866  31.847  19.900  1.00 21.16 ? 88   SER B C   1 
ATOM   3151  O  O   . SER B  1 87  ? 24.177  30.682  19.628  1.00 21.50 ? 88   SER B O   1 
ATOM   3152  C  CB  . SER B  1 87  ? 23.026  31.960  17.514  1.00 21.97 ? 88   SER B CB  1 
ATOM   3153  O  OG  . SER B  1 87  ? 22.318  32.726  16.561  1.00 18.82 ? 88   SER B OG  1 
ATOM   3154  N  N   . PRO B  1 88  ? 24.005  32.353  21.146  1.00 22.39 ? 89   PRO B N   1 
ATOM   3155  C  CA  . PRO B  1 88  ? 24.492  31.539  22.268  1.00 23.70 ? 89   PRO B CA  1 
ATOM   3156  C  C   . PRO B  1 88  ? 23.377  30.740  22.966  1.00 24.11 ? 89   PRO B C   1 
ATOM   3157  O  O   . PRO B  1 88  ? 23.635  30.035  23.935  1.00 23.74 ? 89   PRO B O   1 
ATOM   3158  C  CB  . PRO B  1 88  ? 25.022  32.588  23.229  1.00 22.45 ? 89   PRO B CB  1 
ATOM   3159  C  CG  . PRO B  1 88  ? 24.099  33.704  23.055  1.00 22.47 ? 89   PRO B CG  1 
ATOM   3160  C  CD  . PRO B  1 88  ? 23.752  33.738  21.589  1.00 22.51 ? 89   PRO B CD  1 
ATOM   3161  N  N   . GLY B  1 89  ? 22.150  30.871  22.483  1.00 23.55 ? 90   GLY B N   1 
ATOM   3162  C  CA  . GLY B  1 89  ? 21.033  30.131  23.028  1.00 23.89 ? 90   GLY B CA  1 
ATOM   3163  C  C   . GLY B  1 89  ? 20.240  31.015  23.957  1.00 23.13 ? 90   GLY B C   1 
ATOM   3164  O  O   . GLY B  1 89  ? 20.415  32.244  23.953  1.00 19.69 ? 90   GLY B O   1 
ATOM   3165  N  N   . TRP B  1 90  ? 19.374  30.383  24.750  1.00 22.58 ? 91   TRP B N   1 
ATOM   3166  C  CA  . TRP B  1 90  ? 18.483  31.106  25.647  1.00 23.86 ? 91   TRP B CA  1 
ATOM   3167  C  C   . TRP B  1 90  ? 19.283  31.479  26.885  1.00 25.24 ? 91   TRP B C   1 
ATOM   3168  O  O   . TRP B  1 90  ? 19.309  30.742  27.883  1.00 25.78 ? 91   TRP B O   1 
ATOM   3169  C  CB  . TRP B  1 90  ? 17.260  30.258  26.019  1.00 23.79 ? 91   TRP B CB  1 
ATOM   3170  C  CG  . TRP B  1 90  ? 16.388  29.821  24.862  1.00 24.87 ? 91   TRP B CG  1 
ATOM   3171  C  CD1 . TRP B  1 90  ? 16.708  29.791  23.536  1.00 22.63 ? 91   TRP B CD1 1 
ATOM   3172  C  CD2 . TRP B  1 90  ? 15.066  29.273  24.960  1.00 28.27 ? 91   TRP B CD2 1 
ATOM   3173  N  NE1 . TRP B  1 90  ? 15.655  29.296  22.804  1.00 24.40 ? 91   TRP B NE1 1 
ATOM   3174  C  CE2 . TRP B  1 90  ? 14.638  28.968  23.654  1.00 24.82 ? 91   TRP B CE2 1 
ATOM   3175  C  CE3 . TRP B  1 90  ? 14.205  29.010  26.029  1.00 22.34 ? 91   TRP B CE3 1 
ATOM   3176  C  CZ2 . TRP B  1 90  ? 13.383  28.419  23.393  1.00 25.73 ? 91   TRP B CZ2 1 
ATOM   3177  C  CZ3 . TRP B  1 90  ? 12.979  28.467  25.772  1.00 22.42 ? 91   TRP B CZ3 1 
ATOM   3178  C  CH2 . TRP B  1 90  ? 12.567  28.187  24.462  1.00 22.41 ? 91   TRP B CH2 1 
ATOM   3179  N  N   . THR B  1 91  ? 19.969  32.614  26.804  1.00 24.97 ? 92   THR B N   1 
ATOM   3180  C  CA  . THR B  1 91  ? 20.739  33.124  27.941  1.00 25.42 ? 92   THR B CA  1 
ATOM   3181  C  C   . THR B  1 91  ? 20.762  34.658  27.943  1.00 24.07 ? 92   THR B C   1 
ATOM   3182  O  O   . THR B  1 91  ? 20.585  35.296  26.913  1.00 23.59 ? 92   THR B O   1 
ATOM   3183  C  CB  . THR B  1 91  ? 22.171  32.531  27.970  1.00 25.34 ? 92   THR B CB  1 
ATOM   3184  O  OG1 . THR B  1 91  ? 22.768  32.792  29.235  1.00 30.03 ? 92   THR B OG1 1 
ATOM   3185  C  CG2 . THR B  1 91  ? 23.042  33.150  26.886  1.00 24.90 ? 92   THR B CG2 1 
ATOM   3186  N  N   . THR B  1 92  ? 20.948  35.243  29.115  1.00 24.35 ? 93   THR B N   1 
ATOM   3187  C  CA  . THR B  1 92  ? 20.872  36.701  29.269  1.00 25.21 ? 93   THR B CA  1 
ATOM   3188  C  C   . THR B  1 92  ? 22.207  37.371  28.960  1.00 25.72 ? 93   THR B C   1 
ATOM   3189  O  O   . THR B  1 92  ? 22.230  38.497  28.461  1.00 27.33 ? 93   THR B O   1 
ATOM   3190  C  CB  . THR B  1 92  ? 20.466  37.081  30.697  1.00 26.15 ? 93   THR B CB  1 
ATOM   3191  O  OG1 . THR B  1 92  ? 21.380  36.470  31.627  1.00 23.14 ? 93   THR B OG1 1 
ATOM   3192  C  CG2 . THR B  1 92  ? 19.017  36.633  30.977  1.00 22.85 ? 93   THR B CG2 1 
ATOM   3193  N  N   . HIS B  1 93  ? 23.295  36.654  29.239  1.00 25.34 ? 94   HIS B N   1 
ATOM   3194  C  CA  . HIS B  1 93  ? 24.653  37.148  29.107  1.00 27.43 ? 94   HIS B CA  1 
ATOM   3195  C  C   . HIS B  1 93  ? 25.520  36.025  28.592  1.00 26.71 ? 94   HIS B C   1 
ATOM   3196  O  O   . HIS B  1 93  ? 25.327  34.871  28.983  1.00 24.68 ? 94   HIS B O   1 
ATOM   3197  C  CB  . HIS B  1 93  ? 25.221  37.609  30.475  1.00 27.79 ? 94   HIS B CB  1 
ATOM   3198  C  CG  . HIS B  1 93  ? 24.542  38.818  31.033  1.00 31.46 ? 94   HIS B CG  1 
ATOM   3199  N  ND1 . HIS B  1 93  ? 23.305  38.765  31.642  1.00 39.58 ? 94   HIS B ND1 1 
ATOM   3200  C  CD2 . HIS B  1 93  ? 24.922  40.116  31.071  1.00 35.91 ? 94   HIS B CD2 1 
ATOM   3201  C  CE1 . HIS B  1 93  ? 22.953  39.977  32.031  1.00 40.10 ? 94   HIS B CE1 1 
ATOM   3202  N  NE2 . HIS B  1 93  ? 23.917  40.815  31.701  1.00 39.70 ? 94   HIS B NE2 1 
ATOM   3203  N  N   . SER B  1 94  ? 26.502  36.374  27.751  1.00 27.01 ? 95   SER B N   1 
ATOM   3204  C  CA  . SER B  1 94  ? 27.390  35.382  27.139  1.00 26.87 ? 95   SER B CA  1 
ATOM   3205  C  C   . SER B  1 94  ? 28.713  35.978  26.674  1.00 25.74 ? 95   SER B C   1 
ATOM   3206  O  O   . SER B  1 94  ? 28.839  37.180  26.450  1.00 25.08 ? 95   SER B O   1 
ATOM   3207  C  CB  . SER B  1 94  ? 26.690  34.718  25.939  1.00 27.70 ? 95   SER B CB  1 
ATOM   3208  O  OG  . SER B  1 94  ? 26.529  35.632  24.864  1.00 20.83 ? 95   SER B OG  1 
ATOM   3209  N  N   . ILE B  1 95  ? 29.692  35.117  26.513  1.00 26.04 ? 96   ILE B N   1 
ATOM   3210  C  CA  . ILE B  1 95  ? 30.991  35.533  26.047  1.00 29.73 ? 96   ILE B CA  1 
ATOM   3211  C  C   . ILE B  1 95  ? 31.131  35.069  24.609  1.00 30.46 ? 96   ILE B C   1 
ATOM   3212  O  O   . ILE B  1 95  ? 30.801  33.929  24.296  1.00 29.98 ? 96   ILE B O   1 
ATOM   3213  C  CB  . ILE B  1 95  ? 32.127  34.944  26.915  1.00 30.28 ? 96   ILE B CB  1 
ATOM   3214  C  CG1 . ILE B  1 95  ? 32.070  35.553  28.326  1.00 33.08 ? 96   ILE B CG1 1 
ATOM   3215  C  CG2 . ILE B  1 95  ? 33.495  35.190  26.260  1.00 28.13 ? 96   ILE B CG2 1 
ATOM   3216  C  CD1 . ILE B  1 95  ? 33.047  34.907  29.357  1.00 30.89 ? 96   ILE B CD1 1 
ATOM   3217  N  N   . SER B  1 96  ? 31.601  35.970  23.746  1.00 29.57 ? 97   SER B N   1 
ATOM   3218  C  CA  . SER B  1 96  ? 31.919  35.648  22.359  1.00 29.54 ? 97   SER B CA  1 
ATOM   3219  C  C   . SER B  1 96  ? 33.346  36.054  22.022  1.00 30.86 ? 97   SER B C   1 
ATOM   3220  O  O   . SER B  1 96  ? 33.844  37.055  22.533  1.00 29.18 ? 97   SER B O   1 
ATOM   3221  C  CB  . SER B  1 96  ? 30.983  36.415  21.444  1.00 29.84 ? 97   SER B CB  1 
ATOM   3222  O  OG  . SER B  1 96  ? 31.474  36.421  20.124  1.00 32.56 ? 97   SER B OG  1 
ATOM   3223  N  N   . ASP B  1 97  ? 33.990  35.294  21.136  1.00 33.36 ? 98   ASP B N   1 
ATOM   3224  C  CA  . ASP B  1 97  ? 35.294  35.700  20.576  1.00 34.84 ? 98   ASP B CA  1 
ATOM   3225  C  C   . ASP B  1 97  ? 35.163  36.617  19.349  1.00 35.62 ? 98   ASP B C   1 
ATOM   3226  O  O   . ASP B  1 97  ? 36.153  36.928  18.684  1.00 37.28 ? 98   ASP B O   1 
ATOM   3227  C  CB  . ASP B  1 97  ? 36.146  34.477  20.247  1.00 36.04 ? 98   ASP B CB  1 
ATOM   3228  C  CG  . ASP B  1 97  ? 35.500  33.544  19.215  1.00 40.81 ? 98   ASP B CG  1 
ATOM   3229  O  OD1 . ASP B  1 97  ? 34.515  33.902  18.530  1.00 46.07 ? 98   ASP B OD1 1 
ATOM   3230  O  OD2 . ASP B  1 97  ? 36.003  32.422  19.085  1.00 45.20 ? 98   ASP B OD2 1 
ATOM   3231  N  N   . GLY B  1 98  ? 33.942  37.051  19.048  1.00 34.51 ? 99   GLY B N   1 
ATOM   3232  C  CA  . GLY B  1 98  ? 33.698  37.942  17.927  1.00 34.65 ? 99   GLY B CA  1 
ATOM   3233  C  C   . GLY B  1 98  ? 33.480  37.298  16.563  1.00 33.70 ? 99   GLY B C   1 
ATOM   3234  O  O   . GLY B  1 98  ? 32.919  37.937  15.675  1.00 35.23 ? 99   GLY B O   1 
ATOM   3235  N  N   . LYS B  1 99  ? 33.899  36.051  16.375  1.00 34.22 ? 100  LYS B N   1 
ATOM   3236  C  CA  . LYS B  1 99  ? 33.778  35.405  15.048  1.00 37.78 ? 100  LYS B CA  1 
ATOM   3237  C  C   . LYS B  1 99  ? 32.356  34.938  14.696  1.00 37.13 ? 100  LYS B C   1 
ATOM   3238  O  O   . LYS B  1 99  ? 32.007  34.859  13.526  1.00 37.58 ? 100  LYS B O   1 
ATOM   3239  C  CB  . LYS B  1 99  ? 34.784  34.244  14.875  1.00 38.12 ? 100  LYS B CB  1 
ATOM   3240  C  CG  . LYS B  1 99  ? 36.231  34.720  14.606  1.00 45.74 ? 100  LYS B CG  1 
ATOM   3241  C  CD  . LYS B  1 99  ? 37.032  33.814  13.607  1.00 49.57 ? 100  LYS B CD  1 
ATOM   3242  C  CE  . LYS B  1 99  ? 38.126  32.996  14.292  1.00 54.52 ? 100  LYS B CE  1 
ATOM   3243  N  NZ  . LYS B  1 99  ? 39.255  32.642  13.375  1.00 52.73 ? 100  LYS B NZ  1 
ATOM   3244  N  N   . ASP B  1 100 ? 31.535  34.649  15.696  1.00 36.27 ? 101  ASP B N   1 
ATOM   3245  C  CA  . ASP B  1 100 ? 30.199  34.108  15.452  1.00 37.83 ? 101  ASP B CA  1 
ATOM   3246  C  C   . ASP B  1 100 ? 29.109  35.210  15.476  1.00 36.43 ? 101  ASP B C   1 
ATOM   3247  O  O   . ASP B  1 100 ? 27.936  34.906  15.686  1.00 37.60 ? 101  ASP B O   1 
ATOM   3248  C  CB  . ASP B  1 100 ? 29.890  32.962  16.460  1.00 37.75 ? 101  ASP B CB  1 
ATOM   3249  C  CG  . ASP B  1 100 ? 30.112  33.373  17.948  1.00 42.50 ? 101  ASP B CG  1 
ATOM   3250  O  OD1 . ASP B  1 100 ? 30.314  34.565  18.231  1.00 45.39 ? 101  ASP B OD1 1 
ATOM   3251  O  OD2 . ASP B  1 100 ? 30.081  32.508  18.850  1.00 46.82 ? 101  ASP B OD2 1 
ATOM   3252  N  N   . LEU B  1 101 ? 29.497  36.470  15.256  1.00 33.06 ? 102  LEU B N   1 
ATOM   3253  C  CA  . LEU B  1 101 ? 28.591  37.606  15.432  1.00 31.53 ? 102  LEU B CA  1 
ATOM   3254  C  C   . LEU B  1 101 ? 28.313  38.339  14.123  1.00 30.83 ? 102  LEU B C   1 
ATOM   3255  O  O   . LEU B  1 101 ? 29.102  38.287  13.186  1.00 31.07 ? 102  LEU B O   1 
ATOM   3256  C  CB  . LEU B  1 101 ? 29.133  38.600  16.472  1.00 31.14 ? 102  LEU B CB  1 
ATOM   3257  C  CG  . LEU B  1 101 ? 29.528  38.144  17.892  1.00 32.01 ? 102  LEU B CG  1 
ATOM   3258  C  CD1 . LEU B  1 101 ? 30.007  39.341  18.717  1.00 26.18 ? 102  LEU B CD1 1 
ATOM   3259  C  CD2 . LEU B  1 101 ? 28.413  37.430  18.640  1.00 27.32 ? 102  LEU B CD2 1 
ATOM   3260  N  N   . GLU B  1 102 ? 27.179  39.034  14.082  1.00 29.27 ? 103  GLU B N   1 
ATOM   3261  C  CA  . GLU B  1 102 ? 26.769  39.831  12.935  1.00 28.59 ? 103  GLU B CA  1 
ATOM   3262  C  C   . GLU B  1 102 ? 26.261  41.198  13.404  1.00 29.21 ? 103  GLU B C   1 
ATOM   3263  O  O   . GLU B  1 102 ? 25.295  41.299  14.180  1.00 24.78 ? 103  GLU B O   1 
ATOM   3264  C  CB  . GLU B  1 102 ? 25.673  39.088  12.118  1.00 29.48 ? 103  GLU B CB  1 
ATOM   3265  C  CG  . GLU B  1 102 ? 25.194  39.801  10.844  1.00 33.55 ? 103  GLU B CG  1 
ATOM   3266  C  CD  . GLU B  1 102 ? 23.968  39.131  10.173  1.00 38.04 ? 103  GLU B CD  1 
ATOM   3267  O  OE1 . GLU B  1 102 ? 23.615  37.986  10.525  1.00 35.16 ? 103  GLU B OE1 1 
ATOM   3268  O  OE2 . GLU B  1 102 ? 23.344  39.757  9.287   1.00 33.70 ? 103  GLU B OE2 1 
ATOM   3269  N  N   . LYS B  1 103 ? 26.899  42.250  12.900  1.00 28.72 ? 104  LYS B N   1 
ATOM   3270  C  CA  . LYS B  1 103 ? 26.432  43.603  13.104  1.00 29.05 ? 104  LYS B CA  1 
ATOM   3271  C  C   . LYS B  1 103 ? 25.202  43.875  12.233  1.00 28.46 ? 104  LYS B C   1 
ATOM   3272  O  O   . LYS B  1 103 ? 25.053  43.283  11.164  1.00 25.92 ? 104  LYS B O   1 
ATOM   3273  C  CB  . LYS B  1 103 ? 27.569  44.594  12.789  1.00 32.31 ? 104  LYS B CB  1 
ATOM   3274  C  CG  . LYS B  1 103 ? 28.766  44.541  13.736  1.00 34.85 ? 104  LYS B CG  1 
ATOM   3275  C  CD  . LYS B  1 103 ? 29.878  45.542  13.314  1.00 42.90 ? 104  LYS B CD  1 
ATOM   3276  C  CE  . LYS B  1 103 ? 29.500  46.993  13.637  1.00 43.93 ? 104  LYS B CE  1 
ATOM   3277  N  NZ  . LYS B  1 103 ? 30.669  47.924  13.723  1.00 46.89 ? 104  LYS B NZ  1 
ATOM   3278  N  N   . LEU B  1 104 ? 24.316  44.760  12.698  1.00 28.95 ? 105  LEU B N   1 
ATOM   3279  C  CA  . LEU B  1 104 ? 23.133  45.133  11.929  1.00 30.01 ? 105  LEU B CA  1 
ATOM   3280  C  C   . LEU B  1 104 ? 23.516  46.019  10.737  1.00 30.70 ? 105  LEU B C   1 
ATOM   3281  O  O   . LEU B  1 104 ? 24.616  46.560  10.696  1.00 31.77 ? 105  LEU B O   1 
ATOM   3282  C  CB  . LEU B  1 104 ? 22.117  45.886  12.790  1.00 29.97 ? 105  LEU B CB  1 
ATOM   3283  C  CG  . LEU B  1 104 ? 21.554  45.304  14.103  1.00 33.12 ? 105  LEU B CG  1 
ATOM   3284  C  CD1 . LEU B  1 104 ? 20.179  45.882  14.390  1.00 35.62 ? 105  LEU B CD1 1 
ATOM   3285  C  CD2 . LEU B  1 104 ? 21.469  43.821  14.121  1.00 29.28 ? 105  LEU B CD2 1 
ATOM   3286  N  N   . LEU B  1 105 ? 22.604  46.159  9.773   1.00 30.44 ? 106  LEU B N   1 
ATOM   3287  C  CA  . LEU B  1 105 ? 22.777  47.075  8.635   1.00 30.25 ? 106  LEU B CA  1 
ATOM   3288  C  C   . LEU B  1 105 ? 23.241  48.476  9.101   1.00 31.98 ? 106  LEU B C   1 
ATOM   3289  O  O   . LEU B  1 105 ? 22.700  49.025  10.045  1.00 30.42 ? 106  LEU B O   1 
ATOM   3290  C  CB  . LEU B  1 105 ? 21.490  47.185  7.810   1.00 28.84 ? 106  LEU B CB  1 
ATOM   3291  C  CG  . LEU B  1 105 ? 20.914  45.919  7.120   1.00 28.70 ? 106  LEU B CG  1 
ATOM   3292  C  CD1 . LEU B  1 105 ? 19.605  46.199  6.380   1.00 25.62 ? 106  LEU B CD1 1 
ATOM   3293  C  CD2 . LEU B  1 105 ? 21.902  45.288  6.156   1.00 20.25 ? 106  LEU B CD2 1 
ATOM   3294  N  N   . THR B  1 106 ? 24.258  49.026  8.436   1.00 34.73 ? 107  THR B N   1 
ATOM   3295  C  CA  . THR B  1 106 ? 24.829  50.352  8.757   1.00 36.41 ? 107  THR B CA  1 
ATOM   3296  C  C   . THR B  1 106 ? 23.741  51.413  8.818   1.00 36.67 ? 107  THR B C   1 
ATOM   3297  O  O   . THR B  1 106 ? 23.728  52.259  9.708   1.00 34.68 ? 107  THR B O   1 
ATOM   3298  C  CB  . THR B  1 106 ? 25.808  50.819  7.658   1.00 37.42 ? 107  THR B CB  1 
ATOM   3299  O  OG1 . THR B  1 106 ? 26.764  49.791  7.382   1.00 38.37 ? 107  THR B OG1 1 
ATOM   3300  C  CG2 . THR B  1 106 ? 26.531  52.101  8.069   1.00 42.21 ? 107  THR B CG2 1 
ATOM   3301  N  N   . GLU B  1 107 ? 22.819  51.328  7.861   1.00 36.79 ? 108  GLU B N   1 
ATOM   3302  C  CA  . GLU B  1 107 ? 21.752  52.287  7.714   1.00 38.69 ? 108  GLU B CA  1 
ATOM   3303  C  C   . GLU B  1 107 ? 20.548  52.008  8.624   1.00 37.70 ? 108  GLU B C   1 
ATOM   3304  O  O   . GLU B  1 107 ? 19.453  52.443  8.308   1.00 38.32 ? 108  GLU B O   1 
ATOM   3305  C  CB  . GLU B  1 107 ? 21.319  52.347  6.229   1.00 39.67 ? 108  GLU B CB  1 
ATOM   3306  C  CG  . GLU B  1 107 ? 20.519  51.123  5.712   1.00 46.97 ? 108  GLU B CG  1 
ATOM   3307  C  CD  . GLU B  1 107 ? 21.319  50.142  4.835   1.00 50.18 ? 108  GLU B CD  1 
ATOM   3308  O  OE1 . GLU B  1 107 ? 22.377  49.617  5.297   1.00 40.57 ? 108  GLU B OE1 1 
ATOM   3309  O  OE2 . GLU B  1 107 ? 20.847  49.898  3.685   1.00 51.29 ? 108  GLU B OE2 1 
ATOM   3310  N  N   . TRP B  1 108 ? 20.741  51.304  9.744   1.00 37.31 ? 109  TRP B N   1 
ATOM   3311  C  CA  . TRP B  1 108 ? 19.616  50.896  10.607  1.00 37.09 ? 109  TRP B CA  1 
ATOM   3312  C  C   . TRP B  1 108 ? 19.057  52.104  11.361  1.00 35.96 ? 109  TRP B C   1 
ATOM   3313  O  O   . TRP B  1 108 ? 19.740  52.659  12.196  1.00 37.67 ? 109  TRP B O   1 
ATOM   3314  C  CB  . TRP B  1 108 ? 20.009  49.782  11.611  1.00 35.10 ? 109  TRP B CB  1 
ATOM   3315  C  CG  . TRP B  1 108 ? 18.799  49.181  12.278  1.00 35.47 ? 109  TRP B CG  1 
ATOM   3316  C  CD1 . TRP B  1 108 ? 18.043  49.747  13.259  1.00 37.67 ? 109  TRP B CD1 1 
ATOM   3317  C  CD2 . TRP B  1 108 ? 18.174  47.916  11.978  1.00 31.33 ? 109  TRP B CD2 1 
ATOM   3318  N  NE1 . TRP B  1 108 ? 16.997  48.914  13.601  1.00 34.61 ? 109  TRP B NE1 1 
ATOM   3319  C  CE2 . TRP B  1 108 ? 17.052  47.790  12.826  1.00 31.86 ? 109  TRP B CE2 1 
ATOM   3320  C  CE3 . TRP B  1 108 ? 18.457  46.882  11.077  1.00 31.50 ? 109  TRP B CE3 1 
ATOM   3321  C  CZ2 . TRP B  1 108 ? 16.213  46.664  12.806  1.00 31.13 ? 109  TRP B CZ2 1 
ATOM   3322  C  CZ3 . TRP B  1 108 ? 17.619  45.768  11.056  1.00 29.65 ? 109  TRP B CZ3 1 
ATOM   3323  C  CH2 . TRP B  1 108 ? 16.518  45.671  11.913  1.00 30.25 ? 109  TRP B CH2 1 
ATOM   3324  N  N   . PRO B  1 109 ? 17.804  52.497  11.087  1.00 35.79 ? 110  PRO B N   1 
ATOM   3325  C  CA  . PRO B  1 109 ? 17.283  53.726  11.699  1.00 36.45 ? 110  PRO B CA  1 
ATOM   3326  C  C   . PRO B  1 109 ? 16.853  53.610  13.176  1.00 36.71 ? 110  PRO B C   1 
ATOM   3327  O  O   . PRO B  1 109 ? 16.506  52.530  13.666  1.00 35.15 ? 110  PRO B O   1 
ATOM   3328  C  CB  . PRO B  1 109 ? 16.084  54.094  10.807  1.00 37.23 ? 110  PRO B CB  1 
ATOM   3329  C  CG  . PRO B  1 109 ? 15.929  52.996  9.814   1.00 36.70 ? 110  PRO B CG  1 
ATOM   3330  C  CD  . PRO B  1 109 ? 16.808  51.864  10.212  1.00 36.47 ? 110  PRO B CD  1 
ATOM   3331  N  N   . ASP B  1 110 ? 16.881  54.731  13.882  1.00 37.40 ? 111  ASP B N   1 
ATOM   3332  C  CA  . ASP B  1 110 ? 16.554  54.730  15.302  1.00 38.68 ? 111  ASP B CA  1 
ATOM   3333  C  C   . ASP B  1 110 ? 15.057  54.475  15.532  1.00 37.77 ? 111  ASP B C   1 
ATOM   3334  O  O   . ASP B  1 110 ? 14.668  54.059  16.616  1.00 38.90 ? 111  ASP B O   1 
ATOM   3335  C  CB  . ASP B  1 110 ? 16.983  56.048  15.945  1.00 40.85 ? 111  ASP B CB  1 
ATOM   3336  N  N   . THR B  1 111 ? 14.241  54.696  14.505  1.00 35.75 ? 112  THR B N   1 
ATOM   3337  C  CA  . THR B  1 111 ? 12.787  54.590  14.604  1.00 37.24 ? 112  THR B CA  1 
ATOM   3338  C  C   . THR B  1 111 ? 12.188  53.172  14.444  1.00 38.03 ? 112  THR B C   1 
ATOM   3339  O  O   . THR B  1 111 ? 10.978  52.997  14.627  1.00 37.59 ? 112  THR B O   1 
ATOM   3340  C  CB  . THR B  1 111 ? 12.133  55.444  13.523  1.00 37.19 ? 112  THR B CB  1 
ATOM   3341  O  OG1 . THR B  1 111 ? 12.654  55.055  12.254  1.00 36.01 ? 112  THR B OG1 1 
ATOM   3342  C  CG2 . THR B  1 111 ? 12.410  56.926  13.763  1.00 41.03 ? 112  THR B CG2 1 
ATOM   3343  N  N   . ILE B  1 112 ? 12.991  52.178  14.063  1.00 35.90 ? 113  ILE B N   1 
ATOM   3344  C  CA  . ILE B  1 112 ? 12.485  50.814  14.018  1.00 35.48 ? 113  ILE B CA  1 
ATOM   3345  C  C   . ILE B  1 112 ? 13.128  49.982  15.119  1.00 33.17 ? 113  ILE B C   1 
ATOM   3346  O  O   . ILE B  1 112 ? 14.333  50.098  15.361  1.00 32.92 ? 113  ILE B O   1 
ATOM   3347  C  CB  . ILE B  1 112 ? 12.676  50.117  12.655  1.00 37.37 ? 113  ILE B CB  1 
ATOM   3348  C  CG1 . ILE B  1 112 ? 14.102  49.614  12.471  1.00 35.69 ? 113  ILE B CG1 1 
ATOM   3349  C  CG2 . ILE B  1 112 ? 12.257  51.020  11.482  1.00 35.88 ? 113  ILE B CG2 1 
ATOM   3350  C  CD1 . ILE B  1 112 ? 14.265  48.879  11.154  1.00 38.17 ? 113  ILE B CD1 1 
ATOM   3351  N  N   . PRO B  1 113 ? 12.327  49.129  15.773  1.00 29.69 ? 114  PRO B N   1 
ATOM   3352  C  CA  . PRO B  1 113 ? 12.819  48.264  16.845  1.00 29.42 ? 114  PRO B CA  1 
ATOM   3353  C  C   . PRO B  1 113 ? 14.001  47.420  16.380  1.00 28.38 ? 114  PRO B C   1 
ATOM   3354  O  O   . PRO B  1 113 ? 13.951  46.880  15.282  1.00 27.28 ? 114  PRO B O   1 
ATOM   3355  C  CB  . PRO B  1 113 ? 11.637  47.343  17.148  1.00 30.28 ? 114  PRO B CB  1 
ATOM   3356  C  CG  . PRO B  1 113 ? 10.466  47.955  16.520  1.00 34.78 ? 114  PRO B CG  1 
ATOM   3357  C  CD  . PRO B  1 113 ? 10.922  48.862  15.432  1.00 30.15 ? 114  PRO B CD  1 
ATOM   3358  N  N   . LEU B  1 114 ? 15.041  47.326  17.211  1.00 26.62 ? 115  LEU B N   1 
ATOM   3359  C  CA  . LEU B  1 114 ? 16.166  46.430  16.967  1.00 26.51 ? 115  LEU B CA  1 
ATOM   3360  C  C   . LEU B  1 114 ? 15.687  44.982  16.808  1.00 25.08 ? 115  LEU B C   1 
ATOM   3361  O  O   . LEU B  1 114 ? 16.336  44.194  16.134  1.00 21.95 ? 115  LEU B O   1 
ATOM   3362  C  CB  . LEU B  1 114 ? 17.165  46.498  18.125  1.00 24.61 ? 115  LEU B CB  1 
ATOM   3363  C  CG  . LEU B  1 114 ? 17.832  47.863  18.317  1.00 29.35 ? 115  LEU B CG  1 
ATOM   3364  C  CD1 . LEU B  1 114 ? 18.556  47.901  19.635  1.00 28.97 ? 115  LEU B CD1 1 
ATOM   3365  C  CD2 . LEU B  1 114 ? 18.758  48.189  17.151  1.00 19.25 ? 115  LEU B CD2 1 
ATOM   3366  N  N   . SER B  1 115 ? 14.545  44.659  17.431  1.00 22.54 ? 116  SER B N   1 
ATOM   3367  C  CA  . SER B  1 115 ? 13.979  43.312  17.383  1.00 22.35 ? 116  SER B CA  1 
ATOM   3368  C  C   . SER B  1 115 ? 13.510  42.903  15.978  1.00 20.54 ? 116  SER B C   1 
ATOM   3369  O  O   . SER B  1 115 ? 13.358  41.729  15.719  1.00 21.21 ? 116  SER B O   1 
ATOM   3370  C  CB  . SER B  1 115 ? 12.837  43.159  18.420  1.00 19.94 ? 116  SER B CB  1 
ATOM   3371  O  OG  . SER B  1 115 ? 11.879  44.187  18.246  1.00 22.88 ? 116  SER B OG  1 
ATOM   3372  N  N   . LEU B  1 116 ? 13.286  43.850  15.071  1.00 20.25 ? 117  LEU B N   1 
ATOM   3373  C  CA  . LEU B  1 116 ? 13.052  43.494  13.657  1.00 21.31 ? 117  LEU B CA  1 
ATOM   3374  C  C   . LEU B  1 116 ? 14.204  42.691  13.002  1.00 21.55 ? 117  LEU B C   1 
ATOM   3375  O  O   . LEU B  1 116 ? 13.969  41.993  11.975  1.00 19.60 ? 117  LEU B O   1 
ATOM   3376  C  CB  . LEU B  1 116 ? 12.752  44.721  12.800  1.00 20.15 ? 117  LEU B CB  1 
ATOM   3377  C  CG  . LEU B  1 116 ? 11.426  45.455  13.015  1.00 26.37 ? 117  LEU B CG  1 
ATOM   3378  C  CD1 . LEU B  1 116 ? 10.886  45.984  11.699  1.00 27.32 ? 117  LEU B CD1 1 
ATOM   3379  C  CD2 . LEU B  1 116 ? 10.352  44.611  13.725  1.00 23.01 ? 117  LEU B CD2 1 
ATOM   3380  N  N   . ALA B  1 117 ? 15.404  42.763  13.602  1.00 18.37 ? 118  ALA B N   1 
ATOM   3381  C  CA  . ALA B  1 117 ? 16.575  42.006  13.128  1.00 20.49 ? 118  ALA B CA  1 
ATOM   3382  C  C   . ALA B  1 117 ? 16.459  40.511  13.419  1.00 19.40 ? 118  ALA B C   1 
ATOM   3383  O  O   . ALA B  1 117 ? 17.288  39.722  12.954  1.00 16.46 ? 118  ALA B O   1 
ATOM   3384  C  CB  . ALA B  1 117 ? 17.893  42.559  13.752  1.00 18.08 ? 118  ALA B CB  1 
ATOM   3385  N  N   . LEU B  1 118 ? 15.459  40.155  14.226  1.00 20.44 ? 119  LEU B N   1 
ATOM   3386  C  CA  . LEU B  1 118 ? 15.069  38.779  14.502  1.00 20.46 ? 119  LEU B CA  1 
ATOM   3387  C  C   . LEU B  1 118 ? 13.803  38.364  13.729  1.00 20.70 ? 119  LEU B C   1 
ATOM   3388  O  O   . LEU B  1 118 ? 13.350  37.233  13.868  1.00 22.16 ? 119  LEU B O   1 
ATOM   3389  C  CB  . LEU B  1 118 ? 14.815  38.588  16.002  1.00 18.92 ? 119  LEU B CB  1 
ATOM   3390  C  CG  . LEU B  1 118 ? 15.988  38.844  16.943  1.00 21.23 ? 119  LEU B CG  1 
ATOM   3391  C  CD1 . LEU B  1 118 ? 15.549  38.855  18.433  1.00 19.17 ? 119  LEU B CD1 1 
ATOM   3392  C  CD2 . LEU B  1 118 ? 17.048  37.825  16.726  1.00 12.11 ? 119  LEU B CD2 1 
ATOM   3393  N  N   . GLY B  1 119 ? 13.268  39.251  12.896  1.00 21.12 ? 120  GLY B N   1 
ATOM   3394  C  CA  . GLY B  1 119 ? 11.956  39.071  12.272  1.00 19.04 ? 120  GLY B CA  1 
ATOM   3395  C  C   . GLY B  1 119 ? 11.913  39.540  10.832  1.00 17.99 ? 120  GLY B C   1 
ATOM   3396  O  O   . GLY B  1 119 ? 12.631  39.014  9.975   1.00 16.57 ? 120  GLY B O   1 
ATOM   3397  N  N   . THR B  1 120 ? 11.118  40.565  10.556  1.00 16.90 ? 121  THR B N   1 
ATOM   3398  C  CA  . THR B  1 120 ? 10.931  41.015  9.179   1.00 18.11 ? 121  THR B CA  1 
ATOM   3399  C  C   . THR B  1 120 ? 12.234  41.414  8.491   1.00 20.05 ? 121  THR B C   1 
ATOM   3400  O  O   . THR B  1 120 ? 12.378  41.197  7.278   1.00 18.61 ? 121  THR B O   1 
ATOM   3401  C  CB  . THR B  1 120 ? 9.902   42.167  9.106   1.00 17.94 ? 121  THR B CB  1 
ATOM   3402  O  OG1 . THR B  1 120 ? 8.634   41.670  9.561   1.00 19.87 ? 121  THR B OG1 1 
ATOM   3403  C  CG2 . THR B  1 120 ? 9.782   42.723  7.708   1.00 16.10 ? 121  THR B CG2 1 
ATOM   3404  N  N   . VAL B  1 121 ? 13.174  42.006  9.239   1.00 21.50 ? 122  VAL B N   1 
ATOM   3405  C  CA  . VAL B  1 121 ? 14.491  42.380  8.655   1.00 21.92 ? 122  VAL B CA  1 
ATOM   3406  C  C   . VAL B  1 121 ? 15.565  41.477  9.250   1.00 21.79 ? 122  VAL B C   1 
ATOM   3407  O  O   . VAL B  1 121 ? 16.584  41.926  9.778   1.00 20.60 ? 122  VAL B O   1 
ATOM   3408  C  CB  . VAL B  1 121 ? 14.859  43.888  8.843   1.00 22.77 ? 122  VAL B CB  1 
ATOM   3409  C  CG1 . VAL B  1 121 ? 16.086  44.244  7.994   1.00 20.78 ? 122  VAL B CG1 1 
ATOM   3410  C  CG2 . VAL B  1 121 ? 13.669  44.777  8.470   1.00 21.88 ? 122  VAL B CG2 1 
ATOM   3411  N  N   . GLY B  1 122 ? 15.298  40.187  9.146   1.00 20.66 ? 123  GLY B N   1 
ATOM   3412  C  CA  . GLY B  1 122 ? 16.140  39.147  9.695   1.00 19.71 ? 123  GLY B CA  1 
ATOM   3413  C  C   . GLY B  1 122 ? 15.688  37.814  9.142   1.00 18.92 ? 123  GLY B C   1 
ATOM   3414  O  O   . GLY B  1 122 ? 15.058  37.745  8.065   1.00 19.65 ? 123  GLY B O   1 
ATOM   3415  N  N   . MET B  1 123 ? 15.972  36.762  9.891   1.00 18.11 ? 124  MET B N   1 
ATOM   3416  C  CA  . MET B  1 123 ? 15.829  35.404  9.395   1.00 18.21 ? 124  MET B CA  1 
ATOM   3417  C  C   . MET B  1 123 ? 14.437  35.062  8.804   1.00 15.70 ? 124  MET B C   1 
ATOM   3418  O  O   . MET B  1 123 ? 14.375  34.657  7.654   1.00 16.38 ? 124  MET B O   1 
ATOM   3419  C  CB  . MET B  1 123 ? 16.310  34.409  10.453  1.00 18.46 ? 124  MET B CB  1 
ATOM   3420  C  CG  . MET B  1 123 ? 16.429  33.001  9.940   1.00 21.34 ? 124  MET B CG  1 
ATOM   3421  S  SD  . MET B  1 123 ? 14.824  32.170  10.058  1.00 19.40 ? 124  MET B SD  1 
ATOM   3422  C  CE  . MET B  1 123 ? 14.959  31.531  11.713  1.00 13.85 ? 124  MET B CE  1 
ATOM   3423  N  N   . PRO B  1 124 ? 13.324  35.266  9.549   1.00 16.41 ? 125  PRO B N   1 
ATOM   3424  C  CA  . PRO B  1 124 ? 11.997  34.985  8.970   1.00 17.33 ? 125  PRO B CA  1 
ATOM   3425  C  C   . PRO B  1 124 ? 11.640  35.808  7.725   1.00 16.05 ? 125  PRO B C   1 
ATOM   3426  O  O   . PRO B  1 124 ? 11.013  35.294  6.802   1.00 15.78 ? 125  PRO B O   1 
ATOM   3427  C  CB  . PRO B  1 124 ? 11.035  35.323  10.109  1.00 18.54 ? 125  PRO B CB  1 
ATOM   3428  C  CG  . PRO B  1 124 ? 11.843  35.113  11.337  1.00 19.78 ? 125  PRO B CG  1 
ATOM   3429  C  CD  . PRO B  1 124 ? 13.224  35.566  10.983  1.00 16.58 ? 125  PRO B CD  1 
ATOM   3430  N  N   . GLY B  1 125 ? 12.028  37.074  7.688   1.00 14.93 ? 126  GLY B N   1 
ATOM   3431  C  CA  . GLY B  1 125 ? 11.792  37.887  6.512   1.00 15.04 ? 126  GLY B CA  1 
ATOM   3432  C  C   . GLY B  1 125 ? 12.600  37.448  5.300   1.00 16.71 ? 126  GLY B C   1 
ATOM   3433  O  O   . GLY B  1 125 ? 12.119  37.491  4.194   1.00 16.80 ? 126  GLY B O   1 
ATOM   3434  N  N   . LEU B  1 126 ? 13.847  37.039  5.510   1.00 18.05 ? 127  LEU B N   1 
ATOM   3435  C  CA  . LEU B  1 126 ? 14.649  36.437  4.442   1.00 16.13 ? 127  LEU B CA  1 
ATOM   3436  C  C   . LEU B  1 126 ? 14.020  35.135  3.952   1.00 16.99 ? 127  LEU B C   1 
ATOM   3437  O  O   . LEU B  1 126 ? 14.022  34.884  2.754   1.00 14.06 ? 127  LEU B O   1 
ATOM   3438  C  CB  . LEU B  1 126 ? 16.077  36.179  4.923   1.00 16.02 ? 127  LEU B CB  1 
ATOM   3439  C  CG  . LEU B  1 126 ? 16.974  37.417  5.165   1.00 16.95 ? 127  LEU B CG  1 
ATOM   3440  C  CD1 . LEU B  1 126 ? 18.272  37.034  5.908   1.00 13.30 ? 127  LEU B CD1 1 
ATOM   3441  C  CD2 . LEU B  1 126 ? 17.314  38.121  3.847   1.00 13.06 ? 127  LEU B CD2 1 
ATOM   3442  N  N   . THR B  1 127 ? 13.493  34.316  4.879   1.00 17.35 ? 128  THR B N   1 
ATOM   3443  C  CA  . THR B  1 127 ? 12.801  33.066  4.540   1.00 15.29 ? 128  THR B CA  1 
ATOM   3444  C  C   . THR B  1 127 ? 11.629  33.336  3.625   1.00 16.92 ? 128  THR B C   1 
ATOM   3445  O  O   . THR B  1 127 ? 11.419  32.629  2.667   1.00 16.07 ? 128  THR B O   1 
ATOM   3446  C  CB  . THR B  1 127 ? 12.219  32.384  5.782   1.00 16.13 ? 128  THR B CB  1 
ATOM   3447  O  OG1 . THR B  1 127 ? 13.261  32.095  6.702   1.00 13.93 ? 128  THR B OG1 1 
ATOM   3448  C  CG2 . THR B  1 127 ? 11.484  31.068  5.448   1.00 12.14 ? 128  THR B CG2 1 
ATOM   3449  N  N   . ALA B  1 128 ? 10.856  34.365  3.949   1.00 18.30 ? 129  ALA B N   1 
ATOM   3450  C  CA  . ALA B  1 128 ? 9.722   34.767  3.140   1.00 17.06 ? 129  ALA B CA  1 
ATOM   3451  C  C   . ALA B  1 128 ? 10.223  35.277  1.800   1.00 17.28 ? 129  ALA B C   1 
ATOM   3452  O  O   . ALA B  1 128 ? 9.694   34.935  0.752   1.00 12.81 ? 129  ALA B O   1 
ATOM   3453  C  CB  . ALA B  1 128 ? 8.923   35.890  3.853   1.00 13.75 ? 129  ALA B CB  1 
ATOM   3454  N  N   . TYR B  1 129 ? 11.243  36.116  1.847   1.00 17.82 ? 130  TYR B N   1 
ATOM   3455  C  CA  . TYR B  1 129 ? 11.762  36.729  0.635   1.00 19.61 ? 130  TYR B CA  1 
ATOM   3456  C  C   . TYR B  1 129 ? 12.222  35.672  -0.359  1.00 18.50 ? 130  TYR B C   1 
ATOM   3457  O  O   . TYR B  1 129 ? 11.714  35.620  -1.470  1.00 17.68 ? 130  TYR B O   1 
ATOM   3458  C  CB  . TYR B  1 129 ? 12.887  37.684  0.994   1.00 18.31 ? 130  TYR B CB  1 
ATOM   3459  C  CG  . TYR B  1 129 ? 13.476  38.534  -0.104  1.00 17.76 ? 130  TYR B CG  1 
ATOM   3460  C  CD1 . TYR B  1 129 ? 14.424  38.022  -0.986  1.00 20.72 ? 130  TYR B CD1 1 
ATOM   3461  C  CD2 . TYR B  1 129 ? 13.183  39.880  -0.191  1.00 22.06 ? 130  TYR B CD2 1 
ATOM   3462  C  CE1 . TYR B  1 129 ? 15.012  38.829  -1.951  1.00 24.31 ? 130  TYR B CE1 1 
ATOM   3463  C  CE2 . TYR B  1 129 ? 13.772  40.688  -1.144  1.00 19.69 ? 130  TYR B CE2 1 
ATOM   3464  C  CZ  . TYR B  1 129 ? 14.684  40.166  -2.014  1.00 20.26 ? 130  TYR B CZ  1 
ATOM   3465  O  OH  . TYR B  1 129 ? 15.247  40.977  -2.955  1.00 27.44 ? 130  TYR B OH  1 
ATOM   3466  N  N   . PHE B  1 130 ? 13.150  34.814  0.035   1.00 17.54 ? 131  PHE B N   1 
ATOM   3467  C  CA  . PHE B  1 130 ? 13.660  33.823  -0.909  1.00 17.99 ? 131  PHE B CA  1 
ATOM   3468  C  C   . PHE B  1 130 ? 12.665  32.735  -1.265  1.00 18.76 ? 131  PHE B C   1 
ATOM   3469  O  O   . PHE B  1 130 ? 12.558  32.363  -2.411  1.00 18.63 ? 131  PHE B O   1 
ATOM   3470  C  CB  . PHE B  1 130 ? 14.997  33.249  -0.441  1.00 19.16 ? 131  PHE B CB  1 
ATOM   3471  C  CG  . PHE B  1 130 ? 16.109  34.258  -0.473  1.00 16.33 ? 131  PHE B CG  1 
ATOM   3472  C  CD1 . PHE B  1 130 ? 16.524  34.809  -1.677  1.00 22.34 ? 131  PHE B CD1 1 
ATOM   3473  C  CD2 . PHE B  1 130 ? 16.703  34.702  0.687   1.00 21.24 ? 131  PHE B CD2 1 
ATOM   3474  C  CE1 . PHE B  1 130 ? 17.556  35.770  -1.711  1.00 21.62 ? 131  PHE B CE1 1 
ATOM   3475  C  CE2 . PHE B  1 130 ? 17.723  35.656  0.655   1.00 19.80 ? 131  PHE B CE2 1 
ATOM   3476  C  CZ  . PHE B  1 130 ? 18.128  36.195  -0.530  1.00 18.89 ? 131  PHE B CZ  1 
ATOM   3477  N  N   . GLY B  1 131 ? 11.925  32.232  -0.292  1.00 18.70 ? 132  GLY B N   1 
ATOM   3478  C  CA  . GLY B  1 131 ? 10.910  31.248  -0.553  1.00 18.09 ? 132  GLY B CA  1 
ATOM   3479  C  C   . GLY B  1 131 ? 9.901   31.726  -1.577  1.00 18.58 ? 132  GLY B C   1 
ATOM   3480  O  O   . GLY B  1 131 ? 9.554   30.980  -2.466  1.00 15.79 ? 132  GLY B O   1 
ATOM   3481  N  N   . LEU B  1 132 ? 9.436   32.972  -1.477  1.00 19.54 ? 133  LEU B N   1 
ATOM   3482  C  CA  . LEU B  1 132 ? 8.415   33.454  -2.415  1.00 19.91 ? 133  LEU B CA  1 
ATOM   3483  C  C   . LEU B  1 132 ? 9.027   33.873  -3.743  1.00 20.43 ? 133  LEU B C   1 
ATOM   3484  O  O   . LEU B  1 132 ? 8.528   33.475  -4.785  1.00 20.32 ? 133  LEU B O   1 
ATOM   3485  C  CB  . LEU B  1 132 ? 7.578   34.591  -1.843  1.00 18.52 ? 133  LEU B CB  1 
ATOM   3486  C  CG  . LEU B  1 132 ? 6.482   35.124  -2.775  1.00 19.48 ? 133  LEU B CG  1 
ATOM   3487  C  CD1 . LEU B  1 132 ? 5.360   34.098  -2.976  1.00 20.75 ? 133  LEU B CD1 1 
ATOM   3488  C  CD2 . LEU B  1 132 ? 5.919   36.500  -2.306  1.00 17.03 ? 133  LEU B CD2 1 
ATOM   3489  N  N   . LEU B  1 133 ? 10.096  34.667  -3.713  1.00 21.30 ? 134  LEU B N   1 
ATOM   3490  C  CA  . LEU B  1 133 ? 10.656  35.227  -4.945  1.00 23.15 ? 134  LEU B CA  1 
ATOM   3491  C  C   . LEU B  1 133 ? 11.550  34.252  -5.740  1.00 24.46 ? 134  LEU B C   1 
ATOM   3492  O  O   . LEU B  1 133 ? 11.549  34.297  -6.966  1.00 22.76 ? 134  LEU B O   1 
ATOM   3493  C  CB  . LEU B  1 133 ? 11.368  36.552  -4.671  1.00 23.54 ? 134  LEU B CB  1 
ATOM   3494  C  CG  . LEU B  1 133 ? 10.495  37.612  -3.956  1.00 25.87 ? 134  LEU B CG  1 
ATOM   3495  C  CD1 . LEU B  1 133 ? 11.350  38.780  -3.460  1.00 21.31 ? 134  LEU B CD1 1 
ATOM   3496  C  CD2 . LEU B  1 133 ? 9.346   38.111  -4.842  1.00 22.35 ? 134  LEU B CD2 1 
ATOM   3497  N  N   . GLU B  1 134 ? 12.298  33.374  -5.069  1.00 22.83 ? 135  GLU B N   1 
ATOM   3498  C  CA  . GLU B  1 134 ? 13.102  32.383  -5.797  1.00 25.13 ? 135  GLU B CA  1 
ATOM   3499  C  C   . GLU B  1 134 ? 12.475  31.014  -5.883  1.00 23.88 ? 135  GLU B C   1 
ATOM   3500  O  O   . GLU B  1 134 ? 12.493  30.424  -6.950  1.00 25.11 ? 135  GLU B O   1 
ATOM   3501  C  CB  . GLU B  1 134 ? 14.495  32.232  -5.218  1.00 26.57 ? 135  GLU B CB  1 
ATOM   3502  C  CG  . GLU B  1 134 ? 15.206  33.538  -5.147  1.00 37.80 ? 135  GLU B CG  1 
ATOM   3503  C  CD  . GLU B  1 134 ? 16.644  33.483  -5.598  1.00 46.51 ? 135  GLU B CD  1 
ATOM   3504  O  OE1 . GLU B  1 134 ? 17.343  32.459  -5.395  1.00 48.56 ? 135  GLU B OE1 1 
ATOM   3505  O  OE2 . GLU B  1 134 ? 17.069  34.508  -6.152  1.00 53.15 ? 135  GLU B OE2 1 
ATOM   3506  N  N   . ILE B  1 135 ? 11.925  30.497  -4.786  1.00 21.83 ? 136  ILE B N   1 
ATOM   3507  C  CA  . ILE B  1 135 ? 11.422  29.131  -4.814  1.00 19.59 ? 136  ILE B CA  1 
ATOM   3508  C  C   . ILE B  1 135 ? 10.059  29.034  -5.528  1.00 23.56 ? 136  ILE B C   1 
ATOM   3509  O  O   . ILE B  1 135 ? 9.935   28.271  -6.477  1.00 25.27 ? 136  ILE B O   1 
ATOM   3510  C  CB  . ILE B  1 135 ? 11.409  28.493  -3.442  1.00 19.09 ? 136  ILE B CB  1 
ATOM   3511  C  CG1 . ILE B  1 135 ? 12.830  28.531  -2.824  1.00 19.06 ? 136  ILE B CG1 1 
ATOM   3512  C  CG2 . ILE B  1 135 ? 10.933  27.063  -3.547  1.00 12.90 ? 136  ILE B CG2 1 
ATOM   3513  C  CD1 . ILE B  1 135 ? 13.957  27.930  -3.776  1.00 17.49 ? 136  ILE B CD1 1 
ATOM   3514  N  N   . CYS B  1 136 ? 9.059   29.805  -5.098  1.00 22.14 ? 137  CYS B N   1 
ATOM   3515  C  CA  . CYS B  1 136 ? 7.823   29.916  -5.852  1.00 25.14 ? 137  CYS B CA  1 
ATOM   3516  C  C   . CYS B  1 136 ? 8.071   30.641  -7.146  1.00 24.88 ? 137  CYS B C   1 
ATOM   3517  O  O   . CYS B  1 136 ? 7.383   30.415  -8.103  1.00 26.22 ? 137  CYS B O   1 
ATOM   3518  C  CB  . CYS B  1 136 ? 6.739   30.680  -5.086  1.00 24.94 ? 137  CYS B CB  1 
ATOM   3519  S  SG  . CYS B  1 136 ? 6.082   29.877  -3.656  1.00 26.15 ? 137  CYS B SG  1 
ATOM   3520  N  N   . GLY B  1 137 ? 9.032   31.545  -7.161  1.00 27.07 ? 138  GLY B N   1 
ATOM   3521  C  CA  . GLY B  1 137 ? 9.322   32.312  -8.373  1.00 28.83 ? 138  GLY B CA  1 
ATOM   3522  C  C   . GLY B  1 137 ? 8.181   33.185  -8.868  1.00 27.98 ? 138  GLY B C   1 
ATOM   3523  O  O   . GLY B  1 137 ? 7.922   33.218  -10.052 1.00 28.42 ? 138  GLY B O   1 
ATOM   3524  N  N   . VAL B  1 138 ? 7.490   33.898  -7.991  1.00 31.00 ? 139  VAL B N   1 
ATOM   3525  C  CA  . VAL B  1 138 ? 6.379   34.755  -8.464  1.00 34.23 ? 139  VAL B CA  1 
ATOM   3526  C  C   . VAL B  1 138 ? 6.834   35.876  -9.407  1.00 36.73 ? 139  VAL B C   1 
ATOM   3527  O  O   . VAL B  1 138 ? 7.877   36.487  -9.211  1.00 37.39 ? 139  VAL B O   1 
ATOM   3528  C  CB  . VAL B  1 138 ? 5.551   35.372  -7.312  1.00 34.96 ? 139  VAL B CB  1 
ATOM   3529  C  CG1 . VAL B  1 138 ? 4.930   34.279  -6.484  1.00 34.97 ? 139  VAL B CG1 1 
ATOM   3530  C  CG2 . VAL B  1 138 ? 6.380   36.276  -6.470  1.00 29.42 ? 139  VAL B CG2 1 
ATOM   3531  N  N   . LYS B  1 139 ? 6.047   36.129  -10.444 1.00 41.86 ? 140  LYS B N   1 
ATOM   3532  C  CA  . LYS B  1 139 ? 6.355   37.158  -11.452 1.00 45.21 ? 140  LYS B CA  1 
ATOM   3533  C  C   . LYS B  1 139 ? 5.410   38.380  -11.416 1.00 44.34 ? 140  LYS B C   1 
ATOM   3534  O  O   . LYS B  1 139 ? 5.786   39.477  -11.866 1.00 44.23 ? 140  LYS B O   1 
ATOM   3535  C  CB  . LYS B  1 139 ? 6.300   36.533  -12.856 1.00 47.76 ? 140  LYS B CB  1 
ATOM   3536  C  CG  . LYS B  1 139 ? 7.298   35.391  -13.107 1.00 54.49 ? 140  LYS B CG  1 
ATOM   3537  C  CD  . LYS B  1 139 ? 8.754   35.874  -13.045 1.00 62.54 ? 140  LYS B CD  1 
ATOM   3538  C  CE  . LYS B  1 139 ? 9.730   34.782  -13.495 1.00 65.69 ? 140  LYS B CE  1 
ATOM   3539  N  NZ  . LYS B  1 139 ? 11.076  34.952  -12.875 1.00 67.61 ? 140  LYS B NZ  1 
ATOM   3540  N  N   . GLY B  1 140 ? 4.200   38.177  -10.882 1.00 41.51 ? 141  GLY B N   1 
ATOM   3541  C  CA  . GLY B  1 140 ? 3.129   39.167  -10.916 1.00 39.04 ? 141  GLY B CA  1 
ATOM   3542  C  C   . GLY B  1 140 ? 1.871   38.555  -11.496 1.00 37.50 ? 141  GLY B C   1 
ATOM   3543  O  O   . GLY B  1 140 ? 1.932   37.838  -12.497 1.00 37.18 ? 141  GLY B O   1 
ATOM   3544  N  N   . GLY B  1 141 ? 0.732   38.813  -10.855 1.00 34.87 ? 142  GLY B N   1 
ATOM   3545  C  CA  . GLY B  1 141 ? -0.553  38.278  -11.306 1.00 34.00 ? 142  GLY B CA  1 
ATOM   3546  C  C   . GLY B  1 141 ? -0.912  36.885  -10.802 1.00 32.80 ? 142  GLY B C   1 
ATOM   3547  O  O   . GLY B  1 141 ? -2.021  36.402  -11.044 1.00 35.59 ? 142  GLY B O   1 
ATOM   3548  N  N   . GLU B  1 142 ? 0.007   36.224  -10.112 1.00 29.37 ? 143  GLU B N   1 
ATOM   3549  C  CA  . GLU B  1 142 ? -0.247  34.874  -9.632  1.00 28.24 ? 143  GLU B CA  1 
ATOM   3550  C  C   . GLU B  1 142 ? -1.170  34.867  -8.433  1.00 25.78 ? 143  GLU B C   1 
ATOM   3551  O  O   . GLU B  1 142 ? -1.192  35.808  -7.649  1.00 25.57 ? 143  GLU B O   1 
ATOM   3552  C  CB  . GLU B  1 142 ? 1.048   34.192  -9.203  1.00 29.78 ? 143  GLU B CB  1 
ATOM   3553  C  CG  . GLU B  1 142 ? 2.051   33.968  -10.314 1.00 34.77 ? 143  GLU B CG  1 
ATOM   3554  C  CD  . GLU B  1 142 ? 3.161   34.995  -10.323 1.00 45.13 ? 143  GLU B CD  1 
ATOM   3555  O  OE1 . GLU B  1 142 ? 3.003   36.121  -9.759  1.00 39.21 ? 143  GLU B OE1 1 
ATOM   3556  O  OE2 . GLU B  1 142 ? 4.209   34.672  -10.913 1.00 51.13 ? 143  GLU B OE2 1 
ATOM   3557  N  N   . THR B  1 143 ? -1.892  33.768  -8.258  1.00 23.63 ? 144  THR B N   1 
ATOM   3558  C  CA  . THR B  1 143 ? -2.600  33.526  -7.024  1.00 23.16 ? 144  THR B CA  1 
ATOM   3559  C  C   . THR B  1 143 ? -1.757  32.647  -6.071  1.00 24.31 ? 144  THR B C   1 
ATOM   3560  O  O   . THR B  1 143 ? -1.440  31.488  -6.374  1.00 21.57 ? 144  THR B O   1 
ATOM   3561  C  CB  . THR B  1 143 ? -3.955  32.884  -7.307  1.00 23.78 ? 144  THR B CB  1 
ATOM   3562  O  OG1 . THR B  1 143 ? -4.750  33.789  -8.097  1.00 26.21 ? 144  THR B OG1 1 
ATOM   3563  C  CG2 . THR B  1 143 ? -4.664  32.558  -6.016  1.00 25.49 ? 144  THR B CG2 1 
ATOM   3564  N  N   . VAL B  1 144 ? -1.418  33.225  -4.913  1.00 23.69 ? 145  VAL B N   1 
ATOM   3565  C  CA  . VAL B  1 144 ? -0.583  32.603  -3.902  1.00 20.95 ? 145  VAL B CA  1 
ATOM   3566  C  C   . VAL B  1 144 ? -1.402  32.241  -2.669  1.00 21.77 ? 145  VAL B C   1 
ATOM   3567  O  O   . VAL B  1 144 ? -2.156  33.066  -2.137  1.00 21.82 ? 145  VAL B O   1 
ATOM   3568  C  CB  . VAL B  1 144 ? 0.528   33.560  -3.432  1.00 23.30 ? 145  VAL B CB  1 
ATOM   3569  C  CG1 . VAL B  1 144 ? 1.459   32.860  -2.453  1.00 19.80 ? 145  VAL B CG1 1 
ATOM   3570  C  CG2 . VAL B  1 144 ? 1.294   34.135  -4.617  1.00 21.45 ? 145  VAL B CG2 1 
ATOM   3571  N  N   . MET B  1 145 ? -1.255  31.010  -2.218  1.00 19.31 ? 146  MET B N   1 
ATOM   3572  C  CA  . MET B  1 145 ? -1.899  30.556  -1.003  1.00 20.94 ? 146  MET B CA  1 
ATOM   3573  C  C   . MET B  1 145 ? -0.818  30.503  0.045   1.00 19.96 ? 146  MET B C   1 
ATOM   3574  O  O   . MET B  1 145 ? 0.224   29.924  -0.189  1.00 22.28 ? 146  MET B O   1 
ATOM   3575  C  CB  . MET B  1 145 ? -2.571  29.197  -1.259  1.00 21.78 ? 146  MET B CB  1 
ATOM   3576  C  CG  . MET B  1 145 ? -2.657  28.241  -0.135  1.00 28.18 ? 146  MET B CG  1 
ATOM   3577  S  SD  . MET B  1 145 ? -3.406  28.734  1.383   1.00 38.27 ? 146  MET B SD  1 
ATOM   3578  C  CE  . MET B  1 145 ? -2.205  28.019  2.400   1.00 35.37 ? 146  MET B CE  1 
ATOM   3579  N  N   . VAL B  1 146 ? -1.037  31.145  1.179   1.00 20.12 ? 147  VAL B N   1 
ATOM   3580  C  CA  . VAL B  1 146 ? -0.060  31.130  2.250   1.00 21.30 ? 147  VAL B CA  1 
ATOM   3581  C  C   . VAL B  1 146 ? -0.746  30.798  3.572   1.00 20.05 ? 147  VAL B C   1 
ATOM   3582  O  O   . VAL B  1 146 ? -1.761  31.367  3.937   1.00 19.12 ? 147  VAL B O   1 
ATOM   3583  C  CB  . VAL B  1 146 ? 0.758   32.478  2.290   1.00 23.46 ? 147  VAL B CB  1 
ATOM   3584  C  CG1 . VAL B  1 146 ? -0.122  33.649  2.426   1.00 27.28 ? 147  VAL B CG1 1 
ATOM   3585  C  CG2 . VAL B  1 146 ? 1.780   32.479  3.413   1.00 19.31 ? 147  VAL B CG2 1 
ATOM   3586  N  N   . ASN B  1 147 ? -0.210  29.823  4.276   1.00 22.00 ? 148  ASN B N   1 
ATOM   3587  C  CA  . ASN B  1 147 ? -0.771  29.442  5.571   1.00 20.24 ? 148  ASN B CA  1 
ATOM   3588  C  C   . ASN B  1 147 ? 0.156   30.021  6.644   1.00 19.28 ? 148  ASN B C   1 
ATOM   3589  O  O   . ASN B  1 147 ? 1.207   30.596  6.302   1.00 17.00 ? 148  ASN B O   1 
ATOM   3590  C  CB  . ASN B  1 147 ? -0.989  27.923  5.662   1.00 19.77 ? 148  ASN B CB  1 
ATOM   3591  C  CG  . ASN B  1 147 ? 0.230   27.107  5.234   1.00 23.06 ? 148  ASN B CG  1 
ATOM   3592  O  OD1 . ASN B  1 147 ? 1.364   27.550  5.406   1.00 21.60 ? 148  ASN B OD1 1 
ATOM   3593  N  ND2 . ASN B  1 147 ? -0.003  25.897  4.701   1.00 16.03 ? 148  ASN B ND2 1 
ATOM   3594  N  N   . ALA B  1 148 ? -0.255  29.904  7.910   1.00 18.62 ? 149  ALA B N   1 
ATOM   3595  C  CA  . ALA B  1 148 ? 0.336   30.644  9.029   1.00 17.93 ? 149  ALA B CA  1 
ATOM   3596  C  C   . ALA B  1 148 ? 0.561   32.074  8.610   1.00 16.97 ? 149  ALA B C   1 
ATOM   3597  O  O   . ALA B  1 148 ? 1.627   32.646  8.822   1.00 16.45 ? 149  ALA B O   1 
ATOM   3598  C  CB  . ALA B  1 148 ? 1.658   29.968  9.507   1.00 17.50 ? 149  ALA B CB  1 
ATOM   3599  N  N   . ALA B  1 149 ? -0.470  32.649  8.001   1.00 18.40 ? 150  ALA B N   1 
ATOM   3600  C  CA  . ALA B  1 149 ? -0.347  33.870  7.231   1.00 19.15 ? 150  ALA B CA  1 
ATOM   3601  C  C   . ALA B  1 149 ? -0.198  35.116  8.084   1.00 21.76 ? 150  ALA B C   1 
ATOM   3602  O  O   . ALA B  1 149 ? 0.128   36.171  7.547   1.00 21.53 ? 150  ALA B O   1 
ATOM   3603  C  CB  . ALA B  1 149 ? -1.537  34.027  6.312   1.00 19.87 ? 150  ALA B CB  1 
ATOM   3604  N  N   . ALA B  1 150 ? -0.457  35.007  9.393   1.00 22.68 ? 151  ALA B N   1 
ATOM   3605  C  CA  . ALA B  1 150 ? -0.240  36.124  10.322  1.00 22.83 ? 151  ALA B CA  1 
ATOM   3606  C  C   . ALA B  1 150 ? 0.990   35.883  11.199  1.00 21.78 ? 151  ALA B C   1 
ATOM   3607  O  O   . ALA B  1 150 ? 1.237   36.629  12.155  1.00 19.71 ? 151  ALA B O   1 
ATOM   3608  C  CB  . ALA B  1 150 ? -1.503  36.362  11.197  1.00 21.68 ? 151  ALA B CB  1 
ATOM   3609  N  N   . GLY B  1 151 ? 1.736   34.828  10.892  1.00 19.75 ? 152  GLY B N   1 
ATOM   3610  C  CA  . GLY B  1 151 ? 2.989   34.548  11.555  1.00 20.07 ? 152  GLY B CA  1 
ATOM   3611  C  C   . GLY B  1 151 ? 4.144   35.355  10.984  1.00 19.22 ? 152  GLY B C   1 
ATOM   3612  O  O   . GLY B  1 151 ? 3.979   36.129  10.045  1.00 18.78 ? 152  GLY B O   1 
ATOM   3613  N  N   . ALA B  1 152 ? 5.326   35.177  11.550  1.00 19.56 ? 153  ALA B N   1 
ATOM   3614  C  CA  . ALA B  1 152 ? 6.500   35.980  11.137  1.00 18.94 ? 153  ALA B CA  1 
ATOM   3615  C  C   . ALA B  1 152 ? 6.783   35.811  9.648   1.00 18.37 ? 153  ALA B C   1 
ATOM   3616  O  O   . ALA B  1 152 ? 6.899   36.796  8.920   1.00 15.09 ? 153  ALA B O   1 
ATOM   3617  C  CB  . ALA B  1 152 ? 7.734   35.599  11.958  1.00 16.40 ? 153  ALA B CB  1 
ATOM   3618  N  N   . VAL B  1 153 ? 6.877   34.558  9.195   1.00 17.84 ? 154  VAL B N   1 
ATOM   3619  C  CA  . VAL B  1 153 ? 7.197   34.286  7.798   1.00 17.27 ? 154  VAL B CA  1 
ATOM   3620  C  C   . VAL B  1 153 ? 5.988   34.578  6.919   1.00 18.33 ? 154  VAL B C   1 
ATOM   3621  O  O   . VAL B  1 153 ? 6.082   35.317  5.926   1.00 15.76 ? 154  VAL B O   1 
ATOM   3622  C  CB  . VAL B  1 153 ? 7.663   32.828  7.596   1.00 17.69 ? 154  VAL B CB  1 
ATOM   3623  C  CG1 . VAL B  1 153 ? 7.892   32.528  6.121   1.00 14.51 ? 154  VAL B CG1 1 
ATOM   3624  C  CG2 . VAL B  1 153 ? 8.930   32.555  8.400   1.00 16.70 ? 154  VAL B CG2 1 
ATOM   3625  N  N   . GLY B  1 154 ? 4.849   33.991  7.274   1.00 18.18 ? 155  GLY B N   1 
ATOM   3626  C  CA  . GLY B  1 154 ? 3.660   34.094  6.422   1.00 18.08 ? 155  GLY B CA  1 
ATOM   3627  C  C   . GLY B  1 154 ? 3.193   35.503  6.177   1.00 18.36 ? 155  GLY B C   1 
ATOM   3628  O  O   . GLY B  1 154 ? 2.794   35.834  5.068   1.00 18.84 ? 155  GLY B O   1 
ATOM   3629  N  N   . SER B  1 155 ? 3.242   36.351  7.200   1.00 18.61 ? 156  SER B N   1 
ATOM   3630  C  CA  . SER B  1 155 ? 2.738   37.726  7.043   1.00 20.35 ? 156  SER B CA  1 
ATOM   3631  C  C   . SER B  1 155 ? 3.630   38.469  6.084   1.00 20.00 ? 156  SER B C   1 
ATOM   3632  O  O   . SER B  1 155 ? 3.140   39.262  5.283   1.00 20.81 ? 156  SER B O   1 
ATOM   3633  C  CB  . SER B  1 155 ? 2.603   38.490  8.377   1.00 19.82 ? 156  SER B CB  1 
ATOM   3634  O  OG  . SER B  1 155 ? 3.793   38.459  9.144   1.00 21.24 ? 156  SER B OG  1 
ATOM   3635  N  N   . VAL B  1 156 ? 4.925   38.160  6.091   1.00 20.29 ? 157  VAL B N   1 
ATOM   3636  C  CA  . VAL B  1 156 ? 5.828   38.824  5.131   1.00 20.05 ? 157  VAL B CA  1 
ATOM   3637  C  C   . VAL B  1 156 ? 5.656   38.293  3.720   1.00 18.80 ? 157  VAL B C   1 
ATOM   3638  O  O   . VAL B  1 156 ? 5.627   39.064  2.771   1.00 17.72 ? 157  VAL B O   1 
ATOM   3639  C  CB  . VAL B  1 156 ? 7.279   38.722  5.558   1.00 20.37 ? 157  VAL B CB  1 
ATOM   3640  C  CG1 . VAL B  1 156 ? 8.162   39.396  4.506   1.00 21.09 ? 157  VAL B CG1 1 
ATOM   3641  C  CG2 . VAL B  1 156 ? 7.440   39.374  6.953   1.00 16.67 ? 157  VAL B CG2 1 
ATOM   3642  N  N   . VAL B  1 157 ? 5.516   36.974  3.576   1.00 19.09 ? 158  VAL B N   1 
ATOM   3643  C  CA  . VAL B  1 157 ? 5.235   36.390  2.273   1.00 17.84 ? 158  VAL B CA  1 
ATOM   3644  C  C   . VAL B  1 157 ? 4.069   37.125  1.640   1.00 18.21 ? 158  VAL B C   1 
ATOM   3645  O  O   . VAL B  1 157 ? 4.154   37.647  0.526   1.00 19.07 ? 158  VAL B O   1 
ATOM   3646  C  CB  . VAL B  1 157 ? 4.873   34.887  2.383   1.00 18.54 ? 158  VAL B CB  1 
ATOM   3647  C  CG1 . VAL B  1 157 ? 4.239   34.393  1.060   1.00 13.76 ? 158  VAL B CG1 1 
ATOM   3648  C  CG2 . VAL B  1 157 ? 6.099   34.019  2.825   1.00 15.77 ? 158  VAL B CG2 1 
ATOM   3649  N  N   . GLY B  1 158 ? 2.985   37.199  2.394   1.00 20.07 ? 159  GLY B N   1 
ATOM   3650  C  CA  . GLY B  1 158 ? 1.756   37.785  1.913   1.00 23.23 ? 159  GLY B CA  1 
ATOM   3651  C  C   . GLY B  1 158 ? 1.938   39.219  1.473   1.00 21.97 ? 159  GLY B C   1 
ATOM   3652  O  O   . GLY B  1 158 ? 1.476   39.598  0.412   1.00 18.01 ? 159  GLY B O   1 
ATOM   3653  N  N   . GLN B  1 159 ? 2.620   40.016  2.284   1.00 23.34 ? 160  GLN B N   1 
ATOM   3654  C  CA  . GLN B  1 159 ? 2.832   41.426  1.923   1.00 24.68 ? 160  GLN B CA  1 
ATOM   3655  C  C   . GLN B  1 159 ? 3.793   41.598  0.743   1.00 22.34 ? 160  GLN B C   1 
ATOM   3656  O  O   . GLN B  1 159 ? 3.565   42.439  -0.115  1.00 20.22 ? 160  GLN B O   1 
ATOM   3657  C  CB  . GLN B  1 159 ? 3.311   42.212  3.139   1.00 25.57 ? 160  GLN B CB  1 
ATOM   3658  C  CG  . GLN B  1 159 ? 2.242   42.324  4.187   1.00 25.04 ? 160  GLN B CG  1 
ATOM   3659  C  CD  . GLN B  1 159 ? 2.685   43.176  5.355   1.00 26.13 ? 160  GLN B CD  1 
ATOM   3660  O  OE1 . GLN B  1 159 ? 2.571   44.396  5.324   1.00 27.62 ? 160  GLN B OE1 1 
ATOM   3661  N  NE2 . GLN B  1 159 ? 3.182   42.539  6.384   1.00 22.52 ? 160  GLN B NE2 1 
ATOM   3662  N  N   . ILE B  1 160 ? 4.850   40.775  0.667   1.00 23.41 ? 161  ILE B N   1 
ATOM   3663  C  CA  . ILE B  1 160 ? 5.741   40.830  -0.503  1.00 21.00 ? 161  ILE B CA  1 
ATOM   3664  C  C   . ILE B  1 160 ? 4.936   40.461  -1.732  1.00 22.19 ? 161  ILE B C   1 
ATOM   3665  O  O   . ILE B  1 160 ? 5.093   41.066  -2.786  1.00 23.02 ? 161  ILE B O   1 
ATOM   3666  C  CB  . ILE B  1 160 ? 6.921   39.889  -0.382  1.00 21.86 ? 161  ILE B CB  1 
ATOM   3667  C  CG1 . ILE B  1 160 ? 7.883   40.400  0.697   1.00 22.18 ? 161  ILE B CG1 1 
ATOM   3668  C  CG2 . ILE B  1 160 ? 7.627   39.752  -1.745  1.00 20.91 ? 161  ILE B CG2 1 
ATOM   3669  C  CD1 . ILE B  1 160 ? 9.094   39.521  0.925   1.00 21.66 ? 161  ILE B CD1 1 
ATOM   3670  N  N   . ALA B  1 161 ? 4.044   39.484  -1.589  1.00 21.80 ? 162  ALA B N   1 
ATOM   3671  C  CA  . ALA B  1 161 ? 3.233   39.053  -2.722  1.00 23.74 ? 162  ALA B CA  1 
ATOM   3672  C  C   . ALA B  1 161 ? 2.283   40.183  -3.171  1.00 24.65 ? 162  ALA B C   1 
ATOM   3673  O  O   . ALA B  1 161 ? 2.150   40.439  -4.354  1.00 22.77 ? 162  ALA B O   1 
ATOM   3674  C  CB  . ALA B  1 161 ? 2.453   37.751  -2.394  1.00 18.40 ? 162  ALA B CB  1 
ATOM   3675  N  N   . LYS B  1 162 ? 1.639   40.864  -2.234  1.00 23.50 ? 163  LYS B N   1 
ATOM   3676  C  CA  . LYS B  1 162 ? 0.813   42.007  -2.627  1.00 26.56 ? 163  LYS B CA  1 
ATOM   3677  C  C   . LYS B  1 162 ? 1.591   43.115  -3.368  1.00 26.44 ? 163  LYS B C   1 
ATOM   3678  O  O   . LYS B  1 162 ? 1.114   43.604  -4.389  1.00 25.30 ? 163  LYS B O   1 
ATOM   3679  C  CB  . LYS B  1 162 ? 0.054   42.581  -1.435  1.00 25.41 ? 163  LYS B CB  1 
ATOM   3680  C  CG  . LYS B  1 162 ? -1.010  41.647  -0.903  1.00 24.44 ? 163  LYS B CG  1 
ATOM   3681  C  CD  . LYS B  1 162 ? -2.051  41.190  -1.969  1.00 26.22 ? 163  LYS B CD  1 
ATOM   3682  C  CE  . LYS B  1 162 ? -2.875  42.346  -2.565  1.00 30.20 ? 163  LYS B CE  1 
ATOM   3683  N  NZ  . LYS B  1 162 ? -3.658  41.913  -3.738  1.00 25.59 ? 163  LYS B NZ  1 
ATOM   3684  N  N   . LEU B  1 163 ? 2.794   43.472  -2.909  1.00 28.67 ? 164  LEU B N   1 
ATOM   3685  C  CA  . LEU B  1 163 ? 3.558   44.524  -3.590  1.00 29.37 ? 164  LEU B CA  1 
ATOM   3686  C  C   . LEU B  1 163 ? 4.104   44.087  -4.958  1.00 30.19 ? 164  LEU B C   1 
ATOM   3687  O  O   . LEU B  1 163 ? 4.452   44.928  -5.797  1.00 29.17 ? 164  LEU B O   1 
ATOM   3688  C  CB  . LEU B  1 163 ? 4.651   45.110  -2.684  1.00 32.34 ? 164  LEU B CB  1 
ATOM   3689  C  CG  . LEU B  1 163 ? 5.945   44.350  -2.389  1.00 32.47 ? 164  LEU B CG  1 
ATOM   3690  C  CD1 . LEU B  1 163 ? 6.974   44.568  -3.497  1.00 33.67 ? 164  LEU B CD1 1 
ATOM   3691  C  CD2 . LEU B  1 163 ? 6.502   44.774  -1.041  1.00 27.73 ? 164  LEU B CD2 1 
ATOM   3692  N  N   . LYS B  1 164 ? 4.150   42.778  -5.201  1.00 29.88 ? 165  LYS B N   1 
ATOM   3693  C  CA  . LYS B  1 164 ? 4.481   42.265  -6.527  1.00 29.29 ? 165  LYS B CA  1 
ATOM   3694  C  C   . LYS B  1 164 ? 3.251   42.089  -7.425  1.00 28.98 ? 165  LYS B C   1 
ATOM   3695  O  O   . LYS B  1 164 ? 3.371   41.612  -8.525  1.00 29.74 ? 165  LYS B O   1 
ATOM   3696  C  CB  . LYS B  1 164 ? 5.256   40.949  -6.427  1.00 30.29 ? 165  LYS B CB  1 
ATOM   3697  C  CG  . LYS B  1 164 ? 6.655   41.087  -5.803  1.00 32.05 ? 165  LYS B CG  1 
ATOM   3698  C  CD  . LYS B  1 164 ? 7.616   41.971  -6.630  1.00 34.71 ? 165  LYS B CD  1 
ATOM   3699  C  CE  . LYS B  1 164 ? 8.975   42.135  -5.898  1.00 39.49 ? 165  LYS B CE  1 
ATOM   3700  N  NZ  . LYS B  1 164 ? 10.031  42.901  -6.647  1.00 39.35 ? 165  LYS B NZ  1 
ATOM   3701  N  N   . GLY B  1 165 ? 2.074   42.482  -6.967  1.00 30.62 ? 166  GLY B N   1 
ATOM   3702  C  CA  . GLY B  1 165 ? 0.885   42.447  -7.820  1.00 30.65 ? 166  GLY B CA  1 
ATOM   3703  C  C   . GLY B  1 165 ? 0.284   41.061  -7.909  1.00 30.19 ? 166  GLY B C   1 
ATOM   3704  O  O   . GLY B  1 165 ? -0.266  40.691  -8.945  1.00 32.14 ? 166  GLY B O   1 
ATOM   3705  N  N   . CYS B  1 166 ? 0.399   40.289  -6.827  1.00 30.01 ? 167  CYS B N   1 
ATOM   3706  C  CA  . CYS B  1 166 ? -0.220  38.961  -6.734  1.00 28.79 ? 167  CYS B CA  1 
ATOM   3707  C  C   . CYS B  1 166 ? -1.507  39.018  -5.917  1.00 28.32 ? 167  CYS B C   1 
ATOM   3708  O  O   . CYS B  1 166 ? -1.707  39.947  -5.143  1.00 28.92 ? 167  CYS B O   1 
ATOM   3709  C  CB  . CYS B  1 166 ? 0.730   37.976  -6.052  1.00 30.13 ? 167  CYS B CB  1 
ATOM   3710  S  SG  . CYS B  1 166 ? 2.315   37.749  -6.842  1.00 29.08 ? 167  CYS B SG  1 
ATOM   3711  N  N   . LYS B  1 167 ? -2.374  38.027  -6.114  1.00 27.37 ? 168  LYS B N   1 
ATOM   3712  C  CA  . LYS B  1 167 ? -3.562  37.823  -5.295  1.00 25.99 ? 168  LYS B CA  1 
ATOM   3713  C  C   . LYS B  1 167 ? -3.166  36.871  -4.177  1.00 25.18 ? 168  LYS B C   1 
ATOM   3714  O  O   . LYS B  1 167 ? -2.611  35.809  -4.445  1.00 25.01 ? 168  LYS B O   1 
ATOM   3715  C  CB  . LYS B  1 167 ? -4.720  37.211  -6.135  1.00 27.35 ? 168  LYS B CB  1 
ATOM   3716  C  CG  . LYS B  1 167 ? -5.844  36.573  -5.286  1.00 28.11 ? 168  LYS B CG  1 
ATOM   3717  C  CD  . LYS B  1 167 ? -7.127  36.253  -6.079  1.00 34.96 ? 168  LYS B CD  1 
ATOM   3718  C  CE  . LYS B  1 167 ? -8.195  35.629  -5.185  1.00 33.12 ? 168  LYS B CE  1 
ATOM   3719  N  NZ  . LYS B  1 167 ? -9.255  34.929  -5.956  1.00 38.94 ? 168  LYS B NZ  1 
ATOM   3720  N  N   . VAL B  1 168 ? -3.466  37.229  -2.932  1.00 23.70 ? 169  VAL B N   1 
ATOM   3721  C  CA  . VAL B  1 168 ? -3.048  36.429  -1.787  1.00 23.76 ? 169  VAL B CA  1 
ATOM   3722  C  C   . VAL B  1 168 ? -4.245  35.859  -1.060  1.00 23.58 ? 169  VAL B C   1 
ATOM   3723  O  O   . VAL B  1 168 ? -5.174  36.595  -0.727  1.00 23.98 ? 169  VAL B O   1 
ATOM   3724  C  CB  . VAL B  1 168 ? -2.205  37.251  -0.790  1.00 24.82 ? 169  VAL B CB  1 
ATOM   3725  C  CG1 . VAL B  1 168 ? -1.995  36.460  0.506   1.00 21.65 ? 169  VAL B CG1 1 
ATOM   3726  C  CG2 . VAL B  1 168 ? -0.862  37.652  -1.418  1.00 22.06 ? 169  VAL B CG2 1 
ATOM   3727  N  N   . VAL B  1 169 ? -4.218  34.544  -0.840  1.00 21.98 ? 170  VAL B N   1 
ATOM   3728  C  CA  . VAL B  1 169 ? -5.195  33.841  -0.036  1.00 20.77 ? 170  VAL B CA  1 
ATOM   3729  C  C   . VAL B  1 169 ? -4.464  33.292  1.155   1.00 21.92 ? 170  VAL B C   1 
ATOM   3730  O  O   . VAL B  1 169 ? -3.512  32.494  1.011   1.00 23.49 ? 170  VAL B O   1 
ATOM   3731  C  CB  . VAL B  1 169 ? -5.841  32.667  -0.804  1.00 23.18 ? 170  VAL B CB  1 
ATOM   3732  C  CG1 . VAL B  1 169 ? -6.805  31.889  0.116   1.00 18.23 ? 170  VAL B CG1 1 
ATOM   3733  C  CG2 . VAL B  1 169 ? -6.521  33.157  -2.092  1.00 20.63 ? 170  VAL B CG2 1 
ATOM   3734  N  N   . GLY B  1 170 ? -4.910  33.704  2.339   1.00 23.41 ? 171  GLY B N   1 
ATOM   3735  C  CA  . GLY B  1 170 ? -4.208  33.413  3.582   1.00 22.50 ? 171  GLY B CA  1 
ATOM   3736  C  C   . GLY B  1 170 ? -5.033  32.644  4.580   1.00 21.96 ? 171  GLY B C   1 
ATOM   3737  O  O   . GLY B  1 170 ? -6.223  32.912  4.760   1.00 23.61 ? 171  GLY B O   1 
ATOM   3738  N  N   . ALA B  1 171 ? -4.394  31.715  5.275   1.00 20.97 ? 172  ALA B N   1 
ATOM   3739  C  CA  . ALA B  1 171 ? -5.069  30.946  6.320   1.00 22.23 ? 172  ALA B CA  1 
ATOM   3740  C  C   . ALA B  1 171 ? -4.447  31.236  7.670   1.00 21.92 ? 172  ALA B C   1 
ATOM   3741  O  O   . ALA B  1 171 ? -3.203  31.222  7.794   1.00 20.36 ? 172  ALA B O   1 
ATOM   3742  C  CB  . ALA B  1 171 ? -5.001  29.444  6.014   1.00 21.13 ? 172  ALA B CB  1 
ATOM   3743  N  N   . VAL B  1 172 ? -5.305  31.475  8.677   1.00 22.82 ? 173  VAL B N   1 
ATOM   3744  C  CA  . VAL B  1 172 ? -4.876  31.741  10.057  1.00 22.15 ? 173  VAL B CA  1 
ATOM   3745  C  C   . VAL B  1 172 ? -5.772  31.041  11.088  1.00 24.02 ? 173  VAL B C   1 
ATOM   3746  O  O   . VAL B  1 172 ? -6.818  30.505  10.738  1.00 25.90 ? 173  VAL B O   1 
ATOM   3747  C  CB  . VAL B  1 172 ? -4.845  33.260  10.339  1.00 24.26 ? 173  VAL B CB  1 
ATOM   3748  C  CG1 . VAL B  1 172 ? -3.917  33.965  9.346   1.00 16.22 ? 173  VAL B CG1 1 
ATOM   3749  C  CG2 . VAL B  1 172 ? -6.263  33.878  10.292  1.00 21.48 ? 173  VAL B CG2 1 
ATOM   3750  N  N   . GLY B  1 173 ? -5.353  31.054  12.355  1.00 23.11 ? 174  GLY B N   1 
ATOM   3751  C  CA  . GLY B  1 173 ? -6.025  30.305  13.435  1.00 23.00 ? 174  GLY B CA  1 
ATOM   3752  C  C   . GLY B  1 173 ? -6.948  31.082  14.383  1.00 25.41 ? 174  GLY B C   1 
ATOM   3753  O  O   . GLY B  1 173 ? -7.372  30.534  15.401  1.00 23.87 ? 174  GLY B O   1 
ATOM   3754  N  N   . SER B  1 174 ? -7.260  32.338  14.060  1.00 26.20 ? 175  SER B N   1 
ATOM   3755  C  CA  . SER B  1 174 ? -8.137  33.167  14.912  1.00 27.28 ? 175  SER B CA  1 
ATOM   3756  C  C   . SER B  1 174 ? -8.808  34.281  14.129  1.00 26.85 ? 175  SER B C   1 
ATOM   3757  O  O   . SER B  1 174 ? -8.347  34.687  13.037  1.00 26.10 ? 175  SER B O   1 
ATOM   3758  C  CB  . SER B  1 174 ? -7.338  33.812  16.048  1.00 28.26 ? 175  SER B CB  1 
ATOM   3759  O  OG  . SER B  1 174 ? -6.668  34.976  15.566  1.00 28.51 ? 175  SER B OG  1 
ATOM   3760  N  N   . ASP B  1 175 ? -9.881  34.813  14.711  1.00 28.27 ? 176  ASP B N   1 
ATOM   3761  C  CA  . ASP B  1 175 ? -10.651 35.891  14.061  1.00 28.49 ? 176  ASP B CA  1 
ATOM   3762  C  C   . ASP B  1 175 ? -9.930  37.223  14.091  1.00 25.67 ? 176  ASP B C   1 
ATOM   3763  O  O   . ASP B  1 175 ? -10.071 38.023  13.178  1.00 26.34 ? 176  ASP B O   1 
ATOM   3764  C  CB  . ASP B  1 175 ? -12.060 36.008  14.680  1.00 31.14 ? 176  ASP B CB  1 
ATOM   3765  C  CG  . ASP B  1 175 ? -12.917 34.746  14.437  1.00 37.16 ? 176  ASP B CG  1 
ATOM   3766  O  OD1 . ASP B  1 175 ? -12.563 33.951  13.543  1.00 36.33 ? 176  ASP B OD1 1 
ATOM   3767  O  OD2 . ASP B  1 175 ? -13.932 34.538  15.139  1.00 43.71 ? 176  ASP B OD2 1 
ATOM   3768  N  N   . GLU B  1 176 ? -9.158  37.461  15.140  1.00 26.60 ? 177  GLU B N   1 
ATOM   3769  C  CA  . GLU B  1 176 ? -8.310  38.642  15.212  1.00 28.56 ? 177  GLU B CA  1 
ATOM   3770  C  C   . GLU B  1 176 ? -7.279  38.622  14.087  1.00 27.21 ? 177  GLU B C   1 
ATOM   3771  O  O   . GLU B  1 176 ? -7.056  39.632  13.431  1.00 28.63 ? 177  GLU B O   1 
ATOM   3772  C  CB  . GLU B  1 176 ? -7.611  38.703  16.579  1.00 30.24 ? 177  GLU B CB  1 
ATOM   3773  C  CG  . GLU B  1 176 ? -6.710  39.925  16.780  1.00 39.57 ? 177  GLU B CG  1 
ATOM   3774  C  CD  . GLU B  1 176 ? -5.932  39.912  18.117  1.00 47.42 ? 177  GLU B CD  1 
ATOM   3775  O  OE1 . GLU B  1 176 ? -6.145  39.005  18.957  1.00 50.94 ? 177  GLU B OE1 1 
ATOM   3776  O  OE2 . GLU B  1 176 ? -5.108  40.834  18.317  1.00 49.89 ? 177  GLU B OE2 1 
ATOM   3777  N  N   . LYS B  1 177 ? -6.677  37.459  13.837  1.00 26.18 ? 178  LYS B N   1 
ATOM   3778  C  CA  . LYS B  1 177 ? -5.701  37.337  12.742  1.00 25.17 ? 178  LYS B CA  1 
ATOM   3779  C  C   . LYS B  1 177 ? -6.358  37.601  11.397  1.00 24.71 ? 178  LYS B C   1 
ATOM   3780  O  O   . LYS B  1 177 ? -5.775  38.287  10.545  1.00 24.95 ? 178  LYS B O   1 
ATOM   3781  C  CB  . LYS B  1 177 ? -4.997  35.977  12.773  1.00 23.81 ? 178  LYS B CB  1 
ATOM   3782  C  CG  . LYS B  1 177 ? -4.054  35.819  13.918  1.00 22.07 ? 178  LYS B CG  1 
ATOM   3783  C  CD  . LYS B  1 177 ? -3.395  34.429  13.971  1.00 22.13 ? 178  LYS B CD  1 
ATOM   3784  C  CE  . LYS B  1 177 ? -2.591  34.308  15.224  1.00 22.20 ? 178  LYS B CE  1 
ATOM   3785  N  NZ  . LYS B  1 177 ? -1.763  33.071  15.365  1.00 15.58 ? 178  LYS B NZ  1 
ATOM   3786  N  N   . VAL B  1 178 ? -7.585  37.097  11.206  1.00 25.12 ? 179  VAL B N   1 
ATOM   3787  C  CA  . VAL B  1 178 ? -8.339  37.371  9.968   1.00 25.10 ? 179  VAL B CA  1 
ATOM   3788  C  C   . VAL B  1 178 ? -8.516  38.886  9.716   1.00 26.14 ? 179  VAL B C   1 
ATOM   3789  O  O   . VAL B  1 178 ? -8.157  39.418  8.662   1.00 25.64 ? 179  VAL B O   1 
ATOM   3790  C  CB  . VAL B  1 178 ? -9.739  36.684  9.973   1.00 25.19 ? 179  VAL B CB  1 
ATOM   3791  C  CG1 . VAL B  1 178 ? -10.613 37.204  8.824   1.00 20.52 ? 179  VAL B CG1 1 
ATOM   3792  C  CG2 . VAL B  1 178 ? -9.613  35.148  9.915   1.00 23.43 ? 179  VAL B CG2 1 
ATOM   3793  N  N   . ALA B  1 179 ? -9.060  39.574  10.703  1.00 27.38 ? 180  ALA B N   1 
ATOM   3794  C  CA  . ALA B  1 179 ? -9.286  41.021  10.616  1.00 27.87 ? 180  ALA B CA  1 
ATOM   3795  C  C   . ALA B  1 179 ? -8.017  41.794  10.352  1.00 25.53 ? 180  ALA B C   1 
ATOM   3796  O  O   . ALA B  1 179 ? -8.005  42.720  9.547   1.00 27.19 ? 180  ALA B O   1 
ATOM   3797  C  CB  . ALA B  1 179 ? -9.955  41.541  11.918  1.00 27.14 ? 180  ALA B CB  1 
ATOM   3798  N  N   . TYR B  1 180 ? -6.945  41.417  11.034  1.00 26.51 ? 181  TYR B N   1 
ATOM   3799  C  CA  . TYR B  1 180 ? -5.676  42.111  10.860  1.00 26.61 ? 181  TYR B CA  1 
ATOM   3800  C  C   . TYR B  1 180 ? -5.202  42.021  9.409   1.00 27.09 ? 181  TYR B C   1 
ATOM   3801  O  O   . TYR B  1 180 ? -4.890  43.034  8.779   1.00 27.51 ? 181  TYR B O   1 
ATOM   3802  C  CB  . TYR B  1 180 ? -4.610  41.530  11.801  1.00 27.38 ? 181  TYR B CB  1 
ATOM   3803  C  CG  . TYR B  1 180 ? -3.253  42.136  11.555  1.00 30.28 ? 181  TYR B CG  1 
ATOM   3804  C  CD1 . TYR B  1 180 ? -3.020  43.472  11.841  1.00 30.91 ? 181  TYR B CD1 1 
ATOM   3805  C  CD2 . TYR B  1 180 ? -2.211  41.380  10.984  1.00 28.18 ? 181  TYR B CD2 1 
ATOM   3806  C  CE1 . TYR B  1 180 ? -1.785  44.048  11.589  1.00 33.15 ? 181  TYR B CE1 1 
ATOM   3807  C  CE2 . TYR B  1 180 ? -0.983  41.936  10.735  1.00 28.82 ? 181  TYR B CE2 1 
ATOM   3808  C  CZ  . TYR B  1 180 ? -0.776  43.280  11.031  1.00 31.50 ? 181  TYR B CZ  1 
ATOM   3809  O  OH  . TYR B  1 180 ? 0.434   43.859  10.809  1.00 26.95 ? 181  TYR B OH  1 
ATOM   3810  N  N   . LEU B  1 181 ? -5.155  40.794  8.885   1.00 26.06 ? 182  LEU B N   1 
ATOM   3811  C  CA  . LEU B  1 181 ? -4.705  40.569  7.509   1.00 26.52 ? 182  LEU B CA  1 
ATOM   3812  C  C   . LEU B  1 181 ? -5.630  41.179  6.457   1.00 25.63 ? 182  LEU B C   1 
ATOM   3813  O  O   . LEU B  1 181 ? -5.174  41.609  5.392   1.00 24.47 ? 182  LEU B O   1 
ATOM   3814  C  CB  . LEU B  1 181 ? -4.493  39.070  7.252   1.00 26.87 ? 182  LEU B CB  1 
ATOM   3815  C  CG  . LEU B  1 181 ? -3.324  38.423  8.001   1.00 24.06 ? 182  LEU B CG  1 
ATOM   3816  C  CD1 . LEU B  1 181 ? -3.180  36.942  7.600   1.00 21.73 ? 182  LEU B CD1 1 
ATOM   3817  C  CD2 . LEU B  1 181 ? -2.035  39.162  7.716   1.00 16.31 ? 182  LEU B CD2 1 
ATOM   3818  N  N   . GLN B  1 182 ? -6.924  41.222  6.735   1.00 26.60 ? 183  GLN B N   1 
ATOM   3819  C  CA  . GLN B  1 182 ? -7.854  41.927  5.819   1.00 28.61 ? 183  GLN B CA  1 
ATOM   3820  C  C   . GLN B  1 182 ? -7.517  43.413  5.761   1.00 28.06 ? 183  GLN B C   1 
ATOM   3821  O  O   . GLN B  1 182 ? -7.546  44.002  4.688   1.00 29.16 ? 183  GLN B O   1 
ATOM   3822  C  CB  . GLN B  1 182 ? -9.321  41.725  6.242   1.00 28.30 ? 183  GLN B CB  1 
ATOM   3823  C  CG  . GLN B  1 182 ? -9.813  40.287  6.122   1.00 29.14 ? 183  GLN B CG  1 
ATOM   3824  C  CD  . GLN B  1 182 ? -11.179 40.067  6.760   1.00 32.91 ? 183  GLN B CD  1 
ATOM   3825  O  OE1 . GLN B  1 182 ? -11.503 40.674  7.776   1.00 34.34 ? 183  GLN B OE1 1 
ATOM   3826  N  NE2 . GLN B  1 182 ? -11.985 39.190  6.158   1.00 31.13 ? 183  GLN B NE2 1 
ATOM   3827  N  N   . LYS B  1 183 ? -7.148  43.998  6.905   1.00 29.45 ? 184  LYS B N   1 
ATOM   3828  C  CA  . LYS B  1 183 ? -6.766  45.422  6.965   1.00 31.67 ? 184  LYS B CA  1 
ATOM   3829  C  C   . LYS B  1 183 ? -5.455  45.714  6.238   1.00 32.98 ? 184  LYS B C   1 
ATOM   3830  O  O   . LYS B  1 183 ? -5.293  46.784  5.665   1.00 34.53 ? 184  LYS B O   1 
ATOM   3831  C  CB  . LYS B  1 183 ? -6.682  45.917  8.421   1.00 33.32 ? 184  LYS B CB  1 
ATOM   3832  N  N   . LEU B  1 184 ? -4.515  44.768  6.258   1.00 34.44 ? 185  LEU B N   1 
ATOM   3833  C  CA  . LEU B  1 184 ? -3.335  44.840  5.381   1.00 33.48 ? 185  LEU B CA  1 
ATOM   3834  C  C   . LEU B  1 184 ? -3.685  44.717  3.907   1.00 34.16 ? 185  LEU B C   1 
ATOM   3835  O  O   . LEU B  1 184 ? -2.884  45.098  3.060   1.00 33.56 ? 185  LEU B O   1 
ATOM   3836  C  CB  . LEU B  1 184 ? -2.317  43.745  5.708   1.00 34.29 ? 185  LEU B CB  1 
ATOM   3837  C  CG  . LEU B  1 184 ? -1.452  43.930  6.943   1.00 32.92 ? 185  LEU B CG  1 
ATOM   3838  C  CD1 . LEU B  1 184 ? -0.371  42.839  7.005   1.00 29.76 ? 185  LEU B CD1 1 
ATOM   3839  C  CD2 . LEU B  1 184 ? -0.857  45.329  6.942   1.00 33.67 ? 185  LEU B CD2 1 
ATOM   3840  N  N   . GLY B  1 185 ? -4.849  44.141  3.594   1.00 33.20 ? 186  GLY B N   1 
ATOM   3841  C  CA  . GLY B  1 185 ? -5.329  44.090  2.207   1.00 31.97 ? 186  GLY B CA  1 
ATOM   3842  C  C   . GLY B  1 185 ? -5.078  42.783  1.468   1.00 29.70 ? 186  GLY B C   1 
ATOM   3843  O  O   . GLY B  1 185 ? -5.132  42.738  0.236   1.00 31.70 ? 186  GLY B O   1 
ATOM   3844  N  N   . PHE B  1 186 ? -4.836  41.711  2.208   1.00 27.35 ? 187  PHE B N   1 
ATOM   3845  C  CA  . PHE B  1 186 ? -4.825  40.379  1.606   1.00 28.15 ? 187  PHE B CA  1 
ATOM   3846  C  C   . PHE B  1 186 ? -6.230  40.105  1.030   1.00 28.18 ? 187  PHE B C   1 
ATOM   3847  O  O   . PHE B  1 186 ? -7.249  40.400  1.681   1.00 28.07 ? 187  PHE B O   1 
ATOM   3848  C  CB  . PHE B  1 186 ? -4.458  39.313  2.638   1.00 28.02 ? 187  PHE B CB  1 
ATOM   3849  C  CG  . PHE B  1 186 ? -3.019  39.354  3.114   1.00 23.13 ? 187  PHE B CG  1 
ATOM   3850  C  CD1 . PHE B  1 186 ? -2.179  40.445  2.871   1.00 28.56 ? 187  PHE B CD1 1 
ATOM   3851  C  CD2 . PHE B  1 186 ? -2.509  38.280  3.823   1.00 25.60 ? 187  PHE B CD2 1 
ATOM   3852  C  CE1 . PHE B  1 186 ? -0.839  40.451  3.337   1.00 26.94 ? 187  PHE B CE1 1 
ATOM   3853  C  CE2 . PHE B  1 186 ? -1.189  38.287  4.305   1.00 25.28 ? 187  PHE B CE2 1 
ATOM   3854  C  CZ  . PHE B  1 186 ? -0.356  39.366  4.046   1.00 23.25 ? 187  PHE B CZ  1 
ATOM   3855  N  N   . ASP B  1 187 ? -6.267  39.537  -0.176  1.00 28.47 ? 188  ASP B N   1 
ATOM   3856  C  CA  . ASP B  1 187 ? -7.501  39.407  -0.958  1.00 28.71 ? 188  ASP B CA  1 
ATOM   3857  C  C   . ASP B  1 187 ? -8.547  38.560  -0.236  1.00 28.39 ? 188  ASP B C   1 
ATOM   3858  O  O   . ASP B  1 187 ? -9.695  38.962  -0.102  1.00 28.63 ? 188  ASP B O   1 
ATOM   3859  C  CB  . ASP B  1 187 ? -7.224  38.853  -2.353  1.00 27.50 ? 188  ASP B CB  1 
ATOM   3860  C  CG  . ASP B  1 187 ? -6.187  39.656  -3.100  1.00 30.88 ? 188  ASP B CG  1 
ATOM   3861  O  OD1 . ASP B  1 187 ? -5.057  39.752  -2.581  1.00 29.57 ? 188  ASP B OD1 1 
ATOM   3862  O  OD2 . ASP B  1 187 ? -6.495  40.204  -4.183  1.00 33.60 ? 188  ASP B OD2 1 
ATOM   3863  N  N   . VAL B  1 188 ? -8.143  37.403  0.246   1.00 26.74 ? 189  VAL B N   1 
ATOM   3864  C  CA  . VAL B  1 188 ? -9.020  36.582  1.039   1.00 25.83 ? 189  VAL B CA  1 
ATOM   3865  C  C   . VAL B  1 188 ? -8.216  36.048  2.204   1.00 25.37 ? 189  VAL B C   1 
ATOM   3866  O  O   . VAL B  1 188 ? -7.073  35.626  2.029   1.00 25.29 ? 189  VAL B O   1 
ATOM   3867  C  CB  . VAL B  1 188 ? -9.594  35.404  0.227   1.00 26.08 ? 189  VAL B CB  1 
ATOM   3868  C  CG1 . VAL B  1 188 ? -10.536 34.576  1.095   1.00 24.06 ? 189  VAL B CG1 1 
ATOM   3869  C  CG2 . VAL B  1 188 ? -10.298 35.896  -1.049  1.00 27.89 ? 189  VAL B CG2 1 
ATOM   3870  N  N   . VAL B  1 189 ? -8.815  36.086  3.390   1.00 24.00 ? 190  VAL B N   1 
ATOM   3871  C  CA  . VAL B  1 189 ? -8.239  35.536  4.602   1.00 21.83 ? 190  VAL B CA  1 
ATOM   3872  C  C   . VAL B  1 189 ? -9.367  34.774  5.320   1.00 25.29 ? 190  VAL B C   1 
ATOM   3873  O  O   . VAL B  1 189 ? -10.513 35.248  5.369   1.00 27.30 ? 190  VAL B O   1 
ATOM   3874  C  CB  . VAL B  1 189 ? -7.707  36.663  5.525   1.00 22.68 ? 190  VAL B CB  1 
ATOM   3875  C  CG1 . VAL B  1 189 ? -6.878  36.089  6.661   1.00 20.38 ? 190  VAL B CG1 1 
ATOM   3876  C  CG2 . VAL B  1 189 ? -6.929  37.692  4.742   1.00 19.93 ? 190  VAL B CG2 1 
ATOM   3877  N  N   . PHE B  1 190 ? -9.059  33.600  5.854   1.00 23.94 ? 191  PHE B N   1 
ATOM   3878  C  CA  . PHE B  1 190 ? -10.030 32.816  6.575   1.00 22.95 ? 191  PHE B CA  1 
ATOM   3879  C  C   . PHE B  1 190 ? -9.367  32.149  7.733   1.00 24.33 ? 191  PHE B C   1 
ATOM   3880  O  O   . PHE B  1 190 ? -8.147  32.015  7.763   1.00 24.09 ? 191  PHE B O   1 
ATOM   3881  C  CB  . PHE B  1 190 ? -10.694 31.752  5.679   1.00 24.98 ? 191  PHE B CB  1 
ATOM   3882  C  CG  . PHE B  1 190 ? -9.738  30.724  5.098   1.00 23.35 ? 191  PHE B CG  1 
ATOM   3883  C  CD1 . PHE B  1 190 ? -9.115  30.941  3.878   1.00 25.03 ? 191  PHE B CD1 1 
ATOM   3884  C  CD2 . PHE B  1 190 ? -9.486  29.540  5.752   1.00 23.62 ? 191  PHE B CD2 1 
ATOM   3885  C  CE1 . PHE B  1 190 ? -8.240  29.982  3.321   1.00 24.84 ? 191  PHE B CE1 1 
ATOM   3886  C  CE2 . PHE B  1 190 ? -8.597  28.584  5.198   1.00 26.40 ? 191  PHE B CE2 1 
ATOM   3887  C  CZ  . PHE B  1 190 ? -7.991  28.816  3.979   1.00 21.09 ? 191  PHE B CZ  1 
ATOM   3888  N  N   . ASN B  1 191 ? -10.212 31.716  8.666   1.00 24.67 ? 192  ASN B N   1 
ATOM   3889  C  CA  . ASN B  1 191 ? -9.826  31.062  9.891   1.00 24.23 ? 192  ASN B CA  1 
ATOM   3890  C  C   . ASN B  1 191 ? -10.050 29.587  9.706   1.00 26.83 ? 192  ASN B C   1 
ATOM   3891  O  O   . ASN B  1 191 ? -11.217 29.144  9.656   1.00 27.56 ? 192  ASN B O   1 
ATOM   3892  C  CB  . ASN B  1 191 ? -10.704 31.581  11.025  1.00 24.18 ? 192  ASN B CB  1 
ATOM   3893  C  CG  . ASN B  1 191 ? -10.421 30.911  12.333  1.00 25.44 ? 192  ASN B CG  1 
ATOM   3894  O  OD1 . ASN B  1 191 ? -9.874  29.814  12.382  1.00 28.11 ? 192  ASN B OD1 1 
ATOM   3895  N  ND2 . ASN B  1 191 ? -10.805 31.576  13.423  1.00 28.15 ? 192  ASN B ND2 1 
ATOM   3896  N  N   . TYR B  1 192 ? -8.949  28.832  9.614   1.00 24.29 ? 193  TYR B N   1 
ATOM   3897  C  CA  . TYR B  1 192 ? -9.005  27.415  9.225   1.00 25.64 ? 193  TYR B CA  1 
ATOM   3898  C  C   . TYR B  1 192 ? -9.529  26.539  10.330  1.00 26.24 ? 193  TYR B C   1 
ATOM   3899  O  O   . TYR B  1 192 ? -9.756  25.341  10.135  1.00 24.62 ? 193  TYR B O   1 
ATOM   3900  C  CB  . TYR B  1 192 ? -7.621  26.887  8.769   1.00 22.18 ? 193  TYR B CB  1 
ATOM   3901  C  CG  . TYR B  1 192 ? -6.612  26.755  9.858   1.00 21.46 ? 193  TYR B CG  1 
ATOM   3902  C  CD1 . TYR B  1 192 ? -6.531  25.593  10.610  1.00 23.01 ? 193  TYR B CD1 1 
ATOM   3903  C  CD2 . TYR B  1 192 ? -5.697  27.787  10.131  1.00 20.28 ? 193  TYR B CD2 1 
ATOM   3904  C  CE1 . TYR B  1 192 ? -5.609  25.448  11.620  1.00 23.02 ? 193  TYR B CE1 1 
ATOM   3905  C  CE2 . TYR B  1 192 ? -4.745  27.653  11.167  1.00 16.35 ? 193  TYR B CE2 1 
ATOM   3906  C  CZ  . TYR B  1 192 ? -4.718  26.486  11.898  1.00 20.65 ? 193  TYR B CZ  1 
ATOM   3907  O  OH  . TYR B  1 192 ? -3.826  26.304  12.927  1.00 23.76 ? 193  TYR B OH  1 
ATOM   3908  N  N   . LYS B  1 193 ? -9.647  27.113  11.521  1.00 29.44 ? 194  LYS B N   1 
ATOM   3909  C  CA  . LYS B  1 193 ? -10.119 26.354  12.667  1.00 29.86 ? 194  LYS B CA  1 
ATOM   3910  C  C   . LYS B  1 193 ? -11.629 26.318  12.724  1.00 30.20 ? 194  LYS B C   1 
ATOM   3911  O  O   . LYS B  1 193 ? -12.179 25.426  13.354  1.00 32.56 ? 194  LYS B O   1 
ATOM   3912  C  CB  . LYS B  1 193 ? -9.572  26.953  13.959  1.00 31.12 ? 194  LYS B CB  1 
ATOM   3913  C  CG  . LYS B  1 193 ? -8.096  26.669  14.137  1.00 33.59 ? 194  LYS B CG  1 
ATOM   3914  C  CD  . LYS B  1 193 ? -7.630  27.050  15.479  1.00 30.25 ? 194  LYS B CD  1 
ATOM   3915  C  CE  . LYS B  1 193 ? -6.192  26.732  15.617  1.00 31.03 ? 194  LYS B CE  1 
ATOM   3916  N  NZ  . LYS B  1 193 ? -5.701  27.327  16.839  1.00 23.07 ? 194  LYS B NZ  1 
ATOM   3917  N  N   . THR B  1 194 ? -12.286 27.276  12.070  1.00 30.54 ? 195  THR B N   1 
ATOM   3918  C  CA  . THR B  1 194 ? -13.729 27.457  12.207  1.00 32.36 ? 195  THR B CA  1 
ATOM   3919  C  C   . THR B  1 194 ? -14.515 27.361  10.895  1.00 34.14 ? 195  THR B C   1 
ATOM   3920  O  O   . THR B  1 194 ? -15.739 27.375  10.923  1.00 35.64 ? 195  THR B O   1 
ATOM   3921  C  CB  . THR B  1 194 ? -14.056 28.855  12.823  1.00 32.42 ? 195  THR B CB  1 
ATOM   3922  O  OG1 . THR B  1 194 ? -13.608 29.895  11.938  1.00 31.09 ? 195  THR B OG1 1 
ATOM   3923  C  CG2 . THR B  1 194 ? -13.413 29.027  14.202  1.00 29.95 ? 195  THR B CG2 1 
ATOM   3924  N  N   . VAL B  1 195 ? -13.844 27.337  9.747   1.00 34.00 ? 196  VAL B N   1 
ATOM   3925  C  CA  . VAL B  1 195 ? -14.570 27.172  8.489   1.00 34.64 ? 196  VAL B CA  1 
ATOM   3926  C  C   . VAL B  1 195 ? -15.151 25.767  8.452   1.00 35.41 ? 196  VAL B C   1 
ATOM   3927  O  O   . VAL B  1 195 ? -14.598 24.828  9.047   1.00 33.42 ? 196  VAL B O   1 
ATOM   3928  C  CB  . VAL B  1 195 ? -13.689 27.387  7.257   1.00 33.86 ? 196  VAL B CB  1 
ATOM   3929  C  CG1 . VAL B  1 195 ? -13.204 28.814  7.216   1.00 35.34 ? 196  VAL B CG1 1 
ATOM   3930  C  CG2 . VAL B  1 195 ? -12.520 26.392  7.248   1.00 31.40 ? 196  VAL B CG2 1 
ATOM   3931  N  N   . GLU B  1 196 ? -16.279 25.626  7.772   1.00 36.96 ? 197  GLU B N   1 
ATOM   3932  C  CA  . GLU B  1 196 ? -16.957 24.330  7.686   1.00 36.84 ? 197  GLU B CA  1 
ATOM   3933  C  C   . GLU B  1 196 ? -16.115 23.314  6.908   1.00 35.75 ? 197  GLU B C   1 
ATOM   3934  O  O   . GLU B  1 196 ? -15.991 22.159  7.310   1.00 36.20 ? 197  GLU B O   1 
ATOM   3935  C  CB  . GLU B  1 196 ? -18.305 24.521  7.012   1.00 38.85 ? 197  GLU B CB  1 
ATOM   3936  C  CG  . GLU B  1 196 ? -19.166 23.272  6.971   1.00 47.63 ? 197  GLU B CG  1 
ATOM   3937  C  CD  . GLU B  1 196 ? -20.614 23.607  6.666   1.00 52.96 ? 197  GLU B CD  1 
ATOM   3938  O  OE1 . GLU B  1 196 ? -21.145 24.505  7.362   1.00 50.98 ? 197  GLU B OE1 1 
ATOM   3939  O  OE2 . GLU B  1 196 ? -21.202 22.981  5.743   1.00 54.85 ? 197  GLU B OE2 1 
ATOM   3940  N  N   . SER B  1 197 ? -15.519 23.759  5.808   1.00 34.66 ? 198  SER B N   1 
ATOM   3941  C  CA  . SER B  1 197 ? -14.714 22.879  4.946   1.00 34.03 ? 198  SER B CA  1 
ATOM   3942  C  C   . SER B  1 197 ? -13.549 23.653  4.315   1.00 32.06 ? 198  SER B C   1 
ATOM   3943  O  O   . SER B  1 197 ? -13.765 24.651  3.601   1.00 30.95 ? 198  SER B O   1 
ATOM   3944  C  CB  . SER B  1 197 ? -15.589 22.313  3.830   1.00 33.57 ? 198  SER B CB  1 
ATOM   3945  O  OG  . SER B  1 197 ? -14.812 21.667  2.835   1.00 36.77 ? 198  SER B OG  1 
ATOM   3946  N  N   . LEU B  1 198 ? -12.328 23.180  4.563   1.00 30.69 ? 199  LEU B N   1 
ATOM   3947  C  CA  . LEU B  1 198 ? -11.132 23.814  4.001   1.00 28.96 ? 199  LEU B CA  1 
ATOM   3948  C  C   . LEU B  1 198 ? -11.157 23.793  2.484   1.00 26.92 ? 199  LEU B C   1 
ATOM   3949  O  O   . LEU B  1 198 ? -10.882 24.796  1.848   1.00 26.93 ? 199  LEU B O   1 
ATOM   3950  C  CB  . LEU B  1 198 ? -9.851  23.129  4.506   1.00 28.19 ? 199  LEU B CB  1 
ATOM   3951  C  CG  . LEU B  1 198 ? -8.552  23.749  3.957   1.00 25.27 ? 199  LEU B CG  1 
ATOM   3952  C  CD1 . LEU B  1 198 ? -8.470  25.265  4.260   1.00 21.47 ? 199  LEU B CD1 1 
ATOM   3953  C  CD2 . LEU B  1 198 ? -7.313  22.988  4.464   1.00 21.76 ? 199  LEU B CD2 1 
ATOM   3954  N  N   . GLU B  1 199 ? -11.505 22.643  1.919   1.00 28.68 ? 200  GLU B N   1 
ATOM   3955  C  CA  . GLU B  1 199 ? -11.613 22.461  0.472   1.00 28.58 ? 200  GLU B CA  1 
ATOM   3956  C  C   . GLU B  1 199 ? -12.610 23.430  -0.147  1.00 27.86 ? 200  GLU B C   1 
ATOM   3957  O  O   . GLU B  1 199 ? -12.317 24.089  -1.152  1.00 27.11 ? 200  GLU B O   1 
ATOM   3958  C  CB  . GLU B  1 199 ? -12.021 21.006  0.165   1.00 30.37 ? 200  GLU B CB  1 
ATOM   3959  C  CG  . GLU B  1 199 ? -12.169 20.656  -1.329  1.00 37.66 ? 200  GLU B CG  1 
ATOM   3960  C  CD  . GLU B  1 199 ? -12.793 19.267  -1.574  1.00 44.90 ? 200  GLU B CD  1 
ATOM   3961  O  OE1 . GLU B  1 199 ? -13.022 18.504  -0.607  1.00 45.82 ? 200  GLU B OE1 1 
ATOM   3962  O  OE2 . GLU B  1 199 ? -13.069 18.951  -2.749  1.00 46.22 ? 200  GLU B OE2 1 
ATOM   3963  N  N   . GLU B  1 200 ? -13.794 23.538  0.432   1.00 28.84 ? 201  GLU B N   1 
ATOM   3964  C  CA  . GLU B  1 200 ? -14.780 24.477  -0.128  1.00 30.59 ? 201  GLU B CA  1 
ATOM   3965  C  C   . GLU B  1 200 ? -14.369 25.923  0.064   1.00 28.91 ? 201  GLU B C   1 
ATOM   3966  O  O   . GLU B  1 200 ? -14.660 26.749  -0.782  1.00 27.42 ? 201  GLU B O   1 
ATOM   3967  C  CB  . GLU B  1 200 ? -16.184 24.241  0.440   1.00 32.45 ? 201  GLU B CB  1 
ATOM   3968  C  CG  . GLU B  1 200 ? -16.830 22.945  -0.052  1.00 39.50 ? 201  GLU B CG  1 
ATOM   3969  C  CD  . GLU B  1 200 ? -16.915 22.838  -1.587  1.00 42.20 ? 201  GLU B CD  1 
ATOM   3970  O  OE1 . GLU B  1 200 ? -17.339 23.829  -2.231  1.00 40.63 ? 201  GLU B OE1 1 
ATOM   3971  O  OE2 . GLU B  1 200 ? -16.559 21.754  -2.128  1.00 41.99 ? 201  GLU B OE2 1 
ATOM   3972  N  N   . THR B  1 201 ? -13.674 26.233  1.163   1.00 29.25 ? 202  THR B N   1 
ATOM   3973  C  CA  . THR B  1 201 ? -13.177 27.620  1.362   1.00 27.16 ? 202  THR B CA  1 
ATOM   3974  C  C   . THR B  1 201 ? -12.101 27.962  0.337   1.00 24.88 ? 202  THR B C   1 
ATOM   3975  O  O   . THR B  1 201 ? -12.165 28.997  -0.343  1.00 22.46 ? 202  THR B O   1 
ATOM   3976  C  CB  . THR B  1 201 ? -12.651 27.844  2.790   1.00 27.20 ? 202  THR B CB  1 
ATOM   3977  O  OG1 . THR B  1 201 ? -13.693 27.553  3.716   1.00 27.45 ? 202  THR B OG1 1 
ATOM   3978  C  CG2 . THR B  1 201 ? -12.204 29.299  2.990   1.00 25.40 ? 202  THR B CG2 1 
ATOM   3979  N  N   . LEU B  1 202 ? -11.113 27.083  0.206   1.00 26.44 ? 203  LEU B N   1 
ATOM   3980  C  CA  . LEU B  1 202 ? -10.062 27.282  -0.816  1.00 25.35 ? 203  LEU B CA  1 
ATOM   3981  C  C   . LEU B  1 202 ? -10.663 27.422  -2.217  1.00 26.35 ? 203  LEU B C   1 
ATOM   3982  O  O   . LEU B  1 202 ? -10.194 28.222  -3.036  1.00 26.71 ? 203  LEU B O   1 
ATOM   3983  C  CB  . LEU B  1 202 ? -9.054  26.141  -0.752  1.00 25.48 ? 203  LEU B CB  1 
ATOM   3984  C  CG  . LEU B  1 202 ? -8.124  26.142  0.473   1.00 24.85 ? 203  LEU B CG  1 
ATOM   3985  C  CD1 . LEU B  1 202 ? -7.448  24.786  0.613   1.00 20.71 ? 203  LEU B CD1 1 
ATOM   3986  C  CD2 . LEU B  1 202 ? -7.067  27.304  0.447   1.00 18.99 ? 203  LEU B CD2 1 
ATOM   3987  N  N   . LYS B  1 203 ? -11.736 26.675  -2.480  1.00 29.44 ? 204  LYS B N   1 
ATOM   3988  C  CA  . LYS B  1 203 ? -12.401 26.686  -3.804  1.00 31.74 ? 204  LYS B CA  1 
ATOM   3989  C  C   . LYS B  1 203 ? -13.128 28.016  -4.037  1.00 30.63 ? 204  LYS B C   1 
ATOM   3990  O  O   . LYS B  1 203 ? -12.956 28.653  -5.074  1.00 29.42 ? 204  LYS B O   1 
ATOM   3991  C  CB  . LYS B  1 203 ? -13.342 25.468  -3.914  1.00 33.52 ? 204  LYS B CB  1 
ATOM   3992  C  CG  . LYS B  1 203 ? -14.107 25.271  -5.224  1.00 43.46 ? 204  LYS B CG  1 
ATOM   3993  C  CD  . LYS B  1 203 ? -13.190 25.070  -6.434  1.00 52.26 ? 204  LYS B CD  1 
ATOM   3994  C  CE  . LYS B  1 203 ? -13.994 24.869  -7.735  1.00 55.01 ? 204  LYS B CE  1 
ATOM   3995  N  NZ  . LYS B  1 203 ? -13.201 25.229  -8.944  1.00 56.55 ? 204  LYS B NZ  1 
ATOM   3996  N  N   . LYS B  1 204 ? -13.903 28.459  -3.054  1.00 32.51 ? 205  LYS B N   1 
ATOM   3997  C  CA  . LYS B  1 204 ? -14.530 29.782  -3.140  1.00 34.16 ? 205  LYS B CA  1 
ATOM   3998  C  C   . LYS B  1 204 ? -13.491 30.894  -3.233  1.00 32.98 ? 205  LYS B C   1 
ATOM   3999  O  O   . LYS B  1 204 ? -13.632 31.808  -4.059  1.00 32.81 ? 205  LYS B O   1 
ATOM   4000  C  CB  . LYS B  1 204 ? -15.458 30.049  -1.961  1.00 34.99 ? 205  LYS B CB  1 
ATOM   4001  C  CG  . LYS B  1 204 ? -16.462 31.173  -2.242  1.00 39.62 ? 205  LYS B CG  1 
ATOM   4002  N  N   . ALA B  1 205 ? -12.435 30.807  -2.421  1.00 30.70 ? 206  ALA B N   1 
ATOM   4003  C  CA  . ALA B  1 205 ? -11.419 31.871  -2.407  1.00 29.10 ? 206  ALA B CA  1 
ATOM   4004  C  C   . ALA B  1 205 ? -10.771 32.042  -3.767  1.00 28.53 ? 206  ALA B C   1 
ATOM   4005  O  O   . ALA B  1 205 ? -10.415 33.152  -4.144  1.00 29.92 ? 206  ALA B O   1 
ATOM   4006  C  CB  . ALA B  1 205 ? -10.346 31.614  -1.331  1.00 26.18 ? 206  ALA B CB  1 
ATOM   4007  N  N   . SER B  1 206 ? -10.566 30.939  -4.485  1.00 29.21 ? 207  SER B N   1 
ATOM   4008  C  CA  . SER B  1 206 ? -9.966  30.995  -5.818  1.00 28.81 ? 207  SER B CA  1 
ATOM   4009  C  C   . SER B  1 206 ? -10.487 29.849  -6.684  1.00 31.27 ? 207  SER B C   1 
ATOM   4010  O  O   . SER B  1 206 ? -9.848  28.783  -6.753  1.00 31.73 ? 207  SER B O   1 
ATOM   4011  C  CB  . SER B  1 206 ? -8.432  30.916  -5.746  1.00 27.71 ? 207  SER B CB  1 
ATOM   4012  O  OG  . SER B  1 206 ? -7.891  31.072  -7.042  1.00 24.38 ? 207  SER B OG  1 
ATOM   4013  N  N   . PRO B  1 207 ? -11.639 30.066  -7.359  1.00 32.91 ? 208  PRO B N   1 
ATOM   4014  C  CA  . PRO B  1 207 ? -12.262 29.005  -8.180  1.00 32.68 ? 208  PRO B CA  1 
ATOM   4015  C  C   . PRO B  1 207 ? -11.333 28.398  -9.254  1.00 31.19 ? 208  PRO B C   1 
ATOM   4016  O  O   . PRO B  1 207 ? -11.432 27.214  -9.549  1.00 30.48 ? 208  PRO B O   1 
ATOM   4017  C  CB  . PRO B  1 207 ? -13.475 29.713  -8.837  1.00 33.52 ? 208  PRO B CB  1 
ATOM   4018  C  CG  . PRO B  1 207 ? -13.767 30.914  -7.992  1.00 33.59 ? 208  PRO B CG  1 
ATOM   4019  C  CD  . PRO B  1 207 ? -12.451 31.308  -7.327  1.00 33.53 ? 208  PRO B CD  1 
ATOM   4020  N  N   . ASP B  1 208 ? -10.436 29.214  -9.797  1.00 32.24 ? 209  ASP B N   1 
ATOM   4021  C  CA  . ASP B  1 208 ? -9.489  28.825  -10.847 1.00 33.06 ? 209  ASP B CA  1 
ATOM   4022  C  C   . ASP B  1 208 ? -8.246  28.072  -10.329 1.00 31.88 ? 209  ASP B C   1 
ATOM   4023  O  O   . ASP B  1 208 ? -7.421  27.602  -11.124 1.00 32.43 ? 209  ASP B O   1 
ATOM   4024  C  CB  . ASP B  1 208 ? -9.035  30.097  -11.571 1.00 35.62 ? 209  ASP B CB  1 
ATOM   4025  C  CG  . ASP B  1 208 ? -8.354  29.829  -12.910 1.00 46.46 ? 209  ASP B CG  1 
ATOM   4026  O  OD1 . ASP B  1 208 ? -8.835  28.968  -13.684 1.00 52.94 ? 209  ASP B OD1 1 
ATOM   4027  O  OD2 . ASP B  1 208 ? -7.334  30.516  -13.189 1.00 57.33 ? 209  ASP B OD2 1 
ATOM   4028  N  N   . GLY B  1 209 ? -8.111  27.936  -9.014  1.00 29.30 ? 210  GLY B N   1 
ATOM   4029  C  CA  . GLY B  1 209 ? -6.976  27.225  -8.427  1.00 28.54 ? 210  GLY B CA  1 
ATOM   4030  C  C   . GLY B  1 209 ? -5.842  28.157  -8.041  1.00 26.15 ? 210  GLY B C   1 
ATOM   4031  O  O   . GLY B  1 209 ? -5.967  29.371  -8.161  1.00 23.55 ? 210  GLY B O   1 
ATOM   4032  N  N   . TYR B  1 210 ? -4.725  27.567  -7.602  1.00 26.23 ? 211  TYR B N   1 
ATOM   4033  C  CA  . TYR B  1 210 ? -3.570  28.302  -7.092  1.00 23.35 ? 211  TYR B CA  1 
ATOM   4034  C  C   . TYR B  1 210 ? -2.300  28.076  -7.931  1.00 23.09 ? 211  TYR B C   1 
ATOM   4035  O  O   . TYR B  1 210 ? -1.963  26.950  -8.311  1.00 21.77 ? 211  TYR B O   1 
ATOM   4036  C  CB  . TYR B  1 210 ? -3.351  27.922  -5.614  1.00 22.26 ? 211  TYR B CB  1 
ATOM   4037  C  CG  . TYR B  1 210 ? -4.543  28.273  -4.762  1.00 24.05 ? 211  TYR B CG  1 
ATOM   4038  C  CD1 . TYR B  1 210 ? -4.656  29.531  -4.187  1.00 25.71 ? 211  TYR B CD1 1 
ATOM   4039  C  CD2 . TYR B  1 210 ? -5.592  27.381  -4.585  1.00 23.20 ? 211  TYR B CD2 1 
ATOM   4040  C  CE1 . TYR B  1 210 ? -5.753  29.880  -3.435  1.00 24.73 ? 211  TYR B CE1 1 
ATOM   4041  C  CE2 . TYR B  1 210 ? -6.710  27.722  -3.831  1.00 22.69 ? 211  TYR B CE2 1 
ATOM   4042  C  CZ  . TYR B  1 210 ? -6.787  28.979  -3.247  1.00 27.42 ? 211  TYR B CZ  1 
ATOM   4043  O  OH  . TYR B  1 210 ? -7.892  29.363  -2.499  1.00 24.12 ? 211  TYR B OH  1 
ATOM   4044  N  N   . ASP B  1 211 ? -1.593  29.159  -8.234  1.00 22.41 ? 212  ASP B N   1 
ATOM   4045  C  CA  . ASP B  1 211 ? -0.356  29.047  -9.004  1.00 22.03 ? 212  ASP B CA  1 
ATOM   4046  C  C   . ASP B  1 211 ? 0.774   28.638  -8.082  1.00 21.77 ? 212  ASP B C   1 
ATOM   4047  O  O   . ASP B  1 211 ? 1.649   27.867  -8.464  1.00 19.26 ? 212  ASP B O   1 
ATOM   4048  C  CB  . ASP B  1 211 ? 0.008   30.367  -9.659  1.00 23.16 ? 212  ASP B CB  1 
ATOM   4049  C  CG  . ASP B  1 211 ? -1.038  30.847  -10.630 1.00 24.35 ? 212  ASP B CG  1 
ATOM   4050  O  OD1 . ASP B  1 211 ? -1.096  30.310  -11.759 1.00 23.60 ? 212  ASP B OD1 1 
ATOM   4051  O  OD2 . ASP B  1 211 ? -1.782  31.785  -10.259 1.00 28.38 ? 212  ASP B OD2 1 
ATOM   4052  N  N   . CYS B  1 212 ? 0.743   29.174  -6.863  1.00 21.43 ? 213  CYS B N   1 
ATOM   4053  C  CA  . CYS B  1 212 ? 1.834   29.030  -5.917  1.00 21.06 ? 213  CYS B CA  1 
ATOM   4054  C  C   . CYS B  1 212 ? 1.321   28.718  -4.547  1.00 20.05 ? 213  CYS B C   1 
ATOM   4055  O  O   . CYS B  1 212 ? 0.335   29.302  -4.105  1.00 19.96 ? 213  CYS B O   1 
ATOM   4056  C  CB  . CYS B  1 212 ? 2.610   30.348  -5.799  1.00 22.49 ? 213  CYS B CB  1 
ATOM   4057  S  SG  . CYS B  1 212 ? 3.380   30.913  -7.295  1.00 23.40 ? 213  CYS B SG  1 
ATOM   4058  N  N   . TYR B  1 213 ? 2.034   27.856  -3.844  1.00 19.07 ? 214  TYR B N   1 
ATOM   4059  C  CA  . TYR B  1 213 ? 1.718   27.547  -2.459  1.00 18.09 ? 214  TYR B CA  1 
ATOM   4060  C  C   . TYR B  1 213 ? 2.983   27.748  -1.637  1.00 16.95 ? 214  TYR B C   1 
ATOM   4061  O  O   . TYR B  1 213 ? 4.002   27.126  -1.901  1.00 17.97 ? 214  TYR B O   1 
ATOM   4062  C  CB  . TYR B  1 213 ? 1.237   26.098  -2.380  1.00 17.04 ? 214  TYR B CB  1 
ATOM   4063  C  CG  . TYR B  1 213 ? 0.853   25.555  -1.009  1.00 17.80 ? 214  TYR B CG  1 
ATOM   4064  C  CD1 . TYR B  1 213 ? 0.278   26.363  -0.038  1.00 16.38 ? 214  TYR B CD1 1 
ATOM   4065  C  CD2 . TYR B  1 213 ? 1.013   24.197  -0.720  1.00 16.33 ? 214  TYR B CD2 1 
ATOM   4066  C  CE1 . TYR B  1 213 ? -0.100  25.834  1.190   1.00 16.26 ? 214  TYR B CE1 1 
ATOM   4067  C  CE2 . TYR B  1 213 ? 0.639   23.671  0.497   1.00 15.57 ? 214  TYR B CE2 1 
ATOM   4068  C  CZ  . TYR B  1 213 ? 0.083   24.491  1.450   1.00 12.42 ? 214  TYR B CZ  1 
ATOM   4069  O  OH  . TYR B  1 213 ? -0.288  23.948  2.670   1.00 17.10 ? 214  TYR B OH  1 
ATOM   4070  N  N   . PHE B  1 214 ? 2.931   28.653  -0.683  1.00 17.38 ? 215  PHE B N   1 
ATOM   4071  C  CA  . PHE B  1 214 ? 4.029   28.837  0.306   1.00 19.52 ? 215  PHE B CA  1 
ATOM   4072  C  C   . PHE B  1 214 ? 3.589   28.152  1.572   1.00 17.30 ? 215  PHE B C   1 
ATOM   4073  O  O   . PHE B  1 214 ? 2.666   28.616  2.248   1.00 16.08 ? 215  PHE B O   1 
ATOM   4074  C  CB  . PHE B  1 214 ? 4.317   30.326  0.560   1.00 15.35 ? 215  PHE B CB  1 
ATOM   4075  C  CG  . PHE B  1 214 ? 5.551   30.580  1.333   1.00 16.27 ? 215  PHE B CG  1 
ATOM   4076  C  CD1 . PHE B  1 214 ? 5.633   30.258  2.670   1.00 14.91 ? 215  PHE B CD1 1 
ATOM   4077  C  CD2 . PHE B  1 214 ? 6.661   31.157  0.721   1.00 18.55 ? 215  PHE B CD2 1 
ATOM   4078  C  CE1 . PHE B  1 214 ? 6.786   30.498  3.388   1.00 16.24 ? 215  PHE B CE1 1 
ATOM   4079  C  CE2 . PHE B  1 214 ? 7.834   31.382  1.437   1.00 15.04 ? 215  PHE B CE2 1 
ATOM   4080  C  CZ  . PHE B  1 214 ? 7.897   31.068  2.756   1.00 15.27 ? 215  PHE B CZ  1 
ATOM   4081  N  N   . ASP B  1 215 ? 4.261   27.052  1.901   1.00 17.94 ? 216  ASP B N   1 
ATOM   4082  C  CA  . ASP B  1 215 ? 3.727   26.123  2.883   1.00 17.50 ? 216  ASP B CA  1 
ATOM   4083  C  C   . ASP B  1 215 ? 4.563   26.121  4.164   1.00 17.89 ? 216  ASP B C   1 
ATOM   4084  O  O   . ASP B  1 215 ? 5.739   25.716  4.154   1.00 15.77 ? 216  ASP B O   1 
ATOM   4085  C  CB  . ASP B  1 215 ? 3.610   24.724  2.263   1.00 16.03 ? 216  ASP B CB  1 
ATOM   4086  C  CG  . ASP B  1 215 ? 3.057   23.701  3.214   1.00 19.78 ? 216  ASP B CG  1 
ATOM   4087  O  OD1 . ASP B  1 215 ? 2.465   24.115  4.246   1.00 15.76 ? 216  ASP B OD1 1 
ATOM   4088  O  OD2 . ASP B  1 215 ? 3.231   22.478  2.932   1.00 20.00 ? 216  ASP B OD2 1 
ATOM   4089  N  N   . ASN B  1 216 ? 3.913   26.578  5.253   1.00 13.95 ? 217  ASN B N   1 
ATOM   4090  C  CA  . ASN B  1 216 ? 4.468   26.612  6.600   1.00 15.68 ? 217  ASN B CA  1 
ATOM   4091  C  C   . ASN B  1 216 ? 3.972   25.486  7.536   1.00 16.43 ? 217  ASN B C   1 
ATOM   4092  O  O   . ASN B  1 216 ? 4.490   25.327  8.670   1.00 16.07 ? 217  ASN B O   1 
ATOM   4093  C  CB  . ASN B  1 216 ? 4.111   27.956  7.243   1.00 16.77 ? 217  ASN B CB  1 
ATOM   4094  C  CG  . ASN B  1 216 ? 4.849   29.114  6.618   1.00 15.52 ? 217  ASN B CG  1 
ATOM   4095  O  OD1 . ASN B  1 216 ? 6.074   29.081  6.486   1.00 19.43 ? 217  ASN B OD1 1 
ATOM   4096  N  ND2 . ASN B  1 216 ? 4.123   30.148  6.244   1.00 15.44 ? 217  ASN B ND2 1 
ATOM   4097  N  N   . VAL B  1 217 ? 2.983   24.714  7.062   1.00 16.64 ? 218  VAL B N   1 
ATOM   4098  C  CA  . VAL B  1 217 ? 2.126   23.882  7.936   1.00 16.25 ? 218  VAL B CA  1 
ATOM   4099  C  C   . VAL B  1 217 ? 2.220   22.391  7.624   1.00 15.38 ? 218  VAL B C   1 
ATOM   4100  O  O   . VAL B  1 217 ? 2.320   21.579  8.529   1.00 16.32 ? 218  VAL B O   1 
ATOM   4101  C  CB  . VAL B  1 217 ? 0.648   24.321  7.833   1.00 17.11 ? 218  VAL B CB  1 
ATOM   4102  C  CG1 . VAL B  1 217 ? -0.285  23.326  8.552   1.00 13.21 ? 218  VAL B CG1 1 
ATOM   4103  C  CG2 . VAL B  1 217 ? 0.466   25.754  8.380   1.00 15.21 ? 218  VAL B CG2 1 
ATOM   4104  N  N   . GLY B  1 218 ? 2.170   22.026  6.352   1.00 16.74 ? 219  GLY B N   1 
ATOM   4105  C  CA  . GLY B  1 218 ? 2.255   20.602  5.962   1.00 17.51 ? 219  GLY B CA  1 
ATOM   4106  C  C   . GLY B  1 218 ? 1.019   19.785  6.344   1.00 16.98 ? 219  GLY B C   1 
ATOM   4107  O  O   . GLY B  1 218 ? -0.076  20.325  6.594   1.00 15.87 ? 219  GLY B O   1 
ATOM   4108  N  N   . GLY B  1 219 ? 1.206   18.484  6.377   1.00 16.69 ? 220  GLY B N   1 
ATOM   4109  C  CA  . GLY B  1 219 ? 0.142   17.545  6.717   1.00 19.79 ? 220  GLY B CA  1 
ATOM   4110  C  C   . GLY B  1 219 ? -1.117  17.634  5.883   1.00 18.85 ? 220  GLY B C   1 
ATOM   4111  O  O   . GLY B  1 219 ? -1.110  17.994  4.698   1.00 19.15 ? 220  GLY B O   1 
ATOM   4112  N  N   . GLU B  1 220 ? -2.215  17.337  6.556   1.00 20.34 ? 221  GLU B N   1 
ATOM   4113  C  CA  . GLU B  1 220 ? -3.543  17.250  5.961   1.00 23.12 ? 221  GLU B CA  1 
ATOM   4114  C  C   . GLU B  1 220 ? -3.917  18.578  5.306   1.00 19.92 ? 221  GLU B C   1 
ATOM   4115  O  O   . GLU B  1 220 ? -4.544  18.610  4.218   1.00 19.67 ? 221  GLU B O   1 
ATOM   4116  C  CB  . GLU B  1 220 ? -4.557  16.875  7.067   1.00 25.16 ? 221  GLU B CB  1 
ATOM   4117  C  CG  . GLU B  1 220 ? -5.417  15.594  6.939   1.00 34.72 ? 221  GLU B CG  1 
ATOM   4118  C  CD  . GLU B  1 220 ? -4.824  14.406  6.193   1.00 35.85 ? 221  GLU B CD  1 
ATOM   4119  O  OE1 . GLU B  1 220 ? -4.650  14.481  4.968   1.00 38.20 ? 221  GLU B OE1 1 
ATOM   4120  O  OE2 . GLU B  1 220 ? -4.597  13.357  6.826   1.00 42.92 ? 221  GLU B OE2 1 
ATOM   4121  N  N   . PHE B  1 221 ? -3.537  19.686  5.936   1.00 18.26 ? 222  PHE B N   1 
ATOM   4122  C  CA  . PHE B  1 221 ? -3.805  20.997  5.322   1.00 17.83 ? 222  PHE B CA  1 
ATOM   4123  C  C   . PHE B  1 221 ? -3.181  21.055  3.930   1.00 15.85 ? 222  PHE B C   1 
ATOM   4124  O  O   . PHE B  1 221 ? -3.827  21.432  2.976   1.00 15.54 ? 222  PHE B O   1 
ATOM   4125  C  CB  . PHE B  1 221 ? -3.280  22.148  6.191   1.00 20.31 ? 222  PHE B CB  1 
ATOM   4126  C  CG  . PHE B  1 221 ? -3.770  23.513  5.771   1.00 16.84 ? 222  PHE B CG  1 
ATOM   4127  C  CD1 . PHE B  1 221 ? -3.307  24.105  4.629   1.00 19.01 ? 222  PHE B CD1 1 
ATOM   4128  C  CD2 . PHE B  1 221 ? -4.677  24.212  6.557   1.00 23.94 ? 222  PHE B CD2 1 
ATOM   4129  C  CE1 . PHE B  1 221 ? -3.734  25.375  4.250   1.00 19.44 ? 222  PHE B CE1 1 
ATOM   4130  C  CE2 . PHE B  1 221 ? -5.120  25.479  6.177   1.00 20.72 ? 222  PHE B CE2 1 
ATOM   4131  C  CZ  . PHE B  1 221 ? -4.644  26.049  5.015   1.00 20.57 ? 222  PHE B CZ  1 
ATOM   4132  N  N   . SER B  1 222 ? -1.929  20.654  3.795   1.00 17.46 ? 223  SER B N   1 
ATOM   4133  C  CA  . SER B  1 222 ? -1.283  20.722  2.464   1.00 18.86 ? 223  SER B CA  1 
ATOM   4134  C  C   . SER B  1 222 ? -1.868  19.741  1.419   1.00 18.52 ? 223  SER B C   1 
ATOM   4135  O  O   . SER B  1 222 ? -1.994  20.072  0.233   1.00 19.17 ? 223  SER B O   1 
ATOM   4136  C  CB  . SER B  1 222 ? 0.225   20.591  2.604   1.00 17.15 ? 223  SER B CB  1 
ATOM   4137  O  OG  . SER B  1 222 ? 0.716   21.690  3.356   1.00 16.51 ? 223  SER B OG  1 
ATOM   4138  N  N   . ASN B  1 223 ? -2.245  18.557  1.868   1.00 18.15 ? 224  ASN B N   1 
ATOM   4139  C  CA  . ASN B  1 223 ? -2.993  17.610  1.029   1.00 19.48 ? 224  ASN B CA  1 
ATOM   4140  C  C   . ASN B  1 223 ? -4.179  18.267  0.371   1.00 18.99 ? 224  ASN B C   1 
ATOM   4141  O  O   . ASN B  1 223 ? -4.349  18.136  -0.825  1.00 19.41 ? 224  ASN B O   1 
ATOM   4142  C  CB  . ASN B  1 223 ? -3.404  16.370  1.826   1.00 16.79 ? 224  ASN B CB  1 
ATOM   4143  C  CG  . ASN B  1 223 ? -2.207  15.538  2.216   1.00 20.20 ? 224  ASN B CG  1 
ATOM   4144  O  OD1 . ASN B  1 223 ? -1.113  15.737  1.676   1.00 19.98 ? 224  ASN B OD1 1 
ATOM   4145  N  ND2 . ASN B  1 223 ? -2.376  14.648  3.187   1.00 18.24 ? 224  ASN B ND2 1 
ATOM   4146  N  N   . THR B  1 224 ? -4.935  19.057  1.129   1.00 19.55 ? 225  THR B N   1 
ATOM   4147  C  CA  . THR B  1 224 ? -6.107  19.736  0.569   1.00 19.66 ? 225  THR B CA  1 
ATOM   4148  C  C   . THR B  1 224 ? -5.705  20.800  -0.431  1.00 20.05 ? 225  THR B C   1 
ATOM   4149  O  O   . THR B  1 224 ? -6.291  20.901  -1.513  1.00 20.96 ? 225  THR B O   1 
ATOM   4150  C  CB  . THR B  1 224 ? -7.019  20.366  1.675   1.00 20.27 ? 225  THR B CB  1 
ATOM   4151  O  OG1 . THR B  1 224 ? -7.413  19.351  2.591   1.00 18.58 ? 225  THR B OG1 1 
ATOM   4152  C  CG2 . THR B  1 224 ? -8.273  21.019  1.052   1.00 15.73 ? 225  THR B CG2 1 
ATOM   4153  N  N   . VAL B  1 225 ? -4.709  21.602  -0.076  1.00 19.61 ? 226  VAL B N   1 
ATOM   4154  C  CA  . VAL B  1 225 ? -4.181  22.610  -1.008  1.00 17.59 ? 226  VAL B CA  1 
ATOM   4155  C  C   . VAL B  1 225 ? -3.665  21.985  -2.288  1.00 17.52 ? 226  VAL B C   1 
ATOM   4156  O  O   . VAL B  1 225 ? -3.833  22.546  -3.369  1.00 19.74 ? 226  VAL B O   1 
ATOM   4157  C  CB  . VAL B  1 225 ? -3.055  23.462  -0.361  1.00 19.03 ? 226  VAL B CB  1 
ATOM   4158  C  CG1 . VAL B  1 225 ? -2.429  24.432  -1.361  1.00 11.90 ? 226  VAL B CG1 1 
ATOM   4159  C  CG2 . VAL B  1 225 ? -3.604  24.237  0.822   1.00 18.85 ? 226  VAL B CG2 1 
ATOM   4160  N  N   . ILE B  1 226 ? -3.007  20.837  -2.187  1.00 19.44 ? 227  ILE B N   1 
ATOM   4161  C  CA  . ILE B  1 226 ? -2.400  20.214  -3.369  1.00 19.38 ? 227  ILE B CA  1 
ATOM   4162  C  C   . ILE B  1 226 ? -3.503  19.859  -4.376  1.00 19.71 ? 227  ILE B C   1 
ATOM   4163  O  O   . ILE B  1 226 ? -3.329  19.980  -5.598  1.00 17.28 ? 227  ILE B O   1 
ATOM   4164  C  CB  . ILE B  1 226 ? -1.486  19.012  -2.981  1.00 19.38 ? 227  ILE B CB  1 
ATOM   4165  C  CG1 . ILE B  1 226 ? -0.123  19.530  -2.543  1.00 23.29 ? 227  ILE B CG1 1 
ATOM   4166  C  CG2 . ILE B  1 226 ? -1.251  18.099  -4.129  1.00 18.28 ? 227  ILE B CG2 1 
ATOM   4167  C  CD1 . ILE B  1 226 ? 0.670   18.523  -1.705  1.00 26.65 ? 227  ILE B CD1 1 
ATOM   4168  N  N   . GLY B  1 227 ? -4.669  19.509  -3.847  1.00 20.51 ? 228  GLY B N   1 
ATOM   4169  C  CA  . GLY B  1 227 ? -5.838  19.263  -4.672  1.00 20.69 ? 228  GLY B CA  1 
ATOM   4170  C  C   . GLY B  1 227 ? -6.393  20.485  -5.381  1.00 22.17 ? 228  GLY B C   1 
ATOM   4171  O  O   . GLY B  1 227 ? -7.222  20.342  -6.258  1.00 23.26 ? 228  GLY B O   1 
ATOM   4172  N  N   . GLN B  1 228 ? -5.933  21.685  -5.048  1.00 20.98 ? 229  GLN B N   1 
ATOM   4173  C  CA  . GLN B  1 228 ? -6.362  22.869  -5.792  1.00 23.16 ? 229  GLN B CA  1 
ATOM   4174  C  C   . GLN B  1 228 ? -5.211  23.629  -6.497  1.00 21.42 ? 229  GLN B C   1 
ATOM   4175  O  O   . GLN B  1 228 ? -5.399  24.739  -7.018  1.00 19.17 ? 229  GLN B O   1 
ATOM   4176  C  CB  . GLN B  1 228 ? -7.178  23.782  -4.867  1.00 23.20 ? 229  GLN B CB  1 
ATOM   4177  C  CG  . GLN B  1 228 ? -8.459  23.051  -4.342  1.00 31.97 ? 229  GLN B CG  1 
ATOM   4178  C  CD  . GLN B  1 228 ? -9.458  23.977  -3.692  1.00 37.62 ? 229  GLN B CD  1 
ATOM   4179  O  OE1 . GLN B  1 228 ? -9.540  25.164  -4.031  1.00 37.88 ? 229  GLN B OE1 1 
ATOM   4180  N  NE2 . GLN B  1 228 ? -10.217 23.447  -2.742  1.00 40.54 ? 229  GLN B NE2 1 
ATOM   4181  N  N   . MET B  1 229 ? -4.037  23.017  -6.569  1.00 21.36 ? 230  MET B N   1 
ATOM   4182  C  CA  . MET B  1 229 ? -2.938  23.623  -7.346  1.00 20.63 ? 230  MET B CA  1 
ATOM   4183  C  C   . MET B  1 229 ? -3.229  23.502  -8.837  1.00 21.20 ? 230  MET B C   1 
ATOM   4184  O  O   . MET B  1 229 ? -3.720  22.464  -9.295  1.00 18.67 ? 230  MET B O   1 
ATOM   4185  C  CB  . MET B  1 229 ? -1.629  22.942  -7.018  1.00 21.25 ? 230  MET B CB  1 
ATOM   4186  C  CG  . MET B  1 229 ? -1.162  23.141  -5.572  1.00 20.61 ? 230  MET B CG  1 
ATOM   4187  S  SD  . MET B  1 229 ? -0.890  24.861  -5.120  1.00 17.39 ? 230  MET B SD  1 
ATOM   4188  C  CE  . MET B  1 229 ? 0.402   25.374  -6.226  1.00 13.86 ? 230  MET B CE  1 
ATOM   4189  N  N   . LYS B  1 230 ? -2.951  24.577  -9.576  1.00 22.43 ? 231  LYS B N   1 
ATOM   4190  C  CA  . LYS B  1 230 ? -3.007  24.558  -11.024 1.00 23.22 ? 231  LYS B CA  1 
ATOM   4191  C  C   . LYS B  1 230 ? -1.877  23.672  -11.587 1.00 22.83 ? 231  LYS B C   1 
ATOM   4192  O  O   . LYS B  1 230 ? -0.970  23.273  -10.860 1.00 18.96 ? 231  LYS B O   1 
ATOM   4193  C  CB  . LYS B  1 230 ? -2.824  25.952  -11.603 1.00 23.26 ? 231  LYS B CB  1 
ATOM   4194  C  CG  . LYS B  1 230 ? -3.892  27.019  -11.273 1.00 31.52 ? 231  LYS B CG  1 
ATOM   4195  C  CD  . LYS B  1 230 ? -3.937  28.028  -12.445 1.00 37.83 ? 231  LYS B CD  1 
ATOM   4196  C  CE  . LYS B  1 230 ? -4.179  29.448  -12.030 1.00 44.00 ? 231  LYS B CE  1 
ATOM   4197  N  NZ  . LYS B  1 230 ? -3.868  30.348  -13.202 1.00 41.26 ? 231  LYS B NZ  1 
ATOM   4198  N  N   . LYS B  1 231 ? -1.953  23.385  -12.888 1.00 22.54 ? 232  LYS B N   1 
ATOM   4199  C  CA  . LYS B  1 231 ? -0.970  22.550  -13.567 1.00 23.19 ? 232  LYS B CA  1 
ATOM   4200  C  C   . LYS B  1 231 ? 0.384   23.228  -13.528 1.00 21.43 ? 232  LYS B C   1 
ATOM   4201  O  O   . LYS B  1 231 ? 0.468   24.422  -13.750 1.00 23.74 ? 232  LYS B O   1 
ATOM   4202  C  CB  . LYS B  1 231 ? -1.400  22.321  -15.018 1.00 25.62 ? 232  LYS B CB  1 
ATOM   4203  C  CG  . LYS B  1 231 ? -0.538  21.311  -15.804 1.00 33.00 ? 232  LYS B CG  1 
ATOM   4204  C  CD  . LYS B  1 231 ? -1.352  20.561  -16.848 1.00 38.70 ? 232  LYS B CD  1 
ATOM   4205  C  CE  . LYS B  1 231 ? -0.540  19.481  -17.573 1.00 43.47 ? 232  LYS B CE  1 
ATOM   4206  N  NZ  . LYS B  1 231 ? -0.782  18.089  -17.013 1.00 43.64 ? 232  LYS B NZ  1 
ATOM   4207  N  N   . PHE B  1 232 ? 1.439   22.469  -13.253 1.00 19.83 ? 233  PHE B N   1 
ATOM   4208  C  CA  . PHE B  1 232 ? 2.774   23.018  -13.039 1.00 18.08 ? 233  PHE B CA  1 
ATOM   4209  C  C   . PHE B  1 232 ? 2.828   24.002  -11.875 1.00 19.10 ? 233  PHE B C   1 
ATOM   4210  O  O   . PHE B  1 232 ? 3.706   24.842  -11.828 1.00 19.90 ? 233  PHE B O   1 
ATOM   4211  C  CB  . PHE B  1 232 ? 3.320   23.724  -14.284 1.00 19.71 ? 233  PHE B CB  1 
ATOM   4212  C  CG  . PHE B  1 232 ? 3.115   22.963  -15.568 1.00 23.61 ? 233  PHE B CG  1 
ATOM   4213  C  CD1 . PHE B  1 232 ? 3.672   21.698  -15.743 1.00 22.34 ? 233  PHE B CD1 1 
ATOM   4214  C  CD2 . PHE B  1 232 ? 2.410   23.535  -16.621 1.00 26.46 ? 233  PHE B CD2 1 
ATOM   4215  C  CE1 . PHE B  1 232 ? 3.499   20.993  -16.939 1.00 24.56 ? 233  PHE B CE1 1 
ATOM   4216  C  CE2 . PHE B  1 232 ? 2.224   22.833  -17.812 1.00 29.50 ? 233  PHE B CE2 1 
ATOM   4217  C  CZ  . PHE B  1 232 ? 2.779   21.568  -17.968 1.00 26.52 ? 233  PHE B CZ  1 
ATOM   4218  N  N   . GLY B  1 233 ? 1.902   23.904  -10.930 1.00 21.22 ? 234  GLY B N   1 
ATOM   4219  C  CA  . GLY B  1 233 ? 1.946   24.758  -9.750  1.00 20.21 ? 234  GLY B CA  1 
ATOM   4220  C  C   . GLY B  1 233 ? 3.223   24.544  -8.946  1.00 18.41 ? 234  GLY B C   1 
ATOM   4221  O  O   . GLY B  1 233 ? 3.780   23.457  -8.921  1.00 15.71 ? 234  GLY B O   1 
ATOM   4222  N  N   . ARG B  1 234 ? 3.650   25.573  -8.237  1.00 17.85 ? 235  ARG B N   1 
ATOM   4223  C  CA  . ARG B  1 234 ? 4.906   25.524  -7.524  1.00 17.90 ? 235  ARG B CA  1 
ATOM   4224  C  C   . ARG B  1 234 ? 4.656   25.626  -6.044  1.00 18.38 ? 235  ARG B C   1 
ATOM   4225  O  O   . ARG B  1 234 ? 4.042   26.584  -5.579  1.00 19.73 ? 235  ARG B O   1 
ATOM   4226  C  CB  . ARG B  1 234 ? 5.767   26.666  -7.975  1.00 17.06 ? 235  ARG B CB  1 
ATOM   4227  C  CG  . ARG B  1 234 ? 6.168   26.588  -9.449  1.00 23.65 ? 235  ARG B CG  1 
ATOM   4228  C  CD  . ARG B  1 234 ? 6.314   28.001  -10.023 1.00 38.62 ? 235  ARG B CD  1 
ATOM   4229  N  NE  . ARG B  1 234 ? 5.047   28.515  -10.551 1.00 46.01 ? 235  ARG B NE  1 
ATOM   4230  C  CZ  . ARG B  1 234 ? 4.754   29.800  -10.787 1.00 47.39 ? 235  ARG B CZ  1 
ATOM   4231  N  NH1 . ARG B  1 234 ? 5.614   30.791  -10.519 1.00 44.51 ? 235  ARG B NH1 1 
ATOM   4232  N  NH2 . ARG B  1 234 ? 3.564   30.096  -11.294 1.00 47.28 ? 235  ARG B NH2 1 
ATOM   4233  N  N   . ILE B  1 235 ? 5.120   24.624  -5.305  1.00 16.77 ? 236  ILE B N   1 
ATOM   4234  C  CA  . ILE B  1 235 ? 5.041   24.633  -3.867  1.00 17.40 ? 236  ILE B CA  1 
ATOM   4235  C  C   . ILE B  1 235 ? 6.413   24.900  -3.259  1.00 17.25 ? 236  ILE B C   1 
ATOM   4236  O  O   . ILE B  1 235 ? 7.379   24.197  -3.570  1.00 17.85 ? 236  ILE B O   1 
ATOM   4237  C  CB  . ILE B  1 235 ? 4.501   23.298  -3.301  1.00 16.23 ? 236  ILE B CB  1 
ATOM   4238  C  CG1 . ILE B  1 235 ? 3.100   23.031  -3.861  1.00 21.18 ? 236  ILE B CG1 1 
ATOM   4239  C  CG2 . ILE B  1 235 ? 4.484   23.355  -1.772  1.00 11.50 ? 236  ILE B CG2 1 
ATOM   4240  C  CD1 . ILE B  1 235 ? 2.558   21.635  -3.560  1.00 20.55 ? 236  ILE B CD1 1 
ATOM   4241  N  N   . ALA B  1 236 ? 6.486   25.905  -2.393  1.00 14.84 ? 237  ALA B N   1 
ATOM   4242  C  CA  . ALA B  1 236 ? 7.680   26.145  -1.620  1.00 16.29 ? 237  ALA B CA  1 
ATOM   4243  C  C   . ALA B  1 236 ? 7.435   25.499  -0.274  1.00 15.50 ? 237  ALA B C   1 
ATOM   4244  O  O   . ALA B  1 236 ? 6.540   25.892  0.444   1.00 16.88 ? 237  ALA B O   1 
ATOM   4245  C  CB  . ALA B  1 236 ? 7.976   27.654  -1.495  1.00 14.00 ? 237  ALA B CB  1 
ATOM   4246  N  N   . ILE B  1 237 ? 8.200   24.454  0.022   1.00 17.02 ? 238  ILE B N   1 
ATOM   4247  C  CA  . ILE B  1 237 ? 8.130   23.733  1.289   1.00 17.75 ? 238  ILE B CA  1 
ATOM   4248  C  C   . ILE B  1 237 ? 9.048   24.410  2.296   1.00 17.46 ? 238  ILE B C   1 
ATOM   4249  O  O   . ILE B  1 237 ? 10.237  24.103  2.366   1.00 14.73 ? 238  ILE B O   1 
ATOM   4250  C  CB  . ILE B  1 237 ? 8.550   22.238  1.135   1.00 16.56 ? 238  ILE B CB  1 
ATOM   4251  C  CG1 . ILE B  1 237 ? 7.649   21.525  0.110   1.00 21.43 ? 238  ILE B CG1 1 
ATOM   4252  C  CG2 . ILE B  1 237 ? 8.524   21.539  2.495   1.00 16.80 ? 238  ILE B CG2 1 
ATOM   4253  C  CD1 . ILE B  1 237 ? 8.034   20.049  -0.197  1.00 15.43 ? 238  ILE B CD1 1 
ATOM   4254  N  N   . CYS B  1 238 ? 8.467   25.315  3.083   1.00 17.38 ? 239  CYS B N   1 
ATOM   4255  C  CA  . CYS B  1 238 ? 9.190   26.116  4.068   1.00 15.40 ? 239  CYS B CA  1 
ATOM   4256  C  C   . CYS B  1 238 ? 9.250   25.451  5.445   1.00 16.12 ? 239  CYS B C   1 
ATOM   4257  O  O   . CYS B  1 238 ? 10.304  25.397  6.119   1.00 13.83 ? 239  CYS B O   1 
ATOM   4258  C  CB  . CYS B  1 238 ? 8.508   27.466  4.179   1.00 17.29 ? 239  CYS B CB  1 
ATOM   4259  S  SG  . CYS B  1 238 ? 9.268   28.565  5.364   1.00 15.75 ? 239  CYS B SG  1 
ATOM   4260  N  N   . GLY B  1 239 ? 8.091   24.978  5.872   1.00 17.38 ? 240  GLY B N   1 
ATOM   4261  C  CA  . GLY B  1 239 ? 7.914   24.383  7.181   1.00 17.33 ? 240  GLY B CA  1 
ATOM   4262  C  C   . GLY B  1 239 ? 6.771   23.392  7.151   1.00 16.23 ? 240  GLY B C   1 
ATOM   4263  O  O   . GLY B  1 239 ? 6.031   23.332  6.168   1.00 15.72 ? 240  GLY B O   1 
ATOM   4264  N  N   . ALA B  1 240 ? 6.638   22.632  8.231   1.00 13.76 ? 241  ALA B N   1 
ATOM   4265  C  CA  . ALA B  1 240 ? 5.599   21.610  8.377   1.00 15.56 ? 241  ALA B CA  1 
ATOM   4266  C  C   . ALA B  1 240 ? 5.118   21.617  9.841   1.00 16.86 ? 241  ALA B C   1 
ATOM   4267  O  O   . ALA B  1 240 ? 5.179   20.580  10.534  1.00 18.63 ? 241  ALA B O   1 
ATOM   4268  C  CB  . ALA B  1 240 ? 6.172   20.250  8.039   1.00 12.49 ? 241  ALA B CB  1 
ATOM   4269  N  N   . ILE B  1 241 ? 4.689   22.786  10.314  1.00 16.65 ? 242  ILE B N   1 
ATOM   4270  C  CA  . ILE B  1 241 ? 4.526   22.993  11.749  1.00 17.74 ? 242  ILE B CA  1 
ATOM   4271  C  C   . ILE B  1 241 ? 3.381   22.111  12.315  1.00 17.96 ? 242  ILE B C   1 
ATOM   4272  O  O   . ILE B  1 241 ? 3.397   21.770  13.487  1.00 18.64 ? 242  ILE B O   1 
ATOM   4273  C  CB  . ILE B  1 241 ? 4.378   24.506  12.117  1.00 17.13 ? 242  ILE B CB  1 
ATOM   4274  C  CG1 . ILE B  1 241 ? 4.573   24.703  13.616  1.00 20.51 ? 242  ILE B CG1 1 
ATOM   4275  C  CG2 . ILE B  1 241 ? 3.009   25.114  11.672  1.00 11.46 ? 242  ILE B CG2 1 
ATOM   4276  C  CD1 . ILE B  1 241 ? 4.604   26.135  14.012  1.00 17.66 ? 242  ILE B CD1 1 
ATOM   4277  N  N   . SER B  1 242 ? 2.430   21.684  11.481  1.00 17.64 ? 243  SER B N   1 
ATOM   4278  C  CA  . SER B  1 242 ? 1.394   20.732  11.965  1.00 18.12 ? 243  SER B CA  1 
ATOM   4279  C  C   . SER B  1 242 ? 1.972   19.408  12.448  1.00 16.85 ? 243  SER B C   1 
ATOM   4280  O  O   . SER B  1 242 ? 1.321   18.683  13.180  1.00 16.71 ? 243  SER B O   1 
ATOM   4281  C  CB  . SER B  1 242 ? 0.348   20.457  10.887  1.00 18.62 ? 243  SER B CB  1 
ATOM   4282  O  OG  . SER B  1 242 ? 0.897   19.704  9.825   1.00 19.07 ? 243  SER B OG  1 
ATOM   4283  N  N   . THR B  1 243 ? 3.201   19.098  12.054  1.00 18.18 ? 244  THR B N   1 
ATOM   4284  C  CA  . THR B  1 243 ? 3.838   17.845  12.398  1.00 15.06 ? 244  THR B CA  1 
ATOM   4285  C  C   . THR B  1 243 ? 4.887   17.937  13.478  1.00 16.87 ? 244  THR B C   1 
ATOM   4286  O  O   . THR B  1 243 ? 5.370   16.894  13.963  1.00 13.55 ? 244  THR B O   1 
ATOM   4287  C  CB  . THR B  1 243 ? 4.577   17.261  11.182  1.00 17.70 ? 244  THR B CB  1 
ATOM   4288  O  OG1 . THR B  1 243 ? 5.687   18.108  10.853  1.00 15.90 ? 244  THR B OG1 1 
ATOM   4289  C  CG2 . THR B  1 243 ? 3.636   17.133  9.964   1.00 15.09 ? 244  THR B CG2 1 
ATOM   4290  N  N   . TYR B  1 244 ? 5.279   19.143  13.877  1.00 18.34 ? 245  TYR B N   1 
ATOM   4291  C  CA  . TYR B  1 244 ? 6.447   19.251  14.785  1.00 18.81 ? 245  TYR B CA  1 
ATOM   4292  C  C   . TYR B  1 244 ? 6.206   18.705  16.179  1.00 18.66 ? 245  TYR B C   1 
ATOM   4293  O  O   . TYR B  1 244 ? 7.151   18.241  16.825  1.00 20.53 ? 245  TYR B O   1 
ATOM   4294  C  CB  . TYR B  1 244 ? 6.924   20.696  14.936  1.00 19.18 ? 245  TYR B CB  1 
ATOM   4295  C  CG  . TYR B  1 244 ? 7.408   21.375  13.686  1.00 17.50 ? 245  TYR B CG  1 
ATOM   4296  C  CD1 . TYR B  1 244 ? 7.651   20.676  12.509  1.00 16.93 ? 245  TYR B CD1 1 
ATOM   4297  C  CD2 . TYR B  1 244 ? 7.680   22.739  13.707  1.00 17.52 ? 245  TYR B CD2 1 
ATOM   4298  C  CE1 . TYR B  1 244 ? 8.100   21.336  11.378  1.00 19.16 ? 245  TYR B CE1 1 
ATOM   4299  C  CE2 . TYR B  1 244 ? 8.123   23.402  12.600  1.00 17.23 ? 245  TYR B CE2 1 
ATOM   4300  C  CZ  . TYR B  1 244 ? 8.347   22.701  11.433  1.00 21.01 ? 245  TYR B CZ  1 
ATOM   4301  O  OH  . TYR B  1 244 ? 8.807   23.395  10.338  1.00 16.75 ? 245  TYR B OH  1 
ATOM   4302  N  N   . ASN B  1 245 ? 4.961   18.764  16.652  1.00 19.34 ? 246  ASN B N   1 
ATOM   4303  C  CA  . ASN B  1 245 ? 4.632   18.287  17.999  1.00 20.76 ? 246  ASN B CA  1 
ATOM   4304  C  C   . ASN B  1 245 ? 3.858   16.941  18.007  1.00 22.92 ? 246  ASN B C   1 
ATOM   4305  O  O   . ASN B  1 245 ? 3.324   16.548  19.037  1.00 22.95 ? 246  ASN B O   1 
ATOM   4306  C  CB  . ASN B  1 245 ? 3.803   19.339  18.749  1.00 19.31 ? 246  ASN B CB  1 
ATOM   4307  C  CG  . ASN B  1 245 ? 4.515   20.642  18.920  1.00 19.44 ? 246  ASN B CG  1 
ATOM   4308  O  OD1 . ASN B  1 245 ? 5.349   20.801  19.829  1.00 18.70 ? 246  ASN B OD1 1 
ATOM   4309  N  ND2 . ASN B  1 245 ? 4.141   21.620  18.103  1.00 18.88 ? 246  ASN B ND2 1 
ATOM   4310  N  N   . ARG B  1 246 ? 3.816   16.247  16.871  1.00 24.97 ? 247  ARG B N   1 
ATOM   4311  C  CA  . ARG B  1 246 ? 3.114   14.961  16.756  1.00 25.23 ? 247  ARG B CA  1 
ATOM   4312  C  C   . ARG B  1 246 ? 3.616   13.915  17.757  1.00 29.67 ? 247  ARG B C   1 
ATOM   4313  O  O   . ARG B  1 246 ? 4.809   13.883  18.111  1.00 29.24 ? 247  ARG B O   1 
ATOM   4314  C  CB  . ARG B  1 246 ? 3.212   14.410  15.321  1.00 21.04 ? 247  ARG B CB  1 
ATOM   4315  C  CG  . ARG B  1 246 ? 4.618   13.830  14.927  1.00 20.28 ? 247  ARG B CG  1 
ATOM   4316  C  CD  . ARG B  1 246 ? 4.679   13.410  13.421  1.00 24.18 ? 247  ARG B CD  1 
ATOM   4317  N  NE  . ARG B  1 246 ? 5.896   12.649  13.142  1.00 29.32 ? 247  ARG B NE  1 
ATOM   4318  C  CZ  . ARG B  1 246 ? 7.094   13.159  12.849  1.00 36.13 ? 247  ARG B CZ  1 
ATOM   4319  N  NH1 . ARG B  1 246 ? 7.304   14.479  12.728  1.00 38.02 ? 247  ARG B NH1 1 
ATOM   4320  N  NH2 . ARG B  1 246 ? 8.103   12.323  12.663  1.00 36.28 ? 247  ARG B NH2 1 
ATOM   4321  N  N   . THR B  1 247 ? 2.691   13.084  18.226  1.00 33.52 ? 248  THR B N   1 
ATOM   4322  C  CA  . THR B  1 247 ? 3.045   11.927  19.061  1.00 38.44 ? 248  THR B CA  1 
ATOM   4323  C  C   . THR B  1 247 ? 2.903   10.597  18.313  1.00 41.79 ? 248  THR B C   1 
ATOM   4324  O  O   . THR B  1 247 ? 3.470   9.588   18.751  1.00 44.48 ? 248  THR B O   1 
ATOM   4325  C  CB  . THR B  1 247 ? 2.242   11.909  20.370  1.00 37.75 ? 248  THR B CB  1 
ATOM   4326  O  OG1 . THR B  1 247 ? 0.835   11.972  20.090  1.00 35.27 ? 248  THR B OG1 1 
ATOM   4327  C  CG2 . THR B  1 247 ? 2.613   13.140  21.200  1.00 40.48 ? 248  THR B CG2 1 
ATOM   4328  N  N   . GLY B  1 248 ? 2.191   10.608  17.177  1.00 40.36 ? 249  GLY B N   1 
ATOM   4329  C  CA  . GLY B  1 248 ? 2.058   9.418   16.328  1.00 39.08 ? 249  GLY B CA  1 
ATOM   4330  C  C   . GLY B  1 248 ? 2.655   9.523   14.924  1.00 36.25 ? 249  GLY B C   1 
ATOM   4331  O  O   . GLY B  1 248 ? 3.455   10.412  14.640  1.00 37.42 ? 249  GLY B O   1 
ATOM   4332  N  N   . PRO B  1 249 ? 2.288   8.589   14.038  1.00 34.58 ? 250  PRO B N   1 
ATOM   4333  C  CA  . PRO B  1 249 ? 2.817   8.625   12.675  1.00 31.53 ? 250  PRO B CA  1 
ATOM   4334  C  C   . PRO B  1 249 ? 2.392   9.864   11.927  1.00 27.41 ? 250  PRO B C   1 
ATOM   4335  O  O   . PRO B  1 249 ? 1.310   10.393  12.164  1.00 26.59 ? 250  PRO B O   1 
ATOM   4336  C  CB  . PRO B  1 249 ? 2.192   7.401   11.981  1.00 32.21 ? 250  PRO B CB  1 
ATOM   4337  C  CG  . PRO B  1 249 ? 1.316   6.712   13.002  1.00 36.20 ? 250  PRO B CG  1 
ATOM   4338  C  CD  . PRO B  1 249 ? 1.587   7.323   14.349  1.00 35.53 ? 250  PRO B CD  1 
ATOM   4339  N  N   . LEU B  1 250 ? 3.237   10.290  11.001  1.00 24.35 ? 251  LEU B N   1 
ATOM   4340  C  CA  . LEU B  1 250 ? 2.904   11.358  10.071  1.00 24.40 ? 251  LEU B CA  1 
ATOM   4341  C  C   . LEU B  1 250 ? 1.612   11.008  9.371   1.00 22.64 ? 251  LEU B C   1 
ATOM   4342  O  O   . LEU B  1 250 ? 1.367   9.846   9.150   1.00 21.54 ? 251  LEU B O   1 
ATOM   4343  C  CB  . LEU B  1 250 ? 4.019   11.487  9.038   1.00 22.89 ? 251  LEU B CB  1 
ATOM   4344  C  CG  . LEU B  1 250 ? 5.266   12.145  9.627   1.00 24.72 ? 251  LEU B CG  1 
ATOM   4345  C  CD1 . LEU B  1 250 ? 6.540   11.856  8.818   1.00 26.50 ? 251  LEU B CD1 1 
ATOM   4346  C  CD2 . LEU B  1 250 ? 4.998   13.649  9.723   1.00 19.59 ? 251  LEU B CD2 1 
ATOM   4347  N  N   . PRO B  1 251 ? 0.795   12.003  9.002   1.00 23.67 ? 252  PRO B N   1 
ATOM   4348  C  CA  . PRO B  1 251 ? -0.383  11.674  8.186   1.00 24.87 ? 252  PRO B CA  1 
ATOM   4349  C  C   . PRO B  1 251 ? -0.007  11.249  6.748   1.00 26.89 ? 252  PRO B C   1 
ATOM   4350  O  O   . PRO B  1 251 ? 1.157   11.382  6.342   1.00 24.86 ? 252  PRO B O   1 
ATOM   4351  C  CB  . PRO B  1 251 ? -1.164  12.985  8.151   1.00 24.85 ? 252  PRO B CB  1 
ATOM   4352  C  CG  . PRO B  1 251 ? -0.132  14.044  8.367   1.00 25.43 ? 252  PRO B CG  1 
ATOM   4353  C  CD  . PRO B  1 251 ? 0.987   13.455  9.149   1.00 23.71 ? 252  PRO B CD  1 
ATOM   4354  N  N   . PRO B  1 252 ? -0.996  10.773  5.973   1.00 27.31 ? 253  PRO B N   1 
ATOM   4355  C  CA  . PRO B  1 252 ? -0.787  10.432  4.577   1.00 27.90 ? 253  PRO B CA  1 
ATOM   4356  C  C   . PRO B  1 252 ? -0.159  11.566  3.784   1.00 28.67 ? 253  PRO B C   1 
ATOM   4357  O  O   . PRO B  1 252 ? -0.473  12.731  4.029   1.00 26.61 ? 253  PRO B O   1 
ATOM   4358  C  CB  . PRO B  1 252 ? -2.208  10.202  4.049   1.00 28.78 ? 253  PRO B CB  1 
ATOM   4359  C  CG  . PRO B  1 252 ? -3.069  10.051  5.218   1.00 29.97 ? 253  PRO B CG  1 
ATOM   4360  C  CD  . PRO B  1 252 ? -2.346  10.427  6.445   1.00 27.26 ? 253  PRO B CD  1 
ATOM   4361  N  N   . GLY B  1 253 ? 0.693   11.225  2.819   1.00 28.61 ? 254  GLY B N   1 
ATOM   4362  C  CA  . GLY B  1 253 ? 1.158   12.203  1.850   1.00 26.56 ? 254  GLY B CA  1 
ATOM   4363  C  C   . GLY B  1 253 ? 0.033   12.588  0.902   1.00 26.73 ? 254  GLY B C   1 
ATOM   4364  O  O   . GLY B  1 253 ? -1.039  12.038  0.963   1.00 25.33 ? 254  GLY B O   1 
ATOM   4365  N  N   . PRO B  1 254 ? 0.273   13.561  0.020   1.00 28.18 ? 255  PRO B N   1 
ATOM   4366  C  CA  . PRO B  1 254 ? -0.748  13.962  -0.943  1.00 29.54 ? 255  PRO B CA  1 
ATOM   4367  C  C   . PRO B  1 254 ? -1.011  12.886  -1.989  1.00 29.92 ? 255  PRO B C   1 
ATOM   4368  O  O   . PRO B  1 254 ? -0.118  12.074  -2.279  1.00 27.18 ? 255  PRO B O   1 
ATOM   4369  C  CB  . PRO B  1 254 ? -0.164  15.206  -1.599  1.00 30.81 ? 255  PRO B CB  1 
ATOM   4370  C  CG  . PRO B  1 254 ? 1.313   15.101  -1.390  1.00 31.75 ? 255  PRO B CG  1 
ATOM   4371  C  CD  . PRO B  1 254 ? 1.578   14.187  -0.232  1.00 30.23 ? 255  PRO B CD  1 
ATOM   4372  N  N   . PRO B  1 255 ? -2.236  12.862  -2.538  1.00 29.79 ? 256  PRO B N   1 
ATOM   4373  C  CA  . PRO B  1 255 ? -2.584  11.804  -3.460  1.00 29.35 ? 256  PRO B CA  1 
ATOM   4374  C  C   . PRO B  1 255 ? -1.678  11.880  -4.703  1.00 26.59 ? 256  PRO B C   1 
ATOM   4375  O  O   . PRO B  1 255 ? -1.563  12.933  -5.300  1.00 22.66 ? 256  PRO B O   1 
ATOM   4376  C  CB  . PRO B  1 255 ? -4.064  12.084  -3.798  1.00 30.67 ? 256  PRO B CB  1 
ATOM   4377  C  CG  . PRO B  1 255 ? -4.505  13.155  -2.860  1.00 32.46 ? 256  PRO B CG  1 
ATOM   4378  C  CD  . PRO B  1 255 ? -3.259  13.922  -2.529  1.00 31.94 ? 256  PRO B CD  1 
ATOM   4379  N  N   . PRO B  1 256 ? -0.976  10.786  -5.029  1.00 25.60 ? 257  PRO B N   1 
ATOM   4380  C  CA  . PRO B  1 256 ? -0.018  10.772  -6.146  1.00 25.86 ? 257  PRO B CA  1 
ATOM   4381  C  C   . PRO B  1 256 ? -0.631  11.082  -7.520  1.00 24.01 ? 257  PRO B C   1 
ATOM   4382  O  O   . PRO B  1 256 ? -0.007  11.758  -8.353  1.00 23.39 ? 257  PRO B O   1 
ATOM   4383  C  CB  . PRO B  1 256 ? 0.525   9.333   -6.115  1.00 25.73 ? 257  PRO B CB  1 
ATOM   4384  C  CG  . PRO B  1 256 ? 0.364   8.893   -4.741  1.00 25.64 ? 257  PRO B CG  1 
ATOM   4385  C  CD  . PRO B  1 256 ? -0.873  9.562   -4.216  1.00 26.80 ? 257  PRO B CD  1 
ATOM   4386  N  N   . GLU B  1 257 ? -1.827  10.564  -7.744  1.00 22.39 ? 258  GLU B N   1 
ATOM   4387  C  CA  . GLU B  1 257 ? -2.600  10.814  -8.960  1.00 25.10 ? 258  GLU B CA  1 
ATOM   4388  C  C   . GLU B  1 257 ? -2.714  12.285  -9.258  1.00 21.12 ? 258  GLU B C   1 
ATOM   4389  O  O   . GLU B  1 257 ? -2.543  12.700  -10.399 1.00 21.05 ? 258  GLU B O   1 
ATOM   4390  C  CB  . GLU B  1 257 ? -4.031  10.286  -8.804  1.00 26.14 ? 258  GLU B CB  1 
ATOM   4391  C  CG  . GLU B  1 257 ? -4.124  8.809   -8.831  1.00 38.62 ? 258  GLU B CG  1 
ATOM   4392  C  CD  . GLU B  1 257 ? -5.475  8.291   -8.359  1.00 41.50 ? 258  GLU B CD  1 
ATOM   4393  O  OE1 . GLU B  1 257 ? -6.496  9.046   -8.421  1.00 41.44 ? 258  GLU B OE1 1 
ATOM   4394  O  OE2 . GLU B  1 257 ? -5.479  7.114   -7.951  1.00 43.25 ? 258  GLU B OE2 1 
ATOM   4395  N  N   . ILE B  1 258 ? -3.019  13.059  -8.223  1.00 19.14 ? 259  ILE B N   1 
ATOM   4396  C  CA  . ILE B  1 258 ? -3.206  14.490  -8.386  1.00 20.56 ? 259  ILE B CA  1 
ATOM   4397  C  C   . ILE B  1 258 ? -1.863  15.146  -8.656  1.00 19.77 ? 259  ILE B C   1 
ATOM   4398  O  O   . ILE B  1 258 ? -1.763  15.972  -9.543  1.00 17.88 ? 259  ILE B O   1 
ATOM   4399  C  CB  . ILE B  1 258 ? -3.862  15.126  -7.165  1.00 21.00 ? 259  ILE B CB  1 
ATOM   4400  C  CG1 . ILE B  1 258 ? -5.235  14.491  -6.937  1.00 25.45 ? 259  ILE B CG1 1 
ATOM   4401  C  CG2 . ILE B  1 258 ? -3.961  16.627  -7.340  1.00 16.07 ? 259  ILE B CG2 1 
ATOM   4402  C  CD1 . ILE B  1 258 ? -5.911  14.974  -5.642  1.00 29.93 ? 259  ILE B CD1 1 
ATOM   4403  N  N   . VAL B  1 259 ? -0.828  14.730  -7.924  1.00 18.96 ? 260  VAL B N   1 
ATOM   4404  C  CA  . VAL B  1 259 ? 0.487   15.350  -8.056  1.00 18.41 ? 260  VAL B CA  1 
ATOM   4405  C  C   . VAL B  1 259 ? 1.038   15.105  -9.457  1.00 17.53 ? 260  VAL B C   1 
ATOM   4406  O  O   . VAL B  1 259 ? 1.606   15.997  -10.061 1.00 17.33 ? 260  VAL B O   1 
ATOM   4407  C  CB  . VAL B  1 259 ? 1.483   14.840  -7.016  1.00 17.28 ? 260  VAL B CB  1 
ATOM   4408  C  CG1 . VAL B  1 259 ? 2.884   15.318  -7.357  1.00 19.30 ? 260  VAL B CG1 1 
ATOM   4409  C  CG2 . VAL B  1 259 ? 1.088   15.330  -5.598  1.00 18.33 ? 260  VAL B CG2 1 
ATOM   4410  N  N   . ILE B  1 260 ? 0.859   13.894  -9.970  1.00 17.35 ? 261  ILE B N   1 
ATOM   4411  C  CA  . ILE B  1 260 ? 1.298   13.578  -11.324 1.00 17.97 ? 261  ILE B CA  1 
ATOM   4412  C  C   . ILE B  1 260 ? 0.431   14.238  -12.394 1.00 17.65 ? 261  ILE B C   1 
ATOM   4413  O  O   . ILE B  1 260 ? 0.948   14.819  -13.331 1.00 18.23 ? 261  ILE B O   1 
ATOM   4414  C  CB  . ILE B  1 260 ? 1.307   12.081  -11.556 1.00 20.56 ? 261  ILE B CB  1 
ATOM   4415  C  CG1 . ILE B  1 260 ? 2.389   11.427  -10.669 1.00 17.94 ? 261  ILE B CG1 1 
ATOM   4416  C  CG2 . ILE B  1 260 ? 1.525   11.786  -13.056 1.00 16.95 ? 261  ILE B CG2 1 
ATOM   4417  C  CD1 . ILE B  1 260 ? 2.067   9.991   -10.341 1.00 14.22 ? 261  ILE B CD1 1 
ATOM   4418  N  N   . TYR B  1 261 ? -0.889  14.157  -12.251 1.00 19.60 ? 262  TYR B N   1 
ATOM   4419  C  CA  . TYR B  1 261 ? -1.789  14.728  -13.254 1.00 21.35 ? 262  TYR B CA  1 
ATOM   4420  C  C   . TYR B  1 261 ? -1.597  16.244  -13.367 1.00 21.03 ? 262  TYR B C   1 
ATOM   4421  O  O   . TYR B  1 261 ? -1.669  16.805  -14.454 1.00 21.18 ? 262  TYR B O   1 
ATOM   4422  C  CB  . TYR B  1 261 ? -3.235  14.420  -12.871 1.00 21.78 ? 262  TYR B CB  1 
ATOM   4423  C  CG  . TYR B  1 261 ? -4.279  14.986  -13.810 1.00 26.84 ? 262  TYR B CG  1 
ATOM   4424  C  CD1 . TYR B  1 261 ? -4.747  16.274  -13.642 1.00 29.83 ? 262  TYR B CD1 1 
ATOM   4425  C  CD2 . TYR B  1 261 ? -4.835  14.217  -14.827 1.00 27.06 ? 262  TYR B CD2 1 
ATOM   4426  C  CE1 . TYR B  1 261 ? -5.703  16.811  -14.465 1.00 26.53 ? 262  TYR B CE1 1 
ATOM   4427  C  CE2 . TYR B  1 261 ? -5.834  14.751  -15.676 1.00 28.26 ? 262  TYR B CE2 1 
ATOM   4428  C  CZ  . TYR B  1 261 ? -6.254  16.053  -15.483 1.00 31.56 ? 262  TYR B CZ  1 
ATOM   4429  O  OH  . TYR B  1 261 ? -7.238  16.622  -16.278 1.00 31.02 ? 262  TYR B OH  1 
ATOM   4430  N  N   . GLN B  1 262 ? -1.359  16.904  -12.234 1.00 18.26 ? 263  GLN B N   1 
ATOM   4431  C  CA  . GLN B  1 262 ? -1.118  18.356  -12.225 1.00 19.18 ? 263  GLN B CA  1 
ATOM   4432  C  C   . GLN B  1 262 ? 0.372   18.731  -12.444 1.00 17.89 ? 263  GLN B C   1 
ATOM   4433  O  O   . GLN B  1 262 ? 0.701   19.894  -12.591 1.00 15.42 ? 263  GLN B O   1 
ATOM   4434  C  CB  . GLN B  1 262 ? -1.664  18.963  -10.934 1.00 18.60 ? 263  GLN B CB  1 
ATOM   4435  C  CG  . GLN B  1 262 ? -3.227  18.921  -10.837 1.00 21.27 ? 263  GLN B CG  1 
ATOM   4436  C  CD  . GLN B  1 262 ? -3.914  19.728  -11.962 1.00 23.54 ? 263  GLN B CD  1 
ATOM   4437  O  OE1 . GLN B  1 262 ? -4.219  19.191  -13.018 1.00 25.15 ? 263  GLN B OE1 1 
ATOM   4438  N  NE2 . GLN B  1 262 ? -4.090  21.026  -11.753 1.00 24.55 ? 263  GLN B NE2 1 
ATOM   4439  N  N   . GLU B  1 263 ? 1.245   17.733  -12.495 1.00 16.89 ? 264  GLU B N   1 
ATOM   4440  C  CA  . GLU B  1 263 ? 2.665   17.928  -12.812 1.00 18.97 ? 264  GLU B CA  1 
ATOM   4441  C  C   . GLU B  1 263 ? 3.292   18.999  -11.948 1.00 18.69 ? 264  GLU B C   1 
ATOM   4442  O  O   . GLU B  1 263 ? 3.863   19.948  -12.460 1.00 15.71 ? 264  GLU B O   1 
ATOM   4443  C  CB  . GLU B  1 263 ? 2.824   18.274  -14.281 1.00 17.70 ? 264  GLU B CB  1 
ATOM   4444  C  CG  . GLU B  1 263 ? 2.369   17.159  -15.192 1.00 16.10 ? 264  GLU B CG  1 
ATOM   4445  C  CD  . GLU B  1 263 ? 2.765   17.370  -16.651 1.00 20.33 ? 264  GLU B CD  1 
ATOM   4446  O  OE1 . GLU B  1 263 ? 3.988   17.423  -16.988 1.00 20.35 ? 264  GLU B OE1 1 
ATOM   4447  O  OE2 . GLU B  1 263 ? 1.844   17.444  -17.482 1.00 22.05 ? 264  GLU B OE2 1 
ATOM   4448  N  N   . LEU B  1 264 ? 3.174   18.820  -10.636 1.00 17.45 ? 265  LEU B N   1 
ATOM   4449  C  CA  . LEU B  1 264 ? 3.539   19.851  -9.677  1.00 18.66 ? 265  LEU B CA  1 
ATOM   4450  C  C   . LEU B  1 264 ? 5.015   19.843  -9.375  1.00 19.23 ? 265  LEU B C   1 
ATOM   4451  O  O   . LEU B  1 264 ? 5.664   18.803  -9.425  1.00 17.78 ? 265  LEU B O   1 
ATOM   4452  C  CB  . LEU B  1 264 ? 2.782   19.659  -8.353  1.00 17.19 ? 265  LEU B CB  1 
ATOM   4453  C  CG  . LEU B  1 264 ? 1.256   19.732  -8.464  1.00 20.73 ? 265  LEU B CG  1 
ATOM   4454  C  CD1 . LEU B  1 264 ? 0.602   19.456  -7.096  1.00 18.89 ? 265  LEU B CD1 1 
ATOM   4455  C  CD2 . LEU B  1 264 ? 0.791   21.075  -9.049  1.00 19.90 ? 265  LEU B CD2 1 
ATOM   4456  N  N   . ARG B  1 265 ? 5.521   21.012  -9.008  1.00 19.09 ? 266  ARG B N   1 
ATOM   4457  C  CA  . ARG B  1 265 ? 6.899   21.184  -8.613  1.00 20.80 ? 266  ARG B CA  1 
ATOM   4458  C  C   . ARG B  1 265 ? 6.975   21.592  -7.174  1.00 22.79 ? 266  ARG B C   1 
ATOM   4459  O  O   . ARG B  1 265 ? 6.385   22.602  -6.796  1.00 20.93 ? 266  ARG B O   1 
ATOM   4460  C  CB  . ARG B  1 265 ? 7.521   22.271  -9.437  1.00 22.95 ? 266  ARG B CB  1 
ATOM   4461  C  CG  . ARG B  1 265 ? 8.973   22.559  -9.102  1.00 34.48 ? 266  ARG B CG  1 
ATOM   4462  C  CD  . ARG B  1 265 ? 9.476   23.735  -9.943  1.00 42.32 ? 266  ARG B CD  1 
ATOM   4463  N  NE  . ARG B  1 265 ? 10.902  23.958  -9.735  1.00 47.86 ? 266  ARG B NE  1 
ATOM   4464  C  CZ  . ARG B  1 265 ? 11.437  24.560  -8.670  1.00 53.99 ? 266  ARG B CZ  1 
ATOM   4465  N  NH1 . ARG B  1 265 ? 10.678  25.029  -7.668  1.00 48.05 ? 266  ARG B NH1 1 
ATOM   4466  N  NH2 . ARG B  1 265 ? 12.763  24.687  -8.610  1.00 54.96 ? 266  ARG B NH2 1 
ATOM   4467  N  N   . MET B  1 266 ? 7.700   20.812  -6.372  1.00 21.61 ? 267  MET B N   1 
ATOM   4468  C  CA  . MET B  1 266 ? 7.776   21.043  -4.939  1.00 23.79 ? 267  MET B CA  1 
ATOM   4469  C  C   . MET B  1 266 ? 9.225   21.151  -4.558  1.00 23.60 ? 267  MET B C   1 
ATOM   4470  O  O   . MET B  1 266 ? 10.007  20.250  -4.849  1.00 27.20 ? 267  MET B O   1 
ATOM   4471  C  CB  . MET B  1 266 ? 7.109   19.898  -4.172  1.00 24.16 ? 267  MET B CB  1 
ATOM   4472  C  CG  . MET B  1 266 ? 5.688   19.641  -4.645  1.00 29.24 ? 267  MET B CG  1 
ATOM   4473  S  SD  . MET B  1 266 ? 5.021   18.119  -4.004  1.00 36.11 ? 267  MET B SD  1 
ATOM   4474  C  CE  . MET B  1 266 ? 3.274   18.416  -4.124  1.00 43.14 ? 267  MET B CE  1 
ATOM   4475  N  N   . GLU B  1 267 ? 9.596   22.265  -3.951  1.00 19.61 ? 268  GLU B N   1 
ATOM   4476  C  CA  . GLU B  1 267 ? 10.965  22.444  -3.497  1.00 19.65 ? 268  GLU B CA  1 
ATOM   4477  C  C   . GLU B  1 267 ? 11.001  22.969  -2.083  1.00 15.71 ? 268  GLU B C   1 
ATOM   4478  O  O   . GLU B  1 267 ? 10.323  23.943  -1.773  1.00 16.39 ? 268  GLU B O   1 
ATOM   4479  C  CB  . GLU B  1 267 ? 11.752  23.383  -4.412  1.00 17.75 ? 268  GLU B CB  1 
ATOM   4480  C  CG  . GLU B  1 267 ? 13.232  23.310  -4.139  1.00 22.96 ? 268  GLU B CG  1 
ATOM   4481  C  CD  . GLU B  1 267 ? 14.086  24.284  -4.949  1.00 27.24 ? 268  GLU B CD  1 
ATOM   4482  O  OE1 . GLU B  1 267 ? 13.646  24.748  -6.012  1.00 28.54 ? 268  GLU B OE1 1 
ATOM   4483  O  OE2 . GLU B  1 267 ? 15.218  24.582  -4.502  1.00 28.85 ? 268  GLU B OE2 1 
ATOM   4484  N  N   . ALA B  1 268 ? 11.802  22.313  -1.255  1.00 12.78 ? 269  ALA B N   1 
ATOM   4485  C  CA  . ALA B  1 268 ? 12.088  22.725  0.083   1.00 14.56 ? 269  ALA B CA  1 
ATOM   4486  C  C   . ALA B  1 268 ? 13.378  23.519  0.105   1.00 15.65 ? 269  ALA B C   1 
ATOM   4487  O  O   . ALA B  1 268 ? 14.224  23.371  -0.779  1.00 16.46 ? 269  ALA B O   1 
ATOM   4488  C  CB  . ALA B  1 268 ? 12.214  21.547  0.981   1.00 13.73 ? 269  ALA B CB  1 
ATOM   4489  N  N   . PHE B  1 269 ? 13.543  24.340  1.137   1.00 16.63 ? 270  PHE B N   1 
ATOM   4490  C  CA  . PHE B  1 269 ? 14.729  25.233  1.233   1.00 17.77 ? 270  PHE B CA  1 
ATOM   4491  C  C   . PHE B  1 269 ? 15.011  25.591  2.678   1.00 16.31 ? 270  PHE B C   1 
ATOM   4492  O  O   . PHE B  1 269 ? 14.148  25.484  3.531   1.00 16.17 ? 270  PHE B O   1 
ATOM   4493  C  CB  . PHE B  1 269 ? 14.485  26.514  0.408   1.00 18.11 ? 270  PHE B CB  1 
ATOM   4494  C  CG  . PHE B  1 269 ? 13.339  27.342  0.926   1.00 18.13 ? 270  PHE B CG  1 
ATOM   4495  C  CD1 . PHE B  1 269 ? 12.026  26.948  0.692   1.00 17.02 ? 270  PHE B CD1 1 
ATOM   4496  C  CD2 . PHE B  1 269 ? 13.575  28.430  1.760   1.00 17.41 ? 270  PHE B CD2 1 
ATOM   4497  C  CE1 . PHE B  1 269 ? 10.943  27.675  1.239   1.00 17.98 ? 270  PHE B CE1 1 
ATOM   4498  C  CE2 . PHE B  1 269 ? 12.517  29.166  2.301   1.00 16.87 ? 270  PHE B CE2 1 
ATOM   4499  C  CZ  . PHE B  1 269 ? 11.210  28.792  2.050   1.00 15.89 ? 270  PHE B CZ  1 
ATOM   4500  N  N   . VAL B  1 270 ? 16.242  25.993  2.941   1.00 16.99 ? 271  VAL B N   1 
ATOM   4501  C  CA  . VAL B  1 270 ? 16.678  26.499  4.213   1.00 16.75 ? 271  VAL B CA  1 
ATOM   4502  C  C   . VAL B  1 270 ? 17.194  27.921  3.937   1.00 18.04 ? 271  VAL B C   1 
ATOM   4503  O  O   . VAL B  1 270 ? 17.979  28.147  2.989   1.00 13.93 ? 271  VAL B O   1 
ATOM   4504  C  CB  . VAL B  1 270 ? 17.776  25.594  4.848   1.00 21.12 ? 271  VAL B CB  1 
ATOM   4505  C  CG1 . VAL B  1 270 ? 18.336  26.229  6.089   1.00 18.16 ? 271  VAL B CG1 1 
ATOM   4506  C  CG2 . VAL B  1 270 ? 17.216  24.213  5.188   1.00 17.92 ? 271  VAL B CG2 1 
ATOM   4507  N  N   . VAL B  1 271 ? 16.720  28.878  4.741   1.00 17.73 ? 272  VAL B N   1 
ATOM   4508  C  CA  . VAL B  1 271 ? 16.960  30.294  4.523   1.00 17.39 ? 272  VAL B CA  1 
ATOM   4509  C  C   . VAL B  1 271 ? 18.461  30.555  4.432   1.00 17.74 ? 272  VAL B C   1 
ATOM   4510  O  O   . VAL B  1 271 ? 18.901  31.372  3.626   1.00 14.87 ? 272  VAL B O   1 
ATOM   4511  C  CB  . VAL B  1 271 ? 16.346  31.127  5.659   1.00 19.31 ? 272  VAL B CB  1 
ATOM   4512  C  CG1 . VAL B  1 271 ? 16.915  30.680  7.016   1.00 16.61 ? 272  VAL B CG1 1 
ATOM   4513  C  CG2 . VAL B  1 271 ? 16.577  32.599  5.445   1.00 16.62 ? 272  VAL B CG2 1 
ATOM   4514  N  N   . TYR B  1 272 ? 19.249  29.792  5.191   1.00 18.19 ? 273  TYR B N   1 
ATOM   4515  C  CA  . TYR B  1 272 ? 20.698  30.019  5.265   1.00 21.96 ? 273  TYR B CA  1 
ATOM   4516  C  C   . TYR B  1 272 ? 21.475  29.709  3.946   1.00 22.76 ? 273  TYR B C   1 
ATOM   4517  O  O   . TYR B  1 272 ? 22.678  30.000  3.839   1.00 20.97 ? 273  TYR B O   1 
ATOM   4518  C  CB  . TYR B  1 272 ? 21.318  29.265  6.465   1.00 20.99 ? 273  TYR B CB  1 
ATOM   4519  C  CG  . TYR B  1 272 ? 20.580  29.460  7.783   1.00 24.81 ? 273  TYR B CG  1 
ATOM   4520  C  CD1 . TYR B  1 272 ? 20.495  30.714  8.368   1.00 24.53 ? 273  TYR B CD1 1 
ATOM   4521  C  CD2 . TYR B  1 272 ? 19.980  28.381  8.451   1.00 22.80 ? 273  TYR B CD2 1 
ATOM   4522  C  CE1 . TYR B  1 272 ? 19.844  30.908  9.578   1.00 24.46 ? 273  TYR B CE1 1 
ATOM   4523  C  CE2 . TYR B  1 272 ? 19.299  28.567  9.678   1.00 25.50 ? 273  TYR B CE2 1 
ATOM   4524  C  CZ  . TYR B  1 272 ? 19.246  29.845  10.227  1.00 26.44 ? 273  TYR B CZ  1 
ATOM   4525  O  OH  . TYR B  1 272 ? 18.582  30.092  11.413  1.00 23.65 ? 273  TYR B OH  1 
ATOM   4526  N  N   . ARG B  1 273 ? 20.796  29.107  2.968   1.00 21.04 ? 274  ARG B N   1 
ATOM   4527  C  CA  . ARG B  1 273 ? 21.351  28.899  1.629   1.00 20.34 ? 274  ARG B CA  1 
ATOM   4528  C  C   . ARG B  1 273 ? 21.858  30.211  1.016   1.00 23.27 ? 274  ARG B C   1 
ATOM   4529  O  O   . ARG B  1 273 ? 22.929  30.252  0.396   1.00 23.78 ? 274  ARG B O   1 
ATOM   4530  C  CB  . ARG B  1 273 ? 20.269  28.299  0.724   1.00 21.26 ? 274  ARG B CB  1 
ATOM   4531  C  CG  . ARG B  1 273 ? 20.756  27.861  -0.663  1.00 23.99 ? 274  ARG B CG  1 
ATOM   4532  C  CD  . ARG B  1 273 ? 19.646  27.789  -1.653  1.00 23.09 ? 274  ARG B CD  1 
ATOM   4533  N  NE  . ARG B  1 273 ? 18.703  26.716  -1.359  1.00 23.85 ? 274  ARG B NE  1 
ATOM   4534  C  CZ  . ARG B  1 273 ? 17.784  26.278  -2.207  1.00 20.49 ? 274  ARG B CZ  1 
ATOM   4535  N  NH1 . ARG B  1 273 ? 17.670  26.812  -3.424  1.00 20.23 ? 274  ARG B NH1 1 
ATOM   4536  N  NH2 . ARG B  1 273 ? 16.995  25.288  -1.842  1.00 24.21 ? 274  ARG B NH2 1 
ATOM   4537  N  N   . TRP B  1 274 ? 21.094  31.286  1.200   1.00 23.18 ? 275  TRP B N   1 
ATOM   4538  C  CA  . TRP B  1 274 ? 21.434  32.574  0.608   1.00 23.47 ? 275  TRP B CA  1 
ATOM   4539  C  C   . TRP B  1 274 ? 22.340  33.366  1.541   1.00 23.72 ? 275  TRP B C   1 
ATOM   4540  O  O   . TRP B  1 274 ? 21.949  33.721  2.655   1.00 23.47 ? 275  TRP B O   1 
ATOM   4541  C  CB  . TRP B  1 274 ? 20.174  33.359  0.252   1.00 22.69 ? 275  TRP B CB  1 
ATOM   4542  C  CG  . TRP B  1 274 ? 19.421  32.745  -0.845  1.00 19.68 ? 275  TRP B CG  1 
ATOM   4543  C  CD1 . TRP B  1 274 ? 19.592  32.955  -2.188  1.00 21.41 ? 275  TRP B CD1 1 
ATOM   4544  C  CD2 . TRP B  1 274 ? 18.377  31.779  -0.718  1.00 18.26 ? 275  TRP B CD2 1 
ATOM   4545  N  NE1 . TRP B  1 274 ? 18.700  32.184  -2.899  1.00 24.24 ? 275  TRP B NE1 1 
ATOM   4546  C  CE2 . TRP B  1 274 ? 17.941  31.458  -2.014  1.00 21.74 ? 275  TRP B CE2 1 
ATOM   4547  C  CE3 . TRP B  1 274 ? 17.764  31.153  0.376   1.00 21.37 ? 275  TRP B CE3 1 
ATOM   4548  C  CZ2 . TRP B  1 274 ? 16.920  30.528  -2.249  1.00 22.12 ? 275  TRP B CZ2 1 
ATOM   4549  C  CZ3 . TRP B  1 274 ? 16.747  30.257  0.148   1.00 23.89 ? 275  TRP B CZ3 1 
ATOM   4550  C  CH2 . TRP B  1 274 ? 16.341  29.937  -1.159  1.00 22.90 ? 275  TRP B CH2 1 
ATOM   4551  N  N   . GLN B  1 275 ? 23.557  33.620  1.061   1.00 23.83 ? 276  GLN B N   1 
ATOM   4552  C  CA  . GLN B  1 275 ? 24.589  34.348  1.783   1.00 25.55 ? 276  GLN B CA  1 
ATOM   4553  C  C   . GLN B  1 275 ? 25.150  35.481  0.911   1.00 25.49 ? 276  GLN B C   1 
ATOM   4554  O  O   . GLN B  1 275 ? 24.661  35.717  -0.198  1.00 22.31 ? 276  GLN B O   1 
ATOM   4555  C  CB  . GLN B  1 275 ? 25.708  33.360  2.198   1.00 27.64 ? 276  GLN B CB  1 
ATOM   4556  C  CG  . GLN B  1 275 ? 25.248  32.311  3.230   1.00 26.78 ? 276  GLN B CG  1 
ATOM   4557  C  CD  . GLN B  1 275 ? 24.909  32.930  4.563   1.00 33.97 ? 276  GLN B CD  1 
ATOM   4558  O  OE1 . GLN B  1 275 ? 25.417  34.002  4.914   1.00 34.91 ? 276  GLN B OE1 1 
ATOM   4559  N  NE2 . GLN B  1 275 ? 24.034  32.271  5.316   1.00 35.64 ? 276  GLN B NE2 1 
ATOM   4560  N  N   . GLY B  1 276 ? 26.165  36.182  1.419   1.00 25.99 ? 277  GLY B N   1 
ATOM   4561  C  CA  . GLY B  1 276 ? 26.845  37.238  0.647   1.00 26.85 ? 277  GLY B CA  1 
ATOM   4562  C  C   . GLY B  1 276 ? 25.951  38.385  0.198   1.00 27.06 ? 277  GLY B C   1 
ATOM   4563  O  O   . GLY B  1 276 ? 25.077  38.845  0.929   1.00 23.67 ? 277  GLY B O   1 
ATOM   4564  N  N   . ASP B  1 277 ? 26.168  38.828  -1.027  1.00 27.15 ? 278  ASP B N   1 
ATOM   4565  C  CA  . ASP B  1 277 ? 25.450  39.952  -1.594  1.00 28.83 ? 278  ASP B CA  1 
ATOM   4566  C  C   . ASP B  1 277 ? 23.950  39.713  -1.772  1.00 26.60 ? 278  ASP B C   1 
ATOM   4567  O  O   . ASP B  1 277 ? 23.166  40.650  -1.661  1.00 25.57 ? 278  ASP B O   1 
ATOM   4568  C  CB  . ASP B  1 277 ? 26.039  40.314  -2.965  1.00 30.91 ? 278  ASP B CB  1 
ATOM   4569  C  CG  . ASP B  1 277 ? 27.377  41.029  -2.870  1.00 38.87 ? 278  ASP B CG  1 
ATOM   4570  O  OD1 . ASP B  1 277 ? 27.786  41.518  -1.774  1.00 36.70 ? 278  ASP B OD1 1 
ATOM   4571  O  OD2 . ASP B  1 277 ? 28.011  41.102  -3.942  1.00 47.66 ? 278  ASP B OD2 1 
ATOM   4572  N  N   . ALA B  1 278 ? 23.555  38.484  -2.103  1.00 25.21 ? 279  ALA B N   1 
ATOM   4573  C  CA  . ALA B  1 278 ? 22.146  38.177  -2.313  1.00 24.87 ? 279  ALA B CA  1 
ATOM   4574  C  C   . ALA B  1 278 ? 21.397  38.473  -0.997  1.00 23.32 ? 279  ALA B C   1 
ATOM   4575  O  O   . ALA B  1 278 ? 20.352  39.122  -0.987  1.00 22.34 ? 279  ALA B O   1 
ATOM   4576  C  CB  . ALA B  1 278 ? 21.970  36.691  -2.757  1.00 23.37 ? 279  ALA B CB  1 
ATOM   4577  N  N   . ARG B  1 279 ? 21.997  38.022  0.099   1.00 21.91 ? 280  ARG B N   1 
ATOM   4578  C  CA  . ARG B  1 279 ? 21.437  38.134  1.425   1.00 23.24 ? 280  ARG B CA  1 
ATOM   4579  C  C   . ARG B  1 279 ? 21.352  39.589  1.843   1.00 24.63 ? 280  ARG B C   1 
ATOM   4580  O  O   . ARG B  1 279 ? 20.293  40.058  2.299   1.00 19.94 ? 280  ARG B O   1 
ATOM   4581  C  CB  . ARG B  1 279 ? 22.291  37.340  2.417   1.00 21.77 ? 280  ARG B CB  1 
ATOM   4582  C  CG  . ARG B  1 279 ? 21.788  37.355  3.848   1.00 23.09 ? 280  ARG B CG  1 
ATOM   4583  C  CD  . ARG B  1 279 ? 22.597  36.444  4.739   1.00 24.72 ? 280  ARG B CD  1 
ATOM   4584  N  NE  . ARG B  1 279 ? 22.129  36.504  6.110   1.00 23.64 ? 280  ARG B NE  1 
ATOM   4585  C  CZ  . ARG B  1 279 ? 22.472  37.434  7.001   1.00 28.38 ? 280  ARG B CZ  1 
ATOM   4586  N  NH1 . ARG B  1 279 ? 23.289  38.427  6.685   1.00 24.37 ? 280  ARG B NH1 1 
ATOM   4587  N  NH2 . ARG B  1 279 ? 21.964  37.376  8.227   1.00 29.28 ? 280  ARG B NH2 1 
ATOM   4588  N  N   . GLN B  1 280 ? 22.469  40.290  1.671   1.00 24.16 ? 281  GLN B N   1 
ATOM   4589  C  CA  . GLN B  1 280 ? 22.546  41.707  1.977   1.00 26.99 ? 281  GLN B CA  1 
ATOM   4590  C  C   . GLN B  1 280 ? 21.512  42.536  1.175   1.00 26.19 ? 281  GLN B C   1 
ATOM   4591  O  O   . GLN B  1 280 ? 20.786  43.361  1.735   1.00 28.14 ? 281  GLN B O   1 
ATOM   4592  C  CB  . GLN B  1 280 ? 23.977  42.176  1.707   1.00 29.19 ? 281  GLN B CB  1 
ATOM   4593  C  CG  . GLN B  1 280 ? 24.351  43.467  2.363   1.00 37.91 ? 281  GLN B CG  1 
ATOM   4594  C  CD  . GLN B  1 280 ? 24.601  43.331  3.866   1.00 44.52 ? 281  GLN B CD  1 
ATOM   4595  O  OE1 . GLN B  1 280 ? 24.478  42.238  4.444   1.00 43.43 ? 281  GLN B OE1 1 
ATOM   4596  N  NE2 . GLN B  1 280 ? 24.961  44.457  4.506   1.00 42.47 ? 281  GLN B NE2 1 
ATOM   4597  N  N   . LYS B  1 281 ? 21.395  42.291  -0.121  1.00 25.25 ? 282  LYS B N   1 
ATOM   4598  C  CA  . LYS B  1 281 ? 20.376  42.971  -0.898  1.00 25.51 ? 282  LYS B CA  1 
ATOM   4599  C  C   . LYS B  1 281 ? 18.981  42.670  -0.358  1.00 24.77 ? 282  LYS B C   1 
ATOM   4600  O  O   . LYS B  1 281 ? 18.164  43.589  -0.209  1.00 20.62 ? 282  LYS B O   1 
ATOM   4601  C  CB  . LYS B  1 281 ? 20.416  42.588  -2.361  1.00 27.03 ? 282  LYS B CB  1 
ATOM   4602  C  CG  . LYS B  1 281 ? 19.561  43.510  -3.223  1.00 32.12 ? 282  LYS B CG  1 
ATOM   4603  C  CD  . LYS B  1 281 ? 19.707  43.170  -4.689  1.00 46.02 ? 282  LYS B CD  1 
ATOM   4604  N  N   . ALA B  1 282 ? 18.726  41.391  -0.065  1.00 21.48 ? 283  ALA B N   1 
ATOM   4605  C  CA  . ALA B  1 282 ? 17.438  40.970  0.498   1.00 21.50 ? 283  ALA B CA  1 
ATOM   4606  C  C   . ALA B  1 282 ? 17.102  41.734  1.777   1.00 20.44 ? 283  ALA B C   1 
ATOM   4607  O  O   . ALA B  1 282 ? 16.051  42.341  1.861   1.00 17.82 ? 283  ALA B O   1 
ATOM   4608  C  CB  . ALA B  1 282 ? 17.418  39.478  0.743   1.00 20.08 ? 283  ALA B CB  1 
ATOM   4609  N  N   . LEU B  1 283 ? 18.021  41.741  2.739   1.00 20.11 ? 284  LEU B N   1 
ATOM   4610  C  CA  . LEU B  1 283 ? 17.837  42.509  3.965   1.00 22.75 ? 284  LEU B CA  1 
ATOM   4611  C  C   . LEU B  1 283 ? 17.516  43.984  3.705   1.00 22.53 ? 284  LEU B C   1 
ATOM   4612  O  O   . LEU B  1 283 ? 16.655  44.556  4.382   1.00 20.93 ? 284  LEU B O   1 
ATOM   4613  C  CB  . LEU B  1 283 ? 19.074  42.406  4.867   1.00 21.66 ? 284  LEU B CB  1 
ATOM   4614  C  CG  . LEU B  1 283 ? 19.294  41.050  5.563   1.00 23.53 ? 284  LEU B CG  1 
ATOM   4615  C  CD1 . LEU B  1 283 ? 20.663  41.020  6.258   1.00 16.02 ? 284  LEU B CD1 1 
ATOM   4616  C  CD2 . LEU B  1 283 ? 18.175  40.755  6.589   1.00 18.92 ? 284  LEU B CD2 1 
ATOM   4617  N  N   . LYS B  1 284 ? 18.204  44.586  2.735   1.00 23.40 ? 285  LYS B N   1 
ATOM   4618  C  CA  . LYS B  1 284 ? 18.061  46.018  2.447   1.00 24.44 ? 285  LYS B CA  1 
ATOM   4619  C  C   . LYS B  1 284 ? 16.749  46.292  1.720   1.00 23.73 ? 285  LYS B C   1 
ATOM   4620  O  O   . LYS B  1 284 ? 16.145  47.329  1.921   1.00 24.22 ? 285  LYS B O   1 
ATOM   4621  C  CB  . LYS B  1 284 ? 19.259  46.547  1.625   1.00 26.35 ? 285  LYS B CB  1 
ATOM   4622  C  CG  . LYS B  1 284 ? 20.575  46.677  2.410   1.00 26.10 ? 285  LYS B CG  1 
ATOM   4623  C  CD  . LYS B  1 284 ? 21.742  47.077  1.530   1.00 32.96 ? 285  LYS B CD  1 
ATOM   4624  C  CE  . LYS B  1 284 ? 23.026  47.253  2.371   1.00 40.62 ? 285  LYS B CE  1 
ATOM   4625  N  NZ  . LYS B  1 284 ? 24.250  47.574  1.568   1.00 43.45 ? 285  LYS B NZ  1 
ATOM   4626  N  N   . ASP B  1 285 ? 16.326  45.353  0.876   1.00 23.09 ? 286  ASP B N   1 
ATOM   4627  C  CA  . ASP B  1 285 ? 14.996  45.380  0.304   1.00 24.11 ? 286  ASP B CA  1 
ATOM   4628  C  C   . ASP B  1 285 ? 13.928  45.335  1.414   1.00 23.46 ? 286  ASP B C   1 
ATOM   4629  O  O   . ASP B  1 285 ? 13.013  46.140  1.411   1.00 21.96 ? 286  ASP B O   1 
ATOM   4630  C  CB  . ASP B  1 285 ? 14.795  44.237  -0.708  1.00 24.79 ? 286  ASP B CB  1 
ATOM   4631  C  CG  . ASP B  1 285 ? 15.460  44.504  -2.063  1.00 27.53 ? 286  ASP B CG  1 
ATOM   4632  O  OD1 . ASP B  1 285 ? 16.043  45.586  -2.231  1.00 28.11 ? 286  ASP B OD1 1 
ATOM   4633  O  OD2 . ASP B  1 285 ? 15.405  43.619  -2.961  1.00 29.12 ? 286  ASP B OD2 1 
ATOM   4634  N  N   . LEU B  1 286 ? 14.070  44.431  2.379   1.00 23.02 ? 287  LEU B N   1 
ATOM   4635  C  CA  . LEU B  1 286 ? 13.051  44.298  3.436   1.00 24.45 ? 287  LEU B CA  1 
ATOM   4636  C  C   . LEU B  1 286 ? 12.969  45.564  4.305   1.00 24.27 ? 287  LEU B C   1 
ATOM   4637  O  O   . LEU B  1 286 ? 11.877  46.064  4.603   1.00 21.26 ? 287  LEU B O   1 
ATOM   4638  C  CB  . LEU B  1 286 ? 13.306  43.052  4.288   1.00 22.45 ? 287  LEU B CB  1 
ATOM   4639  C  CG  . LEU B  1 286 ? 13.079  41.687  3.595   1.00 27.23 ? 287  LEU B CG  1 
ATOM   4640  C  CD1 . LEU B  1 286 ? 13.957  40.578  4.214   1.00 18.99 ? 287  LEU B CD1 1 
ATOM   4641  C  CD2 . LEU B  1 286 ? 11.612  41.274  3.665   1.00 14.52 ? 287  LEU B CD2 1 
ATOM   4642  N  N   . LEU B  1 287 ? 14.125  46.085  4.698   1.00 24.70 ? 288  LEU B N   1 
ATOM   4643  C  CA  . LEU B  1 287 ? 14.175  47.340  5.466   1.00 26.86 ? 288  LEU B CA  1 
ATOM   4644  C  C   . LEU B  1 287 ? 13.541  48.504  4.678   1.00 25.82 ? 288  LEU B C   1 
ATOM   4645  O  O   . LEU B  1 287 ? 12.720  49.248  5.208   1.00 27.76 ? 288  LEU B O   1 
ATOM   4646  C  CB  . LEU B  1 287 ? 15.620  47.678  5.864   1.00 26.73 ? 288  LEU B CB  1 
ATOM   4647  C  CG  . LEU B  1 287 ? 15.831  49.010  6.587   1.00 28.46 ? 288  LEU B CG  1 
ATOM   4648  C  CD1 . LEU B  1 287 ? 15.178  48.938  7.958   1.00 24.78 ? 288  LEU B CD1 1 
ATOM   4649  C  CD2 . LEU B  1 287 ? 17.311  49.347  6.710   1.00 21.28 ? 288  LEU B CD2 1 
ATOM   4650  N  N   . LYS B  1 288 ? 13.925  48.640  3.418   1.00 26.48 ? 289  LYS B N   1 
ATOM   4651  C  CA  . LYS B  1 288 ? 13.361  49.656  2.554   1.00 28.31 ? 289  LYS B CA  1 
ATOM   4652  C  C   . LYS B  1 288 ? 11.835  49.537  2.511   1.00 28.75 ? 289  LYS B C   1 
ATOM   4653  O  O   . LYS B  1 288 ? 11.138  50.522  2.740   1.00 28.51 ? 289  LYS B O   1 
ATOM   4654  C  CB  . LYS B  1 288 ? 13.975  49.550  1.162   1.00 29.40 ? 289  LYS B CB  1 
ATOM   4655  C  CG  . LYS B  1 288 ? 13.457  50.566  0.112   1.00 31.60 ? 289  LYS B CG  1 
ATOM   4656  C  CD  . LYS B  1 288 ? 13.999  50.202  -1.293  1.00 37.64 ? 289  LYS B CD  1 
ATOM   4657  C  CE  . LYS B  1 288 ? 12.962  50.369  -2.421  1.00 43.54 ? 289  LYS B CE  1 
ATOM   4658  N  NZ  . LYS B  1 288 ? 13.066  49.247  -3.438  1.00 36.76 ? 289  LYS B NZ  1 
ATOM   4659  N  N   . TRP B  1 289 ? 11.317  48.331  2.270   1.00 28.20 ? 290  TRP B N   1 
ATOM   4660  C  CA  . TRP B  1 289 ? 9.859   48.123  2.242   1.00 28.51 ? 290  TRP B CA  1 
ATOM   4661  C  C   . TRP B  1 289 ? 9.169   48.447  3.562   1.00 28.02 ? 290  TRP B C   1 
ATOM   4662  O  O   . TRP B  1 289 ? 8.032   48.922  3.568   1.00 29.83 ? 290  TRP B O   1 
ATOM   4663  C  CB  . TRP B  1 289 ? 9.500   46.700  1.787   1.00 27.86 ? 290  TRP B CB  1 
ATOM   4664  C  CG  . TRP B  1 289 ? 9.886   46.445  0.362   1.00 29.10 ? 290  TRP B CG  1 
ATOM   4665  C  CD1 . TRP B  1 289 ? 9.937   47.361  -0.647  1.00 25.54 ? 290  TRP B CD1 1 
ATOM   4666  C  CD2 . TRP B  1 289 ? 10.275  45.197  -0.210  1.00 28.49 ? 290  TRP B CD2 1 
ATOM   4667  N  NE1 . TRP B  1 289 ? 10.324  46.759  -1.814  1.00 30.63 ? 290  TRP B NE1 1 
ATOM   4668  C  CE2 . TRP B  1 289 ? 10.548  45.431  -1.572  1.00 27.38 ? 290  TRP B CE2 1 
ATOM   4669  C  CE3 . TRP B  1 289 ? 10.405  43.896  0.291   1.00 27.88 ? 290  TRP B CE3 1 
ATOM   4670  C  CZ2 . TRP B  1 289 ? 10.956  44.425  -2.428  1.00 27.79 ? 290  TRP B CZ2 1 
ATOM   4671  C  CZ3 . TRP B  1 289 ? 10.775  42.887  -0.566  1.00 21.68 ? 290  TRP B CZ3 1 
ATOM   4672  C  CH2 . TRP B  1 289 ? 11.065  43.151  -1.902  1.00 27.50 ? 290  TRP B CH2 1 
ATOM   4673  N  N   . VAL B  1 290 ? 9.857   48.214  4.672   1.00 27.23 ? 291  VAL B N   1 
ATOM   4674  C  CA  . VAL B  1 290 ? 9.312   48.574  5.961   1.00 29.48 ? 291  VAL B CA  1 
ATOM   4675  C  C   . VAL B  1 290 ? 9.257   50.110  6.094   1.00 32.51 ? 291  VAL B C   1 
ATOM   4676  O  O   . VAL B  1 290 ? 8.238   50.660  6.529   1.00 31.06 ? 291  VAL B O   1 
ATOM   4677  C  CB  . VAL B  1 290 ? 10.091  47.948  7.124   1.00 28.04 ? 291  VAL B CB  1 
ATOM   4678  C  CG1 . VAL B  1 290 ? 9.684   48.599  8.430   1.00 25.88 ? 291  VAL B CG1 1 
ATOM   4679  C  CG2 . VAL B  1 290 ? 9.858   46.437  7.181   1.00 25.78 ? 291  VAL B CG2 1 
ATOM   4680  N  N   . LEU B  1 291 ? 10.325  50.794  5.684   1.00 34.12 ? 292  LEU B N   1 
ATOM   4681  C  CA  . LEU B  1 291 ? 10.355  52.271  5.781   1.00 35.63 ? 292  LEU B CA  1 
ATOM   4682  C  C   . LEU B  1 291 ? 9.357   52.932  4.848   1.00 35.61 ? 292  LEU B C   1 
ATOM   4683  O  O   . LEU B  1 291 ? 8.811   53.979  5.168   1.00 36.69 ? 292  LEU B O   1 
ATOM   4684  C  CB  . LEU B  1 291 ? 11.747  52.815  5.507   1.00 33.27 ? 292  LEU B CB  1 
ATOM   4685  C  CG  . LEU B  1 291 ? 12.734  52.425  6.603   1.00 35.60 ? 292  LEU B CG  1 
ATOM   4686  C  CD1 . LEU B  1 291 ? 14.186  52.554  6.117   1.00 32.97 ? 292  LEU B CD1 1 
ATOM   4687  C  CD2 . LEU B  1 291 ? 12.463  53.271  7.846   1.00 35.37 ? 292  LEU B CD2 1 
ATOM   4688  N  N   . GLU B  1 292 ? 9.111   52.314  3.704   1.00 35.83 ? 293  GLU B N   1 
ATOM   4689  C  CA  . GLU B  1 292 ? 8.109   52.815  2.768   1.00 36.54 ? 293  GLU B CA  1 
ATOM   4690  C  C   . GLU B  1 292 ? 6.657   52.468  3.146   1.00 36.44 ? 293  GLU B C   1 
ATOM   4691  O  O   . GLU B  1 292 ? 5.724   52.982  2.551   1.00 38.09 ? 293  GLU B O   1 
ATOM   4692  C  CB  . GLU B  1 292 ? 8.390   52.281  1.378   1.00 35.40 ? 293  GLU B CB  1 
ATOM   4693  C  CG  . GLU B  1 292 ? 9.728   52.724  0.787   1.00 39.96 ? 293  GLU B CG  1 
ATOM   4694  C  CD  . GLU B  1 292 ? 9.976   52.079  -0.575  1.00 43.99 ? 293  GLU B CD  1 
ATOM   4695  O  OE1 . GLU B  1 292 ? 9.296   51.080  -0.898  1.00 45.36 ? 293  GLU B OE1 1 
ATOM   4696  O  OE2 . GLU B  1 292 ? 10.836  52.568  -1.328  1.00 44.63 ? 293  GLU B OE2 1 
ATOM   4697  N  N   . GLY B  1 293 ? 6.460   51.597  4.120   1.00 35.91 ? 294  GLY B N   1 
ATOM   4698  C  CA  . GLY B  1 293 ? 5.121   51.170  4.484   1.00 35.13 ? 294  GLY B CA  1 
ATOM   4699  C  C   . GLY B  1 293 ? 4.527   50.072  3.608   1.00 33.75 ? 294  GLY B C   1 
ATOM   4700  O  O   . GLY B  1 293 ? 3.397   49.694  3.808   1.00 32.84 ? 294  GLY B O   1 
ATOM   4701  N  N   . LYS B  1 294 ? 5.295   49.545  2.658   1.00 33.90 ? 295  LYS B N   1 
ATOM   4702  C  CA  . LYS B  1 294 ? 4.851   48.428  1.818   1.00 34.01 ? 295  LYS B CA  1 
ATOM   4703  C  C   . LYS B  1 294 ? 4.789   47.129  2.612   1.00 32.17 ? 295  LYS B C   1 
ATOM   4704  O  O   . LYS B  1 294 ? 3.964   46.256  2.326   1.00 33.47 ? 295  LYS B O   1 
ATOM   4705  C  CB  . LYS B  1 294 ? 5.793   48.267  0.621   1.00 35.25 ? 295  LYS B CB  1 
ATOM   4706  C  CG  . LYS B  1 294 ? 5.768   49.449  -0.344  1.00 40.94 ? 295  LYS B CG  1 
ATOM   4707  C  CD  . LYS B  1 294 ? 6.654   49.190  -1.581  1.00 45.44 ? 295  LYS B CD  1 
ATOM   4708  C  CE  . LYS B  1 294 ? 6.466   50.247  -2.672  1.00 48.86 ? 295  LYS B CE  1 
ATOM   4709  N  NZ  . LYS B  1 294 ? 7.662   50.373  -3.572  1.00 51.48 ? 295  LYS B NZ  1 
ATOM   4710  N  N   . ILE B  1 295 ? 5.684   46.998  3.596   1.00 30.22 ? 296  ILE B N   1 
ATOM   4711  C  CA  . ILE B  1 295 ? 5.629   45.930  4.593   1.00 27.81 ? 296  ILE B CA  1 
ATOM   4712  C  C   . ILE B  1 295 ? 5.451   46.557  5.985   1.00 29.34 ? 296  ILE B C   1 
ATOM   4713  O  O   . ILE B  1 295 ? 6.367   47.206  6.511   1.00 28.33 ? 296  ILE B O   1 
ATOM   4714  C  CB  . ILE B  1 295 ? 6.914   45.105  4.622   1.00 26.83 ? 296  ILE B CB  1 
ATOM   4715  C  CG1 . ILE B  1 295 ? 7.109   44.350  3.305   1.00 25.00 ? 296  ILE B CG1 1 
ATOM   4716  C  CG2 . ILE B  1 295 ? 6.903   44.158  5.820   1.00 19.83 ? 296  ILE B CG2 1 
ATOM   4717  C  CD1 . ILE B  1 295 ? 8.411   43.563  3.282   1.00 28.06 ? 296  ILE B CD1 1 
ATOM   4718  N  N   . GLN B  1 296 ? 4.283   46.348  6.579   1.00 26.88 ? 297  GLN B N   1 
ATOM   4719  C  CA  . GLN B  1 296 ? 4.035   46.781  7.929   1.00 29.53 ? 297  GLN B CA  1 
ATOM   4720  C  C   . GLN B  1 296 ? 4.586   45.718  8.854   1.00 30.87 ? 297  GLN B C   1 
ATOM   4721  O  O   . GLN B  1 296 ? 4.654   44.550  8.485   1.00 33.12 ? 297  GLN B O   1 
ATOM   4722  C  CB  . GLN B  1 296 ? 2.541   46.993  8.156   1.00 29.80 ? 297  GLN B CB  1 
ATOM   4723  C  CG  . GLN B  1 296 ? 1.944   48.063  7.241   1.00 36.93 ? 297  GLN B CG  1 
ATOM   4724  C  CD  . GLN B  1 296 ? 0.616   48.591  7.761   1.00 54.76 ? 297  GLN B CD  1 
ATOM   4725  O  OE1 . GLN B  1 296 ? 0.401   48.683  8.980   1.00 58.19 ? 297  GLN B OE1 1 
ATOM   4726  N  NE2 . GLN B  1 296 ? -0.290  48.937  6.841   1.00 54.82 ? 297  GLN B NE2 1 
ATOM   4727  N  N   . TYR B  1 297 ? 5.019   46.112  10.038  1.00 31.46 ? 298  TYR B N   1 
ATOM   4728  C  CA  . TYR B  1 297 ? 5.396   45.132  11.034  1.00 33.50 ? 298  TYR B CA  1 
ATOM   4729  C  C   . TYR B  1 297 ? 4.465   45.174  12.248  1.00 33.05 ? 298  TYR B C   1 
ATOM   4730  O  O   . TYR B  1 297 ? 3.882   46.205  12.580  1.00 31.63 ? 298  TYR B O   1 
ATOM   4731  C  CB  . TYR B  1 297 ? 6.859   45.299  11.465  1.00 33.95 ? 298  TYR B CB  1 
ATOM   4732  C  CG  . TYR B  1 297 ? 7.191   46.602  12.156  1.00 37.95 ? 298  TYR B CG  1 
ATOM   4733  C  CD1 . TYR B  1 297 ? 7.578   47.724  11.425  1.00 42.47 ? 298  TYR B CD1 1 
ATOM   4734  C  CD2 . TYR B  1 297 ? 7.155   46.700  13.549  1.00 39.87 ? 298  TYR B CD2 1 
ATOM   4735  C  CE1 . TYR B  1 297 ? 7.899   48.914  12.064  1.00 45.64 ? 298  TYR B CE1 1 
ATOM   4736  C  CE2 . TYR B  1 297 ? 7.468   47.871  14.190  1.00 40.58 ? 298  TYR B CE2 1 
ATOM   4737  C  CZ  . TYR B  1 297 ? 7.841   48.977  13.453  1.00 44.53 ? 298  TYR B CZ  1 
ATOM   4738  O  OH  . TYR B  1 297 ? 8.148   50.147  14.112  1.00 52.05 ? 298  TYR B OH  1 
ATOM   4739  N  N   . LYS B  1 298 ? 4.320   44.014  12.866  1.00 33.32 ? 299  LYS B N   1 
ATOM   4740  C  CA  . LYS B  1 298 ? 3.735   43.880  14.170  1.00 35.25 ? 299  LYS B CA  1 
ATOM   4741  C  C   . LYS B  1 298 ? 4.541   42.819  14.890  1.00 33.15 ? 299  LYS B C   1 
ATOM   4742  O  O   . LYS B  1 298 ? 4.929   41.820  14.301  1.00 36.28 ? 299  LYS B O   1 
ATOM   4743  C  CB  . LYS B  1 298 ? 2.254   43.479  14.083  1.00 37.19 ? 299  LYS B CB  1 
ATOM   4744  C  CG  . LYS B  1 298 ? 1.470   43.798  15.370  1.00 41.68 ? 299  LYS B CG  1 
ATOM   4745  C  CD  . LYS B  1 298 ? 0.007   44.140  15.097  1.00 47.28 ? 299  LYS B CD  1 
ATOM   4746  C  CE  . LYS B  1 298 ? -0.823  44.159  16.391  1.00 51.95 ? 299  LYS B CE  1 
ATOM   4747  N  NZ  . LYS B  1 298 ? -0.225  45.013  17.474  1.00 52.35 ? 299  LYS B NZ  1 
ATOM   4748  N  N   . GLU B  1 299 ? 4.816   43.051  16.155  1.00 29.37 ? 300  GLU B N   1 
ATOM   4749  C  CA  . GLU B  1 299 ? 5.512   42.084  16.966  1.00 28.43 ? 300  GLU B CA  1 
ATOM   4750  C  C   . GLU B  1 299 ? 4.585   41.613  18.077  1.00 26.87 ? 300  GLU B C   1 
ATOM   4751  O  O   . GLU B  1 299 ? 3.652   42.317  18.454  1.00 27.78 ? 300  GLU B O   1 
ATOM   4752  C  CB  . GLU B  1 299 ? 6.777   42.697  17.542  1.00 27.67 ? 300  GLU B CB  1 
ATOM   4753  C  CG  . GLU B  1 299 ? 7.785   43.145  16.499  1.00 27.82 ? 300  GLU B CG  1 
ATOM   4754  C  CD  . GLU B  1 299 ? 9.017   43.781  17.131  1.00 31.82 ? 300  GLU B CD  1 
ATOM   4755  O  OE1 . GLU B  1 299 ? 8.886   44.895  17.678  1.00 30.57 ? 300  GLU B OE1 1 
ATOM   4756  O  OE2 . GLU B  1 299 ? 10.110  43.165  17.073  1.00 27.00 ? 300  GLU B OE2 1 
ATOM   4757  N  N   . TYR B  1 300 ? 4.823   40.398  18.546  1.00 24.50 ? 301  TYR B N   1 
ATOM   4758  C  CA  . TYR B  1 300 ? 4.122   39.834  19.672  1.00 24.56 ? 301  TYR B CA  1 
ATOM   4759  C  C   . TYR B  1 300 ? 5.177   39.762  20.746  1.00 24.02 ? 301  TYR B C   1 
ATOM   4760  O  O   . TYR B  1 300 ? 5.969   38.837  20.778  1.00 21.42 ? 301  TYR B O   1 
ATOM   4761  C  CB  . TYR B  1 300 ? 3.577   38.441  19.341  1.00 24.63 ? 301  TYR B CB  1 
ATOM   4762  C  CG  . TYR B  1 300 ? 2.733   37.816  20.437  1.00 21.45 ? 301  TYR B CG  1 
ATOM   4763  C  CD1 . TYR B  1 300 ? 1.437   38.257  20.684  1.00 27.21 ? 301  TYR B CD1 1 
ATOM   4764  C  CD2 . TYR B  1 300 ? 3.218   36.790  21.209  1.00 24.92 ? 301  TYR B CD2 1 
ATOM   4765  C  CE1 . TYR B  1 300 ? 0.658   37.694  21.684  1.00 27.19 ? 301  TYR B CE1 1 
ATOM   4766  C  CE2 . TYR B  1 300 ? 2.444   36.210  22.206  1.00 28.08 ? 301  TYR B CE2 1 
ATOM   4767  C  CZ  . TYR B  1 300 ? 1.167   36.670  22.440  1.00 31.86 ? 301  TYR B CZ  1 
ATOM   4768  O  OH  . TYR B  1 300 ? 0.409   36.088  23.427  1.00 32.38 ? 301  TYR B OH  1 
ATOM   4769  N  N   . ILE B  1 301 ? 5.209   40.767  21.610  1.00 26.98 ? 302  ILE B N   1 
ATOM   4770  C  CA  . ILE B  1 301 ? 6.335   40.951  22.544  1.00 27.81 ? 302  ILE B CA  1 
ATOM   4771  C  C   . ILE B  1 301 ? 5.999   40.466  23.946  1.00 26.16 ? 302  ILE B C   1 
ATOM   4772  O  O   . ILE B  1 301 ? 5.165   41.061  24.620  1.00 26.19 ? 302  ILE B O   1 
ATOM   4773  C  CB  . ILE B  1 301 ? 6.760   42.441  22.626  1.00 28.03 ? 302  ILE B CB  1 
ATOM   4774  C  CG1 . ILE B  1 301 ? 7.110   42.967  21.238  1.00 31.37 ? 302  ILE B CG1 1 
ATOM   4775  C  CG2 . ILE B  1 301 ? 7.937   42.598  23.577  1.00 26.96 ? 302  ILE B CG2 1 
ATOM   4776  C  CD1 . ILE B  1 301 ? 7.251   44.470  21.145  1.00 36.43 ? 302  ILE B CD1 1 
ATOM   4777  N  N   . ILE B  1 302 ? 6.642   39.384  24.361  1.00 26.97 ? 303  ILE B N   1 
ATOM   4778  C  CA  . ILE B  1 302 ? 6.555   38.875  25.719  1.00 27.50 ? 303  ILE B CA  1 
ATOM   4779  C  C   . ILE B  1 302 ? 7.646   39.566  26.562  1.00 28.80 ? 303  ILE B C   1 
ATOM   4780  O  O   . ILE B  1 302 ? 8.806   39.649  26.157  1.00 29.74 ? 303  ILE B O   1 
ATOM   4781  C  CB  . ILE B  1 302 ? 6.737   37.323  25.767  1.00 28.06 ? 303  ILE B CB  1 
ATOM   4782  C  CG1 . ILE B  1 302 ? 5.450   36.584  25.362  1.00 31.11 ? 303  ILE B CG1 1 
ATOM   4783  C  CG2 . ILE B  1 302 ? 7.115   36.859  27.145  1.00 24.86 ? 303  ILE B CG2 1 
ATOM   4784  C  CD1 . ILE B  1 302 ? 5.174   36.596  23.897  1.00 36.48 ? 303  ILE B CD1 1 
ATOM   4785  N  N   . GLU B  1 303 ? 7.255   40.041  27.742  1.00 29.09 ? 304  GLU B N   1 
ATOM   4786  C  CA  . GLU B  1 303 ? 8.114   40.814  28.640  1.00 28.59 ? 304  GLU B CA  1 
ATOM   4787  C  C   . GLU B  1 303 ? 8.803   39.940  29.667  1.00 25.39 ? 304  GLU B C   1 
ATOM   4788  O  O   . GLU B  1 303 ? 8.152   39.308  30.498  1.00 27.79 ? 304  GLU B O   1 
ATOM   4789  C  CB  . GLU B  1 303 ? 7.265   41.866  29.346  1.00 29.76 ? 304  GLU B CB  1 
ATOM   4790  C  CG  . GLU B  1 303 ? 6.556   42.838  28.389  1.00 35.89 ? 304  GLU B CG  1 
ATOM   4791  C  CD  . GLU B  1 303 ? 7.457   43.950  27.847  1.00 42.07 ? 304  GLU B CD  1 
ATOM   4792  O  OE1 . GLU B  1 303 ? 8.530   44.201  28.448  1.00 41.68 ? 304  GLU B OE1 1 
ATOM   4793  O  OE2 . GLU B  1 303 ? 7.080   44.572  26.824  1.00 40.22 ? 304  GLU B OE2 1 
ATOM   4794  N  N   . GLY B  1 304 ? 10.121  39.853  29.581  1.00 24.79 ? 305  GLY B N   1 
ATOM   4795  C  CA  . GLY B  1 304 ? 10.910  39.147  30.575  1.00 23.91 ? 305  GLY B CA  1 
ATOM   4796  C  C   . GLY B  1 304 ? 11.478  37.821  30.152  1.00 25.01 ? 305  GLY B C   1 
ATOM   4797  O  O   . GLY B  1 304 ? 10.753  36.931  29.706  1.00 27.70 ? 305  GLY B O   1 
ATOM   4798  N  N   . PHE B  1 305 ? 12.777  37.663  30.359  1.00 24.12 ? 306  PHE B N   1 
ATOM   4799  C  CA  . PHE B  1 305 ? 13.508  36.452  30.016  1.00 24.52 ? 306  PHE B CA  1 
ATOM   4800  C  C   . PHE B  1 305 ? 12.894  35.210  30.656  1.00 26.58 ? 306  PHE B C   1 
ATOM   4801  O  O   . PHE B  1 305 ? 12.997  34.094  30.138  1.00 26.70 ? 306  PHE B O   1 
ATOM   4802  C  CB  . PHE B  1 305 ? 14.952  36.602  30.504  1.00 22.48 ? 306  PHE B CB  1 
ATOM   4803  C  CG  . PHE B  1 305 ? 15.820  35.415  30.251  1.00 18.83 ? 306  PHE B CG  1 
ATOM   4804  C  CD1 . PHE B  1 305 ? 16.358  35.189  28.989  1.00 24.62 ? 306  PHE B CD1 1 
ATOM   4805  C  CD2 . PHE B  1 305 ? 16.138  34.547  31.270  1.00 18.59 ? 306  PHE B CD2 1 
ATOM   4806  C  CE1 . PHE B  1 305 ? 17.199  34.092  28.748  1.00 20.53 ? 306  PHE B CE1 1 
ATOM   4807  C  CE2 . PHE B  1 305 ? 16.960  33.418  31.038  1.00 19.05 ? 306  PHE B CE2 1 
ATOM   4808  C  CZ  . PHE B  1 305 ? 17.493  33.210  29.776  1.00 22.36 ? 306  PHE B CZ  1 
ATOM   4809  N  N   . GLU B  1 306 ? 12.301  35.409  31.824  1.00 28.64 ? 307  GLU B N   1 
ATOM   4810  C  CA  . GLU B  1 306 ? 11.774  34.304  32.625  1.00 30.17 ? 307  GLU B CA  1 
ATOM   4811  C  C   . GLU B  1 306 ? 10.486  33.736  32.006  1.00 27.65 ? 307  GLU B C   1 
ATOM   4812  O  O   . GLU B  1 306 ? 10.064  32.633  32.359  1.00 28.15 ? 307  GLU B O   1 
ATOM   4813  C  CB  . GLU B  1 306 ? 11.605  34.698  34.125  1.00 31.96 ? 307  GLU B CB  1 
ATOM   4814  C  CG  . GLU B  1 306 ? 11.334  36.216  34.422  1.00 41.11 ? 307  GLU B CG  1 
ATOM   4815  C  CD  . GLU B  1 306 ? 12.588  37.127  34.256  1.00 48.59 ? 307  GLU B CD  1 
ATOM   4816  O  OE1 . GLU B  1 306 ? 13.700  36.734  34.701  1.00 48.94 ? 307  GLU B OE1 1 
ATOM   4817  O  OE2 . GLU B  1 306 ? 12.455  38.229  33.655  1.00 53.35 ? 307  GLU B OE2 1 
ATOM   4818  N  N   . ASN B  1 307 ? 9.901   34.473  31.062  1.00 24.96 ? 308  ASN B N   1 
ATOM   4819  C  CA  . ASN B  1 307 ? 8.738   34.027  30.326  1.00 24.40 ? 308  ASN B CA  1 
ATOM   4820  C  C   . ASN B  1 307 ? 9.059   33.420  28.939  1.00 24.16 ? 308  ASN B C   1 
ATOM   4821  O  O   . ASN B  1 307 ? 8.161   33.252  28.109  1.00 21.43 ? 308  ASN B O   1 
ATOM   4822  C  CB  . ASN B  1 307 ? 7.755   35.179  30.202  1.00 24.78 ? 308  ASN B CB  1 
ATOM   4823  C  CG  . ASN B  1 307 ? 7.231   35.630  31.562  1.00 30.11 ? 308  ASN B CG  1 
ATOM   4824  O  OD1 . ASN B  1 307 ? 6.666   34.831  32.315  1.00 28.07 ? 308  ASN B OD1 1 
ATOM   4825  N  ND2 . ASN B  1 307 ? 7.435   36.907  31.886  1.00 26.26 ? 308  ASN B ND2 1 
ATOM   4826  N  N   . MET B  1 308 ? 10.317  33.029  28.727  1.00 20.25 ? 309  MET B N   1 
ATOM   4827  C  CA  . MET B  1 308 ? 10.748  32.606  27.415  1.00 21.34 ? 309  MET B CA  1 
ATOM   4828  C  C   . MET B  1 308 ? 10.112  31.292  26.985  1.00 18.20 ? 309  MET B C   1 
ATOM   4829  O  O   . MET B  1 308 ? 9.568   31.213  25.891  1.00 18.05 ? 309  MET B O   1 
ATOM   4830  C  CB  . MET B  1 308 ? 12.275  32.550  27.318  1.00 20.54 ? 309  MET B CB  1 
ATOM   4831  C  CG  . MET B  1 308 ? 12.773  32.379  25.900  1.00 26.46 ? 309  MET B CG  1 
ATOM   4832  S  SD  . MET B  1 308 ? 14.455  33.009  25.688  1.00 23.25 ? 309  MET B SD  1 
ATOM   4833  C  CE  . MET B  1 308 ? 14.822  32.544  23.974  1.00 21.80 ? 309  MET B CE  1 
ATOM   4834  N  N   . PRO B  1 309 ? 10.177  30.264  27.834  1.00 18.04 ? 310  PRO B N   1 
ATOM   4835  C  CA  . PRO B  1 309 ? 9.479   29.017  27.547  1.00 17.65 ? 310  PRO B CA  1 
ATOM   4836  C  C   . PRO B  1 309 ? 8.022   29.278  27.200  1.00 20.99 ? 310  PRO B C   1 
ATOM   4837  O  O   . PRO B  1 309 ? 7.531   28.747  26.212  1.00 21.20 ? 310  PRO B O   1 
ATOM   4838  C  CB  . PRO B  1 309 ? 9.633   28.235  28.852  1.00 21.27 ? 310  PRO B CB  1 
ATOM   4839  C  CG  . PRO B  1 309 ? 10.943  28.734  29.416  1.00 20.37 ? 310  PRO B CG  1 
ATOM   4840  C  CD  . PRO B  1 309 ? 10.924  30.189  29.109  1.00 20.17 ? 310  PRO B CD  1 
ATOM   4841  N  N   . ALA B  1 310 ? 7.351   30.137  27.975  1.00 21.91 ? 311  ALA B N   1 
ATOM   4842  C  CA  . ALA B  1 310 ? 5.953   30.516  27.706  1.00 21.59 ? 311  ALA B CA  1 
ATOM   4843  C  C   . ALA B  1 310 ? 5.777   31.146  26.355  1.00 22.97 ? 311  ALA B C   1 
ATOM   4844  O  O   . ALA B  1 310 ? 4.748   30.929  25.708  1.00 25.06 ? 311  ALA B O   1 
ATOM   4845  C  CB  . ALA B  1 310 ? 5.405   31.475  28.792  1.00 19.35 ? 311  ALA B CB  1 
ATOM   4846  N  N   . ALA B  1 311 ? 6.738   31.978  25.945  1.00 22.09 ? 312  ALA B N   1 
ATOM   4847  C  CA  . ALA B  1 311 ? 6.705   32.610  24.608  1.00 18.37 ? 312  ALA B CA  1 
ATOM   4848  C  C   . ALA B  1 311 ? 6.805   31.573  23.490  1.00 16.92 ? 312  ALA B C   1 
ATOM   4849  O  O   . ALA B  1 311 ? 6.075   31.647  22.498  1.00 18.79 ? 312  ALA B O   1 
ATOM   4850  C  CB  . ALA B  1 311 ? 7.844   33.639  24.462  1.00 16.29 ? 312  ALA B CB  1 
ATOM   4851  N  N   . PHE B  1 312 ? 7.724   30.633  23.659  1.00 16.03 ? 313  PHE B N   1 
ATOM   4852  C  CA  . PHE B  1 312 ? 7.922   29.519  22.730  1.00 17.69 ? 313  PHE B CA  1 
ATOM   4853  C  C   . PHE B  1 312 ? 6.662   28.629  22.636  1.00 18.97 ? 313  PHE B C   1 
ATOM   4854  O  O   . PHE B  1 312 ? 6.156   28.363  21.545  1.00 18.60 ? 313  PHE B O   1 
ATOM   4855  C  CB  . PHE B  1 312 ? 9.093   28.685  23.238  1.00 17.25 ? 313  PHE B CB  1 
ATOM   4856  C  CG  . PHE B  1 312 ? 9.384   27.461  22.436  1.00 14.85 ? 313  PHE B CG  1 
ATOM   4857  C  CD1 . PHE B  1 312 ? 9.525   27.527  21.056  1.00 18.24 ? 313  PHE B CD1 1 
ATOM   4858  C  CD2 . PHE B  1 312 ? 9.554   26.251  23.068  1.00 11.25 ? 313  PHE B CD2 1 
ATOM   4859  C  CE1 . PHE B  1 312 ? 9.834   26.414  20.321  1.00 14.57 ? 313  PHE B CE1 1 
ATOM   4860  C  CE2 . PHE B  1 312 ? 9.850   25.117  22.361  1.00 17.86 ? 313  PHE B CE2 1 
ATOM   4861  C  CZ  . PHE B  1 312 ? 9.982   25.185  20.968  1.00 19.43 ? 313  PHE B CZ  1 
ATOM   4862  N  N   . MET B  1 313 ? 6.156   28.194  23.792  1.00 19.97 ? 314  MET B N   1 
ATOM   4863  C  CA  . MET B  1 313 ? 4.948   27.343  23.841  1.00 19.28 ? 314  MET B CA  1 
ATOM   4864  C  C   . MET B  1 313 ? 3.733   28.059  23.257  1.00 17.92 ? 314  MET B C   1 
ATOM   4865  O  O   . MET B  1 313 ? 2.982   27.453  22.502  1.00 18.38 ? 314  MET B O   1 
ATOM   4866  C  CB  . MET B  1 313 ? 4.685   26.860  25.273  1.00 19.63 ? 314  MET B CB  1 
ATOM   4867  C  CG  . MET B  1 313 ? 5.720   25.862  25.727  1.00 17.45 ? 314  MET B CG  1 
ATOM   4868  S  SD  . MET B  1 313 ? 5.423   25.231  27.390  1.00 22.64 ? 314  MET B SD  1 
ATOM   4869  C  CE  . MET B  1 313 ? 6.116   26.588  28.395  1.00 23.12 ? 314  MET B CE  1 
ATOM   4870  N  N   . GLY B  1 314 ? 3.572   29.345  23.567  1.00 18.03 ? 315  GLY B N   1 
ATOM   4871  C  CA  . GLY B  1 314 ? 2.463   30.158  23.040  1.00 18.57 ? 315  GLY B CA  1 
ATOM   4872  C  C   . GLY B  1 314 ? 2.494   30.357  21.523  1.00 21.02 ? 315  GLY B C   1 
ATOM   4873  O  O   . GLY B  1 314 ? 1.445   30.333  20.837  1.00 18.82 ? 315  GLY B O   1 
ATOM   4874  N  N   . MET B  1 315 ? 3.701   30.596  21.002  1.00 19.06 ? 316  MET B N   1 
ATOM   4875  C  CA  . MET B  1 315 ? 3.919   30.619  19.555  1.00 19.48 ? 316  MET B CA  1 
ATOM   4876  C  C   . MET B  1 315 ? 3.569   29.261  18.932  1.00 18.18 ? 316  MET B C   1 
ATOM   4877  O  O   . MET B  1 315 ? 2.831   29.203  17.978  1.00 17.40 ? 316  MET B O   1 
ATOM   4878  C  CB  . MET B  1 315 ? 5.364   31.031  19.223  1.00 18.29 ? 316  MET B CB  1 
ATOM   4879  C  CG  . MET B  1 315 ? 5.693   31.009  17.738  1.00 18.17 ? 316  MET B CG  1 
ATOM   4880  S  SD  . MET B  1 315 ? 6.238   29.366  17.294  1.00 26.23 ? 316  MET B SD  1 
ATOM   4881  C  CE  . MET B  1 315 ? 7.907   29.359  18.069  1.00 13.58 ? 316  MET B CE  1 
ATOM   4882  N  N   . LEU B  1 316 ? 4.088   28.164  19.455  1.00 17.79 ? 317  LEU B N   1 
ATOM   4883  C  CA  . LEU B  1 316 ? 3.656   26.848  18.942  1.00 17.91 ? 317  LEU B CA  1 
ATOM   4884  C  C   . LEU B  1 316 ? 2.126   26.646  19.006  1.00 21.05 ? 317  LEU B C   1 
ATOM   4885  O  O   . LEU B  1 316 ? 1.554   25.941  18.165  1.00 21.26 ? 317  LEU B O   1 
ATOM   4886  C  CB  . LEU B  1 316 ? 4.328   25.727  19.677  1.00 17.63 ? 317  LEU B CB  1 
ATOM   4887  C  CG  . LEU B  1 316 ? 5.846   25.674  19.573  1.00 19.02 ? 317  LEU B CG  1 
ATOM   4888  C  CD1 . LEU B  1 316 ? 6.321   24.526  20.435  1.00 15.61 ? 317  LEU B CD1 1 
ATOM   4889  C  CD2 . LEU B  1 316 ? 6.264   25.479  18.145  1.00 17.35 ? 317  LEU B CD2 1 
ATOM   4890  N  N   . LYS B  1 317 ? 1.456   27.278  19.962  1.00 19.80 ? 318  LYS B N   1 
ATOM   4891  C  CA  . LYS B  1 317 ? 0.001   27.122  20.092  1.00 20.42 ? 318  LYS B CA  1 
ATOM   4892  C  C   . LYS B  1 317 ? -0.784  28.209  19.364  1.00 20.88 ? 318  LYS B C   1 
ATOM   4893  O  O   . LYS B  1 317 ? -2.003  28.238  19.452  1.00 20.71 ? 318  LYS B O   1 
ATOM   4894  C  CB  . LYS B  1 317 ? -0.391  27.041  21.578  1.00 20.88 ? 318  LYS B CB  1 
ATOM   4895  C  CG  . LYS B  1 317 ? -0.245  25.630  22.166  1.00 23.89 ? 318  LYS B CG  1 
ATOM   4896  C  CD  . LYS B  1 317 ? -1.561  24.855  21.972  1.00 26.62 ? 318  LYS B CD  1 
ATOM   4897  C  CE  . LYS B  1 317 ? -1.531  23.507  22.575  1.00 26.77 ? 318  LYS B CE  1 
ATOM   4898  N  NZ  . LYS B  1 317 ? -2.755  22.710  22.124  1.00 22.99 ? 318  LYS B NZ  1 
ATOM   4899  N  N   . GLY B  1 318 ? -0.093  29.090  18.630  1.00 20.99 ? 319  GLY B N   1 
ATOM   4900  C  CA  . GLY B  1 318 ? -0.759  30.112  17.840  1.00 20.05 ? 319  GLY B CA  1 
ATOM   4901  C  C   . GLY B  1 318 ? -1.160  31.409  18.535  1.00 20.97 ? 319  GLY B C   1 
ATOM   4902  O  O   . GLY B  1 318 ? -1.906  32.208  17.965  1.00 20.79 ? 319  GLY B O   1 
ATOM   4903  N  N   . ASP B  1 319 ? -0.635  31.655  19.730  1.00 20.14 ? 320  ASP B N   1 
ATOM   4904  C  CA  . ASP B  1 319 ? -0.943  32.902  20.448  1.00 22.58 ? 320  ASP B CA  1 
ATOM   4905  C  C   . ASP B  1 319 ? -0.503  34.151  19.712  1.00 23.38 ? 320  ASP B C   1 
ATOM   4906  O  O   . ASP B  1 319 ? -1.155  35.174  19.805  1.00 22.19 ? 320  ASP B O   1 
ATOM   4907  C  CB  . ASP B  1 319 ? -0.254  32.935  21.815  1.00 23.49 ? 320  ASP B CB  1 
ATOM   4908  C  CG  . ASP B  1 319 ? -0.826  31.969  22.796  1.00 24.20 ? 320  ASP B CG  1 
ATOM   4909  O  OD1 . ASP B  1 319 ? -1.852  31.315  22.495  1.00 31.01 ? 320  ASP B OD1 1 
ATOM   4910  O  OD2 . ASP B  1 319 ? -0.252  31.879  23.904  1.00 32.98 ? 320  ASP B OD2 1 
ATOM   4911  N  N   . ASN B  1 320 ? 0.625   34.074  19.003  1.00 25.35 ? 321  ASN B N   1 
ATOM   4912  C  CA  . ASN B  1 320 ? 1.264   35.269  18.408  1.00 23.36 ? 321  ASN B CA  1 
ATOM   4913  C  C   . ASN B  1 320 ? 0.618   35.795  17.155  1.00 24.30 ? 321  ASN B C   1 
ATOM   4914  O  O   . ASN B  1 320 ? 0.277   35.034  16.272  1.00 23.72 ? 321  ASN B O   1 
ATOM   4915  C  CB  . ASN B  1 320 ? 2.739   34.987  18.076  1.00 23.02 ? 321  ASN B CB  1 
ATOM   4916  C  CG  . ASN B  1 320 ? 2.915   33.875  17.040  1.00 20.96 ? 321  ASN B CG  1 
ATOM   4917  O  OD1 . ASN B  1 320 ? 2.578   32.732  17.294  1.00 19.50 ? 321  ASN B OD1 1 
ATOM   4918  N  ND2 . ASN B  1 320 ? 3.470   34.213  15.885  1.00 17.18 ? 321  ASN B ND2 1 
ATOM   4919  N  N   . LEU B  1 321 ? 0.479   37.119  17.086  1.00 25.21 ? 322  LEU B N   1 
ATOM   4920  C  CA  . LEU B  1 321 ? 0.249   37.837  15.854  1.00 26.25 ? 322  LEU B CA  1 
ATOM   4921  C  C   . LEU B  1 321 ? 1.585   38.510  15.490  1.00 25.14 ? 322  LEU B C   1 
ATOM   4922  O  O   . LEU B  1 321 ? 2.104   39.311  16.235  1.00 24.71 ? 322  LEU B O   1 
ATOM   4923  C  CB  . LEU B  1 321 ? -0.853  38.865  16.059  1.00 27.59 ? 322  LEU B CB  1 
ATOM   4924  C  CG  . LEU B  1 321 ? -1.518  39.386  14.778  1.00 35.37 ? 322  LEU B CG  1 
ATOM   4925  C  CD1 . LEU B  1 321 ? -2.930  39.904  15.039  1.00 40.18 ? 322  LEU B CD1 1 
ATOM   4926  C  CD2 . LEU B  1 321 ? -0.680  40.449  14.129  1.00 41.52 ? 322  LEU B CD2 1 
ATOM   4927  N  N   . GLY B  1 322 ? 2.156   38.152  14.352  1.00 26.48 ? 323  GLY B N   1 
ATOM   4928  C  CA  . GLY B  1 322 ? 3.517   38.573  13.998  1.00 24.72 ? 323  GLY B CA  1 
ATOM   4929  C  C   . GLY B  1 322 ? 4.597   37.815  14.772  1.00 22.25 ? 323  GLY B C   1 
ATOM   4930  O  O   . GLY B  1 322 ? 4.320   36.839  15.444  1.00 21.73 ? 323  GLY B O   1 
ATOM   4931  N  N   . LYS B  1 323 ? 5.827   38.297  14.672  1.00 22.22 ? 324  LYS B N   1 
ATOM   4932  C  CA  . LYS B  1 323 ? 7.015   37.658  15.245  1.00 20.83 ? 324  LYS B CA  1 
ATOM   4933  C  C   . LYS B  1 323 ? 6.991   37.654  16.753  1.00 20.50 ? 324  LYS B C   1 
ATOM   4934  O  O   . LYS B  1 323 ? 6.763   38.701  17.373  1.00 19.96 ? 324  LYS B O   1 
ATOM   4935  C  CB  . LYS B  1 323 ? 8.275   38.385  14.782  1.00 20.21 ? 324  LYS B CB  1 
ATOM   4936  C  CG  . LYS B  1 323 ? 9.586   37.796  15.299  1.00 21.76 ? 324  LYS B CG  1 
ATOM   4937  C  CD  . LYS B  1 323 ? 9.922   36.489  14.586  1.00 21.15 ? 324  LYS B CD  1 
ATOM   4938  C  CE  . LYS B  1 323 ? 11.000  35.683  15.329  1.00 19.29 ? 324  LYS B CE  1 
ATOM   4939  N  NZ  . LYS B  1 323 ? 10.425  34.902  16.468  1.00 17.32 ? 324  LYS B NZ  1 
ATOM   4940  N  N   . THR B  1 324 ? 7.251   36.477  17.332  1.00 19.67 ? 325  THR B N   1 
ATOM   4941  C  CA  . THR B  1 324 ? 7.265   36.310  18.760  1.00 17.76 ? 325  THR B CA  1 
ATOM   4942  C  C   . THR B  1 324 ? 8.662   36.715  19.242  1.00 19.80 ? 325  THR B C   1 
ATOM   4943  O  O   . THR B  1 324 ? 9.675   36.168  18.783  1.00 17.77 ? 325  THR B O   1 
ATOM   4944  C  CB  . THR B  1 324 ? 6.944   34.849  19.181  1.00 19.72 ? 325  THR B CB  1 
ATOM   4945  O  OG1 . THR B  1 324 ? 5.803   34.354  18.470  1.00 17.68 ? 325  THR B OG1 1 
ATOM   4946  C  CG2 . THR B  1 324 ? 6.683   34.771  20.657  1.00 15.00 ? 325  THR B CG2 1 
ATOM   4947  N  N   . ILE B  1 325 ? 8.694   37.672  20.164  1.00 20.38 ? 326  ILE B N   1 
ATOM   4948  C  CA  . ILE B  1 325 ? 9.930   38.317  20.644  1.00 21.10 ? 326  ILE B CA  1 
ATOM   4949  C  C   . ILE B  1 325 ? 9.905   38.358  22.160  1.00 22.59 ? 326  ILE B C   1 
ATOM   4950  O  O   . ILE B  1 325 ? 8.906   38.773  22.758  1.00 24.14 ? 326  ILE B O   1 
ATOM   4951  C  CB  . ILE B  1 325 ? 10.006  39.758  20.127  1.00 20.12 ? 326  ILE B CB  1 
ATOM   4952  C  CG1 . ILE B  1 325 ? 10.236  39.768  18.609  1.00 22.96 ? 326  ILE B CG1 1 
ATOM   4953  C  CG2 . ILE B  1 325 ? 11.091  40.550  20.855  1.00 22.06 ? 326  ILE B CG2 1 
ATOM   4954  C  CD1 . ILE B  1 325 ? 11.599  39.179  18.182  1.00 15.64 ? 326  ILE B CD1 1 
ATOM   4955  N  N   . VAL B  1 326 ? 10.963  37.892  22.805  1.00 22.01 ? 327  VAL B N   1 
ATOM   4956  C  CA  . VAL B  1 326 ? 11.074  38.076  24.231  1.00 21.42 ? 327  VAL B CA  1 
ATOM   4957  C  C   . VAL B  1 326 ? 11.969  39.284  24.498  1.00 24.92 ? 327  VAL B C   1 
ATOM   4958  O  O   . VAL B  1 326 ? 13.133  39.323  24.092  1.00 19.42 ? 327  VAL B O   1 
ATOM   4959  C  CB  . VAL B  1 326 ? 11.632  36.868  24.936  1.00 22.43 ? 327  VAL B CB  1 
ATOM   4960  C  CG1 . VAL B  1 326 ? 11.716  37.161  26.450  1.00 25.28 ? 327  VAL B CG1 1 
ATOM   4961  C  CG2 . VAL B  1 326 ? 10.751  35.659  24.691  1.00 21.46 ? 327  VAL B CG2 1 
ATOM   4962  N  N   . LYS B  1 327 ? 11.407  40.286  25.172  1.00 26.11 ? 328  LYS B N   1 
ATOM   4963  C  CA  . LYS B  1 327 ? 12.186  41.436  25.606  1.00 26.42 ? 328  LYS B CA  1 
ATOM   4964  C  C   . LYS B  1 327 ? 12.855  41.049  26.909  1.00 25.07 ? 328  LYS B C   1 
ATOM   4965  O  O   . LYS B  1 327 ? 12.159  40.726  27.860  1.00 23.82 ? 328  LYS B O   1 
ATOM   4966  C  CB  . LYS B  1 327 ? 11.267  42.647  25.765  1.00 28.04 ? 328  LYS B CB  1 
ATOM   4967  C  CG  . LYS B  1 327 ? 11.979  43.905  26.163  1.00 32.86 ? 328  LYS B CG  1 
ATOM   4968  C  CD  . LYS B  1 327 ? 11.034  45.072  26.253  1.00 37.86 ? 328  LYS B CD  1 
ATOM   4969  C  CE  . LYS B  1 327 ? 11.782  46.313  26.643  1.00 42.06 ? 328  LYS B CE  1 
ATOM   4970  N  NZ  . LYS B  1 327 ? 10.864  47.232  27.361  1.00 51.62 ? 328  LYS B NZ  1 
ATOM   4971  N  N   . ALA B  1 328 ? 14.193  41.064  26.974  1.00 25.88 ? 329  ALA B N   1 
ATOM   4972  C  CA  . ALA B  1 328 ? 14.901  40.591  28.202  1.00 28.44 ? 329  ALA B CA  1 
ATOM   4973  C  C   . ALA B  1 328 ? 14.606  41.440  29.460  1.00 31.07 ? 329  ALA B C   1 
ATOM   4974  O  O   . ALA B  1 328 ? 14.478  42.664  29.364  1.00 32.79 ? 329  ALA B O   1 
ATOM   4975  C  CB  . ALA B  1 328 ? 16.391  40.514  27.983  1.00 27.69 ? 329  ALA B CB  1 
ATOM   4976  N  N   . SER C  1 1   ? 13.841  91.927  24.496  1.00 49.41 ? 2    SER C N   1 
ATOM   4977  C  CA  . SER C  1 1   ? 14.234  90.607  25.078  1.00 49.79 ? 2    SER C CA  1 
ATOM   4978  C  C   . SER C  1 1   ? 13.925  90.586  26.575  1.00 47.18 ? 2    SER C C   1 
ATOM   4979  O  O   . SER C  1 1   ? 14.734  91.038  27.391  1.00 47.39 ? 2    SER C O   1 
ATOM   4980  C  CB  . SER C  1 1   ? 15.721  90.311  24.839  1.00 50.79 ? 2    SER C CB  1 
ATOM   4981  O  OG  . SER C  1 1   ? 16.073  89.034  25.358  1.00 53.32 ? 2    SER C OG  1 
ATOM   4982  N  N   . MET C  1 2   ? 12.751  90.052  26.912  1.00 44.89 ? 3    MET C N   1 
ATOM   4983  C  CA  . MET C  1 2   ? 12.211  90.096  28.275  1.00 44.16 ? 3    MET C CA  1 
ATOM   4984  C  C   . MET C  1 2   ? 11.878  88.699  28.762  1.00 41.35 ? 3    MET C C   1 
ATOM   4985  O  O   . MET C  1 2   ? 11.527  87.819  27.961  1.00 40.94 ? 3    MET C O   1 
ATOM   4986  C  CB  . MET C  1 2   ? 10.915  90.921  28.307  1.00 45.04 ? 3    MET C CB  1 
ATOM   4987  C  CG  . MET C  1 2   ? 11.060  92.379  27.819  1.00 49.27 ? 3    MET C CG  1 
ATOM   4988  S  SD  . MET C  1 2   ? 11.999  93.437  28.949  1.00 55.20 ? 3    MET C SD  1 
ATOM   4989  C  CE  . MET C  1 2   ? 10.870  93.533  30.344  1.00 51.46 ? 3    MET C CE  1 
ATOM   4990  N  N   . THR C  1 3   ? 11.964  88.515  30.079  1.00 38.65 ? 4    THR C N   1 
ATOM   4991  C  CA  . THR C  1 3   ? 11.542  87.271  30.712  1.00 35.16 ? 4    THR C CA  1 
ATOM   4992  C  C   . THR C  1 3   ? 10.707  87.510  31.944  1.00 33.12 ? 4    THR C C   1 
ATOM   4993  O  O   . THR C  1 3   ? 10.883  88.512  32.618  1.00 33.69 ? 4    THR C O   1 
ATOM   4994  C  CB  . THR C  1 3   ? 12.731  86.388  31.117  1.00 35.00 ? 4    THR C CB  1 
ATOM   4995  O  OG1 . THR C  1 3   ? 12.241  85.081  31.440  1.00 34.12 ? 4    THR C OG1 1 
ATOM   4996  C  CG2 . THR C  1 3   ? 13.492  86.961  32.313  1.00 30.49 ? 4    THR C CG2 1 
ATOM   4997  N  N   . LYS C  1 4   ? 9.808   86.570  32.231  1.00 32.18 ? 5    LYS C N   1 
ATOM   4998  C  CA  . LYS C  1 4   ? 9.099   86.532  33.513  1.00 31.66 ? 5    LYS C CA  1 
ATOM   4999  C  C   . LYS C  1 4   ? 9.593   85.355  34.358  1.00 30.61 ? 5    LYS C C   1 
ATOM   5000  O  O   . LYS C  1 4   ? 9.698   84.243  33.849  1.00 31.17 ? 5    LYS C O   1 
ATOM   5001  C  CB  . LYS C  1 4   ? 7.607   86.361  33.284  1.00 32.97 ? 5    LYS C CB  1 
ATOM   5002  C  CG  . LYS C  1 4   ? 6.887   87.513  32.547  1.00 38.13 ? 5    LYS C CG  1 
ATOM   5003  C  CD  . LYS C  1 4   ? 5.497   86.992  32.091  1.00 45.15 ? 5    LYS C CD  1 
ATOM   5004  C  CE  . LYS C  1 4   ? 4.434   88.079  32.014  1.00 55.49 ? 5    LYS C CE  1 
ATOM   5005  N  NZ  . LYS C  1 4   ? 3.110   87.475  31.649  1.00 60.19 ? 5    LYS C NZ  1 
ATOM   5006  N  N   . THR C  1 5   ? 9.853   85.602  35.644  1.00 28.28 ? 6    THR C N   1 
ATOM   5007  C  CA  . THR C  1 5   ? 10.370  84.608  36.551  1.00 27.45 ? 6    THR C CA  1 
ATOM   5008  C  C   . THR C  1 5   ? 9.558   84.562  37.861  1.00 27.21 ? 6    THR C C   1 
ATOM   5009  O  O   . THR C  1 5   ? 9.305   85.590  38.484  1.00 26.77 ? 6    THR C O   1 
ATOM   5010  C  CB  . THR C  1 5   ? 11.836  84.922  36.895  1.00 27.75 ? 6    THR C CB  1 
ATOM   5011  O  OG1 . THR C  1 5   ? 12.575  85.088  35.683  1.00 30.21 ? 6    THR C OG1 1 
ATOM   5012  C  CG2 . THR C  1 5   ? 12.472  83.811  37.730  1.00 26.76 ? 6    THR C CG2 1 
ATOM   5013  N  N   . TRP C  1 6   ? 9.174   83.359  38.281  1.00 25.95 ? 7    TRP C N   1 
ATOM   5014  C  CA  . TRP C  1 6   ? 8.561   83.141  39.602  1.00 24.03 ? 7    TRP C CA  1 
ATOM   5015  C  C   . TRP C  1 6   ? 9.660   82.879  40.654  1.00 23.87 ? 7    TRP C C   1 
ATOM   5016  O  O   . TRP C  1 6   ? 10.474  81.947  40.518  1.00 25.72 ? 7    TRP C O   1 
ATOM   5017  C  CB  . TRP C  1 6   ? 7.585   81.983  39.559  1.00 21.77 ? 7    TRP C CB  1 
ATOM   5018  C  CG  . TRP C  1 6   ? 6.216   82.297  39.048  1.00 20.49 ? 7    TRP C CG  1 
ATOM   5019  C  CD1 . TRP C  1 6   ? 5.636   81.791  37.937  1.00 22.97 ? 7    TRP C CD1 1 
ATOM   5020  C  CD2 . TRP C  1 6   ? 5.223   83.143  39.667  1.00 22.45 ? 7    TRP C CD2 1 
ATOM   5021  N  NE1 . TRP C  1 6   ? 4.352   82.283  37.793  1.00 25.91 ? 7    TRP C NE1 1 
ATOM   5022  C  CE2 . TRP C  1 6   ? 4.070   83.100  38.856  1.00 22.83 ? 7    TRP C CE2 1 
ATOM   5023  C  CE3 . TRP C  1 6   ? 5.192   83.908  40.836  1.00 27.15 ? 7    TRP C CE3 1 
ATOM   5024  C  CZ2 . TRP C  1 6   ? 2.894   83.806  39.167  1.00 26.96 ? 7    TRP C CZ2 1 
ATOM   5025  C  CZ3 . TRP C  1 6   ? 4.012   84.623  41.149  1.00 24.02 ? 7    TRP C CZ3 1 
ATOM   5026  C  CH2 . TRP C  1 6   ? 2.886   84.563  40.313  1.00 22.69 ? 7    TRP C CH2 1 
ATOM   5027  N  N   . THR C  1 7   ? 9.696   83.723  41.681  1.00 22.30 ? 8    THR C N   1 
ATOM   5028  C  CA  . THR C  1 7   ? 10.677  83.630  42.746  1.00 23.20 ? 8    THR C CA  1 
ATOM   5029  C  C   . THR C  1 7   ? 9.955   83.228  44.019  1.00 25.01 ? 8    THR C C   1 
ATOM   5030  O  O   . THR C  1 7   ? 8.720   83.341  44.101  1.00 25.43 ? 8    THR C O   1 
ATOM   5031  C  CB  . THR C  1 7   ? 11.405  84.993  42.961  1.00 24.12 ? 8    THR C CB  1 
ATOM   5032  O  OG1 . THR C  1 7   ? 10.449  85.991  43.332  1.00 26.42 ? 8    THR C OG1 1 
ATOM   5033  C  CG2 . THR C  1 7   ? 12.128  85.455  41.659  1.00 19.60 ? 8    THR C CG2 1 
ATOM   5034  N  N   . LEU C  1 8   ? 10.721  82.730  44.991  1.00 25.52 ? 9    LEU C N   1 
ATOM   5035  C  CA  . LEU C  1 8   ? 10.225  82.477  46.334  1.00 25.62 ? 9    LEU C CA  1 
ATOM   5036  C  C   . LEU C  1 8   ? 10.297  83.766  47.167  1.00 25.64 ? 9    LEU C C   1 
ATOM   5037  O  O   . LEU C  1 8   ? 11.385  84.252  47.520  1.00 27.60 ? 9    LEU C O   1 
ATOM   5038  C  CB  . LEU C  1 8   ? 11.033  81.367  47.014  1.00 26.12 ? 9    LEU C CB  1 
ATOM   5039  C  CG  . LEU C  1 8   ? 10.536  80.829  48.382  1.00 26.37 ? 9    LEU C CG  1 
ATOM   5040  C  CD1 . LEU C  1 8   ? 9.307   79.962  48.260  1.00 21.24 ? 9    LEU C CD1 1 
ATOM   5041  C  CD2 . LEU C  1 8   ? 11.640  80.018  49.052  1.00 25.16 ? 9    LEU C CD2 1 
ATOM   5042  N  N   . LYS C  1 9   ? 9.133   84.310  47.484  1.00 25.73 ? 10   LYS C N   1 
ATOM   5043  C  CA  . LYS C  1 9   ? 9.032   85.513  48.306  1.00 27.83 ? 10   LYS C CA  1 
ATOM   5044  C  C   . LYS C  1 9   ? 9.209   85.155  49.781  1.00 27.60 ? 10   LYS C C   1 
ATOM   5045  O  O   . LYS C  1 9   ? 9.942   85.825  50.509  1.00 28.15 ? 10   LYS C O   1 
ATOM   5046  C  CB  . LYS C  1 9   ? 7.673   86.208  48.065  1.00 29.62 ? 10   LYS C CB  1 
ATOM   5047  C  CG  . LYS C  1 9   ? 7.509   87.561  48.790  1.00 33.72 ? 10   LYS C CG  1 
ATOM   5048  C  CD  . LYS C  1 9   ? 6.400   88.425  48.180  1.00 42.06 ? 10   LYS C CD  1 
ATOM   5049  C  CE  . LYS C  1 9   ? 5.160   88.554  49.047  1.00 51.93 ? 10   LYS C CE  1 
ATOM   5050  N  NZ  . LYS C  1 9   ? 3.958   88.883  48.207  1.00 52.20 ? 10   LYS C NZ  1 
ATOM   5051  N  N   . LYS C  1 10  ? 8.555   84.079  50.209  1.00 26.70 ? 11   LYS C N   1 
ATOM   5052  C  CA  . LYS C  1 10  ? 8.613   83.646  51.607  1.00 27.20 ? 11   LYS C CA  1 
ATOM   5053  C  C   . LYS C  1 10  ? 8.607   82.128  51.689  1.00 25.64 ? 11   LYS C C   1 
ATOM   5054  O  O   . LYS C  1 10  ? 7.897   81.466  50.935  1.00 21.39 ? 11   LYS C O   1 
ATOM   5055  C  CB  . LYS C  1 10  ? 7.390   84.151  52.382  1.00 29.67 ? 11   LYS C CB  1 
ATOM   5056  C  CG  . LYS C  1 10  ? 7.295   85.657  52.611  1.00 36.25 ? 11   LYS C CG  1 
ATOM   5057  C  CD  . LYS C  1 10  ? 8.468   86.255  53.380  1.00 45.87 ? 11   LYS C CD  1 
ATOM   5058  C  CE  . LYS C  1 10  ? 8.521   85.811  54.820  1.00 49.97 ? 11   LYS C CE  1 
ATOM   5059  N  NZ  . LYS C  1 10  ? 9.490   86.670  55.568  1.00 56.09 ? 11   LYS C NZ  1 
ATOM   5060  N  N   . HIS C  1 11  ? 9.369   81.588  52.634  1.00 23.17 ? 12   HIS C N   1 
ATOM   5061  C  CA  . HIS C  1 11  ? 9.399   80.154  52.840  1.00 23.37 ? 12   HIS C CA  1 
ATOM   5062  C  C   . HIS C  1 11  ? 8.036   79.677  53.232  1.00 22.85 ? 12   HIS C C   1 
ATOM   5063  O  O   . HIS C  1 11  ? 7.332   80.360  53.960  1.00 24.04 ? 12   HIS C O   1 
ATOM   5064  C  CB  . HIS C  1 11  ? 10.438  79.781  53.900  1.00 24.85 ? 12   HIS C CB  1 
ATOM   5065  C  CG  . HIS C  1 11  ? 11.832  79.792  53.370  1.00 28.35 ? 12   HIS C CG  1 
ATOM   5066  N  ND1 . HIS C  1 11  ? 12.277  78.860  52.453  1.00 27.30 ? 12   HIS C ND1 1 
ATOM   5067  C  CD2 . HIS C  1 11  ? 12.865  80.643  53.582  1.00 24.94 ? 12   HIS C CD2 1 
ATOM   5068  C  CE1 . HIS C  1 11  ? 13.534  79.123  52.150  1.00 27.37 ? 12   HIS C CE1 1 
ATOM   5069  N  NE2 . HIS C  1 11  ? 13.913  80.200  52.816  1.00 28.44 ? 12   HIS C NE2 1 
ATOM   5070  N  N   . PHE C  1 12  ? 7.657   78.511  52.727  1.00 22.86 ? 13   PHE C N   1 
ATOM   5071  C  CA  . PHE C  1 12  ? 6.318   77.989  52.914  1.00 21.60 ? 13   PHE C CA  1 
ATOM   5072  C  C   . PHE C  1 12  ? 6.126   77.550  54.359  1.00 23.86 ? 13   PHE C C   1 
ATOM   5073  O  O   . PHE C  1 12  ? 7.060   77.067  54.989  1.00 23.61 ? 13   PHE C O   1 
ATOM   5074  C  CB  . PHE C  1 12  ? 6.079   76.780  52.026  1.00 20.98 ? 13   PHE C CB  1 
ATOM   5075  C  CG  . PHE C  1 12  ? 6.422   76.992  50.602  1.00 21.64 ? 13   PHE C CG  1 
ATOM   5076  C  CD1 . PHE C  1 12  ? 5.991   78.119  49.926  1.00 19.46 ? 13   PHE C CD1 1 
ATOM   5077  C  CD2 . PHE C  1 12  ? 7.207   76.068  49.925  1.00 20.27 ? 13   PHE C CD2 1 
ATOM   5078  C  CE1 . PHE C  1 12  ? 6.334   78.315  48.580  1.00 24.24 ? 13   PHE C CE1 1 
ATOM   5079  C  CE2 . PHE C  1 12  ? 7.542   76.259  48.584  1.00 18.49 ? 13   PHE C CE2 1 
ATOM   5080  C  CZ  . PHE C  1 12  ? 7.110   77.368  47.912  1.00 19.87 ? 13   PHE C CZ  1 
ATOM   5081  N  N   . VAL C  1 13  ? 4.907   77.718  54.862  1.00 23.41 ? 14   VAL C N   1 
ATOM   5082  C  CA  . VAL C  1 13  ? 4.508   77.204  56.175  1.00 23.16 ? 14   VAL C CA  1 
ATOM   5083  C  C   . VAL C  1 13  ? 3.260   76.353  55.944  1.00 21.75 ? 14   VAL C C   1 
ATOM   5084  O  O   . VAL C  1 13  ? 2.200   76.874  55.587  1.00 19.82 ? 14   VAL C O   1 
ATOM   5085  C  CB  . VAL C  1 13  ? 4.198   78.349  57.163  1.00 23.67 ? 14   VAL C CB  1 
ATOM   5086  C  CG1 . VAL C  1 13  ? 3.612   77.793  58.462  1.00 24.28 ? 14   VAL C CG1 1 
ATOM   5087  C  CG2 . VAL C  1 13  ? 5.462   79.159  57.459  1.00 22.15 ? 14   VAL C CG2 1 
ATOM   5088  N  N   . GLY C  1 14  ? 3.392   75.044  56.121  1.00 19.63 ? 15   GLY C N   1 
ATOM   5089  C  CA  . GLY C  1 14  ? 2.338   74.114  55.728  1.00 20.05 ? 15   GLY C CA  1 
ATOM   5090  C  C   . GLY C  1 14  ? 2.351   74.075  54.220  1.00 21.80 ? 15   GLY C C   1 
ATOM   5091  O  O   . GLY C  1 14  ? 3.420   74.107  53.610  1.00 24.55 ? 15   GLY C O   1 
ATOM   5092  N  N   . TYR C  1 15  ? 1.175   74.019  53.624  1.00 20.81 ? 16   TYR C N   1 
ATOM   5093  C  CA  . TYR C  1 15  ? 1.033   74.219  52.191  1.00 20.80 ? 16   TYR C CA  1 
ATOM   5094  C  C   . TYR C  1 15  ? 1.403   75.648  51.806  1.00 19.98 ? 16   TYR C C   1 
ATOM   5095  O  O   . TYR C  1 15  ? 1.258   76.564  52.608  1.00 18.90 ? 16   TYR C O   1 
ATOM   5096  C  CB  . TYR C  1 15  ? -0.387  73.919  51.724  1.00 18.85 ? 16   TYR C CB  1 
ATOM   5097  C  CG  . TYR C  1 15  ? -0.758  72.462  51.771  1.00 20.01 ? 16   TYR C CG  1 
ATOM   5098  C  CD1 . TYR C  1 15  ? -1.307  71.901  52.916  1.00 22.45 ? 16   TYR C CD1 1 
ATOM   5099  C  CD2 . TYR C  1 15  ? -0.574  71.643  50.662  1.00 21.68 ? 16   TYR C CD2 1 
ATOM   5100  C  CE1 . TYR C  1 15  ? -1.653  70.567  52.962  1.00 27.58 ? 16   TYR C CE1 1 
ATOM   5101  C  CE2 . TYR C  1 15  ? -0.920  70.300  50.700  1.00 22.48 ? 16   TYR C CE2 1 
ATOM   5102  C  CZ  . TYR C  1 15  ? -1.459  69.770  51.849  1.00 23.67 ? 16   TYR C CZ  1 
ATOM   5103  O  OH  . TYR C  1 15  ? -1.803  68.452  51.891  1.00 21.08 ? 16   TYR C OH  1 
ATOM   5104  N  N   . PRO C  1 16  ? 1.916   75.833  50.569  1.00 21.20 ? 17   PRO C N   1 
ATOM   5105  C  CA  . PRO C  1 16  ? 2.156   77.196  50.084  1.00 20.64 ? 17   PRO C CA  1 
ATOM   5106  C  C   . PRO C  1 16  ? 0.850   77.944  49.914  1.00 19.19 ? 17   PRO C C   1 
ATOM   5107  O  O   . PRO C  1 16  ? -0.209  77.315  49.742  1.00 17.07 ? 17   PRO C O   1 
ATOM   5108  C  CB  . PRO C  1 16  ? 2.790   76.982  48.709  1.00 20.27 ? 17   PRO C CB  1 
ATOM   5109  C  CG  . PRO C  1 16  ? 3.255   75.579  48.684  1.00 21.84 ? 17   PRO C CG  1 
ATOM   5110  C  CD  . PRO C  1 16  ? 2.243   74.834  49.538  1.00 20.11 ? 17   PRO C CD  1 
ATOM   5111  N  N   . THR C  1 17  ? 0.936   79.265  49.924  1.00 18.64 ? 18   THR C N   1 
ATOM   5112  C  CA  . THR C  1 17  ? -0.134  80.100  49.375  1.00 20.67 ? 18   THR C CA  1 
ATOM   5113  C  C   . THR C  1 17  ? 0.462   81.118  48.399  1.00 22.08 ? 18   THR C C   1 
ATOM   5114  O  O   . THR C  1 17  ? 1.702   81.325  48.343  1.00 21.82 ? 18   THR C O   1 
ATOM   5115  C  CB  . THR C  1 17  ? -0.954  80.824  50.526  1.00 22.81 ? 18   THR C CB  1 
ATOM   5116  O  OG1 . THR C  1 17  ? -2.090  81.527  49.990  1.00 24.50 ? 18   THR C OG1 1 
ATOM   5117  C  CG2 . THR C  1 17  ? -0.080  81.795  51.275  1.00 17.35 ? 18   THR C CG2 1 
ATOM   5118  N  N   . ASN C  1 18  ? -0.426  81.764  47.644  1.00 21.64 ? 19   ASN C N   1 
ATOM   5119  C  CA  . ASN C  1 18  ? -0.035  82.647  46.534  1.00 23.16 ? 19   ASN C CA  1 
ATOM   5120  C  C   . ASN C  1 18  ? 0.956   83.696  46.928  1.00 23.58 ? 19   ASN C C   1 
ATOM   5121  O  O   . ASN C  1 18  ? 1.881   84.013  46.168  1.00 22.70 ? 19   ASN C O   1 
ATOM   5122  C  CB  . ASN C  1 18  ? -1.257  83.324  45.919  1.00 24.07 ? 19   ASN C CB  1 
ATOM   5123  C  CG  . ASN C  1 18  ? -2.263  82.332  45.450  1.00 22.14 ? 19   ASN C CG  1 
ATOM   5124  O  OD1 . ASN C  1 18  ? -3.091  81.866  46.228  1.00 23.54 ? 19   ASN C OD1 1 
ATOM   5125  N  ND2 . ASN C  1 18  ? -2.201  81.983  44.176  1.00 23.62 ? 19   ASN C ND2 1 
ATOM   5126  N  N   . SER C  1 19  ? 0.807   84.203  48.139  1.00 23.27 ? 20   SER C N   1 
ATOM   5127  C  CA  . SER C  1 19  ? 1.637   85.300  48.576  1.00 23.55 ? 20   SER C CA  1 
ATOM   5128  C  C   . SER C  1 19  ? 3.063   84.857  48.942  1.00 23.07 ? 20   SER C C   1 
ATOM   5129  O  O   . SER C  1 19  ? 3.910   85.705  49.194  1.00 21.49 ? 20   SER C O   1 
ATOM   5130  C  CB  . SER C  1 19  ? 0.970   86.028  49.742  1.00 23.43 ? 20   SER C CB  1 
ATOM   5131  O  OG  . SER C  1 19  ? 0.888   85.197  50.874  1.00 26.55 ? 20   SER C OG  1 
ATOM   5132  N  N   . ASP C  1 20  ? 3.331   83.549  48.963  1.00 23.81 ? 21   ASP C N   1 
ATOM   5133  C  CA  . ASP C  1 20  ? 4.701   83.054  49.159  1.00 23.59 ? 21   ASP C CA  1 
ATOM   5134  C  C   . ASP C  1 20  ? 5.530   83.168  47.854  1.00 24.95 ? 21   ASP C C   1 
ATOM   5135  O  O   . ASP C  1 20  ? 6.767   83.012  47.877  1.00 24.66 ? 21   ASP C O   1 
ATOM   5136  C  CB  . ASP C  1 20  ? 4.703   81.601  49.657  1.00 24.44 ? 21   ASP C CB  1 
ATOM   5137  C  CG  . ASP C  1 20  ? 3.955   81.412  50.982  1.00 24.48 ? 21   ASP C CG  1 
ATOM   5138  O  OD1 . ASP C  1 20  ? 4.044   82.301  51.857  1.00 17.68 ? 21   ASP C OD1 1 
ATOM   5139  O  OD2 . ASP C  1 20  ? 3.304   80.348  51.148  1.00 23.04 ? 21   ASP C OD2 1 
ATOM   5140  N  N   . PHE C  1 21  ? 4.854   83.418  46.729  1.00 24.13 ? 22   PHE C N   1 
ATOM   5141  C  CA  . PHE C  1 21  ? 5.511   83.614  45.427  1.00 23.77 ? 22   PHE C CA  1 
ATOM   5142  C  C   . PHE C  1 21  ? 5.455   85.069  44.926  1.00 27.87 ? 22   PHE C C   1 
ATOM   5143  O  O   . PHE C  1 21  ? 4.514   85.820  45.242  1.00 29.07 ? 22   PHE C O   1 
ATOM   5144  C  CB  . PHE C  1 21  ? 4.845   82.755  44.385  1.00 22.54 ? 22   PHE C CB  1 
ATOM   5145  C  CG  . PHE C  1 21  ? 4.666   81.338  44.794  1.00 22.57 ? 22   PHE C CG  1 
ATOM   5146  C  CD1 . PHE C  1 21  ? 3.509   80.932  45.460  1.00 22.87 ? 22   PHE C CD1 1 
ATOM   5147  C  CD2 . PHE C  1 21  ? 5.643   80.391  44.508  1.00 24.54 ? 22   PHE C CD2 1 
ATOM   5148  C  CE1 . PHE C  1 21  ? 3.339   79.603  45.849  1.00 17.46 ? 22   PHE C CE1 1 
ATOM   5149  C  CE2 . PHE C  1 21  ? 5.472   79.058  44.879  1.00 24.63 ? 22   PHE C CE2 1 
ATOM   5150  C  CZ  . PHE C  1 21  ? 4.325   78.670  45.569  1.00 20.43 ? 22   PHE C CZ  1 
ATOM   5151  N  N   . GLU C  1 22  ? 6.457   85.451  44.129  1.00 28.06 ? 23   GLU C N   1 
ATOM   5152  C  CA  . GLU C  1 22  ? 6.492   86.767  43.485  1.00 28.28 ? 23   GLU C CA  1 
ATOM   5153  C  C   . GLU C  1 22  ? 7.036   86.709  42.063  1.00 28.04 ? 23   GLU C C   1 
ATOM   5154  O  O   . GLU C  1 22  ? 8.187   86.271  41.834  1.00 25.31 ? 23   GLU C O   1 
ATOM   5155  C  CB  . GLU C  1 22  ? 7.355   87.749  44.254  1.00 28.24 ? 23   GLU C CB  1 
ATOM   5156  C  CG  . GLU C  1 22  ? 7.263   89.143  43.682  1.00 30.43 ? 23   GLU C CG  1 
ATOM   5157  C  CD  . GLU C  1 22  ? 8.087   90.158  44.427  1.00 38.00 ? 23   GLU C CD  1 
ATOM   5158  O  OE1 . GLU C  1 22  ? 8.930   89.783  45.283  1.00 38.24 ? 23   GLU C OE1 1 
ATOM   5159  O  OE2 . GLU C  1 22  ? 7.894   91.356  44.133  1.00 49.50 ? 23   GLU C OE2 1 
ATOM   5160  N  N   . LEU C  1 23  ? 6.203   87.186  41.141  1.00 27.91 ? 24   LEU C N   1 
ATOM   5161  C  CA  . LEU C  1 23  ? 6.506   87.266  39.715  1.00 30.28 ? 24   LEU C CA  1 
ATOM   5162  C  C   . LEU C  1 23  ? 7.285   88.537  39.389  1.00 32.46 ? 24   LEU C C   1 
ATOM   5163  O  O   . LEU C  1 23  ? 6.811   89.651  39.652  1.00 34.07 ? 24   LEU C O   1 
ATOM   5164  C  CB  . LEU C  1 23  ? 5.204   87.267  38.936  1.00 30.45 ? 24   LEU C CB  1 
ATOM   5165  C  CG  . LEU C  1 23  ? 5.218   87.298  37.416  1.00 35.53 ? 24   LEU C CG  1 
ATOM   5166  C  CD1 . LEU C  1 23  ? 5.510   85.918  36.863  1.00 33.31 ? 24   LEU C CD1 1 
ATOM   5167  C  CD2 . LEU C  1 23  ? 3.884   87.809  36.901  1.00 35.03 ? 24   LEU C CD2 1 
ATOM   5168  N  N   . LYS C  1 24  ? 8.472   88.358  38.815  1.00 33.11 ? 25   LYS C N   1 
ATOM   5169  C  CA  . LYS C  1 24  ? 9.299   89.460  38.342  1.00 34.84 ? 25   LYS C CA  1 
ATOM   5170  C  C   . LYS C  1 24  ? 9.557   89.393  36.830  1.00 35.10 ? 25   LYS C C   1 
ATOM   5171  O  O   . LYS C  1 24  ? 9.771   88.303  36.248  1.00 31.92 ? 25   LYS C O   1 
ATOM   5172  C  CB  . LYS C  1 24  ? 10.624  89.488  39.089  1.00 34.90 ? 25   LYS C CB  1 
ATOM   5173  C  CG  . LYS C  1 24  ? 10.449  89.726  40.581  1.00 41.15 ? 25   LYS C CG  1 
ATOM   5174  C  CD  . LYS C  1 24  ? 11.788  89.832  41.327  1.00 44.31 ? 25   LYS C CD  1 
ATOM   5175  C  CE  . LYS C  1 24  ? 11.558  90.083  42.819  1.00 49.30 ? 25   LYS C CE  1 
ATOM   5176  N  NZ  . LYS C  1 24  ? 12.807  90.005  43.646  1.00 51.35 ? 25   LYS C NZ  1 
ATOM   5177  N  N   . THR C  1 25  ? 9.520   90.577  36.210  1.00 34.96 ? 26   THR C N   1 
ATOM   5178  C  CA  . THR C  1 25  ? 9.838   90.751  34.808  1.00 35.53 ? 26   THR C CA  1 
ATOM   5179  C  C   . THR C  1 25  ? 11.221  91.367  34.795  1.00 36.37 ? 26   THR C C   1 
ATOM   5180  O  O   . THR C  1 25  ? 11.564  92.134  35.677  1.00 35.94 ? 26   THR C O   1 
ATOM   5181  C  CB  . THR C  1 25  ? 8.804   91.649  34.096  1.00 36.76 ? 26   THR C CB  1 
ATOM   5182  O  OG1 . THR C  1 25  ? 7.482   91.129  34.314  1.00 37.06 ? 26   THR C OG1 1 
ATOM   5183  C  CG2 . THR C  1 25  ? 9.049   91.679  32.590  1.00 38.74 ? 26   THR C CG2 1 
ATOM   5184  N  N   . SER C  1 26  ? 12.044  90.975  33.833  1.00 36.60 ? 27   SER C N   1 
ATOM   5185  C  CA  . SER C  1 26  ? 13.413  91.484  33.763  1.00 37.79 ? 27   SER C CA  1 
ATOM   5186  C  C   . SER C  1 26  ? 13.917  91.439  32.324  1.00 37.34 ? 27   SER C C   1 
ATOM   5187  O  O   . SER C  1 26  ? 13.280  90.852  31.454  1.00 37.98 ? 27   SER C O   1 
ATOM   5188  C  CB  . SER C  1 26  ? 14.342  90.712  34.721  1.00 38.24 ? 27   SER C CB  1 
ATOM   5189  O  OG  . SER C  1 26  ? 14.331  89.310  34.467  1.00 43.54 ? 27   SER C OG  1 
ATOM   5190  N  N   . GLU C  1 27  ? 15.039  92.095  32.064  1.00 38.57 ? 28   GLU C N   1 
ATOM   5191  C  CA  . GLU C  1 27  ? 15.565  92.179  30.702  1.00 39.75 ? 28   GLU C CA  1 
ATOM   5192  C  C   . GLU C  1 27  ? 16.756  91.230  30.609  1.00 37.84 ? 28   GLU C C   1 
ATOM   5193  O  O   . GLU C  1 27  ? 17.617  91.254  31.476  1.00 37.52 ? 28   GLU C O   1 
ATOM   5194  C  CB  . GLU C  1 27  ? 15.981  93.620  30.372  1.00 40.11 ? 28   GLU C CB  1 
ATOM   5195  N  N   . LEU C  1 28  ? 16.771  90.369  29.590  1.00 37.51 ? 29   LEU C N   1 
ATOM   5196  C  CA  . LEU C  1 28  ? 17.931  89.496  29.338  1.00 37.28 ? 29   LEU C CA  1 
ATOM   5197  C  C   . LEU C  1 28  ? 18.908  90.204  28.398  1.00 37.52 ? 29   LEU C C   1 
ATOM   5198  O  O   . LEU C  1 28  ? 18.481  90.944  27.508  1.00 36.17 ? 29   LEU C O   1 
ATOM   5199  C  CB  . LEU C  1 28  ? 17.499  88.145  28.737  1.00 36.47 ? 29   LEU C CB  1 
ATOM   5200  C  CG  . LEU C  1 28  ? 16.665  87.198  29.619  1.00 33.65 ? 29   LEU C CG  1 
ATOM   5201  C  CD1 . LEU C  1 28  ? 16.124  86.057  28.780  1.00 35.62 ? 29   LEU C CD1 1 
ATOM   5202  C  CD2 . LEU C  1 28  ? 17.441  86.660  30.788  1.00 34.28 ? 29   LEU C CD2 1 
ATOM   5203  N  N   . PRO C  1 29  ? 20.221  89.984  28.589  1.00 39.14 ? 30   PRO C N   1 
ATOM   5204  C  CA  . PRO C  1 29  ? 21.222  90.610  27.736  1.00 39.93 ? 30   PRO C CA  1 
ATOM   5205  C  C   . PRO C  1 29  ? 21.238  90.008  26.326  1.00 42.93 ? 30   PRO C C   1 
ATOM   5206  O  O   . PRO C  1 29  ? 20.503  89.036  26.047  1.00 43.61 ? 30   PRO C O   1 
ATOM   5207  C  CB  . PRO C  1 29  ? 22.536  90.313  28.467  1.00 39.93 ? 30   PRO C CB  1 
ATOM   5208  C  CG  . PRO C  1 29  ? 22.294  89.044  29.187  1.00 41.20 ? 30   PRO C CG  1 
ATOM   5209  C  CD  . PRO C  1 29  ? 20.832  89.071  29.577  1.00 40.83 ? 30   PRO C CD  1 
ATOM   5210  N  N   . PRO C  1 30  ? 22.052  90.587  25.425  1.00 43.65 ? 31   PRO C N   1 
ATOM   5211  C  CA  . PRO C  1 30  ? 22.166  89.980  24.085  1.00 43.21 ? 31   PRO C CA  1 
ATOM   5212  C  C   . PRO C  1 30  ? 22.948  88.665  24.113  1.00 41.09 ? 31   PRO C C   1 
ATOM   5213  O  O   . PRO C  1 30  ? 23.752  88.438  25.026  1.00 39.97 ? 31   PRO C O   1 
ATOM   5214  C  CB  . PRO C  1 30  ? 22.887  91.049  23.242  1.00 44.04 ? 31   PRO C CB  1 
ATOM   5215  C  CG  . PRO C  1 30  ? 23.446  92.076  24.233  1.00 46.14 ? 31   PRO C CG  1 
ATOM   5216  C  CD  . PRO C  1 30  ? 22.907  91.781  25.610  1.00 45.06 ? 31   PRO C CD  1 
ATOM   5217  N  N   . LEU C  1 31  ? 22.692  87.802  23.135  1.00 40.15 ? 32   LEU C N   1 
ATOM   5218  C  CA  . LEU C  1 31  ? 23.398  86.525  23.043  1.00 40.10 ? 32   LEU C CA  1 
ATOM   5219  C  C   . LEU C  1 31  ? 24.867  86.752  22.743  1.00 41.19 ? 32   LEU C C   1 
ATOM   5220  O  O   . LEU C  1 31  ? 25.196  87.487  21.818  1.00 42.63 ? 32   LEU C O   1 
ATOM   5221  C  CB  . LEU C  1 31  ? 22.812  85.662  21.926  1.00 39.13 ? 32   LEU C CB  1 
ATOM   5222  C  CG  . LEU C  1 31  ? 21.389  85.169  22.113  1.00 37.43 ? 32   LEU C CG  1 
ATOM   5223  C  CD1 . LEU C  1 31  ? 20.943  84.380  20.901  1.00 35.00 ? 32   LEU C CD1 1 
ATOM   5224  C  CD2 . LEU C  1 31  ? 21.294  84.338  23.401  1.00 38.40 ? 32   LEU C CD2 1 
ATOM   5225  N  N   . LYS C  1 32  ? 25.745  86.135  23.531  1.00 42.39 ? 33   LYS C N   1 
ATOM   5226  C  CA  . LYS C  1 32  ? 27.152  86.003  23.146  1.00 43.09 ? 33   LYS C CA  1 
ATOM   5227  C  C   . LYS C  1 32  ? 27.299  84.815  22.175  1.00 43.71 ? 33   LYS C C   1 
ATOM   5228  O  O   . LYS C  1 32  ? 26.320  84.097  21.895  1.00 43.51 ? 33   LYS C O   1 
ATOM   5229  C  CB  . LYS C  1 32  ? 28.038  85.832  24.379  1.00 43.62 ? 33   LYS C CB  1 
ATOM   5230  C  CG  . LYS C  1 32  ? 27.971  87.017  25.357  1.00 46.23 ? 33   LYS C CG  1 
ATOM   5231  C  CD  . LYS C  1 32  ? 28.650  86.668  26.680  1.00 50.64 ? 33   LYS C CD  1 
ATOM   5232  C  CE  . LYS C  1 32  ? 28.382  87.717  27.755  1.00 52.97 ? 33   LYS C CE  1 
ATOM   5233  N  NZ  . LYS C  1 32  ? 28.255  87.071  29.090  1.00 52.79 ? 33   LYS C NZ  1 
ATOM   5234  N  N   . ASN C  1 33  ? 28.508  84.611  21.658  1.00 42.60 ? 34   ASN C N   1 
ATOM   5235  C  CA  . ASN C  1 33  ? 28.754  83.522  20.716  1.00 41.22 ? 34   ASN C CA  1 
ATOM   5236  C  C   . ASN C  1 33  ? 28.648  82.183  21.423  1.00 38.93 ? 34   ASN C C   1 
ATOM   5237  O  O   . ASN C  1 33  ? 29.170  82.013  22.526  1.00 37.71 ? 34   ASN C O   1 
ATOM   5238  C  CB  . ASN C  1 33  ? 30.131  83.643  20.048  1.00 42.69 ? 34   ASN C CB  1 
ATOM   5239  C  CG  . ASN C  1 33  ? 30.266  82.728  18.838  1.00 45.15 ? 34   ASN C CG  1 
ATOM   5240  O  OD1 . ASN C  1 33  ? 29.456  82.785  17.914  1.00 45.45 ? 34   ASN C OD1 1 
ATOM   5241  N  ND2 . ASN C  1 33  ? 31.279  81.880  18.846  1.00 44.70 ? 34   ASN C ND2 1 
ATOM   5242  N  N   . GLY C  1 34  ? 27.954  81.242  20.790  1.00 37.24 ? 35   GLY C N   1 
ATOM   5243  C  CA  . GLY C  1 34  ? 27.695  79.942  21.405  1.00 36.34 ? 35   GLY C CA  1 
ATOM   5244  C  C   . GLY C  1 34  ? 26.483  79.892  22.317  1.00 35.39 ? 35   GLY C C   1 
ATOM   5245  O  O   . GLY C  1 34  ? 26.166  78.826  22.859  1.00 37.58 ? 35   GLY C O   1 
ATOM   5246  N  N   . GLU C  1 35  ? 25.785  81.016  22.478  1.00 32.91 ? 36   GLU C N   1 
ATOM   5247  C  CA  . GLU C  1 35  ? 24.590  81.057  23.323  1.00 31.10 ? 36   GLU C CA  1 
ATOM   5248  C  C   . GLU C  1 35  ? 23.292  81.001  22.539  1.00 31.33 ? 36   GLU C C   1 
ATOM   5249  O  O   . GLU C  1 35  ? 23.219  81.436  21.390  1.00 32.21 ? 36   GLU C O   1 
ATOM   5250  C  CB  . GLU C  1 35  ? 24.596  82.293  24.191  1.00 30.55 ? 36   GLU C CB  1 
ATOM   5251  C  CG  . GLU C  1 35  ? 25.676  82.247  25.259  1.00 31.21 ? 36   GLU C CG  1 
ATOM   5252  C  CD  . GLU C  1 35  ? 25.675  83.498  26.108  1.00 35.39 ? 36   GLU C CD  1 
ATOM   5253  O  OE1 . GLU C  1 35  ? 25.103  84.527  25.643  1.00 32.19 ? 36   GLU C OE1 1 
ATOM   5254  O  OE2 . GLU C  1 35  ? 26.258  83.468  27.223  1.00 35.20 ? 36   GLU C OE2 1 
ATOM   5255  N  N   . VAL C  1 36  ? 22.269  80.440  23.173  1.00 29.51 ? 37   VAL C N   1 
ATOM   5256  C  CA  . VAL C  1 36  ? 20.951  80.412  22.604  1.00 28.41 ? 37   VAL C CA  1 
ATOM   5257  C  C   . VAL C  1 36  ? 19.969  81.084  23.566  1.00 29.25 ? 37   VAL C C   1 
ATOM   5258  O  O   . VAL C  1 36  ? 20.208  81.139  24.777  1.00 28.45 ? 37   VAL C O   1 
ATOM   5259  C  CB  . VAL C  1 36  ? 20.487  78.980  22.324  1.00 28.80 ? 37   VAL C CB  1 
ATOM   5260  C  CG1 . VAL C  1 36  ? 21.392  78.325  21.293  1.00 27.49 ? 37   VAL C CG1 1 
ATOM   5261  C  CG2 . VAL C  1 36  ? 20.420  78.153  23.622  1.00 25.34 ? 37   VAL C CG2 1 
ATOM   5262  N  N   . LEU C  1 37  ? 18.882  81.606  23.003  1.00 28.48 ? 38   LEU C N   1 
ATOM   5263  C  CA  . LEU C  1 37  ? 17.773  82.127  23.788  1.00 28.08 ? 38   LEU C CA  1 
ATOM   5264  C  C   . LEU C  1 37  ? 16.743  81.046  23.771  1.00 26.38 ? 38   LEU C C   1 
ATOM   5265  O  O   . LEU C  1 37  ? 16.366  80.573  22.691  1.00 24.47 ? 38   LEU C O   1 
ATOM   5266  C  CB  . LEU C  1 37  ? 17.175  83.406  23.185  1.00 28.64 ? 38   LEU C CB  1 
ATOM   5267  C  CG  . LEU C  1 37  ? 16.078  84.035  24.047  1.00 30.78 ? 38   LEU C CG  1 
ATOM   5268  C  CD1 . LEU C  1 37  ? 16.633  84.328  25.443  1.00 28.67 ? 38   LEU C CD1 1 
ATOM   5269  C  CD2 . LEU C  1 37  ? 15.509  85.333  23.426  1.00 33.31 ? 38   LEU C CD2 1 
ATOM   5270  N  N   . LEU C  1 38  ? 16.298  80.656  24.971  1.00 27.34 ? 39   LEU C N   1 
ATOM   5271  C  CA  . LEU C  1 38  ? 15.319  79.590  25.141  1.00 26.66 ? 39   LEU C CA  1 
ATOM   5272  C  C   . LEU C  1 38  ? 13.964  80.152  25.543  1.00 25.97 ? 39   LEU C C   1 
ATOM   5273  O  O   . LEU C  1 38  ? 13.881  81.067  26.353  1.00 27.56 ? 39   LEU C O   1 
ATOM   5274  C  CB  . LEU C  1 38  ? 15.812  78.594  26.205  1.00 27.73 ? 39   LEU C CB  1 
ATOM   5275  C  CG  . LEU C  1 38  ? 17.141  77.878  25.937  1.00 29.65 ? 39   LEU C CG  1 
ATOM   5276  C  CD1 . LEU C  1 38  ? 17.500  77.028  27.152  1.00 26.50 ? 39   LEU C CD1 1 
ATOM   5277  C  CD2 . LEU C  1 38  ? 17.101  77.045  24.637  1.00 25.12 ? 39   LEU C CD2 1 
ATOM   5278  N  N   . GLU C  1 39  ? 12.912  79.602  24.954  1.00 25.61 ? 40   GLU C N   1 
ATOM   5279  C  CA  . GLU C  1 39  ? 11.539  79.981  25.255  1.00 25.47 ? 40   GLU C CA  1 
ATOM   5280  C  C   . GLU C  1 39  ? 10.742  78.761  25.777  1.00 24.83 ? 40   GLU C C   1 
ATOM   5281  O  O   . GLU C  1 39  ? 10.516  77.796  25.055  1.00 22.98 ? 40   GLU C O   1 
ATOM   5282  C  CB  . GLU C  1 39  ? 10.877  80.546  24.003  1.00 25.82 ? 40   GLU C CB  1 
ATOM   5283  C  CG  . GLU C  1 39  ? 9.413   80.949  24.187  1.00 32.94 ? 40   GLU C CG  1 
ATOM   5284  C  CD  . GLU C  1 39  ? 8.872   81.809  23.042  1.00 40.99 ? 40   GLU C CD  1 
ATOM   5285  O  OE1 . GLU C  1 39  ? 9.280   82.984  22.929  1.00 43.45 ? 40   GLU C OE1 1 
ATOM   5286  O  OE2 . GLU C  1 39  ? 8.033   81.300  22.270  1.00 40.41 ? 40   GLU C OE2 1 
ATOM   5287  N  N   . ALA C  1 40  ? 10.327  78.817  27.037  1.00 22.34 ? 41   ALA C N   1 
ATOM   5288  C  CA  . ALA C  1 40  ? 9.542   77.738  27.626  1.00 24.74 ? 41   ALA C CA  1 
ATOM   5289  C  C   . ALA C  1 40  ? 8.283   77.458  26.808  1.00 24.21 ? 41   ALA C C   1 
ATOM   5290  O  O   . ALA C  1 40  ? 7.565   78.375  26.460  1.00 24.41 ? 41   ALA C O   1 
ATOM   5291  C  CB  . ALA C  1 40  ? 9.155   78.092  29.075  1.00 21.42 ? 41   ALA C CB  1 
ATOM   5292  N  N   . LEU C  1 41  ? 8.056   76.187  26.493  1.00 24.65 ? 42   LEU C N   1 
ATOM   5293  C  CA  . LEU C  1 41  ? 6.814   75.726  25.906  1.00 25.41 ? 42   LEU C CA  1 
ATOM   5294  C  C   . LEU C  1 41  ? 5.963   75.048  26.972  1.00 26.55 ? 42   LEU C C   1 
ATOM   5295  O  O   . LEU C  1 41  ? 4.743   75.240  27.025  1.00 28.56 ? 42   LEU C O   1 
ATOM   5296  C  CB  . LEU C  1 41  ? 7.100   74.719  24.790  1.00 28.02 ? 42   LEU C CB  1 
ATOM   5297  C  CG  . LEU C  1 41  ? 7.976   75.185  23.606  1.00 30.00 ? 42   LEU C CG  1 
ATOM   5298  C  CD1 . LEU C  1 41  ? 8.232   74.041  22.633  1.00 25.11 ? 42   LEU C CD1 1 
ATOM   5299  C  CD2 . LEU C  1 41  ? 7.324   76.368  22.902  1.00 26.07 ? 42   LEU C CD2 1 
ATOM   5300  N  N   . PHE C  1 42  ? 6.612   74.242  27.809  1.00 26.16 ? 43   PHE C N   1 
ATOM   5301  C  CA  . PHE C  1 42  ? 5.931   73.469  28.843  1.00 24.32 ? 43   PHE C CA  1 
ATOM   5302  C  C   . PHE C  1 42  ? 6.839   73.424  30.037  1.00 24.41 ? 43   PHE C C   1 
ATOM   5303  O  O   . PHE C  1 42  ? 8.024   73.104  29.915  1.00 25.04 ? 43   PHE C O   1 
ATOM   5304  C  CB  . PHE C  1 42  ? 5.667   72.040  28.408  1.00 23.29 ? 43   PHE C CB  1 
ATOM   5305  C  CG  . PHE C  1 42  ? 4.753   71.905  27.229  1.00 26.57 ? 43   PHE C CG  1 
ATOM   5306  C  CD1 . PHE C  1 42  ? 3.376   71.974  27.390  1.00 25.27 ? 43   PHE C CD1 1 
ATOM   5307  C  CD2 . PHE C  1 42  ? 5.267   71.633  25.959  1.00 26.92 ? 43   PHE C CD2 1 
ATOM   5308  C  CE1 . PHE C  1 42  ? 2.522   71.828  26.299  1.00 30.23 ? 43   PHE C CE1 1 
ATOM   5309  C  CE2 . PHE C  1 42  ? 4.412   71.494  24.851  1.00 29.15 ? 43   PHE C CE2 1 
ATOM   5310  C  CZ  . PHE C  1 42  ? 3.029   71.584  25.026  1.00 27.69 ? 43   PHE C CZ  1 
ATOM   5311  N  N   . LEU C  1 43  ? 6.285   73.760  31.192  1.00 24.34 ? 44   LEU C N   1 
ATOM   5312  C  CA  . LEU C  1 43  ? 7.018   73.700  32.433  1.00 23.69 ? 44   LEU C CA  1 
ATOM   5313  C  C   . LEU C  1 43  ? 6.358   72.659  33.324  1.00 23.25 ? 44   LEU C C   1 
ATOM   5314  O  O   . LEU C  1 43  ? 5.131   72.500  33.280  1.00 22.71 ? 44   LEU C O   1 
ATOM   5315  C  CB  . LEU C  1 43  ? 7.034   75.057  33.123  1.00 23.61 ? 44   LEU C CB  1 
ATOM   5316  C  CG  . LEU C  1 43  ? 7.482   76.279  32.328  1.00 25.18 ? 44   LEU C CG  1 
ATOM   5317  C  CD1 . LEU C  1 43  ? 6.277   77.081  31.819  1.00 22.80 ? 44   LEU C CD1 1 
ATOM   5318  C  CD2 . LEU C  1 43  ? 8.377   77.174  33.217  1.00 21.79 ? 44   LEU C CD2 1 
ATOM   5319  N  N   . THR C  1 44  ? 7.173   71.947  34.111  1.00 22.64 ? 45   THR C N   1 
ATOM   5320  C  CA  . THR C  1 44  ? 6.662   71.012  35.117  1.00 21.32 ? 45   THR C CA  1 
ATOM   5321  C  C   . THR C  1 44  ? 6.688   71.648  36.507  1.00 22.08 ? 45   THR C C   1 
ATOM   5322  O  O   . THR C  1 44  ? 7.533   72.510  36.814  1.00 20.57 ? 45   THR C O   1 
ATOM   5323  C  CB  . THR C  1 44  ? 7.472   69.691  35.161  1.00 22.11 ? 45   THR C CB  1 
ATOM   5324  O  OG1 . THR C  1 44  ? 6.972   68.847  36.198  1.00 22.90 ? 45   THR C OG1 1 
ATOM   5325  C  CG2 . THR C  1 44  ? 8.958   69.950  35.408  1.00 19.82 ? 45   THR C CG2 1 
ATOM   5326  N  N   . VAL C  1 45  ? 5.730   71.230  37.331  1.00 21.38 ? 46   VAL C N   1 
ATOM   5327  C  CA  . VAL C  1 45  ? 5.816   71.408  38.787  1.00 19.91 ? 46   VAL C CA  1 
ATOM   5328  C  C   . VAL C  1 45  ? 5.856   70.020  39.405  1.00 18.44 ? 46   VAL C C   1 
ATOM   5329  O  O   . VAL C  1 45  ? 5.340   69.072  38.837  1.00 20.62 ? 46   VAL C O   1 
ATOM   5330  C  CB  . VAL C  1 45  ? 4.619   72.206  39.329  1.00 20.06 ? 46   VAL C CB  1 
ATOM   5331  C  CG1 . VAL C  1 45  ? 4.727   73.645  38.894  1.00 18.30 ? 46   VAL C CG1 1 
ATOM   5332  C  CG2 . VAL C  1 45  ? 3.303   71.584  38.888  1.00 15.06 ? 46   VAL C CG2 1 
ATOM   5333  N  N   . ASP C  1 46  ? 6.520   69.882  40.538  1.00 19.94 ? 47   ASP C N   1 
ATOM   5334  C  CA  . ASP C  1 46  ? 6.792   68.559  41.085  1.00 19.90 ? 47   ASP C CA  1 
ATOM   5335  C  C   . ASP C  1 46  ? 6.882   68.608  42.595  1.00 19.92 ? 47   ASP C C   1 
ATOM   5336  O  O   . ASP C  1 46  ? 7.361   69.623  43.172  1.00 18.47 ? 47   ASP C O   1 
ATOM   5337  C  CB  . ASP C  1 46  ? 8.099   67.965  40.536  1.00 19.01 ? 47   ASP C CB  1 
ATOM   5338  C  CG  . ASP C  1 46  ? 8.093   67.816  39.021  1.00 18.98 ? 47   ASP C CG  1 
ATOM   5339  O  OD1 . ASP C  1 46  ? 8.458   68.776  38.317  1.00 21.99 ? 47   ASP C OD1 1 
ATOM   5340  O  OD2 . ASP C  1 46  ? 7.746   66.734  38.536  1.00 16.27 ? 47   ASP C OD2 1 
ATOM   5341  N  N   . PRO C  1 47  ? 6.471   67.505  43.235  1.00 18.36 ? 48   PRO C N   1 
ATOM   5342  C  CA  . PRO C  1 47  ? 6.479   67.457  44.694  1.00 20.00 ? 48   PRO C CA  1 
ATOM   5343  C  C   . PRO C  1 47  ? 7.786   67.835  45.306  1.00 17.43 ? 48   PRO C C   1 
ATOM   5344  O  O   . PRO C  1 47  ? 7.777   68.515  46.323  1.00 18.87 ? 48   PRO C O   1 
ATOM   5345  C  CB  . PRO C  1 47  ? 6.140   66.003  44.987  1.00 19.06 ? 48   PRO C CB  1 
ATOM   5346  C  CG  . PRO C  1 47  ? 5.187   65.649  43.903  1.00 19.39 ? 48   PRO C CG  1 
ATOM   5347  C  CD  . PRO C  1 47  ? 5.772   66.324  42.672  1.00 20.32 ? 48   PRO C CD  1 
ATOM   5348  N  N   . TYR C  1 48  ? 8.900   67.452  44.679  1.00 17.49 ? 49   TYR C N   1 
ATOM   5349  C  CA  . TYR C  1 48  ? 10.243  67.702  45.237  1.00 16.87 ? 49   TYR C CA  1 
ATOM   5350  C  C   . TYR C  1 48  ? 10.483  69.211  45.472  1.00 15.61 ? 49   TYR C C   1 
ATOM   5351  O  O   . TYR C  1 48  ? 11.266  69.596  46.360  1.00 17.12 ? 49   TYR C O   1 
ATOM   5352  C  CB  . TYR C  1 48  ? 11.380  67.040  44.373  1.00 17.26 ? 49   TYR C CB  1 
ATOM   5353  C  CG  . TYR C  1 48  ? 11.769  67.846  43.138  1.00 16.86 ? 49   TYR C CG  1 
ATOM   5354  C  CD1 . TYR C  1 48  ? 12.618  68.966  43.241  1.00 20.98 ? 49   TYR C CD1 1 
ATOM   5355  C  CD2 . TYR C  1 48  ? 11.247  67.532  41.888  1.00 18.50 ? 49   TYR C CD2 1 
ATOM   5356  C  CE1 . TYR C  1 48  ? 12.963  69.733  42.101  1.00 21.67 ? 49   TYR C CE1 1 
ATOM   5357  C  CE2 . TYR C  1 48  ? 11.564  68.300  40.752  1.00 21.10 ? 49   TYR C CE2 1 
ATOM   5358  C  CZ  . TYR C  1 48  ? 12.426  69.395  40.865  1.00 22.95 ? 49   TYR C CZ  1 
ATOM   5359  O  OH  . TYR C  1 48  ? 12.729  70.139  39.730  1.00 24.00 ? 49   TYR C OH  1 
ATOM   5360  N  N   . MET C  1 49  ? 9.811   70.058  44.691  1.00 16.52 ? 50   MET C N   1 
ATOM   5361  C  CA  . MET C  1 49  ? 9.952   71.513  44.825  1.00 17.20 ? 50   MET C CA  1 
ATOM   5362  C  C   . MET C  1 49  ? 9.541   72.014  46.212  1.00 18.35 ? 50   MET C C   1 
ATOM   5363  O  O   . MET C  1 49  ? 10.146  72.969  46.728  1.00 18.00 ? 50   MET C O   1 
ATOM   5364  C  CB  . MET C  1 49  ? 9.159   72.239  43.742  1.00 18.42 ? 50   MET C CB  1 
ATOM   5365  C  CG  . MET C  1 49  ? 9.734   72.003  42.340  1.00 18.76 ? 50   MET C CG  1 
ATOM   5366  S  SD  . MET C  1 49  ? 8.671   72.619  41.034  1.00 21.24 ? 50   MET C SD  1 
ATOM   5367  C  CE  . MET C  1 49  ? 9.470   71.924  39.548  1.00 18.32 ? 50   MET C CE  1 
ATOM   5368  N  N   . ARG C  1 50  ? 8.557   71.348  46.820  1.00 18.20 ? 51   ARG C N   1 
ATOM   5369  C  CA  . ARG C  1 50  ? 8.093   71.717  48.161  1.00 19.49 ? 51   ARG C CA  1 
ATOM   5370  C  C   . ARG C  1 50  ? 9.224   71.532  49.165  1.00 19.26 ? 51   ARG C C   1 
ATOM   5371  O  O   . ARG C  1 50  ? 9.383   72.313  50.084  1.00 19.95 ? 51   ARG C O   1 
ATOM   5372  C  CB  . ARG C  1 50  ? 6.875   70.864  48.565  1.00 17.98 ? 51   ARG C CB  1 
ATOM   5373  C  CG  . ARG C  1 50  ? 6.330   71.120  50.007  1.00 19.17 ? 51   ARG C CG  1 
ATOM   5374  C  CD  . ARG C  1 50  ? 5.880   72.583  50.206  1.00 20.17 ? 51   ARG C CD  1 
ATOM   5375  N  NE  . ARG C  1 50  ? 5.519   72.894  51.590  1.00 19.52 ? 51   ARG C NE  1 
ATOM   5376  C  CZ  . ARG C  1 50  ? 6.386   73.186  52.560  1.00 22.48 ? 51   ARG C CZ  1 
ATOM   5377  N  NH1 . ARG C  1 50  ? 7.708   73.205  52.334  1.00 19.89 ? 51   ARG C NH1 1 
ATOM   5378  N  NH2 . ARG C  1 50  ? 5.932   73.469  53.781  1.00 22.66 ? 51   ARG C NH2 1 
ATOM   5379  N  N   . VAL C  1 51  ? 10.002  70.478  48.969  1.00 19.19 ? 52   VAL C N   1 
ATOM   5380  C  CA  . VAL C  1 51  ? 11.098  70.137  49.852  1.00 20.34 ? 52   VAL C CA  1 
ATOM   5381  C  C   . VAL C  1 51  ? 12.327  70.991  49.529  1.00 21.12 ? 52   VAL C C   1 
ATOM   5382  O  O   . VAL C  1 51  ? 12.968  71.505  50.424  1.00 17.02 ? 52   VAL C O   1 
ATOM   5383  C  CB  . VAL C  1 51  ? 11.443  68.651  49.703  1.00 24.51 ? 52   VAL C CB  1 
ATOM   5384  C  CG1 . VAL C  1 51  ? 12.676  68.269  50.560  1.00 22.33 ? 52   VAL C CG1 1 
ATOM   5385  C  CG2 . VAL C  1 51  ? 10.224  67.804  50.053  1.00 20.27 ? 52   VAL C CG2 1 
ATOM   5386  N  N   . ALA C  1 52  ? 12.636  71.143  48.239  1.00 22.24 ? 53   ALA C N   1 
ATOM   5387  C  CA  . ALA C  1 52  ? 13.824  71.852  47.836  1.00 21.74 ? 53   ALA C CA  1 
ATOM   5388  C  C   . ALA C  1 52  ? 13.713  73.344  48.093  1.00 21.86 ? 53   ALA C C   1 
ATOM   5389  O  O   . ALA C  1 52  ? 14.730  74.001  48.271  1.00 21.06 ? 53   ALA C O   1 
ATOM   5390  C  CB  . ALA C  1 52  ? 14.177  71.558  46.348  1.00 19.97 ? 53   ALA C CB  1 
ATOM   5391  N  N   . ALA C  1 53  ? 12.489  73.878  48.108  1.00 22.54 ? 54   ALA C N   1 
ATOM   5392  C  CA  . ALA C  1 53  ? 12.269  75.315  48.371  1.00 21.58 ? 54   ALA C CA  1 
ATOM   5393  C  C   . ALA C  1 53  ? 12.917  75.761  49.676  1.00 22.98 ? 54   ALA C C   1 
ATOM   5394  O  O   . ALA C  1 53  ? 13.457  76.856  49.783  1.00 20.97 ? 54   ALA C O   1 
ATOM   5395  C  CB  . ALA C  1 53  ? 10.765  75.626  48.405  1.00 20.21 ? 54   ALA C CB  1 
ATOM   5396  N  N   . LYS C  1 54  ? 12.901  74.883  50.661  1.00 24.71 ? 55   LYS C N   1 
ATOM   5397  C  CA  . LYS C  1 54  ? 13.450  75.204  51.956  1.00 28.21 ? 55   LYS C CA  1 
ATOM   5398  C  C   . LYS C  1 54  ? 14.931  75.627  51.883  1.00 29.33 ? 55   LYS C C   1 
ATOM   5399  O  O   . LYS C  1 54  ? 15.391  76.365  52.754  1.00 29.39 ? 55   LYS C O   1 
ATOM   5400  C  CB  . LYS C  1 54  ? 13.264  74.001  52.901  1.00 31.49 ? 55   LYS C CB  1 
ATOM   5401  C  CG  . LYS C  1 54  ? 11.785  73.736  53.277  1.00 36.58 ? 55   LYS C CG  1 
ATOM   5402  C  CD  . LYS C  1 54  ? 11.411  72.259  53.539  1.00 44.84 ? 55   LYS C CD  1 
ATOM   5403  C  CE  . LYS C  1 54  ? 12.347  71.473  54.476  1.00 51.27 ? 55   LYS C CE  1 
ATOM   5404  N  NZ  . LYS C  1 54  ? 12.119  71.684  55.945  1.00 54.83 ? 55   LYS C NZ  1 
ATOM   5405  N  N   . ARG C  1 55  ? 15.674  75.170  50.866  1.00 28.65 ? 56   ARG C N   1 
ATOM   5406  C  CA  . ARG C  1 55  ? 17.079  75.552  50.727  1.00 30.93 ? 56   ARG C CA  1 
ATOM   5407  C  C   . ARG C  1 55  ? 17.292  76.843  49.915  1.00 31.69 ? 56   ARG C C   1 
ATOM   5408  O  O   . ARG C  1 55  ? 18.404  77.356  49.845  1.00 31.21 ? 56   ARG C O   1 
ATOM   5409  C  CB  . ARG C  1 55  ? 17.903  74.394  50.129  1.00 34.36 ? 56   ARG C CB  1 
ATOM   5410  C  CG  . ARG C  1 55  ? 18.277  73.297  51.164  1.00 38.86 ? 56   ARG C CG  1 
ATOM   5411  C  CD  . ARG C  1 55  ? 17.057  72.526  51.667  1.00 46.58 ? 56   ARG C CD  1 
ATOM   5412  N  N   . LEU C  1 56  ? 16.234  77.381  49.314  1.00 30.46 ? 57   LEU C N   1 
ATOM   5413  C  CA  . LEU C  1 56  ? 16.344  78.652  48.623  1.00 29.35 ? 57   LEU C CA  1 
ATOM   5414  C  C   . LEU C  1 56  ? 16.479  79.803  49.606  1.00 31.55 ? 57   LEU C C   1 
ATOM   5415  O  O   . LEU C  1 56  ? 15.995  79.725  50.754  1.00 30.90 ? 57   LEU C O   1 
ATOM   5416  C  CB  . LEU C  1 56  ? 15.115  78.882  47.745  1.00 29.13 ? 57   LEU C CB  1 
ATOM   5417  C  CG  . LEU C  1 56  ? 14.984  77.839  46.651  1.00 28.42 ? 57   LEU C CG  1 
ATOM   5418  C  CD1 . LEU C  1 56  ? 13.728  78.065  45.802  1.00 21.53 ? 57   LEU C CD1 1 
ATOM   5419  C  CD2 . LEU C  1 56  ? 16.280  77.838  45.792  1.00 24.00 ? 57   LEU C CD2 1 
ATOM   5420  N  N   . LYS C  1 57  ? 17.171  80.858  49.164  1.00 31.87 ? 58   LYS C N   1 
ATOM   5421  C  CA  . LYS C  1 57  ? 17.071  82.173  49.800  1.00 32.53 ? 58   LYS C CA  1 
ATOM   5422  C  C   . LYS C  1 57  ? 15.821  82.873  49.256  1.00 30.65 ? 58   LYS C C   1 
ATOM   5423  O  O   . LYS C  1 57  ? 15.502  82.767  48.074  1.00 28.95 ? 58   LYS C O   1 
ATOM   5424  C  CB  . LYS C  1 57  ? 18.312  83.044  49.518  1.00 33.90 ? 58   LYS C CB  1 
ATOM   5425  C  CG  . LYS C  1 57  ? 19.567  82.647  50.282  1.00 37.31 ? 58   LYS C CG  1 
ATOM   5426  N  N   . GLU C  1 58  ? 15.109  83.601  50.109  1.00 30.84 ? 59   GLU C N   1 
ATOM   5427  C  CA  . GLU C  1 58  ? 14.005  84.449  49.627  1.00 30.86 ? 59   GLU C CA  1 
ATOM   5428  C  C   . GLU C  1 58  ? 14.526  85.344  48.509  1.00 29.85 ? 59   GLU C C   1 
ATOM   5429  O  O   . GLU C  1 58  ? 15.602  85.923  48.620  1.00 32.63 ? 59   GLU C O   1 
ATOM   5430  C  CB  . GLU C  1 58  ? 13.427  85.296  50.764  1.00 32.57 ? 59   GLU C CB  1 
ATOM   5431  C  CG  . GLU C  1 58  ? 12.770  84.464  51.862  1.00 38.16 ? 59   GLU C CG  1 
ATOM   5432  C  CD  . GLU C  1 58  ? 12.298  85.285  53.074  1.00 49.16 ? 59   GLU C CD  1 
ATOM   5433  O  OE1 . GLU C  1 58  ? 12.385  86.542  53.066  1.00 49.10 ? 59   GLU C OE1 1 
ATOM   5434  O  OE2 . GLU C  1 58  ? 11.827  84.640  54.039  1.00 52.14 ? 59   GLU C OE2 1 
ATOM   5435  N  N   . GLY C  1 59  ? 13.760  85.462  47.435  1.00 28.68 ? 60   GLY C N   1 
ATOM   5436  C  CA  . GLY C  1 59  ? 14.216  86.135  46.222  1.00 27.74 ? 60   GLY C CA  1 
ATOM   5437  C  C   . GLY C  1 59  ? 14.750  85.187  45.135  1.00 26.20 ? 60   GLY C C   1 
ATOM   5438  O  O   . GLY C  1 59  ? 14.775  85.540  43.978  1.00 23.59 ? 60   GLY C O   1 
ATOM   5439  N  N   . ASP C  1 60  ? 15.185  83.986  45.504  1.00 26.38 ? 61   ASP C N   1 
ATOM   5440  C  CA  . ASP C  1 60  ? 15.643  83.005  44.503  1.00 25.78 ? 61   ASP C CA  1 
ATOM   5441  C  C   . ASP C  1 60  ? 14.513  82.553  43.586  1.00 25.04 ? 61   ASP C C   1 
ATOM   5442  O  O   . ASP C  1 60  ? 13.355  82.485  43.981  1.00 28.27 ? 61   ASP C O   1 
ATOM   5443  C  CB  . ASP C  1 60  ? 16.247  81.777  45.193  1.00 25.10 ? 61   ASP C CB  1 
ATOM   5444  C  CG  . ASP C  1 60  ? 17.535  82.088  45.888  1.00 29.05 ? 61   ASP C CG  1 
ATOM   5445  O  OD1 . ASP C  1 60  ? 18.129  83.145  45.582  1.00 31.67 ? 61   ASP C OD1 1 
ATOM   5446  O  OD2 . ASP C  1 60  ? 17.951  81.283  46.749  1.00 30.28 ? 61   ASP C OD2 1 
ATOM   5447  N  N   . THR C  1 61  ? 14.862  82.275  42.343  1.00 24.87 ? 62   THR C N   1 
ATOM   5448  C  CA  . THR C  1 61  ? 13.964  81.672  41.386  1.00 23.35 ? 62   THR C CA  1 
ATOM   5449  C  C   . THR C  1 61  ? 13.595  80.248  41.833  1.00 22.39 ? 62   THR C C   1 
ATOM   5450  O  O   . THR C  1 61  ? 14.462  79.509  42.308  1.00 21.45 ? 62   THR C O   1 
ATOM   5451  C  CB  . THR C  1 61  ? 14.708  81.583  40.048  1.00 24.09 ? 62   THR C CB  1 
ATOM   5452  O  OG1 . THR C  1 61  ? 15.233  82.868  39.737  1.00 27.74 ? 62   THR C OG1 1 
ATOM   5453  C  CG2 . THR C  1 61  ? 13.815  81.068  38.886  1.00 22.34 ? 62   THR C CG2 1 
ATOM   5454  N  N   . MET C  1 62  ? 12.321  79.879  41.685  1.00 21.37 ? 63   MET C N   1 
ATOM   5455  C  CA  . MET C  1 62  ? 11.865  78.518  41.950  1.00 21.06 ? 63   MET C CA  1 
ATOM   5456  C  C   . MET C  1 62  ? 12.528  77.553  40.943  1.00 22.78 ? 63   MET C C   1 
ATOM   5457  O  O   . MET C  1 62  ? 12.667  77.870  39.756  1.00 21.15 ? 63   MET C O   1 
ATOM   5458  C  CB  . MET C  1 62  ? 10.344  78.425  41.824  1.00 21.48 ? 63   MET C CB  1 
ATOM   5459  C  CG  . MET C  1 62  ? 9.547   78.983  43.016  1.00 24.76 ? 63   MET C CG  1 
ATOM   5460  S  SD  . MET C  1 62  ? 9.843   78.153  44.592  1.00 23.37 ? 63   MET C SD  1 
ATOM   5461  C  CE  . MET C  1 62  ? 9.287   76.492  44.284  1.00 13.75 ? 63   MET C CE  1 
ATOM   5462  N  N   . MET C  1 63  ? 12.970  76.403  41.432  1.00 22.06 ? 64   MET C N   1 
ATOM   5463  C  CA  . MET C  1 63  ? 13.717  75.467  40.619  1.00 22.01 ? 64   MET C CA  1 
ATOM   5464  C  C   . MET C  1 63  ? 12.753  74.626  39.803  1.00 22.28 ? 64   MET C C   1 
ATOM   5465  O  O   . MET C  1 63  ? 11.588  74.431  40.174  1.00 21.24 ? 64   MET C O   1 
ATOM   5466  C  CB  . MET C  1 63  ? 14.611  74.570  41.494  1.00 23.72 ? 64   MET C CB  1 
ATOM   5467  C  CG  . MET C  1 63  ? 13.865  73.540  42.348  1.00 25.24 ? 64   MET C CG  1 
ATOM   5468  S  SD  . MET C  1 63  ? 12.895  74.209  43.734  1.00 25.99 ? 64   MET C SD  1 
ATOM   5469  C  CE  . MET C  1 63  ? 14.212  74.843  44.733  1.00 20.32 ? 64   MET C CE  1 
ATOM   5470  N  N   . GLY C  1 64  ? 13.227  74.133  38.666  1.00 21.36 ? 65   GLY C N   1 
ATOM   5471  C  CA  . GLY C  1 64  ? 12.388  73.319  37.813  1.00 20.28 ? 65   GLY C CA  1 
ATOM   5472  C  C   . GLY C  1 64  ? 12.889  73.177  36.394  1.00 21.64 ? 65   GLY C C   1 
ATOM   5473  O  O   . GLY C  1 64  ? 13.741  73.942  35.954  1.00 23.54 ? 65   GLY C O   1 
ATOM   5474  N  N   . GLN C  1 65  ? 12.308  72.210  35.690  1.00 21.85 ? 66   GLN C N   1 
ATOM   5475  C  CA  . GLN C  1 65  ? 12.682  71.837  34.341  1.00 21.65 ? 66   GLN C CA  1 
ATOM   5476  C  C   . GLN C  1 65  ? 11.568  72.259  33.375  1.00 22.75 ? 66   GLN C C   1 
ATOM   5477  O  O   . GLN C  1 65  ? 10.422  72.473  33.776  1.00 22.80 ? 66   GLN C O   1 
ATOM   5478  C  CB  . GLN C  1 65  ? 12.905  70.310  34.293  1.00 22.39 ? 66   GLN C CB  1 
ATOM   5479  C  CG  . GLN C  1 65  ? 13.359  69.752  32.961  1.00 18.43 ? 66   GLN C CG  1 
ATOM   5480  C  CD  . GLN C  1 65  ? 13.631  68.246  32.983  1.00 21.72 ? 66   GLN C CD  1 
ATOM   5481  O  OE1 . GLN C  1 65  ? 12.732  67.439  33.214  1.00 24.66 ? 66   GLN C OE1 1 
ATOM   5482  N  NE2 . GLN C  1 65  ? 14.874  67.865  32.679  1.00 19.15 ? 66   GLN C NE2 1 
ATOM   5483  N  N   . GLN C  1 66  ? 11.920  72.432  32.103  1.00 24.17 ? 67   GLN C N   1 
ATOM   5484  C  CA  . GLN C  1 66  ? 10.949  72.791  31.069  1.00 24.24 ? 67   GLN C CA  1 
ATOM   5485  C  C   . GLN C  1 66  ? 11.335  72.181  29.723  1.00 25.08 ? 67   GLN C C   1 
ATOM   5486  O  O   . GLN C  1 66  ? 12.514  71.889  29.468  1.00 24.17 ? 67   GLN C O   1 
ATOM   5487  C  CB  . GLN C  1 66  ? 10.886  74.315  30.910  1.00 24.26 ? 67   GLN C CB  1 
ATOM   5488  C  CG  . GLN C  1 66  ? 12.225  74.913  30.507  1.00 24.48 ? 67   GLN C CG  1 
ATOM   5489  C  CD  . GLN C  1 66  ? 12.226  76.425  30.415  1.00 26.10 ? 67   GLN C CD  1 
ATOM   5490  O  OE1 . GLN C  1 66  ? 12.328  76.977  29.321  1.00 22.60 ? 67   GLN C OE1 1 
ATOM   5491  N  NE2 . GLN C  1 66  ? 12.127  77.103  31.561  1.00 21.92 ? 67   GLN C NE2 1 
ATOM   5492  N  N   . VAL C  1 67  ? 10.329  71.988  28.872  1.00 24.64 ? 68   VAL C N   1 
ATOM   5493  C  CA  . VAL C  1 67  ? 10.563  71.781  27.451  1.00 25.41 ? 68   VAL C CA  1 
ATOM   5494  C  C   . VAL C  1 67  ? 10.594  73.176  26.818  1.00 26.78 ? 68   VAL C C   1 
ATOM   5495  O  O   . VAL C  1 67  ? 9.596   73.916  26.885  1.00 28.15 ? 68   VAL C O   1 
ATOM   5496  C  CB  . VAL C  1 67  ? 9.466   70.922  26.796  1.00 24.08 ? 68   VAL C CB  1 
ATOM   5497  C  CG1 . VAL C  1 67  ? 9.670   70.869  25.279  1.00 20.36 ? 68   VAL C CG1 1 
ATOM   5498  C  CG2 . VAL C  1 67  ? 9.482   69.531  27.398  1.00 22.52 ? 68   VAL C CG2 1 
ATOM   5499  N  N   . ALA C  1 68  ? 11.733  73.511  26.208  1.00 25.83 ? 69   ALA C N   1 
ATOM   5500  C  CA  . ALA C  1 68  ? 11.981  74.830  25.619  1.00 24.87 ? 69   ALA C CA  1 
ATOM   5501  C  C   . ALA C  1 68  ? 12.354  74.722  24.138  1.00 27.13 ? 69   ALA C C   1 
ATOM   5502  O  O   . ALA C  1 68  ? 12.863  73.689  23.679  1.00 24.27 ? 69   ALA C O   1 
ATOM   5503  C  CB  . ALA C  1 68  ? 13.088  75.516  26.366  1.00 21.91 ? 69   ALA C CB  1 
ATOM   5504  N  N   . LYS C  1 69  ? 12.095  75.810  23.410  1.00 28.39 ? 70   LYS C N   1 
ATOM   5505  C  CA  . LYS C  1 69  ? 12.436  75.956  21.987  1.00 29.56 ? 70   LYS C CA  1 
ATOM   5506  C  C   . LYS C  1 69  ? 13.543  77.014  21.837  1.00 28.95 ? 70   LYS C C   1 
ATOM   5507  O  O   . LYS C  1 69  ? 13.475  78.067  22.443  1.00 28.91 ? 70   LYS C O   1 
ATOM   5508  C  CB  . LYS C  1 69  ? 11.178  76.362  21.190  1.00 29.74 ? 70   LYS C CB  1 
ATOM   5509  C  CG  . LYS C  1 69  ? 11.394  76.616  19.666  1.00 34.30 ? 70   LYS C CG  1 
ATOM   5510  C  CD  . LYS C  1 69  ? 10.038  76.859  18.905  1.00 32.81 ? 70   LYS C CD  1 
ATOM   5511  N  N   . VAL C  1 70  ? 14.581  76.711  21.060  1.00 29.15 ? 71   VAL C N   1 
ATOM   5512  C  CA  . VAL C  1 70  ? 15.618  77.682  20.752  1.00 28.83 ? 71   VAL C CA  1 
ATOM   5513  C  C   . VAL C  1 70  ? 15.024  78.712  19.783  1.00 28.83 ? 71   VAL C C   1 
ATOM   5514  O  O   . VAL C  1 70  ? 14.682  78.342  18.675  1.00 31.43 ? 71   VAL C O   1 
ATOM   5515  C  CB  . VAL C  1 70  ? 16.843  76.997  20.053  1.00 29.78 ? 71   VAL C CB  1 
ATOM   5516  C  CG1 . VAL C  1 70  ? 17.860  78.026  19.601  1.00 27.75 ? 71   VAL C CG1 1 
ATOM   5517  C  CG2 . VAL C  1 70  ? 17.503  75.963  20.971  1.00 28.59 ? 71   VAL C CG2 1 
ATOM   5518  N  N   . VAL C  1 71  ? 14.883  79.979  20.184  1.00 29.07 ? 72   VAL C N   1 
ATOM   5519  C  CA  . VAL C  1 71  ? 14.243  81.005  19.301  1.00 30.45 ? 72   VAL C CA  1 
ATOM   5520  C  C   . VAL C  1 71  ? 15.216  82.023  18.709  1.00 32.10 ? 72   VAL C C   1 
ATOM   5521  O  O   . VAL C  1 71  ? 14.878  82.705  17.719  1.00 31.47 ? 72   VAL C O   1 
ATOM   5522  C  CB  . VAL C  1 71  ? 13.089  81.765  19.994  1.00 30.63 ? 72   VAL C CB  1 
ATOM   5523  C  CG1 . VAL C  1 71  ? 11.877  80.818  20.221  1.00 24.30 ? 72   VAL C CG1 1 
ATOM   5524  C  CG2 . VAL C  1 71  ? 13.574  82.403  21.294  1.00 25.29 ? 72   VAL C CG2 1 
ATOM   5525  N  N   . GLU C  1 72  ? 16.385  82.144  19.340  1.00 32.18 ? 73   GLU C N   1 
ATOM   5526  C  CA  . GLU C  1 72  ? 17.556  82.809  18.758  1.00 33.01 ? 73   GLU C CA  1 
ATOM   5527  C  C   . GLU C  1 72  ? 18.755  81.933  19.088  1.00 33.38 ? 73   GLU C C   1 
ATOM   5528  O  O   . GLU C  1 72  ? 18.792  81.303  20.143  1.00 33.03 ? 73   GLU C O   1 
ATOM   5529  C  CB  . GLU C  1 72  ? 17.774  84.205  19.346  1.00 32.94 ? 73   GLU C CB  1 
ATOM   5530  C  CG  . GLU C  1 72  ? 16.626  85.221  19.061  1.00 41.79 ? 73   GLU C CG  1 
ATOM   5531  C  CD  . GLU C  1 72  ? 16.358  85.429  17.568  1.00 45.48 ? 73   GLU C CD  1 
ATOM   5532  O  OE1 . GLU C  1 72  ? 17.295  85.266  16.757  1.00 47.42 ? 73   GLU C OE1 1 
ATOM   5533  O  OE2 . GLU C  1 72  ? 15.203  85.740  17.202  1.00 50.74 ? 73   GLU C OE2 1 
ATOM   5534  N  N   . SER C  1 73  ? 19.737  81.908  18.194  1.00 32.13 ? 74   SER C N   1 
ATOM   5535  C  CA  . SER C  1 73  ? 20.917  81.084  18.370  1.00 32.19 ? 74   SER C CA  1 
ATOM   5536  C  C   . SER C  1 73  ? 22.176  81.724  17.796  1.00 32.87 ? 74   SER C C   1 
ATOM   5537  O  O   . SER C  1 73  ? 22.166  82.238  16.666  1.00 33.14 ? 74   SER C O   1 
ATOM   5538  C  CB  . SER C  1 73  ? 20.693  79.745  17.676  1.00 31.48 ? 74   SER C CB  1 
ATOM   5539  O  OG  . SER C  1 73  ? 21.876  78.986  17.730  1.00 32.21 ? 74   SER C OG  1 
ATOM   5540  N  N   . LYS C  1 74  ? 23.244  81.706  18.589  1.00 34.54 ? 75   LYS C N   1 
ATOM   5541  C  CA  . LYS C  1 74  ? 24.617  81.913  18.098  1.00 34.35 ? 75   LYS C CA  1 
ATOM   5542  C  C   . LYS C  1 74  ? 25.435  80.623  18.304  1.00 34.64 ? 75   LYS C C   1 
ATOM   5543  O  O   . LYS C  1 74  ? 26.658  80.675  18.527  1.00 37.11 ? 75   LYS C O   1 
ATOM   5544  C  CB  . LYS C  1 74  ? 25.282  83.067  18.840  1.00 34.18 ? 75   LYS C CB  1 
ATOM   5545  C  CG  . LYS C  1 74  ? 24.867  84.439  18.383  1.00 36.25 ? 75   LYS C CG  1 
ATOM   5546  C  CD  . LYS C  1 74  ? 25.856  85.463  18.940  1.00 45.11 ? 75   LYS C CD  1 
ATOM   5547  C  CE  . LYS C  1 74  ? 25.765  86.844  18.277  1.00 54.30 ? 75   LYS C CE  1 
ATOM   5548  N  NZ  . LYS C  1 74  ? 25.271  87.892  19.225  1.00 52.07 ? 75   LYS C NZ  1 
ATOM   5549  N  N   . ASN C  1 75  ? 24.758  79.478  18.235  1.00 32.88 ? 76   ASN C N   1 
ATOM   5550  C  CA  . ASN C  1 75  ? 25.387  78.184  18.404  1.00 33.89 ? 76   ASN C CA  1 
ATOM   5551  C  C   . ASN C  1 75  ? 25.005  77.272  17.243  1.00 35.00 ? 76   ASN C C   1 
ATOM   5552  O  O   . ASN C  1 75  ? 23.843  76.859  17.118  1.00 33.76 ? 76   ASN C O   1 
ATOM   5553  C  CB  . ASN C  1 75  ? 24.955  77.547  19.733  1.00 33.92 ? 76   ASN C CB  1 
ATOM   5554  C  CG  . ASN C  1 75  ? 25.772  76.318  20.092  1.00 35.00 ? 76   ASN C CG  1 
ATOM   5555  O  OD1 . ASN C  1 75  ? 26.073  75.474  19.239  1.00 39.32 ? 76   ASN C OD1 1 
ATOM   5556  N  ND2 . ASN C  1 75  ? 26.150  76.220  21.358  1.00 33.18 ? 76   ASN C ND2 1 
ATOM   5557  N  N   . VAL C  1 76  ? 25.995  76.924  16.422  1.00 35.34 ? 77   VAL C N   1 
ATOM   5558  C  CA  . VAL C  1 76  ? 25.757  76.096  15.232  1.00 35.49 ? 77   VAL C CA  1 
ATOM   5559  C  C   . VAL C  1 76  ? 25.210  74.683  15.529  1.00 35.45 ? 77   VAL C C   1 
ATOM   5560  O  O   . VAL C  1 76  ? 24.599  74.063  14.659  1.00 38.11 ? 77   VAL C O   1 
ATOM   5561  C  CB  . VAL C  1 76  ? 27.041  76.001  14.351  1.00 37.13 ? 77   VAL C CB  1 
ATOM   5562  C  CG1 . VAL C  1 76  ? 27.440  77.392  13.848  1.00 39.68 ? 77   VAL C CG1 1 
ATOM   5563  C  CG2 . VAL C  1 76  ? 28.207  75.368  15.126  1.00 36.12 ? 77   VAL C CG2 1 
ATOM   5564  N  N   . ALA C  1 77  ? 25.406  74.188  16.747  1.00 34.91 ? 78   ALA C N   1 
ATOM   5565  C  CA  . ALA C  1 77  ? 24.839  72.885  17.177  1.00 34.96 ? 78   ALA C CA  1 
ATOM   5566  C  C   . ALA C  1 77  ? 23.366  72.977  17.610  1.00 35.57 ? 78   ALA C C   1 
ATOM   5567  O  O   . ALA C  1 77  ? 22.682  71.948  17.739  1.00 34.90 ? 78   ALA C O   1 
ATOM   5568  C  CB  . ALA C  1 77  ? 25.678  72.299  18.332  1.00 34.13 ? 78   ALA C CB  1 
ATOM   5569  N  N   . LEU C  1 78  ? 22.896  74.208  17.836  1.00 35.69 ? 79   LEU C N   1 
ATOM   5570  C  CA  . LEU C  1 78  ? 21.570  74.474  18.391  1.00 34.83 ? 79   LEU C CA  1 
ATOM   5571  C  C   . LEU C  1 78  ? 20.845  75.492  17.513  1.00 34.99 ? 79   LEU C C   1 
ATOM   5572  O  O   . LEU C  1 78  ? 20.627  76.648  17.911  1.00 34.20 ? 79   LEU C O   1 
ATOM   5573  C  CB  . LEU C  1 78  ? 21.708  74.976  19.840  1.00 34.77 ? 79   LEU C CB  1 
ATOM   5574  C  CG  . LEU C  1 78  ? 22.144  73.881  20.825  1.00 36.75 ? 79   LEU C CG  1 
ATOM   5575  C  CD1 . LEU C  1 78  ? 22.573  74.439  22.202  1.00 35.57 ? 79   LEU C CD1 1 
ATOM   5576  C  CD2 . LEU C  1 78  ? 21.003  72.873  20.967  1.00 31.06 ? 79   LEU C CD2 1 
ATOM   5577  N  N   . PRO C  1 79  ? 20.486  75.068  16.289  1.00 33.47 ? 80   PRO C N   1 
ATOM   5578  C  CA  . PRO C  1 79  ? 19.766  75.977  15.424  1.00 33.35 ? 80   PRO C CA  1 
ATOM   5579  C  C   . PRO C  1 79  ? 18.394  76.301  16.019  1.00 33.05 ? 80   PRO C C   1 
ATOM   5580  O  O   . PRO C  1 79  ? 17.890  75.551  16.854  1.00 31.49 ? 80   PRO C O   1 
ATOM   5581  C  CB  . PRO C  1 79  ? 19.609  75.180  14.128  1.00 34.02 ? 80   PRO C CB  1 
ATOM   5582  C  CG  . PRO C  1 79  ? 19.675  73.720  14.576  1.00 33.40 ? 80   PRO C CG  1 
ATOM   5583  C  CD  . PRO C  1 79  ? 20.649  73.727  15.697  1.00 33.47 ? 80   PRO C CD  1 
ATOM   5584  N  N   . LYS C  1 80  ? 17.831  77.422  15.583  1.00 32.89 ? 81   LYS C N   1 
ATOM   5585  C  CA  . LYS C  1 80  ? 16.515  77.872  15.984  1.00 32.42 ? 81   LYS C CA  1 
ATOM   5586  C  C   . LYS C  1 80  ? 15.518  76.772  15.706  1.00 33.09 ? 81   LYS C C   1 
ATOM   5587  O  O   . LYS C  1 80  ? 15.676  76.025  14.748  1.00 34.11 ? 81   LYS C O   1 
ATOM   5588  C  CB  . LYS C  1 80  ? 16.137  79.128  15.195  1.00 33.96 ? 81   LYS C CB  1 
ATOM   5589  C  CG  . LYS C  1 80  ? 16.885  80.391  15.630  1.00 38.25 ? 81   LYS C CG  1 
ATOM   5590  C  CD  . LYS C  1 80  ? 16.789  81.521  14.599  1.00 43.67 ? 81   LYS C CD  1 
ATOM   5591  C  CE  . LYS C  1 80  ? 15.362  81.995  14.367  1.00 42.89 ? 81   LYS C CE  1 
ATOM   5592  N  NZ  . LYS C  1 80  ? 15.339  83.267  13.567  1.00 47.49 ? 81   LYS C NZ  1 
ATOM   5593  N  N   . GLY C  1 81  ? 14.498  76.653  16.548  1.00 31.94 ? 82   GLY C N   1 
ATOM   5594  C  CA  . GLY C  1 81  ? 13.506  75.579  16.407  1.00 30.23 ? 82   GLY C CA  1 
ATOM   5595  C  C   . GLY C  1 81  ? 13.898  74.275  17.090  1.00 29.56 ? 82   GLY C C   1 
ATOM   5596  O  O   . GLY C  1 81  ? 13.058  73.391  17.235  1.00 29.07 ? 82   GLY C O   1 
ATOM   5597  N  N   . THR C  1 82  ? 15.162  74.129  17.505  1.00 27.94 ? 83   THR C N   1 
ATOM   5598  C  CA  . THR C  1 82  ? 15.563  72.943  18.257  1.00 28.10 ? 83   THR C CA  1 
ATOM   5599  C  C   . THR C  1 82  ? 14.783  72.844  19.597  1.00 27.65 ? 83   THR C C   1 
ATOM   5600  O  O   . THR C  1 82  ? 14.656  73.830  20.333  1.00 27.53 ? 83   THR C O   1 
ATOM   5601  C  CB  . THR C  1 82  ? 17.081  72.929  18.576  1.00 30.47 ? 83   THR C CB  1 
ATOM   5602  O  OG1 . THR C  1 82  ? 17.859  73.039  17.369  1.00 31.32 ? 83   THR C OG1 1 
ATOM   5603  C  CG2 . THR C  1 82  ? 17.461  71.629  19.341  1.00 28.28 ? 83   THR C CG2 1 
ATOM   5604  N  N   . ILE C  1 83  ? 14.283  71.647  19.912  1.00 27.75 ? 84   ILE C N   1 
ATOM   5605  C  CA  . ILE C  1 83  ? 13.625  71.411  21.198  1.00 27.68 ? 84   ILE C CA  1 
ATOM   5606  C  C   . ILE C  1 83  ? 14.619  70.776  22.163  1.00 28.02 ? 84   ILE C C   1 
ATOM   5607  O  O   . ILE C  1 83  ? 15.319  69.817  21.821  1.00 29.24 ? 84   ILE C O   1 
ATOM   5608  C  CB  . ILE C  1 83  ? 12.349  70.541  21.074  1.00 28.11 ? 84   ILE C CB  1 
ATOM   5609  C  CG1 . ILE C  1 83  ? 11.424  71.056  19.969  1.00 26.87 ? 84   ILE C CG1 1 
ATOM   5610  C  CG2 . ILE C  1 83  ? 11.571  70.570  22.359  1.00 28.37 ? 84   ILE C CG2 1 
ATOM   5611  C  CD1 . ILE C  1 83  ? 10.979  72.498  20.161  1.00 24.82 ? 84   ILE C CD1 1 
ATOM   5612  N  N   . VAL C  1 84  ? 14.694  71.351  23.361  1.00 27.75 ? 85   VAL C N   1 
ATOM   5613  C  CA  . VAL C  1 84  ? 15.568  70.874  24.410  1.00 26.93 ? 85   VAL C CA  1 
ATOM   5614  C  C   . VAL C  1 84  ? 14.791  70.736  25.701  1.00 27.25 ? 85   VAL C C   1 
ATOM   5615  O  O   . VAL C  1 84  ? 13.697  71.301  25.841  1.00 31.99 ? 85   VAL C O   1 
ATOM   5616  C  CB  . VAL C  1 84  ? 16.761  71.847  24.642  1.00 27.78 ? 85   VAL C CB  1 
ATOM   5617  C  CG1 . VAL C  1 84  ? 17.602  71.970  23.356  1.00 27.34 ? 85   VAL C CG1 1 
ATOM   5618  C  CG2 . VAL C  1 84  ? 16.262  73.229  25.123  1.00 23.44 ? 85   VAL C CG2 1 
ATOM   5619  N  N   . LEU C  1 85  ? 15.350  69.970  26.628  1.00 24.83 ? 86   LEU C N   1 
ATOM   5620  C  CA  . LEU C  1 85  ? 14.978  70.015  28.039  1.00 24.13 ? 86   LEU C CA  1 
ATOM   5621  C  C   . LEU C  1 85  ? 15.978  70.943  28.698  1.00 23.57 ? 86   LEU C C   1 
ATOM   5622  O  O   . LEU C  1 85  ? 17.153  70.820  28.438  1.00 22.13 ? 86   LEU C O   1 
ATOM   5623  C  CB  . LEU C  1 85  ? 15.097  68.641  28.689  1.00 24.29 ? 86   LEU C CB  1 
ATOM   5624  C  CG  . LEU C  1 85  ? 13.967  67.652  28.444  1.00 23.32 ? 86   LEU C CG  1 
ATOM   5625  C  CD1 . LEU C  1 85  ? 14.399  66.250  28.948  1.00 21.83 ? 86   LEU C CD1 1 
ATOM   5626  C  CD2 . LEU C  1 85  ? 12.685  68.105  29.130  1.00 23.35 ? 86   LEU C CD2 1 
ATOM   5627  N  N   . ALA C  1 86  ? 15.502  71.871  29.532  1.00 22.17 ? 87   ALA C N   1 
ATOM   5628  C  CA  . ALA C  1 86  ? 16.368  72.765  30.295  1.00 22.67 ? 87   ALA C CA  1 
ATOM   5629  C  C   . ALA C  1 86  ? 15.750  72.974  31.684  1.00 21.80 ? 87   ALA C C   1 
ATOM   5630  O  O   . ALA C  1 86  ? 14.543  72.808  31.853  1.00 20.76 ? 87   ALA C O   1 
ATOM   5631  C  CB  . ALA C  1 86  ? 16.533  74.118  29.561  1.00 21.17 ? 87   ALA C CB  1 
ATOM   5632  N  N   . SER C  1 87  ? 16.584  73.345  32.651  1.00 22.50 ? 88   SER C N   1 
ATOM   5633  C  CA  . SER C  1 87  ? 16.173  73.570  34.030  1.00 22.92 ? 88   SER C CA  1 
ATOM   5634  C  C   . SER C  1 87  ? 16.616  74.934  34.560  1.00 23.29 ? 88   SER C C   1 
ATOM   5635  O  O   . SER C  1 87  ? 17.357  75.027  35.541  1.00 24.31 ? 88   SER C O   1 
ATOM   5636  C  CB  . SER C  1 87  ? 16.734  72.449  34.904  1.00 24.56 ? 88   SER C CB  1 
ATOM   5637  O  OG  . SER C  1 87  ? 16.233  71.208  34.441  1.00 26.37 ? 88   SER C OG  1 
ATOM   5638  N  N   . PRO C  1 88  ? 16.153  76.019  33.922  1.00 23.71 ? 89   PRO C N   1 
ATOM   5639  C  CA  . PRO C  1 88  ? 16.505  77.344  34.453  1.00 24.07 ? 89   PRO C CA  1 
ATOM   5640  C  C   . PRO C  1 88  ? 15.567  77.771  35.576  1.00 25.61 ? 89   PRO C C   1 
ATOM   5641  O  O   . PRO C  1 88  ? 15.679  78.883  36.075  1.00 26.36 ? 89   PRO C O   1 
ATOM   5642  C  CB  . PRO C  1 88  ? 16.294  78.244  33.254  1.00 23.30 ? 89   PRO C CB  1 
ATOM   5643  C  CG  . PRO C  1 88  ? 15.059  77.600  32.572  1.00 22.84 ? 89   PRO C CG  1 
ATOM   5644  C  CD  . PRO C  1 88  ? 15.276  76.110  32.740  1.00 21.72 ? 89   PRO C CD  1 
ATOM   5645  N  N   . GLY C  1 89  ? 14.622  76.914  35.954  1.00 25.30 ? 90   GLY C N   1 
ATOM   5646  C  CA  . GLY C  1 89  ? 13.619  77.317  36.939  1.00 26.06 ? 90   GLY C CA  1 
ATOM   5647  C  C   . GLY C  1 89  ? 12.329  77.793  36.287  1.00 24.69 ? 90   GLY C C   1 
ATOM   5648  O  O   . GLY C  1 89  ? 12.082  77.571  35.093  1.00 23.81 ? 90   GLY C O   1 
ATOM   5649  N  N   . TRP C  1 90  ? 11.501  78.441  37.098  1.00 24.76 ? 91   TRP C N   1 
ATOM   5650  C  CA  . TRP C  1 90  ? 10.172  78.874  36.697  1.00 24.35 ? 91   TRP C CA  1 
ATOM   5651  C  C   . TRP C  1 90  ? 10.395  80.194  35.979  1.00 25.47 ? 91   TRP C C   1 
ATOM   5652  O  O   . TRP C  1 90  ? 10.378  81.279  36.601  1.00 25.31 ? 91   TRP C O   1 
ATOM   5653  C  CB  . TRP C  1 90  ? 9.281   79.078  37.935  1.00 25.25 ? 91   TRP C CB  1 
ATOM   5654  C  CG  . TRP C  1 90  ? 8.985   77.837  38.727  1.00 27.26 ? 91   TRP C CG  1 
ATOM   5655  C  CD1 . TRP C  1 90  ? 9.699   76.678  38.742  1.00 23.74 ? 91   TRP C CD1 1 
ATOM   5656  C  CD2 . TRP C  1 90  ? 7.904   77.644  39.653  1.00 29.44 ? 91   TRP C CD2 1 
ATOM   5657  N  NE1 . TRP C  1 90  ? 9.109   75.765  39.562  1.00 24.23 ? 91   TRP C NE1 1 
ATOM   5658  C  CE2 . TRP C  1 90  ? 8.016   76.336  40.155  1.00 24.33 ? 91   TRP C CE2 1 
ATOM   5659  C  CE3 . TRP C  1 90  ? 6.848   78.454  40.102  1.00 25.91 ? 91   TRP C CE3 1 
ATOM   5660  C  CZ2 . TRP C  1 90  ? 7.130   75.818  41.090  1.00 23.42 ? 91   TRP C CZ2 1 
ATOM   5661  C  CZ3 . TRP C  1 90  ? 5.973   77.943  41.035  1.00 21.31 ? 91   TRP C CZ3 1 
ATOM   5662  C  CH2 . TRP C  1 90  ? 6.118   76.639  41.520  1.00 22.76 ? 91   TRP C CH2 1 
ATOM   5663  N  N   . THR C  1 91  ? 10.681  80.093  34.682  1.00 25.57 ? 92   THR C N   1 
ATOM   5664  C  CA  . THR C  1 91  ? 11.019  81.264  33.876  1.00 24.90 ? 92   THR C CA  1 
ATOM   5665  C  C   . THR C  1 91  ? 10.613  81.033  32.436  1.00 25.46 ? 92   THR C C   1 
ATOM   5666  O  O   . THR C  1 91  ? 10.691  79.895  31.909  1.00 24.70 ? 92   THR C O   1 
ATOM   5667  C  CB  . THR C  1 91  ? 12.514  81.607  33.997  1.00 26.52 ? 92   THR C CB  1 
ATOM   5668  O  OG1 . THR C  1 91  ? 12.733  82.966  33.607  1.00 29.07 ? 92   THR C OG1 1 
ATOM   5669  C  CG2 . THR C  1 91  ? 13.405  80.661  33.136  1.00 23.87 ? 92   THR C CG2 1 
ATOM   5670  N  N   . THR C  1 92  ? 10.154  82.098  31.789  1.00 26.30 ? 93   THR C N   1 
ATOM   5671  C  CA  . THR C  1 92  ? 9.653   81.984  30.422  1.00 26.71 ? 93   THR C CA  1 
ATOM   5672  C  C   . THR C  1 92  ? 10.742  82.009  29.370  1.00 27.17 ? 93   THR C C   1 
ATOM   5673  O  O   . THR C  1 92  ? 10.566  81.430  28.307  1.00 30.56 ? 93   THR C O   1 
ATOM   5674  C  CB  . THR C  1 92  ? 8.660   83.108  30.057  1.00 27.62 ? 93   THR C CB  1 
ATOM   5675  O  OG1 . THR C  1 92  ? 9.267   84.389  30.320  1.00 23.85 ? 93   THR C OG1 1 
ATOM   5676  C  CG2 . THR C  1 92  ? 7.333   82.921  30.826  1.00 23.78 ? 93   THR C CG2 1 
ATOM   5677  N  N   . HIS C  1 93  ? 11.826  82.721  29.644  1.00 27.84 ? 94   HIS C N   1 
ATOM   5678  C  CA  . HIS C  1 93  ? 12.897  82.917  28.674  1.00 29.82 ? 94   HIS C CA  1 
ATOM   5679  C  C   . HIS C  1 93  ? 14.230  82.840  29.422  1.00 29.53 ? 94   HIS C C   1 
ATOM   5680  O  O   . HIS C  1 93  ? 14.343  83.330  30.550  1.00 30.22 ? 94   HIS C O   1 
ATOM   5681  C  CB  . HIS C  1 93  ? 12.767  84.277  27.945  1.00 31.24 ? 94   HIS C CB  1 
ATOM   5682  C  CG  . HIS C  1 93  ? 11.574  84.382  27.024  1.00 34.61 ? 94   HIS C CG  1 
ATOM   5683  N  ND1 . HIS C  1 93  ? 10.296  84.648  27.478  1.00 42.55 ? 94   HIS C ND1 1 
ATOM   5684  C  CD2 . HIS C  1 93  ? 11.476  84.277  25.676  1.00 36.10 ? 94   HIS C CD2 1 
ATOM   5685  C  CE1 . HIS C  1 93  ? 9.463   84.690  26.449  1.00 44.58 ? 94   HIS C CE1 1 
ATOM   5686  N  NE2 . HIS C  1 93  ? 10.155  84.471  25.344  1.00 39.61 ? 94   HIS C NE2 1 
ATOM   5687  N  N   . SER C  1 94  ? 15.217  82.189  28.811  1.00 25.97 ? 95   SER C N   1 
ATOM   5688  C  CA  . SER C  1 94  ? 16.513  82.060  29.434  1.00 27.58 ? 95   SER C CA  1 
ATOM   5689  C  C   . SER C  1 94  ? 17.610  81.928  28.387  1.00 27.74 ? 95   SER C C   1 
ATOM   5690  O  O   . SER C  1 94  ? 17.361  81.610  27.225  1.00 28.47 ? 95   SER C O   1 
ATOM   5691  C  CB  . SER C  1 94  ? 16.530  80.873  30.424  1.00 27.33 ? 95   SER C CB  1 
ATOM   5692  O  OG  . SER C  1 94  ? 16.123  79.659  29.804  1.00 22.15 ? 95   SER C OG  1 
ATOM   5693  N  N   . ILE C  1 95  ? 18.823  82.200  28.822  1.00 29.85 ? 96   ILE C N   1 
ATOM   5694  C  CA  . ILE C  1 95  ? 19.994  82.138  27.971  1.00 31.82 ? 96   ILE C CA  1 
ATOM   5695  C  C   . ILE C  1 95  ? 20.825  80.964  28.449  1.00 32.36 ? 96   ILE C C   1 
ATOM   5696  O  O   . ILE C  1 95  ? 21.056  80.809  29.654  1.00 31.97 ? 96   ILE C O   1 
ATOM   5697  C  CB  . ILE C  1 95  ? 20.826  83.442  28.049  1.00 32.65 ? 96   ILE C CB  1 
ATOM   5698  C  CG1 . ILE C  1 95  ? 20.088  84.583  27.342  1.00 33.61 ? 96   ILE C CG1 1 
ATOM   5699  C  CG2 . ILE C  1 95  ? 22.221  83.257  27.408  1.00 32.88 ? 96   ILE C CG2 1 
ATOM   5700  C  CD1 . ILE C  1 95  ? 20.758  85.947  27.537  1.00 31.49 ? 96   ILE C CD1 1 
ATOM   5701  N  N   . SER C  1 96  ? 21.243  80.133  27.497  1.00 31.96 ? 97   SER C N   1 
ATOM   5702  C  CA  . SER C  1 96  ? 22.111  78.999  27.773  1.00 31.48 ? 97   SER C CA  1 
ATOM   5703  C  C   . SER C  1 96  ? 23.300  78.960  26.803  1.00 33.17 ? 97   SER C C   1 
ATOM   5704  O  O   . SER C  1 96  ? 23.195  79.351  25.619  1.00 33.18 ? 97   SER C O   1 
ATOM   5705  C  CB  . SER C  1 96  ? 21.308  77.701  27.665  1.00 32.10 ? 97   SER C CB  1 
ATOM   5706  O  OG  . SER C  1 96  ? 22.154  76.559  27.717  1.00 34.05 ? 97   SER C OG  1 
ATOM   5707  N  N   . ASP C  1 97  ? 24.430  78.481  27.319  1.00 35.33 ? 98   ASP C N   1 
ATOM   5708  C  CA  . ASP C  1 97  ? 25.594  78.142  26.496  1.00 35.76 ? 98   ASP C CA  1 
ATOM   5709  C  C   . ASP C  1 97  ? 25.442  76.774  25.807  1.00 35.00 ? 98   ASP C C   1 
ATOM   5710  O  O   . ASP C  1 97  ? 26.301  76.369  25.019  1.00 34.81 ? 98   ASP C O   1 
ATOM   5711  C  CB  . ASP C  1 97  ? 26.860  78.144  27.355  1.00 38.08 ? 98   ASP C CB  1 
ATOM   5712  C  CG  . ASP C  1 97  ? 26.728  77.284  28.594  1.00 41.08 ? 98   ASP C CG  1 
ATOM   5713  O  OD1 . ASP C  1 97  ? 25.827  76.416  28.639  1.00 46.98 ? 98   ASP C OD1 1 
ATOM   5714  O  OD2 . ASP C  1 97  ? 27.518  77.502  29.535  1.00 43.50 ? 98   ASP C OD2 1 
ATOM   5715  N  N   . GLY C  1 98  ? 24.361  76.059  26.107  1.00 33.98 ? 99   GLY C N   1 
ATOM   5716  C  CA  . GLY C  1 98  ? 24.101  74.740  25.510  1.00 34.35 ? 99   GLY C CA  1 
ATOM   5717  C  C   . GLY C  1 98  ? 24.621  73.558  26.325  1.00 34.02 ? 99   GLY C C   1 
ATOM   5718  O  O   . GLY C  1 98  ? 24.202  72.415  26.136  1.00 32.97 ? 99   GLY C O   1 
ATOM   5719  N  N   . LYS C  1 99  ? 25.543  73.829  27.230  1.00 35.16 ? 100  LYS C N   1 
ATOM   5720  C  CA  . LYS C  1 99  ? 26.181  72.772  27.988  1.00 38.59 ? 100  LYS C CA  1 
ATOM   5721  C  C   . LYS C  1 99  ? 25.231  72.104  28.988  1.00 38.29 ? 100  LYS C C   1 
ATOM   5722  O  O   . LYS C  1 99  ? 25.416  70.941  29.292  1.00 38.09 ? 100  LYS C O   1 
ATOM   5723  C  CB  . LYS C  1 99  ? 27.450  73.312  28.665  1.00 39.77 ? 100  LYS C CB  1 
ATOM   5724  C  CG  . LYS C  1 99  ? 28.557  73.614  27.616  1.00 45.16 ? 100  LYS C CG  1 
ATOM   5725  C  CD  . LYS C  1 99  ? 29.852  74.108  28.241  1.00 50.08 ? 100  LYS C CD  1 
ATOM   5726  C  CE  . LYS C  1 99  ? 30.991  74.103  27.210  1.00 55.60 ? 100  LYS C CE  1 
ATOM   5727  N  NZ  . LYS C  1 99  ? 32.204  74.854  27.660  1.00 53.86 ? 100  LYS C NZ  1 
ATOM   5728  N  N   . ASP C  1 100 ? 24.201  72.823  29.450  1.00 38.02 ? 101  ASP C N   1 
ATOM   5729  C  CA  . ASP C  1 100 ? 23.230  72.282  30.412  1.00 38.34 ? 101  ASP C CA  1 
ATOM   5730  C  C   . ASP C  1 100 ? 21.875  71.906  29.780  1.00 36.44 ? 101  ASP C C   1 
ATOM   5731  O  O   . ASP C  1 100 ? 20.852  71.892  30.463  1.00 36.62 ? 101  ASP C O   1 
ATOM   5732  C  CB  . ASP C  1 100 ? 23.019  73.286  31.559  1.00 38.10 ? 101  ASP C CB  1 
ATOM   5733  C  CG  . ASP C  1 100 ? 22.560  74.654  31.061  1.00 42.45 ? 101  ASP C CG  1 
ATOM   5734  O  OD1 . ASP C  1 100 ? 22.374  74.827  29.844  1.00 46.13 ? 101  ASP C OD1 1 
ATOM   5735  O  OD2 . ASP C  1 100 ? 22.389  75.569  31.883  1.00 49.29 ? 101  ASP C OD2 1 
ATOM   5736  N  N   . LEU C  1 101 ? 21.866  71.595  28.487  1.00 34.30 ? 102  LEU C N   1 
ATOM   5737  C  CA  . LEU C  1 101 ? 20.622  71.293  27.767  1.00 31.69 ? 102  LEU C CA  1 
ATOM   5738  C  C   . LEU C  1 101 ? 20.589  69.835  27.356  1.00 31.98 ? 102  LEU C C   1 
ATOM   5739  O  O   . LEU C  1 101 ? 21.617  69.204  27.271  1.00 31.54 ? 102  LEU C O   1 
ATOM   5740  C  CB  . LEU C  1 101 ? 20.533  72.140  26.507  1.00 30.60 ? 102  LEU C CB  1 
ATOM   5741  C  CG  . LEU C  1 101 ? 20.631  73.654  26.683  1.00 32.27 ? 102  LEU C CG  1 
ATOM   5742  C  CD1 . LEU C  1 101 ? 20.138  74.327  25.399  1.00 30.13 ? 102  LEU C CD1 1 
ATOM   5743  C  CD2 . LEU C  1 101 ? 19.817  74.162  27.898  1.00 30.31 ? 102  LEU C CD2 1 
ATOM   5744  N  N   . GLU C  1 102 ? 19.415  69.303  27.066  1.00 30.87 ? 103  GLU C N   1 
ATOM   5745  C  CA  . GLU C  1 102 ? 19.327  67.918  26.646  1.00 31.15 ? 103  GLU C CA  1 
ATOM   5746  C  C   . GLU C  1 102 ? 18.317  67.846  25.540  1.00 31.16 ? 103  GLU C C   1 
ATOM   5747  O  O   . GLU C  1 102 ? 17.152  68.202  25.739  1.00 27.70 ? 103  GLU C O   1 
ATOM   5748  C  CB  . GLU C  1 102 ? 18.917  67.004  27.823  1.00 31.74 ? 103  GLU C CB  1 
ATOM   5749  C  CG  . GLU C  1 102 ? 18.354  65.610  27.421  1.00 35.20 ? 103  GLU C CG  1 
ATOM   5750  C  CD  . GLU C  1 102 ? 17.862  64.777  28.629  1.00 39.53 ? 103  GLU C CD  1 
ATOM   5751  O  OE1 . GLU C  1 102 ? 18.235  65.093  29.773  1.00 31.41 ? 103  GLU C OE1 1 
ATOM   5752  O  OE2 . GLU C  1 102 ? 17.106  63.801  28.427  1.00 37.04 ? 103  GLU C OE2 1 
ATOM   5753  N  N   . LYS C  1 103 ? 18.766  67.397  24.368  1.00 31.50 ? 104  LYS C N   1 
ATOM   5754  C  CA  . LYS C  1 103 ? 17.860  67.180  23.251  1.00 32.02 ? 104  LYS C CA  1 
ATOM   5755  C  C   . LYS C  1 103 ? 17.007  65.958  23.526  1.00 31.10 ? 104  LYS C C   1 
ATOM   5756  O  O   . LYS C  1 103 ? 17.416  65.077  24.279  1.00 32.63 ? 104  LYS C O   1 
ATOM   5757  C  CB  . LYS C  1 103 ? 18.642  66.950  21.955  1.00 33.95 ? 104  LYS C CB  1 
ATOM   5758  C  CG  . LYS C  1 103 ? 19.215  68.210  21.318  1.00 37.89 ? 104  LYS C CG  1 
ATOM   5759  C  CD  . LYS C  1 103 ? 20.109  67.794  20.147  1.00 44.94 ? 104  LYS C CD  1 
ATOM   5760  C  CE  . LYS C  1 103 ? 20.644  68.952  19.350  1.00 46.13 ? 104  LYS C CE  1 
ATOM   5761  N  NZ  . LYS C  1 103 ? 21.130  68.445  18.029  1.00 46.91 ? 104  LYS C NZ  1 
ATOM   5762  N  N   . LEU C  1 104 ? 15.848  65.885  22.887  1.00 30.37 ? 105  LEU C N   1 
ATOM   5763  C  CA  . LEU C  1 104 ? 14.962  64.736  23.042  1.00 31.95 ? 105  LEU C CA  1 
ATOM   5764  C  C   . LEU C  1 104 ? 15.501  63.537  22.266  1.00 33.58 ? 105  LEU C C   1 
ATOM   5765  O  O   . LEU C  1 104 ? 16.405  63.681  21.435  1.00 35.23 ? 105  LEU C O   1 
ATOM   5766  C  CB  . LEU C  1 104 ? 13.543  65.047  22.543  1.00 29.76 ? 105  LEU C CB  1 
ATOM   5767  C  CG  . LEU C  1 104 ? 12.814  66.258  23.125  1.00 33.30 ? 105  LEU C CG  1 
ATOM   5768  C  CD1 . LEU C  1 104 ? 11.308  66.135  22.932  1.00 36.97 ? 105  LEU C CD1 1 
ATOM   5769  C  CD2 . LEU C  1 104 ? 13.129  66.443  24.584  1.00 31.38 ? 105  LEU C CD2 1 
ATOM   5770  N  N   . LEU C  1 105 ? 14.920  62.362  22.509  1.00 32.65 ? 106  LEU C N   1 
ATOM   5771  C  CA  . LEU C  1 105 ? 15.303  61.167  21.772  1.00 31.69 ? 106  LEU C CA  1 
ATOM   5772  C  C   . LEU C  1 105 ? 15.120  61.393  20.252  1.00 33.85 ? 106  LEU C C   1 
ATOM   5773  O  O   . LEU C  1 105 ? 14.070  61.852  19.813  1.00 32.39 ? 106  LEU C O   1 
ATOM   5774  C  CB  . LEU C  1 105 ? 14.485  59.957  22.222  1.00 30.53 ? 106  LEU C CB  1 
ATOM   5775  C  CG  . LEU C  1 105 ? 14.655  59.477  23.660  1.00 28.90 ? 106  LEU C CG  1 
ATOM   5776  C  CD1 . LEU C  1 105 ? 13.582  58.448  24.002  1.00 27.49 ? 106  LEU C CD1 1 
ATOM   5777  C  CD2 . LEU C  1 105 ? 16.047  58.899  23.839  1.00 26.69 ? 106  LEU C CD2 1 
ATOM   5778  N  N   . THR C  1 106 ? 16.176  61.088  19.493  1.00 35.42 ? 107  THR C N   1 
ATOM   5779  C  CA  . THR C  1 106 ? 16.182  61.026  18.029  1.00 36.77 ? 107  THR C CA  1 
ATOM   5780  C  C   . THR C  1 106 ? 14.921  60.378  17.441  1.00 36.91 ? 107  THR C C   1 
ATOM   5781  O  O   . THR C  1 106 ? 14.361  60.861  16.475  1.00 34.14 ? 107  THR C O   1 
ATOM   5782  C  CB  . THR C  1 106 ? 17.407  60.196  17.571  1.00 38.16 ? 107  THR C CB  1 
ATOM   5783  O  OG1 . THR C  1 106 ? 18.620  60.945  17.811  1.00 38.73 ? 107  THR C OG1 1 
ATOM   5784  C  CG2 . THR C  1 106 ? 17.297  59.807  16.096  1.00 44.88 ? 107  THR C CG2 1 
ATOM   5785  N  N   . GLU C  1 107 ? 14.473  59.291  18.054  1.00 38.73 ? 108  GLU C N   1 
ATOM   5786  C  CA  . GLU C  1 107 ? 13.278  58.591  17.599  1.00 38.98 ? 108  GLU C CA  1 
ATOM   5787  C  C   . GLU C  1 107 ? 11.982  59.226  18.116  1.00 38.06 ? 108  GLU C C   1 
ATOM   5788  O  O   . GLU C  1 107 ? 10.920  58.645  17.966  1.00 38.07 ? 108  GLU C O   1 
ATOM   5789  C  CB  . GLU C  1 107 ? 13.342  57.089  17.980  1.00 40.32 ? 108  GLU C CB  1 
ATOM   5790  C  CG  . GLU C  1 107 ? 13.588  56.756  19.468  1.00 44.19 ? 108  GLU C CG  1 
ATOM   5791  C  CD  . GLU C  1 107 ? 15.062  56.568  19.819  1.00 46.19 ? 108  GLU C CD  1 
ATOM   5792  O  OE1 . GLU C  1 107 ? 15.901  57.402  19.421  1.00 45.45 ? 108  GLU C OE1 1 
ATOM   5793  O  OE2 . GLU C  1 107 ? 15.388  55.581  20.501  1.00 49.61 ? 108  GLU C OE2 1 
ATOM   5794  N  N   . TRP C  1 108 ? 12.059  60.412  18.717  1.00 37.23 ? 109  TRP C N   1 
ATOM   5795  C  CA  . TRP C  1 108 ? 10.870  61.036  19.281  1.00 37.05 ? 109  TRP C CA  1 
ATOM   5796  C  C   . TRP C  1 108 ? 9.911   61.364  18.156  1.00 36.61 ? 109  TRP C C   1 
ATOM   5797  O  O   . TRP C  1 108 ? 10.234  62.183  17.299  1.00 38.87 ? 109  TRP C O   1 
ATOM   5798  C  CB  . TRP C  1 108 ? 11.207  62.302  20.082  1.00 36.28 ? 109  TRP C CB  1 
ATOM   5799  C  CG  . TRP C  1 108 ? 10.058  62.808  20.895  1.00 35.39 ? 109  TRP C CG  1 
ATOM   5800  C  CD1 . TRP C  1 108 ? 8.974   63.486  20.437  1.00 37.37 ? 109  TRP C CD1 1 
ATOM   5801  C  CD2 . TRP C  1 108 ? 9.884   62.678  22.314  1.00 31.80 ? 109  TRP C CD2 1 
ATOM   5802  N  NE1 . TRP C  1 108 ? 8.126   63.786  21.476  1.00 37.31 ? 109  TRP C NE1 1 
ATOM   5803  C  CE2 . TRP C  1 108 ? 8.661   63.298  22.641  1.00 33.97 ? 109  TRP C CE2 1 
ATOM   5804  C  CE3 . TRP C  1 108 ? 10.637  62.084  23.336  1.00 31.89 ? 109  TRP C CE3 1 
ATOM   5805  C  CZ2 . TRP C  1 108 ? 8.169   63.353  23.955  1.00 32.21 ? 109  TRP C CZ2 1 
ATOM   5806  C  CZ3 . TRP C  1 108 ? 10.147  62.132  24.641  1.00 31.22 ? 109  TRP C CZ3 1 
ATOM   5807  C  CH2 . TRP C  1 108 ? 8.925   62.777  24.937  1.00 30.78 ? 109  TRP C CH2 1 
ATOM   5808  N  N   . PRO C  1 109 ? 8.737   60.723  18.149  1.00 35.69 ? 110  PRO C N   1 
ATOM   5809  C  CA  . PRO C  1 109 ? 7.752   60.936  17.102  1.00 37.12 ? 110  PRO C CA  1 
ATOM   5810  C  C   . PRO C  1 109 ? 6.873   62.129  17.385  1.00 37.80 ? 110  PRO C C   1 
ATOM   5811  O  O   . PRO C  1 109 ? 6.789   62.564  18.531  1.00 37.73 ? 110  PRO C O   1 
ATOM   5812  C  CB  . PRO C  1 109 ? 6.906   59.664  17.165  1.00 37.80 ? 110  PRO C CB  1 
ATOM   5813  C  CG  . PRO C  1 109 ? 6.950   59.255  18.577  1.00 37.43 ? 110  PRO C CG  1 
ATOM   5814  C  CD  . PRO C  1 109 ? 8.251   59.764  19.157  1.00 36.59 ? 110  PRO C CD  1 
ATOM   5815  N  N   . ASP C  1 110 ? 6.191   62.622  16.353  1.00 38.56 ? 111  ASP C N   1 
ATOM   5816  C  CA  . ASP C  1 110 ? 5.349   63.822  16.481  1.00 39.82 ? 111  ASP C CA  1 
ATOM   5817  C  C   . ASP C  1 110 ? 3.917   63.486  16.880  1.00 39.48 ? 111  ASP C C   1 
ATOM   5818  O  O   . ASP C  1 110 ? 3.058   64.366  16.946  1.00 40.27 ? 111  ASP C O   1 
ATOM   5819  C  CB  . ASP C  1 110 ? 5.377   64.682  15.198  1.00 41.79 ? 111  ASP C CB  1 
ATOM   5820  C  CG  . ASP C  1 110 ? 5.229   63.866  13.911  1.00 48.76 ? 111  ASP C CG  1 
ATOM   5821  O  OD1 . ASP C  1 110 ? 4.596   62.779  13.920  1.00 53.99 ? 111  ASP C OD1 1 
ATOM   5822  O  OD2 . ASP C  1 110 ? 5.757   64.336  12.874  1.00 55.77 ? 111  ASP C OD2 1 
ATOM   5823  N  N   . THR C  1 111 ? 3.660   62.214  17.151  1.00 37.66 ? 112  THR C N   1 
ATOM   5824  C  CA  . THR C  1 111 ? 2.332   61.782  17.534  1.00 38.12 ? 112  THR C CA  1 
ATOM   5825  C  C   . THR C  1 111 ? 2.130   61.891  19.055  1.00 39.00 ? 112  THR C C   1 
ATOM   5826  O  O   . THR C  1 111 ? 1.023   61.684  19.545  1.00 39.75 ? 112  THR C O   1 
ATOM   5827  C  CB  . THR C  1 111 ? 2.098   60.338  17.070  1.00 38.66 ? 112  THR C CB  1 
ATOM   5828  O  OG1 . THR C  1 111 ? 3.193   59.516  17.508  1.00 38.42 ? 112  THR C OG1 1 
ATOM   5829  C  CG2 . THR C  1 111 ? 2.012   60.279  15.530  1.00 40.22 ? 112  THR C CG2 1 
ATOM   5830  N  N   . ILE C  1 112 ? 3.187   62.212  19.806  1.00 37.58 ? 113  ILE C N   1 
ATOM   5831  C  CA  . ILE C  1 112 ? 3.058   62.348  21.265  1.00 36.30 ? 113  ILE C CA  1 
ATOM   5832  C  C   . ILE C  1 112 ? 3.451   63.753  21.682  1.00 33.67 ? 113  ILE C C   1 
ATOM   5833  O  O   . ILE C  1 112 ? 4.353   64.352  21.076  1.00 35.22 ? 113  ILE C O   1 
ATOM   5834  C  CB  . ILE C  1 112 ? 3.898   61.287  22.041  1.00 36.68 ? 113  ILE C CB  1 
ATOM   5835  C  CG1 . ILE C  1 112 ? 5.405   61.574  21.942  1.00 37.07 ? 113  ILE C CG1 1 
ATOM   5836  C  CG2 . ILE C  1 112 ? 3.591   59.867  21.525  1.00 37.21 ? 113  ILE C CG2 1 
ATOM   5837  C  CD1 . ILE C  1 112 ? 6.248   60.696  22.839  1.00 36.96 ? 113  ILE C CD1 1 
ATOM   5838  N  N   . PRO C  1 113 ? 2.772   64.305  22.701  1.00 32.53 ? 114  PRO C N   1 
ATOM   5839  C  CA  . PRO C  1 113 ? 3.108   65.671  23.108  1.00 31.26 ? 114  PRO C CA  1 
ATOM   5840  C  C   . PRO C  1 113 ? 4.523   65.752  23.644  1.00 28.55 ? 114  PRO C C   1 
ATOM   5841  O  O   . PRO C  1 113 ? 5.015   64.794  24.269  1.00 29.72 ? 114  PRO C O   1 
ATOM   5842  C  CB  . PRO C  1 113 ? 2.113   65.968  24.238  1.00 31.24 ? 114  PRO C CB  1 
ATOM   5843  C  CG  . PRO C  1 113 ? 1.066   64.966  24.114  1.00 33.53 ? 114  PRO C CG  1 
ATOM   5844  C  CD  . PRO C  1 113 ? 1.725   63.742  23.571  1.00 33.06 ? 114  PRO C CD  1 
ATOM   5845  N  N   . LEU C  1 114 ? 5.158   66.886  23.400  1.00 27.15 ? 115  LEU C N   1 
ATOM   5846  C  CA  . LEU C  1 114 ? 6.539   67.106  23.809  1.00 28.28 ? 115  LEU C CA  1 
ATOM   5847  C  C   . LEU C  1 114 ? 6.636   67.094  25.332  1.00 26.10 ? 115  LEU C C   1 
ATOM   5848  O  O   . LEU C  1 114 ? 7.693   66.824  25.906  1.00 27.52 ? 115  LEU C O   1 
ATOM   5849  C  CB  . LEU C  1 114 ? 7.032   68.454  23.259  1.00 27.94 ? 115  LEU C CB  1 
ATOM   5850  C  CG  . LEU C  1 114 ? 7.134   68.614  21.733  1.00 31.75 ? 115  LEU C CG  1 
ATOM   5851  C  CD1 . LEU C  1 114 ? 7.370   70.071  21.367  1.00 29.55 ? 115  LEU C CD1 1 
ATOM   5852  C  CD2 . LEU C  1 114 ? 8.257   67.748  21.158  1.00 27.18 ? 115  LEU C CD2 1 
ATOM   5853  N  N   . SER C  1 115 ? 5.515   67.391  25.980  1.00 25.30 ? 116  SER C N   1 
ATOM   5854  C  CA  . SER C  1 115 ? 5.476   67.541  27.428  1.00 25.31 ? 116  SER C CA  1 
ATOM   5855  C  C   . SER C  1 115 ? 5.644   66.201  28.134  1.00 25.14 ? 116  SER C C   1 
ATOM   5856  O  O   . SER C  1 115 ? 6.030   66.171  29.310  1.00 25.03 ? 116  SER C O   1 
ATOM   5857  C  CB  . SER C  1 115 ? 4.171   68.240  27.853  1.00 24.37 ? 116  SER C CB  1 
ATOM   5858  O  OG  . SER C  1 115 ? 3.072   67.630  27.217  1.00 27.31 ? 116  SER C OG  1 
ATOM   5859  N  N   . LEU C  1 116 ? 5.429   65.088  27.418  1.00 23.32 ? 117  LEU C N   1 
ATOM   5860  C  CA  . LEU C  1 116 ? 5.695   63.790  28.011  1.00 22.84 ? 117  LEU C CA  1 
ATOM   5861  C  C   . LEU C  1 116 ? 7.163   63.669  28.401  1.00 21.88 ? 117  LEU C C   1 
ATOM   5862  O  O   . LEU C  1 116 ? 7.505   62.825  29.201  1.00 22.03 ? 117  LEU C O   1 
ATOM   5863  C  CB  . LEU C  1 116 ? 5.300   62.624  27.101  1.00 24.89 ? 117  LEU C CB  1 
ATOM   5864  C  CG  . LEU C  1 116 ? 3.835   62.436  26.700  1.00 26.27 ? 117  LEU C CG  1 
ATOM   5865  C  CD1 . LEU C  1 116 ? 3.615   60.993  26.274  1.00 29.40 ? 117  LEU C CD1 1 
ATOM   5866  C  CD2 . LEU C  1 116 ? 2.897   62.805  27.789  1.00 26.18 ? 117  LEU C CD2 1 
ATOM   5867  N  N   . ALA C  1 117 ? 8.028   64.517  27.842  1.00 22.70 ? 118  ALA C N   1 
ATOM   5868  C  CA  . ALA C  1 117 ? 9.441   64.529  28.224  1.00 21.68 ? 118  ALA C CA  1 
ATOM   5869  C  C   . ALA C  1 117 ? 9.649   64.998  29.665  1.00 22.46 ? 118  ALA C C   1 
ATOM   5870  O  O   . ALA C  1 117 ? 10.770  64.910  30.193  1.00 22.31 ? 118  ALA C O   1 
ATOM   5871  C  CB  . ALA C  1 117 ? 10.228  65.415  27.294  1.00 22.77 ? 118  ALA C CB  1 
ATOM   5872  N  N   . LEU C  1 118 ? 8.584   65.531  30.265  1.00 22.08 ? 119  LEU C N   1 
ATOM   5873  C  CA  . LEU C  1 118 ? 8.590   66.019  31.644  1.00 22.67 ? 119  LEU C CA  1 
ATOM   5874  C  C   . LEU C  1 118 ? 7.851   65.033  32.562  1.00 22.09 ? 119  LEU C C   1 
ATOM   5875  O  O   . LEU C  1 118 ? 7.732   65.257  33.767  1.00 23.26 ? 119  LEU C O   1 
ATOM   5876  C  CB  . LEU C  1 118 ? 7.897   67.391  31.713  1.00 21.32 ? 119  LEU C CB  1 
ATOM   5877  C  CG  . LEU C  1 118 ? 8.528   68.559  30.952  1.00 22.69 ? 119  LEU C CG  1 
ATOM   5878  C  CD1 . LEU C  1 118 ? 7.609   69.823  30.946  1.00 16.82 ? 119  LEU C CD1 1 
ATOM   5879  C  CD2 . LEU C  1 118 ? 9.889   68.908  31.514  1.00 17.77 ? 119  LEU C CD2 1 
ATOM   5880  N  N   . GLY C  1 119 ? 7.366   63.941  31.982  1.00 23.01 ? 120  GLY C N   1 
ATOM   5881  C  CA  . GLY C  1 119 ? 6.489   63.007  32.673  1.00 22.70 ? 120  GLY C CA  1 
ATOM   5882  C  C   . GLY C  1 119 ? 6.858   61.576  32.375  1.00 21.33 ? 120  GLY C C   1 
ATOM   5883  O  O   . GLY C  1 119 ? 7.945   61.108  32.738  1.00 23.11 ? 120  GLY C O   1 
ATOM   5884  N  N   . THR C  1 120 ? 5.953   60.884  31.703  1.00 21.43 ? 121  THR C N   1 
ATOM   5885  C  CA  . THR C  1 120 ? 6.101   59.459  31.444  1.00 21.19 ? 121  THR C CA  1 
ATOM   5886  C  C   . THR C  1 120 ? 7.361   59.113  30.660  1.00 22.76 ? 121  THR C C   1 
ATOM   5887  O  O   . THR C  1 120 ? 7.956   58.080  30.906  1.00 24.79 ? 121  THR C O   1 
ATOM   5888  C  CB  . THR C  1 120 ? 4.877   58.944  30.726  1.00 21.67 ? 121  THR C CB  1 
ATOM   5889  O  OG1 . THR C  1 120 ? 3.756   59.144  31.582  1.00 26.44 ? 121  THR C OG1 1 
ATOM   5890  C  CG2 . THR C  1 120 ? 5.004   57.455  30.355  1.00 18.68 ? 121  THR C CG2 1 
ATOM   5891  N  N   . VAL C  1 121 ? 7.773   59.950  29.715  1.00 22.72 ? 122  VAL C N   1 
ATOM   5892  C  CA  . VAL C  1 121 ? 9.049   59.693  29.022  1.00 24.25 ? 122  VAL C CA  1 
ATOM   5893  C  C   . VAL C  1 121 ? 10.057  60.752  29.455  1.00 25.28 ? 122  VAL C C   1 
ATOM   5894  O  O   . VAL C  1 121 ? 10.655  61.499  28.647  1.00 25.89 ? 122  VAL C O   1 
ATOM   5895  C  CB  . VAL C  1 121 ? 8.894   59.599  27.498  1.00 23.48 ? 122  VAL C CB  1 
ATOM   5896  C  CG1 . VAL C  1 121 ? 10.140  58.945  26.908  1.00 23.29 ? 122  VAL C CG1 1 
ATOM   5897  C  CG2 . VAL C  1 121 ? 7.648   58.788  27.175  1.00 22.49 ? 122  VAL C CG2 1 
ATOM   5898  N  N   . GLY C  1 122 ? 10.258  60.755  30.770  1.00 24.77 ? 123  GLY C N   1 
ATOM   5899  C  CA  . GLY C  1 122 ? 10.997  61.789  31.466  1.00 22.88 ? 123  GLY C CA  1 
ATOM   5900  C  C   . GLY C  1 122 ? 11.162  61.357  32.890  1.00 21.42 ? 123  GLY C C   1 
ATOM   5901  O  O   . GLY C  1 122 ? 10.947  60.193  33.219  1.00 23.18 ? 123  GLY C O   1 
ATOM   5902  N  N   . MET C  1 123 ? 11.510  62.307  33.742  1.00 20.68 ? 124  MET C N   1 
ATOM   5903  C  CA  . MET C  1 123 ? 11.892  62.020  35.110  1.00 20.59 ? 124  MET C CA  1 
ATOM   5904  C  C   . MET C  1 123 ? 10.849  61.190  35.906  1.00 19.19 ? 124  MET C C   1 
ATOM   5905  O  O   . MET C  1 123 ? 11.213  60.201  36.527  1.00 19.16 ? 124  MET C O   1 
ATOM   5906  C  CB  . MET C  1 123 ? 12.280  63.325  35.814  1.00 20.44 ? 124  MET C CB  1 
ATOM   5907  C  CG  . MET C  1 123 ? 12.838  63.133  37.179  1.00 21.12 ? 124  MET C CG  1 
ATOM   5908  S  SD  . MET C  1 123 ? 11.545  63.049  38.382  1.00 23.47 ? 124  MET C SD  1 
ATOM   5909  C  CE  . MET C  1 123 ? 11.362  64.799  38.733  1.00 16.93 ? 124  MET C CE  1 
ATOM   5910  N  N   . PRO C  1 124 ? 9.560   61.553  35.858  1.00 18.36 ? 125  PRO C N   1 
ATOM   5911  C  CA  . PRO C  1 124 ? 8.633   60.682  36.602  1.00 16.85 ? 125  PRO C CA  1 
ATOM   5912  C  C   . PRO C  1 124 ? 8.578   59.256  36.083  1.00 19.07 ? 125  PRO C C   1 
ATOM   5913  O  O   . PRO C  1 124 ? 8.450   58.316  36.866  1.00 20.90 ? 125  PRO C O   1 
ATOM   5914  C  CB  . PRO C  1 124 ? 7.284   61.356  36.401  1.00 17.17 ? 125  PRO C CB  1 
ATOM   5915  C  CG  . PRO C  1 124 ? 7.650   62.845  36.372  1.00 20.74 ? 125  PRO C CG  1 
ATOM   5916  C  CD  . PRO C  1 124 ? 8.988   62.895  35.628  1.00 18.90 ? 125  PRO C CD  1 
ATOM   5917  N  N   . GLY C  1 125 ? 8.653   59.089  34.771  1.00 19.21 ? 126  GLY C N   1 
ATOM   5918  C  CA  . GLY C  1 125 ? 8.558   57.762  34.201  1.00 20.30 ? 126  GLY C CA  1 
ATOM   5919  C  C   . GLY C  1 125 ? 9.761   56.947  34.566  1.00 18.87 ? 126  GLY C C   1 
ATOM   5920  O  O   . GLY C  1 125 ? 9.645   55.768  34.832  1.00 22.67 ? 126  GLY C O   1 
ATOM   5921  N  N   . LEU C  1 126 ? 10.925  57.580  34.590  1.00 18.66 ? 127  LEU C N   1 
ATOM   5922  C  CA  . LEU C  1 126 ? 12.123  56.902  35.030  1.00 17.92 ? 127  LEU C CA  1 
ATOM   5923  C  C   . LEU C  1 126 ? 12.052  56.491  36.504  1.00 18.68 ? 127  LEU C C   1 
ATOM   5924  O  O   . LEU C  1 126 ? 12.437  55.361  36.864  1.00 19.23 ? 127  LEU C O   1 
ATOM   5925  C  CB  . LEU C  1 126 ? 13.356  57.754  34.782  1.00 17.42 ? 127  LEU C CB  1 
ATOM   5926  C  CG  . LEU C  1 126 ? 13.671  58.007  33.310  1.00 20.33 ? 127  LEU C CG  1 
ATOM   5927  C  CD1 . LEU C  1 126 ? 14.682  59.110  33.212  1.00 16.52 ? 127  LEU C CD1 1 
ATOM   5928  C  CD2 . LEU C  1 126 ? 14.197  56.703  32.661  1.00 21.50 ? 127  LEU C CD2 1 
ATOM   5929  N  N   . THR C  1 127 ? 11.590  57.404  37.350  1.00 17.34 ? 128  THR C N   1 
ATOM   5930  C  CA  . THR C  1 127 ? 11.388  57.116  38.778  1.00 16.89 ? 128  THR C CA  1 
ATOM   5931  C  C   . THR C  1 127 ? 10.576  55.833  38.960  1.00 17.55 ? 128  THR C C   1 
ATOM   5932  O  O   . THR C  1 127 ? 10.935  54.949  39.702  1.00 16.47 ? 128  THR C O   1 
ATOM   5933  C  CB  . THR C  1 127 ? 10.598  58.256  39.430  1.00 17.28 ? 128  THR C CB  1 
ATOM   5934  O  OG1 . THR C  1 127 ? 11.329  59.480  39.285  1.00 16.73 ? 128  THR C OG1 1 
ATOM   5935  C  CG2 . THR C  1 127 ? 10.299  57.947  40.906  1.00 13.41 ? 128  THR C CG2 1 
ATOM   5936  N  N   . ALA C  1 128 ? 9.452   55.754  38.269  1.00 19.80 ? 129  ALA C N   1 
ATOM   5937  C  CA  . ALA C  1 128 ? 8.609   54.568  38.336  1.00 18.96 ? 129  ALA C CA  1 
ATOM   5938  C  C   . ALA C  1 128 ? 9.375   53.344  37.851  1.00 19.76 ? 129  ALA C C   1 
ATOM   5939  O  O   . ALA C  1 128 ? 9.377   52.289  38.484  1.00 20.02 ? 129  ALA C O   1 
ATOM   5940  C  CB  . ALA C  1 128 ? 7.376   54.777  37.465  1.00 17.64 ? 129  ALA C CB  1 
ATOM   5941  N  N   . TYR C  1 129 ? 10.013  53.489  36.698  1.00 21.81 ? 130  TYR C N   1 
ATOM   5942  C  CA  . TYR C  1 129 ? 10.692  52.377  36.047  1.00 21.33 ? 130  TYR C CA  1 
ATOM   5943  C  C   . TYR C  1 129 ? 11.750  51.795  36.967  1.00 21.35 ? 130  TYR C C   1 
ATOM   5944  O  O   . TYR C  1 129 ? 11.782  50.582  37.208  1.00 20.62 ? 130  TYR C O   1 
ATOM   5945  C  CB  . TYR C  1 129 ? 11.306  52.885  34.735  1.00 23.84 ? 130  TYR C CB  1 
ATOM   5946  C  CG  . TYR C  1 129 ? 12.046  51.899  33.868  1.00 19.41 ? 130  TYR C CG  1 
ATOM   5947  C  CD1 . TYR C  1 129 ? 13.323  51.484  34.202  1.00 20.30 ? 130  TYR C CD1 1 
ATOM   5948  C  CD2 . TYR C  1 129 ? 11.502  51.450  32.665  1.00 22.35 ? 130  TYR C CD2 1 
ATOM   5949  C  CE1 . TYR C  1 129 ? 14.020  50.616  33.407  1.00 23.69 ? 130  TYR C CE1 1 
ATOM   5950  C  CE2 . TYR C  1 129 ? 12.204  50.574  31.861  1.00 21.35 ? 130  TYR C CE2 1 
ATOM   5951  C  CZ  . TYR C  1 129 ? 13.468  50.171  32.234  1.00 23.92 ? 130  TYR C CZ  1 
ATOM   5952  O  OH  . TYR C  1 129 ? 14.224  49.321  31.457  1.00 31.31 ? 130  TYR C OH  1 
ATOM   5953  N  N   . PHE C  1 130 ? 12.631  52.629  37.492  1.00 19.36 ? 131  PHE C N   1 
ATOM   5954  C  CA  . PHE C  1 130 ? 13.713  52.062  38.289  1.00 20.79 ? 131  PHE C CA  1 
ATOM   5955  C  C   . PHE C  1 130 ? 13.234  51.638  39.674  1.00 22.12 ? 131  PHE C C   1 
ATOM   5956  O  O   . PHE C  1 130 ? 13.740  50.657  40.236  1.00 22.10 ? 131  PHE C O   1 
ATOM   5957  C  CB  . PHE C  1 130 ? 14.916  53.002  38.363  1.00 22.50 ? 131  PHE C CB  1 
ATOM   5958  C  CG  . PHE C  1 130 ? 15.689  53.081  37.068  1.00 23.17 ? 131  PHE C CG  1 
ATOM   5959  C  CD1 . PHE C  1 130 ? 16.378  51.971  36.592  1.00 27.08 ? 131  PHE C CD1 1 
ATOM   5960  C  CD2 . PHE C  1 130 ? 15.730  54.248  36.335  1.00 25.23 ? 131  PHE C CD2 1 
ATOM   5961  C  CE1 . PHE C  1 130 ? 17.082  52.024  35.392  1.00 23.54 ? 131  PHE C CE1 1 
ATOM   5962  C  CE2 . PHE C  1 130 ? 16.447  54.319  35.138  1.00 26.66 ? 131  PHE C CE2 1 
ATOM   5963  C  CZ  . PHE C  1 130 ? 17.115  53.205  34.665  1.00 24.30 ? 131  PHE C CZ  1 
ATOM   5964  N  N   . GLY C  1 131 ? 12.253  52.357  40.214  1.00 21.41 ? 132  GLY C N   1 
ATOM   5965  C  CA  . GLY C  1 131 ? 11.734  52.038  41.542  1.00 22.88 ? 132  GLY C CA  1 
ATOM   5966  C  C   . GLY C  1 131 ? 10.977  50.720  41.567  1.00 21.68 ? 132  GLY C C   1 
ATOM   5967  O  O   . GLY C  1 131 ? 11.042  49.975  42.535  1.00 22.17 ? 132  GLY C O   1 
ATOM   5968  N  N   . LEU C  1 132 ? 10.251  50.427  40.505  1.00 21.58 ? 133  LEU C N   1 
ATOM   5969  C  CA  . LEU C  1 132 ? 9.527   49.163  40.441  1.00 22.53 ? 133  LEU C CA  1 
ATOM   5970  C  C   . LEU C  1 132 ? 10.462  48.050  40.016  1.00 23.59 ? 133  LEU C C   1 
ATOM   5971  O  O   . LEU C  1 132 ? 10.560  46.998  40.682  1.00 26.13 ? 133  LEU C O   1 
ATOM   5972  C  CB  . LEU C  1 132 ? 8.334   49.262  39.467  1.00 21.92 ? 133  LEU C CB  1 
ATOM   5973  C  CG  . LEU C  1 132 ? 7.459   48.014  39.416  1.00 22.02 ? 133  LEU C CG  1 
ATOM   5974  C  CD1 . LEU C  1 132 ? 6.849   47.793  40.807  1.00 23.46 ? 133  LEU C CD1 1 
ATOM   5975  C  CD2 . LEU C  1 132 ? 6.347   48.113  38.354  1.00 21.31 ? 133  LEU C CD2 1 
ATOM   5976  N  N   . LEU C  1 133 ? 11.190  48.272  38.926  1.00 23.28 ? 134  LEU C N   1 
ATOM   5977  C  CA  . LEU C  1 133 ? 11.913  47.174  38.308  1.00 24.15 ? 134  LEU C CA  1 
ATOM   5978  C  C   . LEU C  1 133 ? 13.244  46.834  38.975  1.00 27.02 ? 134  LEU C C   1 
ATOM   5979  O  O   . LEU C  1 133 ? 13.655  45.662  38.921  1.00 26.00 ? 134  LEU C O   1 
ATOM   5980  C  CB  . LEU C  1 133 ? 12.119  47.414  36.811  1.00 24.62 ? 134  LEU C CB  1 
ATOM   5981  C  CG  . LEU C  1 133 ? 10.874  47.752  36.005  1.00 26.90 ? 134  LEU C CG  1 
ATOM   5982  C  CD1 . LEU C  1 133 ? 11.265  48.117  34.538  1.00 21.78 ? 134  LEU C CD1 1 
ATOM   5983  C  CD2 . LEU C  1 133 ? 9.850   46.631  36.082  1.00 25.03 ? 134  LEU C CD2 1 
ATOM   5984  N  N   . GLU C  1 134 ? 13.922  47.808  39.597  1.00 25.36 ? 135  GLU C N   1 
ATOM   5985  C  CA  . GLU C  1 134 ? 15.201  47.502  40.260  1.00 26.42 ? 135  GLU C CA  1 
ATOM   5986  C  C   . GLU C  1 134 ? 15.101  47.491  41.775  1.00 27.73 ? 135  GLU C C   1 
ATOM   5987  O  O   . GLU C  1 134 ? 15.639  46.582  42.435  1.00 29.69 ? 135  GLU C O   1 
ATOM   5988  C  CB  . GLU C  1 134 ? 16.296  48.497  39.877  1.00 28.04 ? 135  GLU C CB  1 
ATOM   5989  C  CG  . GLU C  1 134 ? 16.502  48.619  38.396  1.00 38.62 ? 135  GLU C CG  1 
ATOM   5990  C  CD  . GLU C  1 134 ? 17.983  48.664  37.988  1.00 48.67 ? 135  GLU C CD  1 
ATOM   5991  O  OE1 . GLU C  1 134 ? 18.849  49.043  38.831  1.00 49.13 ? 135  GLU C OE1 1 
ATOM   5992  O  OE2 . GLU C  1 134 ? 18.255  48.307  36.813  1.00 50.50 ? 135  GLU C OE2 1 
ATOM   5993  N  N   . ILE C  1 135 ? 14.434  48.478  42.366  1.00 24.75 ? 136  ILE C N   1 
ATOM   5994  C  CA  A ILE C  1 135 ? 14.344  48.504  43.826  0.50 25.15 ? 136  ILE C CA  1 
ATOM   5995  C  CA  B ILE C  1 135 ? 14.349  48.514  43.821  0.50 24.04 ? 136  ILE C CA  1 
ATOM   5996  C  C   . ILE C  1 135 ? 13.293  47.511  44.346  1.00 24.77 ? 136  ILE C C   1 
ATOM   5997  O  O   . ILE C  1 135 ? 13.600  46.677  45.198  1.00 26.50 ? 136  ILE C O   1 
ATOM   5998  C  CB  A ILE C  1 135 ? 14.120  49.915  44.402  0.50 23.96 ? 136  ILE C CB  1 
ATOM   5999  C  CB  B ILE C  1 135 ? 14.136  49.944  44.367  0.50 21.81 ? 136  ILE C CB  1 
ATOM   6000  C  CG1 A ILE C  1 135 ? 15.259  50.847  43.997  0.50 27.84 ? 136  ILE C CG1 1 
ATOM   6001  C  CG1 B ILE C  1 135 ? 15.132  50.935  43.736  0.50 21.74 ? 136  ILE C CG1 1 
ATOM   6002  C  CG2 A ILE C  1 135 ? 14.114  49.864  45.911  0.50 21.33 ? 136  ILE C CG2 1 
ATOM   6003  C  CG2 B ILE C  1 135 ? 14.340  49.956  45.866  0.50 17.77 ? 136  ILE C CG2 1 
ATOM   6004  C  CD1 A ILE C  1 135 ? 15.022  51.580  42.733  0.50 28.29 ? 136  ILE C CD1 1 
ATOM   6005  C  CD1 B ILE C  1 135 ? 16.629  50.584  43.969  0.50 10.97 ? 136  ILE C CD1 1 
ATOM   6006  N  N   . CYS C  1 136 ? 12.055  47.570  43.860  1.00 24.71 ? 137  CYS C N   1 
ATOM   6007  C  CA  . CYS C  1 136 ? 11.095  46.515  44.212  1.00 25.08 ? 137  CYS C CA  1 
ATOM   6008  C  C   . CYS C  1 136 ? 11.530  45.180  43.600  1.00 27.20 ? 137  CYS C C   1 
ATOM   6009  O  O   . CYS C  1 136 ? 11.377  44.117  44.213  1.00 29.37 ? 137  CYS C O   1 
ATOM   6010  C  CB  . CYS C  1 136 ? 9.683   46.829  43.719  1.00 25.86 ? 137  CYS C CB  1 
ATOM   6011  S  SG  . CYS C  1 136 ? 8.792   48.038  44.687  1.00 31.19 ? 137  CYS C SG  1 
ATOM   6012  N  N   . GLY C  1 137 ? 12.021  45.229  42.365  1.00 29.08 ? 138  GLY C N   1 
ATOM   6013  C  CA  . GLY C  1 137 ? 12.469  44.030  41.650  1.00 30.25 ? 138  GLY C CA  1 
ATOM   6014  C  C   . GLY C  1 137 ? 11.371  43.063  41.228  1.00 32.23 ? 138  GLY C C   1 
ATOM   6015  O  O   . GLY C  1 137 ? 11.573  41.839  41.301  1.00 35.36 ? 138  GLY C O   1 
ATOM   6016  N  N   . VAL C  1 138 ? 10.229  43.580  40.772  1.00 33.22 ? 139  VAL C N   1 
ATOM   6017  C  CA  . VAL C  1 138 ? 9.090   42.727  40.379  1.00 35.11 ? 139  VAL C CA  1 
ATOM   6018  C  C   . VAL C  1 138 ? 9.407   41.786  39.209  1.00 38.79 ? 139  VAL C C   1 
ATOM   6019  O  O   . VAL C  1 138 ? 10.102  42.160  38.280  1.00 39.70 ? 139  VAL C O   1 
ATOM   6020  C  CB  . VAL C  1 138 ? 7.839   43.548  39.953  1.00 34.45 ? 139  VAL C CB  1 
ATOM   6021  C  CG1 . VAL C  1 138 ? 7.420   44.486  41.023  1.00 35.19 ? 139  VAL C CG1 1 
ATOM   6022  C  CG2 . VAL C  1 138 ? 8.082   44.294  38.632  1.00 30.06 ? 139  VAL C CG2 1 
ATOM   6023  N  N   . LYS C  1 139 ? 8.812   40.596  39.233  1.00 43.53 ? 140  LYS C N   1 
ATOM   6024  C  CA  . LYS C  1 139 ? 9.154   39.493  38.321  1.00 44.99 ? 140  LYS C CA  1 
ATOM   6025  C  C   . LYS C  1 139 ? 8.001   39.043  37.393  1.00 45.75 ? 140  LYS C C   1 
ATOM   6026  O  O   . LYS C  1 139 ? 8.246   38.593  36.254  1.00 46.97 ? 140  LYS C O   1 
ATOM   6027  C  CB  . LYS C  1 139 ? 9.612   38.300  39.165  1.00 46.67 ? 140  LYS C CB  1 
ATOM   6028  N  N   . GLY C  1 140 ? 6.762   39.181  37.881  1.00 42.88 ? 141  GLY C N   1 
ATOM   6029  C  CA  . GLY C  1 140 ? 5.578   38.608  37.249  1.00 40.00 ? 141  GLY C CA  1 
ATOM   6030  C  C   . GLY C  1 140 ? 4.780   37.804  38.278  1.00 38.80 ? 141  GLY C C   1 
ATOM   6031  O  O   . GLY C  1 140 ? 5.328   36.924  38.966  1.00 38.32 ? 141  GLY C O   1 
ATOM   6032  N  N   . GLY C  1 141 ? 3.494   38.116  38.406  1.00 36.20 ? 142  GLY C N   1 
ATOM   6033  C  CA  . GLY C  1 141 ? 2.628   37.403  39.351  1.00 35.75 ? 142  GLY C CA  1 
ATOM   6034  C  C   . GLY C  1 141 ? 2.756   37.848  40.802  1.00 33.78 ? 142  GLY C C   1 
ATOM   6035  O  O   . GLY C  1 141 ? 2.142   37.256  41.668  1.00 36.52 ? 142  GLY C O   1 
ATOM   6036  N  N   . GLU C  1 142 ? 3.555   38.875  41.084  1.00 31.54 ? 143  GLU C N   1 
ATOM   6037  C  CA  . GLU C  1 142 ? 3.541   39.493  42.410  1.00 29.87 ? 143  GLU C CA  1 
ATOM   6038  C  C   . GLU C  1 142 ? 2.339   40.405  42.524  1.00 26.82 ? 143  GLU C C   1 
ATOM   6039  O  O   . GLU C  1 142 ? 1.800   40.852  41.522  1.00 26.53 ? 143  GLU C O   1 
ATOM   6040  C  CB  . GLU C  1 142 ? 4.803   40.325  42.675  1.00 30.04 ? 143  GLU C CB  1 
ATOM   6041  C  CG  . GLU C  1 142 ? 6.084   39.499  42.754  1.00 34.78 ? 143  GLU C CG  1 
ATOM   6042  C  CD  . GLU C  1 142 ? 7.046   39.777  41.605  1.00 47.00 ? 143  GLU C CD  1 
ATOM   6043  O  OE1 . GLU C  1 142 ? 6.615   39.937  40.416  1.00 42.99 ? 143  GLU C OE1 1 
ATOM   6044  O  OE2 . GLU C  1 142 ? 8.255   39.835  41.899  1.00 53.23 ? 143  GLU C OE2 1 
ATOM   6045  N  N   . THR C  1 143 ? 1.932   40.687  43.753  1.00 25.24 ? 144  THR C N   1 
ATOM   6046  C  CA  . THR C  1 143 ? 0.918   41.698  44.009  1.00 25.85 ? 144  THR C CA  1 
ATOM   6047  C  C   . THR C  1 143 ? 1.616   42.963  44.515  1.00 24.86 ? 144  THR C C   1 
ATOM   6048  O  O   . THR C  1 143 ? 2.410   42.912  45.480  1.00 25.15 ? 144  THR C O   1 
ATOM   6049  C  CB  . THR C  1 143 ? -0.089  41.194  45.049  1.00 26.04 ? 144  THR C CB  1 
ATOM   6050  O  OG1 . THR C  1 143 ? -0.614  39.941  44.596  1.00 26.94 ? 144  THR C OG1 1 
ATOM   6051  C  CG2 . THR C  1 143 ? -1.209  42.212  45.261  1.00 24.48 ? 144  THR C CG2 1 
ATOM   6052  N  N   . VAL C  1 144 ? 1.323   44.078  43.849  1.00 24.23 ? 145  VAL C N   1 
ATOM   6053  C  CA  . VAL C  1 144 ? 1.969   45.359  44.096  1.00 22.88 ? 145  VAL C CA  1 
ATOM   6054  C  C   . VAL C  1 144 ? 0.963   46.391  44.585  1.00 23.12 ? 145  VAL C C   1 
ATOM   6055  O  O   . VAL C  1 144 ? -0.066  46.611  43.941  1.00 21.57 ? 145  VAL C O   1 
ATOM   6056  C  CB  . VAL C  1 144 ? 2.562   45.923  42.795  1.00 23.98 ? 145  VAL C CB  1 
ATOM   6057  C  CG1 . VAL C  1 144 ? 3.201   47.295  43.064  1.00 22.57 ? 145  VAL C CG1 1 
ATOM   6058  C  CG2 . VAL C  1 144 ? 3.534   44.932  42.176  1.00 22.81 ? 145  VAL C CG2 1 
ATOM   6059  N  N   . MET C  1 145 ? 1.283   47.051  45.698  1.00 21.42 ? 146  MET C N   1 
ATOM   6060  C  CA  . MET C  1 145 ? 0.465   48.141  46.227  1.00 21.03 ? 146  MET C CA  1 
ATOM   6061  C  C   . MET C  1 145 ? 1.137   49.449  45.854  1.00 20.48 ? 146  MET C C   1 
ATOM   6062  O  O   . MET C  1 145 ? 2.316   49.662  46.143  1.00 23.67 ? 146  MET C O   1 
ATOM   6063  C  CB  . MET C  1 145 ? 0.309   47.988  47.752  1.00 24.64 ? 146  MET C CB  1 
ATOM   6064  C  CG  . MET C  1 145 ? 0.145   49.254  48.555  1.00 28.65 ? 146  MET C CG  1 
ATOM   6065  S  SD  . MET C  1 145 ? -1.336  50.150  48.234  1.00 43.84 ? 146  MET C SD  1 
ATOM   6066  C  CE  . MET C  1 145 ? -0.771  51.724  48.721  1.00 34.93 ? 146  MET C CE  1 
ATOM   6067  N  N   . VAL C  1 146 ? 0.400   50.322  45.183  1.00 21.90 ? 147  VAL C N   1 
ATOM   6068  C  CA  . VAL C  1 146 ? 0.924   51.632  44.771  1.00 22.46 ? 147  VAL C CA  1 
ATOM   6069  C  C   . VAL C  1 146 ? -0.061  52.687  45.217  1.00 21.76 ? 147  VAL C C   1 
ATOM   6070  O  O   . VAL C  1 146 ? -1.249  52.557  44.983  1.00 23.38 ? 147  VAL C O   1 
ATOM   6071  C  CB  . VAL C  1 146 ? 1.126   51.718  43.246  1.00 24.35 ? 147  VAL C CB  1 
ATOM   6072  C  CG1 . VAL C  1 146 ? -0.143  51.388  42.542  1.00 28.53 ? 147  VAL C CG1 1 
ATOM   6073  C  CG2 . VAL C  1 146 ? 1.653   53.134  42.802  1.00 17.69 ? 147  VAL C CG2 1 
ATOM   6074  N  N   . ASN C  1 147 ? 0.439   53.712  45.888  1.00 22.71 ? 148  ASN C N   1 
ATOM   6075  C  CA  . ASN C  1 147 ? -0.363  54.884  46.269  1.00 21.93 ? 148  ASN C CA  1 
ATOM   6076  C  C   . ASN C  1 147 ? -0.006  56.094  45.381  1.00 21.62 ? 148  ASN C C   1 
ATOM   6077  O  O   . ASN C  1 147 ? 0.949   56.014  44.569  1.00 20.93 ? 148  ASN C O   1 
ATOM   6078  C  CB  . ASN C  1 147 ? -0.173  55.175  47.771  1.00 21.44 ? 148  ASN C CB  1 
ATOM   6079  C  CG  . ASN C  1 147 ? 1.282   55.279  48.167  1.00 24.73 ? 148  ASN C CG  1 
ATOM   6080  O  OD1 . ASN C  1 147 ? 2.132   55.647  47.331  1.00 22.31 ? 148  ASN C OD1 1 
ATOM   6081  N  ND2 . ASN C  1 147 ? 1.602   54.922  49.432  1.00 17.92 ? 148  ASN C ND2 1 
ATOM   6082  N  N   . ALA C  1 148 ? -0.748  57.203  45.540  1.00 20.14 ? 149  ALA C N   1 
ATOM   6083  C  CA  . ALA C  1 148 ? -0.793  58.301  44.546  1.00 18.99 ? 149  ALA C CA  1 
ATOM   6084  C  C   . ALA C  1 148 ? -0.869  57.735  43.115  1.00 20.23 ? 149  ALA C C   1 
ATOM   6085  O  O   . ALA C  1 148 ? -0.217  58.232  42.162  1.00 20.64 ? 149  ALA C O   1 
ATOM   6086  C  CB  . ALA C  1 148 ? 0.404   59.230  44.700  1.00 18.57 ? 149  ALA C CB  1 
ATOM   6087  N  N   . ALA C  1 149 ? -1.683  56.699  42.984  1.00 19.29 ? 150  ALA C N   1 
ATOM   6088  C  CA  . ALA C  1 149 ? -1.670  55.813  41.824  1.00 21.97 ? 150  ALA C CA  1 
ATOM   6089  C  C   . ALA C  1 149 ? -2.133  56.471  40.512  1.00 22.92 ? 150  ALA C C   1 
ATOM   6090  O  O   . ALA C  1 149 ? -1.779  55.987  39.419  1.00 23.37 ? 150  ALA C O   1 
ATOM   6091  C  CB  . ALA C  1 149 ? -2.518  54.545  42.114  1.00 21.44 ? 150  ALA C CB  1 
ATOM   6092  N  N   . ALA C  1 150 ? -2.889  57.561  40.631  1.00 21.80 ? 151  ALA C N   1 
ATOM   6093  C  CA  . ALA C  1 150 ? -3.300  58.362  39.477  1.00 23.30 ? 151  ALA C CA  1 
ATOM   6094  C  C   . ALA C  1 150 ? -2.347  59.540  39.199  1.00 24.73 ? 151  ALA C C   1 
ATOM   6095  O  O   . ALA C  1 150 ? -2.630  60.358  38.335  1.00 26.35 ? 151  ALA C O   1 
ATOM   6096  C  CB  . ALA C  1 150 ? -4.722  58.895  39.686  1.00 23.73 ? 151  ALA C CB  1 
ATOM   6097  N  N   . GLY C  1 151 ? -1.247  59.659  39.945  1.00 23.31 ? 152  GLY C N   1 
ATOM   6098  C  CA  . GLY C  1 151 ? -0.261  60.732  39.710  1.00 23.16 ? 152  GLY C CA  1 
ATOM   6099  C  C   . GLY C  1 151 ? 0.749   60.363  38.628  1.00 22.90 ? 152  GLY C C   1 
ATOM   6100  O  O   . GLY C  1 151 ? 0.621   59.321  38.007  1.00 25.67 ? 152  GLY C O   1 
ATOM   6101  N  N   . ALA C  1 152 ? 1.752   61.205  38.401  1.00 23.01 ? 153  ALA C N   1 
ATOM   6102  C  CA  . ALA C  1 152 ? 2.685   60.986  37.286  1.00 22.04 ? 153  ALA C CA  1 
ATOM   6103  C  C   . ALA C  1 152 ? 3.485   59.697  37.473  1.00 22.69 ? 153  ALA C C   1 
ATOM   6104  O  O   . ALA C  1 152 ? 3.455   58.828  36.615  1.00 19.66 ? 153  ALA C O   1 
ATOM   6105  C  CB  . ALA C  1 152 ? 3.597   62.160  37.121  1.00 20.84 ? 153  ALA C CB  1 
ATOM   6106  N  N   . VAL C  1 153 ? 4.160   59.572  38.617  1.00 22.91 ? 154  VAL C N   1 
ATOM   6107  C  CA  . VAL C  1 153 ? 4.932   58.377  38.952  1.00 20.34 ? 154  VAL C CA  1 
ATOM   6108  C  C   . VAL C  1 153 ? 4.024   57.155  39.122  1.00 20.94 ? 154  VAL C C   1 
ATOM   6109  O  O   . VAL C  1 153 ? 4.233   56.112  38.498  1.00 20.58 ? 154  VAL C O   1 
ATOM   6110  C  CB  . VAL C  1 153 ? 5.792   58.607  40.249  1.00 21.68 ? 154  VAL C CB  1 
ATOM   6111  C  CG1 . VAL C  1 153 ? 6.471   57.308  40.713  1.00 15.22 ? 154  VAL C CG1 1 
ATOM   6112  C  CG2 . VAL C  1 153 ? 6.867   59.706  40.023  1.00 14.52 ? 154  VAL C CG2 1 
ATOM   6113  N  N   . GLY C  1 154 ? 2.996   57.289  39.958  1.00 22.64 ? 155  GLY C N   1 
ATOM   6114  C  CA  . GLY C  1 154 ? 2.182   56.146  40.347  1.00 20.94 ? 155  GLY C CA  1 
ATOM   6115  C  C   . GLY C  1 154 ? 1.460   55.449  39.225  1.00 19.66 ? 155  GLY C C   1 
ATOM   6116  O  O   . GLY C  1 154 ? 1.313   54.236  39.236  1.00 20.26 ? 155  GLY C O   1 
ATOM   6117  N  N   . SER C  1 155 ? 0.997   56.221  38.254  1.00 21.81 ? 156  SER C N   1 
ATOM   6118  C  CA  . SER C  1 155 ? 0.255   55.660  37.125  1.00 22.04 ? 156  SER C CA  1 
ATOM   6119  C  C   . SER C  1 155 ? 1.192   54.837  36.246  1.00 22.81 ? 156  SER C C   1 
ATOM   6120  O  O   . SER C  1 155 ? 0.836   53.758  35.770  1.00 25.94 ? 156  SER C O   1 
ATOM   6121  C  CB  . SER C  1 155 ? -0.431  56.776  36.326  1.00 22.26 ? 156  SER C CB  1 
ATOM   6122  O  OG  . SER C  1 155 ? 0.464   57.824  35.995  1.00 24.08 ? 156  SER C OG  1 
ATOM   6123  N  N   . VAL C  1 156 ? 2.408   55.322  36.059  1.00 21.47 ? 157  VAL C N   1 
ATOM   6124  C  CA  . VAL C  1 156 ? 3.390   54.568  35.279  1.00 22.18 ? 157  VAL C CA  1 
ATOM   6125  C  C   . VAL C  1 156 ? 3.764   53.290  36.027  1.00 21.42 ? 157  VAL C C   1 
ATOM   6126  O  O   . VAL C  1 156 ? 3.865   52.246  35.420  1.00 22.32 ? 157  VAL C O   1 
ATOM   6127  C  CB  . VAL C  1 156 ? 4.653   55.406  34.983  1.00 22.12 ? 157  VAL C CB  1 
ATOM   6128  C  CG1 . VAL C  1 156 ? 5.647   54.587  34.166  1.00 21.70 ? 157  VAL C CG1 1 
ATOM   6129  C  CG2 . VAL C  1 156 ? 4.276   56.664  34.258  1.00 19.40 ? 157  VAL C CG2 1 
ATOM   6130  N  N   . VAL C  1 157 ? 3.950   53.364  37.346  1.00 20.54 ? 158  VAL C N   1 
ATOM   6131  C  CA  . VAL C  1 157 ? 4.253   52.165  38.139  1.00 19.61 ? 158  VAL C CA  1 
ATOM   6132  C  C   . VAL C  1 157 ? 3.231   51.045  37.922  1.00 22.28 ? 158  VAL C C   1 
ATOM   6133  O  O   . VAL C  1 157 ? 3.605   49.877  37.673  1.00 20.81 ? 158  VAL C O   1 
ATOM   6134  C  CB  . VAL C  1 157 ? 4.337   52.451  39.664  1.00 20.30 ? 158  VAL C CB  1 
ATOM   6135  C  CG1 . VAL C  1 157 ? 4.386   51.145  40.458  1.00 14.04 ? 158  VAL C CG1 1 
ATOM   6136  C  CG2 . VAL C  1 157 ? 5.577   53.330  40.004  1.00 19.34 ? 158  VAL C CG2 1 
ATOM   6137  N  N   . GLY C  1 158 ? 1.946   51.393  37.995  1.00 21.43 ? 159  GLY C N   1 
ATOM   6138  C  CA  . GLY C  1 158 ? 0.897   50.389  37.904  1.00 21.51 ? 159  GLY C CA  1 
ATOM   6139  C  C   . GLY C  1 158 ? 0.839   49.734  36.544  1.00 23.81 ? 159  GLY C C   1 
ATOM   6140  O  O   . GLY C  1 158 ? 0.629   48.525  36.439  1.00 21.90 ? 159  GLY C O   1 
ATOM   6141  N  N   . GLN C  1 159 ? 1.040   50.541  35.500  1.00 24.63 ? 160  GLN C N   1 
ATOM   6142  C  CA  . GLN C  1 159 ? 0.963   50.065  34.148  1.00 23.47 ? 160  GLN C CA  1 
ATOM   6143  C  C   . GLN C  1 159 ? 2.193   49.262  33.791  1.00 24.16 ? 160  GLN C C   1 
ATOM   6144  O  O   . GLN C  1 159 ? 2.108   48.302  33.037  1.00 26.72 ? 160  GLN C O   1 
ATOM   6145  C  CB  . GLN C  1 159 ? 0.792   51.225  33.190  1.00 25.27 ? 160  GLN C CB  1 
ATOM   6146  C  CG  . GLN C  1 159 ? -0.518  51.947  33.373  1.00 26.88 ? 160  GLN C CG  1 
ATOM   6147  C  CD  . GLN C  1 159 ? -0.712  53.021  32.338  1.00 29.10 ? 160  GLN C CD  1 
ATOM   6148  O  OE1 . GLN C  1 159 ? -1.025  52.726  31.187  1.00 30.85 ? 160  GLN C OE1 1 
ATOM   6149  N  NE2 . GLN C  1 159 ? -0.542  54.272  32.741  1.00 27.05 ? 160  GLN C NE2 1 
ATOM   6150  N  N   . ILE C  1 160 ? 3.341   49.613  34.341  1.00 23.74 ? 161  ILE C N   1 
ATOM   6151  C  CA  . ILE C  1 160 ? 4.500   48.765  34.135  1.00 23.20 ? 161  ILE C CA  1 
ATOM   6152  C  C   . ILE C  1 160 ? 4.274   47.430  34.865  1.00 23.78 ? 161  ILE C C   1 
ATOM   6153  O  O   . ILE C  1 160 ? 4.396   46.354  34.276  1.00 22.53 ? 161  ILE C O   1 
ATOM   6154  C  CB  . ILE C  1 160 ? 5.777   49.424  34.564  1.00 22.36 ? 161  ILE C CB  1 
ATOM   6155  C  CG1 . ILE C  1 160 ? 6.029   50.670  33.698  1.00 23.23 ? 161  ILE C CG1 1 
ATOM   6156  C  CG2 . ILE C  1 160 ? 6.911   48.433  34.428  1.00 21.19 ? 161  ILE C CG2 1 
ATOM   6157  C  CD1 . ILE C  1 160 ? 7.176   51.565  34.190  1.00 19.94 ? 161  ILE C CD1 1 
ATOM   6158  N  N   . ALA C  1 161 ? 3.876   47.500  36.127  1.00 25.53 ? 162  ALA C N   1 
ATOM   6159  C  CA  . ALA C  1 161 ? 3.559   46.278  36.880  1.00 25.33 ? 162  ALA C CA  1 
ATOM   6160  C  C   . ALA C  1 161 ? 2.627   45.393  36.085  1.00 26.68 ? 162  ALA C C   1 
ATOM   6161  O  O   . ALA C  1 161 ? 2.900   44.189  35.934  1.00 28.55 ? 162  ALA C O   1 
ATOM   6162  C  CB  . ALA C  1 161 ? 2.951   46.602  38.243  1.00 23.05 ? 162  ALA C CB  1 
ATOM   6163  N  N   . LYS C  1 162 ? 1.553   45.980  35.549  1.00 27.13 ? 163  LYS C N   1 
ATOM   6164  C  CA  . LYS C  1 162 ? 0.571   45.210  34.753  1.00 28.48 ? 163  LYS C CA  1 
ATOM   6165  C  C   . LYS C  1 162 ? 1.179   44.499  33.526  1.00 29.53 ? 163  LYS C C   1 
ATOM   6166  O  O   . LYS C  1 162 ? 0.916   43.306  33.312  1.00 30.16 ? 163  LYS C O   1 
ATOM   6167  C  CB  . LYS C  1 162 ? -0.631  46.082  34.299  1.00 28.53 ? 163  LYS C CB  1 
ATOM   6168  C  CG  . LYS C  1 162 ? -1.689  46.421  35.366  1.00 24.96 ? 163  LYS C CG  1 
ATOM   6169  C  CD  . LYS C  1 162 ? -2.183  45.248  36.209  1.00 27.01 ? 163  LYS C CD  1 
ATOM   6170  C  CE  . LYS C  1 162 ? -2.989  44.183  35.423  1.00 33.66 ? 163  LYS C CE  1 
ATOM   6171  N  NZ  . LYS C  1 162 ? -3.182  42.893  36.209  1.00 23.04 ? 163  LYS C NZ  1 
ATOM   6172  N  N   . LEU C  1 163 ? 1.989   45.211  32.734  1.00 31.08 ? 164  LEU C N   1 
ATOM   6173  C  CA  . LEU C  1 163 ? 2.592   44.625  31.524  1.00 31.07 ? 164  LEU C CA  1 
ATOM   6174  C  C   . LEU C  1 163 ? 3.677   43.601  31.873  1.00 32.57 ? 164  LEU C C   1 
ATOM   6175  O  O   . LEU C  1 163 ? 4.111   42.835  31.018  1.00 34.61 ? 164  LEU C O   1 
ATOM   6176  C  CB  . LEU C  1 163 ? 3.132   45.720  30.575  1.00 31.87 ? 164  LEU C CB  1 
ATOM   6177  C  CG  . LEU C  1 163 ? 4.352   46.596  30.932  1.00 32.04 ? 164  LEU C CG  1 
ATOM   6178  C  CD1 . LEU C  1 163 ? 5.697   45.874  30.731  1.00 27.70 ? 164  LEU C CD1 1 
ATOM   6179  C  CD2 . LEU C  1 163 ? 4.324   47.887  30.103  1.00 27.20 ? 164  LEU C CD2 1 
ATOM   6180  N  N   . LYS C  1 164 ? 4.100   43.584  33.135  1.00 31.25 ? 165  LYS C N   1 
ATOM   6181  C  CA  . LYS C  1 164 ? 4.951   42.522  33.654  1.00 30.79 ? 165  LYS C CA  1 
ATOM   6182  C  C   . LYS C  1 164 ? 4.101   41.379  34.205  1.00 29.87 ? 165  LYS C C   1 
ATOM   6183  O  O   . LYS C  1 164 ? 4.626   40.371  34.629  1.00 29.17 ? 165  LYS C O   1 
ATOM   6184  C  CB  . LYS C  1 164 ? 5.877   43.064  34.735  1.00 30.38 ? 165  LYS C CB  1 
ATOM   6185  C  CG  . LYS C  1 164 ? 6.882   44.077  34.222  1.00 33.51 ? 165  LYS C CG  1 
ATOM   6186  C  CD  . LYS C  1 164 ? 8.041   43.370  33.534  1.00 36.51 ? 165  LYS C CD  1 
ATOM   6187  C  CE  . LYS C  1 164 ? 9.043   44.366  32.948  1.00 41.37 ? 165  LYS C CE  1 
ATOM   6188  N  NZ  . LYS C  1 164 ? 10.202  43.681  32.276  1.00 43.43 ? 165  LYS C NZ  1 
ATOM   6189  N  N   . GLY C  1 165 ? 2.781   41.532  34.181  1.00 30.97 ? 166  GLY C N   1 
ATOM   6190  C  CA  . GLY C  1 165 ? 1.887   40.482  34.628  1.00 31.17 ? 166  GLY C CA  1 
ATOM   6191  C  C   . GLY C  1 165 ? 1.793   40.412  36.141  1.00 31.13 ? 166  GLY C C   1 
ATOM   6192  O  O   . GLY C  1 165 ? 1.655   39.319  36.690  1.00 31.95 ? 166  GLY C O   1 
ATOM   6193  N  N   . CYS C  1 166 ? 1.866   41.570  36.810  1.00 29.32 ? 167  CYS C N   1 
ATOM   6194  C  CA  . CYS C  1 166 ? 1.566   41.667  38.250  1.00 29.18 ? 167  CYS C CA  1 
ATOM   6195  C  C   . CYS C  1 166 ? 0.109   42.046  38.486  1.00 28.58 ? 167  CYS C C   1 
ATOM   6196  O  O   . CYS C  1 166 ? -0.546  42.592  37.609  1.00 29.07 ? 167  CYS C O   1 
ATOM   6197  C  CB  . CYS C  1 166 ? 2.442   42.721  38.903  1.00 28.66 ? 167  CYS C CB  1 
ATOM   6198  S  SG  . CYS C  1 166 ? 4.208   42.435  38.698  1.00 34.23 ? 167  CYS C SG  1 
ATOM   6199  N  N   . LYS C  1 167 ? -0.392  41.767  39.686  1.00 28.78 ? 168  LYS C N   1 
ATOM   6200  C  CA  . LYS C  1 167 ? -1.662  42.337  40.149  1.00 27.17 ? 168  LYS C CA  1 
ATOM   6201  C  C   . LYS C  1 167 ? -1.356  43.662  40.834  1.00 27.13 ? 168  LYS C C   1 
ATOM   6202  O  O   . LYS C  1 167 ? -0.423  43.752  41.640  1.00 28.30 ? 168  LYS C O   1 
ATOM   6203  C  CB  . LYS C  1 167 ? -2.356  41.381  41.118  1.00 29.85 ? 168  LYS C CB  1 
ATOM   6204  C  CG  . LYS C  1 167 ? -3.598  41.930  41.842  1.00 30.88 ? 168  LYS C CG  1 
ATOM   6205  C  CD  . LYS C  1 167 ? -4.253  40.830  42.695  1.00 34.62 ? 168  LYS C CD  1 
ATOM   6206  C  CE  . LYS C  1 167 ? -5.285  41.375  43.696  1.00 35.27 ? 168  LYS C CE  1 
ATOM   6207  N  NZ  . LYS C  1 167 ? -5.858  40.300  44.580  1.00 36.89 ? 168  LYS C NZ  1 
ATOM   6208  N  N   . VAL C  1 168 ? -2.147  44.682  40.516  1.00 26.06 ? 169  VAL C N   1 
ATOM   6209  C  CA  . VAL C  1 168 ? -1.951  46.014  41.033  1.00 24.50 ? 169  VAL C CA  1 
ATOM   6210  C  C   . VAL C  1 168 ? -3.132  46.471  41.900  1.00 25.61 ? 169  VAL C C   1 
ATOM   6211  O  O   . VAL C  1 168 ? -4.283  46.465  41.446  1.00 23.75 ? 169  VAL C O   1 
ATOM   6212  C  CB  . VAL C  1 168 ? -1.813  47.026  39.873  1.00 25.61 ? 169  VAL C CB  1 
ATOM   6213  C  CG1 . VAL C  1 168 ? -2.052  48.442  40.396  1.00 21.10 ? 169  VAL C CG1 1 
ATOM   6214  C  CG2 . VAL C  1 168 ? -0.435  46.893  39.183  1.00 25.01 ? 169  VAL C CG2 1 
ATOM   6215  N  N   . VAL C  1 169 ? -2.828  46.900  43.131  1.00 24.59 ? 170  VAL C N   1 
ATOM   6216  C  CA  . VAL C  1 169 ? -3.807  47.563  44.008  1.00 24.34 ? 170  VAL C CA  1 
ATOM   6217  C  C   . VAL C  1 169 ? -3.392  49.019  44.129  1.00 22.70 ? 170  VAL C C   1 
ATOM   6218  O  O   . VAL C  1 169 ? -2.264  49.319  44.530  1.00 24.81 ? 170  VAL C O   1 
ATOM   6219  C  CB  . VAL C  1 169 ? -3.888  46.872  45.420  1.00 24.31 ? 170  VAL C CB  1 
ATOM   6220  C  CG1 . VAL C  1 169 ? -4.920  47.569  46.339  1.00 18.86 ? 170  VAL C CG1 1 
ATOM   6221  C  CG2 . VAL C  1 169 ? -4.215  45.390  45.253  1.00 22.64 ? 170  VAL C CG2 1 
ATOM   6222  N  N   . GLY C  1 170 ? -4.303  49.926  43.792  1.00 23.98 ? 171  GLY C N   1 
ATOM   6223  C  CA  . GLY C  1 170 ? -3.998  51.341  43.806  1.00 23.90 ? 171  GLY C CA  1 
ATOM   6224  C  C   . GLY C  1 170 ? -4.842  52.131  44.771  1.00 24.64 ? 171  GLY C C   1 
ATOM   6225  O  O   . GLY C  1 170 ? -6.037  51.905  44.881  1.00 28.34 ? 171  GLY C O   1 
ATOM   6226  N  N   . ALA C  1 171 ? -4.225  53.081  45.459  1.00 23.87 ? 172  ALA C N   1 
ATOM   6227  C  CA  . ALA C  1 171 ? -4.952  54.018  46.310  1.00 23.94 ? 172  ALA C CA  1 
ATOM   6228  C  C   . ALA C  1 171 ? -4.900  55.370  45.644  1.00 22.85 ? 172  ALA C C   1 
ATOM   6229  O  O   . ALA C  1 171 ? -3.808  55.785  45.230  1.00 23.06 ? 172  ALA C O   1 
ATOM   6230  C  CB  . ALA C  1 171 ? -4.305  54.101  47.699  1.00 21.75 ? 172  ALA C CB  1 
ATOM   6231  N  N   . VAL C  1 172 ? -6.055  56.042  45.530  1.00 22.75 ? 173  VAL C N   1 
ATOM   6232  C  CA  . VAL C  1 172 ? -6.146  57.439  45.012  1.00 23.30 ? 173  VAL C CA  1 
ATOM   6233  C  C   . VAL C  1 172 ? -7.125  58.275  45.845  1.00 24.74 ? 173  VAL C C   1 
ATOM   6234  O  O   . VAL C  1 172 ? -7.903  57.722  46.614  1.00 26.43 ? 173  VAL C O   1 
ATOM   6235  C  CB  . VAL C  1 172 ? -6.610  57.488  43.551  1.00 24.16 ? 173  VAL C CB  1 
ATOM   6236  C  CG1 . VAL C  1 172 ? -5.683  56.614  42.653  1.00 21.09 ? 173  VAL C CG1 1 
ATOM   6237  C  CG2 . VAL C  1 172 ? -8.092  57.058  43.434  1.00 23.97 ? 173  VAL C CG2 1 
ATOM   6238  N  N   . GLY C  1 173 ? -7.105  59.595  45.662  1.00 23.28 ? 174  GLY C N   1 
ATOM   6239  C  CA  . GLY C  1 173 ? -7.867  60.507  46.522  1.00 24.74 ? 174  GLY C CA  1 
ATOM   6240  C  C   . GLY C  1 173 ? -9.180  61.069  45.979  1.00 25.46 ? 174  GLY C C   1 
ATOM   6241  O  O   . GLY C  1 173 ? -9.702  62.033  46.523  1.00 25.83 ? 174  GLY C O   1 
ATOM   6242  N  N   . SER C  1 174 ? -9.707  60.487  44.906  1.00 26.80 ? 175  SER C N   1 
ATOM   6243  C  CA  . SER C  1 174 ? -10.957 60.978  44.272  1.00 28.72 ? 175  SER C CA  1 
ATOM   6244  C  C   . SER C  1 174 ? -11.591 59.865  43.457  1.00 28.48 ? 175  SER C C   1 
ATOM   6245  O  O   . SER C  1 174 ? -10.876 58.993  42.936  1.00 30.90 ? 175  SER C O   1 
ATOM   6246  C  CB  . SER C  1 174 ? -10.687 62.153  43.334  1.00 28.94 ? 175  SER C CB  1 
ATOM   6247  O  OG  . SER C  1 174 ? -10.252 61.678  42.056  1.00 31.36 ? 175  SER C OG  1 
ATOM   6248  N  N   . ASP C  1 175 ? -12.918 59.899  43.340  1.00 29.73 ? 176  ASP C N   1 
ATOM   6249  C  CA  . ASP C  1 175 ? -13.678 58.895  42.574  1.00 29.88 ? 176  ASP C CA  1 
ATOM   6250  C  C   . ASP C  1 175 ? -13.372 58.987  41.089  1.00 28.08 ? 176  ASP C C   1 
ATOM   6251  O  O   . ASP C  1 175 ? -13.365 57.982  40.398  1.00 28.90 ? 176  ASP C O   1 
ATOM   6252  C  CB  . ASP C  1 175 ? -15.197 59.040  42.789  1.00 31.23 ? 176  ASP C CB  1 
ATOM   6253  C  CG  . ASP C  1 175 ? -15.609 58.897  44.253  1.00 37.59 ? 176  ASP C CG  1 
ATOM   6254  O  OD1 . ASP C  1 175 ? -14.859 58.243  45.033  1.00 37.31 ? 176  ASP C OD1 1 
ATOM   6255  O  OD2 . ASP C  1 175 ? -16.678 59.458  44.618  1.00 41.53 ? 176  ASP C OD2 1 
ATOM   6256  N  N   . GLU C  1 176 ? -13.111 60.189  40.594  1.00 29.12 ? 177  GLU C N   1 
ATOM   6257  C  CA  . GLU C  1 176 ? -12.644 60.351  39.215  1.00 30.11 ? 177  GLU C CA  1 
ATOM   6258  C  C   . GLU C  1 176 ? -11.379 59.516  38.945  1.00 30.18 ? 177  GLU C C   1 
ATOM   6259  O  O   . GLU C  1 176 ? -11.237 58.871  37.893  1.00 28.45 ? 177  GLU C O   1 
ATOM   6260  C  CB  . GLU C  1 176 ? -12.387 61.837  38.911  1.00 32.17 ? 177  GLU C CB  1 
ATOM   6261  C  CG  . GLU C  1 176 ? -12.106 62.152  37.438  1.00 39.11 ? 177  GLU C CG  1 
ATOM   6262  C  CD  . GLU C  1 176 ? -12.052 63.655  37.119  1.00 46.99 ? 177  GLU C CD  1 
ATOM   6263  O  OE1 . GLU C  1 176 ? -12.283 64.495  38.024  1.00 51.68 ? 177  GLU C OE1 1 
ATOM   6264  O  OE2 . GLU C  1 176 ? -11.778 63.989  35.942  1.00 49.73 ? 177  GLU C OE2 1 
ATOM   6265  N  N   . LYS C  1 177 ? -10.454 59.505  39.906  1.00 30.17 ? 178  LYS C N   1 
ATOM   6266  C  CA  . LYS C  1 177 ? -9.162  58.865  39.664  1.00 26.17 ? 178  LYS C CA  1 
ATOM   6267  C  C   . LYS C  1 177 ? -9.386  57.363  39.748  1.00 25.99 ? 178  LYS C C   1 
ATOM   6268  O  O   . LYS C  1 177 ? -8.751  56.579  39.026  1.00 28.21 ? 178  LYS C O   1 
ATOM   6269  C  CB  . LYS C  1 177 ? -8.119  59.361  40.667  1.00 25.15 ? 178  LYS C CB  1 
ATOM   6270  C  CG  . LYS C  1 177 ? -7.685  60.814  40.456  1.00 24.14 ? 178  LYS C CG  1 
ATOM   6271  C  CD  . LYS C  1 177 ? -6.742  61.284  41.568  1.00 23.92 ? 178  LYS C CD  1 
ATOM   6272  C  CE  . LYS C  1 177 ? -6.390  62.759  41.442  1.00 25.55 ? 178  LYS C CE  1 
ATOM   6273  N  NZ  . LYS C  1 177 ? -5.357  63.184  42.444  1.00 21.42 ? 178  LYS C NZ  1 
ATOM   6274  N  N   . VAL C  1 178 ? -10.328 56.970  40.594  1.00 25.20 ? 179  VAL C N   1 
ATOM   6275  C  CA  . VAL C  1 178 ? -10.685 55.568  40.744  1.00 25.60 ? 179  VAL C CA  1 
ATOM   6276  C  C   . VAL C  1 178 ? -11.208 55.044  39.414  1.00 27.48 ? 179  VAL C C   1 
ATOM   6277  O  O   . VAL C  1 178 ? -10.729 54.022  38.926  1.00 28.36 ? 179  VAL C O   1 
ATOM   6278  C  CB  . VAL C  1 178 ? -11.740 55.355  41.868  1.00 24.28 ? 179  VAL C CB  1 
ATOM   6279  C  CG1 . VAL C  1 178 ? -12.272 53.910  41.864  1.00 25.51 ? 179  VAL C CG1 1 
ATOM   6280  C  CG2 . VAL C  1 178 ? -11.132 55.667  43.218  1.00 25.29 ? 179  VAL C CG2 1 
ATOM   6281  N  N   . ALA C  1 179 ? -12.180 55.759  38.831  1.00 28.06 ? 180  ALA C N   1 
ATOM   6282  C  CA  . ALA C  1 179 ? -12.727 55.427  37.506  1.00 28.51 ? 180  ALA C CA  1 
ATOM   6283  C  C   . ALA C  1 179 ? -11.650 55.267  36.422  1.00 27.80 ? 180  ALA C C   1 
ATOM   6284  O  O   . ALA C  1 179 ? -11.639 54.290  35.667  1.00 28.80 ? 180  ALA C O   1 
ATOM   6285  C  CB  . ALA C  1 179 ? -13.762 56.502  37.077  1.00 28.84 ? 180  ALA C CB  1 
ATOM   6286  N  N   . TYR C  1 180 ? -10.751 56.238  36.337  1.00 28.78 ? 181  TYR C N   1 
ATOM   6287  C  CA  . TYR C  1 180 ? -9.752  56.235  35.292  1.00 27.25 ? 181  TYR C CA  1 
ATOM   6288  C  C   . TYR C  1 180 ? -8.856  54.983  35.400  1.00 28.67 ? 181  TYR C C   1 
ATOM   6289  O  O   . TYR C  1 180 ? -8.682  54.229  34.416  1.00 31.21 ? 181  TYR C O   1 
ATOM   6290  C  CB  . TYR C  1 180 ? -8.939  57.543  35.307  1.00 27.80 ? 181  TYR C CB  1 
ATOM   6291  C  CG  . TYR C  1 180 ? -7.755  57.526  34.349  1.00 28.48 ? 181  TYR C CG  1 
ATOM   6292  C  CD1 . TYR C  1 180 ? -7.933  57.729  32.976  1.00 33.36 ? 181  TYR C CD1 1 
ATOM   6293  C  CD2 . TYR C  1 180 ? -6.474  57.281  34.809  1.00 27.16 ? 181  TYR C CD2 1 
ATOM   6294  C  CE1 . TYR C  1 180 ? -6.853  57.696  32.084  1.00 32.76 ? 181  TYR C CE1 1 
ATOM   6295  C  CE2 . TYR C  1 180 ? -5.387  57.236  33.936  1.00 31.02 ? 181  TYR C CE2 1 
ATOM   6296  C  CZ  . TYR C  1 180 ? -5.580  57.448  32.573  1.00 33.99 ? 181  TYR C CZ  1 
ATOM   6297  O  OH  . TYR C  1 180 ? -4.495  57.417  31.711  1.00 34.58 ? 181  TYR C OH  1 
ATOM   6298  N  N   . LEU C  1 181 ? -8.326  54.736  36.594  1.00 27.05 ? 182  LEU C N   1 
ATOM   6299  C  CA  . LEU C  1 181 ? -7.426  53.616  36.796  1.00 26.58 ? 182  LEU C CA  1 
ATOM   6300  C  C   . LEU C  1 181 ? -8.103  52.267  36.591  1.00 25.98 ? 182  LEU C C   1 
ATOM   6301  O  O   . LEU C  1 181 ? -7.468  51.321  36.143  1.00 25.86 ? 182  LEU C O   1 
ATOM   6302  C  CB  . LEU C  1 181 ? -6.787  53.675  38.179  1.00 27.01 ? 182  LEU C CB  1 
ATOM   6303  C  CG  . LEU C  1 181 ? -5.871  54.877  38.387  1.00 28.93 ? 182  LEU C CG  1 
ATOM   6304  C  CD1 . LEU C  1 181 ? -5.228  54.871  39.790  1.00 22.00 ? 182  LEU C CD1 1 
ATOM   6305  C  CD2 . LEU C  1 181 ? -4.837  54.928  37.290  1.00 17.79 ? 182  LEU C CD2 1 
ATOM   6306  N  N   . GLN C  1 182 ? -9.373  52.162  36.942  1.00 28.14 ? 183  GLN C N   1 
ATOM   6307  C  CA  . GLN C  1 182 ? -10.129 50.938  36.651  1.00 29.33 ? 183  GLN C CA  1 
ATOM   6308  C  C   . GLN C  1 182 ? -10.243 50.708  35.134  1.00 30.74 ? 183  GLN C C   1 
ATOM   6309  O  O   . GLN C  1 182 ? -10.052 49.581  34.638  1.00 29.32 ? 183  GLN C O   1 
ATOM   6310  C  CB  . GLN C  1 182 ? -11.509 51.020  37.267  1.00 28.91 ? 183  GLN C CB  1 
ATOM   6311  C  CG  . GLN C  1 182 ? -11.509 50.881  38.779  1.00 28.11 ? 183  GLN C CG  1 
ATOM   6312  C  CD  . GLN C  1 182 ? -12.891 51.069  39.378  1.00 34.72 ? 183  GLN C CD  1 
ATOM   6313  O  OE1 . GLN C  1 182 ? -13.748 51.724  38.770  1.00 37.62 ? 183  GLN C OE1 1 
ATOM   6314  N  NE2 . GLN C  1 182 ? -13.122 50.499  40.575  1.00 30.79 ? 183  GLN C NE2 1 
ATOM   6315  N  N   . LYS C  1 183 ? -10.542 51.787  34.407  1.00 32.84 ? 184  LYS C N   1 
ATOM   6316  C  CA  . LYS C  1 183 ? -10.611 51.744  32.951  1.00 32.49 ? 184  LYS C CA  1 
ATOM   6317  C  C   . LYS C  1 183 ? -9.284  51.277  32.399  1.00 33.99 ? 184  LYS C C   1 
ATOM   6318  O  O   . LYS C  1 183 ? -9.247  50.465  31.478  1.00 36.54 ? 184  LYS C O   1 
ATOM   6319  C  CB  . LYS C  1 183 ? -10.991 53.113  32.373  1.00 34.46 ? 184  LYS C CB  1 
ATOM   6320  N  N   . LEU C  1 184 ? -8.189  51.757  32.984  1.00 34.54 ? 185  LEU C N   1 
ATOM   6321  C  CA  . LEU C  1 184 ? -6.862  51.256  32.631  1.00 34.59 ? 185  LEU C CA  1 
ATOM   6322  C  C   . LEU C  1 184 ? -6.661  49.756  32.855  1.00 34.23 ? 185  LEU C C   1 
ATOM   6323  O  O   . LEU C  1 184 ? -5.810  49.130  32.201  1.00 32.39 ? 185  LEU C O   1 
ATOM   6324  C  CB  . LEU C  1 184 ? -5.775  52.025  33.380  1.00 35.93 ? 185  LEU C CB  1 
ATOM   6325  C  CG  . LEU C  1 184 ? -5.404  53.393  32.819  1.00 35.49 ? 185  LEU C CG  1 
ATOM   6326  C  CD1 . LEU C  1 184 ? -4.166  53.948  33.561  1.00 33.84 ? 185  LEU C CD1 1 
ATOM   6327  C  CD2 . LEU C  1 184 ? -5.156  53.295  31.330  1.00 34.62 ? 185  LEU C CD2 1 
ATOM   6328  N  N   . GLY C  1 185 ? -7.424  49.176  33.777  1.00 32.80 ? 186  GLY C N   1 
ATOM   6329  C  CA  . GLY C  1 185 ? -7.336  47.740  34.040  1.00 31.22 ? 186  GLY C CA  1 
ATOM   6330  C  C   . GLY C  1 185 ? -6.553  47.386  35.287  1.00 30.12 ? 186  GLY C C   1 
ATOM   6331  O  O   . GLY C  1 185 ? -6.109  46.252  35.441  1.00 30.71 ? 186  GLY C O   1 
ATOM   6332  N  N   . PHE C  1 186 ? -6.392  48.338  36.197  1.00 29.50 ? 187  PHE C N   1 
ATOM   6333  C  CA  . PHE C  1 186 ? -5.750  48.042  37.482  1.00 29.57 ? 187  PHE C CA  1 
ATOM   6334  C  C   . PHE C  1 186 ? -6.699  47.109  38.241  1.00 29.98 ? 187  PHE C C   1 
ATOM   6335  O  O   . PHE C  1 186 ? -7.921  47.305  38.195  1.00 30.35 ? 187  PHE C O   1 
ATOM   6336  C  CB  . PHE C  1 186 ? -5.500  49.335  38.275  1.00 28.25 ? 187  PHE C CB  1 
ATOM   6337  C  CG  . PHE C  1 186 ? -4.304  50.138  37.819  1.00 27.38 ? 187  PHE C CG  1 
ATOM   6338  C  CD1 . PHE C  1 186 ? -3.682  49.915  36.588  1.00 29.45 ? 187  PHE C CD1 1 
ATOM   6339  C  CD2 . PHE C  1 186 ? -3.787  51.131  38.648  1.00 28.28 ? 187  PHE C CD2 1 
ATOM   6340  C  CE1 . PHE C  1 186 ? -2.584  50.671  36.188  1.00 28.33 ? 187  PHE C CE1 1 
ATOM   6341  C  CE2 . PHE C  1 186 ? -2.689  51.881  38.261  1.00 28.70 ? 187  PHE C CE2 1 
ATOM   6342  C  CZ  . PHE C  1 186 ? -2.080  51.651  37.009  1.00 27.19 ? 187  PHE C CZ  1 
ATOM   6343  N  N   . ASP C  1 187 ? -6.154  46.106  38.934  1.00 28.90 ? 188  ASP C N   1 
ATOM   6344  C  CA  . ASP C  1 187 ? -6.991  45.051  39.502  1.00 30.20 ? 188  ASP C CA  1 
ATOM   6345  C  C   . ASP C  1 187 ? -7.972  45.560  40.586  1.00 29.77 ? 188  ASP C C   1 
ATOM   6346  O  O   . ASP C  1 187 ? -9.164  45.263  40.535  1.00 29.11 ? 188  ASP C O   1 
ATOM   6347  C  CB  . ASP C  1 187 ? -6.144  43.885  40.013  1.00 29.28 ? 188  ASP C CB  1 
ATOM   6348  C  CG  . ASP C  1 187 ? -5.216  43.327  38.945  1.00 34.24 ? 188  ASP C CG  1 
ATOM   6349  O  OD1 . ASP C  1 187 ? -4.427  44.120  38.364  1.00 35.62 ? 188  ASP C OD1 1 
ATOM   6350  O  OD2 . ASP C  1 187 ? -5.292  42.112  38.667  1.00 34.23 ? 188  ASP C OD2 1 
ATOM   6351  N  N   . VAL C  1 188 ? -7.465  46.318  41.550  1.00 29.23 ? 189  VAL C N   1 
ATOM   6352  C  CA  . VAL C  1 188 ? -8.315  46.973  42.563  1.00 28.49 ? 189  VAL C CA  1 
ATOM   6353  C  C   . VAL C  1 188 ? -7.848  48.400  42.714  1.00 28.46 ? 189  VAL C C   1 
ATOM   6354  O  O   . VAL C  1 188 ? -6.640  48.659  42.775  1.00 29.24 ? 189  VAL C O   1 
ATOM   6355  C  CB  . VAL C  1 188 ? -8.227  46.289  43.951  1.00 27.42 ? 189  VAL C CB  1 
ATOM   6356  C  CG1 . VAL C  1 188 ? -9.152  46.993  44.942  1.00 26.57 ? 189  VAL C CG1 1 
ATOM   6357  C  CG2 . VAL C  1 188 ? -8.604  44.806  43.848  1.00 28.94 ? 189  VAL C CG2 1 
ATOM   6358  N  N   . VAL C  1 189 ? -8.797  49.325  42.766  1.00 26.59 ? 190  VAL C N   1 
ATOM   6359  C  CA  . VAL C  1 189 ? -8.479  50.726  42.959  1.00 25.01 ? 190  VAL C CA  1 
ATOM   6360  C  C   . VAL C  1 189 ? -9.514  51.315  43.884  1.00 25.17 ? 190  VAL C C   1 
ATOM   6361  O  O   . VAL C  1 189 ? -10.679 51.089  43.678  1.00 25.40 ? 190  VAL C O   1 
ATOM   6362  C  CB  . VAL C  1 189 ? -8.530  51.518  41.631  1.00 26.34 ? 190  VAL C CB  1 
ATOM   6363  C  CG1 . VAL C  1 189 ? -7.915  52.908  41.848  1.00 21.42 ? 190  VAL C CG1 1 
ATOM   6364  C  CG2 . VAL C  1 189 ? -7.847  50.749  40.497  1.00 25.59 ? 190  VAL C CG2 1 
ATOM   6365  N  N   . PHE C  1 190 ? -9.097  52.062  44.905  1.00 26.78 ? 191  PHE C N   1 
ATOM   6366  C  CA  . PHE C  1 190 ? -10.051 52.664  45.851  1.00 24.39 ? 191  PHE C CA  1 
ATOM   6367  C  C   . PHE C  1 190 ? -9.714  54.066  46.192  1.00 23.94 ? 191  PHE C C   1 
ATOM   6368  O  O   . PHE C  1 190 ? -8.590  54.505  46.009  1.00 28.09 ? 191  PHE C O   1 
ATOM   6369  C  CB  . PHE C  1 190 ? -10.134 51.862  47.156  1.00 26.13 ? 191  PHE C CB  1 
ATOM   6370  C  CG  . PHE C  1 190 ? -8.815  51.725  47.888  1.00 27.56 ? 191  PHE C CG  1 
ATOM   6371  C  CD1 . PHE C  1 190 ? -7.965  50.657  47.623  1.00 27.88 ? 191  PHE C CD1 1 
ATOM   6372  C  CD2 . PHE C  1 190 ? -8.436  52.648  48.846  1.00 22.87 ? 191  PHE C CD2 1 
ATOM   6373  C  CE1 . PHE C  1 190 ? -6.757  50.533  48.304  1.00 26.79 ? 191  PHE C CE1 1 
ATOM   6374  C  CE2 . PHE C  1 190 ? -7.238  52.517  49.526  1.00 24.37 ? 191  PHE C CE2 1 
ATOM   6375  C  CZ  . PHE C  1 190 ? -6.404  51.472  49.255  1.00 23.56 ? 191  PHE C CZ  1 
ATOM   6376  N  N   . ASN C  1 191 ? -10.704 54.760  46.729  1.00 24.74 ? 192  ASN C N   1 
ATOM   6377  C  CA  . ASN C  1 191 ? -10.530 56.097  47.249  1.00 24.19 ? 192  ASN C CA  1 
ATOM   6378  C  C   . ASN C  1 191 ? -10.160 56.060  48.726  1.00 26.25 ? 192  ASN C C   1 
ATOM   6379  O  O   . ASN C  1 191 ? -11.030 55.794  49.565  1.00 24.28 ? 192  ASN C O   1 
ATOM   6380  C  CB  . ASN C  1 191 ? -11.842 56.856  47.085  1.00 23.23 ? 192  ASN C CB  1 
ATOM   6381  C  CG  . ASN C  1 191 ? -11.695 58.309  47.370  1.00 27.03 ? 192  ASN C CG  1 
ATOM   6382  O  OD1 . ASN C  1 191 ? -10.892 58.702  48.223  1.00 33.97 ? 192  ASN C OD1 1 
ATOM   6383  N  ND2 . ASN C  1 191 ? -12.452 59.143  46.646  1.00 26.81 ? 192  ASN C ND2 1 
ATOM   6384  N  N   . TYR C  1 192 ? -8.902  56.396  49.054  1.00 26.70 ? 193  TYR C N   1 
ATOM   6385  C  CA  . TYR C  1 192 ? -8.434  56.324  50.446  1.00 26.38 ? 193  TYR C CA  1 
ATOM   6386  C  C   . TYR C  1 192 ? -9.058  57.361  51.364  1.00 26.47 ? 193  TYR C C   1 
ATOM   6387  O  O   . TYR C  1 192 ? -8.949  57.238  52.570  1.00 29.16 ? 193  TYR C O   1 
ATOM   6388  C  CB  . TYR C  1 192 ? -6.896  56.382  50.555  1.00 24.95 ? 193  TYR C CB  1 
ATOM   6389  C  CG  . TYR C  1 192 ? -6.300  57.736  50.302  1.00 22.05 ? 193  TYR C CG  1 
ATOM   6390  C  CD1 . TYR C  1 192 ? -6.231  58.693  51.309  1.00 21.43 ? 193  TYR C CD1 1 
ATOM   6391  C  CD2 . TYR C  1 192 ? -5.795  58.057  49.038  1.00 21.02 ? 193  TYR C CD2 1 
ATOM   6392  C  CE1 . TYR C  1 192 ? -5.698  59.949  51.052  1.00 25.77 ? 193  TYR C CE1 1 
ATOM   6393  C  CE2 . TYR C  1 192 ? -5.274  59.293  48.769  1.00 21.13 ? 193  TYR C CE2 1 
ATOM   6394  C  CZ  . TYR C  1 192 ? -5.214  60.239  49.763  1.00 22.84 ? 193  TYR C CZ  1 
ATOM   6395  O  OH  . TYR C  1 192 ? -4.663  61.471  49.456  1.00 25.58 ? 193  TYR C OH  1 
ATOM   6396  N  N   . LYS C  1 193 ? -9.684  58.386  50.801  1.00 29.27 ? 194  LYS C N   1 
ATOM   6397  C  CA  . LYS C  1 193 ? -10.316 59.451  51.588  1.00 29.63 ? 194  LYS C CA  1 
ATOM   6398  C  C   . LYS C  1 193 ? -11.750 59.131  52.005  1.00 30.73 ? 194  LYS C C   1 
ATOM   6399  O  O   . LYS C  1 193 ? -12.304 59.781  52.910  1.00 30.88 ? 194  LYS C O   1 
ATOM   6400  C  CB  . LYS C  1 193 ? -10.323 60.769  50.793  1.00 31.27 ? 194  LYS C CB  1 
ATOM   6401  C  CG  . LYS C  1 193 ? -8.939  61.384  50.562  1.00 32.79 ? 194  LYS C CG  1 
ATOM   6402  C  CD  . LYS C  1 193 ? -9.031  62.736  49.830  1.00 31.55 ? 194  LYS C CD  1 
ATOM   6403  C  CE  . LYS C  1 193 ? -7.728  63.533  49.910  1.00 33.90 ? 194  LYS C CE  1 
ATOM   6404  N  NZ  . LYS C  1 193 ? -7.576  64.522  48.790  1.00 28.54 ? 194  LYS C NZ  1 
ATOM   6405  N  N   . THR C  1 194 ? -12.367 58.159  51.337  1.00 32.13 ? 195  THR C N   1 
ATOM   6406  C  CA  . THR C  1 194 ? -13.765 57.833  51.614  1.00 32.96 ? 195  THR C CA  1 
ATOM   6407  C  C   . THR C  1 194 ? -14.000 56.419  52.149  1.00 34.35 ? 195  THR C C   1 
ATOM   6408  O  O   . THR C  1 194 ? -15.096 56.131  52.612  1.00 34.45 ? 195  THR C O   1 
ATOM   6409  C  CB  . THR C  1 194 ? -14.637 58.000  50.360  1.00 32.49 ? 195  THR C CB  1 
ATOM   6410  O  OG1 . THR C  1 194 ? -14.194 57.080  49.351  1.00 34.07 ? 195  THR C OG1 1 
ATOM   6411  C  CG2 . THR C  1 194 ? -14.582 59.441  49.841  1.00 28.95 ? 195  THR C CG2 1 
ATOM   6412  N  N   . VAL C  1 195 ? -13.008 55.531  52.081  1.00 34.10 ? 196  VAL C N   1 
ATOM   6413  C  CA  . VAL C  1 195 ? -13.205 54.194  52.602  1.00 34.97 ? 196  VAL C CA  1 
ATOM   6414  C  C   . VAL C  1 195 ? -13.332 54.266  54.124  1.00 36.20 ? 196  VAL C C   1 
ATOM   6415  O  O   . VAL C  1 195 ? -12.745 55.145  54.776  1.00 34.72 ? 196  VAL C O   1 
ATOM   6416  C  CB  . VAL C  1 195 ? -12.077 53.189  52.192  1.00 35.00 ? 196  VAL C CB  1 
ATOM   6417  C  CG1 . VAL C  1 195 ? -12.019 53.048  50.686  1.00 34.33 ? 196  VAL C CG1 1 
ATOM   6418  C  CG2 . VAL C  1 195 ? -10.733 53.607  52.782  1.00 31.72 ? 196  VAL C CG2 1 
ATOM   6419  N  N   . GLU C  1 196 ? -14.105 53.329  54.671  1.00 38.25 ? 197  GLU C N   1 
ATOM   6420  C  CA  . GLU C  1 196 ? -14.347 53.243  56.112  1.00 38.66 ? 197  GLU C CA  1 
ATOM   6421  C  C   . GLU C  1 196 ? -13.039 52.897  56.812  1.00 36.85 ? 197  GLU C C   1 
ATOM   6422  O  O   . GLU C  1 196 ? -12.612 53.587  57.746  1.00 34.73 ? 197  GLU C O   1 
ATOM   6423  C  CB  . GLU C  1 196 ? -15.404 52.160  56.394  1.00 39.98 ? 197  GLU C CB  1 
ATOM   6424  C  CG  . GLU C  1 196 ? -16.063 52.227  57.789  1.00 46.94 ? 197  GLU C CG  1 
ATOM   6425  C  CD  . GLU C  1 196 ? -17.424 51.494  57.830  1.00 53.53 ? 197  GLU C CD  1 
ATOM   6426  O  OE1 . GLU C  1 196 ? -18.248 51.686  56.898  1.00 50.73 ? 197  GLU C OE1 1 
ATOM   6427  O  OE2 . GLU C  1 196 ? -17.669 50.725  58.790  1.00 54.54 ? 197  GLU C OE2 1 
ATOM   6428  N  N   . SER C  1 197 ? -12.398 51.837  56.323  1.00 35.07 ? 198  SER C N   1 
ATOM   6429  C  CA  . SER C  1 197 ? -11.198 51.319  56.949  1.00 34.28 ? 198  SER C CA  1 
ATOM   6430  C  C   . SER C  1 197 ? -10.106 51.016  55.916  1.00 33.04 ? 198  SER C C   1 
ATOM   6431  O  O   . SER C  1 197 ? -10.238 50.100  55.088  1.00 33.47 ? 198  SER C O   1 
ATOM   6432  C  CB  . SER C  1 197 ? -11.531 50.050  57.744  1.00 34.30 ? 198  SER C CB  1 
ATOM   6433  O  OG  . SER C  1 197 ? -10.375 49.548  58.392  1.00 35.36 ? 198  SER C OG  1 
ATOM   6434  N  N   . LEU C  1 198 ? -9.003  51.752  55.999  1.00 31.27 ? 199  LEU C N   1 
ATOM   6435  C  CA  . LEU C  1 198 ? -7.889  51.503  55.114  1.00 27.64 ? 199  LEU C CA  1 
ATOM   6436  C  C   . LEU C  1 198 ? -7.468  50.054  55.244  1.00 27.89 ? 199  LEU C C   1 
ATOM   6437  O  O   . LEU C  1 198 ? -7.282  49.345  54.244  1.00 27.58 ? 199  LEU C O   1 
ATOM   6438  C  CB  . LEU C  1 198 ? -6.747  52.440  55.448  1.00 27.50 ? 199  LEU C CB  1 
ATOM   6439  C  CG  . LEU C  1 198 ? -5.592  52.463  54.452  1.00 24.21 ? 199  LEU C CG  1 
ATOM   6440  C  CD1 . LEU C  1 198 ? -6.080  52.655  53.004  1.00 22.34 ? 199  LEU C CD1 1 
ATOM   6441  C  CD2 . LEU C  1 198 ? -4.636  53.536  54.878  1.00 18.52 ? 199  LEU C CD2 1 
ATOM   6442  N  N   . GLU C  1 199 ? -7.361  49.595  56.484  1.00 29.66 ? 200  GLU C N   1 
ATOM   6443  C  CA  . GLU C  1 199 ? -6.832  48.266  56.760  1.00 30.13 ? 200  GLU C CA  1 
ATOM   6444  C  C   . GLU C  1 199 ? -7.742  47.179  56.183  1.00 32.05 ? 200  GLU C C   1 
ATOM   6445  O  O   . GLU C  1 199 ? -7.255  46.229  55.542  1.00 31.68 ? 200  GLU C O   1 
ATOM   6446  C  CB  . GLU C  1 199 ? -6.631  48.096  58.268  1.00 31.85 ? 200  GLU C CB  1 
ATOM   6447  C  CG  . GLU C  1 199 ? -5.717  46.936  58.676  1.00 38.99 ? 200  GLU C CG  1 
ATOM   6448  C  CD  . GLU C  1 199 ? -5.859  46.532  60.157  1.00 45.16 ? 200  GLU C CD  1 
ATOM   6449  O  OE1 . GLU C  1 199 ? -6.028  47.417  61.027  1.00 47.83 ? 200  GLU C OE1 1 
ATOM   6450  O  OE2 . GLU C  1 199 ? -5.788  45.315  60.441  1.00 47.33 ? 200  GLU C OE2 1 
ATOM   6451  N  N   . GLU C  1 200 ? -9.055  47.304  56.397  1.00 32.36 ? 201  GLU C N   1 
ATOM   6452  C  CA  . GLU C  1 200 ? -10.000 46.320  55.825  1.00 35.42 ? 201  GLU C CA  1 
ATOM   6453  C  C   . GLU C  1 200 ? -10.069 46.379  54.287  1.00 32.21 ? 201  GLU C C   1 
ATOM   6454  O  O   . GLU C  1 200 ? -10.246 45.350  53.610  1.00 31.21 ? 201  GLU C O   1 
ATOM   6455  C  CB  . GLU C  1 200 ? -11.413 46.478  56.419  1.00 37.59 ? 201  GLU C CB  1 
ATOM   6456  C  CG  . GLU C  1 200 ? -11.603 45.753  57.788  1.00 50.54 ? 201  GLU C CG  1 
ATOM   6457  C  CD  . GLU C  1 200 ? -12.903 46.153  58.506  1.00 60.97 ? 201  GLU C CD  1 
ATOM   6458  O  OE1 . GLU C  1 200 ? -13.949 46.268  57.823  1.00 65.70 ? 201  GLU C OE1 1 
ATOM   6459  O  OE2 . GLU C  1 200 ? -12.873 46.372  59.745  1.00 62.12 ? 201  GLU C OE2 1 
ATOM   6460  N  N   . THR C  1 201 ? -9.943  47.582  53.735  1.00 30.30 ? 202  THR C N   1 
ATOM   6461  C  CA  . THR C  1 201 ? -9.943  47.737  52.289  1.00 28.90 ? 202  THR C CA  1 
ATOM   6462  C  C   . THR C  1 201 ? -8.743  46.999  51.709  1.00 28.46 ? 202  THR C C   1 
ATOM   6463  O  O   . THR C  1 201 ? -8.900  46.149  50.822  1.00 29.50 ? 202  THR C O   1 
ATOM   6464  C  CB  . THR C  1 201 ? -9.969  49.215  51.909  1.00 30.18 ? 202  THR C CB  1 
ATOM   6465  O  OG1 . THR C  1 201 ? -11.178 49.792  52.414  1.00 26.84 ? 202  THR C OG1 1 
ATOM   6466  C  CG2 . THR C  1 201 ? -9.912  49.405  50.380  1.00 28.32 ? 202  THR C CG2 1 
ATOM   6467  N  N   . LEU C  1 202 ? -7.563  47.243  52.276  1.00 28.13 ? 203  LEU C N   1 
ATOM   6468  C  CA  . LEU C  1 202 ? -6.332  46.603  51.798  1.00 26.91 ? 203  LEU C CA  1 
ATOM   6469  C  C   . LEU C  1 202 ? -6.384  45.088  51.914  1.00 28.20 ? 203  LEU C C   1 
ATOM   6470  O  O   . LEU C  1 202 ? -5.932  44.357  51.010  1.00 28.16 ? 203  LEU C O   1 
ATOM   6471  C  CB  . LEU C  1 202 ? -5.109  47.142  52.551  1.00 27.55 ? 203  LEU C CB  1 
ATOM   6472  C  CG  . LEU C  1 202 ? -4.693  48.543  52.114  1.00 25.59 ? 203  LEU C CG  1 
ATOM   6473  C  CD1 . LEU C  1 202 ? -3.882  49.225  53.215  1.00 24.51 ? 203  LEU C CD1 1 
ATOM   6474  C  CD2 . LEU C  1 202 ? -3.917  48.487  50.782  1.00 22.15 ? 203  LEU C CD2 1 
ATOM   6475  N  N   . LYS C  1 203 ? -6.952  44.611  53.010  1.00 30.30 ? 204  LYS C N   1 
ATOM   6476  C  CA  . LYS C  1 203 ? -7.088  43.170  53.231  1.00 32.97 ? 204  LYS C CA  1 
ATOM   6477  C  C   . LYS C  1 203 ? -8.027  42.524  52.206  1.00 33.47 ? 204  LYS C C   1 
ATOM   6478  O  O   . LYS C  1 203 ? -7.713  41.458  51.663  1.00 33.02 ? 204  LYS C O   1 
ATOM   6479  C  CB  . LYS C  1 203 ? -7.544  42.905  54.673  1.00 35.82 ? 204  LYS C CB  1 
ATOM   6480  C  CG  . LYS C  1 203 ? -7.601  41.431  55.098  1.00 44.63 ? 204  LYS C CG  1 
ATOM   6481  C  CD  . LYS C  1 203 ? -6.226  40.763  55.241  1.00 51.06 ? 204  LYS C CD  1 
ATOM   6482  C  CE  . LYS C  1 203 ? -6.397  39.314  55.732  1.00 54.60 ? 204  LYS C CE  1 
ATOM   6483  N  NZ  . LYS C  1 203 ? -5.170  38.462  55.611  1.00 56.66 ? 204  LYS C NZ  1 
ATOM   6484  N  N   . LYS C  1 204 ? -9.152  43.180  51.919  1.00 34.62 ? 205  LYS C N   1 
ATOM   6485  C  CA  . LYS C  1 204 ? -10.102 42.664  50.929  1.00 34.69 ? 205  LYS C CA  1 
ATOM   6486  C  C   . LYS C  1 204 ? -9.505  42.703  49.522  1.00 34.13 ? 205  LYS C C   1 
ATOM   6487  O  O   . LYS C  1 204 ? -9.848  41.870  48.674  1.00 34.56 ? 205  LYS C O   1 
ATOM   6488  C  CB  . LYS C  1 204 ? -11.404 43.463  50.951  1.00 36.13 ? 205  LYS C CB  1 
ATOM   6489  C  CG  . LYS C  1 204 ? -12.656 42.631  50.653  1.00 43.38 ? 205  LYS C CG  1 
ATOM   6490  N  N   . ALA C  1 205 ? -8.618  43.674  49.278  1.00 31.74 ? 206  ALA C N   1 
ATOM   6491  C  CA  . ALA C  1 205 ? -8.002  43.855  47.966  1.00 28.98 ? 206  ALA C CA  1 
ATOM   6492  C  C   . ALA C  1 205 ? -6.976  42.749  47.703  1.00 30.27 ? 206  ALA C C   1 
ATOM   6493  O  O   . ALA C  1 205 ? -6.861  42.251  46.566  1.00 30.55 ? 206  ALA C O   1 
ATOM   6494  C  CB  . ALA C  1 205 ? -7.351  45.246  47.873  1.00 28.77 ? 206  ALA C CB  1 
ATOM   6495  N  N   . SER C  1 206 ? -6.243  42.359  48.756  1.00 30.28 ? 207  SER C N   1 
ATOM   6496  C  CA  . SER C  1 206 ? -5.343  41.218  48.687  1.00 30.08 ? 207  SER C CA  1 
ATOM   6497  C  C   . SER C  1 206 ? -5.265  40.504  50.032  1.00 32.39 ? 207  SER C C   1 
ATOM   6498  O  O   . SER C  1 206 ? -4.460  40.872  50.897  1.00 34.87 ? 207  SER C O   1 
ATOM   6499  C  CB  . SER C  1 206 ? -3.952  41.658  48.262  1.00 29.75 ? 207  SER C CB  1 
ATOM   6500  O  OG  . SER C  1 206 ? -3.104  40.532  48.125  1.00 26.51 ? 207  SER C OG  1 
ATOM   6501  N  N   . PRO C  1 207 ? -6.090  39.471  50.217  1.00 34.10 ? 208  PRO C N   1 
ATOM   6502  C  CA  . PRO C  1 207 ? -6.108  38.730  51.491  1.00 33.96 ? 208  PRO C CA  1 
ATOM   6503  C  C   . PRO C  1 207 ? -4.789  38.031  51.794  1.00 34.07 ? 208  PRO C C   1 
ATOM   6504  O  O   . PRO C  1 207 ? -4.401  37.911  52.955  1.00 35.76 ? 208  PRO C O   1 
ATOM   6505  C  CB  . PRO C  1 207 ? -7.206  37.689  51.276  1.00 34.32 ? 208  PRO C CB  1 
ATOM   6506  C  CG  . PRO C  1 207 ? -8.040  38.213  50.161  1.00 34.51 ? 208  PRO C CG  1 
ATOM   6507  C  CD  . PRO C  1 207 ? -7.149  39.022  49.293  1.00 34.22 ? 208  PRO C CD  1 
ATOM   6508  N  N   . ASP C  1 208 ? -4.130  37.573  50.737  1.00 33.73 ? 209  ASP C N   1 
ATOM   6509  C  CA  . ASP C  1 208 ? -2.788  37.031  50.784  1.00 35.04 ? 209  ASP C CA  1 
ATOM   6510  C  C   . ASP C  1 208 ? -1.689  38.035  51.207  1.00 32.62 ? 209  ASP C C   1 
ATOM   6511  O  O   . ASP C  1 208 ? -0.569  37.619  51.461  1.00 32.82 ? 209  ASP C O   1 
ATOM   6512  C  CB  . ASP C  1 208 ? -2.432  36.516  49.369  1.00 37.84 ? 209  ASP C CB  1 
ATOM   6513  C  CG  . ASP C  1 208 ? -1.414  35.388  49.385  1.00 47.98 ? 209  ASP C CG  1 
ATOM   6514  O  OD1 . ASP C  1 208 ? -1.079  34.906  50.489  1.00 55.55 ? 209  ASP C OD1 1 
ATOM   6515  O  OD2 . ASP C  1 208 ? -0.951  34.971  48.291  1.00 58.25 ? 209  ASP C OD2 1 
ATOM   6516  N  N   . GLY C  1 209 ? -1.981  39.335  51.233  1.00 30.43 ? 210  GLY C N   1 
ATOM   6517  C  CA  . GLY C  1 209 ? -0.961  40.357  51.513  1.00 29.66 ? 210  GLY C CA  1 
ATOM   6518  C  C   . GLY C  1 209 ? -0.235  40.869  50.268  1.00 28.84 ? 210  GLY C C   1 
ATOM   6519  O  O   . GLY C  1 209 ? -0.618  40.552  49.141  1.00 27.33 ? 210  GLY C O   1 
ATOM   6520  N  N   . TYR C  1 210 ? 0.827   41.653  50.468  1.00 27.27 ? 211  TYR C N   1 
ATOM   6521  C  CA  . TYR C  1 210 ? 1.488   42.339  49.375  1.00 23.63 ? 211  TYR C CA  1 
ATOM   6522  C  C   . TYR C  1 210 ? 2.960   41.966  49.243  1.00 24.96 ? 211  TYR C C   1 
ATOM   6523  O  O   . TYR C  1 210 ? 3.712   42.033  50.222  1.00 26.11 ? 211  TYR C O   1 
ATOM   6524  C  CB  . TYR C  1 210 ? 1.323   43.845  49.557  1.00 24.16 ? 211  TYR C CB  1 
ATOM   6525  C  CG  . TYR C  1 210 ? -0.133  44.286  49.473  1.00 26.50 ? 211  TYR C CG  1 
ATOM   6526  C  CD1 . TYR C  1 210 ? -0.957  44.240  50.593  1.00 27.06 ? 211  TYR C CD1 1 
ATOM   6527  C  CD2 . TYR C  1 210 ? -0.691  44.718  48.270  1.00 25.18 ? 211  TYR C CD2 1 
ATOM   6528  C  CE1 . TYR C  1 210 ? -2.293  44.599  50.526  1.00 24.61 ? 211  TYR C CE1 1 
ATOM   6529  C  CE2 . TYR C  1 210 ? -2.043  45.104  48.194  1.00 26.79 ? 211  TYR C CE2 1 
ATOM   6530  C  CZ  . TYR C  1 210 ? -2.830  45.043  49.331  1.00 25.17 ? 211  TYR C CZ  1 
ATOM   6531  O  OH  . TYR C  1 210 ? -4.154  45.395  49.278  1.00 26.81 ? 211  TYR C OH  1 
ATOM   6532  N  N   . ASP C  1 211 ? 3.377   41.609  48.024  1.00 23.39 ? 212  ASP C N   1 
ATOM   6533  C  CA  . ASP C  1 211 ? 4.795   41.360  47.717  1.00 22.00 ? 212  ASP C CA  1 
ATOM   6534  C  C   . ASP C  1 211 ? 5.620   42.633  47.661  1.00 22.09 ? 212  ASP C C   1 
ATOM   6535  O  O   . ASP C  1 211 ? 6.774   42.657  48.081  1.00 20.61 ? 212  ASP C O   1 
ATOM   6536  C  CB  . ASP C  1 211 ? 4.913   40.654  46.382  1.00 23.78 ? 212  ASP C CB  1 
ATOM   6537  C  CG  . ASP C  1 211 ? 4.164   39.348  46.368  1.00 27.03 ? 212  ASP C CG  1 
ATOM   6538  O  OD1 . ASP C  1 211 ? 4.685   38.390  46.982  1.00 25.01 ? 212  ASP C OD1 1 
ATOM   6539  O  OD2 . ASP C  1 211 ? 3.036   39.316  45.816  1.00 31.99 ? 212  ASP C OD2 1 
ATOM   6540  N  N   . CYS C  1 212 ? 5.015   43.689  47.129  1.00 24.00 ? 213  CYS C N   1 
ATOM   6541  C  CA  . CYS C  1 212 ? 5.712   44.925  46.841  1.00 22.97 ? 213  CYS C CA  1 
ATOM   6542  C  C   . CYS C  1 212 ? 4.827   46.091  47.143  1.00 22.51 ? 213  CYS C C   1 
ATOM   6543  O  O   . CYS C  1 212 ? 3.600   46.063  46.893  1.00 21.84 ? 213  CYS C O   1 
ATOM   6544  C  CB  . CYS C  1 212 ? 6.116   45.005  45.360  1.00 23.80 ? 213  CYS C CB  1 
ATOM   6545  S  SG  . CYS C  1 212 ? 7.265   43.705  44.835  1.00 33.09 ? 213  CYS C SG  1 
ATOM   6546  N  N   . TYR C  1 213 ? 5.475   47.128  47.665  1.00 20.80 ? 214  TYR C N   1 
ATOM   6547  C  CA  . TYR C  1 213 ? 4.847   48.390  47.950  1.00 19.58 ? 214  TYR C CA  1 
ATOM   6548  C  C   . TYR C  1 213 ? 5.706   49.491  47.315  1.00 19.86 ? 214  TYR C C   1 
ATOM   6549  O  O   . TYR C  1 213 ? 6.870   49.668  47.667  1.00 18.80 ? 214  TYR C O   1 
ATOM   6550  C  CB  . TYR C  1 213 ? 4.767   48.559  49.470  1.00 19.43 ? 214  TYR C CB  1 
ATOM   6551  C  CG  . TYR C  1 213 ? 4.121   49.834  49.977  1.00 20.05 ? 214  TYR C CG  1 
ATOM   6552  C  CD1 . TYR C  1 213 ? 3.167   50.529  49.237  1.00 17.86 ? 214  TYR C CD1 1 
ATOM   6553  C  CD2 . TYR C  1 213 ? 4.454   50.329  51.225  1.00 20.43 ? 214  TYR C CD2 1 
ATOM   6554  C  CE1 . TYR C  1 213 ? 2.587   51.700  49.723  1.00 17.22 ? 214  TYR C CE1 1 
ATOM   6555  C  CE2 . TYR C  1 213 ? 3.892   51.478  51.707  1.00 16.64 ? 214  TYR C CE2 1 
ATOM   6556  C  CZ  . TYR C  1 213 ? 2.952   52.153  50.976  1.00 17.11 ? 214  TYR C CZ  1 
ATOM   6557  O  OH  . TYR C  1 213 ? 2.403   53.283  51.540  1.00 22.58 ? 214  TYR C OH  1 
ATOM   6558  N  N   . PHE C  1 214 ? 5.126   50.212  46.367  1.00 20.67 ? 215  PHE C N   1 
ATOM   6559  C  CA  . PHE C  1 214 ? 5.774   51.357  45.779  1.00 18.41 ? 215  PHE C CA  1 
ATOM   6560  C  C   . PHE C  1 214 ? 5.185   52.537  46.513  1.00 17.32 ? 215  PHE C C   1 
ATOM   6561  O  O   . PHE C  1 214 ? 4.041   52.884  46.306  1.00 17.72 ? 215  PHE C O   1 
ATOM   6562  C  CB  . PHE C  1 214 ? 5.520   51.407  44.253  1.00 18.30 ? 215  PHE C CB  1 
ATOM   6563  C  CG  . PHE C  1 214 ? 6.339   52.460  43.536  1.00 19.63 ? 215  PHE C CG  1 
ATOM   6564  C  CD1 . PHE C  1 214 ? 6.031   53.812  43.671  1.00 19.12 ? 215  PHE C CD1 1 
ATOM   6565  C  CD2 . PHE C  1 214 ? 7.450   52.100  42.762  1.00 20.35 ? 215  PHE C CD2 1 
ATOM   6566  C  CE1 . PHE C  1 214 ? 6.804   54.797  43.053  1.00 17.60 ? 215  PHE C CE1 1 
ATOM   6567  C  CE2 . PHE C  1 214 ? 8.221   53.072  42.132  1.00 19.61 ? 215  PHE C CE2 1 
ATOM   6568  C  CZ  . PHE C  1 214 ? 7.902   54.427  42.279  1.00 18.03 ? 215  PHE C CZ  1 
ATOM   6569  N  N   . ASP C  1 215 ? 5.983   53.198  47.348  1.00 19.39 ? 216  ASP C N   1 
ATOM   6570  C  CA  . ASP C  1 215 ? 5.436   54.168  48.278  1.00 16.47 ? 216  ASP C CA  1 
ATOM   6571  C  C   . ASP C  1 215 ? 5.770   55.570  47.881  1.00 17.81 ? 216  ASP C C   1 
ATOM   6572  O  O   . ASP C  1 215 ? 6.950   55.969  47.892  1.00 21.29 ? 216  ASP C O   1 
ATOM   6573  C  CB  . ASP C  1 215 ? 5.962   53.889  49.689  1.00 15.40 ? 216  ASP C CB  1 
ATOM   6574  C  CG  . ASP C  1 215 ? 5.314   54.790  50.760  1.00 19.68 ? 216  ASP C CG  1 
ATOM   6575  O  OD1 . ASP C  1 215 ? 4.269   55.428  50.478  1.00 20.65 ? 216  ASP C OD1 1 
ATOM   6576  O  OD2 . ASP C  1 215 ? 5.835   54.844  51.897  1.00 18.77 ? 216  ASP C OD2 1 
ATOM   6577  N  N   . ASN C  1 216 ? 4.725   56.340  47.587  1.00 17.62 ? 217  ASN C N   1 
ATOM   6578  C  CA  . ASN C  1 216 ? 4.841   57.756  47.237  1.00 17.45 ? 217  ASN C CA  1 
ATOM   6579  C  C   . ASN C  1 216 ? 4.419   58.695  48.369  1.00 17.85 ? 217  ASN C C   1 
ATOM   6580  O  O   . ASN C  1 216 ? 4.564   59.922  48.248  1.00 18.28 ? 217  ASN C O   1 
ATOM   6581  C  CB  . ASN C  1 216 ? 3.974   58.076  46.013  1.00 17.71 ? 217  ASN C CB  1 
ATOM   6582  C  CG  . ASN C  1 216 ? 4.539   57.515  44.729  1.00 17.22 ? 217  ASN C CG  1 
ATOM   6583  O  OD1 . ASN C  1 216 ? 5.695   57.796  44.364  1.00 21.38 ? 217  ASN C OD1 1 
ATOM   6584  N  ND2 . ASN C  1 216 ? 3.731   56.735  44.019  1.00 18.28 ? 217  ASN C ND2 1 
ATOM   6585  N  N   . VAL C  1 217 ? 3.904   58.125  49.460  1.00 18.58 ? 218  VAL C N   1 
ATOM   6586  C  CA  . VAL C  1 217 ? 3.072   58.890  50.421  1.00 18.43 ? 218  VAL C CA  1 
ATOM   6587  C  C   . VAL C  1 217 ? 3.631   58.955  51.835  1.00 16.02 ? 218  VAL C C   1 
ATOM   6588  O  O   . VAL C  1 217 ? 3.659   60.013  52.437  1.00 16.69 ? 218  VAL C O   1 
ATOM   6589  C  CB  . VAL C  1 217 ? 1.637   58.298  50.488  1.00 19.04 ? 218  VAL C CB  1 
ATOM   6590  C  CG1 . VAL C  1 217 ? 0.835   58.942  51.586  1.00 14.40 ? 218  VAL C CG1 1 
ATOM   6591  C  CG2 . VAL C  1 217 ? 0.913   58.462  49.155  1.00 16.52 ? 218  VAL C CG2 1 
ATOM   6592  N  N   . GLY C  1 218 ? 4.053   57.805  52.366  1.00 19.88 ? 219  GLY C N   1 
ATOM   6593  C  CA  . GLY C  1 218 ? 4.609   57.718  53.732  1.00 19.40 ? 219  GLY C CA  1 
ATOM   6594  C  C   . GLY C  1 218 ? 3.568   57.892  54.831  1.00 17.65 ? 219  GLY C C   1 
ATOM   6595  O  O   . GLY C  1 218 ? 2.372   57.704  54.609  1.00 20.57 ? 219  GLY C O   1 
ATOM   6596  N  N   . GLY C  1 219 ? 4.038   58.222  56.022  1.00 19.35 ? 220  GLY C N   1 
ATOM   6597  C  CA  . GLY C  1 219 ? 3.174   58.469  57.191  1.00 20.23 ? 220  GLY C CA  1 
ATOM   6598  C  C   . GLY C  1 219 ? 2.270   57.311  57.561  1.00 19.32 ? 220  GLY C C   1 
ATOM   6599  O  O   . GLY C  1 219 ? 2.586   56.149  57.300  1.00 19.66 ? 220  GLY C O   1 
ATOM   6600  N  N   . GLU C  1 220 ? 1.114   57.650  58.128  1.00 22.30 ? 221  GLU C N   1 
ATOM   6601  C  CA  . GLU C  1 220 ? 0.135   56.661  58.641  1.00 22.51 ? 221  GLU C CA  1 
ATOM   6602  C  C   . GLU C  1 220 ? -0.310  55.692  57.586  1.00 18.66 ? 221  GLU C C   1 
ATOM   6603  O  O   . GLU C  1 220 ? -0.460  54.518  57.854  1.00 20.66 ? 221  GLU C O   1 
ATOM   6604  C  CB  . GLU C  1 220 ? -1.105  57.357  59.248  1.00 24.82 ? 221  GLU C CB  1 
ATOM   6605  C  CG  . GLU C  1 220 ? -0.806  58.250  60.481  1.00 32.27 ? 221  GLU C CG  1 
ATOM   6606  C  CD  . GLU C  1 220 ? -0.413  57.486  61.756  1.00 37.65 ? 221  GLU C CD  1 
ATOM   6607  O  OE1 . GLU C  1 220 ? -0.138  56.261  61.702  1.00 40.95 ? 221  GLU C OE1 1 
ATOM   6608  O  OE2 . GLU C  1 220 ? -0.394  58.131  62.830  1.00 39.86 ? 221  GLU C OE2 1 
ATOM   6609  N  N   . PHE C  1 221 ? -0.470  56.165  56.360  1.00 20.54 ? 222  PHE C N   1 
ATOM   6610  C  CA  . PHE C  1 221 ? -0.905  55.304  55.256  1.00 18.47 ? 222  PHE C CA  1 
ATOM   6611  C  C   . PHE C  1 221 ? 0.045   54.111  55.115  1.00 18.27 ? 222  PHE C C   1 
ATOM   6612  O  O   . PHE C  1 221 ? -0.372  52.955  55.013  1.00 17.42 ? 222  PHE C O   1 
ATOM   6613  C  CB  . PHE C  1 221 ? -0.981  56.121  53.946  1.00 20.74 ? 222  PHE C CB  1 
ATOM   6614  C  CG  . PHE C  1 221 ? -1.608  55.372  52.796  1.00 18.84 ? 222  PHE C CG  1 
ATOM   6615  C  CD1 . PHE C  1 221 ? -0.911  54.375  52.153  1.00 18.12 ? 222  PHE C CD1 1 
ATOM   6616  C  CD2 . PHE C  1 221 ? -2.909  55.655  52.380  1.00 23.97 ? 222  PHE C CD2 1 
ATOM   6617  C  CE1 . PHE C  1 221 ? -1.480  53.646  51.117  1.00 21.21 ? 222  PHE C CE1 1 
ATOM   6618  C  CE2 . PHE C  1 221 ? -3.492  54.930  51.329  1.00 22.30 ? 222  PHE C CE2 1 
ATOM   6619  C  CZ  . PHE C  1 221 ? -2.773  53.926  50.702  1.00 20.98 ? 222  PHE C CZ  1 
ATOM   6620  N  N   . SER C  1 222 ? 1.338   54.408  55.101  1.00 20.43 ? 223  SER C N   1 
ATOM   6621  C  CA  . SER C  1 222 ? 2.394   53.382  55.000  1.00 20.58 ? 223  SER C CA  1 
ATOM   6622  C  C   . SER C  1 222 ? 2.498   52.484  56.239  1.00 19.40 ? 223  SER C C   1 
ATOM   6623  O  O   . SER C  1 222 ? 2.766   51.284  56.125  1.00 21.77 ? 223  SER C O   1 
ATOM   6624  C  CB  . SER C  1 222 ? 3.744   54.058  54.716  1.00 20.15 ? 223  SER C CB  1 
ATOM   6625  O  OG  . SER C  1 222 ? 3.778   54.461  53.358  1.00 19.00 ? 223  SER C OG  1 
ATOM   6626  N  N   . ASN C  1 223 ? 2.275   53.059  57.408  1.00 19.57 ? 224  ASN C N   1 
ATOM   6627  C  CA  . ASN C  1 223 ? 2.174   52.291  58.641  1.00 19.58 ? 224  ASN C CA  1 
ATOM   6628  C  C   . ASN C  1 223 ? 1.180   51.187  58.470  1.00 19.28 ? 224  ASN C C   1 
ATOM   6629  O  O   . ASN C  1 223 ? 1.522   50.027  58.694  1.00 18.47 ? 224  ASN C O   1 
ATOM   6630  C  CB  . ASN C  1 223 ? 1.844   53.183  59.841  1.00 20.90 ? 224  ASN C CB  1 
ATOM   6631  C  CG  . ASN C  1 223 ? 3.015   54.053  60.229  1.00 22.78 ? 224  ASN C CG  1 
ATOM   6632  O  OD1 . ASN C  1 223 ? 4.132   53.816  59.745  1.00 20.87 ? 224  ASN C OD1 1 
ATOM   6633  N  ND2 . ASN C  1 223 ? 2.783   55.075  61.083  1.00 20.29 ? 224  ASN C ND2 1 
ATOM   6634  N  N   . THR C  1 224 ? 0.007   51.532  57.948  1.00 19.17 ? 225  THR C N   1 
ATOM   6635  C  CA  . THR C  1 224 ? -1.060  50.569  57.719  1.00 20.43 ? 225  THR C CA  1 
ATOM   6636  C  C   . THR C  1 224 ? -0.681  49.501  56.673  1.00 23.59 ? 225  THR C C   1 
ATOM   6637  O  O   . THR C  1 224 ? -0.923  48.298  56.880  1.00 25.61 ? 225  THR C O   1 
ATOM   6638  C  CB  . THR C  1 224 ? -2.355  51.313  57.290  1.00 22.33 ? 225  THR C CB  1 
ATOM   6639  O  OG1 . THR C  1 224 ? -2.633  52.366  58.247  1.00 20.25 ? 225  THR C OG1 1 
ATOM   6640  C  CG2 . THR C  1 224 ? -3.541  50.352  57.171  1.00 18.41 ? 225  THR C CG2 1 
ATOM   6641  N  N   . VAL C  1 225 ? -0.053  49.924  55.572  1.00 22.64 ? 226  VAL C N   1 
ATOM   6642  C  CA  . VAL C  1 225 ? 0.325   48.985  54.507  1.00 19.08 ? 226  VAL C CA  1 
ATOM   6643  C  C   . VAL C  1 225 ? 1.380   48.013  54.997  1.00 19.79 ? 226  VAL C C   1 
ATOM   6644  O  O   . VAL C  1 225 ? 1.396   46.826  54.616  1.00 22.51 ? 226  VAL C O   1 
ATOM   6645  C  CB  . VAL C  1 225 ? 0.832   49.724  53.236  1.00 19.25 ? 226  VAL C CB  1 
ATOM   6646  C  CG1 . VAL C  1 225 ? 1.421   48.750  52.249  1.00 13.12 ? 226  VAL C CG1 1 
ATOM   6647  C  CG2 . VAL C  1 225 ? -0.328  50.537  52.583  1.00 18.84 ? 226  VAL C CG2 1 
ATOM   6648  N  N   . ILE C  1 226 ? 2.275   48.500  55.836  1.00 20.96 ? 227  ILE C N   1 
ATOM   6649  C  CA  . ILE C  1 226 ? 3.321   47.640  56.384  1.00 21.91 ? 227  ILE C CA  1 
ATOM   6650  C  C   . ILE C  1 226 ? 2.720   46.408  57.053  1.00 21.87 ? 227  ILE C C   1 
ATOM   6651  O  O   . ILE C  1 226 ? 3.262   45.334  56.937  1.00 23.54 ? 227  ILE C O   1 
ATOM   6652  C  CB  . ILE C  1 226 ? 4.287   48.429  57.311  1.00 22.48 ? 227  ILE C CB  1 
ATOM   6653  C  CG1 . ILE C  1 226 ? 5.264   49.223  56.435  1.00 22.86 ? 227  ILE C CG1 1 
ATOM   6654  C  CG2 . ILE C  1 226 ? 5.045   47.507  58.264  1.00 17.41 ? 227  ILE C CG2 1 
ATOM   6655  C  CD1 . ILE C  1 226 ? 5.880   50.419  57.086  1.00 24.17 ? 227  ILE C CD1 1 
ATOM   6656  N  N   . GLY C  1 227 ? 1.566   46.571  57.679  1.00 23.13 ? 228  GLY C N   1 
ATOM   6657  C  CA  . GLY C  1 227 ? 0.897   45.500  58.389  1.00 22.28 ? 228  GLY C CA  1 
ATOM   6658  C  C   . GLY C  1 227 ? 0.291   44.447  57.487  1.00 23.33 ? 228  GLY C C   1 
ATOM   6659  O  O   . GLY C  1 227 ? -0.144  43.416  57.976  1.00 21.49 ? 228  GLY C O   1 
ATOM   6660  N  N   . GLN C  1 228 ? 0.289   44.684  56.178  1.00 22.09 ? 229  GLN C N   1 
ATOM   6661  C  CA  . GLN C  1 228 ? -0.218  43.713  55.225  1.00 23.22 ? 229  GLN C CA  1 
ATOM   6662  C  C   . GLN C  1 228 ? 0.812   43.259  54.184  1.00 22.97 ? 229  GLN C C   1 
ATOM   6663  O  O   . GLN C  1 228 ? 0.469   42.569  53.216  1.00 23.41 ? 229  GLN C O   1 
ATOM   6664  C  CB  . GLN C  1 228 ? -1.484  44.280  54.578  1.00 24.23 ? 229  GLN C CB  1 
ATOM   6665  C  CG  . GLN C  1 228 ? -2.593  44.485  55.651  1.00 31.10 ? 229  GLN C CG  1 
ATOM   6666  C  CD  . GLN C  1 228 ? -3.946  44.823  55.072  1.00 38.31 ? 229  GLN C CD  1 
ATOM   6667  O  OE1 . GLN C  1 228 ? -4.402  44.203  54.104  1.00 37.94 ? 229  GLN C OE1 1 
ATOM   6668  N  NE2 . GLN C  1 228 ? -4.616  45.804  55.678  1.00 42.86 ? 229  GLN C NE2 1 
ATOM   6669  N  N   . MET C  1 229 ? 2.074   43.633  54.388  1.00 23.67 ? 230  MET C N   1 
ATOM   6670  C  CA  . MET C  1 229 ? 3.166   43.121  53.582  1.00 23.02 ? 230  MET C CA  1 
ATOM   6671  C  C   . MET C  1 229 ? 3.404   41.636  53.845  1.00 23.09 ? 230  MET C C   1 
ATOM   6672  O  O   . MET C  1 229 ? 3.407   41.175  54.990  1.00 22.73 ? 230  MET C O   1 
ATOM   6673  C  CB  . MET C  1 229 ? 4.467   43.871  53.875  1.00 23.17 ? 230  MET C CB  1 
ATOM   6674  C  CG  . MET C  1 229 ? 4.477   45.351  53.454  1.00 23.91 ? 230  MET C CG  1 
ATOM   6675  S  SD  . MET C  1 229 ? 4.225   45.667  51.710  1.00 24.22 ? 230  MET C SD  1 
ATOM   6676  C  CE  . MET C  1 229 ? 5.584   44.807  50.942  1.00 16.27 ? 230  MET C CE  1 
ATOM   6677  N  N   . LYS C  1 230 ? 3.659   40.885  52.778  1.00 23.30 ? 231  LYS C N   1 
ATOM   6678  C  CA  . LYS C  1 230 ? 4.057   39.491  52.929  1.00 23.41 ? 231  LYS C CA  1 
ATOM   6679  C  C   . LYS C  1 230 ? 5.435   39.416  53.572  1.00 22.95 ? 231  LYS C C   1 
ATOM   6680  O  O   . LYS C  1 230 ? 6.129   40.432  53.694  1.00 21.20 ? 231  LYS C O   1 
ATOM   6681  C  CB  . LYS C  1 230 ? 4.077   38.791  51.570  1.00 25.13 ? 231  LYS C CB  1 
ATOM   6682  C  CG  . LYS C  1 230 ? 2.708   38.651  50.893  1.00 28.56 ? 231  LYS C CG  1 
ATOM   6683  C  CD  . LYS C  1 230 ? 2.751   37.588  49.792  1.00 36.97 ? 231  LYS C CD  1 
ATOM   6684  C  CE  . LYS C  1 230 ? 1.684   37.826  48.718  1.00 43.56 ? 231  LYS C CE  1 
ATOM   6685  N  NZ  . LYS C  1 230 ? 1.871   36.944  47.498  1.00 43.22 ? 231  LYS C NZ  1 
ATOM   6686  N  N   . LYS C  1 231 ? 5.816   38.224  54.013  1.00 22.38 ? 232  LYS C N   1 
ATOM   6687  C  CA  . LYS C  1 231 ? 7.134   38.004  54.570  1.00 24.63 ? 232  LYS C CA  1 
ATOM   6688  C  C   . LYS C  1 231 ? 8.200   38.230  53.484  1.00 24.07 ? 232  LYS C C   1 
ATOM   6689  O  O   . LYS C  1 231 ? 8.061   37.754  52.374  1.00 26.08 ? 232  LYS C O   1 
ATOM   6690  C  CB  . LYS C  1 231 ? 7.234   36.579  55.145  1.00 26.06 ? 232  LYS C CB  1 
ATOM   6691  C  CG  . LYS C  1 231 ? 8.448   36.347  56.036  1.00 32.69 ? 232  LYS C CG  1 
ATOM   6692  C  CD  . LYS C  1 231 ? 8.317   35.035  56.827  1.00 39.64 ? 232  LYS C CD  1 
ATOM   6693  C  CE  . LYS C  1 231 ? 9.675   34.465  57.235  1.00 44.80 ? 232  LYS C CE  1 
ATOM   6694  N  NZ  . LYS C  1 231 ? 9.645   32.959  57.385  1.00 46.39 ? 232  LYS C NZ  1 
ATOM   6695  N  N   . PHE C  1 232 ? 9.269   38.944  53.825  1.00 22.62 ? 233  PHE C N   1 
ATOM   6696  C  CA  . PHE C  1 232 ? 10.291  39.397  52.851  1.00 21.64 ? 233  PHE C CA  1 
ATOM   6697  C  C   . PHE C  1 232 ? 9.743   40.381  51.818  1.00 20.93 ? 233  PHE C C   1 
ATOM   6698  O  O   . PHE C  1 232 ? 10.358  40.582  50.771  1.00 21.15 ? 233  PHE C O   1 
ATOM   6699  C  CB  . PHE C  1 232 ? 10.942  38.228  52.137  1.00 20.66 ? 233  PHE C CB  1 
ATOM   6700  C  CG  . PHE C  1 232 ? 11.338  37.101  53.058  1.00 24.31 ? 233  PHE C CG  1 
ATOM   6701  C  CD1 . PHE C  1 232 ? 12.271  37.301  54.033  1.00 21.86 ? 233  PHE C CD1 1 
ATOM   6702  C  CD2 . PHE C  1 232 ? 10.807  35.833  52.902  1.00 30.22 ? 233  PHE C CD2 1 
ATOM   6703  C  CE1 . PHE C  1 232 ? 12.646  36.280  54.866  1.00 23.75 ? 233  PHE C CE1 1 
ATOM   6704  C  CE2 . PHE C  1 232 ? 11.204  34.808  53.725  1.00 30.35 ? 233  PHE C CE2 1 
ATOM   6705  C  CZ  . PHE C  1 232 ? 12.128  35.047  54.709  1.00 26.74 ? 233  PHE C CZ  1 
ATOM   6706  N  N   . GLY C  1 233 ? 8.598   40.998  52.112  1.00 20.29 ? 234  GLY C N   1 
ATOM   6707  C  CA  . GLY C  1 233 ? 7.998   41.952  51.181  1.00 20.74 ? 234  GLY C CA  1 
ATOM   6708  C  C   . GLY C  1 233 ? 8.921   43.145  50.987  1.00 21.97 ? 234  GLY C C   1 
ATOM   6709  O  O   . GLY C  1 233 ? 9.712   43.484  51.872  1.00 23.13 ? 234  GLY C O   1 
ATOM   6710  N  N   . ARG C  1 234 ? 8.835   43.783  49.828  1.00 22.57 ? 235  ARG C N   1 
ATOM   6711  C  CA  . ARG C  1 234 ? 9.782   44.851  49.465  1.00 22.23 ? 235  ARG C CA  1 
ATOM   6712  C  C   . ARG C  1 234 ? 9.097   46.208  49.302  1.00 20.74 ? 235  ARG C C   1 
ATOM   6713  O  O   . ARG C  1 234 ? 8.085   46.332  48.622  1.00 20.58 ? 235  ARG C O   1 
ATOM   6714  C  CB  . ARG C  1 234 ? 10.516  44.478  48.181  1.00 22.24 ? 235  ARG C CB  1 
ATOM   6715  C  CG  . ARG C  1 234 ? 11.391  43.219  48.314  1.00 28.00 ? 235  ARG C CG  1 
ATOM   6716  C  CD  . ARG C  1 234 ? 11.435  42.502  46.981  1.00 37.86 ? 235  ARG C CD  1 
ATOM   6717  N  NE  . ARG C  1 234 ? 10.309  41.601  46.840  1.00 45.79 ? 235  ARG C NE  1 
ATOM   6718  C  CZ  . ARG C  1 234 ? 9.789   41.173  45.691  1.00 46.62 ? 235  ARG C CZ  1 
ATOM   6719  N  NH1 . ARG C  1 234 ? 10.250  41.577  44.517  1.00 44.13 ? 235  ARG C NH1 1 
ATOM   6720  N  NH2 . ARG C  1 234 ? 8.772   40.321  45.734  1.00 50.40 ? 235  ARG C NH2 1 
ATOM   6721  N  N   . ILE C  1 235 ? 9.658   47.222  49.949  1.00 20.41 ? 236  ILE C N   1 
ATOM   6722  C  CA  . ILE C  1 235 ? 9.134   48.573  49.830  1.00 19.49 ? 236  ILE C CA  1 
ATOM   6723  C  C   . ILE C  1 235 ? 10.142  49.424  49.097  1.00 19.22 ? 236  ILE C C   1 
ATOM   6724  O  O   . ILE C  1 235 ? 11.292  49.484  49.507  1.00 21.02 ? 236  ILE C O   1 
ATOM   6725  C  CB  . ILE C  1 235 ? 8.861   49.186  51.183  1.00 19.64 ? 236  ILE C CB  1 
ATOM   6726  C  CG1 . ILE C  1 235 ? 8.022   48.212  52.015  1.00 20.81 ? 236  ILE C CG1 1 
ATOM   6727  C  CG2 . ILE C  1 235 ? 8.153   50.562  51.018  1.00 18.00 ? 236  ILE C CG2 1 
ATOM   6728  C  CD1 . ILE C  1 235 ? 7.543   48.799  53.327  1.00 21.54 ? 236  ILE C CD1 1 
ATOM   6729  N  N   . ALA C  1 236 ? 9.702   50.055  48.007  1.00 17.39 ? 237  ALA C N   1 
ATOM   6730  C  CA  . ALA C  1 236 ? 10.475  51.078  47.334  1.00 19.05 ? 237  ALA C CA  1 
ATOM   6731  C  C   . ALA C  1 236 ? 10.062  52.391  47.927  1.00 17.22 ? 237  ALA C C   1 
ATOM   6732  O  O   . ALA C  1 236 ? 8.931   52.830  47.701  1.00 16.78 ? 237  ALA C O   1 
ATOM   6733  C  CB  . ALA C  1 236 ? 10.174  51.081  45.812  1.00 17.68 ? 237  ALA C CB  1 
ATOM   6734  N  N   . ILE C  1 237 ? 10.962  53.015  48.682  1.00 16.64 ? 238  ILE C N   1 
ATOM   6735  C  CA  . ILE C  1 237 ? 10.694  54.344  49.225  1.00 17.29 ? 238  ILE C CA  1 
ATOM   6736  C  C   . ILE C  1 237 ? 11.010  55.444  48.204  1.00 17.43 ? 238  ILE C C   1 
ATOM   6737  O  O   . ILE C  1 237 ? 12.128  55.912  48.099  1.00 19.86 ? 238  ILE C O   1 
ATOM   6738  C  CB  . ILE C  1 237 ? 11.447  54.597  50.535  1.00 17.88 ? 238  ILE C CB  1 
ATOM   6739  C  CG1 . ILE C  1 237 ? 11.063  53.547  51.587  1.00 20.11 ? 238  ILE C CG1 1 
ATOM   6740  C  CG2 . ILE C  1 237 ? 11.121  55.967  51.064  1.00 18.64 ? 238  ILE C CG2 1 
ATOM   6741  C  CD1 . ILE C  1 237 ? 12.024  53.479  52.839  1.00 19.98 ? 238  ILE C CD1 1 
ATOM   6742  N  N   . CYS C  1 238 ? 9.987   55.857  47.467  1.00 17.02 ? 239  CYS C N   1 
ATOM   6743  C  CA  . CYS C  1 238 ? 10.131  56.840  46.415  1.00 18.51 ? 239  CYS C CA  1 
ATOM   6744  C  C   . CYS C  1 238 ? 9.893   58.256  46.936  1.00 19.04 ? 239  CYS C C   1 
ATOM   6745  O  O   . CYS C  1 238 ? 10.675  59.173  46.667  1.00 18.07 ? 239  CYS C O   1 
ATOM   6746  C  CB  . CYS C  1 238 ? 9.153   56.503  45.283  1.00 17.88 ? 239  CYS C CB  1 
ATOM   6747  S  SG  . CYS C  1 238 ? 9.041   57.711  43.974  1.00 22.39 ? 239  CYS C SG  1 
ATOM   6748  N  N   . GLY C  1 239 ? 8.798   58.427  47.674  1.00 20.77 ? 240  GLY C N   1 
ATOM   6749  C  CA  . GLY C  1 239 ? 8.481   59.691  48.300  1.00 18.69 ? 240  GLY C CA  1 
ATOM   6750  C  C   . GLY C  1 239 ? 7.648   59.493  49.548  1.00 19.34 ? 240  GLY C C   1 
ATOM   6751  O  O   . GLY C  1 239 ? 7.291   58.362  49.891  1.00 17.69 ? 240  GLY C O   1 
ATOM   6752  N  N   . ALA C  1 240 ? 7.358   60.621  50.203  1.00 16.74 ? 241  ALA C N   1 
ATOM   6753  C  CA  . ALA C  1 240 ? 6.606   60.692  51.444  1.00 17.45 ? 241  ALA C CA  1 
ATOM   6754  C  C   . ALA C  1 240 ? 5.757   61.952  51.411  1.00 17.09 ? 241  ALA C C   1 
ATOM   6755  O  O   . ALA C  1 240 ? 5.890   62.798  52.288  1.00 18.42 ? 241  ALA C O   1 
ATOM   6756  C  CB  . ALA C  1 240 ? 7.565   60.778  52.636  1.00 16.14 ? 241  ALA C CB  1 
ATOM   6757  N  N   . ILE C  1 241 ? 4.923   62.096  50.383  1.00 19.74 ? 242  ILE C N   1 
ATOM   6758  C  CA  . ILE C  1 241 ? 4.194   63.362  50.171  1.00 18.87 ? 242  ILE C CA  1 
ATOM   6759  C  C   . ILE C  1 241 ? 3.271   63.757  51.363  1.00 19.27 ? 242  ILE C C   1 
ATOM   6760  O  O   . ILE C  1 241 ? 3.035   64.941  51.589  1.00 17.34 ? 242  ILE C O   1 
ATOM   6761  C  CB  . ILE C  1 241 ? 3.416   63.359  48.812  1.00 18.34 ? 242  ILE C CB  1 
ATOM   6762  C  CG1 . ILE C  1 241 ? 3.032   64.784  48.412  1.00 21.77 ? 242  ILE C CG1 1 
ATOM   6763  C  CG2 . ILE C  1 241 ? 2.184   62.442  48.849  1.00 14.52 ? 242  ILE C CG2 1 
ATOM   6764  C  CD1 . ILE C  1 241 ? 2.747   64.960  46.930  1.00 16.89 ? 242  ILE C CD1 1 
ATOM   6765  N  N   . SER C  1 242 ? 2.782   62.784  52.138  1.00 19.61 ? 243  SER C N   1 
ATOM   6766  C  CA  . SER C  1 242 ? 1.916   63.113  53.315  1.00 19.24 ? 243  SER C CA  1 
ATOM   6767  C  C   . SER C  1 242 ? 2.588   64.014  54.326  1.00 18.03 ? 243  SER C C   1 
ATOM   6768  O  O   . SER C  1 242 ? 1.911   64.655  55.117  1.00 15.74 ? 243  SER C O   1 
ATOM   6769  C  CB  . SER C  1 242 ? 1.452   61.853  54.034  1.00 20.08 ? 243  SER C CB  1 
ATOM   6770  O  OG  . SER C  1 242 ? 2.547   61.132  54.575  1.00 20.82 ? 243  SER C OG  1 
ATOM   6771  N  N   . THR C  1 243 ? 3.921   64.073  54.276  1.00 18.46 ? 244  THR C N   1 
ATOM   6772  C  CA  . THR C  1 243 ? 4.728   64.806  55.231  1.00 16.93 ? 244  THR C CA  1 
ATOM   6773  C  C   . THR C  1 243 ? 5.325   66.110  54.690  1.00 17.56 ? 244  THR C C   1 
ATOM   6774  O  O   . THR C  1 243 ? 5.862   66.909  55.460  1.00 18.23 ? 244  THR C O   1 
ATOM   6775  C  CB  . THR C  1 243 ? 5.934   63.936  55.692  1.00 20.06 ? 244  THR C CB  1 
ATOM   6776  O  OG1 . THR C  1 243 ? 6.906   63.823  54.625  1.00 20.76 ? 244  THR C OG1 1 
ATOM   6777  C  CG2 . THR C  1 243 ? 5.469   62.537  56.074  1.00 15.25 ? 244  THR C CG2 1 
ATOM   6778  N  N   . TYR C  1 244 ? 5.260   66.364  53.388  1.00 17.84 ? 245  TYR C N   1 
ATOM   6779  C  CA  . TYR C  1 244 ? 6.003   67.524  52.854  1.00 18.09 ? 245  TYR C CA  1 
ATOM   6780  C  C   . TYR C  1 244 ? 5.462   68.870  53.265  1.00 19.39 ? 245  TYR C C   1 
ATOM   6781  O  O   . TYR C  1 244 ? 6.201   69.854  53.300  1.00 17.38 ? 245  TYR C O   1 
ATOM   6782  C  CB  . TYR C  1 244 ? 6.005   67.499  51.322  1.00 22.07 ? 245  TYR C CB  1 
ATOM   6783  C  CG  . TYR C  1 244 ? 6.698   66.333  50.664  1.00 16.48 ? 245  TYR C CG  1 
ATOM   6784  C  CD1 . TYR C  1 244 ? 7.490   65.419  51.392  1.00 17.85 ? 245  TYR C CD1 1 
ATOM   6785  C  CD2 . TYR C  1 244 ? 6.597   66.175  49.284  1.00 15.25 ? 245  TYR C CD2 1 
ATOM   6786  C  CE1 . TYR C  1 244 ? 8.120   64.343  50.729  1.00 21.87 ? 245  TYR C CE1 1 
ATOM   6787  C  CE2 . TYR C  1 244 ? 7.189   65.135  48.632  1.00 16.83 ? 245  TYR C CE2 1 
ATOM   6788  C  CZ  . TYR C  1 244 ? 7.956   64.212  49.339  1.00 20.47 ? 245  TYR C CZ  1 
ATOM   6789  O  OH  . TYR C  1 244 ? 8.522   63.182  48.632  1.00 17.86 ? 245  TYR C OH  1 
ATOM   6790  N  N   . ASN C  1 245 ? 4.161   68.920  53.542  1.00 21.72 ? 246  ASN C N   1 
ATOM   6791  C  CA  . ASN C  1 245 ? 3.489   70.162  53.903  1.00 23.57 ? 246  ASN C CA  1 
ATOM   6792  C  C   . ASN C  1 245 ? 3.008   70.162  55.361  1.00 28.28 ? 246  ASN C C   1 
ATOM   6793  O  O   . ASN C  1 245 ? 2.014   70.817  55.678  1.00 27.28 ? 246  ASN C O   1 
ATOM   6794  C  CB  . ASN C  1 245 ? 2.276   70.360  52.988  1.00 21.32 ? 246  ASN C CB  1 
ATOM   6795  C  CG  . ASN C  1 245 ? 2.653   70.451  51.533  1.00 18.15 ? 246  ASN C CG  1 
ATOM   6796  O  OD1 . ASN C  1 245 ? 3.072   71.507  51.038  1.00 18.41 ? 246  ASN C OD1 1 
ATOM   6797  N  ND2 . ASN C  1 245 ? 2.499   69.352  50.830  1.00 18.81 ? 246  ASN C ND2 1 
ATOM   6798  N  N   . ARG C  1 246 ? 3.719   69.428  56.233  1.00 32.80 ? 247  ARG C N   1 
ATOM   6799  C  CA  . ARG C  1 246 ? 3.323   69.211  57.633  1.00 34.44 ? 247  ARG C CA  1 
ATOM   6800  C  C   . ARG C  1 246 ? 3.664   70.375  58.517  1.00 35.82 ? 247  ARG C C   1 
ATOM   6801  O  O   . ARG C  1 246 ? 4.698   71.042  58.331  1.00 38.69 ? 247  ARG C O   1 
ATOM   6802  C  CB  . ARG C  1 246 ? 4.011   67.977  58.217  1.00 39.20 ? 247  ARG C CB  1 
ATOM   6803  C  CG  . ARG C  1 246 ? 5.514   68.145  58.538  1.00 43.35 ? 247  ARG C CG  1 
ATOM   6804  C  CD  . ARG C  1 246 ? 6.060   66.883  59.178  1.00 49.10 ? 247  ARG C CD  1 
ATOM   6805  N  NE  . ARG C  1 246 ? 7.468   67.003  59.560  1.00 52.88 ? 247  ARG C NE  1 
ATOM   6806  C  CZ  . ARG C  1 246 ? 8.507   66.851  58.738  1.00 55.04 ? 247  ARG C CZ  1 
ATOM   6807  N  NH1 . ARG C  1 246 ? 8.331   66.590  57.440  1.00 49.40 ? 247  ARG C NH1 1 
ATOM   6808  N  NH2 . ARG C  1 246 ? 9.742   66.973  59.220  1.00 56.16 ? 247  ARG C NH2 1 
ATOM   6809  N  N   . THR C  1 247 ? 2.813   70.596  59.515  1.00 37.59 ? 248  THR C N   1 
ATOM   6810  C  CA  . THR C  1 247 ? 2.953   71.759  60.375  1.00 40.10 ? 248  THR C CA  1 
ATOM   6811  C  C   . THR C  1 247 ? 3.916   71.587  61.579  1.00 43.96 ? 248  THR C C   1 
ATOM   6812  O  O   . THR C  1 247 ? 4.439   72.601  62.078  1.00 46.72 ? 248  THR C O   1 
ATOM   6813  C  CB  . THR C  1 247 ? 1.529   72.374  60.751  1.00 36.95 ? 248  THR C CB  1 
ATOM   6814  O  OG1 . THR C  1 247 ? 0.477   71.392  60.749  1.00 21.36 ? 248  THR C OG1 1 
ATOM   6815  C  CG2 . THR C  1 247 ? 1.190   73.333  59.669  1.00 41.61 ? 248  THR C CG2 1 
ATOM   6816  N  N   . GLY C  1 248 ? 4.168   70.327  61.991  1.00 42.45 ? 249  GLY C N   1 
ATOM   6817  C  CA  . GLY C  1 248 ? 5.003   69.992  63.172  1.00 40.60 ? 249  GLY C CA  1 
ATOM   6818  C  C   . GLY C  1 248 ? 5.821   68.691  63.074  1.00 39.22 ? 249  GLY C C   1 
ATOM   6819  O  O   . GLY C  1 248 ? 6.472   68.451  62.058  1.00 40.68 ? 249  GLY C O   1 
ATOM   6820  N  N   . PRO C  1 249 ? 5.819   67.848  64.139  1.00 36.80 ? 250  PRO C N   1 
ATOM   6821  C  CA  . PRO C  1 249 ? 6.547   66.562  64.081  1.00 32.18 ? 250  PRO C CA  1 
ATOM   6822  C  C   . PRO C  1 249 ? 5.915   65.469  63.201  1.00 29.29 ? 250  PRO C C   1 
ATOM   6823  O  O   . PRO C  1 249 ? 4.692   65.436  62.986  1.00 27.13 ? 250  PRO C O   1 
ATOM   6824  C  CB  . PRO C  1 249 ? 6.616   66.089  65.544  1.00 32.70 ? 250  PRO C CB  1 
ATOM   6825  C  CG  . PRO C  1 249 ? 5.865   67.098  66.371  1.00 36.52 ? 250  PRO C CG  1 
ATOM   6826  C  CD  . PRO C  1 249 ? 5.249   68.127  65.478  1.00 37.47 ? 250  PRO C CD  1 
ATOM   6827  N  N   . LEU C  1 250 ? 6.760   64.562  62.706  1.00 26.01 ? 251  LEU C N   1 
ATOM   6828  C  CA  . LEU C  1 250 ? 6.293   63.480  61.833  1.00 24.77 ? 251  LEU C CA  1 
ATOM   6829  C  C   . LEU C  1 250 ? 5.259   62.599  62.544  1.00 22.50 ? 251  LEU C C   1 
ATOM   6830  O  O   . LEU C  1 250 ? 5.208   62.564  63.741  1.00 21.01 ? 251  LEU C O   1 
ATOM   6831  C  CB  . LEU C  1 250 ? 7.498   62.646  61.338  1.00 24.99 ? 251  LEU C CB  1 
ATOM   6832  C  CG  . LEU C  1 250 ? 8.510   63.390  60.431  1.00 25.13 ? 251  LEU C CG  1 
ATOM   6833  C  CD1 . LEU C  1 250 ? 9.864   62.728  60.466  1.00 27.17 ? 251  LEU C CD1 1 
ATOM   6834  C  CD2 . LEU C  1 250 ? 8.012   63.522  58.952  1.00 20.38 ? 251  LEU C CD2 1 
ATOM   6835  N  N   . PRO C  1 251 ? 4.428   61.870  61.800  1.00 24.24 ? 252  PRO C N   1 
ATOM   6836  C  CA  . PRO C  1 251 ? 3.639   60.827  62.453  1.00 24.64 ? 252  PRO C CA  1 
ATOM   6837  C  C   . PRO C  1 251 ? 4.489   59.672  63.018  1.00 25.85 ? 252  PRO C C   1 
ATOM   6838  O  O   . PRO C  1 251 ? 5.658   59.524  62.649  1.00 23.26 ? 252  PRO C O   1 
ATOM   6839  C  CB  . PRO C  1 251 ? 2.772   60.285  61.312  1.00 25.32 ? 252  PRO C CB  1 
ATOM   6840  C  CG  . PRO C  1 251 ? 3.552   60.609  60.085  1.00 24.91 ? 252  PRO C CG  1 
ATOM   6841  C  CD  . PRO C  1 251 ? 4.127   61.953  60.370  1.00 22.98 ? 252  PRO C CD  1 
ATOM   6842  N  N   . PRO C  1 252 ? 3.890   58.836  63.893  1.00 26.71 ? 253  PRO C N   1 
ATOM   6843  C  CA  . PRO C  1 252 ? 4.617   57.692  64.424  1.00 26.22 ? 253  PRO C CA  1 
ATOM   6844  C  C   . PRO C  1 252 ? 5.171   56.797  63.323  1.00 26.35 ? 253  PRO C C   1 
ATOM   6845  O  O   . PRO C  1 252 ? 4.539   56.625  62.273  1.00 26.36 ? 253  PRO C O   1 
ATOM   6846  C  CB  . PRO C  1 252 ? 3.563   56.925  65.237  1.00 27.12 ? 253  PRO C CB  1 
ATOM   6847  C  CG  . PRO C  1 252 ? 2.356   57.799  65.326  1.00 29.89 ? 253  PRO C CG  1 
ATOM   6848  C  CD  . PRO C  1 252 ? 2.625   59.083  64.610  1.00 27.99 ? 253  PRO C CD  1 
ATOM   6849  N  N   . GLY C  1 253 ? 6.344   56.222  63.567  1.00 26.50 ? 254  GLY C N   1 
ATOM   6850  C  CA  . GLY C  1 253 ? 6.930   55.291  62.624  1.00 25.98 ? 254  GLY C CA  1 
ATOM   6851  C  C   . GLY C  1 253 ? 6.127   53.994  62.587  1.00 25.82 ? 254  GLY C C   1 
ATOM   6852  O  O   . GLY C  1 253 ? 5.143   53.844  63.291  1.00 23.83 ? 254  GLY C O   1 
ATOM   6853  N  N   . PRO C  1 254 ? 6.555   53.041  61.761  1.00 27.40 ? 255  PRO C N   1 
ATOM   6854  C  CA  . PRO C  1 254 ? 5.847   51.761  61.644  1.00 29.02 ? 255  PRO C CA  1 
ATOM   6855  C  C   . PRO C  1 254 ? 6.071   50.857  62.859  1.00 27.22 ? 255  PRO C C   1 
ATOM   6856  O  O   . PRO C  1 254 ? 7.080   50.991  63.536  1.00 24.93 ? 255  PRO C O   1 
ATOM   6857  C  CB  . PRO C  1 254 ? 6.456   51.128  60.388  1.00 29.49 ? 255  PRO C CB  1 
ATOM   6858  C  CG  . PRO C  1 254 ? 7.543   52.036  59.924  1.00 29.95 ? 255  PRO C CG  1 
ATOM   6859  C  CD  . PRO C  1 254 ? 7.792   53.074  60.966  1.00 30.26 ? 255  PRO C CD  1 
ATOM   6860  N  N   . PRO C  1 255 ? 5.140   49.939  63.139  1.00 29.83 ? 256  PRO C N   1 
ATOM   6861  C  CA  . PRO C  1 255 ? 5.347   49.061  64.305  1.00 29.12 ? 256  PRO C CA  1 
ATOM   6862  C  C   . PRO C  1 255 ? 6.547   48.099  64.112  1.00 26.38 ? 256  PRO C C   1 
ATOM   6863  O  O   . PRO C  1 255 ? 6.511   47.239  63.230  1.00 25.54 ? 256  PRO C O   1 
ATOM   6864  C  CB  . PRO C  1 255 ? 4.030   48.295  64.421  1.00 29.87 ? 256  PRO C CB  1 
ATOM   6865  C  CG  . PRO C  1 255 ? 3.115   48.862  63.387  1.00 32.69 ? 256  PRO C CG  1 
ATOM   6866  C  CD  . PRO C  1 255 ? 3.966   49.524  62.355  1.00 31.73 ? 256  PRO C CD  1 
ATOM   6867  N  N   . PRO C  1 256 ? 7.607   48.260  64.926  1.00 25.47 ? 257  PRO C N   1 
ATOM   6868  C  CA  . PRO C  1 256 ? 8.849   47.489  64.726  1.00 24.83 ? 257  PRO C CA  1 
ATOM   6869  C  C   . PRO C  1 256 ? 8.664   45.974  64.736  1.00 25.55 ? 257  PRO C C   1 
ATOM   6870  O  O   . PRO C  1 256 ? 9.361   45.280  64.012  1.00 23.80 ? 257  PRO C O   1 
ATOM   6871  C  CB  . PRO C  1 256 ? 9.733   47.925  65.874  1.00 25.85 ? 257  PRO C CB  1 
ATOM   6872  C  CG  . PRO C  1 256 ? 9.173   49.224  66.347  1.00 28.95 ? 257  PRO C CG  1 
ATOM   6873  C  CD  . PRO C  1 256 ? 7.718   49.214  66.048  1.00 25.30 ? 257  PRO C CD  1 
ATOM   6874  N  N   . GLU C  1 257 ? 7.714   45.470  65.518  1.00 22.89 ? 258  GLU C N   1 
ATOM   6875  C  CA  . GLU C  1 257 ? 7.489   44.031  65.599  1.00 24.32 ? 258  GLU C CA  1 
ATOM   6876  C  C   . GLU C  1 257 ? 7.035   43.458  64.276  1.00 24.43 ? 258  GLU C C   1 
ATOM   6877  O  O   . GLU C  1 257 ? 7.349   42.316  63.956  1.00 23.83 ? 258  GLU C O   1 
ATOM   6878  C  CB  . GLU C  1 257 ? 6.448   43.700  66.686  1.00 26.42 ? 258  GLU C CB  1 
ATOM   6879  N  N   . ILE C  1 258 ? 6.269   44.245  63.516  1.00 23.91 ? 259  ILE C N   1 
ATOM   6880  C  CA  . ILE C  1 258 ? 5.758   43.812  62.220  1.00 21.46 ? 259  ILE C CA  1 
ATOM   6881  C  C   . ILE C  1 258 ? 6.847   43.862  61.169  1.00 20.07 ? 259  ILE C C   1 
ATOM   6882  O  O   . ILE C  1 258 ? 7.000   42.922  60.398  1.00 22.32 ? 259  ILE C O   1 
ATOM   6883  C  CB  . ILE C  1 258 ? 4.547   44.645  61.772  1.00 24.19 ? 259  ILE C CB  1 
ATOM   6884  C  CG1 . ILE C  1 258 ? 3.405   44.472  62.797  1.00 28.42 ? 259  ILE C CG1 1 
ATOM   6885  C  CG2 . ILE C  1 258 ? 4.083   44.219  60.376  1.00 20.32 ? 259  ILE C CG2 1 
ATOM   6886  C  CD1 . ILE C  1 258 ? 2.092   45.169  62.445  1.00 31.30 ? 259  ILE C CD1 1 
ATOM   6887  N  N   . VAL C  1 259 ? 7.610   44.945  61.144  1.00 19.01 ? 260  VAL C N   1 
ATOM   6888  C  CA  . VAL C  1 259 ? 8.727   45.078  60.215  1.00 18.03 ? 260  VAL C CA  1 
ATOM   6889  C  C   . VAL C  1 259 ? 9.738   43.945  60.453  1.00 18.44 ? 260  VAL C C   1 
ATOM   6890  O  O   . VAL C  1 259 ? 10.146  43.271  59.522  1.00 18.37 ? 260  VAL C O   1 
ATOM   6891  C  CB  . VAL C  1 259 ? 9.442   46.416  60.400  1.00 16.93 ? 260  VAL C CB  1 
ATOM   6892  C  CG1 . VAL C  1 259 ? 10.674  46.479  59.530  1.00 17.74 ? 260  VAL C CG1 1 
ATOM   6893  C  CG2 . VAL C  1 259 ? 8.485   47.588  60.091  1.00 17.93 ? 260  VAL C CG2 1 
ATOM   6894  N  N   . ILE C  1 260 ? 10.099  43.720  61.706  1.00 17.13 ? 261  ILE C N   1 
ATOM   6895  C  CA  . ILE C  1 260 ? 11.032  42.661  62.038  1.00 20.11 ? 261  ILE C CA  1 
ATOM   6896  C  C   . ILE C  1 260 ? 10.477  41.267  61.705  1.00 19.25 ? 261  ILE C C   1 
ATOM   6897  O  O   . ILE C  1 260 ? 11.074  40.556  60.941  1.00 19.43 ? 261  ILE C O   1 
ATOM   6898  C  CB  . ILE C  1 260 ? 11.501  42.726  63.491  1.00 18.64 ? 261  ILE C CB  1 
ATOM   6899  C  CG1 . ILE C  1 260 ? 12.255  44.036  63.750  1.00 19.39 ? 261  ILE C CG1 1 
ATOM   6900  C  CG2 . ILE C  1 260 ? 12.404  41.520  63.782  1.00 18.46 ? 261  ILE C CG2 1 
ATOM   6901  C  CD1 . ILE C  1 260 ? 12.492  44.363  65.274  1.00 13.07 ? 261  ILE C CD1 1 
ATOM   6902  N  N   . TYR C  1 261 ? 9.309   40.920  62.215  1.00 20.10 ? 262  TYR C N   1 
ATOM   6903  C  CA  . TYR C  1 261 ? 8.751   39.575  62.022  1.00 21.08 ? 262  TYR C CA  1 
ATOM   6904  C  C   . TYR C  1 261 ? 8.429   39.254  60.545  1.00 19.72 ? 262  TYR C C   1 
ATOM   6905  O  O   . TYR C  1 261 ? 8.549   38.114  60.121  1.00 20.84 ? 262  TYR C O   1 
ATOM   6906  C  CB  . TYR C  1 261 ? 7.521   39.386  62.925  1.00 22.41 ? 262  TYR C CB  1 
ATOM   6907  C  CG  . TYR C  1 261 ? 7.174   37.947  63.244  1.00 32.71 ? 262  TYR C CG  1 
ATOM   6908  N  N   . GLN C  1 262 ? 8.043   40.253  59.760  1.00 18.57 ? 263  GLN C N   1 
ATOM   6909  C  CA  . GLN C  1 262 ? 7.859   40.059  58.330  1.00 19.31 ? 263  GLN C CA  1 
ATOM   6910  C  C   . GLN C  1 262 ? 9.190   40.269  57.549  1.00 18.93 ? 263  GLN C C   1 
ATOM   6911  O  O   . GLN C  1 262 ? 9.248   40.073  56.340  1.00 18.74 ? 263  GLN C O   1 
ATOM   6912  C  CB  . GLN C  1 262 ? 6.745   40.981  57.797  1.00 20.90 ? 263  GLN C CB  1 
ATOM   6913  C  CG  . GLN C  1 262 ? 5.338   40.725  58.400  1.00 20.33 ? 263  GLN C CG  1 
ATOM   6914  C  CD  . GLN C  1 262 ? 4.832   39.328  58.123  1.00 25.68 ? 263  GLN C CD  1 
ATOM   6915  O  OE1 . GLN C  1 262 ? 4.838   38.484  58.999  1.00 28.50 ? 263  GLN C OE1 1 
ATOM   6916  N  NE2 . GLN C  1 262 ? 4.426   39.068  56.893  1.00 25.52 ? 263  GLN C NE2 1 
ATOM   6917  N  N   . GLU C  1 263 ? 10.239  40.677  58.244  1.00 18.17 ? 264  GLU C N   1 
ATOM   6918  C  CA  . GLU C  1 263 ? 11.580  40.760  57.667  1.00 20.11 ? 264  GLU C CA  1 
ATOM   6919  C  C   . GLU C  1 263 ? 11.531  41.601  56.405  1.00 19.07 ? 264  GLU C C   1 
ATOM   6920  O  O   . GLU C  1 263 ? 11.900  41.154  55.323  1.00 19.11 ? 264  GLU C O   1 
ATOM   6921  C  CB  . GLU C  1 263 ? 12.126  39.347  57.371  1.00 20.02 ? 264  GLU C CB  1 
ATOM   6922  C  CG  . GLU C  1 263 ? 12.059  38.418  58.578  1.00 18.86 ? 264  GLU C CG  1 
ATOM   6923  C  CD  . GLU C  1 263 ? 12.856  37.125  58.403  1.00 21.87 ? 264  GLU C CD  1 
ATOM   6924  O  OE1 . GLU C  1 263 ? 14.085  37.171  58.177  1.00 23.16 ? 264  GLU C OE1 1 
ATOM   6925  O  OE2 . GLU C  1 263 ? 12.272  36.050  58.546  1.00 21.56 ? 264  GLU C OE2 1 
ATOM   6926  N  N   . LEU C  1 264 ? 11.021  42.807  56.532  1.00 17.53 ? 265  LEU C N   1 
ATOM   6927  C  CA  . LEU C  1 264 ? 10.819  43.608  55.344  1.00 19.09 ? 265  LEU C CA  1 
ATOM   6928  C  C   . LEU C  1 264 ? 12.122  44.187  54.843  1.00 20.31 ? 265  LEU C C   1 
ATOM   6929  O  O   . LEU C  1 264 ? 13.044  44.449  55.634  1.00 20.63 ? 265  LEU C O   1 
ATOM   6930  C  CB  . LEU C  1 264 ? 9.844   44.734  55.622  1.00 18.63 ? 265  LEU C CB  1 
ATOM   6931  C  CG  . LEU C  1 264 ? 8.469   44.244  56.050  1.00 19.38 ? 265  LEU C CG  1 
ATOM   6932  C  CD1 . LEU C  1 264 ? 7.564   45.426  56.169  1.00 17.97 ? 265  LEU C CD1 1 
ATOM   6933  C  CD2 . LEU C  1 264 ? 7.936   43.220  55.075  1.00 17.64 ? 265  LEU C CD2 1 
ATOM   6934  N  N   . ARG C  1 265 ? 12.181  44.401  53.528  1.00 20.43 ? 266  ARG C N   1 
ATOM   6935  C  CA  . ARG C  1 265 ? 13.232  45.184  52.915  1.00 22.72 ? 266  ARG C CA  1 
ATOM   6936  C  C   . ARG C  1 265 ? 12.644  46.510  52.437  1.00 23.95 ? 266  ARG C C   1 
ATOM   6937  O  O   . ARG C  1 265 ? 11.660  46.558  51.689  1.00 21.98 ? 266  ARG C O   1 
ATOM   6938  C  CB  . ARG C  1 265 ? 13.903  44.443  51.741  1.00 25.46 ? 266  ARG C CB  1 
ATOM   6939  C  CG  . ARG C  1 265 ? 14.995  45.309  51.051  1.00 33.24 ? 266  ARG C CG  1 
ATOM   6940  C  CD  . ARG C  1 265 ? 15.899  44.503  50.145  1.00 41.32 ? 266  ARG C CD  1 
ATOM   6941  N  NE  . ARG C  1 265 ? 15.323  44.285  48.835  1.00 47.29 ? 266  ARG C NE  1 
ATOM   6942  C  CZ  . ARG C  1 265 ? 15.297  45.186  47.853  1.00 53.89 ? 266  ARG C CZ  1 
ATOM   6943  N  NH1 . ARG C  1 265 ? 15.824  46.400  48.012  1.00 52.60 ? 266  ARG C NH1 1 
ATOM   6944  N  NH2 . ARG C  1 265 ? 14.742  44.850  46.688  1.00 51.47 ? 266  ARG C NH2 1 
ATOM   6945  N  N   . MET C  1 266 ? 13.279  47.585  52.876  1.00 24.14 ? 267  MET C N   1 
ATOM   6946  C  CA  . MET C  1 266 ? 12.808  48.928  52.599  1.00 25.17 ? 267  MET C CA  1 
ATOM   6947  C  C   . MET C  1 266 ? 13.997  49.700  52.055  1.00 25.40 ? 267  MET C C   1 
ATOM   6948  O  O   . MET C  1 266 ? 15.020  49.862  52.749  1.00 27.69 ? 267  MET C O   1 
ATOM   6949  C  CB  . MET C  1 266 ? 12.272  49.562  53.886  1.00 24.99 ? 267  MET C CB  1 
ATOM   6950  C  CG  . MET C  1 266 ? 11.150  48.767  54.535  1.00 29.51 ? 267  MET C CG  1 
ATOM   6951  S  SD  . MET C  1 266 ? 10.710  49.474  56.140  1.00 36.24 ? 267  MET C SD  1 
ATOM   6952  C  CE  . MET C  1 266 ? 8.968   49.167  56.143  1.00 41.04 ? 267  MET C CE  1 
ATOM   6953  N  N   . GLU C  1 267 ? 13.894  50.121  50.795  1.00 24.11 ? 268  GLU C N   1 
ATOM   6954  C  CA  . GLU C  1 267 ? 14.995  50.815  50.143  1.00 19.97 ? 268  GLU C CA  1 
ATOM   6955  C  C   . GLU C  1 267 ? 14.521  52.087  49.475  1.00 18.02 ? 268  GLU C C   1 
ATOM   6956  O  O   . GLU C  1 267 ? 13.596  52.072  48.670  1.00 18.01 ? 268  GLU C O   1 
ATOM   6957  C  CB  . GLU C  1 267 ? 15.687  49.881  49.148  1.00 21.08 ? 268  GLU C CB  1 
ATOM   6958  C  CG  . GLU C  1 267 ? 16.861  50.482  48.417  1.00 22.80 ? 268  GLU C CG  1 
ATOM   6959  C  CD  . GLU C  1 267 ? 17.634  49.450  47.583  1.00 30.95 ? 268  GLU C CD  1 
ATOM   6960  O  OE1 . GLU C  1 267 ? 17.263  48.250  47.580  1.00 34.42 ? 268  GLU C OE1 1 
ATOM   6961  O  OE2 . GLU C  1 267 ? 18.612  49.851  46.922  1.00 31.11 ? 268  GLU C OE2 1 
ATOM   6962  N  N   . ALA C  1 268 ? 15.175  53.199  49.819  1.00 17.46 ? 269  ALA C N   1 
ATOM   6963  C  CA  . ALA C  1 268 ? 14.935  54.465  49.157  1.00 18.13 ? 269  ALA C CA  1 
ATOM   6964  C  C   . ALA C  1 268 ? 15.830  54.635  47.924  1.00 17.96 ? 269  ALA C C   1 
ATOM   6965  O  O   . ALA C  1 268 ? 16.833  53.962  47.786  1.00 21.65 ? 269  ALA C O   1 
ATOM   6966  C  CB  . ALA C  1 268 ? 15.161  55.602  50.133  1.00 19.34 ? 269  ALA C CB  1 
ATOM   6967  N  N   . PHE C  1 269 ? 15.442  55.527  47.020  1.00 19.06 ? 270  PHE C N   1 
ATOM   6968  C  CA  . PHE C  1 269 ? 16.208  55.793  45.793  1.00 20.42 ? 270  PHE C CA  1 
ATOM   6969  C  C   . PHE C  1 269 ? 15.901  57.169  45.266  1.00 20.05 ? 270  PHE C C   1 
ATOM   6970  O  O   . PHE C  1 269 ? 14.835  57.724  45.550  1.00 19.68 ? 270  PHE C O   1 
ATOM   6971  C  CB  . PHE C  1 269 ? 15.876  54.771  44.710  1.00 19.64 ? 270  PHE C CB  1 
ATOM   6972  C  CG  . PHE C  1 269 ? 14.465  54.841  44.241  1.00 20.04 ? 270  PHE C CG  1 
ATOM   6973  C  CD1 . PHE C  1 269 ? 13.440  54.301  44.997  1.00 20.89 ? 270  PHE C CD1 1 
ATOM   6974  C  CD2 . PHE C  1 269 ? 14.141  55.456  43.048  1.00 20.19 ? 270  PHE C CD2 1 
ATOM   6975  C  CE1 . PHE C  1 269 ? 12.120  54.383  44.556  1.00 17.58 ? 270  PHE C CE1 1 
ATOM   6976  C  CE2 . PHE C  1 269 ? 12.818  55.534  42.626  1.00 17.42 ? 270  PHE C CE2 1 
ATOM   6977  C  CZ  . PHE C  1 269 ? 11.832  55.002  43.386  1.00 17.59 ? 270  PHE C CZ  1 
ATOM   6978  N  N   . VAL C  1 270 ? 16.848  57.711  44.509  1.00 20.02 ? 271  VAL C N   1 
ATOM   6979  C  CA  . VAL C  1 270 ? 16.679  58.968  43.787  1.00 20.23 ? 271  VAL C CA  1 
ATOM   6980  C  C   . VAL C  1 270 ? 16.861  58.651  42.300  1.00 20.20 ? 271  VAL C C   1 
ATOM   6981  O  O   . VAL C  1 270 ? 17.793  57.955  41.945  1.00 20.50 ? 271  VAL C O   1 
ATOM   6982  C  CB  . VAL C  1 270 ? 17.697  60.024  44.258  1.00 22.11 ? 271  VAL C CB  1 
ATOM   6983  C  CG1 . VAL C  1 270 ? 17.660  61.235  43.337  1.00 18.85 ? 271  VAL C CG1 1 
ATOM   6984  C  CG2 . VAL C  1 270 ? 17.377  60.422  45.684  1.00 20.09 ? 271  VAL C CG2 1 
ATOM   6985  N  N   . VAL C  1 271 ? 15.944  59.115  41.447  1.00 20.68 ? 272  VAL C N   1 
ATOM   6986  C  CA  . VAL C  1 271 ? 15.899  58.719  40.030  1.00 19.15 ? 272  VAL C CA  1 
ATOM   6987  C  C   . VAL C  1 271 ? 17.242  59.033  39.312  1.00 20.18 ? 272  VAL C C   1 
ATOM   6988  O  O   . VAL C  1 271 ? 17.728  58.238  38.508  1.00 15.84 ? 272  VAL C O   1 
ATOM   6989  C  CB  . VAL C  1 271 ? 14.689  59.382  39.331  1.00 21.14 ? 272  VAL C CB  1 
ATOM   6990  C  CG1 . VAL C  1 271 ? 14.745  60.936  39.512  1.00 18.07 ? 272  VAL C CG1 1 
ATOM   6991  C  CG2 . VAL C  1 271 ? 14.588  58.978  37.879  1.00 20.85 ? 272  VAL C CG2 1 
ATOM   6992  N  N   . TYR C  1 272 ? 17.869  60.148  39.685  1.00 20.69 ? 273  TYR C N   1 
ATOM   6993  C  CA  . TYR C  1 272 ? 19.129  60.585  39.068  1.00 23.97 ? 273  TYR C CA  1 
ATOM   6994  C  C   . TYR C  1 272 ? 20.352  59.651  39.283  1.00 23.33 ? 273  TYR C C   1 
ATOM   6995  O  O   . TYR C  1 272 ? 21.409  59.855  38.668  1.00 26.19 ? 273  TYR C O   1 
ATOM   6996  C  CB  . TYR C  1 272 ? 19.475  62.015  39.528  1.00 24.34 ? 273  TYR C CB  1 
ATOM   6997  C  CG  . TYR C  1 272 ? 18.305  62.981  39.397  1.00 26.03 ? 273  TYR C CG  1 
ATOM   6998  C  CD1 . TYR C  1 272 ? 17.720  63.217  38.163  1.00 26.10 ? 273  TYR C CD1 1 
ATOM   6999  C  CD2 . TYR C  1 272 ? 17.781  63.637  40.510  1.00 22.70 ? 273  TYR C CD2 1 
ATOM   7000  C  CE1 . TYR C  1 272 ? 16.648  64.077  38.030  1.00 28.11 ? 273  TYR C CE1 1 
ATOM   7001  C  CE2 . TYR C  1 272 ? 16.699  64.502  40.389  1.00 24.90 ? 273  TYR C CE2 1 
ATOM   7002  C  CZ  . TYR C  1 272 ? 16.136  64.706  39.149  1.00 26.76 ? 273  TYR C CZ  1 
ATOM   7003  O  OH  . TYR C  1 272 ? 15.086  65.564  39.002  1.00 26.08 ? 273  TYR C OH  1 
ATOM   7004  N  N   . ARG C  1 273 ? 20.217  58.658  40.146  1.00 21.59 ? 274  ARG C N   1 
ATOM   7005  C  CA  . ARG C  1 273 ? 21.224  57.598  40.273  1.00 23.37 ? 274  ARG C CA  1 
ATOM   7006  C  C   . ARG C  1 273 ? 21.566  56.943  38.916  1.00 25.21 ? 274  ARG C C   1 
ATOM   7007  O  O   . ARG C  1 273 ? 22.734  56.673  38.612  1.00 23.33 ? 274  ARG C O   1 
ATOM   7008  C  CB  . ARG C  1 273 ? 20.704  56.503  41.210  1.00 23.07 ? 274  ARG C CB  1 
ATOM   7009  C  CG  . ARG C  1 273 ? 21.805  55.583  41.723  1.00 25.58 ? 274  ARG C CG  1 
ATOM   7010  C  CD  . ARG C  1 273 ? 21.282  54.226  42.139  1.00 25.81 ? 274  ARG C CD  1 
ATOM   7011  N  NE  . ARG C  1 273 ? 20.506  54.315  43.370  1.00 25.64 ? 274  ARG C NE  1 
ATOM   7012  C  CZ  . ARG C  1 273 ? 20.039  53.273  44.041  1.00 24.69 ? 274  ARG C CZ  1 
ATOM   7013  N  NH1 . ARG C  1 273 ? 20.258  52.038  43.601  1.00 22.55 ? 274  ARG C NH1 1 
ATOM   7014  N  NH2 . ARG C  1 273 ? 19.347  53.474  45.166  1.00 29.10 ? 274  ARG C NH2 1 
ATOM   7015  N  N   . TRP C  1 274 ? 20.528  56.687  38.123  1.00 24.02 ? 275  TRP C N   1 
ATOM   7016  C  CA  . TRP C  1 274 ? 20.667  55.997  36.855  1.00 25.53 ? 275  TRP C CA  1 
ATOM   7017  C  C   . TRP C  1 274 ? 20.908  56.987  35.716  1.00 25.42 ? 275  TRP C C   1 
ATOM   7018  O  O   . TRP C  1 274 ? 20.049  57.797  35.393  1.00 26.84 ? 275  TRP C O   1 
ATOM   7019  C  CB  . TRP C  1 274 ? 19.418  55.164  36.580  1.00 26.00 ? 275  TRP C CB  1 
ATOM   7020  C  CG  . TRP C  1 274 ? 19.267  54.032  37.533  1.00 23.12 ? 275  TRP C CG  1 
ATOM   7021  C  CD1 . TRP C  1 274 ? 19.804  52.777  37.415  1.00 23.14 ? 275  TRP C CD1 1 
ATOM   7022  C  CD2 . TRP C  1 274 ? 18.557  54.049  38.758  1.00 18.15 ? 275  TRP C CD2 1 
ATOM   7023  N  NE1 . TRP C  1 274 ? 19.447  52.013  38.471  1.00 24.19 ? 275  TRP C NE1 1 
ATOM   7024  C  CE2 . TRP C  1 274 ? 18.682  52.765  39.324  1.00 23.51 ? 275  TRP C CE2 1 
ATOM   7025  C  CE3 . TRP C  1 274 ? 17.797  55.015  39.426  1.00 23.27 ? 275  TRP C CE3 1 
ATOM   7026  C  CZ2 . TRP C  1 274 ? 18.113  52.431  40.553  1.00 23.27 ? 275  TRP C CZ2 1 
ATOM   7027  C  CZ3 . TRP C  1 274 ? 17.222  54.683  40.653  1.00 27.57 ? 275  TRP C CZ3 1 
ATOM   7028  C  CH2 . TRP C  1 274 ? 17.373  53.400  41.196  1.00 23.96 ? 275  TRP C CH2 1 
ATOM   7029  N  N   . GLN C  1 275 ? 22.094  56.877  35.131  1.00 26.82 ? 276  GLN C N   1 
ATOM   7030  C  CA  . GLN C  1 275 ? 22.598  57.737  34.065  1.00 27.78 ? 276  GLN C CA  1 
ATOM   7031  C  C   . GLN C  1 275 ? 23.144  56.828  32.965  1.00 28.36 ? 276  GLN C C   1 
ATOM   7032  O  O   . GLN C  1 275 ? 23.000  55.605  33.051  1.00 28.68 ? 276  GLN C O   1 
ATOM   7033  C  CB  . GLN C  1 275 ? 23.759  58.573  34.586  1.00 29.64 ? 276  GLN C CB  1 
ATOM   7034  C  CG  . GLN C  1 275 ? 23.434  59.515  35.717  1.00 31.58 ? 276  GLN C CG  1 
ATOM   7035  C  CD  . GLN C  1 275 ? 22.483  60.618  35.310  1.00 36.88 ? 276  GLN C CD  1 
ATOM   7036  O  OE1 . GLN C  1 275 ? 22.465  61.053  34.156  1.00 37.40 ? 276  GLN C OE1 1 
ATOM   7037  N  NE2 . GLN C  1 275 ? 21.686  61.087  36.270  1.00 37.48 ? 276  GLN C NE2 1 
ATOM   7038  N  N   . GLY C  1 276 ? 23.776  57.427  31.947  1.00 29.47 ? 277  GLY C N   1 
ATOM   7039  C  CA  . GLY C  1 276 ? 24.411  56.688  30.865  1.00 28.94 ? 277  GLY C CA  1 
ATOM   7040  C  C   . GLY C  1 276 ? 23.413  55.869  30.057  1.00 30.19 ? 277  GLY C C   1 
ATOM   7041  O  O   . GLY C  1 276 ? 22.263  56.297  29.844  1.00 29.53 ? 277  GLY C O   1 
ATOM   7042  N  N   . ASP C  1 277 ? 23.872  54.703  29.594  1.00 29.53 ? 278  ASP C N   1 
ATOM   7043  C  CA  . ASP C  1 277 ? 23.062  53.784  28.804  1.00 30.60 ? 278  ASP C CA  1 
ATOM   7044  C  C   . ASP C  1 277 ? 21.852  53.245  29.559  1.00 27.96 ? 278  ASP C C   1 
ATOM   7045  O  O   . ASP C  1 277 ? 20.785  53.044  28.981  1.00 28.05 ? 278  ASP C O   1 
ATOM   7046  C  CB  . ASP C  1 277 ? 23.919  52.602  28.288  1.00 32.34 ? 278  ASP C CB  1 
ATOM   7047  C  CG  . ASP C  1 277 ? 23.292  51.899  27.059  1.00 38.41 ? 278  ASP C CG  1 
ATOM   7048  O  OD1 . ASP C  1 277 ? 22.735  52.602  26.168  1.00 37.10 ? 278  ASP C OD1 1 
ATOM   7049  O  OD2 . ASP C  1 277 ? 23.358  50.643  26.998  1.00 45.11 ? 278  ASP C OD2 1 
ATOM   7050  N  N   . ALA C  1 278 ? 22.012  53.013  30.852  1.00 27.30 ? 279  ALA C N   1 
ATOM   7051  C  CA  . ALA C  1 278 ? 20.922  52.484  31.658  1.00 25.89 ? 279  ALA C CA  1 
ATOM   7052  C  C   . ALA C  1 278 ? 19.746  53.470  31.597  1.00 24.97 ? 279  ALA C C   1 
ATOM   7053  O  O   . ALA C  1 278 ? 18.594  53.082  31.370  1.00 25.19 ? 279  ALA C O   1 
ATOM   7054  C  CB  . ALA C  1 278 ? 21.404  52.206  33.105  1.00 25.67 ? 279  ALA C CB  1 
ATOM   7055  N  N   . ARG C  1 279 ? 20.047  54.757  31.691  1.00 22.79 ? 280  ARG C N   1 
ATOM   7056  C  CA  . ARG C  1 279 ? 18.988  55.764  31.570  1.00 24.28 ? 280  ARG C CA  1 
ATOM   7057  C  C   . ARG C  1 279 ? 18.381  55.830  30.164  1.00 24.88 ? 280  ARG C C   1 
ATOM   7058  O  O   . ARG C  1 279 ? 17.137  55.838  29.971  1.00 19.93 ? 280  ARG C O   1 
ATOM   7059  C  CB  . ARG C  1 279 ? 19.552  57.122  31.965  1.00 25.10 ? 280  ARG C CB  1 
ATOM   7060  C  CG  . ARG C  1 279 ? 18.537  58.238  31.963  1.00 22.72 ? 280  ARG C CG  1 
ATOM   7061  C  CD  . ARG C  1 279 ? 19.181  59.494  32.481  1.00 24.46 ? 280  ARG C CD  1 
ATOM   7062  N  NE  . ARG C  1 279 ? 18.273  60.633  32.377  1.00 27.30 ? 280  ARG C NE  1 
ATOM   7063  C  CZ  . ARG C  1 279 ? 18.115  61.404  31.295  1.00 33.08 ? 280  ARG C CZ  1 
ATOM   7064  N  NH1 . ARG C  1 279 ? 18.808  61.190  30.166  1.00 30.31 ? 280  ARG C NH1 1 
ATOM   7065  N  NH2 . ARG C  1 279 ? 17.256  62.420  31.351  1.00 32.79 ? 280  ARG C NH2 1 
ATOM   7066  N  N   . GLN C  1 280 ? 19.273  55.871  29.180  1.00 24.98 ? 281  GLN C N   1 
ATOM   7067  C  CA  . GLN C  1 280 ? 18.874  55.974  27.792  1.00 27.56 ? 281  GLN C CA  1 
ATOM   7068  C  C   . GLN C  1 280 ? 17.999  54.782  27.415  1.00 26.79 ? 281  GLN C C   1 
ATOM   7069  O  O   . GLN C  1 280 ? 16.961  54.940  26.794  1.00 27.54 ? 281  GLN C O   1 
ATOM   7070  C  CB  . GLN C  1 280 ? 20.113  56.042  26.896  1.00 29.33 ? 281  GLN C CB  1 
ATOM   7071  C  CG  . GLN C  1 280 ? 19.797  56.450  25.482  1.00 37.86 ? 281  GLN C CG  1 
ATOM   7072  C  CD  . GLN C  1 280 ? 19.812  57.945  25.255  1.00 42.33 ? 281  GLN C CD  1 
ATOM   7073  O  OE1 . GLN C  1 280 ? 19.733  58.737  26.197  1.00 43.14 ? 281  GLN C OE1 1 
ATOM   7074  N  NE2 . GLN C  1 280 ? 19.938  58.341  23.982  1.00 41.80 ? 281  GLN C NE2 1 
ATOM   7075  N  N   . LYS C  1 281 ? 18.423  53.597  27.826  1.00 27.01 ? 282  LYS C N   1 
ATOM   7076  C  CA  . LYS C  1 281 ? 17.675  52.368  27.583  1.00 27.83 ? 282  LYS C CA  1 
ATOM   7077  C  C   . LYS C  1 281 ? 16.267  52.419  28.218  1.00 26.20 ? 282  LYS C C   1 
ATOM   7078  O  O   . LYS C  1 281 ? 15.279  52.048  27.581  1.00 25.68 ? 282  LYS C O   1 
ATOM   7079  C  CB  . LYS C  1 281 ? 18.482  51.179  28.127  1.00 28.09 ? 282  LYS C CB  1 
ATOM   7080  C  CG  . LYS C  1 281 ? 17.840  49.820  27.954  1.00 36.43 ? 282  LYS C CG  1 
ATOM   7081  C  CD  . LYS C  1 281 ? 18.515  48.769  28.834  1.00 47.27 ? 282  LYS C CD  1 
ATOM   7082  C  CE  . LYS C  1 281 ? 19.634  48.028  28.121  1.00 57.56 ? 282  LYS C CE  1 
ATOM   7083  N  NZ  . LYS C  1 281 ? 20.128  46.845  28.919  1.00 58.92 ? 282  LYS C NZ  1 
ATOM   7084  N  N   . ALA C  1 282 ? 16.191  52.874  29.472  1.00 24.32 ? 283  ALA C N   1 
ATOM   7085  C  CA  . ALA C  1 282 ? 14.902  53.058  30.160  1.00 23.42 ? 283  ALA C CA  1 
ATOM   7086  C  C   . ALA C  1 282 ? 13.972  54.041  29.435  1.00 21.87 ? 283  ALA C C   1 
ATOM   7087  O  O   . ALA C  1 282 ? 12.761  53.801  29.298  1.00 21.90 ? 283  ALA C O   1 
ATOM   7088  C  CB  . ALA C  1 282 ? 15.146  53.504  31.577  1.00 22.16 ? 283  ALA C CB  1 
ATOM   7089  N  N   . LEU C  1 283 ? 14.527  55.149  28.953  1.00 22.71 ? 284  LEU C N   1 
ATOM   7090  C  CA  . LEU C  1 283 ? 13.718  56.123  28.194  1.00 24.13 ? 284  LEU C CA  1 
ATOM   7091  C  C   . LEU C  1 283 ? 13.183  55.504  26.893  1.00 25.18 ? 284  LEU C C   1 
ATOM   7092  O  O   . LEU C  1 283 ? 12.026  55.704  26.535  1.00 24.13 ? 284  LEU C O   1 
ATOM   7093  C  CB  . LEU C  1 283 ? 14.506  57.381  27.881  1.00 23.83 ? 284  LEU C CB  1 
ATOM   7094  C  CG  . LEU C  1 283 ? 14.802  58.371  29.010  1.00 22.64 ? 284  LEU C CG  1 
ATOM   7095  C  CD1 . LEU C  1 283 ? 15.723  59.447  28.478  1.00 17.85 ? 284  LEU C CD1 1 
ATOM   7096  C  CD2 . LEU C  1 283 ? 13.537  59.010  29.559  1.00 21.44 ? 284  LEU C CD2 1 
ATOM   7097  N  N   . LYS C  1 284 ? 14.024  54.744  26.197  1.00 25.29 ? 285  LYS C N   1 
ATOM   7098  C  CA  . LYS C  1 284 ? 13.553  54.012  25.010  1.00 26.88 ? 285  LYS C CA  1 
ATOM   7099  C  C   . LYS C  1 284 ? 12.540  52.922  25.391  1.00 26.21 ? 285  LYS C C   1 
ATOM   7100  O  O   . LYS C  1 284 ? 11.565  52.718  24.664  1.00 27.83 ? 285  LYS C O   1 
ATOM   7101  C  CB  . LYS C  1 284 ? 14.728  53.403  24.221  1.00 25.61 ? 285  LYS C CB  1 
ATOM   7102  C  CG  . LYS C  1 284 ? 15.599  54.450  23.597  1.00 28.71 ? 285  LYS C CG  1 
ATOM   7103  C  CD  . LYS C  1 284 ? 16.815  53.881  22.916  1.00 36.32 ? 285  LYS C CD  1 
ATOM   7104  C  CE  . LYS C  1 284 ? 17.776  54.987  22.565  1.00 40.53 ? 285  LYS C CE  1 
ATOM   7105  N  NZ  . LYS C  1 284 ? 19.081  54.457  22.126  1.00 44.95 ? 285  LYS C NZ  1 
ATOM   7106  N  N   . ASP C  1 285 ? 12.736  52.245  26.530  1.00 24.34 ? 286  ASP C N   1 
ATOM   7107  C  CA  . ASP C  1 285 ? 11.728  51.273  26.976  1.00 25.94 ? 286  ASP C CA  1 
ATOM   7108  C  C   . ASP C  1 285 ? 10.355  51.931  27.175  1.00 25.03 ? 286  ASP C C   1 
ATOM   7109  O  O   . ASP C  1 285 ? 9.339   51.402  26.719  1.00 25.97 ? 286  ASP C O   1 
ATOM   7110  C  CB  . ASP C  1 285 ? 12.158  50.508  28.240  1.00 25.77 ? 286  ASP C CB  1 
ATOM   7111  C  CG  . ASP C  1 285 ? 13.331  49.527  27.987  1.00 28.60 ? 286  ASP C CG  1 
ATOM   7112  O  OD1 . ASP C  1 285 ? 13.793  49.384  26.838  1.00 27.53 ? 286  ASP C OD1 1 
ATOM   7113  O  OD2 . ASP C  1 285 ? 13.813  48.908  28.963  1.00 30.43 ? 286  ASP C OD2 1 
ATOM   7114  N  N   . LEU C  1 286 ? 10.342  53.089  27.839  1.00 26.04 ? 287  LEU C N   1 
ATOM   7115  C  CA  . LEU C  1 286 ? 9.117   53.818  28.161  1.00 24.09 ? 287  LEU C CA  1 
ATOM   7116  C  C   . LEU C  1 286 ? 8.435   54.385  26.909  1.00 25.68 ? 287  LEU C C   1 
ATOM   7117  O  O   . LEU C  1 286 ? 7.205   54.285  26.758  1.00 24.82 ? 287  LEU C O   1 
ATOM   7118  C  CB  . LEU C  1 286 ? 9.446   54.969  29.111  1.00 24.54 ? 287  LEU C CB  1 
ATOM   7119  C  CG  . LEU C  1 286 ? 9.696   54.602  30.585  1.00 28.19 ? 287  LEU C CG  1 
ATOM   7120  C  CD1 . LEU C  1 286 ? 10.690  55.567  31.242  1.00 20.94 ? 287  LEU C CD1 1 
ATOM   7121  C  CD2 . LEU C  1 286 ? 8.380   54.514  31.369  1.00 17.18 ? 287  LEU C CD2 1 
ATOM   7122  N  N   . LEU C  1 287 ? 9.224   55.007  26.026  1.00 25.53 ? 288  LEU C N   1 
ATOM   7123  C  CA  . LEU C  1 287 ? 8.697   55.483  24.737  1.00 27.02 ? 288  LEU C CA  1 
ATOM   7124  C  C   . LEU C  1 287 ? 7.980   54.348  23.997  1.00 27.67 ? 288  LEU C C   1 
ATOM   7125  O  O   . LEU C  1 287 ? 6.797   54.469  23.617  1.00 28.32 ? 288  LEU C O   1 
ATOM   7126  C  CB  . LEU C  1 287 ? 9.819   56.039  23.854  1.00 25.77 ? 288  LEU C CB  1 
ATOM   7127  C  CG  . LEU C  1 287 ? 9.371   56.576  22.472  1.00 28.94 ? 288  LEU C CG  1 
ATOM   7128  C  CD1 . LEU C  1 287 ? 8.409   57.749  22.595  1.00 22.70 ? 288  LEU C CD1 1 
ATOM   7129  C  CD2 . LEU C  1 287 ? 10.581  56.951  21.592  1.00 23.59 ? 288  LEU C CD2 1 
ATOM   7130  N  N   . LYS C  1 288 ? 8.686   53.234  23.824  1.00 27.07 ? 289  LYS C N   1 
ATOM   7131  C  CA  . LYS C  1 288 ? 8.141   52.103  23.074  1.00 28.78 ? 289  LYS C CA  1 
ATOM   7132  C  C   . LYS C  1 288 ? 6.835   51.631  23.699  1.00 29.77 ? 289  LYS C C   1 
ATOM   7133  O  O   . LYS C  1 288 ? 5.843   51.404  23.006  1.00 31.15 ? 289  LYS C O   1 
ATOM   7134  C  CB  . LYS C  1 288 ? 9.167   50.960  22.987  1.00 28.39 ? 289  LYS C CB  1 
ATOM   7135  C  CG  . LYS C  1 288 ? 8.719   49.727  22.216  1.00 30.08 ? 289  LYS C CG  1 
ATOM   7136  C  CD  . LYS C  1 288 ? 8.491   50.020  20.747  1.00 34.79 ? 289  LYS C CD  1 
ATOM   7137  C  CE  . LYS C  1 288 ? 8.018   48.795  19.986  1.00 33.19 ? 289  LYS C CE  1 
ATOM   7138  N  NZ  . LYS C  1 288 ? 7.599   49.167  18.603  1.00 31.71 ? 289  LYS C NZ  1 
ATOM   7139  N  N   . TRP C  1 289 ? 6.833   51.477  25.017  1.00 30.89 ? 290  TRP C N   1 
ATOM   7140  C  CA  . TRP C  1 289 ? 5.609   51.088  25.718  1.00 29.33 ? 290  TRP C CA  1 
ATOM   7141  C  C   . TRP C  1 289 ? 4.436   52.029  25.477  1.00 28.35 ? 290  TRP C C   1 
ATOM   7142  O  O   . TRP C  1 289 ? 3.286   51.587  25.340  1.00 31.00 ? 290  TRP C O   1 
ATOM   7143  C  CB  . TRP C  1 289 ? 5.868   50.934  27.207  1.00 28.60 ? 290  TRP C CB  1 
ATOM   7144  C  CG  . TRP C  1 289 ? 6.606   49.678  27.552  1.00 30.66 ? 290  TRP C CG  1 
ATOM   7145  C  CD1 . TRP C  1 289 ? 6.571   48.483  26.882  1.00 30.14 ? 290  TRP C CD1 1 
ATOM   7146  C  CD2 . TRP C  1 289 ? 7.457   49.476  28.678  1.00 30.93 ? 290  TRP C CD2 1 
ATOM   7147  N  NE1 . TRP C  1 289 ? 7.359   47.560  27.520  1.00 29.29 ? 290  TRP C NE1 1 
ATOM   7148  C  CE2 . TRP C  1 289 ? 7.915   48.139  28.624  1.00 28.18 ? 290  TRP C CE2 1 
ATOM   7149  C  CE3 . TRP C  1 289 ? 7.886   50.295  29.728  1.00 29.70 ? 290  TRP C CE3 1 
ATOM   7150  C  CZ2 . TRP C  1 289 ? 8.776   47.608  29.574  1.00 27.85 ? 290  TRP C CZ2 1 
ATOM   7151  C  CZ3 . TRP C  1 289 ? 8.745   49.761  30.681  1.00 26.39 ? 290  TRP C CZ3 1 
ATOM   7152  C  CH2 . TRP C  1 289 ? 9.180   48.435  30.597  1.00 26.27 ? 290  TRP C CH2 1 
ATOM   7153  N  N   . VAL C  1 290 ? 4.709   53.315  25.436  1.00 28.60 ? 291  VAL C N   1 
ATOM   7154  C  CA  . VAL C  1 290 ? 3.669   54.294  25.121  1.00 30.07 ? 291  VAL C CA  1 
ATOM   7155  C  C   . VAL C  1 290 ? 3.184   54.109  23.685  1.00 32.63 ? 291  VAL C C   1 
ATOM   7156  O  O   . VAL C  1 290 ? 1.980   54.061  23.426  1.00 33.74 ? 291  VAL C O   1 
ATOM   7157  C  CB  . VAL C  1 290 ? 4.173   55.729  25.297  1.00 29.50 ? 291  VAL C CB  1 
ATOM   7158  C  CG1 . VAL C  1 290 ? 3.139   56.726  24.778  1.00 28.98 ? 291  VAL C CG1 1 
ATOM   7159  C  CG2 . VAL C  1 290 ? 4.516   55.984  26.768  1.00 28.57 ? 291  VAL C CG2 1 
ATOM   7160  N  N   . LEU C  1 291 ? 4.115   53.977  22.749  1.00 34.53 ? 292  LEU C N   1 
ATOM   7161  C  CA  . LEU C  1 291 ? 3.727   53.782  21.345  1.00 35.14 ? 292  LEU C CA  1 
ATOM   7162  C  C   . LEU C  1 291 ? 2.868   52.531  21.147  1.00 37.14 ? 292  LEU C C   1 
ATOM   7163  O  O   . LEU C  1 291 ? 1.927   52.553  20.344  1.00 37.36 ? 292  LEU C O   1 
ATOM   7164  C  CB  . LEU C  1 291 ? 4.953   53.745  20.448  1.00 34.11 ? 292  LEU C CB  1 
ATOM   7165  C  CG  . LEU C  1 291 ? 5.679   55.088  20.370  1.00 34.30 ? 292  LEU C CG  1 
ATOM   7166  C  CD1 . LEU C  1 291 ? 6.944   54.947  19.506  1.00 33.91 ? 292  LEU C CD1 1 
ATOM   7167  C  CD2 . LEU C  1 291 ? 4.735   56.169  19.837  1.00 34.23 ? 292  LEU C CD2 1 
ATOM   7168  N  N   . GLU C  1 292 ? 3.169   51.465  21.895  1.00 36.26 ? 293  GLU C N   1 
ATOM   7169  C  CA  . GLU C  1 292 ? 2.377   50.240  21.833  1.00 36.34 ? 293  GLU C CA  1 
ATOM   7170  C  C   . GLU C  1 292 ? 1.025   50.316  22.554  1.00 36.97 ? 293  GLU C C   1 
ATOM   7171  O  O   . GLU C  1 292 ? 0.191   49.437  22.361  1.00 37.31 ? 293  GLU C O   1 
ATOM   7172  C  CB  . GLU C  1 292 ? 3.144   49.070  22.429  1.00 36.01 ? 293  GLU C CB  1 
ATOM   7173  C  CG  . GLU C  1 292 ? 4.360   48.637  21.660  1.00 39.23 ? 293  GLU C CG  1 
ATOM   7174  C  CD  . GLU C  1 292 ? 5.074   47.473  22.368  1.00 45.99 ? 293  GLU C CD  1 
ATOM   7175  O  OE1 . GLU C  1 292 ? 5.673   47.684  23.446  1.00 45.25 ? 293  GLU C OE1 1 
ATOM   7176  O  OE2 . GLU C  1 292 ? 5.012   46.331  21.853  1.00 49.48 ? 293  GLU C OE2 1 
ATOM   7177  N  N   . GLY C  1 293 ? 0.810   51.326  23.398  1.00 36.11 ? 294  GLY C N   1 
ATOM   7178  C  CA  . GLY C  1 293 ? -0.416  51.408  24.188  1.00 33.99 ? 294  GLY C CA  1 
ATOM   7179  C  C   . GLY C  1 293 ? -0.341  50.620  25.489  1.00 33.81 ? 294  GLY C C   1 
ATOM   7180  O  O   . GLY C  1 293 ? -1.313  50.571  26.238  1.00 33.03 ? 294  GLY C O   1 
ATOM   7181  N  N   . LYS C  1 294 ? 0.809   50.004  25.766  1.00 32.69 ? 295  LYS C N   1 
ATOM   7182  C  CA  . LYS C  1 294 ? 1.023   49.319  27.031  1.00 34.36 ? 295  LYS C CA  1 
ATOM   7183  C  C   . LYS C  1 294 ? 1.143   50.312  28.187  1.00 33.58 ? 295  LYS C C   1 
ATOM   7184  O  O   . LYS C  1 294 ? 0.823   49.984  29.330  1.00 34.99 ? 295  LYS C O   1 
ATOM   7185  C  CB  . LYS C  1 294 ? 2.252   48.413  26.966  1.00 36.31 ? 295  LYS C CB  1 
ATOM   7186  C  CG  . LYS C  1 294 ? 2.084   47.237  25.984  1.00 42.40 ? 295  LYS C CG  1 
ATOM   7187  C  CD  . LYS C  1 294 ? 3.169   46.170  26.183  1.00 46.12 ? 295  LYS C CD  1 
ATOM   7188  C  CE  . LYS C  1 294 ? 2.943   44.952  25.286  1.00 49.52 ? 295  LYS C CE  1 
ATOM   7189  N  NZ  . LYS C  1 294 ? 3.019   45.292  23.816  1.00 52.42 ? 295  LYS C NZ  1 
ATOM   7190  N  N   . ILE C  1 295 ? 1.605   51.523  27.891  1.00 32.12 ? 296  ILE C N   1 
ATOM   7191  C  CA  . ILE C  1 295 ? 1.479   52.633  28.825  1.00 30.28 ? 296  ILE C CA  1 
ATOM   7192  C  C   . ILE C  1 295 ? 0.698   53.743  28.149  1.00 31.02 ? 296  ILE C C   1 
ATOM   7193  O  O   . ILE C  1 295 ? 1.147   54.305  27.137  1.00 31.86 ? 296  ILE C O   1 
ATOM   7194  C  CB  . ILE C  1 295 ? 2.846   53.188  29.274  1.00 28.99 ? 296  ILE C CB  1 
ATOM   7195  C  CG1 . ILE C  1 295 ? 3.631   52.133  30.050  1.00 28.54 ? 296  ILE C CG1 1 
ATOM   7196  C  CG2 . ILE C  1 295 ? 2.665   54.398  30.181  1.00 21.71 ? 296  ILE C CG2 1 
ATOM   7197  C  CD1 . ILE C  1 295 ? 4.967   52.641  30.543  1.00 25.83 ? 296  ILE C CD1 1 
ATOM   7198  N  N   . GLN C  1 296 ? -0.464  54.060  28.716  1.00 30.01 ? 297  GLN C N   1 
ATOM   7199  C  CA  . GLN C  1 296 ? -1.295  55.166  28.245  1.00 32.41 ? 297  GLN C CA  1 
ATOM   7200  C  C   . GLN C  1 296 ? -0.938  56.428  28.993  1.00 31.82 ? 297  GLN C C   1 
ATOM   7201  O  O   . GLN C  1 296 ? -0.645  56.380  30.164  1.00 30.80 ? 297  GLN C O   1 
ATOM   7202  C  CB  . GLN C  1 296 ? -2.786  54.866  28.468  1.00 33.16 ? 297  GLN C CB  1 
ATOM   7203  C  CG  . GLN C  1 296 ? -3.363  53.840  27.493  1.00 39.76 ? 297  GLN C CG  1 
ATOM   7204  C  CD  . GLN C  1 296 ? -4.864  53.755  27.613  1.00 47.38 ? 297  GLN C CD  1 
ATOM   7205  O  OE1 . GLN C  1 296 ? -5.555  54.779  27.541  1.00 51.13 ? 297  GLN C OE1 1 
ATOM   7206  N  NE2 . GLN C  1 296 ? -5.385  52.537  27.831  1.00 44.73 ? 297  GLN C NE2 1 
ATOM   7207  N  N   . TYR C  1 297 ? -0.978  57.566  28.316  1.00 33.80 ? 298  TYR C N   1 
ATOM   7208  C  CA  . TYR C  1 297 ? -0.654  58.826  28.970  1.00 34.76 ? 298  TYR C CA  1 
ATOM   7209  C  C   . TYR C  1 297 ? -1.902  59.653  29.203  1.00 34.54 ? 298  TYR C C   1 
ATOM   7210  O  O   . TYR C  1 297 ? -2.950  59.395  28.619  1.00 32.57 ? 298  TYR C O   1 
ATOM   7211  C  CB  . TYR C  1 297 ? 0.388   59.626  28.184  1.00 35.49 ? 298  TYR C CB  1 
ATOM   7212  C  CG  . TYR C  1 297 ? -0.009  60.050  26.782  1.00 39.22 ? 298  TYR C CG  1 
ATOM   7213  C  CD1 . TYR C  1 297 ? 0.262   59.233  25.692  1.00 43.44 ? 298  TYR C CD1 1 
ATOM   7214  C  CD2 . TYR C  1 297 ? -0.613  61.278  26.540  1.00 41.85 ? 298  TYR C CD2 1 
ATOM   7215  C  CE1 . TYR C  1 297 ? -0.074  59.611  24.414  1.00 45.03 ? 298  TYR C CE1 1 
ATOM   7216  C  CE2 . TYR C  1 297 ? -0.966  61.658  25.249  1.00 42.20 ? 298  TYR C CE2 1 
ATOM   7217  C  CZ  . TYR C  1 297 ? -0.678  60.815  24.195  1.00 43.23 ? 298  TYR C CZ  1 
ATOM   7218  O  OH  . TYR C  1 297 ? -1.000  61.150  22.899  1.00 53.54 ? 298  TYR C OH  1 
ATOM   7219  N  N   . LYS C  1 298 ? -1.765  60.610  30.115  1.00 34.69 ? 299  LYS C N   1 
ATOM   7220  C  CA  . LYS C  1 298 ? -2.804  61.584  30.424  1.00 36.09 ? 299  LYS C CA  1 
ATOM   7221  C  C   . LYS C  1 298 ? -2.136  62.744  31.158  1.00 35.19 ? 299  LYS C C   1 
ATOM   7222  O  O   . LYS C  1 298 ? -1.298  62.527  32.051  1.00 35.69 ? 299  LYS C O   1 
ATOM   7223  C  CB  . LYS C  1 298 ? -3.942  60.989  31.267  1.00 37.20 ? 299  LYS C CB  1 
ATOM   7224  C  CG  . LYS C  1 298 ? -5.178  61.927  31.330  1.00 41.93 ? 299  LYS C CG  1 
ATOM   7225  C  CD  . LYS C  1 298 ? -6.489  61.157  31.450  1.00 47.57 ? 299  LYS C CD  1 
ATOM   7226  C  CE  . LYS C  1 298 ? -7.720  62.069  31.457  1.00 51.28 ? 299  LYS C CE  1 
ATOM   7227  N  NZ  . LYS C  1 298 ? -7.900  62.857  30.216  1.00 51.91 ? 299  LYS C NZ  1 
ATOM   7228  N  N   . GLU C  1 299 ? -2.487  63.966  30.765  1.00 32.70 ? 300  GLU C N   1 
ATOM   7229  C  CA  . GLU C  1 299 ? -1.861  65.154  31.324  1.00 30.88 ? 300  GLU C CA  1 
ATOM   7230  C  C   . GLU C  1 299 ? -2.879  66.053  31.999  1.00 30.73 ? 300  GLU C C   1 
ATOM   7231  O  O   . GLU C  1 299 ? -4.048  66.108  31.588  1.00 32.03 ? 300  GLU C O   1 
ATOM   7232  C  CB  . GLU C  1 299 ? -1.082  65.908  30.238  1.00 31.35 ? 300  GLU C CB  1 
ATOM   7233  C  CG  . GLU C  1 299 ? 0.151   65.120  29.720  1.00 30.72 ? 300  GLU C CG  1 
ATOM   7234  C  CD  . GLU C  1 299 ? 0.930   65.875  28.641  1.00 32.11 ? 300  GLU C CD  1 
ATOM   7235  O  OE1 . GLU C  1 299 ? 0.322   66.272  27.629  1.00 30.42 ? 300  GLU C OE1 1 
ATOM   7236  O  OE2 . GLU C  1 299 ? 2.153   66.081  28.805  1.00 31.62 ? 300  GLU C OE2 1 
ATOM   7237  N  N   . TYR C  1 300 ? -2.433  66.711  33.072  1.00 27.71 ? 301  TYR C N   1 
ATOM   7238  C  CA  . TYR C  1 300 ? -3.210  67.703  33.785  1.00 25.56 ? 301  TYR C CA  1 
ATOM   7239  C  C   . TYR C  1 300 ? -2.579  69.046  33.489  1.00 26.67 ? 301  TYR C C   1 
ATOM   7240  O  O   . TYR C  1 300 ? -1.603  69.457  34.129  1.00 25.03 ? 301  TYR C O   1 
ATOM   7241  C  CB  . TYR C  1 300 ? -3.213  67.418  35.278  1.00 25.60 ? 301  TYR C CB  1 
ATOM   7242  C  CG  . TYR C  1 300 ? -4.211  68.265  36.058  1.00 25.57 ? 301  TYR C CG  1 
ATOM   7243  C  CD1 . TYR C  1 300 ? -5.588  67.996  36.003  1.00 27.39 ? 301  TYR C CD1 1 
ATOM   7244  C  CD2 . TYR C  1 300 ? -3.788  69.330  36.847  1.00 24.22 ? 301  TYR C CD2 1 
ATOM   7245  C  CE1 . TYR C  1 300 ? -6.522  68.782  36.724  1.00 25.99 ? 301  TYR C CE1 1 
ATOM   7246  C  CE2 . TYR C  1 300 ? -4.720  70.127  37.562  1.00 27.70 ? 301  TYR C CE2 1 
ATOM   7247  C  CZ  . TYR C  1 300 ? -6.077  69.845  37.493  1.00 29.67 ? 301  TYR C CZ  1 
ATOM   7248  O  OH  . TYR C  1 300 ? -6.976  70.627  38.205  1.00 29.88 ? 301  TYR C OH  1 
ATOM   7249  N  N   . ILE C  1 301 ? -3.130  69.706  32.470  1.00 29.52 ? 302  ILE C N   1 
ATOM   7250  C  CA  . ILE C  1 301 ? -2.528  70.882  31.857  1.00 29.20 ? 302  ILE C CA  1 
ATOM   7251  C  C   . ILE C  1 301 ? -3.164  72.144  32.378  1.00 28.61 ? 302  ILE C C   1 
ATOM   7252  O  O   . ILE C  1 301 ? -4.363  72.337  32.269  1.00 29.27 ? 302  ILE C O   1 
ATOM   7253  C  CB  . ILE C  1 301 ? -2.729  70.939  30.330  1.00 30.96 ? 302  ILE C CB  1 
ATOM   7254  C  CG1 . ILE C  1 301 ? -2.421  69.607  29.651  1.00 34.25 ? 302  ILE C CG1 1 
ATOM   7255  C  CG2 . ILE C  1 301 ? -1.857  72.073  29.750  1.00 29.00 ? 302  ILE C CG2 1 
ATOM   7256  C  CD1 . ILE C  1 301 ? -0.971  69.331  29.508  1.00 38.35 ? 302  ILE C CD1 1 
ATOM   7257  N  N   . ILE C  1 302 ? -2.341  73.015  32.930  1.00 29.33 ? 303  ILE C N   1 
ATOM   7258  C  CA  . ILE C  1 302 ? -2.778  74.325  33.339  1.00 29.48 ? 303  ILE C CA  1 
ATOM   7259  C  C   . ILE C  1 302 ? -2.172  75.298  32.337  1.00 30.06 ? 303  ILE C C   1 
ATOM   7260  O  O   . ILE C  1 302 ? -0.975  75.239  32.044  1.00 29.88 ? 303  ILE C O   1 
ATOM   7261  C  CB  . ILE C  1 302 ? -2.357  74.625  34.784  1.00 29.44 ? 303  ILE C CB  1 
ATOM   7262  C  CG1 . ILE C  1 302 ? -3.255  73.847  35.758  1.00 31.41 ? 303  ILE C CG1 1 
ATOM   7263  C  CG2 . ILE C  1 302 ? -2.442  76.116  35.098  1.00 29.78 ? 303  ILE C CG2 1 
ATOM   7264  C  CD1 . ILE C  1 302 ? -2.925  72.393  35.818  1.00 35.12 ? 303  ILE C CD1 1 
ATOM   7265  N  N   . GLU C  1 303 ? -3.022  76.164  31.793  1.00 29.24 ? 304  GLU C N   1 
ATOM   7266  C  CA  . GLU C  1 303 ? -2.629  77.113  30.752  1.00 29.98 ? 304  GLU C CA  1 
ATOM   7267  C  C   . GLU C  1 303 ? -2.107  78.366  31.386  1.00 27.22 ? 304  GLU C C   1 
ATOM   7268  O  O   . GLU C  1 303 ? -2.744  78.890  32.282  1.00 28.72 ? 304  GLU C O   1 
ATOM   7269  C  CB  . GLU C  1 303 ? -3.841  77.471  29.874  1.00 30.76 ? 304  GLU C CB  1 
ATOM   7270  C  CG  . GLU C  1 303 ? -4.501  76.256  29.213  1.00 36.91 ? 304  GLU C CG  1 
ATOM   7271  C  CD  . GLU C  1 303 ? -4.155  76.058  27.743  1.00 44.30 ? 304  GLU C CD  1 
ATOM   7272  O  OE1 . GLU C  1 303 ? -3.755  77.026  27.060  1.00 48.29 ? 304  GLU C OE1 1 
ATOM   7273  O  OE2 . GLU C  1 303 ? -4.314  74.918  27.253  1.00 47.51 ? 304  GLU C OE2 1 
ATOM   7274  N  N   . GLY C  1 304 ? -0.948  78.834  30.928  1.00 27.73 ? 305  GLY C N   1 
ATOM   7275  C  CA  . GLY C  1 304 ? -0.439  80.159  31.286  1.00 25.35 ? 305  GLY C CA  1 
ATOM   7276  C  C   . GLY C  1 304 ? 0.557   80.168  32.441  1.00 25.48 ? 305  GLY C C   1 
ATOM   7277  O  O   . GLY C  1 304 ? 0.269   79.678  33.546  1.00 22.18 ? 305  GLY C O   1 
ATOM   7278  N  N   . PHE C  1 305 ? 1.708   80.785  32.185  1.00 23.88 ? 306  PHE C N   1 
ATOM   7279  C  CA  . PHE C  1 305 ? 2.802   80.894  33.155  1.00 24.60 ? 306  PHE C CA  1 
ATOM   7280  C  C   . PHE C  1 305 ? 2.422   81.581  34.458  1.00 27.12 ? 306  PHE C C   1 
ATOM   7281  O  O   . PHE C  1 305 ? 2.945   81.231  35.521  1.00 28.05 ? 306  PHE C O   1 
ATOM   7282  C  CB  . PHE C  1 305 ? 3.950   81.666  32.519  1.00 23.84 ? 306  PHE C CB  1 
ATOM   7283  C  CG  . PHE C  1 305 ? 5.149   81.803  33.391  1.00 22.58 ? 306  PHE C CG  1 
ATOM   7284  C  CD1 . PHE C  1 305 ? 6.056   80.767  33.504  1.00 21.13 ? 306  PHE C CD1 1 
ATOM   7285  C  CD2 . PHE C  1 305 ? 5.400   82.981  34.059  1.00 22.23 ? 306  PHE C CD2 1 
ATOM   7286  C  CE1 . PHE C  1 305 ? 7.178   80.897  34.283  1.00 21.17 ? 306  PHE C CE1 1 
ATOM   7287  C  CE2 . PHE C  1 305 ? 6.523   83.114  34.858  1.00 22.85 ? 306  PHE C CE2 1 
ATOM   7288  C  CZ  . PHE C  1 305 ? 7.411   82.057  34.977  1.00 23.46 ? 306  PHE C CZ  1 
ATOM   7289  N  N   . GLU C  1 306 ? 1.553   82.583  34.372  1.00 28.03 ? 307  GLU C N   1 
ATOM   7290  C  CA  . GLU C  1 306 ? 1.075   83.283  35.572  1.00 29.31 ? 307  GLU C CA  1 
ATOM   7291  C  C   . GLU C  1 306 ? 0.367   82.367  36.566  1.00 26.37 ? 307  GLU C C   1 
ATOM   7292  O  O   . GLU C  1 306 ? 0.310   82.704  37.747  1.00 26.12 ? 307  GLU C O   1 
ATOM   7293  C  CB  . GLU C  1 306 ? 0.212   84.544  35.257  1.00 30.01 ? 307  GLU C CB  1 
ATOM   7294  C  CG  . GLU C  1 306 ? -1.052  84.318  34.426  1.00 39.18 ? 307  GLU C CG  1 
ATOM   7295  C  CD  . GLU C  1 306 ? -0.780  84.033  32.937  1.00 47.72 ? 307  GLU C CD  1 
ATOM   7296  O  OE1 . GLU C  1 306 ? 0.321   84.390  32.438  1.00 48.38 ? 307  GLU C OE1 1 
ATOM   7297  O  OE2 . GLU C  1 306 ? -1.676  83.444  32.279  1.00 51.13 ? 307  GLU C OE2 1 
ATOM   7298  N  N   . ASN C  1 307 ? -0.098  81.202  36.103  1.00 25.84 ? 308  ASN C N   1 
ATOM   7299  C  CA  . ASN C  1 307 ? -0.794  80.210  36.943  1.00 25.36 ? 308  ASN C CA  1 
ATOM   7300  C  C   . ASN C  1 307 ? 0.067   79.044  37.472  1.00 24.84 ? 308  ASN C C   1 
ATOM   7301  O  O   . ASN C  1 307 ? -0.462  78.058  37.991  1.00 24.60 ? 308  ASN C O   1 
ATOM   7302  C  CB  . ASN C  1 307 ? -1.967  79.631  36.157  1.00 26.06 ? 308  ASN C CB  1 
ATOM   7303  C  CG  . ASN C  1 307 ? -2.941  80.698  35.752  1.00 31.30 ? 308  ASN C CG  1 
ATOM   7304  O  OD1 . ASN C  1 307 ? -3.286  81.548  36.568  1.00 30.32 ? 308  ASN C OD1 1 
ATOM   7305  N  ND2 . ASN C  1 307 ? -3.352  80.702  34.480  1.00 25.94 ? 308  ASN C ND2 1 
ATOM   7306  N  N   . MET C  1 308 ? 1.384   79.164  37.358  1.00 22.26 ? 309  MET C N   1 
ATOM   7307  C  CA  . MET C  1 308 ? 2.290   78.075  37.729  1.00 22.65 ? 309  MET C CA  1 
ATOM   7308  C  C   . MET C  1 308 ? 2.313   77.810  39.233  1.00 21.44 ? 309  MET C C   1 
ATOM   7309  O  O   . MET C  1 308 ? 2.337   76.650  39.652  1.00 21.96 ? 309  MET C O   1 
ATOM   7310  C  CB  . MET C  1 308 ? 3.700   78.360  37.220  1.00 21.67 ? 309  MET C CB  1 
ATOM   7311  C  CG  . MET C  1 308 ? 4.603   77.180  37.321  1.00 26.18 ? 309  MET C CG  1 
ATOM   7312  S  SD  . MET C  1 308 ? 6.086   77.413  36.366  1.00 26.26 ? 309  MET C SD  1 
ATOM   7313  C  CE  . MET C  1 308 ? 6.816   75.812  36.691  1.00 19.79 ? 309  MET C CE  1 
ATOM   7314  N  N   . PRO C  1 309 ? 2.266   78.874  40.049  1.00 20.42 ? 310  PRO C N   1 
ATOM   7315  C  CA  . PRO C  1 309 ? 2.117   78.657  41.492  1.00 21.45 ? 310  PRO C CA  1 
ATOM   7316  C  C   . PRO C  1 309 ? 0.847   77.904  41.811  1.00 21.08 ? 310  PRO C C   1 
ATOM   7317  O  O   . PRO C  1 309 ? 0.891   76.962  42.577  1.00 21.07 ? 310  PRO C O   1 
ATOM   7318  C  CB  . PRO C  1 309 ? 2.080   80.065  42.074  1.00 21.84 ? 310  PRO C CB  1 
ATOM   7319  C  CG  . PRO C  1 309 ? 2.675   80.940  41.023  1.00 21.81 ? 310  PRO C CG  1 
ATOM   7320  C  CD  . PRO C  1 309 ? 2.425   80.294  39.707  1.00 21.91 ? 310  PRO C CD  1 
ATOM   7321  N  N   . ALA C  1 310 ? -0.262  78.258  41.156  1.00 22.77 ? 311  ALA C N   1 
ATOM   7322  C  CA  . ALA C  1 310 ? -1.524  77.573  41.392  1.00 20.74 ? 311  ALA C CA  1 
ATOM   7323  C  C   . ALA C  1 310 ? -1.466  76.118  40.985  1.00 21.58 ? 311  ALA C C   1 
ATOM   7324  O  O   . ALA C  1 310 ? -2.090  75.284  41.628  1.00 25.73 ? 311  ALA C O   1 
ATOM   7325  C  CB  . ALA C  1 310 ? -2.694  78.292  40.683  1.00 20.99 ? 311  ALA C CB  1 
ATOM   7326  N  N   . ALA C  1 311 ? -0.721  75.795  39.930  1.00 21.96 ? 312  ALA C N   1 
ATOM   7327  C  CA  . ALA C  1 311 ? -0.639  74.403  39.448  1.00 18.63 ? 312  ALA C CA  1 
ATOM   7328  C  C   . ALA C  1 311 ? 0.148   73.551  40.441  1.00 19.38 ? 312  ALA C C   1 
ATOM   7329  O  O   . ALA C  1 311 ? -0.146  72.372  40.638  1.00 17.61 ? 312  ALA C O   1 
ATOM   7330  C  CB  . ALA C  1 311 ? 0.014   74.340  38.087  1.00 16.89 ? 312  ALA C CB  1 
ATOM   7331  N  N   . PHE C  1 312 ? 1.175   74.181  41.017  1.00 19.71 ? 313  PHE C N   1 
ATOM   7332  C  CA  . PHE C  1 312 ? 2.047   73.580  41.995  1.00 18.68 ? 313  PHE C CA  1 
ATOM   7333  C  C   . PHE C  1 312 ? 1.263   73.295  43.300  1.00 19.40 ? 313  PHE C C   1 
ATOM   7334  O  O   . PHE C  1 312 ? 1.242   72.183  43.784  1.00 17.97 ? 313  PHE C O   1 
ATOM   7335  C  CB  . PHE C  1 312 ? 3.221   74.528  42.238  1.00 17.90 ? 313  PHE C CB  1 
ATOM   7336  C  CG  . PHE C  1 312 ? 4.130   74.108  43.357  1.00 17.78 ? 313  PHE C CG  1 
ATOM   7337  C  CD1 . PHE C  1 312 ? 4.692   72.846  43.369  1.00 16.35 ? 313  PHE C CD1 1 
ATOM   7338  C  CD2 . PHE C  1 312 ? 4.445   74.989  44.379  1.00 14.10 ? 313  PHE C CD2 1 
ATOM   7339  C  CE1 . PHE C  1 312 ? 5.551   72.464  44.408  1.00 18.37 ? 313  PHE C CE1 1 
ATOM   7340  C  CE2 . PHE C  1 312 ? 5.310   74.613  45.413  1.00 16.15 ? 313  PHE C CE2 1 
ATOM   7341  C  CZ  . PHE C  1 312 ? 5.855   73.357  45.426  1.00 17.15 ? 313  PHE C CZ  1 
ATOM   7342  N  N   . MET C  1 313 ? 0.587   74.304  43.828  1.00 21.36 ? 314  MET C N   1 
ATOM   7343  C  CA  . MET C  1 313 ? -0.301  74.117  44.987  1.00 20.14 ? 314  MET C CA  1 
ATOM   7344  C  C   . MET C  1 313 ? -1.390  73.050  44.792  1.00 21.73 ? 314  MET C C   1 
ATOM   7345  O  O   . MET C  1 313 ? -1.547  72.168  45.650  1.00 21.64 ? 314  MET C O   1 
ATOM   7346  C  CB  . MET C  1 313 ? -0.918  75.456  45.365  1.00 20.79 ? 314  MET C CB  1 
ATOM   7347  C  CG  . MET C  1 313 ? 0.117   76.381  45.948  1.00 18.12 ? 314  MET C CG  1 
ATOM   7348  S  SD  . MET C  1 313 ? -0.446  77.981  46.509  1.00 25.02 ? 314  MET C SD  1 
ATOM   7349  C  CE  . MET C  1 313 ? -0.826  78.793  44.929  1.00 22.22 ? 314  MET C CE  1 
ATOM   7350  N  N   . GLY C  1 314 ? -2.092  73.092  43.656  1.00 21.55 ? 315  GLY C N   1 
ATOM   7351  C  CA  . GLY C  1 314 ? -3.164  72.128  43.362  1.00 20.82 ? 315  GLY C CA  1 
ATOM   7352  C  C   . GLY C  1 314 ? -2.693  70.674  43.211  1.00 20.90 ? 315  GLY C C   1 
ATOM   7353  O  O   . GLY C  1 314 ? -3.350  69.742  43.668  1.00 23.71 ? 315  GLY C O   1 
ATOM   7354  N  N   . MET C  1 315 ? -1.555  70.488  42.571  1.00 19.77 ? 316  MET C N   1 
ATOM   7355  C  CA  . MET C  1 315 ? -0.881  69.202  42.523  1.00 20.00 ? 316  MET C CA  1 
ATOM   7356  C  C   . MET C  1 315 ? -0.577  68.687  43.926  1.00 19.71 ? 316  MET C C   1 
ATOM   7357  O  O   . MET C  1 315 ? -0.777  67.502  44.204  1.00 19.90 ? 316  MET C O   1 
ATOM   7358  C  CB  . MET C  1 315 ? 0.423   69.331  41.767  1.00 20.96 ? 316  MET C CB  1 
ATOM   7359  C  CG  . MET C  1 315 ? 1.234   68.042  41.709  1.00 22.09 ? 316  MET C CG  1 
ATOM   7360  S  SD  . MET C  1 315 ? 2.374   67.940  43.074  1.00 33.08 ? 316  MET C SD  1 
ATOM   7361  C  CE  . MET C  1 315 ? 3.491   69.270  42.636  1.00 22.70 ? 316  MET C CE  1 
ATOM   7362  N  N   . LEU C  1 316 ? -0.081  69.556  44.805  1.00 17.99 ? 317  LEU C N   1 
ATOM   7363  C  CA  . LEU C  1 316 ? 0.224   69.125  46.181  1.00 20.09 ? 317  LEU C CA  1 
ATOM   7364  C  C   . LEU C  1 316 ? -1.041  68.709  46.882  1.00 19.53 ? 317  LEU C C   1 
ATOM   7365  O  O   . LEU C  1 316 ? -1.039  67.770  47.670  1.00 21.66 ? 317  LEU C O   1 
ATOM   7366  C  CB  . LEU C  1 316 ? 0.863   70.238  47.002  1.00 19.80 ? 317  LEU C CB  1 
ATOM   7367  C  CG  . LEU C  1 316 ? 2.219   70.694  46.555  1.00 20.31 ? 317  LEU C CG  1 
ATOM   7368  C  CD1 . LEU C  1 316 ? 2.581   71.878  47.437  1.00 17.52 ? 317  LEU C CD1 1 
ATOM   7369  C  CD2 . LEU C  1 316 ? 3.214   69.523  46.683  1.00 16.84 ? 317  LEU C CD2 1 
ATOM   7370  N  N   . LYS C  1 317 ? -2.120  69.419  46.583  1.00 20.00 ? 318  LYS C N   1 
ATOM   7371  C  CA  . LYS C  1 317 ? -3.417  69.139  47.174  1.00 21.68 ? 318  LYS C CA  1 
ATOM   7372  C  C   . LYS C  1 317 ? -4.255  68.121  46.442  1.00 22.52 ? 318  LYS C C   1 
ATOM   7373  O  O   . LYS C  1 317 ? -5.416  67.963  46.779  1.00 24.16 ? 318  LYS C O   1 
ATOM   7374  C  CB  . LYS C  1 317 ? -4.220  70.445  47.332  1.00 22.84 ? 318  LYS C CB  1 
ATOM   7375  C  CG  . LYS C  1 317 ? -3.585  71.375  48.333  1.00 22.22 ? 318  LYS C CG  1 
ATOM   7376  C  CD  . LYS C  1 317 ? -4.387  72.654  48.599  1.00 26.28 ? 318  LYS C CD  1 
ATOM   7377  C  CE  . LYS C  1 317 ? -3.510  73.665  49.349  1.00 23.47 ? 318  LYS C CE  1 
ATOM   7378  N  NZ  . LYS C  1 317 ? -4.184  74.926  49.862  1.00 20.27 ? 318  LYS C NZ  1 
ATOM   7379  N  N   . GLY C  1 318 ? -3.695  67.444  45.444  1.00 22.60 ? 319  GLY C N   1 
ATOM   7380  C  CA  . GLY C  1 318 ? -4.390  66.351  44.790  1.00 20.73 ? 319  GLY C CA  1 
ATOM   7381  C  C   . GLY C  1 318 ? -5.333  66.677  43.638  1.00 22.09 ? 319  GLY C C   1 
ATOM   7382  O  O   . GLY C  1 318 ? -6.124  65.830  43.268  1.00 20.60 ? 319  GLY C O   1 
ATOM   7383  N  N   . ASP C  1 319 ? -5.233  67.868  43.048  1.00 22.06 ? 320  ASP C N   1 
ATOM   7384  C  CA  . ASP C  1 319 ? -6.070  68.238  41.887  1.00 24.24 ? 320  ASP C CA  1 
ATOM   7385  C  C   . ASP C  1 319 ? -5.784  67.429  40.606  1.00 25.26 ? 320  ASP C C   1 
ATOM   7386  O  O   . ASP C  1 319 ? -6.702  67.163  39.823  1.00 27.26 ? 320  ASP C O   1 
ATOM   7387  C  CB  . ASP C  1 319 ? -5.842  69.709  41.512  1.00 26.91 ? 320  ASP C CB  1 
ATOM   7388  C  CG  . ASP C  1 319 ? -6.429  70.709  42.511  1.00 26.00 ? 320  ASP C CG  1 
ATOM   7389  O  OD1 . ASP C  1 319 ? -7.177  70.322  43.444  1.00 31.58 ? 320  ASP C OD1 1 
ATOM   7390  O  OD2 . ASP C  1 319 ? -6.138  71.912  42.315  1.00 29.58 ? 320  ASP C OD2 1 
ATOM   7391  N  N   . ASN C  1 320 ? -4.519  67.068  40.388  1.00 24.48 ? 321  ASN C N   1 
ATOM   7392  C  CA  . ASN C  1 320 ? -4.060  66.519  39.112  1.00 24.46 ? 321  ASN C CA  1 
ATOM   7393  C  C   . ASN C  1 320 ? -4.372  65.071  38.915  1.00 25.86 ? 321  ASN C C   1 
ATOM   7394  O  O   . ASN C  1 320 ? -4.100  64.257  39.789  1.00 27.61 ? 321  ASN C O   1 
ATOM   7395  C  CB  . ASN C  1 320 ? -2.537  66.670  38.942  1.00 24.07 ? 321  ASN C CB  1 
ATOM   7396  C  CG  . ASN C  1 320 ? -1.755  65.902  39.998  1.00 23.57 ? 321  ASN C CG  1 
ATOM   7397  O  OD1 . ASN C  1 320 ? -1.929  66.148  41.200  1.00 23.63 ? 321  ASN C OD1 1 
ATOM   7398  N  ND2 . ASN C  1 320 ? -0.892  64.974  39.565  1.00 16.97 ? 321  ASN C ND2 1 
ATOM   7399  N  N   . LEU C  1 321 ? -4.930  64.755  37.749  1.00 27.02 ? 322  LEU C N   1 
ATOM   7400  C  CA  . LEU C  1 321 ? -5.018  63.384  37.250  1.00 27.51 ? 322  LEU C CA  1 
ATOM   7401  C  C   . LEU C  1 321 ? -3.947  63.297  36.177  1.00 27.23 ? 322  LEU C C   1 
ATOM   7402  O  O   . LEU C  1 321 ? -4.072  63.927  35.117  1.00 28.31 ? 322  LEU C O   1 
ATOM   7403  C  CB  . LEU C  1 321 ? -6.417  63.115  36.689  1.00 28.55 ? 322  LEU C CB  1 
ATOM   7404  C  CG  . LEU C  1 321 ? -6.744  61.808  35.962  1.00 34.79 ? 322  LEU C CG  1 
ATOM   7405  C  CD1 . LEU C  1 321 ? -6.254  60.564  36.664  1.00 39.98 ? 322  LEU C CD1 1 
ATOM   7406  C  CD2 . LEU C  1 321 ? -8.261  61.739  35.776  1.00 39.71 ? 322  LEU C CD2 1 
ATOM   7407  N  N   . GLY C  1 322 ? -2.878  62.554  36.473  1.00 25.11 ? 323  GLY C N   1 
ATOM   7408  C  CA  . GLY C  1 322 ? -1.734  62.414  35.580  1.00 24.26 ? 323  GLY C CA  1 
ATOM   7409  C  C   . GLY C  1 322 ? -0.760  63.556  35.801  1.00 24.11 ? 323  GLY C C   1 
ATOM   7410  O  O   . GLY C  1 322 ? -0.958  64.358  36.708  1.00 22.86 ? 323  GLY C O   1 
ATOM   7411  N  N   . LYS C  1 323 ? 0.281   63.629  34.971  1.00 22.55 ? 324  LYS C N   1 
ATOM   7412  C  CA  . LYS C  1 323 ? 1.364   64.589  35.146  1.00 21.83 ? 324  LYS C CA  1 
ATOM   7413  C  C   . LYS C  1 323 ? 0.874   66.027  35.036  1.00 24.16 ? 324  LYS C C   1 
ATOM   7414  O  O   . LYS C  1 323 ? 0.177   66.384  34.081  1.00 24.58 ? 324  LYS C O   1 
ATOM   7415  C  CB  . LYS C  1 323 ? 2.471   64.364  34.101  1.00 23.01 ? 324  LYS C CB  1 
ATOM   7416  C  CG  . LYS C  1 323 ? 3.644   65.347  34.193  1.00 21.58 ? 324  LYS C CG  1 
ATOM   7417  C  CD  . LYS C  1 323 ? 4.504   65.047  35.419  1.00 20.44 ? 324  LYS C CD  1 
ATOM   7418  C  CE  . LYS C  1 323 ? 5.446   66.179  35.786  1.00 20.71 ? 324  LYS C CE  1 
ATOM   7419  N  NZ  . LYS C  1 323 ? 4.791   67.321  36.482  1.00 13.76 ? 324  LYS C NZ  1 
ATOM   7420  N  N   . THR C  1 324 ? 1.283   66.841  36.006  1.00 23.05 ? 325  THR C N   1 
ATOM   7421  C  CA  . THR C  1 324 ? 0.906   68.243  36.088  1.00 20.23 ? 325  THR C CA  1 
ATOM   7422  C  C   . THR C  1 324 ? 1.853   69.027  35.218  1.00 21.58 ? 325  THR C C   1 
ATOM   7423  O  O   . THR C  1 324 ? 3.075   68.971  35.408  1.00 21.42 ? 325  THR C O   1 
ATOM   7424  C  CB  . THR C  1 324 ? 1.038   68.770  37.522  1.00 18.82 ? 325  THR C CB  1 
ATOM   7425  O  OG1 . THR C  1 324 ? 0.366   67.890  38.423  1.00 20.33 ? 325  THR C OG1 1 
ATOM   7426  C  CG2 . THR C  1 324 ? 0.444   70.192  37.676  1.00 19.30 ? 325  THR C CG2 1 
ATOM   7427  N  N   . ILE C  1 325 ? 1.286   69.751  34.255  1.00 23.64 ? 326  ILE C N   1 
ATOM   7428  C  CA  . ILE C  1 325 ? 2.054   70.503  33.260  1.00 22.96 ? 326  ILE C CA  1 
ATOM   7429  C  C   . ILE C  1 325 ? 1.487   71.917  33.121  1.00 23.45 ? 326  ILE C C   1 
ATOM   7430  O  O   . ILE C  1 325 ? 0.275   72.108  33.129  1.00 25.66 ? 326  ILE C O   1 
ATOM   7431  C  CB  . ILE C  1 325 ? 1.982   69.786  31.895  1.00 23.76 ? 326  ILE C CB  1 
ATOM   7432  C  CG1 . ILE C  1 325 ? 2.679   68.433  31.975  1.00 22.78 ? 326  ILE C CG1 1 
ATOM   7433  C  CG2 . ILE C  1 325 ? 2.607   70.644  30.772  1.00 22.61 ? 326  ILE C CG2 1 
ATOM   7434  C  CD1 . ILE C  1 325 ? 4.202   68.530  32.166  1.00 21.10 ? 326  ILE C CD1 1 
ATOM   7435  N  N   . VAL C  1 326 ? 2.365   72.903  33.020  1.00 24.45 ? 327  VAL C N   1 
ATOM   7436  C  CA  . VAL C  1 326 ? 1.976   74.261  32.683  1.00 23.62 ? 327  VAL C CA  1 
ATOM   7437  C  C   . VAL C  1 326 ? 2.362   74.500  31.217  1.00 26.92 ? 327  VAL C C   1 
ATOM   7438  O  O   . VAL C  1 326 ? 3.545   74.373  30.847  1.00 26.03 ? 327  VAL C O   1 
ATOM   7439  C  CB  . VAL C  1 326 ? 2.706   75.292  33.561  1.00 24.44 ? 327  VAL C CB  1 
ATOM   7440  C  CG1 . VAL C  1 326 ? 2.361   76.716  33.138  1.00 23.22 ? 327  VAL C CG1 1 
ATOM   7441  C  CG2 . VAL C  1 326 ? 2.377   75.099  35.031  1.00 22.18 ? 327  VAL C CG2 1 
ATOM   7442  N  N   . LYS C  1 327 ? 1.368   74.801  30.384  1.00 27.73 ? 328  LYS C N   1 
ATOM   7443  C  CA  . LYS C  1 327 ? 1.615   75.282  29.017  1.00 28.87 ? 328  LYS C CA  1 
ATOM   7444  C  C   . LYS C  1 327 ? 1.780   76.774  29.032  1.00 28.37 ? 328  LYS C C   1 
ATOM   7445  O  O   . LYS C  1 327 ? 0.841   77.504  29.380  1.00 28.61 ? 328  LYS C O   1 
ATOM   7446  C  CB  . LYS C  1 327 ? 0.451   74.928  28.095  1.00 31.78 ? 328  LYS C CB  1 
ATOM   7447  C  CG  . LYS C  1 327 ? 0.681   75.341  26.641  1.00 36.09 ? 328  LYS C CG  1 
ATOM   7448  C  CD  . LYS C  1 327 ? -0.378  74.731  25.731  1.00 40.91 ? 328  LYS C CD  1 
ATOM   7449  C  CE  . LYS C  1 327 ? -0.059  74.952  24.260  1.00 42.93 ? 328  LYS C CE  1 
ATOM   7450  N  NZ  . LYS C  1 327 ? -1.039  74.180  23.434  1.00 51.13 ? 328  LYS C NZ  1 
ATOM   7451  N  N   . ALA C  1 328 ? 2.973   77.240  28.679  1.00 28.49 ? 329  ALA C N   1 
ATOM   7452  C  CA  . ALA C  1 328 ? 3.220   78.668  28.591  1.00 28.94 ? 329  ALA C CA  1 
ATOM   7453  C  C   . ALA C  1 328 ? 2.502   79.207  27.352  1.00 31.92 ? 329  ALA C C   1 
ATOM   7454  O  O   . ALA C  1 328 ? 2.453   80.412  27.151  1.00 34.64 ? 329  ALA C O   1 
ATOM   7455  C  CB  . ALA C  1 328 ? 4.694   78.947  28.506  1.00 29.38 ? 329  ALA C CB  1 
ATOM   7456  N  N   . SER D  1 1   ? 37.100  103.431 13.501  1.00 50.18 ? 2    SER D N   1 
ATOM   7457  C  CA  . SER D  1 1   ? 36.816  102.620 12.273  1.00 49.48 ? 2    SER D CA  1 
ATOM   7458  C  C   . SER D  1 1   ? 37.594  101.292 12.312  1.00 47.50 ? 2    SER D C   1 
ATOM   7459  O  O   . SER D  1 1   ? 38.685  101.180 11.744  1.00 47.85 ? 2    SER D O   1 
ATOM   7460  C  CB  . SER D  1 1   ? 37.177  103.442 11.032  1.00 50.21 ? 2    SER D CB  1 
ATOM   7461  O  OG  . SER D  1 1   ? 36.980  102.721 9.826   1.00 52.75 ? 2    SER D OG  1 
ATOM   7462  N  N   . MET D  1 2   ? 37.034  100.302 13.005  1.00 45.11 ? 3    MET D N   1 
ATOM   7463  C  CA  . MET D  1 2   ? 37.697  98.991  13.184  1.00 44.28 ? 3    MET D CA  1 
ATOM   7464  C  C   . MET D  1 2   ? 37.152  97.934  12.208  1.00 41.92 ? 3    MET D C   1 
ATOM   7465  O  O   . MET D  1 2   ? 36.061  98.073  11.664  1.00 41.24 ? 3    MET D O   1 
ATOM   7466  C  CB  . MET D  1 2   ? 37.518  98.489  14.630  1.00 44.64 ? 3    MET D CB  1 
ATOM   7467  C  CG  . MET D  1 2   ? 38.153  99.388  15.719  1.00 48.03 ? 3    MET D CG  1 
ATOM   7468  S  SD  . MET D  1 2   ? 39.968  99.511  15.652  1.00 53.06 ? 3    MET D SD  1 
ATOM   7469  C  CE  . MET D  1 2   ? 40.428  98.033  16.568  1.00 51.60 ? 3    MET D CE  1 
ATOM   7470  N  N   . THR D  1 3   ? 37.928  96.880  11.980  1.00 39.58 ? 4    THR D N   1 
ATOM   7471  C  CA  . THR D  1 3   ? 37.433  95.729  11.232  1.00 36.09 ? 4    THR D CA  1 
ATOM   7472  C  C   . THR D  1 3   ? 37.986  94.376  11.695  1.00 34.55 ? 4    THR D C   1 
ATOM   7473  O  O   . THR D  1 3   ? 39.150  94.250  12.104  1.00 33.60 ? 4    THR D O   1 
ATOM   7474  C  CB  . THR D  1 3   ? 37.634  95.881  9.699   1.00 35.64 ? 4    THR D CB  1 
ATOM   7475  O  OG1 . THR D  1 3   ? 36.859  94.868  9.031   1.00 34.05 ? 4    THR D OG1 1 
ATOM   7476  C  CG2 . THR D  1 3   ? 39.091  95.763  9.301   1.00 31.95 ? 4    THR D CG2 1 
ATOM   7477  N  N   . LYS D  1 4   ? 37.117  93.372  11.624  1.00 32.61 ? 5    LYS D N   1 
ATOM   7478  C  CA  . LYS D  1 4   ? 37.490  91.982  11.852  1.00 31.29 ? 5    LYS D CA  1 
ATOM   7479  C  C   . LYS D  1 4   ? 37.634  91.280  10.492  1.00 29.88 ? 5    LYS D C   1 
ATOM   7480  O  O   . LYS D  1 4   ? 36.783  91.452  9.612   1.00 28.93 ? 5    LYS D O   1 
ATOM   7481  C  CB  . LYS D  1 4   ? 36.436  91.280  12.696  1.00 31.66 ? 5    LYS D CB  1 
ATOM   7482  C  CG  . LYS D  1 4   ? 36.274  91.796  14.130  1.00 35.99 ? 5    LYS D CG  1 
ATOM   7483  C  CD  . LYS D  1 4   ? 34.886  91.417  14.663  1.00 42.98 ? 5    LYS D CD  1 
ATOM   7484  C  CE  . LYS D  1 4   ? 34.811  91.405  16.184  1.00 53.36 ? 5    LYS D CE  1 
ATOM   7485  N  NZ  . LYS D  1 4   ? 33.628  90.601  16.620  1.00 57.02 ? 5    LYS D NZ  1 
ATOM   7486  N  N   . THR D  1 5   ? 38.699  90.486  10.346  1.00 28.11 ? 6    THR D N   1 
ATOM   7487  C  CA  . THR D  1 5   ? 39.005  89.766  9.112   1.00 27.16 ? 6    THR D CA  1 
ATOM   7488  C  C   . THR D  1 5   ? 39.410  88.289  9.349   1.00 27.00 ? 6    THR D C   1 
ATOM   7489  O  O   . THR D  1 5   ? 40.241  87.980  10.213  1.00 26.49 ? 6    THR D O   1 
ATOM   7490  C  CB  . THR D  1 5   ? 40.108  90.501  8.345   1.00 28.12 ? 6    THR D CB  1 
ATOM   7491  O  OG1 . THR D  1 5   ? 39.704  91.860  8.134   1.00 26.26 ? 6    THR D OG1 1 
ATOM   7492  C  CG2 . THR D  1 5   ? 40.396  89.840  6.995   1.00 27.66 ? 6    THR D CG2 1 
ATOM   7493  N  N   . TRP D  1 6   ? 38.797  87.383  8.590   1.00 25.04 ? 7    TRP D N   1 
ATOM   7494  C  CA  . TRP D  1 6   ? 39.159  85.982  8.636   1.00 23.40 ? 7    TRP D CA  1 
ATOM   7495  C  C   . TRP D  1 6   ? 40.216  85.742  7.577   1.00 22.50 ? 7    TRP D C   1 
ATOM   7496  O  O   . TRP D  1 6   ? 40.025  86.057  6.400   1.00 22.72 ? 7    TRP D O   1 
ATOM   7497  C  CB  . TRP D  1 6   ? 37.964  85.067  8.397   1.00 23.71 ? 7    TRP D CB  1 
ATOM   7498  C  CG  . TRP D  1 6   ? 37.155  84.772  9.591   1.00 19.09 ? 7    TRP D CG  1 
ATOM   7499  C  CD1 . TRP D  1 6   ? 35.883  85.190  9.835   1.00 21.79 ? 7    TRP D CD1 1 
ATOM   7500  C  CD2 . TRP D  1 6   ? 37.549  83.988  10.721  1.00 20.15 ? 7    TRP D CD2 1 
ATOM   7501  N  NE1 . TRP D  1 6   ? 35.453  84.718  11.058  1.00 20.25 ? 7    TRP D NE1 1 
ATOM   7502  C  CE2 . TRP D  1 6   ? 36.457  83.967  11.617  1.00 23.95 ? 7    TRP D CE2 1 
ATOM   7503  C  CE3 . TRP D  1 6   ? 38.719  83.310  11.066  1.00 24.79 ? 7    TRP D CE3 1 
ATOM   7504  C  CZ2 . TRP D  1 6   ? 36.499  83.284  12.839  1.00 22.98 ? 7    TRP D CZ2 1 
ATOM   7505  C  CZ3 . TRP D  1 6   ? 38.759  82.617  12.265  1.00 23.12 ? 7    TRP D CZ3 1 
ATOM   7506  C  CH2 . TRP D  1 6   ? 37.657  82.614  13.144  1.00 22.86 ? 7    TRP D CH2 1 
ATOM   7507  N  N   . THR D  1 7   ? 41.334  85.195  8.016   1.00 19.90 ? 8    THR D N   1 
ATOM   7508  C  CA  . THR D  1 7   ? 42.478  84.933  7.146   1.00 23.16 ? 8    THR D CA  1 
ATOM   7509  C  C   . THR D  1 7   ? 42.764  83.440  7.139   1.00 21.76 ? 8    THR D C   1 
ATOM   7510  O  O   . THR D  1 7   ? 42.348  82.739  8.032   1.00 20.95 ? 8    THR D O   1 
ATOM   7511  C  CB  . THR D  1 7   ? 43.721  85.671  7.669   1.00 24.36 ? 8    THR D CB  1 
ATOM   7512  O  OG1 . THR D  1 7   ? 44.124  85.091  8.924   1.00 24.82 ? 8    THR D OG1 1 
ATOM   7513  C  CG2 . THR D  1 7   ? 43.378  87.167  7.859   1.00 20.17 ? 8    THR D CG2 1 
ATOM   7514  N  N   . LEU D  1 8   ? 43.459  82.978  6.111   1.00 23.69 ? 9    LEU D N   1 
ATOM   7515  C  CA  . LEU D  1 8   ? 43.864  81.601  5.990   1.00 24.10 ? 9    LEU D CA  1 
ATOM   7516  C  C   . LEU D  1 8   ? 45.154  81.399  6.757   1.00 25.04 ? 9    LEU D C   1 
ATOM   7517  O  O   . LEU D  1 8   ? 46.217  81.850  6.329   1.00 25.99 ? 9    LEU D O   1 
ATOM   7518  C  CB  . LEU D  1 8   ? 44.063  81.248  4.528   1.00 22.61 ? 9    LEU D CB  1 
ATOM   7519  C  CG  . LEU D  1 8   ? 44.444  79.793  4.209   1.00 24.98 ? 9    LEU D CG  1 
ATOM   7520  C  CD1 . LEU D  1 8   ? 43.219  78.884  4.261   1.00 20.00 ? 9    LEU D CD1 1 
ATOM   7521  C  CD2 . LEU D  1 8   ? 45.132  79.707  2.853   1.00 18.46 ? 9    LEU D CD2 1 
ATOM   7522  N  N   . LYS D  1 9   ? 45.066  80.720  7.891   1.00 25.50 ? 10   LYS D N   1 
ATOM   7523  C  CA  . LYS D  1 9   ? 46.264  80.441  8.686   1.00 27.87 ? 10   LYS D CA  1 
ATOM   7524  C  C   . LYS D  1 9   ? 47.096  79.333  8.063   1.00 28.50 ? 10   LYS D C   1 
ATOM   7525  O  O   . LYS D  1 9   ? 48.328  79.380  8.073   1.00 30.76 ? 10   LYS D O   1 
ATOM   7526  C  CB  . LYS D  1 9   ? 45.908  80.045  10.113  1.00 29.61 ? 10   LYS D CB  1 
ATOM   7527  C  CG  . LYS D  1 9   ? 47.142  80.053  11.055  1.00 33.93 ? 10   LYS D CG  1 
ATOM   7528  C  CD  . LYS D  1 9   ? 46.732  80.006  12.533  1.00 42.84 ? 10   LYS D CD  1 
ATOM   7529  C  CE  . LYS D  1 9   ? 46.663  78.590  13.097  1.00 47.75 ? 10   LYS D CE  1 
ATOM   7530  N  NZ  . LYS D  1 9   ? 45.622  78.445  14.157  1.00 51.50 ? 10   LYS D NZ  1 
ATOM   7531  N  N   . LYS D  1 10  ? 46.430  78.322  7.528   1.00 28.34 ? 11   LYS D N   1 
ATOM   7532  C  CA  . LYS D  1 10  ? 47.143  77.198  6.943   1.00 28.37 ? 11   LYS D CA  1 
ATOM   7533  C  C   . LYS D  1 10  ? 46.363  76.639  5.780   1.00 25.36 ? 11   LYS D C   1 
ATOM   7534  O  O   . LYS D  1 10  ? 45.145  76.569  5.839   1.00 24.12 ? 11   LYS D O   1 
ATOM   7535  C  CB  . LYS D  1 10  ? 47.375  76.109  8.000   1.00 29.55 ? 11   LYS D CB  1 
ATOM   7536  C  CG  . LYS D  1 10  ? 48.857  75.777  8.185   1.00 40.28 ? 11   LYS D CG  1 
ATOM   7537  C  CD  . LYS D  1 10  ? 49.133  74.323  8.605   1.00 48.47 ? 11   LYS D CD  1 
ATOM   7538  C  CE  . LYS D  1 10  ? 50.480  73.854  8.021   1.00 54.34 ? 11   LYS D CE  1 
ATOM   7539  N  NZ  . LYS D  1 10  ? 50.884  72.518  8.516   1.00 56.52 ? 11   LYS D NZ  1 
ATOM   7540  N  N   . HIS D  1 11  ? 47.075  76.243  4.728   1.00 23.60 ? 12   HIS D N   1 
ATOM   7541  C  CA  . HIS D  1 11  ? 46.461  75.622  3.572   1.00 23.01 ? 12   HIS D CA  1 
ATOM   7542  C  C   . HIS D  1 11  ? 45.712  74.366  3.982   1.00 21.29 ? 12   HIS D C   1 
ATOM   7543  O  O   . HIS D  1 11  ? 46.178  73.595  4.803   1.00 17.38 ? 12   HIS D O   1 
ATOM   7544  C  CB  . HIS D  1 11  ? 47.508  75.313  2.489   1.00 23.58 ? 12   HIS D CB  1 
ATOM   7545  C  CG  . HIS D  1 11  ? 47.869  76.508  1.678   1.00 26.27 ? 12   HIS D CG  1 
ATOM   7546  N  ND1 . HIS D  1 11  ? 46.973  77.109  0.823   1.00 20.91 ? 12   HIS D ND1 1 
ATOM   7547  C  CD2 . HIS D  1 11  ? 49.005  77.244  1.622   1.00 24.45 ? 12   HIS D CD2 1 
ATOM   7548  C  CE1 . HIS D  1 11  ? 47.548  78.160  0.266   1.00 27.69 ? 12   HIS D CE1 1 
ATOM   7549  N  NE2 . HIS D  1 11  ? 48.781  78.263  0.734   1.00 26.38 ? 12   HIS D NE2 1 
ATOM   7550  N  N   . PHE D  1 12  ? 44.529  74.191  3.397   1.00 22.45 ? 13   PHE D N   1 
ATOM   7551  C  CA  . PHE D  1 12  ? 43.653  73.061  3.722   1.00 20.09 ? 13   PHE D CA  1 
ATOM   7552  C  C   . PHE D  1 12  ? 44.326  71.748  3.309   1.00 20.20 ? 13   PHE D C   1 
ATOM   7553  O  O   . PHE D  1 12  ? 45.014  71.656  2.260   1.00 16.68 ? 13   PHE D O   1 
ATOM   7554  C  CB  . PHE D  1 12  ? 42.292  73.194  3.035   1.00 19.50 ? 13   PHE D CB  1 
ATOM   7555  C  CG  . PHE D  1 12  ? 41.598  74.522  3.276   1.00 18.04 ? 13   PHE D CG  1 
ATOM   7556  C  CD1 . PHE D  1 12  ? 41.495  75.048  4.539   1.00 17.13 ? 13   PHE D CD1 1 
ATOM   7557  C  CD2 . PHE D  1 12  ? 41.061  75.245  2.213   1.00 17.31 ? 13   PHE D CD2 1 
ATOM   7558  C  CE1 . PHE D  1 12  ? 40.865  76.298  4.746   1.00 23.07 ? 13   PHE D CE1 1 
ATOM   7559  C  CE2 . PHE D  1 12  ? 40.432  76.468  2.415   1.00 17.91 ? 13   PHE D CE2 1 
ATOM   7560  C  CZ  . PHE D  1 12  ? 40.317  76.989  3.682   1.00 17.26 ? 13   PHE D CZ  1 
ATOM   7561  N  N   . VAL D  1 13  ? 44.173  70.758  4.174   1.00 20.42 ? 14   VAL D N   1 
ATOM   7562  C  CA  . VAL D  1 13  ? 44.556  69.379  3.879   1.00 20.44 ? 14   VAL D CA  1 
ATOM   7563  C  C   . VAL D  1 13  ? 43.325  68.575  4.235   1.00 18.30 ? 14   VAL D C   1 
ATOM   7564  O  O   . VAL D  1 13  ? 42.969  68.487  5.394   1.00 19.53 ? 14   VAL D O   1 
ATOM   7565  C  CB  . VAL D  1 13  ? 45.779  68.930  4.737   1.00 23.39 ? 14   VAL D CB  1 
ATOM   7566  C  CG1 . VAL D  1 13  ? 46.078  67.420  4.533   1.00 20.35 ? 14   VAL D CG1 1 
ATOM   7567  C  CG2 . VAL D  1 13  ? 47.004  69.782  4.418   1.00 17.48 ? 14   VAL D CG2 1 
ATOM   7568  N  N   . GLY D  1 14  ? 42.654  68.010  3.243   1.00 17.10 ? 15   GLY D N   1 
ATOM   7569  C  CA  . GLY D  1 14  ? 41.339  67.405  3.440   1.00 16.86 ? 15   GLY D CA  1 
ATOM   7570  C  C   . GLY D  1 14  ? 40.301  68.489  3.703   1.00 18.08 ? 15   GLY D C   1 
ATOM   7571  O  O   . GLY D  1 14  ? 40.409  69.581  3.182   1.00 18.69 ? 15   GLY D O   1 
ATOM   7572  N  N   . TYR D  1 15  ? 39.291  68.197  4.501   1.00 19.19 ? 16   TYR D N   1 
ATOM   7573  C  CA  . TYR D  1 15  ? 38.370  69.239  4.925   1.00 20.64 ? 16   TYR D CA  1 
ATOM   7574  C  C   . TYR D  1 15  ? 39.078  70.317  5.739   1.00 19.92 ? 16   TYR D C   1 
ATOM   7575  O  O   . TYR D  1 15  ? 39.994  70.026  6.513   1.00 18.57 ? 16   TYR D O   1 
ATOM   7576  C  CB  . TYR D  1 15  ? 37.203  68.661  5.744   1.00 19.38 ? 16   TYR D CB  1 
ATOM   7577  C  CG  . TYR D  1 15  ? 36.223  67.918  4.893   1.00 20.31 ? 16   TYR D CG  1 
ATOM   7578  C  CD1 . TYR D  1 15  ? 35.312  68.599  4.122   1.00 20.33 ? 16   TYR D CD1 1 
ATOM   7579  C  CD2 . TYR D  1 15  ? 36.209  66.535  4.858   1.00 20.99 ? 16   TYR D CD2 1 
ATOM   7580  C  CE1 . TYR D  1 15  ? 34.414  67.926  3.313   1.00 20.95 ? 16   TYR D CE1 1 
ATOM   7581  C  CE2 . TYR D  1 15  ? 35.318  65.855  4.081   1.00 25.79 ? 16   TYR D CE2 1 
ATOM   7582  C  CZ  . TYR D  1 15  ? 34.422  66.556  3.297   1.00 24.75 ? 16   TYR D CZ  1 
ATOM   7583  O  OH  . TYR D  1 15  ? 33.547  65.888  2.492   1.00 24.29 ? 16   TYR D OH  1 
ATOM   7584  N  N   . PRO D  1 16  ? 38.638  71.574  5.581   1.00 19.53 ? 17   PRO D N   1 
ATOM   7585  C  CA  . PRO D  1 16  ? 39.170  72.587  6.478   1.00 20.56 ? 17   PRO D CA  1 
ATOM   7586  C  C   . PRO D  1 16  ? 38.801  72.309  7.932   1.00 19.19 ? 17   PRO D C   1 
ATOM   7587  O  O   . PRO D  1 16  ? 37.801  71.629  8.189   1.00 19.42 ? 17   PRO D O   1 
ATOM   7588  C  CB  . PRO D  1 16  ? 38.510  73.882  5.994   1.00 19.95 ? 17   PRO D CB  1 
ATOM   7589  C  CG  . PRO D  1 16  ? 38.092  73.594  4.556   1.00 19.83 ? 17   PRO D CG  1 
ATOM   7590  C  CD  . PRO D  1 16  ? 37.752  72.146  4.546   1.00 19.89 ? 17   PRO D CD  1 
ATOM   7591  N  N   . THR D  1 17  ? 39.623  72.816  8.852   1.00 18.42 ? 18   THR D N   1 
ATOM   7592  C  CA  . THR D  1 17  ? 39.370  72.729  10.277  1.00 19.18 ? 18   THR D CA  1 
ATOM   7593  C  C   . THR D  1 17  ? 39.508  74.126  10.896  1.00 20.56 ? 18   THR D C   1 
ATOM   7594  O  O   . THR D  1 17  ? 40.018  75.032  10.261  1.00 19.66 ? 18   THR D O   1 
ATOM   7595  C  CB  . THR D  1 17  ? 40.320  71.698  10.950  1.00 20.59 ? 18   THR D CB  1 
ATOM   7596  O  OG1 . THR D  1 17  ? 41.644  72.237  11.100  1.00 18.82 ? 18   THR D OG1 1 
ATOM   7597  C  CG2 . THR D  1 17  ? 40.369  70.382  10.125  1.00 17.62 ? 18   THR D CG2 1 
ATOM   7598  N  N   . ASN D  1 18  ? 39.026  74.303  12.123  1.00 20.79 ? 19   ASN D N   1 
ATOM   7599  C  CA  . ASN D  1 18  ? 39.156  75.581  12.838  1.00 22.83 ? 19   ASN D CA  1 
ATOM   7600  C  C   . ASN D  1 18  ? 40.590  76.131  12.856  1.00 22.57 ? 19   ASN D C   1 
ATOM   7601  O  O   . ASN D  1 18  ? 40.813  77.316  12.643  1.00 20.23 ? 19   ASN D O   1 
ATOM   7602  C  CB  . ASN D  1 18  ? 38.627  75.436  14.275  1.00 23.35 ? 19   ASN D CB  1 
ATOM   7603  C  CG  . ASN D  1 18  ? 37.119  75.201  14.318  1.00 21.87 ? 19   ASN D CG  1 
ATOM   7604  O  OD1 . ASN D  1 18  ? 36.442  75.253  13.297  1.00 23.53 ? 19   ASN D OD1 1 
ATOM   7605  N  ND2 . ASN D  1 18  ? 36.596  74.943  15.494  1.00 20.83 ? 19   ASN D ND2 1 
ATOM   7606  N  N   . SER D  1 19  ? 41.567  75.258  13.072  1.00 23.18 ? 20   SER D N   1 
ATOM   7607  C  CA  . SER D  1 19  ? 42.959  75.685  13.103  1.00 23.29 ? 20   SER D CA  1 
ATOM   7608  C  C   . SER D  1 19  ? 43.443  76.241  11.766  1.00 23.13 ? 20   SER D C   1 
ATOM   7609  O  O   . SER D  1 19  ? 44.447  76.906  11.741  1.00 23.12 ? 20   SER D O   1 
ATOM   7610  C  CB  . SER D  1 19  ? 43.871  74.538  13.559  1.00 24.21 ? 20   SER D CB  1 
ATOM   7611  O  OG  . SER D  1 19  ? 44.027  73.578  12.533  1.00 29.39 ? 20   SER D OG  1 
ATOM   7612  N  N   . ASP D  1 20  ? 42.761  75.973  10.644  1.00 23.91 ? 21   ASP D N   1 
ATOM   7613  C  CA  . ASP D  1 20  ? 43.195  76.557  9.378   1.00 21.49 ? 21   ASP D CA  1 
ATOM   7614  C  C   . ASP D  1 20  ? 42.830  78.043  9.189   1.00 22.39 ? 21   ASP D C   1 
ATOM   7615  O  O   . ASP D  1 20  ? 43.318  78.677  8.249   1.00 20.07 ? 21   ASP D O   1 
ATOM   7616  C  CB  . ASP D  1 20  ? 42.629  75.785  8.202   1.00 22.25 ? 21   ASP D CB  1 
ATOM   7617  C  CG  . ASP D  1 20  ? 43.028  74.338  8.206   1.00 25.42 ? 21   ASP D CG  1 
ATOM   7618  O  OD1 . ASP D  1 20  ? 44.178  74.037  8.590   1.00 22.19 ? 21   ASP D OD1 1 
ATOM   7619  O  OD2 . ASP D  1 20  ? 42.163  73.501  7.828   1.00 22.81 ? 21   ASP D OD2 1 
ATOM   7620  N  N   . PHE D  1 21  ? 41.979  78.586  10.056  1.00 21.28 ? 22   PHE D N   1 
ATOM   7621  C  CA  . PHE D  1 21  ? 41.548  79.994  9.955   1.00 22.82 ? 22   PHE D CA  1 
ATOM   7622  C  C   . PHE D  1 21  ? 42.032  80.821  11.143  1.00 25.26 ? 22   PHE D C   1 
ATOM   7623  O  O   . PHE D  1 21  ? 42.164  80.302  12.253  1.00 24.35 ? 22   PHE D O   1 
ATOM   7624  C  CB  . PHE D  1 21  ? 40.020  80.089  9.897   1.00 21.27 ? 22   PHE D CB  1 
ATOM   7625  C  CG  . PHE D  1 21  ? 39.413  79.263  8.812   1.00 17.40 ? 22   PHE D CG  1 
ATOM   7626  C  CD1 . PHE D  1 21  ? 39.051  77.942  9.053   1.00 19.44 ? 22   PHE D CD1 1 
ATOM   7627  C  CD2 . PHE D  1 21  ? 39.206  79.793  7.553   1.00 19.89 ? 22   PHE D CD2 1 
ATOM   7628  C  CE1 . PHE D  1 21  ? 38.482  77.166  8.048   1.00 16.10 ? 22   PHE D CE1 1 
ATOM   7629  C  CE2 . PHE D  1 21  ? 38.647  79.015  6.538   1.00 21.09 ? 22   PHE D CE2 1 
ATOM   7630  C  CZ  . PHE D  1 21  ? 38.299  77.691  6.790   1.00 16.96 ? 22   PHE D CZ  1 
ATOM   7631  N  N   . GLU D  1 22  ? 42.288  82.104  10.905  1.00 25.04 ? 23   GLU D N   1 
ATOM   7632  C  CA  . GLU D  1 22  ? 42.635  83.010  11.982  1.00 27.45 ? 23   GLU D CA  1 
ATOM   7633  C  C   . GLU D  1 22  ? 41.953  84.369  11.819  1.00 26.85 ? 23   GLU D C   1 
ATOM   7634  O  O   . GLU D  1 22  ? 42.098  85.035  10.805  1.00 26.00 ? 23   GLU D O   1 
ATOM   7635  C  CB  . GLU D  1 22  ? 44.147  83.192  12.076  1.00 27.56 ? 23   GLU D CB  1 
ATOM   7636  C  CG  . GLU D  1 22  ? 44.559  84.125  13.211  1.00 31.94 ? 23   GLU D CG  1 
ATOM   7637  C  CD  . GLU D  1 22  ? 46.052  84.193  13.404  1.00 36.50 ? 23   GLU D CD  1 
ATOM   7638  O  OE1 . GLU D  1 22  ? 46.801  83.969  12.441  1.00 36.70 ? 23   GLU D OE1 1 
ATOM   7639  O  OE2 . GLU D  1 22  ? 46.480  84.472  14.530  1.00 49.11 ? 23   GLU D OE2 1 
ATOM   7640  N  N   . LEU D  1 23  ? 41.229  84.749  12.856  1.00 28.57 ? 24   LEU D N   1 
ATOM   7641  C  CA  . LEU D  1 23  ? 40.487  86.006  12.947  1.00 30.70 ? 24   LEU D CA  1 
ATOM   7642  C  C   . LEU D  1 23  ? 41.389  87.124  13.459  1.00 31.52 ? 24   LEU D C   1 
ATOM   7643  O  O   . LEU D  1 23  ? 41.962  87.004  14.547  1.00 30.91 ? 24   LEU D O   1 
ATOM   7644  C  CB  . LEU D  1 23  ? 39.332  85.810  13.933  1.00 30.97 ? 24   LEU D CB  1 
ATOM   7645  C  CG  . LEU D  1 23  ? 38.403  86.997  14.204  1.00 34.97 ? 24   LEU D CG  1 
ATOM   7646  C  CD1 . LEU D  1 23  ? 37.652  87.376  12.954  1.00 31.43 ? 24   LEU D CD1 1 
ATOM   7647  C  CD2 . LEU D  1 23  ? 37.441  86.598  15.332  1.00 34.95 ? 24   LEU D CD2 1 
ATOM   7648  N  N   . LYS D  1 24  ? 41.522  88.191  12.669  1.00 33.27 ? 25   LYS D N   1 
ATOM   7649  C  CA  . LYS D  1 24  ? 42.354  89.342  13.020  1.00 34.57 ? 25   LYS D CA  1 
ATOM   7650  C  C   . LYS D  1 24  ? 41.532  90.628  13.078  1.00 35.09 ? 25   LYS D C   1 
ATOM   7651  O  O   . LYS D  1 24  ? 40.623  90.849  12.265  1.00 33.55 ? 25   LYS D O   1 
ATOM   7652  C  CB  . LYS D  1 24  ? 43.517  89.491  12.028  1.00 34.82 ? 25   LYS D CB  1 
ATOM   7653  C  CG  . LYS D  1 24  ? 44.551  88.365  12.140  1.00 39.91 ? 25   LYS D CG  1 
ATOM   7654  C  CD  . LYS D  1 24  ? 45.785  88.605  11.296  1.00 44.24 ? 25   LYS D CD  1 
ATOM   7655  C  CE  . LYS D  1 24  ? 46.741  87.407  11.350  1.00 50.44 ? 25   LYS D CE  1 
ATOM   7656  N  NZ  . LYS D  1 24  ? 48.100  87.694  10.771  1.00 51.28 ? 25   LYS D NZ  1 
ATOM   7657  N  N   . THR D  1 25  ? 41.863  91.457  14.064  1.00 35.79 ? 26   THR D N   1 
ATOM   7658  C  CA  . THR D  1 25  ? 41.269  92.771  14.265  1.00 35.48 ? 26   THR D CA  1 
ATOM   7659  C  C   . THR D  1 25  ? 42.274  93.837  13.804  1.00 36.82 ? 26   THR D C   1 
ATOM   7660  O  O   . THR D  1 25  ? 43.485  93.713  14.014  1.00 36.15 ? 26   THR D O   1 
ATOM   7661  C  CB  . THR D  1 25  ? 40.893  92.959  15.729  1.00 36.23 ? 26   THR D CB  1 
ATOM   7662  O  OG1 . THR D  1 25  ? 39.905  91.982  16.079  1.00 38.36 ? 26   THR D OG1 1 
ATOM   7663  C  CG2 . THR D  1 25  ? 40.327  94.337  15.991  1.00 38.63 ? 26   THR D CG2 1 
ATOM   7664  N  N   . SER D  1 26  ? 41.768  94.868  13.144  1.00 36.68 ? 27   SER D N   1 
ATOM   7665  C  CA  . SER D  1 26  ? 42.619  95.840  12.471  1.00 37.37 ? 27   SER D CA  1 
ATOM   7666  C  C   . SER D  1 26  ? 41.953  97.219  12.425  1.00 38.37 ? 27   SER D C   1 
ATOM   7667  O  O   . SER D  1 26  ? 40.725  97.341  12.607  1.00 38.48 ? 27   SER D O   1 
ATOM   7668  C  CB  . SER D  1 26  ? 42.919  95.331  11.073  1.00 37.50 ? 27   SER D CB  1 
ATOM   7669  O  OG  . SER D  1 26  ? 42.939  96.379  10.147  1.00 45.20 ? 27   SER D OG  1 
ATOM   7670  N  N   . GLU D  1 27  ? 42.761  98.255  12.191  1.00 39.50 ? 28   GLU D N   1 
ATOM   7671  C  CA  . GLU D  1 27  ? 42.267  99.636  12.180  1.00 39.51 ? 28   GLU D CA  1 
ATOM   7672  C  C   . GLU D  1 27  ? 42.243  100.090 10.742  1.00 38.10 ? 28   GLU D C   1 
ATOM   7673  O  O   . GLU D  1 27  ? 43.245  99.960  10.044  1.00 39.76 ? 28   GLU D O   1 
ATOM   7674  C  CB  . GLU D  1 27  ? 43.163  100.578 13.011  1.00 39.99 ? 28   GLU D CB  1 
ATOM   7675  N  N   . LEU D  1 28  ? 41.109  100.618 10.287  1.00 35.76 ? 29   LEU D N   1 
ATOM   7676  C  CA  . LEU D  1 28  ? 41.049  101.152 8.931   1.00 36.55 ? 29   LEU D CA  1 
ATOM   7677  C  C   . LEU D  1 28  ? 41.453  102.631 8.895   1.00 36.21 ? 29   LEU D C   1 
ATOM   7678  O  O   . LEU D  1 28  ? 41.152  103.386 9.821   1.00 33.16 ? 29   LEU D O   1 
ATOM   7679  C  CB  . LEU D  1 28  ? 39.652  100.957 8.334   1.00 36.04 ? 29   LEU D CB  1 
ATOM   7680  C  CG  . LEU D  1 28  ? 39.350  99.529  7.862   1.00 37.55 ? 29   LEU D CG  1 
ATOM   7681  C  CD1 . LEU D  1 28  ? 37.896  99.431  7.440   1.00 35.62 ? 29   LEU D CD1 1 
ATOM   7682  C  CD2 . LEU D  1 28  ? 40.281  99.120  6.720   1.00 35.35 ? 29   LEU D CD2 1 
ATOM   7683  N  N   . PRO D  1 29  ? 42.118  103.053 7.810   1.00 38.43 ? 30   PRO D N   1 
ATOM   7684  C  CA  . PRO D  1 29  ? 42.416  104.480 7.674   1.00 39.64 ? 30   PRO D CA  1 
ATOM   7685  C  C   . PRO D  1 29  ? 41.146  105.340 7.583   1.00 43.07 ? 30   PRO D C   1 
ATOM   7686  O  O   . PRO D  1 29  ? 40.030  104.805 7.550   1.00 43.57 ? 30   PRO D O   1 
ATOM   7687  C  CB  . PRO D  1 29  ? 43.214  104.553 6.373   1.00 39.65 ? 30   PRO D CB  1 
ATOM   7688  C  CG  . PRO D  1 29  ? 42.838  103.333 5.606   1.00 40.87 ? 30   PRO D CG  1 
ATOM   7689  C  CD  . PRO D  1 29  ? 42.502  102.277 6.616   1.00 38.12 ? 30   PRO D CD  1 
ATOM   7690  N  N   . PRO D  1 30  ? 41.302  106.678 7.587   1.00 45.02 ? 31   PRO D N   1 
ATOM   7691  C  CA  . PRO D  1 30  ? 40.144  107.536 7.270   1.00 43.57 ? 31   PRO D CA  1 
ATOM   7692  C  C   . PRO D  1 30  ? 39.831  107.476 5.778   1.00 41.50 ? 31   PRO D C   1 
ATOM   7693  O  O   . PRO D  1 30  ? 40.711  107.140 4.986   1.00 40.02 ? 31   PRO D O   1 
ATOM   7694  C  CB  . PRO D  1 30  ? 40.614  108.951 7.669   1.00 44.67 ? 31   PRO D CB  1 
ATOM   7695  C  CG  . PRO D  1 30  ? 42.132  108.881 7.705   1.00 46.59 ? 31   PRO D CG  1 
ATOM   7696  C  CD  . PRO D  1 30  ? 42.522  107.445 7.927   1.00 44.61 ? 31   PRO D CD  1 
ATOM   7697  N  N   . LEU D  1 31  ? 38.590  107.805 5.412   1.00 41.06 ? 32   LEU D N   1 
ATOM   7698  C  CA  . LEU D  1 31  ? 38.171  107.858 4.006   1.00 40.42 ? 32   LEU D CA  1 
ATOM   7699  C  C   . LEU D  1 31  ? 38.824  109.022 3.260   1.00 40.37 ? 32   LEU D C   1 
ATOM   7700  O  O   . LEU D  1 31  ? 38.897  110.121 3.784   1.00 41.08 ? 32   LEU D O   1 
ATOM   7701  C  CB  . LEU D  1 31  ? 36.646  108.038 3.907   1.00 39.43 ? 32   LEU D CB  1 
ATOM   7702  C  CG  . LEU D  1 31  ? 35.721  106.930 4.404   1.00 39.14 ? 32   LEU D CG  1 
ATOM   7703  C  CD1 . LEU D  1 31  ? 34.271  107.354 4.275   1.00 34.44 ? 32   LEU D CD1 1 
ATOM   7704  C  CD2 . LEU D  1 31  ? 35.981  105.635 3.613   1.00 38.20 ? 32   LEU D CD2 1 
ATOM   7705  N  N   . LYS D  1 32  ? 39.270  108.779 2.033   1.00 41.03 ? 33   LYS D N   1 
ATOM   7706  C  CA  . LYS D  1 32  ? 39.746  109.842 1.138   1.00 42.25 ? 33   LYS D CA  1 
ATOM   7707  C  C   . LYS D  1 32  ? 38.615  110.219 0.165   1.00 43.46 ? 33   LYS D C   1 
ATOM   7708  O  O   . LYS D  1 32  ? 37.610  109.498 0.063   1.00 42.33 ? 33   LYS D O   1 
ATOM   7709  C  CB  . LYS D  1 32  ? 40.959  109.358 0.334   1.00 42.89 ? 33   LYS D CB  1 
ATOM   7710  C  CG  . LYS D  1 32  ? 42.171  108.884 1.164   1.00 45.35 ? 33   LYS D CG  1 
ATOM   7711  C  CD  . LYS D  1 32  ? 43.304  108.389 0.246   1.00 49.70 ? 33   LYS D CD  1 
ATOM   7712  C  CE  . LYS D  1 32  ? 44.575  108.055 1.033   1.00 53.28 ? 33   LYS D CE  1 
ATOM   7713  N  NZ  . LYS D  1 32  ? 44.404  106.879 1.935   1.00 51.27 ? 33   LYS D NZ  1 
ATOM   7714  N  N   . ASN D  1 33  ? 38.774  111.321 -0.574  1.00 42.97 ? 34   ASN D N   1 
ATOM   7715  C  CA  . ASN D  1 33  ? 37.731  111.726 -1.534  1.00 42.69 ? 34   ASN D CA  1 
ATOM   7716  C  C   . ASN D  1 33  ? 37.371  110.592 -2.490  1.00 40.63 ? 34   ASN D C   1 
ATOM   7717  O  O   . ASN D  1 33  ? 38.237  109.837 -2.931  1.00 40.32 ? 34   ASN D O   1 
ATOM   7718  C  CB  . ASN D  1 33  ? 38.113  112.992 -2.326  1.00 42.61 ? 34   ASN D CB  1 
ATOM   7719  C  CG  . ASN D  1 33  ? 37.220  114.174 -1.991  1.00 48.63 ? 34   ASN D CG  1 
ATOM   7720  O  OD1 . ASN D  1 33  ? 35.996  114.145 -2.240  1.00 48.89 ? 34   ASN D OD1 1 
ATOM   7721  N  ND2 . ASN D  1 33  ? 37.820  115.225 -1.409  1.00 49.62 ? 34   ASN D ND2 1 
ATOM   7722  N  N   . GLY D  1 34  ? 36.081  110.471 -2.790  1.00 39.56 ? 35   GLY D N   1 
ATOM   7723  C  CA  . GLY D  1 34  ? 35.592  109.413 -3.669  1.00 37.43 ? 35   GLY D CA  1 
ATOM   7724  C  C   . GLY D  1 34  ? 35.318  108.084 -2.975  1.00 35.24 ? 35   GLY D C   1 
ATOM   7725  O  O   . GLY D  1 34  ? 34.807  107.173 -3.612  1.00 37.77 ? 35   GLY D O   1 
ATOM   7726  N  N   . GLU D  1 35  ? 35.615  107.974 -1.679  1.00 33.75 ? 36   GLU D N   1 
ATOM   7727  C  CA  . GLU D  1 35  ? 35.593  106.677 -0.980  1.00 32.02 ? 36   GLU D CA  1 
ATOM   7728  C  C   . GLU D  1 35  ? 34.398  106.483 -0.070  1.00 31.05 ? 36   GLU D C   1 
ATOM   7729  O  O   . GLU D  1 35  ? 33.746  107.448 0.347   1.00 32.55 ? 36   GLU D O   1 
ATOM   7730  C  CB  . GLU D  1 35  ? 36.882  106.455 -0.168  1.00 31.25 ? 36   GLU D CB  1 
ATOM   7731  C  CG  . GLU D  1 35  ? 38.103  106.111 -1.039  1.00 30.53 ? 36   GLU D CG  1 
ATOM   7732  C  CD  . GLU D  1 35  ? 39.387  105.885 -0.259  1.00 30.34 ? 36   GLU D CD  1 
ATOM   7733  O  OE1 . GLU D  1 35  ? 39.457  106.242 0.935   1.00 28.65 ? 36   GLU D OE1 1 
ATOM   7734  O  OE2 . GLU D  1 35  ? 40.332  105.333 -0.851  1.00 32.24 ? 36   GLU D OE2 1 
ATOM   7735  N  N   . VAL D  1 36  ? 34.131  105.222 0.250   1.00 28.17 ? 37   VAL D N   1 
ATOM   7736  C  CA  . VAL D  1 36  ? 33.059  104.860 1.173   1.00 27.32 ? 37   VAL D CA  1 
ATOM   7737  C  C   . VAL D  1 36  ? 33.539  103.803 2.170   1.00 27.07 ? 37   VAL D C   1 
ATOM   7738  O  O   . VAL D  1 36  ? 34.409  102.992 1.855   1.00 27.06 ? 37   VAL D O   1 
ATOM   7739  C  CB  . VAL D  1 36  ? 31.839  104.327 0.405   1.00 26.92 ? 37   VAL D CB  1 
ATOM   7740  C  CG1 . VAL D  1 36  ? 31.290  105.393 -0.538  1.00 23.21 ? 37   VAL D CG1 1 
ATOM   7741  C  CG2 . VAL D  1 36  ? 32.202  103.082 -0.372  1.00 22.31 ? 37   VAL D CG2 1 
ATOM   7742  N  N   . LEU D  1 37  ? 32.985  103.844 3.378   1.00 27.51 ? 38   LEU D N   1 
ATOM   7743  C  CA  . LEU D  1 37  ? 33.167  102.795 4.358   1.00 27.70 ? 38   LEU D CA  1 
ATOM   7744  C  C   . LEU D  1 37  ? 31.975  101.882 4.223   1.00 27.44 ? 38   LEU D C   1 
ATOM   7745  O  O   . LEU D  1 37  ? 30.832  102.340 4.320   1.00 29.21 ? 38   LEU D O   1 
ATOM   7746  C  CB  . LEU D  1 37  ? 33.214  103.362 5.774   1.00 28.31 ? 38   LEU D CB  1 
ATOM   7747  C  CG  . LEU D  1 37  ? 33.296  102.361 6.939   1.00 31.02 ? 38   LEU D CG  1 
ATOM   7748  C  CD1 . LEU D  1 37  ? 34.612  101.574 6.921   1.00 28.19 ? 38   LEU D CD1 1 
ATOM   7749  C  CD2 . LEU D  1 37  ? 33.140  103.053 8.268   1.00 31.78 ? 38   LEU D CD2 1 
ATOM   7750  N  N   . LEU D  1 38  ? 32.234  100.594 4.009   1.00 27.36 ? 39   LEU D N   1 
ATOM   7751  C  CA  . LEU D  1 38  ? 31.173  99.593  3.853   1.00 26.18 ? 39   LEU D CA  1 
ATOM   7752  C  C   . LEU D  1 38  ? 31.063  98.709  5.076   1.00 26.15 ? 39   LEU D C   1 
ATOM   7753  O  O   . LEU D  1 38  ? 32.066  98.234  5.610   1.00 27.66 ? 39   LEU D O   1 
ATOM   7754  C  CB  . LEU D  1 38  ? 31.475  98.700  2.669   1.00 25.60 ? 39   LEU D CB  1 
ATOM   7755  C  CG  . LEU D  1 38  ? 31.595  99.374  1.326   1.00 25.39 ? 39   LEU D CG  1 
ATOM   7756  C  CD1 . LEU D  1 38  ? 32.057  98.348  0.258   1.00 23.64 ? 39   LEU D CD1 1 
ATOM   7757  C  CD2 . LEU D  1 38  ? 30.245  99.968  1.013   1.00 25.55 ? 39   LEU D CD2 1 
ATOM   7758  N  N   . GLU D  1 39  ? 29.842  98.473  5.517   1.00 25.78 ? 40   GLU D N   1 
ATOM   7759  C  CA  . GLU D  1 39  ? 29.602  97.573  6.618   1.00 25.15 ? 40   GLU D CA  1 
ATOM   7760  C  C   . GLU D  1 39  ? 28.845  96.379  6.124   1.00 24.59 ? 40   GLU D C   1 
ATOM   7761  O  O   . GLU D  1 39  ? 27.745  96.516  5.568   1.00 24.70 ? 40   GLU D O   1 
ATOM   7762  C  CB  . GLU D  1 39  ? 28.799  98.235  7.720   1.00 26.24 ? 40   GLU D CB  1 
ATOM   7763  C  CG  . GLU D  1 39  ? 28.591  97.334  8.919   1.00 31.17 ? 40   GLU D CG  1 
ATOM   7764  C  CD  . GLU D  1 39  ? 28.010  98.085  10.106  1.00 42.30 ? 40   GLU D CD  1 
ATOM   7765  O  OE1 . GLU D  1 39  ? 28.795  98.775  10.810  1.00 44.55 ? 40   GLU D OE1 1 
ATOM   7766  O  OE2 . GLU D  1 39  ? 26.777  97.970  10.321  1.00 38.23 ? 40   GLU D OE2 1 
ATOM   7767  N  N   . ALA D  1 40  ? 29.446  95.216  6.372   1.00 23.97 ? 41   ALA D N   1 
ATOM   7768  C  CA  . ALA D  1 40  ? 28.921  93.932  5.984   1.00 24.50 ? 41   ALA D CA  1 
ATOM   7769  C  C   . ALA D  1 40  ? 27.601  93.667  6.668   1.00 23.67 ? 41   ALA D C   1 
ATOM   7770  O  O   . ALA D  1 40  ? 27.515  93.761  7.877   1.00 25.99 ? 41   ALA D O   1 
ATOM   7771  C  CB  . ALA D  1 40  ? 29.926  92.844  6.346   1.00 21.59 ? 41   ALA D CB  1 
ATOM   7772  N  N   . LEU D  1 41  ? 26.577  93.338  5.886   1.00 24.79 ? 42   LEU D N   1 
ATOM   7773  C  CA  . LEU D  1 41  ? 25.285  92.873  6.418   1.00 23.16 ? 42   LEU D CA  1 
ATOM   7774  C  C   . LEU D  1 41  ? 25.177  91.358  6.303   1.00 22.71 ? 42   LEU D C   1 
ATOM   7775  O  O   . LEU D  1 41  ? 24.861  90.670  7.275   1.00 18.50 ? 42   LEU D O   1 
ATOM   7776  C  CB  . LEU D  1 41  ? 24.130  93.516  5.657   1.00 23.60 ? 42   LEU D CB  1 
ATOM   7777  C  CG  . LEU D  1 41  ? 24.025  95.043  5.697   1.00 25.45 ? 42   LEU D CG  1 
ATOM   7778  C  CD1 . LEU D  1 41  ? 22.792  95.468  4.883   1.00 25.48 ? 42   LEU D CD1 1 
ATOM   7779  C  CD2 . LEU D  1 41  ? 23.967  95.597  7.152   1.00 24.31 ? 42   LEU D CD2 1 
ATOM   7780  N  N   . PHE D  1 42  ? 25.457  90.832  5.106   1.00 23.74 ? 43   PHE D N   1 
ATOM   7781  C  CA  . PHE D  1 42  ? 25.372  89.393  4.886   1.00 23.32 ? 43   PHE D CA  1 
ATOM   7782  C  C   . PHE D  1 42  ? 26.551  88.963  4.075   1.00 23.71 ? 43   PHE D C   1 
ATOM   7783  O  O   . PHE D  1 42  ? 26.847  89.582  3.058   1.00 24.46 ? 43   PHE D O   1 
ATOM   7784  C  CB  . PHE D  1 42  ? 24.122  89.018  4.106   1.00 22.67 ? 43   PHE D CB  1 
ATOM   7785  C  CG  . PHE D  1 42  ? 22.840  89.290  4.815   1.00 20.70 ? 43   PHE D CG  1 
ATOM   7786  C  CD1 . PHE D  1 42  ? 22.335  88.393  5.736   1.00 25.40 ? 43   PHE D CD1 1 
ATOM   7787  C  CD2 . PHE D  1 42  ? 22.089  90.430  4.498   1.00 25.83 ? 43   PHE D CD2 1 
ATOM   7788  C  CE1 . PHE D  1 42  ? 21.104  88.633  6.379   1.00 27.60 ? 43   PHE D CE1 1 
ATOM   7789  C  CE2 . PHE D  1 42  ? 20.874  90.689  5.128   1.00 28.43 ? 43   PHE D CE2 1 
ATOM   7790  C  CZ  . PHE D  1 42  ? 20.375  89.785  6.072   1.00 28.01 ? 43   PHE D CZ  1 
ATOM   7791  N  N   . LEU D  1 43  ? 27.210  87.884  4.490   1.00 22.33 ? 44   LEU D N   1 
ATOM   7792  C  CA  . LEU D  1 43  ? 28.324  87.362  3.719   1.00 22.05 ? 44   LEU D CA  1 
ATOM   7793  C  C   . LEU D  1 43  ? 28.001  85.951  3.236   1.00 21.24 ? 44   LEU D C   1 
ATOM   7794  O  O   . LEU D  1 43  ? 27.323  85.169  3.908   1.00 20.80 ? 44   LEU D O   1 
ATOM   7795  C  CB  . LEU D  1 43  ? 29.621  87.382  4.551   1.00 23.25 ? 44   LEU D CB  1 
ATOM   7796  C  CG  . LEU D  1 43  ? 30.013  88.669  5.299   1.00 20.99 ? 44   LEU D CG  1 
ATOM   7797  C  CD1 . LEU D  1 43  ? 29.467  88.707  6.711   1.00 16.84 ? 44   LEU D CD1 1 
ATOM   7798  C  CD2 . LEU D  1 43  ? 31.517  88.791  5.337   1.00 19.39 ? 44   LEU D CD2 1 
ATOM   7799  N  N   . THR D  1 44  ? 28.507  85.613  2.063   1.00 21.91 ? 45   THR D N   1 
ATOM   7800  C  CA  . THR D  1 44  ? 28.331  84.264  1.535   1.00 20.59 ? 45   THR D CA  1 
ATOM   7801  C  C   . THR D  1 44  ? 29.598  83.446  1.747   1.00 21.27 ? 45   THR D C   1 
ATOM   7802  O  O   . THR D  1 44  ? 30.718  83.981  1.750   1.00 18.90 ? 45   THR D O   1 
ATOM   7803  C  CB  . THR D  1 44  ? 27.996  84.297  0.046   1.00 20.26 ? 45   THR D CB  1 
ATOM   7804  O  OG1 . THR D  1 44  ? 27.939  82.965  -0.467  1.00 20.42 ? 45   THR D OG1 1 
ATOM   7805  C  CG2 . THR D  1 44  ? 29.024  85.106  -0.733  1.00 17.38 ? 45   THR D CG2 1 
ATOM   7806  N  N   . VAL D  1 45  ? 29.406  82.146  1.898   1.00 20.47 ? 46   VAL D N   1 
ATOM   7807  C  CA  . VAL D  1 45  ? 30.468  81.186  1.695   1.00 19.05 ? 46   VAL D CA  1 
ATOM   7808  C  C   . VAL D  1 45  ? 30.067  80.244  0.576   1.00 19.57 ? 46   VAL D C   1 
ATOM   7809  O  O   . VAL D  1 45  ? 28.882  79.915  0.416   1.00 20.82 ? 46   VAL D O   1 
ATOM   7810  C  CB  . VAL D  1 45  ? 30.754  80.361  2.934   1.00 21.01 ? 46   VAL D CB  1 
ATOM   7811  C  CG1 . VAL D  1 45  ? 31.417  81.241  3.985   1.00 18.39 ? 46   VAL D CG1 1 
ATOM   7812  C  CG2 . VAL D  1 45  ? 29.473  79.669  3.431   1.00 11.39 ? 46   VAL D CG2 1 
ATOM   7813  N  N   . ASP D  1 46  ? 31.055  79.816  -0.207  1.00 18.20 ? 47   ASP D N   1 
ATOM   7814  C  CA  . ASP D  1 46  ? 30.785  79.062  -1.438  1.00 17.47 ? 47   ASP D CA  1 
ATOM   7815  C  C   . ASP D  1 46  ? 31.840  77.984  -1.667  1.00 19.97 ? 47   ASP D C   1 
ATOM   7816  O  O   . ASP D  1 46  ? 32.988  78.163  -1.281  1.00 18.50 ? 47   ASP D O   1 
ATOM   7817  C  CB  . ASP D  1 46  ? 30.804  80.016  -2.603  1.00 18.59 ? 47   ASP D CB  1 
ATOM   7818  C  CG  . ASP D  1 46  ? 29.799  81.149  -2.438  1.00 20.82 ? 47   ASP D CG  1 
ATOM   7819  O  OD1 . ASP D  1 46  ? 28.654  80.914  -2.837  1.00 17.55 ? 47   ASP D OD1 1 
ATOM   7820  O  OD2 . ASP D  1 46  ? 30.142  82.234  -1.884  1.00 19.94 ? 47   ASP D OD2 1 
ATOM   7821  N  N   . PRO D  1 47  ? 31.452  76.864  -2.313  1.00 20.90 ? 48   PRO D N   1 
ATOM   7822  C  CA  . PRO D  1 47  ? 32.411  75.794  -2.543  1.00 17.88 ? 48   PRO D CA  1 
ATOM   7823  C  C   . PRO D  1 47  ? 33.656  76.204  -3.294  1.00 16.46 ? 48   PRO D C   1 
ATOM   7824  O  O   . PRO D  1 47  ? 34.716  75.647  -3.018  1.00 15.32 ? 48   PRO D O   1 
ATOM   7825  C  CB  . PRO D  1 47  ? 31.602  74.753  -3.346  1.00 19.31 ? 48   PRO D CB  1 
ATOM   7826  C  CG  . PRO D  1 47  ? 30.171  74.929  -2.858  1.00 19.40 ? 48   PRO D CG  1 
ATOM   7827  C  CD  . PRO D  1 47  ? 30.057  76.443  -2.629  1.00 20.05 ? 48   PRO D CD  1 
ATOM   7828  N  N   . TYR D  1 48  ? 33.554  77.166  -4.206  1.00 15.15 ? 49   TYR D N   1 
ATOM   7829  C  CA  . TYR D  1 48  ? 34.718  77.588  -4.980  1.00 16.99 ? 49   TYR D CA  1 
ATOM   7830  C  C   . TYR D  1 48  ? 35.874  78.023  -4.051  1.00 15.95 ? 49   TYR D C   1 
ATOM   7831  O  O   . TYR D  1 48  ? 37.039  77.917  -4.424  1.00 15.14 ? 49   TYR D O   1 
ATOM   7832  C  CB  . TYR D  1 48  ? 34.403  78.682  -6.038  1.00 14.30 ? 49   TYR D CB  1 
ATOM   7833  C  CG  . TYR D  1 48  ? 34.286  80.096  -5.471  1.00 16.68 ? 49   TYR D CG  1 
ATOM   7834  C  CD1 . TYR D  1 48  ? 35.428  80.878  -5.218  1.00 18.68 ? 49   TYR D CD1 1 
ATOM   7835  C  CD2 . TYR D  1 48  ? 33.039  80.660  -5.201  1.00 17.34 ? 49   TYR D CD2 1 
ATOM   7836  C  CE1 . TYR D  1 48  ? 35.330  82.161  -4.672  1.00 20.15 ? 49   TYR D CE1 1 
ATOM   7837  C  CE2 . TYR D  1 48  ? 32.924  81.957  -4.637  1.00 21.23 ? 49   TYR D CE2 1 
ATOM   7838  C  CZ  . TYR D  1 48  ? 34.079  82.700  -4.401  1.00 19.83 ? 49   TYR D CZ  1 
ATOM   7839  O  OH  . TYR D  1 48  ? 33.973  83.935  -3.865  1.00 19.87 ? 49   TYR D OH  1 
ATOM   7840  N  N   . MET D  1 49  ? 35.536  78.505  -2.855  1.00 15.91 ? 50   MET D N   1 
ATOM   7841  C  CA  . MET D  1 49  ? 36.525  78.984  -1.902  1.00 17.11 ? 50   MET D CA  1 
ATOM   7842  C  C   . MET D  1 49  ? 37.439  77.855  -1.412  1.00 18.07 ? 50   MET D C   1 
ATOM   7843  O  O   . MET D  1 49  ? 38.572  78.126  -1.038  1.00 16.58 ? 50   MET D O   1 
ATOM   7844  C  CB  . MET D  1 49  ? 35.860  79.648  -0.705  1.00 17.29 ? 50   MET D CB  1 
ATOM   7845  C  CG  . MET D  1 49  ? 35.065  80.934  -1.033  1.00 17.64 ? 50   MET D CG  1 
ATOM   7846  S  SD  . MET D  1 49  ? 34.016  81.450  0.319   1.00 14.80 ? 50   MET D SD  1 
ATOM   7847  C  CE  . MET D  1 49  ? 33.110  82.802  -0.489  1.00 10.82 ? 50   MET D CE  1 
ATOM   7848  N  N   . ARG D  1 50  ? 36.937  76.614  -1.386  1.00 17.03 ? 51   ARG D N   1 
ATOM   7849  C  CA  . ARG D  1 50  ? 37.776  75.469  -1.076  1.00 17.92 ? 51   ARG D CA  1 
ATOM   7850  C  C   . ARG D  1 50  ? 38.853  75.272  -2.138  1.00 17.53 ? 51   ARG D C   1 
ATOM   7851  O  O   . ARG D  1 50  ? 39.935  74.861  -1.827  1.00 18.61 ? 51   ARG D O   1 
ATOM   7852  C  CB  . ARG D  1 50  ? 36.959  74.188  -0.899  1.00 17.96 ? 51   ARG D CB  1 
ATOM   7853  C  CG  . ARG D  1 50  ? 37.771  72.909  -0.632  1.00 14.00 ? 51   ARG D CG  1 
ATOM   7854  C  CD  . ARG D  1 50  ? 38.490  72.943  0.656   1.00 17.95 ? 51   ARG D CD  1 
ATOM   7855  N  NE  . ARG D  1 50  ? 39.378  71.806  0.907   1.00 16.93 ? 51   ARG D NE  1 
ATOM   7856  C  CZ  . ARG D  1 50  ? 40.621  71.665  0.431   1.00 18.55 ? 51   ARG D CZ  1 
ATOM   7857  N  NH1 . ARG D  1 50  ? 41.166  72.562  -0.380  1.00 16.53 ? 51   ARG D NH1 1 
ATOM   7858  N  NH2 . ARG D  1 50  ? 41.334  70.611  0.788   1.00 19.04 ? 51   ARG D NH2 1 
ATOM   7859  N  N   . VAL D  1 51  ? 38.549  75.580  -3.384  1.00 18.74 ? 52   VAL D N   1 
ATOM   7860  C  CA  . VAL D  1 51  ? 39.491  75.404  -4.463  1.00 20.44 ? 52   VAL D CA  1 
ATOM   7861  C  C   . VAL D  1 51  ? 40.435  76.601  -4.581  1.00 21.02 ? 52   VAL D C   1 
ATOM   7862  O  O   . VAL D  1 51  ? 41.643  76.445  -4.714  1.00 18.01 ? 52   VAL D O   1 
ATOM   7863  C  CB  . VAL D  1 51  ? 38.731  75.220  -5.802  1.00 22.60 ? 52   VAL D CB  1 
ATOM   7864  C  CG1 . VAL D  1 51  ? 39.692  75.186  -6.980  1.00 23.48 ? 52   VAL D CG1 1 
ATOM   7865  C  CG2 . VAL D  1 51  ? 37.862  73.952  -5.739  1.00 19.09 ? 52   VAL D CG2 1 
ATOM   7866  N  N   . ALA D  1 52  ? 39.859  77.792  -4.563  1.00 20.01 ? 53   ALA D N   1 
ATOM   7867  C  CA  . ALA D  1 52  ? 40.601  79.012  -4.784  1.00 20.34 ? 53   ALA D CA  1 
ATOM   7868  C  C   . ALA D  1 52  ? 41.558  79.319  -3.637  1.00 20.40 ? 53   ALA D C   1 
ATOM   7869  O  O   . ALA D  1 52  ? 42.546  80.009  -3.852  1.00 19.79 ? 53   ALA D O   1 
ATOM   7870  C  CB  . ALA D  1 52  ? 39.622  80.229  -5.036  1.00 17.67 ? 53   ALA D CB  1 
ATOM   7871  N  N   . ALA D  1 53  ? 41.287  78.813  -2.433  1.00 19.53 ? 54   ALA D N   1 
ATOM   7872  C  CA  . ALA D  1 53  ? 42.204  79.058  -1.304  1.00 21.26 ? 54   ALA D CA  1 
ATOM   7873  C  C   . ALA D  1 53  ? 43.656  78.659  -1.603  1.00 22.22 ? 54   ALA D C   1 
ATOM   7874  O  O   . ALA D  1 53  ? 44.575  79.262  -1.052  1.00 20.19 ? 54   ALA D O   1 
ATOM   7875  C  CB  . ALA D  1 53  ? 41.731  78.351  -0.041  1.00 18.97 ? 54   ALA D CB  1 
ATOM   7876  N  N   . LYS D  1 54  ? 43.854  77.651  -2.459  1.00 24.87 ? 55   LYS D N   1 
ATOM   7877  C  CA  . LYS D  1 54  ? 45.201  77.188  -2.858  1.00 28.18 ? 55   LYS D CA  1 
ATOM   7878  C  C   . LYS D  1 54  ? 46.086  78.302  -3.431  1.00 28.34 ? 55   LYS D C   1 
ATOM   7879  O  O   . LYS D  1 54  ? 47.312  78.211  -3.394  1.00 29.79 ? 55   LYS D O   1 
ATOM   7880  C  CB  . LYS D  1 54  ? 45.102  76.097  -3.922  1.00 30.43 ? 55   LYS D CB  1 
ATOM   7881  C  CG  . LYS D  1 54  ? 44.436  74.775  -3.492  1.00 40.71 ? 55   LYS D CG  1 
ATOM   7882  C  CD  . LYS D  1 54  ? 44.086  73.972  -4.756  1.00 46.42 ? 55   LYS D CD  1 
ATOM   7883  C  CE  . LYS D  1 54  ? 43.570  72.584  -4.476  1.00 51.59 ? 55   LYS D CE  1 
ATOM   7884  N  NZ  . LYS D  1 54  ? 43.603  71.749  -5.751  1.00 53.90 ? 55   LYS D NZ  1 
ATOM   7885  N  N   . ARG D  1 55  ? 45.465  79.337  -3.982  1.00 28.56 ? 56   ARG D N   1 
ATOM   7886  C  CA  . ARG D  1 55  ? 46.193  80.436  -4.618  1.00 30.46 ? 56   ARG D CA  1 
ATOM   7887  C  C   . ARG D  1 55  ? 46.522  81.567  -3.635  1.00 30.05 ? 56   ARG D C   1 
ATOM   7888  O  O   . ARG D  1 55  ? 47.186  82.531  -4.029  1.00 28.51 ? 56   ARG D O   1 
ATOM   7889  C  CB  . ARG D  1 55  ? 45.393  80.997  -5.808  1.00 31.16 ? 56   ARG D CB  1 
ATOM   7890  C  CG  . ARG D  1 55  ? 45.476  80.118  -7.088  1.00 38.24 ? 56   ARG D CG  1 
ATOM   7891  N  N   . LEU D  1 56  ? 46.029  81.458  -2.395  1.00 27.94 ? 57   LEU D N   1 
ATOM   7892  C  CA  . LEU D  1 56  ? 46.324  82.417  -1.326  1.00 28.18 ? 57   LEU D CA  1 
ATOM   7893  C  C   . LEU D  1 56  ? 47.626  82.056  -0.654  1.00 29.25 ? 57   LEU D C   1 
ATOM   7894  O  O   . LEU D  1 56  ? 48.085  80.933  -0.717  1.00 27.46 ? 57   LEU D O   1 
ATOM   7895  C  CB  . LEU D  1 56  ? 45.229  82.457  -0.243  1.00 28.51 ? 57   LEU D CB  1 
ATOM   7896  C  CG  . LEU D  1 56  ? 43.801  82.856  -0.669  1.00 27.18 ? 57   LEU D CG  1 
ATOM   7897  C  CD1 . LEU D  1 56  ? 42.830  82.702  0.467   1.00 21.62 ? 57   LEU D CD1 1 
ATOM   7898  C  CD2 . LEU D  1 56  ? 43.743  84.284  -1.260  1.00 21.19 ? 57   LEU D CD2 1 
ATOM   7899  N  N   . LYS D  1 57  ? 48.223  83.068  -0.043  1.00 30.73 ? 58   LYS D N   1 
ATOM   7900  C  CA  . LYS D  1 57  ? 49.344  82.912  0.830   1.00 30.22 ? 58   LYS D CA  1 
ATOM   7901  C  C   . LYS D  1 57  ? 48.773  82.893  2.233   1.00 29.63 ? 58   LYS D C   1 
ATOM   7902  O  O   . LYS D  1 57  ? 47.740  83.540  2.529   1.00 25.00 ? 58   LYS D O   1 
ATOM   7903  C  CB  . LYS D  1 57  ? 50.307  84.107  0.681   1.00 32.63 ? 58   LYS D CB  1 
ATOM   7904  C  CG  . LYS D  1 57  ? 51.050  84.173  -0.640  1.00 36.89 ? 58   LYS D CG  1 
ATOM   7905  N  N   . GLU D  1 58  ? 49.469  82.199  3.118   1.00 28.66 ? 59   GLU D N   1 
ATOM   7906  C  CA  . GLU D  1 58  ? 49.061  82.135  4.498   1.00 29.57 ? 59   GLU D CA  1 
ATOM   7907  C  C   . GLU D  1 58  ? 49.016  83.555  5.056   1.00 29.45 ? 59   GLU D C   1 
ATOM   7908  O  O   . GLU D  1 58  ? 49.789  84.418  4.661   1.00 29.23 ? 59   GLU D O   1 
ATOM   7909  C  CB  . GLU D  1 58  ? 49.949  81.145  5.267   1.00 31.86 ? 59   GLU D CB  1 
ATOM   7910  C  CG  . GLU D  1 58  ? 49.690  79.704  4.727   1.00 36.89 ? 59   GLU D CG  1 
ATOM   7911  C  CD  . GLU D  1 58  ? 50.684  78.639  5.137   1.00 49.18 ? 59   GLU D CD  1 
ATOM   7912  O  OE1 . GLU D  1 58  ? 51.746  78.990  5.698   1.00 52.76 ? 59   GLU D OE1 1 
ATOM   7913  O  OE2 . GLU D  1 58  ? 50.380  77.431  4.887   1.00 51.95 ? 59   GLU D OE2 1 
ATOM   7914  N  N   . GLY D  1 59  ? 48.031  83.830  5.894   1.00 27.09 ? 60   GLY D N   1 
ATOM   7915  C  CA  . GLY D  1 59  ? 47.812  85.191  6.347   1.00 26.59 ? 60   GLY D CA  1 
ATOM   7916  C  C   . GLY D  1 59  ? 46.942  86.068  5.459   1.00 24.32 ? 60   GLY D C   1 
ATOM   7917  O  O   . GLY D  1 59  ? 46.558  87.132  5.882   1.00 24.79 ? 60   GLY D O   1 
ATOM   7918  N  N   . ASP D  1 60  ? 46.633  85.638  4.239   1.00 23.66 ? 61   ASP D N   1 
ATOM   7919  C  CA  . ASP D  1 60  ? 45.753  86.400  3.376   1.00 24.69 ? 61   ASP D CA  1 
ATOM   7920  C  C   . ASP D  1 60  ? 44.306  86.255  3.833   1.00 24.26 ? 61   ASP D C   1 
ATOM   7921  O  O   . ASP D  1 60  ? 43.916  85.257  4.441   1.00 25.65 ? 61   ASP D O   1 
ATOM   7922  C  CB  . ASP D  1 60  ? 45.819  85.954  1.914   1.00 24.47 ? 61   ASP D CB  1 
ATOM   7923  C  CG  . ASP D  1 60  ? 47.054  86.452  1.181   1.00 28.67 ? 61   ASP D CG  1 
ATOM   7924  O  OD1 . ASP D  1 60  ? 47.815  87.273  1.722   1.00 28.91 ? 61   ASP D OD1 1 
ATOM   7925  O  OD2 . ASP D  1 60  ? 47.237  86.022  0.020   1.00 26.12 ? 61   ASP D OD2 1 
ATOM   7926  N  N   . THR D  1 61  ? 43.525  87.265  3.492   1.00 22.90 ? 62   THR D N   1 
ATOM   7927  C  CA  . THR D  1 61  ? 42.091  87.290  3.681   1.00 22.36 ? 62   THR D CA  1 
ATOM   7928  C  C   . THR D  1 61  ? 41.381  86.286  2.793   1.00 19.34 ? 62   THR D C   1 
ATOM   7929  O  O   . THR D  1 61  ? 41.652  86.207  1.631   1.00 18.25 ? 62   THR D O   1 
ATOM   7930  C  CB  . THR D  1 61  ? 41.580  88.682  3.309   1.00 24.11 ? 62   THR D CB  1 
ATOM   7931  O  OG1 . THR D  1 61  ? 42.353  89.646  4.034   1.00 25.30 ? 62   THR D OG1 1 
ATOM   7932  C  CG2 . THR D  1 61  ? 40.077  88.838  3.621   1.00 19.39 ? 62   THR D CG2 1 
ATOM   7933  N  N   . MET D  1 62  ? 40.488  85.501  3.367   1.00 19.04 ? 63   MET D N   1 
ATOM   7934  C  CA  . MET D  1 62  ? 39.648  84.594  2.576   1.00 20.92 ? 63   MET D CA  1 
ATOM   7935  C  C   . MET D  1 62  ? 38.832  85.404  1.565   1.00 20.21 ? 63   MET D C   1 
ATOM   7936  O  O   . MET D  1 62  ? 38.237  86.434  1.931   1.00 21.19 ? 63   MET D O   1 
ATOM   7937  C  CB  . MET D  1 62  ? 38.720  83.785  3.501   1.00 18.52 ? 63   MET D CB  1 
ATOM   7938  C  CG  . MET D  1 62  ? 39.427  82.671  4.244   1.00 23.61 ? 63   MET D CG  1 
ATOM   7939  S  SD  . MET D  1 62  ? 40.036  81.393  3.143   1.00 22.31 ? 63   MET D SD  1 
ATOM   7940  C  CE  . MET D  1 62  ? 38.526  80.742  2.428   1.00 15.91 ? 63   MET D CE  1 
ATOM   7941  N  N   . MET D  1 63  ? 38.845  84.979  0.305   1.00 17.75 ? 64   MET D N   1 
ATOM   7942  C  CA  . MET D  1 63  ? 38.068  85.651  -0.736  1.00 19.73 ? 64   MET D CA  1 
ATOM   7943  C  C   . MET D  1 63  ? 36.567  85.448  -0.543  1.00 19.58 ? 64   MET D C   1 
ATOM   7944  O  O   . MET D  1 63  ? 36.145  84.438  0.028   1.00 19.36 ? 64   MET D O   1 
ATOM   7945  C  CB  . MET D  1 63  ? 38.455  85.159  -2.136  1.00 20.60 ? 64   MET D CB  1 
ATOM   7946  C  CG  . MET D  1 63  ? 38.014  83.721  -2.471  1.00 23.02 ? 64   MET D CG  1 
ATOM   7947  S  SD  . MET D  1 63  ? 38.939  82.464  -1.566  1.00 22.16 ? 64   MET D SD  1 
ATOM   7948  C  CE  . MET D  1 63  ? 40.501  82.593  -2.426  1.00 17.08 ? 64   MET D CE  1 
ATOM   7949  N  N   . GLY D  1 64  ? 35.766  86.379  -1.063  1.00 18.07 ? 65   GLY D N   1 
ATOM   7950  C  CA  . GLY D  1 64  ? 34.306  86.221  -1.043  1.00 19.63 ? 65   GLY D CA  1 
ATOM   7951  C  C   . GLY D  1 64  ? 33.534  87.507  -1.247  1.00 20.68 ? 65   GLY D C   1 
ATOM   7952  O  O   . GLY D  1 64  ? 34.101  88.594  -1.177  1.00 20.85 ? 65   GLY D O   1 
ATOM   7953  N  N   . GLN D  1 65  ? 32.231  87.364  -1.481  1.00 20.90 ? 66   GLN D N   1 
ATOM   7954  C  CA  . GLN D  1 65  ? 31.328  88.481  -1.734  1.00 20.25 ? 66   GLN D CA  1 
ATOM   7955  C  C   . GLN D  1 65  ? 30.449  88.735  -0.504  1.00 20.70 ? 66   GLN D C   1 
ATOM   7956  O  O   . GLN D  1 65  ? 30.342  87.879  0.365   1.00 17.98 ? 66   GLN D O   1 
ATOM   7957  C  CB  . GLN D  1 65  ? 30.462  88.134  -2.948  1.00 22.48 ? 66   GLN D CB  1 
ATOM   7958  C  CG  . GLN D  1 65  ? 29.568  89.276  -3.489  1.00 19.45 ? 66   GLN D CG  1 
ATOM   7959  C  CD  . GLN D  1 65  ? 28.828  88.872  -4.734  1.00 18.23 ? 66   GLN D CD  1 
ATOM   7960  O  OE1 . GLN D  1 65  ? 28.093  87.879  -4.742  1.00 22.07 ? 66   GLN D OE1 1 
ATOM   7961  N  NE2 . GLN D  1 65  ? 29.000  89.645  -5.792  1.00 15.56 ? 66   GLN D NE2 1 
ATOM   7962  N  N   . GLN D  1 66  ? 29.844  89.913  -0.421  1.00 21.15 ? 67   GLN D N   1 
ATOM   7963  C  CA  . GLN D  1 66  ? 28.926  90.242  0.661   1.00 21.63 ? 67   GLN D CA  1 
ATOM   7964  C  C   . GLN D  1 66  ? 27.886  91.275  0.207   1.00 22.65 ? 67   GLN D C   1 
ATOM   7965  O  O   . GLN D  1 66  ? 28.110  91.979  -0.775  1.00 21.65 ? 67   GLN D O   1 
ATOM   7966  C  CB  . GLN D  1 66  ? 29.692  90.806  1.856   1.00 22.03 ? 67   GLN D CB  1 
ATOM   7967  C  CG  . GLN D  1 66  ? 30.470  92.093  1.566   1.00 22.86 ? 67   GLN D CG  1 
ATOM   7968  C  CD  . GLN D  1 66  ? 31.229  92.626  2.782   1.00 25.59 ? 67   GLN D CD  1 
ATOM   7969  O  OE1 . GLN D  1 66  ? 31.062  93.783  3.186   1.00 21.13 ? 67   GLN D OE1 1 
ATOM   7970  N  NE2 . GLN D  1 66  ? 32.082  91.789  3.356   1.00 22.76 ? 67   GLN D NE2 1 
ATOM   7971  N  N   . VAL D  1 67  ? 26.769  91.364  0.941   1.00 22.21 ? 68   VAL D N   1 
ATOM   7972  C  CA  . VAL D  1 67  ? 25.854  92.514  0.844   1.00 23.26 ? 68   VAL D CA  1 
ATOM   7973  C  C   . VAL D  1 67  ? 26.291  93.501  1.928   1.00 24.01 ? 68   VAL D C   1 
ATOM   7974  O  O   . VAL D  1 67  ? 26.361  93.146  3.097   1.00 25.92 ? 68   VAL D O   1 
ATOM   7975  C  CB  . VAL D  1 67  ? 24.355  92.135  1.056   1.00 24.66 ? 68   VAL D CB  1 
ATOM   7976  C  CG1 . VAL D  1 67  ? 23.475  93.369  1.048   1.00 18.56 ? 68   VAL D CG1 1 
ATOM   7977  C  CG2 . VAL D  1 67  ? 23.864  91.172  -0.029  1.00 22.47 ? 68   VAL D CG2 1 
ATOM   7978  N  N   . ALA D  1 68  ? 26.615  94.723  1.531   1.00 23.27 ? 69   ALA D N   1 
ATOM   7979  C  CA  . ALA D  1 68  ? 27.057  95.737  2.465   1.00 23.22 ? 69   ALA D CA  1 
ATOM   7980  C  C   . ALA D  1 68  ? 26.208  97.016  2.344   1.00 24.55 ? 69   ALA D C   1 
ATOM   7981  O  O   . ALA D  1 68  ? 25.548  97.248  1.319   1.00 20.91 ? 69   ALA D O   1 
ATOM   7982  C  CB  . ALA D  1 68  ? 28.517  96.055  2.230   1.00 20.71 ? 69   ALA D CB  1 
ATOM   7983  N  N   . LYS D  1 69  ? 26.253  97.808  3.423   1.00 27.10 ? 70   LYS D N   1 
ATOM   7984  C  CA  . LYS D  1 69  ? 25.614  99.129  3.551   1.00 27.48 ? 70   LYS D CA  1 
ATOM   7985  C  C   . LYS D  1 69  ? 26.750  100.180 3.664   1.00 27.84 ? 70   LYS D C   1 
ATOM   7986  O  O   . LYS D  1 69  ? 27.724  99.963  4.410   1.00 23.72 ? 70   LYS D O   1 
ATOM   7987  C  CB  . LYS D  1 69  ? 24.736  99.148  4.812   1.00 27.03 ? 70   LYS D CB  1 
ATOM   7988  C  CG  . LYS D  1 69  ? 23.903  100.428 5.068   1.00 32.91 ? 70   LYS D CG  1 
ATOM   7989  C  CD  . LYS D  1 69  ? 23.026  100.312 6.376   1.00 31.00 ? 70   LYS D CD  1 
ATOM   7990  N  N   . VAL D  1 70  ? 26.639  101.280 2.906   1.00 28.07 ? 71   VAL D N   1 
ATOM   7991  C  CA  . VAL D  1 70  ? 27.532  102.437 3.063   1.00 27.71 ? 71   VAL D CA  1 
ATOM   7992  C  C   . VAL D  1 70  ? 27.206  103.163 4.376   1.00 29.06 ? 71   VAL D C   1 
ATOM   7993  O  O   . VAL D  1 70  ? 26.116  103.736 4.531   1.00 27.85 ? 71   VAL D O   1 
ATOM   7994  C  CB  . VAL D  1 70  ? 27.438  103.402 1.866   1.00 28.77 ? 71   VAL D CB  1 
ATOM   7995  C  CG1 . VAL D  1 70  ? 28.209  104.681 2.118   1.00 27.73 ? 71   VAL D CG1 1 
ATOM   7996  C  CG2 . VAL D  1 70  ? 27.939  102.732 0.589   1.00 25.83 ? 71   VAL D CG2 1 
ATOM   7997  N  N   . VAL D  1 71  ? 28.135  103.099 5.331   1.00 28.50 ? 72   VAL D N   1 
ATOM   7998  C  CA  . VAL D  1 71  ? 27.931  103.705 6.650   1.00 29.91 ? 72   VAL D CA  1 
ATOM   7999  C  C   . VAL D  1 71  ? 28.703  105.014 6.852   1.00 31.98 ? 72   VAL D C   1 
ATOM   8000  O  O   . VAL D  1 71  ? 28.494  105.699 7.859   1.00 32.84 ? 72   VAL D O   1 
ATOM   8001  C  CB  . VAL D  1 71  ? 28.285  102.765 7.808   1.00 29.33 ? 72   VAL D CB  1 
ATOM   8002  C  CG1 . VAL D  1 71  ? 27.227  101.679 7.963   1.00 24.85 ? 72   VAL D CG1 1 
ATOM   8003  C  CG2 . VAL D  1 71  ? 29.693  102.203 7.630   1.00 29.78 ? 72   VAL D CG2 1 
ATOM   8004  N  N   . GLU D  1 72  ? 29.588  105.328 5.909   1.00 32.82 ? 73   GLU D N   1 
ATOM   8005  C  CA  . GLU D  1 72  ? 30.230  106.621 5.803   1.00 33.73 ? 73   GLU D CA  1 
ATOM   8006  C  C   . GLU D  1 72  ? 30.566  106.824 4.333   1.00 33.45 ? 73   GLU D C   1 
ATOM   8007  O  O   . GLU D  1 72  ? 30.836  105.846 3.621   1.00 35.41 ? 73   GLU D O   1 
ATOM   8008  C  CB  . GLU D  1 72  ? 31.501  106.669 6.659   1.00 35.11 ? 73   GLU D CB  1 
ATOM   8009  C  CG  . GLU D  1 72  ? 32.133  108.064 6.782   1.00 41.47 ? 73   GLU D CG  1 
ATOM   8010  N  N   . SER D  1 73  ? 30.558  108.074 3.873   1.00 32.80 ? 74   SER D N   1 
ATOM   8011  C  CA  . SER D  1 73  ? 30.702  108.373 2.436   1.00 31.80 ? 74   SER D CA  1 
ATOM   8012  C  C   . SER D  1 73  ? 31.309  109.735 2.073   1.00 32.67 ? 74   SER D C   1 
ATOM   8013  O  O   . SER D  1 73  ? 30.999  110.772 2.674   1.00 34.37 ? 74   SER D O   1 
ATOM   8014  C  CB  . SER D  1 73  ? 29.347  108.260 1.742   1.00 30.48 ? 74   SER D CB  1 
ATOM   8015  O  OG  . SER D  1 73  ? 29.467  108.510 0.344   1.00 30.88 ? 74   SER D OG  1 
ATOM   8016  N  N   . LYS D  1 74  ? 32.149  109.695 1.047   1.00 33.33 ? 75   LYS D N   1 
ATOM   8017  C  CA  . LYS D  1 74  ? 32.722  110.864 0.376   1.00 33.64 ? 75   LYS D CA  1 
ATOM   8018  C  C   . LYS D  1 74  ? 32.555  110.693 -1.138  1.00 32.98 ? 75   LYS D C   1 
ATOM   8019  O  O   . LYS D  1 74  ? 33.378  111.167 -1.921  1.00 31.51 ? 75   LYS D O   1 
ATOM   8020  C  CB  . LYS D  1 74  ? 34.216  110.995 0.720   1.00 33.71 ? 75   LYS D CB  1 
ATOM   8021  C  CG  . LYS D  1 74  ? 34.517  111.527 2.120   1.00 35.63 ? 75   LYS D CG  1 
ATOM   8022  C  CD  . LYS D  1 74  ? 36.018  111.783 2.246   1.00 42.96 ? 75   LYS D CD  1 
ATOM   8023  C  CE  . LYS D  1 74  ? 36.366  112.771 3.353   1.00 48.38 ? 75   LYS D CE  1 
ATOM   8024  N  NZ  . LYS D  1 74  ? 36.469  112.120 4.682   1.00 48.11 ? 75   LYS D NZ  1 
ATOM   8025  N  N   . ASN D  1 75  ? 31.482  110.000 -1.536  1.00 34.21 ? 76   ASN D N   1 
ATOM   8026  C  CA  . ASN D  1 75  ? 31.155  109.752 -2.948  1.00 35.03 ? 76   ASN D CA  1 
ATOM   8027  C  C   . ASN D  1 75  ? 29.661  109.965 -3.081  1.00 36.25 ? 76   ASN D C   1 
ATOM   8028  O  O   . ASN D  1 75  ? 28.872  109.197 -2.540  1.00 35.66 ? 76   ASN D O   1 
ATOM   8029  C  CB  . ASN D  1 75  ? 31.514  108.307 -3.331  1.00 34.76 ? 76   ASN D CB  1 
ATOM   8030  C  CG  . ASN D  1 75  ? 31.406  108.023 -4.828  1.00 38.26 ? 76   ASN D CG  1 
ATOM   8031  O  OD1 . ASN D  1 75  ? 30.424  108.376 -5.501  1.00 38.65 ? 76   ASN D OD1 1 
ATOM   8032  N  ND2 . ASN D  1 75  ? 32.417  107.324 -5.350  1.00 34.90 ? 76   ASN D ND2 1 
ATOM   8033  N  N   . VAL D  1 76  ? 29.285  111.015 -3.808  1.00 36.81 ? 77   VAL D N   1 
ATOM   8034  C  CA  . VAL D  1 76  ? 27.894  111.435 -3.932  1.00 35.55 ? 77   VAL D CA  1 
ATOM   8035  C  C   . VAL D  1 76  ? 27.083  110.448 -4.780  1.00 35.90 ? 77   VAL D C   1 
ATOM   8036  O  O   . VAL D  1 76  ? 25.846  110.491 -4.791  1.00 37.19 ? 77   VAL D O   1 
ATOM   8037  C  CB  . VAL D  1 76  ? 27.809  112.875 -4.532  1.00 35.96 ? 77   VAL D CB  1 
ATOM   8038  C  CG1 . VAL D  1 76  ? 28.452  113.874 -3.589  1.00 38.03 ? 77   VAL D CG1 1 
ATOM   8039  C  CG2 . VAL D  1 76  ? 28.475  112.945 -5.904  1.00 32.05 ? 77   VAL D CG2 1 
ATOM   8040  N  N   . ALA D  1 77  ? 27.769  109.552 -5.488  1.00 34.61 ? 78   ALA D N   1 
ATOM   8041  C  CA  . ALA D  1 77  ? 27.088  108.465 -6.194  1.00 34.22 ? 78   ALA D CA  1 
ATOM   8042  C  C   . ALA D  1 77  ? 26.750  107.298 -5.252  1.00 33.95 ? 78   ALA D C   1 
ATOM   8043  O  O   . ALA D  1 77  ? 25.982  106.401 -5.623  1.00 33.04 ? 78   ALA D O   1 
ATOM   8044  C  CB  . ALA D  1 77  ? 27.925  107.973 -7.360  1.00 34.22 ? 78   ALA D CB  1 
ATOM   8045  N  N   . LEU D  1 78  ? 27.312  107.333 -4.042  1.00 34.07 ? 79   LEU D N   1 
ATOM   8046  C  CA  . LEU D  1 78  ? 27.179  106.258 -3.066  1.00 34.30 ? 79   LEU D CA  1 
ATOM   8047  C  C   . LEU D  1 78  ? 26.929  106.845 -1.698  1.00 33.71 ? 79   LEU D C   1 
ATOM   8048  O  O   . LEU D  1 78  ? 27.785  106.762 -0.823  1.00 33.98 ? 79   LEU D O   1 
ATOM   8049  C  CB  . LEU D  1 78  ? 28.475  105.432 -3.012  1.00 33.72 ? 79   LEU D CB  1 
ATOM   8050  C  CG  . LEU D  1 78  ? 28.893  104.749 -4.298  1.00 33.83 ? 79   LEU D CG  1 
ATOM   8051  C  CD1 . LEU D  1 78  ? 30.300  104.198 -4.139  1.00 35.25 ? 79   LEU D CD1 1 
ATOM   8052  C  CD2 . LEU D  1 78  ? 27.916  103.655 -4.670  1.00 29.24 ? 79   LEU D CD2 1 
ATOM   8053  N  N   . PRO D  1 79  ? 25.753  107.451 -1.491  1.00 33.95 ? 80   PRO D N   1 
ATOM   8054  C  CA  . PRO D  1 79  ? 25.497  108.049 -0.181  1.00 33.27 ? 80   PRO D CA  1 
ATOM   8055  C  C   . PRO D  1 79  ? 25.347  107.031 0.959   1.00 32.54 ? 80   PRO D C   1 
ATOM   8056  O  O   . PRO D  1 79  ? 25.287  105.828 0.719   1.00 35.31 ? 80   PRO D O   1 
ATOM   8057  C  CB  . PRO D  1 79  ? 24.184  108.813 -0.398  1.00 33.08 ? 80   PRO D CB  1 
ATOM   8058  C  CG  . PRO D  1 79  ? 23.528  108.128 -1.543  1.00 34.11 ? 80   PRO D CG  1 
ATOM   8059  C  CD  . PRO D  1 79  ? 24.646  107.682 -2.437  1.00 34.66 ? 80   PRO D CD  1 
ATOM   8060  N  N   . LYS D  1 80  ? 25.273  107.523 2.184   1.00 30.84 ? 81   LYS D N   1 
ATOM   8061  C  CA  . LYS D  1 80  ? 24.982  106.690 3.320   1.00 33.32 ? 81   LYS D CA  1 
ATOM   8062  C  C   . LYS D  1 80  ? 23.654  105.964 3.132   1.00 32.58 ? 81   LYS D C   1 
ATOM   8063  O  O   . LYS D  1 80  ? 22.678  106.545 2.673   1.00 32.46 ? 81   LYS D O   1 
ATOM   8064  C  CB  . LYS D  1 80  ? 24.944  107.514 4.618   1.00 34.78 ? 81   LYS D CB  1 
ATOM   8065  C  CG  . LYS D  1 80  ? 26.313  107.977 5.114   1.00 40.53 ? 81   LYS D CG  1 
ATOM   8066  C  CD  . LYS D  1 80  ? 26.226  109.081 6.195   1.00 44.51 ? 81   LYS D CD  1 
ATOM   8067  C  CE  . LYS D  1 80  ? 25.914  108.539 7.582   1.00 52.68 ? 81   LYS D CE  1 
ATOM   8068  N  NZ  . LYS D  1 80  ? 26.205  109.569 8.639   1.00 55.70 ? 81   LYS D NZ  1 
ATOM   8069  N  N   . GLY D  1 81  ? 23.638  104.684 3.492   1.00 30.65 ? 82   GLY D N   1 
ATOM   8070  C  CA  . GLY D  1 81  ? 22.460  103.856 3.357   1.00 28.84 ? 82   GLY D CA  1 
ATOM   8071  C  C   . GLY D  1 81  ? 22.390  103.062 2.071   1.00 27.09 ? 82   GLY D C   1 
ATOM   8072  O  O   . GLY D  1 81  ? 21.595  102.136 1.977   1.00 30.42 ? 82   GLY D O   1 
ATOM   8073  N  N   . THR D  1 82  ? 23.181  103.415 1.070   1.00 25.96 ? 83   THR D N   1 
ATOM   8074  C  CA  . THR D  1 82  ? 23.241  102.642 -0.166  1.00 26.50 ? 83   THR D CA  1 
ATOM   8075  C  C   . THR D  1 82  ? 23.639  101.173 0.142   1.00 26.79 ? 83   THR D C   1 
ATOM   8076  O  O   . THR D  1 82  ? 24.513  100.913 0.980   1.00 26.03 ? 83   THR D O   1 
ATOM   8077  C  CB  . THR D  1 82  ? 24.269  103.254 -1.134  1.00 28.87 ? 83   THR D CB  1 
ATOM   8078  O  OG1 . THR D  1 82  ? 24.072  104.666 -1.213  1.00 28.47 ? 83   THR D OG1 1 
ATOM   8079  C  CG2 . THR D  1 82  ? 24.174  102.658 -2.524  1.00 24.56 ? 83   THR D CG2 1 
ATOM   8080  N  N   . ILE D  1 83  ? 22.959  100.242 -0.517  1.00 26.58 ? 84   ILE D N   1 
ATOM   8081  C  CA  . ILE D  1 83  ? 23.200  98.821  -0.384  1.00 25.63 ? 84   ILE D CA  1 
ATOM   8082  C  C   . ILE D  1 83  ? 23.970  98.402  -1.635  1.00 25.76 ? 84   ILE D C   1 
ATOM   8083  O  O   . ILE D  1 83  ? 23.551  98.669  -2.764  1.00 28.53 ? 84   ILE D O   1 
ATOM   8084  C  CB  . ILE D  1 83  ? 21.859  98.034  -0.263  1.00 27.06 ? 84   ILE D CB  1 
ATOM   8085  C  CG1 . ILE D  1 83  ? 21.006  98.568  0.913   1.00 27.26 ? 84   ILE D CG1 1 
ATOM   8086  C  CG2 . ILE D  1 83  ? 22.092  96.521  -0.098  1.00 21.54 ? 84   ILE D CG2 1 
ATOM   8087  C  CD1 . ILE D  1 83  ? 21.661  98.468  2.291   1.00 23.96 ? 84   ILE D CD1 1 
ATOM   8088  N  N   . VAL D  1 84  ? 25.112  97.774  -1.428  1.00 25.22 ? 85   VAL D N   1 
ATOM   8089  C  CA  . VAL D  1 84  ? 25.923  97.249  -2.516  1.00 23.85 ? 85   VAL D CA  1 
ATOM   8090  C  C   . VAL D  1 84  ? 26.355  95.774  -2.327  1.00 24.09 ? 85   VAL D C   1 
ATOM   8091  O  O   . VAL D  1 84  ? 26.378  95.227  -1.224  1.00 23.57 ? 85   VAL D O   1 
ATOM   8092  C  CB  . VAL D  1 84  ? 27.206  98.080  -2.690  1.00 24.36 ? 85   VAL D CB  1 
ATOM   8093  C  CG1 . VAL D  1 84  ? 26.863  99.549  -3.040  1.00 26.75 ? 85   VAL D CG1 1 
ATOM   8094  C  CG2 . VAL D  1 84  ? 28.084  97.995  -1.435  1.00 20.15 ? 85   VAL D CG2 1 
ATOM   8095  N  N   . LEU D  1 85  ? 26.691  95.160  -3.446  1.00 22.80 ? 86   LEU D N   1 
ATOM   8096  C  CA  . LEU D  1 85  ? 27.489  93.971  -3.467  1.00 23.67 ? 86   LEU D CA  1 
ATOM   8097  C  C   . LEU D  1 85  ? 28.944  94.407  -3.556  1.00 22.70 ? 86   LEU D C   1 
ATOM   8098  O  O   . LEU D  1 85  ? 29.300  95.284  -4.343  1.00 22.02 ? 86   LEU D O   1 
ATOM   8099  C  CB  . LEU D  1 85  ? 27.132  93.110  -4.674  1.00 24.54 ? 86   LEU D CB  1 
ATOM   8100  C  CG  . LEU D  1 85  ? 25.793  92.369  -4.613  1.00 25.03 ? 86   LEU D CG  1 
ATOM   8101  C  CD1 . LEU D  1 85  ? 25.522  91.751  -5.973  1.00 21.61 ? 86   LEU D CD1 1 
ATOM   8102  C  CD2 . LEU D  1 85  ? 25.811  91.295  -3.522  1.00 25.37 ? 86   LEU D CD2 1 
ATOM   8103  N  N   . ALA D  1 86  ? 29.776  93.790  -2.739  1.00 21.04 ? 87   ALA D N   1 
ATOM   8104  C  CA  . ALA D  1 86  ? 31.216  94.045  -2.746  1.00 20.72 ? 87   ALA D CA  1 
ATOM   8105  C  C   . ALA D  1 86  ? 31.899  92.725  -2.485  1.00 20.61 ? 87   ALA D C   1 
ATOM   8106  O  O   . ALA D  1 86  ? 31.318  91.869  -1.827  1.00 18.36 ? 87   ALA D O   1 
ATOM   8107  C  CB  . ALA D  1 86  ? 31.556  95.006  -1.636  1.00 20.30 ? 87   ALA D CB  1 
ATOM   8108  N  N   . SER D  1 87  ? 33.142  92.583  -2.948  1.00 22.07 ? 88   SER D N   1 
ATOM   8109  C  CA  . SER D  1 87  ? 33.929  91.380  -2.679  1.00 22.23 ? 88   SER D CA  1 
ATOM   8110  C  C   . SER D  1 87  ? 35.302  91.663  -2.018  1.00 22.28 ? 88   SER D C   1 
ATOM   8111  O  O   . SER D  1 87  ? 36.352  91.408  -2.588  1.00 21.80 ? 88   SER D O   1 
ATOM   8112  C  CB  . SER D  1 87  ? 34.070  90.592  -3.980  1.00 24.17 ? 88   SER D CB  1 
ATOM   8113  O  OG  . SER D  1 87  ? 32.790  90.194  -4.441  1.00 24.31 ? 88   SER D OG  1 
ATOM   8114  N  N   . PRO D  1 88  ? 35.291  92.213  -0.801  1.00 24.04 ? 89   PRO D N   1 
ATOM   8115  C  CA  . PRO D  1 88  ? 36.531  92.497  -0.076  1.00 24.16 ? 89   PRO D CA  1 
ATOM   8116  C  C   . PRO D  1 88  ? 36.987  91.303  0.748   1.00 25.32 ? 89   PRO D C   1 
ATOM   8117  O  O   . PRO D  1 88  ? 37.933  91.415  1.541   1.00 24.94 ? 89   PRO D O   1 
ATOM   8118  C  CB  . PRO D  1 88  ? 36.104  93.635  0.861   1.00 22.93 ? 89   PRO D CB  1 
ATOM   8119  C  CG  . PRO D  1 88  ? 34.710  93.286  1.195   1.00 24.33 ? 89   PRO D CG  1 
ATOM   8120  C  CD  . PRO D  1 88  ? 34.118  92.706  -0.059  1.00 22.12 ? 89   PRO D CD  1 
ATOM   8121  N  N   . GLY D  1 89  ? 36.281  90.183  0.597   1.00 24.75 ? 90   GLY D N   1 
ATOM   8122  C  CA  . GLY D  1 89  ? 36.592  88.968  1.320   1.00 24.96 ? 90   GLY D CA  1 
ATOM   8123  C  C   . GLY D  1 89  ? 35.895  88.916  2.659   1.00 23.09 ? 90   GLY D C   1 
ATOM   8124  O  O   . GLY D  1 89  ? 34.974  89.700  2.930   1.00 22.33 ? 90   GLY D O   1 
ATOM   8125  N  N   . TRP D  1 90  ? 36.327  87.971  3.483   1.00 21.83 ? 91   TRP D N   1 
ATOM   8126  C  CA  . TRP D  1 90  ? 35.695  87.685  4.756   1.00 23.70 ? 91   TRP D CA  1 
ATOM   8127  C  C   . TRP D  1 90  ? 36.079  88.778  5.764   1.00 25.42 ? 91   TRP D C   1 
ATOM   8128  O  O   . TRP D  1 90  ? 37.014  88.617  6.574   1.00 23.95 ? 91   TRP D O   1 
ATOM   8129  C  CB  . TRP D  1 90  ? 36.139  86.318  5.292   1.00 24.81 ? 91   TRP D CB  1 
ATOM   8130  C  CG  . TRP D  1 90  ? 35.776  85.093  4.449   1.00 25.02 ? 91   TRP D CG  1 
ATOM   8131  C  CD1 . TRP D  1 90  ? 35.498  85.051  3.121   1.00 22.06 ? 91   TRP D CD1 1 
ATOM   8132  C  CD2 . TRP D  1 90  ? 35.742  83.740  4.903   1.00 26.12 ? 91   TRP D CD2 1 
ATOM   8133  N  NE1 . TRP D  1 90  ? 35.263  83.771  2.727   1.00 23.51 ? 91   TRP D NE1 1 
ATOM   8134  C  CE2 . TRP D  1 90  ? 35.415  82.942  3.801   1.00 22.37 ? 91   TRP D CE2 1 
ATOM   8135  C  CE3 . TRP D  1 90  ? 35.961  83.126  6.145   1.00 22.33 ? 91   TRP D CE3 1 
ATOM   8136  C  CZ2 . TRP D  1 90  ? 35.294  81.557  3.895   1.00 25.76 ? 91   TRP D CZ2 1 
ATOM   8137  C  CZ3 . TRP D  1 90  ? 35.838  81.763  6.237   1.00 21.80 ? 91   TRP D CZ3 1 
ATOM   8138  C  CH2 . TRP D  1 90  ? 35.513  80.987  5.120   1.00 21.03 ? 91   TRP D CH2 1 
ATOM   8139  N  N   . THR D  1 91  ? 35.365  89.898  5.702   1.00 24.16 ? 92   THR D N   1 
ATOM   8140  C  CA  . THR D  1 91  ? 35.676  91.021  6.571   1.00 25.28 ? 92   THR D CA  1 
ATOM   8141  C  C   . THR D  1 91  ? 34.453  91.847  6.882   1.00 23.96 ? 92   THR D C   1 
ATOM   8142  O  O   . THR D  1 91  ? 33.555  91.958  6.038   1.00 25.22 ? 92   THR D O   1 
ATOM   8143  C  CB  . THR D  1 91  ? 36.770  91.904  5.977   1.00 25.87 ? 92   THR D CB  1 
ATOM   8144  O  OG1 . THR D  1 91  ? 37.247  92.787  7.007   1.00 29.65 ? 92   THR D OG1 1 
ATOM   8145  C  CG2 . THR D  1 91  ? 36.252  92.694  4.750   1.00 21.76 ? 92   THR D CG2 1 
ATOM   8146  N  N   . THR D  1 92  ? 34.413  92.426  8.084   1.00 23.67 ? 93   THR D N   1 
ATOM   8147  C  CA  . THR D  1 92  ? 33.193  93.126  8.573   1.00 24.62 ? 93   THR D CA  1 
ATOM   8148  C  C   . THR D  1 92  ? 33.061  94.556  8.061   1.00 25.80 ? 93   THR D C   1 
ATOM   8149  O  O   . THR D  1 92  ? 31.953  95.050  7.861   1.00 27.86 ? 93   THR D O   1 
ATOM   8150  C  CB  . THR D  1 92  ? 33.114  93.158  10.096  1.00 25.80 ? 93   THR D CB  1 
ATOM   8151  O  OG1 . THR D  1 92  ? 34.339  93.688  10.625  1.00 23.35 ? 93   THR D OG1 1 
ATOM   8152  C  CG2 . THR D  1 92  ? 32.854  91.752  10.661  1.00 23.42 ? 93   THR D CG2 1 
ATOM   8153  N  N   . HIS D  1 93  ? 34.194  95.212  7.852   1.00 27.67 ? 94   HIS D N   1 
ATOM   8154  C  CA  . HIS D  1 93  ? 34.244  96.578  7.352   1.00 28.43 ? 94   HIS D CA  1 
ATOM   8155  C  C   . HIS D  1 93  ? 35.382  96.724  6.353   1.00 28.89 ? 94   HIS D C   1 
ATOM   8156  O  O   . HIS D  1 93  ? 36.450  96.115  6.522   1.00 29.66 ? 94   HIS D O   1 
ATOM   8157  C  CB  . HIS D  1 93  ? 34.433  97.575  8.517   1.00 30.71 ? 94   HIS D CB  1 
ATOM   8158  C  CG  . HIS D  1 93  ? 33.281  97.623  9.472   1.00 31.54 ? 94   HIS D CG  1 
ATOM   8159  N  ND1 . HIS D  1 93  ? 33.142  96.738  10.518  1.00 40.99 ? 94   HIS D ND1 1 
ATOM   8160  C  CD2 . HIS D  1 93  ? 32.215  98.454  9.538   1.00 35.24 ? 94   HIS D CD2 1 
ATOM   8161  C  CE1 . HIS D  1 93  ? 32.037  97.021  11.186  1.00 41.63 ? 94   HIS D CE1 1 
ATOM   8162  N  NE2 . HIS D  1 93  ? 31.462  98.066  10.616  1.00 38.42 ? 94   HIS D NE2 1 
ATOM   8163  N  N   . SER D  1 94  ? 35.151  97.536  5.315   1.00 27.78 ? 95   SER D N   1 
ATOM   8164  C  CA  . SER D  1 94  ? 36.109  97.733  4.238   1.00 26.83 ? 95   SER D CA  1 
ATOM   8165  C  C   . SER D  1 94  ? 35.929  99.094  3.560   1.00 27.34 ? 95   SER D C   1 
ATOM   8166  O  O   . SER D  1 94  ? 34.890  99.740  3.689   1.00 25.69 ? 95   SER D O   1 
ATOM   8167  C  CB  . SER D  1 94  ? 35.982  96.623  3.198   1.00 27.22 ? 95   SER D CB  1 
ATOM   8168  O  OG  . SER D  1 94  ? 34.681  96.596  2.614   1.00 24.54 ? 95   SER D OG  1 
ATOM   8169  N  N   . ILE D  1 95  ? 36.954  99.510  2.830   1.00 28.95 ? 96   ILE D N   1 
ATOM   8170  C  CA  . ILE D  1 95  ? 36.947  100.795 2.151   1.00 29.77 ? 96   ILE D CA  1 
ATOM   8171  C  C   . ILE D  1 95  ? 36.963  100.545 0.679   1.00 29.70 ? 96   ILE D C   1 
ATOM   8172  O  O   . ILE D  1 95  ? 37.747  99.714  0.210   1.00 29.25 ? 96   ILE D O   1 
ATOM   8173  C  CB  . ILE D  1 95  ? 38.191  101.602 2.506   1.00 31.68 ? 96   ILE D CB  1 
ATOM   8174  C  CG1 . ILE D  1 95  ? 38.120  102.041 3.973   1.00 33.60 ? 96   ILE D CG1 1 
ATOM   8175  C  CG2 . ILE D  1 95  ? 38.341  102.826 1.571   1.00 30.80 ? 96   ILE D CG2 1 
ATOM   8176  C  CD1 . ILE D  1 95  ? 39.396  102.724 4.466   1.00 32.14 ? 96   ILE D CD1 1 
ATOM   8177  N  N   . SER D  1 96  ? 36.110  101.271 -0.052  1.00 29.67 ? 97   SER D N   1 
ATOM   8178  C  CA  . SER D  1 96  ? 36.018  101.149 -1.495  1.00 28.14 ? 97   SER D CA  1 
ATOM   8179  C  C   . SER D  1 96  ? 35.978  102.505 -2.153  1.00 31.32 ? 97   SER D C   1 
ATOM   8180  O  O   . SER D  1 96  ? 35.390  103.440 -1.607  1.00 30.95 ? 97   SER D O   1 
ATOM   8181  C  CB  . SER D  1 96  ? 34.749  100.413 -1.880  1.00 28.55 ? 97   SER D CB  1 
ATOM   8182  O  OG  . SER D  1 96  ? 34.486  100.558 -3.278  1.00 27.26 ? 97   SER D OG  1 
ATOM   8183  N  N   . ASP D  1 97  ? 36.555  102.591 -3.353  1.00 33.84 ? 98   ASP D N   1 
ATOM   8184  C  CA  . ASP D  1 97  ? 36.468  103.800 -4.187  1.00 35.47 ? 98   ASP D CA  1 
ATOM   8185  C  C   . ASP D  1 97  ? 35.237  103.804 -5.113  1.00 35.63 ? 98   ASP D C   1 
ATOM   8186  O  O   . ASP D  1 97  ? 35.100  104.683 -5.993  1.00 36.66 ? 98   ASP D O   1 
ATOM   8187  C  CB  . ASP D  1 97  ? 37.758  103.979 -5.006  1.00 35.99 ? 98   ASP D CB  1 
ATOM   8188  C  CG  . ASP D  1 97  ? 37.999  102.846 -6.001  1.00 41.14 ? 98   ASP D CG  1 
ATOM   8189  O  OD1 . ASP D  1 97  ? 37.067  102.048 -6.298  1.00 46.16 ? 98   ASP D OD1 1 
ATOM   8190  O  OD2 . ASP D  1 97  ? 39.137  102.765 -6.507  1.00 42.89 ? 98   ASP D OD2 1 
ATOM   8191  N  N   . GLY D  1 98  ? 34.358  102.816 -4.933  1.00 34.70 ? 99   GLY D N   1 
ATOM   8192  C  CA  . GLY D  1 98  ? 33.135  102.705 -5.722  1.00 33.70 ? 99   GLY D CA  1 
ATOM   8193  C  C   . GLY D  1 98  ? 33.247  101.928 -7.018  1.00 34.09 ? 99   GLY D C   1 
ATOM   8194  O  O   . GLY D  1 98  ? 32.238  101.469 -7.560  1.00 33.54 ? 99   GLY D O   1 
ATOM   8195  N  N   . LYS D  1 99  ? 34.459  101.755 -7.525  1.00 35.15 ? 100  LYS D N   1 
ATOM   8196  C  CA  . LYS D  1 99  ? 34.631  101.158 -8.842  1.00 37.14 ? 100  LYS D CA  1 
ATOM   8197  C  C   . LYS D  1 99  ? 34.412  99.650  -8.861  1.00 37.28 ? 100  LYS D C   1 
ATOM   8198  O  O   . LYS D  1 99  ? 34.111  99.075  -9.910  1.00 36.97 ? 100  LYS D O   1 
ATOM   8199  C  CB  . LYS D  1 99  ? 36.000  101.516 -9.424  1.00 38.41 ? 100  LYS D CB  1 
ATOM   8200  C  CG  . LYS D  1 99  ? 36.169  103.011 -9.653  1.00 45.18 ? 100  LYS D CG  1 
ATOM   8201  C  CD  . LYS D  1 99  ? 37.193  103.333 -10.758 1.00 50.89 ? 100  LYS D CD  1 
ATOM   8202  C  CE  . LYS D  1 99  ? 37.397  104.854 -10.899 1.00 55.16 ? 100  LYS D CE  1 
ATOM   8203  N  NZ  . LYS D  1 99  ? 38.503  105.217 -11.839 1.00 54.59 ? 100  LYS D NZ  1 
ATOM   8204  N  N   . ASP D  1 100 ? 34.523  99.018  -7.700  1.00 37.31 ? 101  ASP D N   1 
ATOM   8205  C  CA  . ASP D  1 100 ? 34.441  97.554  -7.611  1.00 38.27 ? 101  ASP D CA  1 
ATOM   8206  C  C   . ASP D  1 100 ? 33.131  97.091  -6.973  1.00 36.80 ? 101  ASP D C   1 
ATOM   8207  O  O   . ASP D  1 100 ? 33.036  95.962  -6.480  1.00 37.98 ? 101  ASP D O   1 
ATOM   8208  C  CB  . ASP D  1 100 ? 35.656  97.018  -6.826  1.00 39.09 ? 101  ASP D CB  1 
ATOM   8209  C  CG  . ASP D  1 100 ? 35.851  97.708  -5.442  1.00 42.33 ? 101  ASP D CG  1 
ATOM   8210  O  OD1 . ASP D  1 100 ? 35.076  98.612  -5.064  1.00 44.75 ? 101  ASP D OD1 1 
ATOM   8211  O  OD2 . ASP D  1 100 ? 36.798  97.338  -4.721  1.00 47.72 ? 101  ASP D OD2 1 
ATOM   8212  N  N   . LEU D  1 101 ? 32.133  97.972  -6.980  1.00 34.24 ? 102  LEU D N   1 
ATOM   8213  C  CA  . LEU D  1 101 ? 30.874  97.736  -6.280  1.00 32.46 ? 102  LEU D CA  1 
ATOM   8214  C  C   . LEU D  1 101 ? 29.768  97.543  -7.285  1.00 32.19 ? 102  LEU D C   1 
ATOM   8215  O  O   . LEU D  1 101 ? 29.884  97.947  -8.446  1.00 32.71 ? 102  LEU D O   1 
ATOM   8216  C  CB  . LEU D  1 101 ? 30.535  98.910  -5.362  1.00 31.10 ? 102  LEU D CB  1 
ATOM   8217  C  CG  . LEU D  1 101 ? 31.625  99.282  -4.357  1.00 32.11 ? 102  LEU D CG  1 
ATOM   8218  C  CD1 . LEU D  1 101 ? 31.155  100.467 -3.543  1.00 28.16 ? 102  LEU D CD1 1 
ATOM   8219  C  CD2 . LEU D  1 101 ? 31.997  98.097  -3.432  1.00 26.67 ? 102  LEU D CD2 1 
ATOM   8220  N  N   . GLU D  1 102 ? 28.693  96.914  -6.830  1.00 31.66 ? 103  GLU D N   1 
ATOM   8221  C  CA  . GLU D  1 102 ? 27.552  96.650  -7.677  1.00 31.04 ? 103  GLU D CA  1 
ATOM   8222  C  C   . GLU D  1 102 ? 26.262  96.931  -6.905  1.00 30.11 ? 103  GLU D C   1 
ATOM   8223  O  O   . GLU D  1 102 ? 25.997  96.338  -5.855  1.00 26.98 ? 103  GLU D O   1 
ATOM   8224  C  CB  . GLU D  1 102 ? 27.621  95.208  -8.168  1.00 31.32 ? 103  GLU D CB  1 
ATOM   8225  C  CG  . GLU D  1 102 ? 26.519  94.811  -9.120  1.00 35.22 ? 103  GLU D CG  1 
ATOM   8226  C  CD  . GLU D  1 102 ? 26.544  93.325  -9.416  1.00 36.57 ? 103  GLU D CD  1 
ATOM   8227  O  OE1 . GLU D  1 102 ? 27.639  92.729  -9.371  1.00 39.45 ? 103  GLU D OE1 1 
ATOM   8228  O  OE2 . GLU D  1 102 ? 25.481  92.756  -9.689  1.00 28.49 ? 103  GLU D OE2 1 
ATOM   8229  N  N   . LYS D  1 103 ? 25.477  97.868  -7.426  1.00 30.59 ? 104  LYS D N   1 
ATOM   8230  C  CA  . LYS D  1 103 ? 24.172  98.174  -6.862  1.00 30.63 ? 104  LYS D CA  1 
ATOM   8231  C  C   . LYS D  1 103 ? 23.241  97.052  -7.242  1.00 27.70 ? 104  LYS D C   1 
ATOM   8232  O  O   . LYS D  1 103 ? 23.457  96.412  -8.245  1.00 27.75 ? 104  LYS D O   1 
ATOM   8233  C  CB  . LYS D  1 103 ? 23.641  99.519  -7.389  1.00 32.06 ? 104  LYS D CB  1 
ATOM   8234  C  CG  . LYS D  1 103 ? 24.211  100.755 -6.657  1.00 35.71 ? 104  LYS D CG  1 
ATOM   8235  C  CD  . LYS D  1 103 ? 24.032  102.042 -7.475  1.00 44.06 ? 104  LYS D CD  1 
ATOM   8236  C  CE  . LYS D  1 103 ? 24.264  103.319 -6.646  1.00 45.29 ? 104  LYS D CE  1 
ATOM   8237  N  NZ  . LYS D  1 103 ? 25.085  104.363 -7.367  1.00 42.17 ? 104  LYS D NZ  1 
ATOM   8238  N  N   . LEU D  1 104 ? 22.221  96.817  -6.424  1.00 29.18 ? 105  LEU D N   1 
ATOM   8239  C  CA  . LEU D  1 104 ? 21.171  95.856  -6.720  1.00 29.98 ? 105  LEU D CA  1 
ATOM   8240  C  C   . LEU D  1 104 ? 20.269  96.302  -7.870  1.00 31.49 ? 105  LEU D C   1 
ATOM   8241  O  O   . LEU D  1 104 ? 20.332  97.444  -8.341  1.00 29.63 ? 105  LEU D O   1 
ATOM   8242  C  CB  . LEU D  1 104 ? 20.292  95.595  -5.483  1.00 30.87 ? 105  LEU D CB  1 
ATOM   8243  C  CG  . LEU D  1 104 ? 20.997  95.162  -4.184  1.00 33.68 ? 105  LEU D CG  1 
ATOM   8244  C  CD1 . LEU D  1 104 ? 19.996  94.587  -3.221  1.00 37.24 ? 105  LEU D CD1 1 
ATOM   8245  C  CD2 . LEU D  1 104 ? 22.079  94.152  -4.461  1.00 28.57 ? 105  LEU D CD2 1 
ATOM   8246  N  N   . LEU D  1 105 ? 19.411  95.382  -8.303  1.00 31.43 ? 106  LEU D N   1 
ATOM   8247  C  CA  . LEU D  1 105 ? 18.461  95.683  -9.348  1.00 31.40 ? 106  LEU D CA  1 
ATOM   8248  C  C   . LEU D  1 105 ? 17.615  96.884  -8.911  1.00 32.72 ? 106  LEU D C   1 
ATOM   8249  O  O   . LEU D  1 105 ? 17.158  96.976  -7.763  1.00 31.34 ? 106  LEU D O   1 
ATOM   8250  C  CB  . LEU D  1 105 ? 17.564  94.499  -9.649  1.00 29.57 ? 106  LEU D CB  1 
ATOM   8251  C  CG  . LEU D  1 105 ? 18.193  93.350  -10.423 1.00 30.77 ? 106  LEU D CG  1 
ATOM   8252  C  CD1 . LEU D  1 105 ? 17.175  92.223  -10.546 1.00 29.06 ? 106  LEU D CD1 1 
ATOM   8253  C  CD2 . LEU D  1 105 ? 18.680  93.815  -11.778 1.00 24.87 ? 106  LEU D CD2 1 
ATOM   8254  N  N   . THR D  1 106 ? 17.487  97.817  -9.837  1.00 33.38 ? 107  THR D N   1 
ATOM   8255  C  CA  . THR D  1 106 ? 16.544  98.929  -9.750  1.00 37.11 ? 107  THR D CA  1 
ATOM   8256  C  C   . THR D  1 106 ? 15.206  98.582  -9.109  1.00 35.22 ? 107  THR D C   1 
ATOM   8257  O  O   . THR D  1 106 ? 14.711  99.309  -8.278  1.00 35.51 ? 107  THR D O   1 
ATOM   8258  C  CB  . THR D  1 106 ? 16.314  99.449  -11.181 1.00 36.39 ? 107  THR D CB  1 
ATOM   8259  O  OG1 . THR D  1 106 ? 17.226  100.520 -11.393 1.00 37.58 ? 107  THR D OG1 1 
ATOM   8260  C  CG2 . THR D  1 106 ? 14.872  99.899  -11.401 1.00 45.99 ? 107  THR D CG2 1 
ATOM   8261  N  N   . GLU D  1 107 ? 14.670  97.432  -9.480  1.00 38.14 ? 108  GLU D N   1 
ATOM   8262  C  CA  . GLU D  1 107 ? 13.337  96.982  -9.071  1.00 38.56 ? 108  GLU D CA  1 
ATOM   8263  C  C   . GLU D  1 107 ? 13.361  96.114  -7.840  1.00 38.28 ? 108  GLU D C   1 
ATOM   8264  O  O   . GLU D  1 107 ? 12.322  95.545  -7.489  1.00 39.15 ? 108  GLU D O   1 
ATOM   8265  C  CB  . GLU D  1 107 ? 12.656  96.204  -10.210 1.00 39.95 ? 108  GLU D CB  1 
ATOM   8266  C  CG  . GLU D  1 107 ? 13.535  95.147  -10.913 1.00 45.85 ? 108  GLU D CG  1 
ATOM   8267  C  CD  . GLU D  1 107 ? 14.236  95.691  -12.163 1.00 50.21 ? 108  GLU D CD  1 
ATOM   8268  O  OE1 . GLU D  1 107 ? 13.617  95.617  -13.262 1.00 51.57 ? 108  GLU D OE1 1 
ATOM   8269  O  OE2 . GLU D  1 107 ? 15.396  96.176  -12.048 1.00 44.15 ? 108  GLU D OE2 1 
ATOM   8270  N  N   . TRP D  1 108 ? 14.526  96.006  -7.180  1.00 37.45 ? 109  TRP D N   1 
ATOM   8271  C  CA  . TRP D  1 108 ? 14.655  95.189  -5.968  1.00 35.65 ? 109  TRP D CA  1 
ATOM   8272  C  C   . TRP D  1 108 ? 13.686  95.680  -4.912  1.00 35.48 ? 109  TRP D C   1 
ATOM   8273  O  O   . TRP D  1 108 ? 13.788  96.822  -4.475  1.00 35.82 ? 109  TRP D O   1 
ATOM   8274  C  CB  . TRP D  1 108 ? 16.086  95.230  -5.386  1.00 36.07 ? 109  TRP D CB  1 
ATOM   8275  C  CG  . TRP D  1 108 ? 16.324  94.120  -4.399  1.00 34.38 ? 109  TRP D CG  1 
ATOM   8276  C  CD1 . TRP D  1 108 ? 15.883  94.057  -3.106  1.00 35.45 ? 109  TRP D CD1 1 
ATOM   8277  C  CD2 . TRP D  1 108 ? 17.009  92.886  -4.648  1.00 29.18 ? 109  TRP D CD2 1 
ATOM   8278  N  NE1 . TRP D  1 108 ? 16.263  92.868  -2.533  1.00 34.64 ? 109  TRP D NE1 1 
ATOM   8279  C  CE2 . TRP D  1 108 ? 16.956  92.131  -3.461  1.00 31.38 ? 109  TRP D CE2 1 
ATOM   8280  C  CE3 . TRP D  1 108 ? 17.654  92.346  -5.762  1.00 30.26 ? 109  TRP D CE3 1 
ATOM   8281  C  CZ2 . TRP D  1 108 ? 17.543  90.865  -3.352  1.00 32.27 ? 109  TRP D CZ2 1 
ATOM   8282  C  CZ3 . TRP D  1 108 ? 18.254  91.092  -5.648  1.00 30.65 ? 109  TRP D CZ3 1 
ATOM   8283  C  CH2 . TRP D  1 108 ? 18.183  90.367  -4.456  1.00 29.51 ? 109  TRP D CH2 1 
ATOM   8284  N  N   . PRO D  1 109 ? 12.753  94.818  -4.487  1.00 36.69 ? 110  PRO D N   1 
ATOM   8285  C  CA  . PRO D  1 109 ? 11.765  95.170  -3.474  1.00 37.33 ? 110  PRO D CA  1 
ATOM   8286  C  C   . PRO D  1 109 ? 12.192  94.853  -2.048  1.00 38.17 ? 110  PRO D C   1 
ATOM   8287  O  O   . PRO D  1 109 ? 13.135  94.080  -1.835  1.00 38.29 ? 110  PRO D O   1 
ATOM   8288  C  CB  . PRO D  1 109 ? 10.572  94.288  -3.856  1.00 37.45 ? 110  PRO D CB  1 
ATOM   8289  C  CG  . PRO D  1 109 ? 11.195  93.055  -4.332  1.00 38.41 ? 110  PRO D CG  1 
ATOM   8290  C  CD  . PRO D  1 109 ? 12.490  93.475  -5.033  1.00 37.61 ? 110  PRO D CD  1 
ATOM   8291  N  N   . ASP D  1 110 ? 11.459  95.422  -1.087  1.00 38.22 ? 111  ASP D N   1 
ATOM   8292  C  CA  . ASP D  1 110 ? 11.711  95.226  0.348   1.00 39.36 ? 111  ASP D CA  1 
ATOM   8293  C  C   . ASP D  1 110 ? 11.047  93.965  0.891   1.00 38.19 ? 111  ASP D C   1 
ATOM   8294  O  O   . ASP D  1 110 ? 11.187  93.639  2.069   1.00 38.60 ? 111  ASP D O   1 
ATOM   8295  C  CB  . ASP D  1 110 ? 11.265  96.464  1.172   1.00 41.73 ? 111  ASP D CB  1 
ATOM   8296  C  CG  . ASP D  1 110 ? 9.719   96.653  1.229   1.00 46.90 ? 111  ASP D CG  1 
ATOM   8297  O  OD1 . ASP D  1 110 ? 8.975   96.012  0.447   1.00 42.02 ? 111  ASP D OD1 1 
ATOM   8298  O  OD2 . ASP D  1 110 ? 9.250   97.471  2.060   1.00 53.21 ? 111  ASP D OD2 1 
ATOM   8299  N  N   . THR D  1 111 ? 10.327  93.258  0.031   1.00 37.57 ? 112  THR D N   1 
ATOM   8300  C  CA  . THR D  1 111 ? 9.581   92.071  0.434   1.00 37.40 ? 112  THR D CA  1 
ATOM   8301  C  C   . THR D  1 111 ? 10.418  90.778  0.432   1.00 37.48 ? 112  THR D C   1 
ATOM   8302  O  O   . THR D  1 111 ? 9.894   89.722  0.770   1.00 37.55 ? 112  THR D O   1 
ATOM   8303  C  CB  . THR D  1 111 ? 8.381   91.869  -0.518  1.00 38.63 ? 112  THR D CB  1 
ATOM   8304  O  OG1 . THR D  1 111 ? 8.850   91.825  -1.878  1.00 38.18 ? 112  THR D OG1 1 
ATOM   8305  C  CG2 . THR D  1 111 ? 7.367   93.022  -0.383  1.00 39.34 ? 112  THR D CG2 1 
ATOM   8306  N  N   . ILE D  1 112 ? 11.696  90.857  0.035   1.00 37.08 ? 113  ILE D N   1 
ATOM   8307  C  CA  . ILE D  1 112 ? 12.619  89.698  0.100   1.00 36.53 ? 113  ILE D CA  1 
ATOM   8308  C  C   . ILE D  1 112 ? 13.887  90.039  0.861   1.00 34.40 ? 113  ILE D C   1 
ATOM   8309  O  O   . ILE D  1 112 ? 14.237  91.204  0.991   1.00 35.46 ? 113  ILE D O   1 
ATOM   8310  C  CB  . ILE D  1 112 ? 13.016  89.175  -1.292  1.00 36.72 ? 113  ILE D CB  1 
ATOM   8311  C  CG1 . ILE D  1 112 ? 13.618  90.286  -2.148  1.00 35.73 ? 113  ILE D CG1 1 
ATOM   8312  C  CG2 . ILE D  1 112 ? 11.801  88.553  -1.980  1.00 35.30 ? 113  ILE D CG2 1 
ATOM   8313  C  CD1 . ILE D  1 112 ? 14.181  89.798  -3.459  1.00 34.95 ? 113  ILE D CD1 1 
ATOM   8314  N  N   . PRO D  1 113 ? 14.578  89.024  1.384   1.00 31.80 ? 114  PRO D N   1 
ATOM   8315  C  CA  . PRO D  1 113 ? 15.836  89.330  2.068   1.00 30.58 ? 114  PRO D CA  1 
ATOM   8316  C  C   . PRO D  1 113 ? 16.900  89.880  1.116   1.00 28.55 ? 114  PRO D C   1 
ATOM   8317  O  O   . PRO D  1 113 ? 16.976  89.453  -0.018  1.00 28.72 ? 114  PRO D O   1 
ATOM   8318  C  CB  . PRO D  1 113 ? 16.276  87.962  2.601   1.00 31.45 ? 114  PRO D CB  1 
ATOM   8319  C  CG  . PRO D  1 113 ? 14.996  87.149  2.669   1.00 33.46 ? 114  PRO D CG  1 
ATOM   8320  C  CD  . PRO D  1 113 ? 14.219  87.597  1.489   1.00 30.54 ? 114  PRO D CD  1 
ATOM   8321  N  N   . LEU D  1 114 ? 17.726  90.800  1.584   1.00 27.01 ? 115  LEU D N   1 
ATOM   8322  C  CA  . LEU D  1 114 ? 18.817  91.325  0.764   1.00 26.32 ? 115  LEU D CA  1 
ATOM   8323  C  C   . LEU D  1 114 ? 19.847  90.240  0.389   1.00 24.31 ? 115  LEU D C   1 
ATOM   8324  O  O   . LEU D  1 114 ? 20.526  90.370  -0.597  1.00 25.49 ? 115  LEU D O   1 
ATOM   8325  C  CB  . LEU D  1 114 ? 19.520  92.483  1.481   1.00 25.23 ? 115  LEU D CB  1 
ATOM   8326  C  CG  . LEU D  1 114 ? 18.747  93.767  1.829   1.00 32.27 ? 115  LEU D CG  1 
ATOM   8327  C  CD1 . LEU D  1 114 ? 19.678  94.742  2.614   1.00 30.32 ? 115  LEU D CD1 1 
ATOM   8328  C  CD2 . LEU D  1 114 ? 18.156  94.468  0.610   1.00 23.36 ? 115  LEU D CD2 1 
ATOM   8329  N  N   . SER D  1 115 ? 19.922  89.170  1.164   1.00 23.69 ? 116  SER D N   1 
ATOM   8330  C  CA  . SER D  1 115 ? 20.879  88.100  0.939   1.00 24.74 ? 116  SER D CA  1 
ATOM   8331  C  C   . SER D  1 115 ? 20.543  87.211  -0.306  1.00 27.25 ? 116  SER D C   1 
ATOM   8332  O  O   . SER D  1 115 ? 21.350  86.354  -0.740  1.00 23.45 ? 116  SER D O   1 
ATOM   8333  C  CB  . SER D  1 115 ? 20.951  87.246  2.195   1.00 24.13 ? 116  SER D CB  1 
ATOM   8334  O  OG  . SER D  1 115 ? 19.646  86.854  2.601   1.00 26.93 ? 116  SER D OG  1 
ATOM   8335  N  N   . LEU D  1 116 ? 19.370  87.434  -0.905  1.00 24.79 ? 117  LEU D N   1 
ATOM   8336  C  CA  . LEU D  1 116 ? 19.028  86.694  -2.080  1.00 23.06 ? 117  LEU D CA  1 
ATOM   8337  C  C   . LEU D  1 116 ? 19.990  87.123  -3.154  1.00 22.33 ? 117  LEU D C   1 
ATOM   8338  O  O   . LEU D  1 116 ? 20.279  86.355  -4.054  1.00 23.17 ? 117  LEU D O   1 
ATOM   8339  C  CB  . LEU D  1 116 ? 17.587  86.925  -2.517  1.00 23.55 ? 117  LEU D CB  1 
ATOM   8340  C  CG  . LEU D  1 116 ? 16.433  86.339  -1.699  1.00 25.22 ? 117  LEU D CG  1 
ATOM   8341  C  CD1 . LEU D  1 116 ? 15.341  85.889  -2.671  1.00 26.02 ? 117  LEU D CD1 1 
ATOM   8342  C  CD2 . LEU D  1 116 ? 16.816  85.179  -0.769  1.00 23.04 ? 117  LEU D CD2 1 
ATOM   8343  N  N   . ALA D  1 117 ? 20.519  88.337  -3.030  1.00 21.68 ? 118  ALA D N   1 
ATOM   8344  C  CA  . ALA D  1 117 ? 21.499  88.855  -3.965  1.00 19.57 ? 118  ALA D CA  1 
ATOM   8345  C  C   . ALA D  1 117 ? 22.825  88.056  -3.928  1.00 19.65 ? 118  ALA D C   1 
ATOM   8346  O  O   . ALA D  1 117 ? 23.614  88.151  -4.836  1.00 17.23 ? 118  ALA D O   1 
ATOM   8347  C  CB  . ALA D  1 117 ? 21.757  90.326  -3.678  1.00 19.39 ? 118  ALA D CB  1 
ATOM   8348  N  N   . LEU D  1 118 ? 23.049  87.276  -2.875  1.00 20.71 ? 119  LEU D N   1 
ATOM   8349  C  CA  . LEU D  1 118 ? 24.187  86.374  -2.793  1.00 20.79 ? 119  LEU D CA  1 
ATOM   8350  C  C   . LEU D  1 118 ? 23.831  84.953  -3.225  1.00 21.11 ? 119  LEU D C   1 
ATOM   8351  O  O   . LEU D  1 118 ? 24.723  84.116  -3.329  1.00 22.50 ? 119  LEU D O   1 
ATOM   8352  C  CB  . LEU D  1 118 ? 24.731  86.341  -1.379  1.00 19.00 ? 119  LEU D CB  1 
ATOM   8353  C  CG  . LEU D  1 118 ? 25.137  87.682  -0.775  1.00 21.73 ? 119  LEU D CG  1 
ATOM   8354  C  CD1 . LEU D  1 118 ? 25.478  87.485  0.725   1.00 17.79 ? 119  LEU D CD1 1 
ATOM   8355  C  CD2 . LEU D  1 118 ? 26.317  88.331  -1.550  1.00 16.56 ? 119  LEU D CD2 1 
ATOM   8356  N  N   . GLY D  1 119 ? 22.544  84.714  -3.503  1.00 21.01 ? 120  GLY D N   1 
ATOM   8357  C  CA  . GLY D  1 119 ? 21.994  83.408  -3.846  1.00 20.11 ? 120  GLY D CA  1 
ATOM   8358  C  C   . GLY D  1 119 ? 21.097  83.377  -5.096  1.00 19.50 ? 120  GLY D C   1 
ATOM   8359  O  O   . GLY D  1 119 ? 21.546  83.581  -6.201  1.00 20.28 ? 120  GLY D O   1 
ATOM   8360  N  N   . THR D  1 120 ? 19.814  83.135  -4.909  1.00 18.52 ? 121  THR D N   1 
ATOM   8361  C  CA  . THR D  1 120 ? 18.893  82.850  -6.015  1.00 20.07 ? 121  THR D CA  1 
ATOM   8362  C  C   . THR D  1 120 ? 18.787  83.991  -7.005  1.00 22.18 ? 121  THR D C   1 
ATOM   8363  O  O   . THR D  1 120 ? 18.652  83.764  -8.208  1.00 23.17 ? 121  THR D O   1 
ATOM   8364  C  CB  . THR D  1 120 ? 17.489  82.504  -5.460  1.00 21.48 ? 121  THR D CB  1 
ATOM   8365  O  OG1 . THR D  1 120 ? 17.597  81.337  -4.629  1.00 19.20 ? 121  THR D OG1 1 
ATOM   8366  C  CG2 . THR D  1 120 ? 16.477  82.272  -6.590  1.00 18.85 ? 121  THR D CG2 1 
ATOM   8367  N  N   . VAL D  1 121 ? 18.880  85.224  -6.518  1.00 21.90 ? 122  VAL D N   1 
ATOM   8368  C  CA  . VAL D  1 121 ? 18.909  86.364  -7.411  1.00 21.95 ? 122  VAL D CA  1 
ATOM   8369  C  C   . VAL D  1 121 ? 20.327  86.963  -7.405  1.00 23.25 ? 122  VAL D C   1 
ATOM   8370  O  O   . VAL D  1 121 ? 20.529  88.168  -7.205  1.00 21.90 ? 122  VAL D O   1 
ATOM   8371  C  CB  . VAL D  1 121 ? 17.809  87.396  -7.055  1.00 23.09 ? 122  VAL D CB  1 
ATOM   8372  C  CG1 . VAL D  1 121 ? 17.684  88.432  -8.191  1.00 21.29 ? 122  VAL D CG1 1 
ATOM   8373  C  CG2 . VAL D  1 121 ? 16.479  86.676  -6.853  1.00 19.87 ? 122  VAL D CG2 1 
ATOM   8374  N  N   . GLY D  1 122 ? 21.293  86.073  -7.637  1.00 22.86 ? 123  GLY D N   1 
ATOM   8375  C  CA  . GLY D  1 122 ? 22.697  86.402  -7.699  1.00 21.62 ? 123  GLY D CA  1 
ATOM   8376  C  C   . GLY D  1 122 ? 23.515  85.251  -8.275  1.00 20.37 ? 123  GLY D C   1 
ATOM   8377  O  O   . GLY D  1 122 ? 23.024  84.474  -9.095  1.00 17.02 ? 123  GLY D O   1 
ATOM   8378  N  N   . MET D  1 123 ? 24.763  85.130  -7.821  1.00 18.92 ? 124  MET D N   1 
ATOM   8379  C  CA  . MET D  1 123 ? 25.724  84.303  -8.527  1.00 18.67 ? 124  MET D CA  1 
ATOM   8380  C  C   . MET D  1 123 ? 25.313  82.837  -8.590  1.00 16.02 ? 124  MET D C   1 
ATOM   8381  O  O   . MET D  1 123 ? 25.339  82.255  -9.646  1.00 17.08 ? 124  MET D O   1 
ATOM   8382  C  CB  . MET D  1 123 ? 27.135  84.492  -7.982  1.00 20.43 ? 124  MET D CB  1 
ATOM   8383  C  CG  . MET D  1 123 ? 28.169  83.680  -8.771  1.00 21.29 ? 124  MET D CG  1 
ATOM   8384  S  SD  . MET D  1 123 ? 28.219  81.972  -8.172  1.00 18.34 ? 124  MET D SD  1 
ATOM   8385  C  CE  . MET D  1 123 ? 29.402  82.196  -6.815  1.00 16.28 ? 124  MET D CE  1 
ATOM   8386  N  N   . PRO D  1 124 ? 24.867  82.246  -7.488  1.00 16.07 ? 125  PRO D N   1 
ATOM   8387  C  CA  . PRO D  1 124 ? 24.371  80.877  -7.647  1.00 16.90 ? 125  PRO D CA  1 
ATOM   8388  C  C   . PRO D  1 124 ? 23.085  80.731  -8.474  1.00 18.36 ? 125  PRO D C   1 
ATOM   8389  O  O   . PRO D  1 124 ? 22.928  79.730  -9.166  1.00 20.03 ? 125  PRO D O   1 
ATOM   8390  C  CB  . PRO D  1 124 ? 24.123  80.425  -6.222  1.00 17.04 ? 125  PRO D CB  1 
ATOM   8391  C  CG  . PRO D  1 124 ? 24.901  81.354  -5.379  1.00 16.70 ? 125  PRO D CG  1 
ATOM   8392  C  CD  . PRO D  1 124 ? 24.904  82.648  -6.078  1.00 17.22 ? 125  PRO D CD  1 
ATOM   8393  N  N   . GLY D  1 125 ? 22.174  81.693  -8.403  1.00 18.50 ? 126  GLY D N   1 
ATOM   8394  C  CA  . GLY D  1 125 ? 20.960  81.649  -9.233  1.00 17.85 ? 126  GLY D CA  1 
ATOM   8395  C  C   . GLY D  1 125 ? 21.299  81.750  -10.691 1.00 18.97 ? 126  GLY D C   1 
ATOM   8396  O  O   . GLY D  1 125 ? 20.751  81.018  -11.503 1.00 22.12 ? 126  GLY D O   1 
ATOM   8397  N  N   . LEU D  1 126 ? 22.249  82.626  -11.022 1.00 18.02 ? 127  LEU D N   1 
ATOM   8398  C  CA  . LEU D  1 126 ? 22.733  82.738  -12.382 1.00 18.31 ? 127  LEU D CA  1 
ATOM   8399  C  C   . LEU D  1 126 ? 23.398  81.449  -12.914 1.00 18.64 ? 127  LEU D C   1 
ATOM   8400  O  O   . LEU D  1 126 ? 23.273  81.093  -14.104 1.00 19.30 ? 127  LEU D O   1 
ATOM   8401  C  CB  . LEU D  1 126 ? 23.708  83.934  -12.499 1.00 18.77 ? 127  LEU D CB  1 
ATOM   8402  C  CG  . LEU D  1 126 ? 23.055  85.317  -12.318 1.00 19.26 ? 127  LEU D CG  1 
ATOM   8403  C  CD1 . LEU D  1 126 ? 24.111  86.445  -12.236 1.00 13.73 ? 127  LEU D CD1 1 
ATOM   8404  C  CD2 . LEU D  1 126 ? 22.077  85.581  -13.464 1.00 18.34 ? 127  LEU D CD2 1 
ATOM   8405  N  N   . THR D  1 127 ? 24.099  80.759  -12.032 1.00 17.66 ? 128  THR D N   1 
ATOM   8406  C  CA  . THR D  1 127 ? 24.812  79.570  -12.390 1.00 16.46 ? 128  THR D CA  1 
ATOM   8407  C  C   . THR D  1 127 ? 23.822  78.500  -12.836 1.00 17.62 ? 128  THR D C   1 
ATOM   8408  O  O   . THR D  1 127 ? 24.028  77.835  -13.849 1.00 18.82 ? 128  THR D O   1 
ATOM   8409  C  CB  . THR D  1 127 ? 25.628  79.064  -11.180 1.00 17.11 ? 128  THR D CB  1 
ATOM   8410  O  OG1 . THR D  1 127 ? 26.558  80.082  -10.779 1.00 17.24 ? 128  THR D OG1 1 
ATOM   8411  C  CG2 . THR D  1 127 ? 26.386  77.793  -11.515 1.00 15.01 ? 128  THR D CG2 1 
ATOM   8412  N  N   . ALA D  1 128 ? 22.778  78.338  -12.038 1.00 17.86 ? 129  ALA D N   1 
ATOM   8413  C  CA  . ALA D  1 128 ? 21.640  77.461  -12.316 1.00 18.23 ? 129  ALA D CA  1 
ATOM   8414  C  C   . ALA D  1 128 ? 20.926  77.798  -13.616 1.00 19.45 ? 129  ALA D C   1 
ATOM   8415  O  O   . ALA D  1 128 ? 20.680  76.931  -14.444 1.00 20.69 ? 129  ALA D O   1 
ATOM   8416  C  CB  . ALA D  1 128 ? 20.664  77.577  -11.181 1.00 16.53 ? 129  ALA D CB  1 
ATOM   8417  N  N   . TYR D  1 129 ? 20.582  79.072  -13.772 1.00 22.24 ? 130  TYR D N   1 
ATOM   8418  C  CA  . TYR D  1 129 ? 19.874  79.573  -14.954 1.00 21.12 ? 130  TYR D CA  1 
ATOM   8419  C  C   . TYR D  1 129 ? 20.665  79.289  -16.205 1.00 20.16 ? 130  TYR D C   1 
ATOM   8420  O  O   . TYR D  1 129 ? 20.163  78.662  -17.146 1.00 21.72 ? 130  TYR D O   1 
ATOM   8421  C  CB  . TYR D  1 129 ? 19.656  81.086  -14.798 1.00 21.04 ? 130  TYR D CB  1 
ATOM   8422  C  CG  . TYR D  1 129 ? 18.885  81.830  -15.885 1.00 18.51 ? 130  TYR D CG  1 
ATOM   8423  C  CD1 . TYR D  1 129 ? 19.460  82.139  -17.105 1.00 21.12 ? 130  TYR D CD1 1 
ATOM   8424  C  CD2 . TYR D  1 129 ? 17.602  82.308  -15.629 1.00 24.50 ? 130  TYR D CD2 1 
ATOM   8425  C  CE1 . TYR D  1 129 ? 18.755  82.888  -18.082 1.00 25.25 ? 130  TYR D CE1 1 
ATOM   8426  C  CE2 . TYR D  1 129 ? 16.890  83.054  -16.583 1.00 24.32 ? 130  TYR D CE2 1 
ATOM   8427  C  CZ  . TYR D  1 129 ? 17.460  83.326  -17.791 1.00 25.34 ? 130  TYR D CZ  1 
ATOM   8428  O  OH  . TYR D  1 129 ? 16.724  84.034  -18.694 1.00 30.27 ? 130  TYR D OH  1 
ATOM   8429  N  N   . PHE D  1 130 ? 21.900  79.747  -16.245 1.00 19.39 ? 131  PHE D N   1 
ATOM   8430  C  CA  . PHE D  1 130 ? 22.654  79.592  -17.485 1.00 18.65 ? 131  PHE D CA  1 
ATOM   8431  C  C   . PHE D  1 130 ? 23.065  78.155  -17.705 1.00 20.03 ? 131  PHE D C   1 
ATOM   8432  O  O   . PHE D  1 130 ? 23.147  77.699  -18.843 1.00 21.34 ? 131  PHE D O   1 
ATOM   8433  C  CB  . PHE D  1 130 ? 23.843  80.552  -17.553 1.00 18.81 ? 131  PHE D CB  1 
ATOM   8434  C  CG  . PHE D  1 130 ? 23.438  81.978  -17.837 1.00 21.18 ? 131  PHE D CG  1 
ATOM   8435  C  CD1 . PHE D  1 130 ? 22.832  82.310  -19.041 1.00 22.99 ? 131  PHE D CD1 1 
ATOM   8436  C  CD2 . PHE D  1 130 ? 23.595  82.974  -16.885 1.00 24.87 ? 131  PHE D CD2 1 
ATOM   8437  C  CE1 . PHE D  1 130 ? 22.437  83.620  -19.308 1.00 26.01 ? 131  PHE D CE1 1 
ATOM   8438  C  CE2 . PHE D  1 130 ? 23.186  84.287  -17.142 1.00 22.95 ? 131  PHE D CE2 1 
ATOM   8439  C  CZ  . PHE D  1 130 ? 22.613  84.611  -18.344 1.00 24.17 ? 131  PHE D CZ  1 
ATOM   8440  N  N   . GLY D  1 131 ? 23.274  77.423  -16.619 1.00 20.39 ? 132  GLY D N   1 
ATOM   8441  C  CA  . GLY D  1 131 ? 23.707  76.045  -16.738 1.00 20.63 ? 132  GLY D CA  1 
ATOM   8442  C  C   . GLY D  1 131 ? 22.613  75.188  -17.322 1.00 19.99 ? 132  GLY D C   1 
ATOM   8443  O  O   . GLY D  1 131 ? 22.873  74.371  -18.195 1.00 18.53 ? 132  GLY D O   1 
ATOM   8444  N  N   . LEU D  1 132 ? 21.389  75.376  -16.821 1.00 20.78 ? 133  LEU D N   1 
ATOM   8445  C  CA  . LEU D  1 132 ? 20.250  74.569  -17.244 1.00 21.39 ? 133  LEU D CA  1 
ATOM   8446  C  C   . LEU D  1 132 ? 19.790  75.027  -18.618 1.00 21.87 ? 133  LEU D C   1 
ATOM   8447  O  O   . LEU D  1 132 ? 19.731  74.225  -19.508 1.00 23.66 ? 133  LEU D O   1 
ATOM   8448  C  CB  . LEU D  1 132 ? 19.118  74.655  -16.244 1.00 20.33 ? 133  LEU D CB  1 
ATOM   8449  C  CG  . LEU D  1 132 ? 17.893  73.774  -16.514 1.00 22.97 ? 133  LEU D CG  1 
ATOM   8450  C  CD1 . LEU D  1 132 ? 18.237  72.245  -16.420 1.00 21.28 ? 133  LEU D CD1 1 
ATOM   8451  C  CD2 . LEU D  1 132 ? 16.770  74.139  -15.530 1.00 17.76 ? 133  LEU D CD2 1 
ATOM   8452  N  N   . LEU D  1 133 ? 19.567  76.328  -18.809 1.00 23.99 ? 134  LEU D N   1 
ATOM   8453  C  CA  . LEU D  1 133 ? 18.945  76.846  -20.044 1.00 24.70 ? 134  LEU D CA  1 
ATOM   8454  C  C   . LEU D  1 133 ? 19.869  77.003  -21.233 1.00 25.88 ? 134  LEU D C   1 
ATOM   8455  O  O   . LEU D  1 133 ? 19.432  76.845  -22.367 1.00 27.33 ? 134  LEU D O   1 
ATOM   8456  C  CB  . LEU D  1 133 ? 18.240  78.178  -19.772 1.00 24.38 ? 134  LEU D CB  1 
ATOM   8457  C  CG  . LEU D  1 133 ? 17.188  78.061  -18.674 1.00 25.89 ? 134  LEU D CG  1 
ATOM   8458  C  CD1 . LEU D  1 133 ? 16.639  79.423  -18.290 1.00 24.19 ? 134  LEU D CD1 1 
ATOM   8459  C  CD2 . LEU D  1 133 ? 16.085  77.109  -19.131 1.00 27.54 ? 134  LEU D CD2 1 
ATOM   8460  N  N   . GLU D  1 134 ? 21.139  77.321  -21.017 1.00 25.68 ? 135  GLU D N   1 
ATOM   8461  C  CA  . GLU D  1 134 ? 22.063  77.401  -22.148 1.00 25.85 ? 135  GLU D CA  1 
ATOM   8462  C  C   . GLU D  1 134 ? 22.998  76.206  -22.316 1.00 24.99 ? 135  GLU D C   1 
ATOM   8463  O  O   . GLU D  1 134 ? 23.289  75.820  -23.434 1.00 27.84 ? 135  GLU D O   1 
ATOM   8464  C  CB  . GLU D  1 134 ? 22.921  78.628  -22.030 1.00 28.00 ? 135  GLU D CB  1 
ATOM   8465  C  CG  . GLU D  1 134 ? 22.125  79.878  -21.814 1.00 38.89 ? 135  GLU D CG  1 
ATOM   8466  C  CD  . GLU D  1 134 ? 21.953  80.688  -23.064 1.00 48.00 ? 135  GLU D CD  1 
ATOM   8467  O  OE1 . GLU D  1 134 ? 22.151  80.125  -24.175 1.00 49.92 ? 135  GLU D OE1 1 
ATOM   8468  O  OE2 . GLU D  1 134 ? 21.647  81.894  -22.914 1.00 52.34 ? 135  GLU D OE2 1 
ATOM   8469  N  N   . ILE D  1 135 ? 23.529  75.661  -21.233 1.00 23.54 ? 136  ILE D N   1 
ATOM   8470  C  CA  . ILE D  1 135 ? 24.532  74.607  -21.372 1.00 22.45 ? 136  ILE D CA  1 
ATOM   8471  C  C   . ILE D  1 135 ? 23.872  73.250  -21.552 1.00 22.19 ? 136  ILE D C   1 
ATOM   8472  O  O   . ILE D  1 135 ? 24.193  72.573  -22.483 1.00 23.83 ? 136  ILE D O   1 
ATOM   8473  C  CB  . ILE D  1 135 ? 25.561  74.585  -20.200 1.00 21.49 ? 136  ILE D CB  1 
ATOM   8474  C  CG1 . ILE D  1 135 ? 26.249  75.945  -20.065 1.00 20.09 ? 136  ILE D CG1 1 
ATOM   8475  C  CG2 . ILE D  1 135 ? 26.617  73.483  -20.446 1.00 19.56 ? 136  ILE D CG2 1 
ATOM   8476  C  CD1 . ILE D  1 135 ? 27.015  76.445  -21.325 1.00 17.32 ? 136  ILE D CD1 1 
ATOM   8477  N  N   . CYS D  1 136 ? 22.970  72.859  -20.653 1.00 24.37 ? 137  CYS D N   1 
ATOM   8478  C  CA  . CYS D  1 136 ? 22.084  71.692  -20.870 1.00 25.32 ? 137  CYS D CA  1 
ATOM   8479  C  C   . CYS D  1 136 ? 21.058  71.951  -21.974 1.00 28.47 ? 137  CYS D C   1 
ATOM   8480  O  O   . CYS D  1 136 ? 20.564  71.001  -22.598 1.00 30.11 ? 137  CYS D O   1 
ATOM   8481  C  CB  . CYS D  1 136 ? 21.289  71.369  -19.617 1.00 24.72 ? 137  CYS D CB  1 
ATOM   8482  S  SG  . CYS D  1 136 ? 22.195  70.563  -18.292 1.00 28.22 ? 137  CYS D SG  1 
ATOM   8483  N  N   . GLY D  1 137 ? 20.688  73.226  -22.143 1.00 27.12 ? 138  GLY D N   1 
ATOM   8484  C  CA  . GLY D  1 137 ? 19.776  73.662  -23.185 1.00 28.81 ? 138  GLY D CA  1 
ATOM   8485  C  C   . GLY D  1 137 ? 18.435  72.981  -23.149 1.00 30.22 ? 138  GLY D C   1 
ATOM   8486  O  O   . GLY D  1 137 ? 17.972  72.491  -24.181 1.00 32.14 ? 138  GLY D O   1 
ATOM   8487  N  N   . VAL D  1 138 ? 17.808  72.939  -21.978 1.00 31.47 ? 139  VAL D N   1 
ATOM   8488  C  CA  . VAL D  1 138 ? 16.492  72.312  -21.870 1.00 35.85 ? 139  VAL D CA  1 
ATOM   8489  C  C   . VAL D  1 138 ? 15.438  73.072  -22.695 1.00 39.70 ? 139  VAL D C   1 
ATOM   8490  O  O   . VAL D  1 138 ? 15.502  74.302  -22.823 1.00 38.63 ? 139  VAL D O   1 
ATOM   8491  C  CB  . VAL D  1 138 ? 15.988  72.207  -20.419 1.00 35.89 ? 139  VAL D CB  1 
ATOM   8492  C  CG1 . VAL D  1 138 ? 16.957  71.388  -19.555 1.00 35.50 ? 139  VAL D CG1 1 
ATOM   8493  C  CG2 . VAL D  1 138 ? 15.753  73.541  -19.869 1.00 29.82 ? 139  VAL D CG2 1 
ATOM   8494  N  N   . LYS D  1 139 ? 14.478  72.326  -23.249 1.00 42.92 ? 140  LYS D N   1 
ATOM   8495  C  CA  . LYS D  1 139 ? 13.444  72.908  -24.118 1.00 45.34 ? 140  LYS D CA  1 
ATOM   8496  C  C   . LYS D  1 139 ? 12.011  72.679  -23.599 1.00 45.54 ? 140  LYS D C   1 
ATOM   8497  O  O   . LYS D  1 139 ? 11.089  73.430  -23.982 1.00 46.58 ? 140  LYS D O   1 
ATOM   8498  C  CB  . LYS D  1 139 ? 13.591  72.365  -25.544 1.00 46.68 ? 140  LYS D CB  1 
ATOM   8499  C  CG  . LYS D  1 139 ? 14.802  72.895  -26.306 1.00 50.30 ? 140  LYS D CG  1 
ATOM   8500  C  CD  . LYS D  1 139 ? 14.525  74.277  -26.868 1.00 58.06 ? 140  LYS D CD  1 
ATOM   8501  C  CE  . LYS D  1 139 ? 15.768  74.943  -27.429 1.00 60.94 ? 140  LYS D CE  1 
ATOM   8502  N  NZ  . LYS D  1 139 ? 15.504  76.400  -27.627 1.00 66.33 ? 140  LYS D NZ  1 
ATOM   8503  N  N   . GLY D  1 140 ? 11.843  71.672  -22.733 1.00 42.02 ? 141  GLY D N   1 
ATOM   8504  C  CA  . GLY D  1 140 ? 10.545  71.303  -22.139 1.00 39.82 ? 141  GLY D CA  1 
ATOM   8505  C  C   . GLY D  1 140 ? 10.242  69.824  -22.360 1.00 38.14 ? 141  GLY D C   1 
ATOM   8506  O  O   . GLY D  1 140 ? 10.444  69.315  -23.452 1.00 40.73 ? 141  GLY D O   1 
ATOM   8507  N  N   . GLY D  1 141 ? 9.767   69.124  -21.339 1.00 36.20 ? 142  GLY D N   1 
ATOM   8508  C  CA  . GLY D  1 141 ? 9.522   67.677  -21.450 1.00 36.37 ? 142  GLY D CA  1 
ATOM   8509  C  C   . GLY D  1 141 ? 10.685  66.770  -21.046 1.00 34.99 ? 142  GLY D C   1 
ATOM   8510  O  O   . GLY D  1 141 ? 10.484  65.587  -20.748 1.00 37.02 ? 142  GLY D O   1 
ATOM   8511  N  N   . GLU D  1 142 ? 11.894  67.327  -20.996 1.00 33.38 ? 143  GLU D N   1 
ATOM   8512  C  CA  . GLU D  1 142 ? 13.110  66.551  -20.727 1.00 31.10 ? 143  GLU D CA  1 
ATOM   8513  C  C   . GLU D  1 142 ? 13.106  65.979  -19.316 1.00 27.89 ? 143  GLU D C   1 
ATOM   8514  O  O   . GLU D  1 142 ? 12.457  66.500  -18.423 1.00 29.17 ? 143  GLU D O   1 
ATOM   8515  C  CB  . GLU D  1 142 ? 14.369  67.413  -20.929 1.00 31.05 ? 143  GLU D CB  1 
ATOM   8516  C  CG  . GLU D  1 142 ? 14.675  67.817  -22.380 1.00 36.04 ? 143  GLU D CG  1 
ATOM   8517  C  CD  . GLU D  1 142 ? 14.423  69.294  -22.676 1.00 45.62 ? 143  GLU D CD  1 
ATOM   8518  O  OE1 . GLU D  1 142 ? 13.612  69.940  -21.970 1.00 42.01 ? 143  GLU D OE1 1 
ATOM   8519  O  OE2 . GLU D  1 142 ? 15.039  69.824  -23.633 1.00 52.12 ? 143  GLU D OE2 1 
ATOM   8520  N  N   . THR D  1 143 ? 13.843  64.893  -19.121 1.00 27.52 ? 144  THR D N   1 
ATOM   8521  C  CA  . THR D  1 143 ? 14.127  64.402  -17.785 1.00 26.22 ? 144  THR D CA  1 
ATOM   8522  C  C   . THR D  1 143 ? 15.521  64.885  -17.379 1.00 25.38 ? 144  THR D C   1 
ATOM   8523  O  O   . THR D  1 143 ? 16.518  64.618  -18.062 1.00 23.20 ? 144  THR D O   1 
ATOM   8524  C  CB  . THR D  1 143 ? 13.979  62.873  -17.708 1.00 27.59 ? 144  THR D CB  1 
ATOM   8525  O  OG1 . THR D  1 143 ? 12.589  62.536  -17.862 1.00 27.47 ? 144  THR D OG1 1 
ATOM   8526  C  CG2 . THR D  1 143 ? 14.488  62.317  -16.355 1.00 24.88 ? 144  THR D CG2 1 
ATOM   8527  N  N   . VAL D  1 144 ? 15.569  65.626  -16.271 1.00 25.46 ? 145  VAL D N   1 
ATOM   8528  C  CA  . VAL D  1 144 ? 16.791  66.274  -15.823 1.00 23.48 ? 145  VAL D CA  1 
ATOM   8529  C  C   . VAL D  1 144 ? 17.289  65.645  -14.520 1.00 23.97 ? 145  VAL D C   1 
ATOM   8530  O  O   . VAL D  1 144 ? 16.548  65.561  -13.541 1.00 26.21 ? 145  VAL D O   1 
ATOM   8531  C  CB  . VAL D  1 144 ? 16.551  67.772  -15.625 1.00 25.06 ? 145  VAL D CB  1 
ATOM   8532  C  CG1 . VAL D  1 144 ? 17.877  68.501  -15.296 1.00 25.51 ? 145  VAL D CG1 1 
ATOM   8533  C  CG2 . VAL D  1 144 ? 15.942  68.356  -16.881 1.00 24.32 ? 145  VAL D CG2 1 
ATOM   8534  N  N   . MET D  1 145 ? 18.523  65.146  -14.522 1.00 21.12 ? 146  MET D N   1 
ATOM   8535  C  CA  . MET D  1 145 ? 19.141  64.685  -13.278 1.00 21.33 ? 146  MET D CA  1 
ATOM   8536  C  C   . MET D  1 145 ? 19.935  65.853  -12.671 1.00 20.16 ? 146  MET D C   1 
ATOM   8537  O  O   . MET D  1 145 ? 20.691  66.525  -13.365 1.00 18.34 ? 146  MET D O   1 
ATOM   8538  C  CB  . MET D  1 145 ? 19.965  63.403  -13.523 1.00 21.19 ? 146  MET D CB  1 
ATOM   8539  C  CG  . MET D  1 145 ? 21.172  63.144  -12.664 1.00 30.53 ? 146  MET D CG  1 
ATOM   8540  S  SD  . MET D  1 145 ? 21.043  63.056  -10.887 1.00 35.81 ? 146  MET D SD  1 
ATOM   8541  C  CE  . MET D  1 145 ? 22.355  64.155  -10.508 1.00 38.41 ? 146  MET D CE  1 
ATOM   8542  N  N   . VAL D  1 146 ? 19.690  66.129  -11.392 1.00 21.29 ? 147  VAL D N   1 
ATOM   8543  C  CA  . VAL D  1 146 ? 20.420  67.162  -10.674 1.00 22.28 ? 147  VAL D CA  1 
ATOM   8544  C  C   . VAL D  1 146 ? 20.833  66.678  -9.270  1.00 21.96 ? 147  VAL D C   1 
ATOM   8545  O  O   . VAL D  1 146 ? 20.083  66.007  -8.554  1.00 19.18 ? 147  VAL D O   1 
ATOM   8546  C  CB  . VAL D  1 146 ? 19.644  68.518  -10.679 1.00 23.49 ? 147  VAL D CB  1 
ATOM   8547  C  CG1 . VAL D  1 146 ? 18.225  68.339  -10.252 1.00 27.65 ? 147  VAL D CG1 1 
ATOM   8548  C  CG2 . VAL D  1 146 ? 20.349  69.578  -9.841  1.00 19.08 ? 147  VAL D CG2 1 
ATOM   8549  N  N   . ASN D  1 147 ? 22.090  66.941  -8.931  1.00 21.57 ? 148  ASN D N   1 
ATOM   8550  C  CA  . ASN D  1 147 ? 22.645  66.514  -7.661  1.00 19.61 ? 148  ASN D CA  1 
ATOM   8551  C  C   . ASN D  1 147 ? 22.954  67.764  -6.853  1.00 20.37 ? 148  ASN D C   1 
ATOM   8552  O  O   . ASN D  1 147 ? 22.742  68.873  -7.352  1.00 19.38 ? 148  ASN D O   1 
ATOM   8553  C  CB  . ASN D  1 147 ? 23.850  65.572  -7.848  1.00 21.40 ? 148  ASN D CB  1 
ATOM   8554  C  CG  . ASN D  1 147 ? 24.897  66.097  -8.812  1.00 19.16 ? 148  ASN D CG  1 
ATOM   8555  O  OD1 . ASN D  1 147 ? 25.059  67.295  -8.972  1.00 16.79 ? 148  ASN D OD1 1 
ATOM   8556  N  ND2 . ASN D  1 147 ? 25.654  65.186  -9.412  1.00 17.95 ? 148  ASN D ND2 1 
ATOM   8557  N  N   . ALA D  1 148 ? 23.385  67.591  -5.602  1.00 20.10 ? 149  ALA D N   1 
ATOM   8558  C  CA  . ALA D  1 148 ? 23.323  68.668  -4.623  1.00 19.84 ? 149  ALA D CA  1 
ATOM   8559  C  C   . ALA D  1 148 ? 22.012  69.468  -4.852  1.00 19.79 ? 149  ALA D C   1 
ATOM   8560  O  O   . ALA D  1 148 ? 21.999  70.706  -4.897  1.00 20.84 ? 149  ALA D O   1 
ATOM   8561  C  CB  . ALA D  1 148 ? 24.617  69.570  -4.701  1.00 14.55 ? 149  ALA D CB  1 
ATOM   8562  N  N   . ALA D  1 149 ? 20.908  68.729  -4.966  1.00 21.61 ? 150  ALA D N   1 
ATOM   8563  C  CA  . ALA D  1 149 ? 19.620  69.277  -5.442  1.00 22.41 ? 150  ALA D CA  1 
ATOM   8564  C  C   . ALA D  1 149 ? 18.892  70.174  -4.428  1.00 21.95 ? 150  ALA D C   1 
ATOM   8565  O  O   . ALA D  1 149 ? 17.973  70.909  -4.803  1.00 25.65 ? 150  ALA D O   1 
ATOM   8566  C  CB  . ALA D  1 149 ? 18.688  68.134  -5.864  1.00 22.51 ? 150  ALA D CB  1 
ATOM   8567  N  N   . ALA D  1 150 ? 19.279  70.087  -3.161  1.00 21.63 ? 151  ALA D N   1 
ATOM   8568  C  CA  . ALA D  1 150 ? 18.783  70.965  -2.113  1.00 21.70 ? 151  ALA D CA  1 
ATOM   8569  C  C   . ALA D  1 150 ? 19.770  72.103  -1.804  1.00 23.64 ? 151  ALA D C   1 
ATOM   8570  O  O   . ALA D  1 150 ? 19.575  72.860  -0.845  1.00 22.08 ? 151  ALA D O   1 
ATOM   8571  C  CB  . ALA D  1 150 ? 18.528  70.175  -0.868  1.00 20.84 ? 151  ALA D CB  1 
ATOM   8572  N  N   . GLY D  1 151 ? 20.819  72.236  -2.610  1.00 23.14 ? 152  GLY D N   1 
ATOM   8573  C  CA  . GLY D  1 151 ? 21.806  73.299  -2.401  1.00 21.32 ? 152  GLY D CA  1 
ATOM   8574  C  C   . GLY D  1 151 ? 21.402  74.564  -3.097  1.00 21.56 ? 152  GLY D C   1 
ATOM   8575  O  O   . GLY D  1 151 ? 20.322  74.631  -3.694  1.00 22.47 ? 152  GLY D O   1 
ATOM   8576  N  N   . ALA D  1 152 ? 22.260  75.582  -3.047  1.00 21.83 ? 153  ALA D N   1 
ATOM   8577  C  CA  . ALA D  1 152 ? 21.900  76.883  -3.603  1.00 20.58 ? 153  ALA D CA  1 
ATOM   8578  C  C   . ALA D  1 152 ? 21.732  76.836  -5.118  1.00 21.61 ? 153  ALA D C   1 
ATOM   8579  O  O   . ALA D  1 152 ? 20.761  77.367  -5.658  1.00 23.88 ? 153  ALA D O   1 
ATOM   8580  C  CB  . ALA D  1 152 ? 22.916  77.913  -3.226  1.00 20.52 ? 153  ALA D CB  1 
ATOM   8581  N  N   . VAL D  1 153 ? 22.671  76.217  -5.817  1.00 21.68 ? 154  VAL D N   1 
ATOM   8582  C  CA  . VAL D  1 153 ? 22.555  76.108  -7.260  1.00 20.12 ? 154  VAL D CA  1 
ATOM   8583  C  C   . VAL D  1 153 ? 21.519  75.033  -7.599  1.00 20.87 ? 154  VAL D C   1 
ATOM   8584  O  O   . VAL D  1 153 ? 20.554  75.301  -8.320  1.00 20.40 ? 154  VAL D O   1 
ATOM   8585  C  CB  . VAL D  1 153 ? 23.896  75.812  -7.922  1.00 19.79 ? 154  VAL D CB  1 
ATOM   8586  C  CG1 . VAL D  1 153 ? 23.714  75.542  -9.434  1.00 16.57 ? 154  VAL D CG1 1 
ATOM   8587  C  CG2 . VAL D  1 153 ? 24.857  76.986  -7.690  1.00 17.33 ? 154  VAL D CG2 1 
ATOM   8588  N  N   . GLY D  1 154 ? 21.704  73.837  -7.053  1.00 20.55 ? 155  GLY D N   1 
ATOM   8589  C  CA  . GLY D  1 154 ? 20.857  72.697  -7.403  1.00 21.93 ? 155  GLY D CA  1 
ATOM   8590  C  C   . GLY D  1 154 ? 19.349  72.932  -7.239  1.00 22.10 ? 155  GLY D C   1 
ATOM   8591  O  O   . GLY D  1 154 ? 18.567  72.550  -8.104  1.00 21.72 ? 155  GLY D O   1 
ATOM   8592  N  N   . SER D  1 155 ? 18.949  73.568  -6.144  1.00 20.74 ? 156  SER D N   1 
ATOM   8593  C  CA  . SER D  1 155 ? 17.527  73.788  -5.887  1.00 23.26 ? 156  SER D CA  1 
ATOM   8594  C  C   . SER D  1 155 ? 16.934  74.742  -6.885  1.00 23.20 ? 156  SER D C   1 
ATOM   8595  O  O   . SER D  1 155 ? 15.797  74.562  -7.301  1.00 26.37 ? 156  SER D O   1 
ATOM   8596  C  CB  . SER D  1 155 ? 17.254  74.253  -4.455  1.00 22.21 ? 156  SER D CB  1 
ATOM   8597  O  OG  . SER D  1 155 ? 17.967  75.432  -4.158  1.00 28.97 ? 156  SER D OG  1 
ATOM   8598  N  N   . VAL D  1 156 ? 17.705  75.735  -7.310  1.00 23.57 ? 157  VAL D N   1 
ATOM   8599  C  CA  . VAL D  1 156 ? 17.242  76.650  -8.330  1.00 20.94 ? 157  VAL D CA  1 
ATOM   8600  C  C   . VAL D  1 156 ? 17.151  75.921  -9.664  1.00 22.19 ? 157  VAL D C   1 
ATOM   8601  O  O   . VAL D  1 156 ? 16.178  76.105  -10.418 1.00 24.34 ? 157  VAL D O   1 
ATOM   8602  C  CB  . VAL D  1 156 ? 18.129  77.914  -8.429  1.00 21.93 ? 157  VAL D CB  1 
ATOM   8603  C  CG1 . VAL D  1 156 ? 17.650  78.834  -9.547  1.00 21.22 ? 157  VAL D CG1 1 
ATOM   8604  C  CG2 . VAL D  1 156 ? 18.109  78.674  -7.130  1.00 21.41 ? 157  VAL D CG2 1 
ATOM   8605  N  N   . VAL D  1 157 ? 18.142  75.091  -9.973  1.00 21.82 ? 158  VAL D N   1 
ATOM   8606  C  CA  . VAL D  1 157 ? 18.117  74.349  -11.222 1.00 21.22 ? 158  VAL D CA  1 
ATOM   8607  C  C   . VAL D  1 157 ? 16.838  73.511  -11.332 1.00 21.56 ? 158  VAL D C   1 
ATOM   8608  O  O   . VAL D  1 157 ? 16.185  73.501  -12.356 1.00 21.88 ? 158  VAL D O   1 
ATOM   8609  C  CB  . VAL D  1 157 ? 19.308  73.383  -11.355 1.00 22.01 ? 158  VAL D CB  1 
ATOM   8610  C  CG1 . VAL D  1 157 ? 19.065  72.394  -12.512 1.00 16.87 ? 158  VAL D CG1 1 
ATOM   8611  C  CG2 . VAL D  1 157 ? 20.607  74.148  -11.537 1.00 19.31 ? 158  VAL D CG2 1 
ATOM   8612  N  N   . GLY D  1 158 ? 16.518  72.779  -10.285 1.00 22.82 ? 159  GLY D N   1 
ATOM   8613  C  CA  . GLY D  1 158 ? 15.324  71.951  -10.291 1.00 25.07 ? 159  GLY D CA  1 
ATOM   8614  C  C   . GLY D  1 158 ? 14.024  72.758  -10.424 1.00 26.60 ? 159  GLY D C   1 
ATOM   8615  O  O   . GLY D  1 158 ? 13.082  72.316  -11.074 1.00 25.28 ? 159  GLY D O   1 
ATOM   8616  N  N   . GLN D  1 159 ? 13.967  73.936  -9.811  1.00 25.81 ? 160  GLN D N   1 
ATOM   8617  C  CA  . GLN D  1 159 ? 12.731  74.716  -9.837  1.00 25.94 ? 160  GLN D CA  1 
ATOM   8618  C  C   . GLN D  1 159 ? 12.513  75.345  -11.191 1.00 26.51 ? 160  GLN D C   1 
ATOM   8619  O  O   . GLN D  1 159 ? 11.368  75.409  -11.688 1.00 27.54 ? 160  GLN D O   1 
ATOM   8620  C  CB  . GLN D  1 159 ? 12.733  75.761  -8.731  1.00 26.54 ? 160  GLN D CB  1 
ATOM   8621  C  CG  . GLN D  1 159 ? 12.663  75.111  -7.388  1.00 24.04 ? 160  GLN D CG  1 
ATOM   8622  C  CD  . GLN D  1 159 ? 12.541  76.114  -6.285  1.00 31.41 ? 160  GLN D CD  1 
ATOM   8623  O  OE1 . GLN D  1 159 ? 11.447  76.576  -5.978  1.00 33.43 ? 160  GLN D OE1 1 
ATOM   8624  N  NE2 . GLN D  1 159 ? 13.662  76.437  -5.647  1.00 30.61 ? 160  GLN D NE2 1 
ATOM   8625  N  N   . ILE D  1 160 ? 13.608  75.750  -11.823 1.00 25.01 ? 161  ILE D N   1 
ATOM   8626  C  CA  . ILE D  1 160 ? 13.543  76.292  -13.158 1.00 22.84 ? 161  ILE D CA  1 
ATOM   8627  C  C   . ILE D  1 160 ? 13.139  75.210  -14.119 1.00 25.47 ? 161  ILE D C   1 
ATOM   8628  O  O   . ILE D  1 160 ? 12.343  75.448  -15.033 1.00 26.98 ? 161  ILE D O   1 
ATOM   8629  C  CB  . ILE D  1 160 ? 14.871  76.917  -13.591 1.00 23.47 ? 161  ILE D CB  1 
ATOM   8630  C  CG1 . ILE D  1 160 ? 15.136  78.178  -12.750 1.00 23.06 ? 161  ILE D CG1 1 
ATOM   8631  C  CG2 . ILE D  1 160 ? 14.842  77.245  -15.064 1.00 19.39 ? 161  ILE D CG2 1 
ATOM   8632  C  CD1 . ILE D  1 160 ? 16.289  79.000  -13.159 1.00 22.01 ? 161  ILE D CD1 1 
ATOM   8633  N  N   . ALA D  1 161 ? 13.684  74.013  -13.934 1.00 26.49 ? 162  ALA D N   1 
ATOM   8634  C  CA  . ALA D  1 161 ? 13.360  72.910  -14.837 1.00 26.33 ? 162  ALA D CA  1 
ATOM   8635  C  C   . ALA D  1 161 ? 11.867  72.534  -14.724 1.00 27.07 ? 162  ALA D C   1 
ATOM   8636  O  O   . ALA D  1 161 ? 11.210  72.293  -15.733 1.00 30.29 ? 162  ALA D O   1 
ATOM   8637  C  CB  . ALA D  1 161 ? 14.255  71.683  -14.546 1.00 24.24 ? 162  ALA D CB  1 
ATOM   8638  N  N   . LYS D  1 162 ? 11.353  72.487  -13.502 1.00 27.63 ? 163  LYS D N   1 
ATOM   8639  C  CA  . LYS D  1 162 ? 9.925   72.238  -13.255 1.00 29.81 ? 163  LYS D CA  1 
ATOM   8640  C  C   . LYS D  1 162 ? 8.994   73.216  -13.967 1.00 32.37 ? 163  LYS D C   1 
ATOM   8641  O  O   . LYS D  1 162 ? 8.014   72.799  -14.630 1.00 34.14 ? 163  LYS D O   1 
ATOM   8642  C  CB  . LYS D  1 162 ? 9.609   72.309  -11.764 1.00 28.73 ? 163  LYS D CB  1 
ATOM   8643  C  CG  . LYS D  1 162 ? 10.031  71.087  -10.934 1.00 27.37 ? 163  LYS D CG  1 
ATOM   8644  C  CD  . LYS D  1 162 ? 9.708   69.746  -11.562 1.00 28.52 ? 163  LYS D CD  1 
ATOM   8645  C  CE  . LYS D  1 162 ? 8.229   69.544  -11.926 1.00 34.57 ? 163  LYS D CE  1 
ATOM   8646  N  NZ  . LYS D  1 162 ? 7.990   68.091  -12.376 1.00 28.41 ? 163  LYS D NZ  1 
ATOM   8647  N  N   . LEU D  1 163 ? 9.275   74.510  -13.836 1.00 32.11 ? 164  LEU D N   1 
ATOM   8648  C  CA  . LEU D  1 163 ? 8.412   75.488  -14.467 1.00 32.73 ? 164  LEU D CA  1 
ATOM   8649  C  C   . LEU D  1 163 ? 8.604   75.482  -15.993 1.00 33.99 ? 164  LEU D C   1 
ATOM   8650  O  O   . LEU D  1 163 ? 7.733   75.979  -16.731 1.00 34.67 ? 164  LEU D O   1 
ATOM   8651  C  CB  . LEU D  1 163 ? 8.587   76.877  -13.839 1.00 32.65 ? 164  LEU D CB  1 
ATOM   8652  C  CG  . LEU D  1 163 ? 9.868   77.664  -14.089 1.00 34.58 ? 164  LEU D CG  1 
ATOM   8653  C  CD1 . LEU D  1 163 ? 9.753   78.533  -15.356 1.00 32.44 ? 164  LEU D CD1 1 
ATOM   8654  C  CD2 . LEU D  1 163 ? 10.164  78.517  -12.857 1.00 28.99 ? 164  LEU D CD2 1 
ATOM   8655  N  N   . LYS D  1 164 ? 9.712   74.913  -16.480 1.00 31.94 ? 165  LYS D N   1 
ATOM   8656  C  CA  . LYS D  1 164 ? 9.862   74.694  -17.931 1.00 31.61 ? 165  LYS D CA  1 
ATOM   8657  C  C   . LYS D  1 164 ? 9.217   73.377  -18.418 1.00 31.05 ? 165  LYS D C   1 
ATOM   8658  O  O   . LYS D  1 164 ? 9.340   73.002  -19.588 1.00 30.42 ? 165  LYS D O   1 
ATOM   8659  C  CB  . LYS D  1 164 ? 11.332  74.762  -18.352 1.00 31.59 ? 165  LYS D CB  1 
ATOM   8660  C  CG  . LYS D  1 164 ? 11.966  76.127  -18.131 1.00 32.36 ? 165  LYS D CG  1 
ATOM   8661  C  CD  . LYS D  1 164 ? 11.471  77.172  -19.122 1.00 36.78 ? 165  LYS D CD  1 
ATOM   8662  C  CE  . LYS D  1 164 ? 12.115  78.526  -18.866 1.00 39.47 ? 165  LYS D CE  1 
ATOM   8663  N  NZ  . LYS D  1 164 ? 11.396  79.646  -19.531 1.00 40.27 ? 165  LYS D NZ  1 
ATOM   8664  N  N   . GLY D  1 165 ? 8.546   72.680  -17.511 1.00 30.78 ? 166  GLY D N   1 
ATOM   8665  C  CA  . GLY D  1 165 ? 7.807   71.477  -17.852 1.00 32.14 ? 166  GLY D CA  1 
ATOM   8666  C  C   . GLY D  1 165 ? 8.644   70.216  -17.895 1.00 33.35 ? 166  GLY D C   1 
ATOM   8667  O  O   . GLY D  1 165 ? 8.320   69.304  -18.659 1.00 35.54 ? 166  GLY D O   1 
ATOM   8668  N  N   . CYS D  1 166 ? 9.714   70.156  -17.091 1.00 31.87 ? 167  CYS D N   1 
ATOM   8669  C  CA  . CYS D  1 166 ? 10.639  69.021  -17.120 1.00 30.18 ? 167  CYS D CA  1 
ATOM   8670  C  C   . CYS D  1 166 ? 10.346  68.129  -15.946 1.00 29.82 ? 167  CYS D C   1 
ATOM   8671  O  O   . CYS D  1 166 ? 9.728   68.544  -14.963 1.00 29.77 ? 167  CYS D O   1 
ATOM   8672  C  CB  . CYS D  1 166 ? 12.093  69.465  -17.018 1.00 32.55 ? 167  CYS D CB  1 
ATOM   8673  S  SG  . CYS D  1 166 ? 12.689  70.549  -18.296 1.00 36.69 ? 167  CYS D SG  1 
ATOM   8674  N  N   . LYS D  1 167 ? 10.776  66.885  -16.077 1.00 28.03 ? 168  LYS D N   1 
ATOM   8675  C  CA  . LYS D  1 167 ? 10.763  65.950  -14.984 1.00 28.03 ? 168  LYS D CA  1 
ATOM   8676  C  C   . LYS D  1 167 ? 12.123  66.096  -14.305 1.00 27.05 ? 168  LYS D C   1 
ATOM   8677  O  O   . LYS D  1 167 ? 13.150  66.061  -14.978 1.00 28.68 ? 168  LYS D O   1 
ATOM   8678  C  CB  . LYS D  1 167 ? 10.574  64.518  -15.517 1.00 28.39 ? 168  LYS D CB  1 
ATOM   8679  C  CG  . LYS D  1 167 ? 10.639  63.427  -14.459 1.00 31.61 ? 168  LYS D CG  1 
ATOM   8680  C  CD  . LYS D  1 167 ? 10.526  62.004  -15.070 1.00 34.48 ? 168  LYS D CD  1 
ATOM   8681  C  CE  . LYS D  1 167 ? 10.526  60.950  -13.969 1.00 36.14 ? 168  LYS D CE  1 
ATOM   8682  N  NZ  . LYS D  1 167 ? 10.601  59.534  -14.465 1.00 37.79 ? 168  LYS D NZ  1 
ATOM   8683  N  N   . VAL D  1 168 ? 12.128  66.250  -12.985 1.00 26.61 ? 169  VAL D N   1 
ATOM   8684  C  CA  . VAL D  1 168 ? 13.369  66.408  -12.232 1.00 25.24 ? 169  VAL D CA  1 
ATOM   8685  C  C   . VAL D  1 168 ? 13.638  65.214  -11.318 1.00 24.76 ? 169  VAL D C   1 
ATOM   8686  O  O   . VAL D  1 168 ? 12.769  64.797  -10.562 1.00 28.02 ? 169  VAL D O   1 
ATOM   8687  C  CB  . VAL D  1 168 ? 13.367  67.712  -11.399 1.00 25.55 ? 169  VAL D CB  1 
ATOM   8688  C  CG1 . VAL D  1 168 ? 14.605  67.760  -10.500 1.00 22.64 ? 169  VAL D CG1 1 
ATOM   8689  C  CG2 . VAL D  1 168 ? 13.349  68.930  -12.326 1.00 22.97 ? 169  VAL D CG2 1 
ATOM   8690  N  N   . VAL D  1 169 ? 14.840  64.660  -11.415 1.00 23.99 ? 170  VAL D N   1 
ATOM   8691  C  CA  . VAL D  1 169 ? 15.328  63.655  -10.478 1.00 23.62 ? 170  VAL D CA  1 
ATOM   8692  C  C   . VAL D  1 169 ? 16.496  64.264  -9.696  1.00 23.73 ? 170  VAL D C   1 
ATOM   8693  O  O   . VAL D  1 169 ? 17.515  64.709  -10.263 1.00 22.37 ? 170  VAL D O   1 
ATOM   8694  C  CB  . VAL D  1 169 ? 15.766  62.360  -11.194 1.00 23.08 ? 170  VAL D CB  1 
ATOM   8695  C  CG1 . VAL D  1 169 ? 16.293  61.350  -10.191 1.00 22.21 ? 170  VAL D CG1 1 
ATOM   8696  C  CG2 . VAL D  1 169 ? 14.605  61.779  -11.974 1.00 23.82 ? 170  VAL D CG2 1 
ATOM   8697  N  N   . GLY D  1 170 ? 16.334  64.276  -8.383  1.00 24.35 ? 171  GLY D N   1 
ATOM   8698  C  CA  . GLY D  1 170 ? 17.210  65.027  -7.514  1.00 24.70 ? 171  GLY D CA  1 
ATOM   8699  C  C   . GLY D  1 170 ? 17.878  64.119  -6.501  1.00 25.20 ? 171  GLY D C   1 
ATOM   8700  O  O   . GLY D  1 170 ? 17.207  63.304  -5.851  1.00 24.91 ? 171  GLY D O   1 
ATOM   8701  N  N   . ALA D  1 171 ? 19.198  64.272  -6.393  1.00 21.82 ? 172  ALA D N   1 
ATOM   8702  C  CA  . ALA D  1 171 ? 20.010  63.601  -5.380  1.00 22.16 ? 172  ALA D CA  1 
ATOM   8703  C  C   . ALA D  1 171 ? 20.410  64.589  -4.283  1.00 22.57 ? 172  ALA D C   1 
ATOM   8704  O  O   . ALA D  1 171 ? 20.932  65.693  -4.559  1.00 20.37 ? 172  ALA D O   1 
ATOM   8705  C  CB  . ALA D  1 171 ? 21.259  63.003  -6.009  1.00 19.96 ? 172  ALA D CB  1 
ATOM   8706  N  N   . VAL D  1 172 ? 20.188  64.166  -3.041  1.00 23.23 ? 173  VAL D N   1 
ATOM   8707  C  CA  . VAL D  1 172 ? 20.512  64.954  -1.861  1.00 23.89 ? 173  VAL D CA  1 
ATOM   8708  C  C   . VAL D  1 172 ? 21.115  64.040  -0.794  1.00 24.53 ? 173  VAL D C   1 
ATOM   8709  O  O   . VAL D  1 172 ? 21.019  62.797  -0.904  1.00 26.40 ? 173  VAL D O   1 
ATOM   8710  C  CB  . VAL D  1 172 ? 19.273  65.739  -1.358  1.00 23.44 ? 173  VAL D CB  1 
ATOM   8711  C  CG1 . VAL D  1 172 ? 18.666  66.512  -2.510  1.00 17.81 ? 173  VAL D CG1 1 
ATOM   8712  C  CG2 . VAL D  1 172 ? 18.214  64.820  -0.749  1.00 23.85 ? 173  VAL D CG2 1 
ATOM   8713  N  N   . GLY D  1 173 ? 21.773  64.640  0.198   1.00 22.18 ? 174  GLY D N   1 
ATOM   8714  C  CA  . GLY D  1 173 ? 22.521  63.877  1.210   1.00 22.73 ? 174  GLY D CA  1 
ATOM   8715  C  C   . GLY D  1 173 ? 21.831  63.621  2.553   1.00 24.72 ? 174  GLY D C   1 
ATOM   8716  O  O   . GLY D  1 173 ? 22.492  63.213  3.527   1.00 23.58 ? 174  GLY D O   1 
ATOM   8717  N  N   . SER D  1 174 ? 20.532  63.910  2.639   1.00 25.33 ? 175  SER D N   1 
ATOM   8718  C  CA  . SER D  1 174 ? 19.794  63.782  3.903   1.00 28.01 ? 175  SER D CA  1 
ATOM   8719  C  C   . SER D  1 174 ? 18.293  63.564  3.682   1.00 28.64 ? 175  SER D C   1 
ATOM   8720  O  O   . SER D  1 174 ? 17.738  63.965  2.656   1.00 29.61 ? 175  SER D O   1 
ATOM   8721  C  CB  . SER D  1 174 ? 20.021  65.007  4.794   1.00 27.98 ? 175  SER D CB  1 
ATOM   8722  O  OG  . SER D  1 174 ? 19.057  66.009  4.542   1.00 30.03 ? 175  SER D OG  1 
ATOM   8723  N  N   . ASP D  1 175 ? 17.644  62.901  4.638   1.00 30.28 ? 176  ASP D N   1 
ATOM   8724  C  CA  . ASP D  1 175 ? 16.204  62.658  4.540   1.00 30.66 ? 176  ASP D CA  1 
ATOM   8725  C  C   . ASP D  1 175 ? 15.481  63.985  4.624   1.00 27.75 ? 176  ASP D C   1 
ATOM   8726  O  O   . ASP D  1 175 ? 14.486  64.221  3.933   1.00 28.42 ? 176  ASP D O   1 
ATOM   8727  C  CB  . ASP D  1 175 ? 15.727  61.725  5.659   1.00 32.67 ? 176  ASP D CB  1 
ATOM   8728  C  CG  . ASP D  1 175 ? 16.216  60.320  5.485   1.00 36.90 ? 176  ASP D CG  1 
ATOM   8729  O  OD1 . ASP D  1 175 ? 16.497  59.934  4.326   1.00 37.85 ? 176  ASP D OD1 1 
ATOM   8730  O  OD2 . ASP D  1 175 ? 16.319  59.601  6.509   1.00 41.99 ? 176  ASP D OD2 1 
ATOM   8731  N  N   . GLU D  1 176 ? 15.994  64.871  5.460   1.00 29.97 ? 177  GLU D N   1 
ATOM   8732  C  CA  . GLU D  1 176 ? 15.420  66.213  5.566   1.00 29.82 ? 177  GLU D CA  1 
ATOM   8733  C  C   . GLU D  1 176 ? 15.397  66.937  4.217   1.00 29.31 ? 177  GLU D C   1 
ATOM   8734  O  O   . GLU D  1 176 ? 14.404  67.567  3.874   1.00 30.99 ? 177  GLU D O   1 
ATOM   8735  C  CB  . GLU D  1 176 ? 16.153  67.050  6.618   1.00 31.71 ? 177  GLU D CB  1 
ATOM   8736  C  CG  . GLU D  1 176 ? 15.386  68.350  6.966   1.00 38.35 ? 177  GLU D CG  1 
ATOM   8737  C  CD  . GLU D  1 176 ? 16.170  69.368  7.809   1.00 48.08 ? 177  GLU D CD  1 
ATOM   8738  O  OE1 . GLU D  1 176 ? 17.273  69.051  8.315   1.00 53.13 ? 177  GLU D OE1 1 
ATOM   8739  O  OE2 . GLU D  1 176 ? 15.655  70.501  7.963   1.00 50.84 ? 177  GLU D OE2 1 
ATOM   8740  N  N   . LYS D  1 177 ? 16.466  66.824  3.422   1.00 28.24 ? 178  LYS D N   1 
ATOM   8741  C  CA  . LYS D  1 177 ? 16.481  67.469  2.103   1.00 26.06 ? 178  LYS D CA  1 
ATOM   8742  C  C   . LYS D  1 177 ? 15.496  66.781  1.155   1.00 25.59 ? 178  LYS D C   1 
ATOM   8743  O  O   . LYS D  1 177 ? 14.789  67.432  0.390   1.00 27.47 ? 178  LYS D O   1 
ATOM   8744  C  CB  . LYS D  1 177 ? 17.917  67.483  1.522   1.00 26.16 ? 178  LYS D CB  1 
ATOM   8745  C  CG  . LYS D  1 177 ? 18.877  68.318  2.329   1.00 23.42 ? 178  LYS D CG  1 
ATOM   8746  C  CD  . LYS D  1 177 ? 20.326  68.233  1.868   1.00 26.55 ? 178  LYS D CD  1 
ATOM   8747  C  CE  . LYS D  1 177 ? 21.241  69.087  2.766   1.00 24.30 ? 178  LYS D CE  1 
ATOM   8748  N  NZ  . LYS D  1 177 ? 22.636  69.291  2.190   1.00 19.86 ? 178  LYS D NZ  1 
ATOM   8749  N  N   . VAL D  1 178 ? 15.438  65.459  1.209   1.00 25.82 ? 179  VAL D N   1 
ATOM   8750  C  CA  . VAL D  1 178 ? 14.521  64.715  0.356   1.00 26.03 ? 179  VAL D CA  1 
ATOM   8751  C  C   . VAL D  1 178 ? 13.097  65.223  0.577   1.00 27.93 ? 179  VAL D C   1 
ATOM   8752  O  O   . VAL D  1 178 ? 12.373  65.541  -0.387  1.00 27.50 ? 179  VAL D O   1 
ATOM   8753  C  CB  . VAL D  1 178 ? 14.627  63.189  0.640   1.00 27.46 ? 179  VAL D CB  1 
ATOM   8754  C  CG1 . VAL D  1 178 ? 13.601  62.396  -0.157  1.00 24.65 ? 179  VAL D CG1 1 
ATOM   8755  C  CG2 . VAL D  1 178 ? 16.025  62.694  0.322   1.00 21.29 ? 179  VAL D CG2 1 
ATOM   8756  N  N   . ALA D  1 179 ? 12.711  65.341  1.850   1.00 29.43 ? 180  ALA D N   1 
ATOM   8757  C  CA  . ALA D  1 179 ? 11.358  65.803  2.222   1.00 29.28 ? 180  ALA D CA  1 
ATOM   8758  C  C   . ALA D  1 179 ? 11.068  67.201  1.714   1.00 29.48 ? 180  ALA D C   1 
ATOM   8759  O  O   . ALA D  1 179 ? 9.964   67.486  1.224   1.00 30.89 ? 180  ALA D O   1 
ATOM   8760  C  CB  . ALA D  1 179 ? 11.162  65.743  3.766   1.00 29.53 ? 180  ALA D CB  1 
ATOM   8761  N  N   . TYR D  1 180 ? 12.055  68.090  1.841   1.00 30.60 ? 181  TYR D N   1 
ATOM   8762  C  CA  . TYR D  1 180 ? 11.886  69.467  1.382   1.00 28.83 ? 181  TYR D CA  1 
ATOM   8763  C  C   . TYR D  1 180 ? 11.640  69.475  -0.118  1.00 28.39 ? 181  TYR D C   1 
ATOM   8764  O  O   . TYR D  1 180 ? 10.724  70.147  -0.596  1.00 31.68 ? 181  TYR D O   1 
ATOM   8765  C  CB  . TYR D  1 180 ? 13.109  70.335  1.752   1.00 31.11 ? 181  TYR D CB  1 
ATOM   8766  C  CG  . TYR D  1 180 ? 13.038  71.753  1.209   1.00 29.54 ? 181  TYR D CG  1 
ATOM   8767  C  CD1 . TYR D  1 180 ? 12.210  72.694  1.797   1.00 33.66 ? 181  TYR D CD1 1 
ATOM   8768  C  CD2 . TYR D  1 180 ? 13.794  72.147  0.109   1.00 27.90 ? 181  TYR D CD2 1 
ATOM   8769  C  CE1 . TYR D  1 180 ? 12.121  73.988  1.302   1.00 32.77 ? 181  TYR D CE1 1 
ATOM   8770  C  CE2 . TYR D  1 180 ? 13.720  73.435  -0.385  1.00 29.97 ? 181  TYR D CE2 1 
ATOM   8771  C  CZ  . TYR D  1 180 ? 12.880  74.357  0.217   1.00 31.31 ? 181  TYR D CZ  1 
ATOM   8772  O  OH  . TYR D  1 180 ? 12.781  75.647  -0.258  1.00 33.18 ? 181  TYR D OH  1 
ATOM   8773  N  N   . LEU D  1 181 ? 12.431  68.718  -0.872  1.00 26.45 ? 182  LEU D N   1 
ATOM   8774  C  CA  . LEU D  1 181 ? 12.348  68.794  -2.342  1.00 26.19 ? 182  LEU D CA  1 
ATOM   8775  C  C   . LEU D  1 181 ? 11.105  68.055  -2.890  1.00 26.50 ? 182  LEU D C   1 
ATOM   8776  O  O   . LEU D  1 181 ? 10.606  68.372  -3.974  1.00 25.07 ? 182  LEU D O   1 
ATOM   8777  C  CB  . LEU D  1 181 ? 13.660  68.274  -2.993  1.00 25.87 ? 182  LEU D CB  1 
ATOM   8778  C  CG  . LEU D  1 181 ? 14.967  69.099  -2.790  1.00 27.15 ? 182  LEU D CG  1 
ATOM   8779  C  CD1 . LEU D  1 181 ? 16.163  68.546  -3.601  1.00 18.58 ? 182  LEU D CD1 1 
ATOM   8780  C  CD2 . LEU D  1 181 ? 14.753  70.563  -3.160  1.00 19.03 ? 182  LEU D CD2 1 
ATOM   8781  N  N   . GLN D  1 182 ? 10.614  67.058  -2.160  1.00 27.32 ? 183  GLN D N   1 
ATOM   8782  C  CA  . GLN D  1 182 ? 9.313   66.468  -2.500  1.00 29.55 ? 183  GLN D CA  1 
ATOM   8783  C  C   . GLN D  1 182 ? 8.210   67.503  -2.259  1.00 31.43 ? 183  GLN D C   1 
ATOM   8784  O  O   . GLN D  1 182 ? 7.375   67.743  -3.131  1.00 33.31 ? 183  GLN D O   1 
ATOM   8785  C  CB  . GLN D  1 182 ? 9.065   65.206  -1.695  1.00 28.84 ? 183  GLN D CB  1 
ATOM   8786  C  CG  . GLN D  1 182 ? 9.962   64.071  -2.134  1.00 28.73 ? 183  GLN D CG  1 
ATOM   8787  C  CD  . GLN D  1 182 ? 9.997   62.931  -1.159  1.00 32.86 ? 183  GLN D CD  1 
ATOM   8788  O  OE1 . GLN D  1 182 ? 9.813   63.116  0.046   1.00 34.66 ? 183  GLN D OE1 1 
ATOM   8789  N  NE2 . GLN D  1 182 ? 10.270  61.741  -1.666  1.00 31.25 ? 183  GLN D NE2 1 
ATOM   8790  N  N   . LYS D  1 183 ? 8.255   68.172  -1.112  1.00 33.56 ? 184  LYS D N   1 
ATOM   8791  C  CA  . LYS D  1 183 ? 7.265   69.217  -0.810  1.00 34.69 ? 184  LYS D CA  1 
ATOM   8792  C  C   . LYS D  1 183 ? 7.226   70.293  -1.890  1.00 35.99 ? 184  LYS D C   1 
ATOM   8793  O  O   . LYS D  1 183 ? 6.147   70.821  -2.193  1.00 36.79 ? 184  LYS D O   1 
ATOM   8794  C  CB  . LYS D  1 183 ? 7.525   69.841  0.563   1.00 36.69 ? 184  LYS D CB  1 
ATOM   8795  N  N   . LEU D  1 184 ? 8.389   70.602  -2.485  1.00 37.18 ? 185  LEU D N   1 
ATOM   8796  C  CA  . LEU D  1 184 ? 8.478   71.591  -3.591  1.00 34.80 ? 185  LEU D CA  1 
ATOM   8797  C  C   . LEU D  1 184 ? 7.887   71.070  -4.902  1.00 34.58 ? 185  LEU D C   1 
ATOM   8798  O  O   . LEU D  1 184 ? 7.521   71.865  -5.769  1.00 33.55 ? 185  LEU D O   1 
ATOM   8799  C  CB  . LEU D  1 184 ? 9.943   71.990  -3.881  1.00 36.25 ? 185  LEU D CB  1 
ATOM   8800  C  CG  . LEU D  1 184 ? 10.720  73.018  -3.042  1.00 35.36 ? 185  LEU D CG  1 
ATOM   8801  C  CD1 . LEU D  1 184 ? 12.001  73.345  -3.767  1.00 32.87 ? 185  LEU D CD1 1 
ATOM   8802  C  CD2 . LEU D  1 184 ? 9.933   74.297  -2.823  1.00 35.01 ? 185  LEU D CD2 1 
ATOM   8803  N  N   . GLY D  1 185 ? 7.876   69.743  -5.076  1.00 34.83 ? 186  GLY D N   1 
ATOM   8804  C  CA  . GLY D  1 185 ? 7.334   69.097  -6.284  1.00 33.78 ? 186  GLY D CA  1 
ATOM   8805  C  C   . GLY D  1 185 ? 8.300   68.408  -7.260  1.00 33.97 ? 186  GLY D C   1 
ATOM   8806  O  O   . GLY D  1 185 ? 7.900   68.056  -8.372  1.00 35.65 ? 186  GLY D O   1 
ATOM   8807  N  N   . PHE D  1 186 ? 9.554   68.178  -6.884  1.00 31.24 ? 187  PHE D N   1 
ATOM   8808  C  CA  . PHE D  1 186 ? 10.445  67.461  -7.797  1.00 30.36 ? 187  PHE D CA  1 
ATOM   8809  C  C   . PHE D  1 186 ? 9.921   66.043  -7.924  1.00 31.04 ? 187  PHE D C   1 
ATOM   8810  O  O   . PHE D  1 186 ? 9.433   65.473  -6.955  1.00 32.21 ? 187  PHE D O   1 
ATOM   8811  C  CB  . PHE D  1 186 ? 11.880  67.425  -7.278  1.00 29.62 ? 187  PHE D CB  1 
ATOM   8812  C  CG  . PHE D  1 186 ? 12.557  68.769  -7.227  1.00 28.55 ? 187  PHE D CG  1 
ATOM   8813  C  CD1 . PHE D  1 186 ? 11.860  69.954  -7.468  1.00 28.72 ? 187  PHE D CD1 1 
ATOM   8814  C  CD2 . PHE D  1 186 ? 13.916  68.846  -6.935  1.00 29.44 ? 187  PHE D CD2 1 
ATOM   8815  C  CE1 . PHE D  1 186 ? 12.500  71.163  -7.399  1.00 28.64 ? 187  PHE D CE1 1 
ATOM   8816  C  CE2 . PHE D  1 186 ? 14.555  70.062  -6.858  1.00 27.96 ? 187  PHE D CE2 1 
ATOM   8817  C  CZ  . PHE D  1 186 ? 13.850  71.227  -7.084  1.00 24.46 ? 187  PHE D CZ  1 
ATOM   8818  N  N   . ASP D  1 187 ? 10.044  65.457  -9.108  1.00 31.74 ? 188  ASP D N   1 
ATOM   8819  C  CA  . ASP D  1 187 ? 9.358   64.194  -9.383  1.00 30.64 ? 188  ASP D CA  1 
ATOM   8820  C  C   . ASP D  1 187 ? 9.871   63.049  -8.544  1.00 30.82 ? 188  ASP D C   1 
ATOM   8821  O  O   . ASP D  1 187 ? 9.086   62.362  -7.881  1.00 32.16 ? 188  ASP D O   1 
ATOM   8822  C  CB  . ASP D  1 187 ? 9.419   63.865  -10.860 1.00 30.31 ? 188  ASP D CB  1 
ATOM   8823  C  CG  . ASP D  1 187 ? 8.820   64.970  -11.716 1.00 34.27 ? 188  ASP D CG  1 
ATOM   8824  O  OD1 . ASP D  1 187 ? 9.437   66.065  -11.831 1.00 36.20 ? 188  ASP D OD1 1 
ATOM   8825  O  OD2 . ASP D  1 187 ? 7.724   64.753  -12.265 1.00 39.82 ? 188  ASP D OD2 1 
ATOM   8826  N  N   . VAL D  1 188 ? 11.184  62.842  -8.557  1.00 29.92 ? 189  VAL D N   1 
ATOM   8827  C  CA  . VAL D  1 188 ? 11.806  61.825  -7.719  1.00 27.16 ? 189  VAL D CA  1 
ATOM   8828  C  C   . VAL D  1 188 ? 12.964  62.483  -6.986  1.00 28.79 ? 189  VAL D C   1 
ATOM   8829  O  O   . VAL D  1 188 ? 13.771  63.213  -7.587  1.00 28.92 ? 189  VAL D O   1 
ATOM   8830  C  CB  . VAL D  1 188 ? 12.293  60.615  -8.552  1.00 28.59 ? 189  VAL D CB  1 
ATOM   8831  C  CG1 . VAL D  1 188 ? 13.005  59.594  -7.677  1.00 24.96 ? 189  VAL D CG1 1 
ATOM   8832  C  CG2 . VAL D  1 188 ? 11.116  59.929  -9.274  1.00 29.28 ? 189  VAL D CG2 1 
ATOM   8833  N  N   . VAL D  1 189 ? 13.029  62.262  -5.681  1.00 26.67 ? 190  VAL D N   1 
ATOM   8834  C  CA  . VAL D  1 189 ? 14.135  62.748  -4.899  1.00 25.53 ? 190  VAL D CA  1 
ATOM   8835  C  C   . VAL D  1 189 ? 14.557  61.661  -3.959  1.00 25.81 ? 190  VAL D C   1 
ATOM   8836  O  O   . VAL D  1 189 ? 13.721  61.114  -3.262  1.00 26.76 ? 190  VAL D O   1 
ATOM   8837  C  CB  . VAL D  1 189 ? 13.742  63.960  -4.071  1.00 27.49 ? 190  VAL D CB  1 
ATOM   8838  C  CG1 . VAL D  1 189 ? 14.938  64.433  -3.239  1.00 22.98 ? 190  VAL D CG1 1 
ATOM   8839  C  CG2 . VAL D  1 189 ? 13.229  65.061  -4.969  1.00 23.38 ? 190  VAL D CG2 1 
ATOM   8840  N  N   . PHE D  1 190 ? 15.856  61.364  -3.937  1.00 26.53 ? 191  PHE D N   1 
ATOM   8841  C  CA  . PHE D  1 190 ? 16.402  60.325  -3.082  1.00 24.80 ? 191  PHE D CA  1 
ATOM   8842  C  C   . PHE D  1 190 ? 17.660  60.765  -2.327  1.00 24.31 ? 191  PHE D C   1 
ATOM   8843  O  O   . PHE D  1 190 ? 18.357  61.685  -2.742  1.00 25.11 ? 191  PHE D O   1 
ATOM   8844  C  CB  . PHE D  1 190 ? 16.703  59.083  -3.917  1.00 24.63 ? 191  PHE D CB  1 
ATOM   8845  C  CG  . PHE D  1 190 ? 17.724  59.303  -5.008  1.00 24.55 ? 191  PHE D CG  1 
ATOM   8846  C  CD1 . PHE D  1 190 ? 17.347  59.786  -6.256  1.00 26.26 ? 191  PHE D CD1 1 
ATOM   8847  C  CD2 . PHE D  1 190 ? 19.051  59.004  -4.795  1.00 20.93 ? 191  PHE D CD2 1 
ATOM   8848  C  CE1 . PHE D  1 190 ? 18.307  59.986  -7.287  1.00 24.37 ? 191  PHE D CE1 1 
ATOM   8849  C  CE2 . PHE D  1 190 ? 20.010  59.182  -5.819  1.00 27.25 ? 191  PHE D CE2 1 
ATOM   8850  C  CZ  . PHE D  1 190 ? 19.634  59.673  -7.059  1.00 24.39 ? 191  PHE D CZ  1 
ATOM   8851  N  N   . ASN D  1 191 ? 17.926  60.079  -1.221  1.00 24.66 ? 192  ASN D N   1 
ATOM   8852  C  CA  . ASN D  1 191 ? 19.138  60.248  -0.424  1.00 24.59 ? 192  ASN D CA  1 
ATOM   8853  C  C   . ASN D  1 191 ? 20.189  59.307  -0.956  1.00 25.05 ? 192  ASN D C   1 
ATOM   8854  O  O   . ASN D  1 191 ? 20.058  58.091  -0.795  1.00 26.50 ? 192  ASN D O   1 
ATOM   8855  C  CB  . ASN D  1 191 ? 18.820  59.915  1.037   1.00 24.12 ? 192  ASN D CB  1 
ATOM   8856  C  CG  . ASN D  1 191 ? 19.977  60.182  2.001   1.00 25.40 ? 192  ASN D CG  1 
ATOM   8857  O  OD1 . ASN D  1 191 ? 21.150  60.159  1.636   1.00 28.51 ? 192  ASN D OD1 1 
ATOM   8858  N  ND2 . ASN D  1 191 ? 19.630  60.413  3.263   1.00 26.90 ? 192  ASN D ND2 1 
ATOM   8859  N  N   . TYR D  1 192 ? 21.232  59.851  -1.583  1.00 24.00 ? 193  TYR D N   1 
ATOM   8860  C  CA  . TYR D  1 192 ? 22.284  59.020  -2.192  1.00 24.67 ? 193  TYR D CA  1 
ATOM   8861  C  C   . TYR D  1 192 ? 23.181  58.280  -1.193  1.00 25.87 ? 193  TYR D C   1 
ATOM   8862  O  O   . TYR D  1 192 ? 23.915  57.364  -1.557  1.00 25.60 ? 193  TYR D O   1 
ATOM   8863  C  CB  . TYR D  1 192 ? 23.159  59.862  -3.137  1.00 24.23 ? 193  TYR D CB  1 
ATOM   8864  C  CG  . TYR D  1 192 ? 23.983  60.940  -2.464  1.00 22.93 ? 193  TYR D CG  1 
ATOM   8865  C  CD1 . TYR D  1 192 ? 25.219  60.640  -1.921  1.00 22.69 ? 193  TYR D CD1 1 
ATOM   8866  C  CD2 . TYR D  1 192 ? 23.536  62.258  -2.379  1.00 22.80 ? 193  TYR D CD2 1 
ATOM   8867  C  CE1 . TYR D  1 192 ? 26.008  61.612  -1.304  1.00 26.25 ? 193  TYR D CE1 1 
ATOM   8868  C  CE2 . TYR D  1 192 ? 24.340  63.271  -1.726  1.00 19.45 ? 193  TYR D CE2 1 
ATOM   8869  C  CZ  . TYR D  1 192 ? 25.565  62.919  -1.215  1.00 19.12 ? 193  TYR D CZ  1 
ATOM   8870  O  OH  . TYR D  1 192 ? 26.379  63.817  -0.578  1.00 26.99 ? 193  TYR D OH  1 
ATOM   8871  N  N   . LYS D  1 193 ? 23.153  58.711  0.054   1.00 27.01 ? 194  LYS D N   1 
ATOM   8872  C  CA  . LYS D  1 193 ? 23.970  58.107  1.085   1.00 29.54 ? 194  LYS D CA  1 
ATOM   8873  C  C   . LYS D  1 193 ? 23.339  56.818  1.627   1.00 31.46 ? 194  LYS D C   1 
ATOM   8874  O  O   . LYS D  1 193 ? 24.040  56.005  2.227   1.00 32.83 ? 194  LYS D O   1 
ATOM   8875  C  CB  . LYS D  1 193 ? 24.177  59.090  2.238   1.00 29.42 ? 194  LYS D CB  1 
ATOM   8876  C  CG  . LYS D  1 193 ? 24.887  60.382  1.856   1.00 30.15 ? 194  LYS D CG  1 
ATOM   8877  C  CD  . LYS D  1 193 ? 25.182  61.249  3.104   1.00 31.42 ? 194  LYS D CD  1 
ATOM   8878  C  CE  . LYS D  1 193 ? 26.124  62.403  2.757   1.00 32.60 ? 194  LYS D CE  1 
ATOM   8879  N  NZ  . LYS D  1 193 ? 25.925  63.634  3.570   1.00 28.06 ? 194  LYS D NZ  1 
ATOM   8880  N  N   . THR D  1 194 ? 22.033  56.634  1.419   1.00 32.08 ? 195  THR D N   1 
ATOM   8881  C  CA  . THR D  1 194 ? 21.316  55.491  2.007   1.00 32.62 ? 195  THR D CA  1 
ATOM   8882  C  C   . THR D  1 194 ? 20.744  54.500  0.973   1.00 34.08 ? 195  THR D C   1 
ATOM   8883  O  O   . THR D  1 194 ? 20.372  53.405  1.333   1.00 34.51 ? 195  THR D O   1 
ATOM   8884  C  CB  . THR D  1 194 ? 20.180  55.973  2.927   1.00 31.66 ? 195  THR D CB  1 
ATOM   8885  O  OG1 . THR D  1 194 ? 19.223  56.698  2.161   1.00 32.39 ? 195  THR D OG1 1 
ATOM   8886  C  CG2 . THR D  1 194 ? 20.724  56.905  4.053   1.00 31.84 ? 195  THR D CG2 1 
ATOM   8887  N  N   . VAL D  1 195 ? 20.677  54.863  -0.304  1.00 34.91 ? 196  VAL D N   1 
ATOM   8888  C  CA  . VAL D  1 195 ? 20.109  53.949  -1.287  1.00 34.91 ? 196  VAL D CA  1 
ATOM   8889  C  C   . VAL D  1 195 ? 21.017  52.724  -1.427  1.00 36.11 ? 196  VAL D C   1 
ATOM   8890  O  O   . VAL D  1 195 ? 22.238  52.804  -1.247  1.00 35.21 ? 196  VAL D O   1 
ATOM   8891  C  CB  . VAL D  1 195 ? 19.879  54.604  -2.683  1.00 34.54 ? 196  VAL D CB  1 
ATOM   8892  C  CG1 . VAL D  1 195 ? 18.895  55.745  -2.586  1.00 32.56 ? 196  VAL D CG1 1 
ATOM   8893  C  CG2 . VAL D  1 195 ? 21.195  55.039  -3.320  1.00 29.96 ? 196  VAL D CG2 1 
ATOM   8894  N  N   . GLU D  1 196 ? 20.416  51.579  -1.708  1.00 36.73 ? 197  GLU D N   1 
ATOM   8895  C  CA  . GLU D  1 196 ? 21.183  50.342  -1.816  1.00 36.54 ? 197  GLU D CA  1 
ATOM   8896  C  C   . GLU D  1 196 ? 22.067  50.364  -3.045  1.00 33.68 ? 197  GLU D C   1 
ATOM   8897  O  O   . GLU D  1 196 ? 23.166  49.826  -3.023  1.00 33.32 ? 197  GLU D O   1 
ATOM   8898  C  CB  . GLU D  1 196 ? 20.248  49.134  -1.885  1.00 37.97 ? 197  GLU D CB  1 
ATOM   8899  C  CG  . GLU D  1 196 ? 20.964  47.778  -1.791  1.00 44.56 ? 197  GLU D CG  1 
ATOM   8900  C  CD  . GLU D  1 196 ? 21.424  47.221  -3.138  1.00 49.81 ? 197  GLU D CD  1 
ATOM   8901  O  OE1 . GLU D  1 196 ? 20.789  47.511  -4.174  1.00 44.37 ? 197  GLU D OE1 1 
ATOM   8902  O  OE2 . GLU D  1 196 ? 22.429  46.488  -3.142  1.00 49.62 ? 197  GLU D OE2 1 
ATOM   8903  N  N   . SER D  1 197 ? 21.567  50.962  -4.120  1.00 32.69 ? 198  SER D N   1 
ATOM   8904  C  CA  . SER D  1 197 ? 22.314  51.056  -5.367  1.00 32.46 ? 198  SER D CA  1 
ATOM   8905  C  C   . SER D  1 197 ? 21.934  52.321  -6.079  1.00 31.19 ? 198  SER D C   1 
ATOM   8906  O  O   . SER D  1 197 ? 20.753  52.553  -6.359  1.00 30.38 ? 198  SER D O   1 
ATOM   8907  C  CB  . SER D  1 197 ? 22.008  49.883  -6.290  1.00 33.07 ? 198  SER D CB  1 
ATOM   8908  O  OG  . SER D  1 197 ? 22.721  49.986  -7.513  1.00 34.30 ? 198  SER D OG  1 
ATOM   8909  N  N   . LEU D  1 198 ? 22.943  53.127  -6.389  1.00 28.45 ? 199  LEU D N   1 
ATOM   8910  C  CA  . LEU D  1 198 ? 22.722  54.364  -7.117  1.00 28.03 ? 199  LEU D CA  1 
ATOM   8911  C  C   . LEU D  1 198 ? 22.248  54.038  -8.528  1.00 26.06 ? 199  LEU D C   1 
ATOM   8912  O  O   . LEU D  1 198 ? 21.313  54.641  -9.017  1.00 25.74 ? 199  LEU D O   1 
ATOM   8913  C  CB  . LEU D  1 198 ? 24.008  55.209  -7.142  1.00 27.33 ? 199  LEU D CB  1 
ATOM   8914  C  CG  . LEU D  1 198 ? 23.957  56.520  -7.915  1.00 25.72 ? 199  LEU D CG  1 
ATOM   8915  C  CD1 . LEU D  1 198 ? 22.734  57.346  -7.501  1.00 20.99 ? 199  LEU D CD1 1 
ATOM   8916  C  CD2 . LEU D  1 198 ? 25.273  57.312  -7.730  1.00 16.93 ? 199  LEU D CD2 1 
ATOM   8917  N  N   . GLU D  1 199 ? 22.927  53.102  -9.179  1.00 27.99 ? 200  GLU D N   1 
ATOM   8918  C  CA  . GLU D  1 199 ? 22.503  52.577  -10.466 1.00 28.98 ? 200  GLU D CA  1 
ATOM   8919  C  C   . GLU D  1 199 ? 21.010  52.249  -10.495 1.00 29.56 ? 200  GLU D C   1 
ATOM   8920  O  O   . GLU D  1 199 ? 20.276  52.756  -11.355 1.00 27.13 ? 200  GLU D O   1 
ATOM   8921  C  CB  . GLU D  1 199 ? 23.289  51.309  -10.814 1.00 31.16 ? 200  GLU D CB  1 
ATOM   8922  C  CG  . GLU D  1 199 ? 22.924  50.723  -12.178 1.00 38.51 ? 200  GLU D CG  1 
ATOM   8923  C  CD  . GLU D  1 199 ? 24.038  49.876  -12.795 1.00 43.87 ? 200  GLU D CD  1 
ATOM   8924  O  OE1 . GLU D  1 199 ? 24.849  49.301  -12.058 1.00 47.58 ? 200  GLU D OE1 1 
ATOM   8925  O  OE2 . GLU D  1 199 ? 24.088  49.783  -14.030 1.00 47.36 ? 200  GLU D OE2 1 
ATOM   8926  N  N   . GLU D  1 200 ? 20.565  51.420  -9.552  1.00 29.69 ? 201  GLU D N   1 
ATOM   8927  C  CA  A GLU D  1 200 ? 19.176  50.929  -9.515  0.50 31.86 ? 201  GLU D CA  1 
ATOM   8928  C  CA  B GLU D  1 200 ? 19.185  50.948  -9.594  0.50 31.46 ? 201  GLU D CA  1 
ATOM   8929  C  C   . GLU D  1 200 ? 18.183  52.047  -9.222  1.00 31.21 ? 201  GLU D C   1 
ATOM   8930  O  O   . GLU D  1 200 ? 17.062  52.044  -9.738  1.00 31.68 ? 201  GLU D O   1 
ATOM   8931  C  CB  A GLU D  1 200 ? 18.985  49.830  -8.443  0.50 32.65 ? 201  GLU D CB  1 
ATOM   8932  C  CB  B GLU D  1 200 ? 18.991  49.704  -8.717  0.50 32.05 ? 201  GLU D CB  1 
ATOM   8933  C  CG  A GLU D  1 200 ? 19.596  48.460  -8.767  0.50 39.78 ? 201  GLU D CG  1 
ATOM   8934  C  CG  B GLU D  1 200 ? 19.909  48.527  -9.093  0.50 37.28 ? 201  GLU D CG  1 
ATOM   8935  C  CD  A GLU D  1 200 ? 19.565  47.488  -7.575  0.50 43.30 ? 201  GLU D CD  1 
ATOM   8936  C  CD  B GLU D  1 200 ? 19.811  48.110  -10.560 0.50 39.03 ? 201  GLU D CD  1 
ATOM   8937  O  OE1 A GLU D  1 200 ? 18.943  47.819  -6.542  0.50 45.11 ? 201  GLU D OE1 1 
ATOM   8938  O  OE1 B GLU D  1 200 ? 18.715  48.221  -11.149 0.50 40.79 ? 201  GLU D OE1 1 
ATOM   8939  O  OE2 A GLU D  1 200 ? 20.175  46.397  -7.669  0.50 45.14 ? 201  GLU D OE2 1 
ATOM   8940  O  OE2 B GLU D  1 200 ? 20.840  47.667  -11.119 0.50 41.63 ? 201  GLU D OE2 1 
ATOM   8941  N  N   . THR D  1 201 ? 18.585  52.977  -8.350  1.00 29.17 ? 202  THR D N   1 
ATOM   8942  C  CA  . THR D  1 201 ? 17.721  54.103  -7.961  1.00 28.67 ? 202  THR D CA  1 
ATOM   8943  C  C   . THR D  1 201 ? 17.474  55.000  -9.161  1.00 27.38 ? 202  THR D C   1 
ATOM   8944  O  O   . THR D  1 201 ? 16.324  55.387  -9.457  1.00 26.17 ? 202  THR D O   1 
ATOM   8945  C  CB  . THR D  1 201 ? 18.345  54.948  -6.781  1.00 30.11 ? 202  THR D CB  1 
ATOM   8946  O  OG1 . THR D  1 201 ? 18.576  54.096  -5.666  1.00 27.35 ? 202  THR D OG1 1 
ATOM   8947  C  CG2 . THR D  1 201 ? 17.425  56.113  -6.336  1.00 23.41 ? 202  THR D CG2 1 
ATOM   8948  N  N   . LEU D  1 202 ? 18.555  55.296  -9.878  1.00 26.91 ? 203  LEU D N   1 
ATOM   8949  C  CA  . LEU D  1 202 ? 18.476  56.173  -11.037 1.00 26.03 ? 203  LEU D CA  1 
ATOM   8950  C  C   . LEU D  1 202 ? 17.651  55.550  -12.146 1.00 26.69 ? 203  LEU D C   1 
ATOM   8951  O  O   . LEU D  1 202 ? 16.941  56.259  -12.853 1.00 25.35 ? 203  LEU D O   1 
ATOM   8952  C  CB  . LEU D  1 202 ? 19.872  56.518  -11.559 1.00 26.32 ? 203  LEU D CB  1 
ATOM   8953  C  CG  . LEU D  1 202 ? 20.674  57.504  -10.705 1.00 24.71 ? 203  LEU D CG  1 
ATOM   8954  C  CD1 . LEU D  1 202 ? 22.092  57.633  -11.237 1.00 21.06 ? 203  LEU D CD1 1 
ATOM   8955  C  CD2 . LEU D  1 202 ? 19.984  58.861  -10.684 1.00 22.68 ? 203  LEU D CD2 1 
ATOM   8956  N  N   . LYS D  1 203 ? 17.758  54.227  -12.287 1.00 30.12 ? 204  LYS D N   1 
ATOM   8957  C  CA  . LYS D  1 203 ? 17.051  53.449  -13.319 1.00 31.90 ? 204  LYS D CA  1 
ATOM   8958  C  C   . LYS D  1 203 ? 15.557  53.392  -13.057 1.00 32.58 ? 204  LYS D C   1 
ATOM   8959  O  O   . LYS D  1 203 ? 14.760  53.568  -13.962 1.00 34.48 ? 204  LYS D O   1 
ATOM   8960  C  CB  . LYS D  1 203 ? 17.624  52.031  -13.374 1.00 33.48 ? 204  LYS D CB  1 
ATOM   8961  C  CG  . LYS D  1 203 ? 17.009  51.098  -14.416 1.00 43.73 ? 204  LYS D CG  1 
ATOM   8962  C  CD  . LYS D  1 203 ? 17.212  51.588  -15.851 1.00 51.01 ? 204  LYS D CD  1 
ATOM   8963  C  CE  . LYS D  1 203 ? 16.857  50.487  -16.842 1.00 54.37 ? 204  LYS D CE  1 
ATOM   8964  N  NZ  . LYS D  1 203 ? 16.856  50.972  -18.226 1.00 55.78 ? 204  LYS D NZ  1 
ATOM   8965  N  N   . LYS D  1 204 ? 15.167  53.150  -11.813 1.00 35.38 ? 205  LYS D N   1 
ATOM   8966  C  CA  . LYS D  1 204 ? 13.747  53.204  -11.443 1.00 35.31 ? 205  LYS D CA  1 
ATOM   8967  C  C   . LYS D  1 204 ? 13.201  54.624  -11.547 1.00 33.83 ? 205  LYS D C   1 
ATOM   8968  O  O   . LYS D  1 204 ? 12.058  54.820  -11.996 1.00 34.21 ? 205  LYS D O   1 
ATOM   8969  C  CB  . LYS D  1 204 ? 13.535  52.666  -10.032 1.00 36.57 ? 205  LYS D CB  1 
ATOM   8970  C  CG  . LYS D  1 204 ? 12.068  52.407  -9.693  1.00 42.59 ? 205  LYS D CG  1 
ATOM   8971  N  N   . ALA D  1 205 ? 14.001  55.624  -11.156 1.00 30.81 ? 206  ALA D N   1 
ATOM   8972  C  CA  . ALA D  1 205 ? 13.521  57.019  -11.220 1.00 29.55 ? 206  ALA D CA  1 
ATOM   8973  C  C   . ALA D  1 205 ? 13.211  57.424  -12.663 1.00 27.92 ? 206  ALA D C   1 
ATOM   8974  O  O   . ALA D  1 205 ? 12.320  58.237  -12.913 1.00 27.26 ? 206  ALA D O   1 
ATOM   8975  C  CB  . ALA D  1 205 ? 14.514  57.986  -10.576 1.00 27.59 ? 206  ALA D CB  1 
ATOM   8976  N  N   . SER D  1 206 ? 13.941  56.853  -13.617 1.00 28.49 ? 207  SER D N   1 
ATOM   8977  C  CA  . SER D  1 206 ? 13.722  57.169  -15.033 1.00 28.35 ? 207  SER D CA  1 
ATOM   8978  C  C   . SER D  1 206 ? 14.164  56.022  -15.945 1.00 31.23 ? 207  SER D C   1 
ATOM   8979  O  O   . SER D  1 206 ? 15.298  56.011  -16.428 1.00 31.97 ? 207  SER D O   1 
ATOM   8980  C  CB  . SER D  1 206 ? 14.475  58.431  -15.395 1.00 28.51 ? 207  SER D CB  1 
ATOM   8981  O  OG  . SER D  1 206 ? 14.203  58.797  -16.732 1.00 28.16 ? 207  SER D OG  1 
ATOM   8982  N  N   . PRO D  1 207 ? 13.275  55.027  -16.161 1.00 33.46 ? 208  PRO D N   1 
ATOM   8983  C  CA  . PRO D  1 207 ? 13.603  53.846  -16.986 1.00 32.44 ? 208  PRO D CA  1 
ATOM   8984  C  C   . PRO D  1 207 ? 14.134  54.153  -18.381 1.00 31.06 ? 208  PRO D C   1 
ATOM   8985  O  O   . PRO D  1 207 ? 14.945  53.412  -18.894 1.00 30.65 ? 208  PRO D O   1 
ATOM   8986  C  CB  . PRO D  1 207 ? 12.268  53.099  -17.058 1.00 32.84 ? 208  PRO D CB  1 
ATOM   8987  C  CG  . PRO D  1 207 ? 11.661  53.345  -15.718 1.00 34.65 ? 208  PRO D CG  1 
ATOM   8988  C  CD  . PRO D  1 207 ? 12.071  54.788  -15.338 1.00 33.46 ? 208  PRO D CD  1 
ATOM   8989  N  N   . ASP D  1 208 ? 13.686  55.240  -18.986 1.00 33.25 ? 209  ASP D N   1 
ATOM   8990  C  CA  . ASP D  1 208 ? 14.179  55.644  -20.314 1.00 35.02 ? 209  ASP D CA  1 
ATOM   8991  C  C   . ASP D  1 208 ? 15.546  56.364  -20.294 1.00 33.23 ? 209  ASP D C   1 
ATOM   8992  O  O   . ASP D  1 208 ? 16.114  56.631  -21.360 1.00 32.04 ? 209  ASP D O   1 
ATOM   8993  C  CB  . ASP D  1 208 ? 13.158  56.577  -20.995 1.00 37.07 ? 209  ASP D CB  1 
ATOM   8994  C  CG  . ASP D  1 208 ? 11.885  55.856  -21.409 1.00 48.84 ? 209  ASP D CG  1 
ATOM   8995  O  OD1 . ASP D  1 208 ? 11.978  54.700  -21.889 1.00 53.88 ? 209  ASP D OD1 1 
ATOM   8996  O  OD2 . ASP D  1 208 ? 10.786  56.445  -21.241 1.00 58.79 ? 209  ASP D OD2 1 
ATOM   8997  N  N   . GLY D  1 209 ? 16.041  56.721  -19.106 1.00 29.81 ? 210  GLY D N   1 
ATOM   8998  C  CA  . GLY D  1 209 ? 17.306  57.458  -18.987 1.00 27.93 ? 210  GLY D CA  1 
ATOM   8999  C  C   . GLY D  1 209 ? 17.134  58.960  -18.810 1.00 25.78 ? 210  GLY D C   1 
ATOM   9000  O  O   . GLY D  1 209 ? 16.043  59.461  -18.534 1.00 22.47 ? 210  GLY D O   1 
ATOM   9001  N  N   . TYR D  1 210 ? 18.225  59.682  -19.006 1.00 24.97 ? 211  TYR D N   1 
ATOM   9002  C  CA  . TYR D  1 210 ? 18.270  61.101  -18.673 1.00 23.98 ? 211  TYR D CA  1 
ATOM   9003  C  C   . TYR D  1 210 ? 18.680  61.916  -19.886 1.00 21.51 ? 211  TYR D C   1 
ATOM   9004  O  O   . TYR D  1 210 ? 19.605  61.548  -20.589 1.00 23.14 ? 211  TYR D O   1 
ATOM   9005  C  CB  . TYR D  1 210 ? 19.183  61.320  -17.448 1.00 23.20 ? 211  TYR D CB  1 
ATOM   9006  C  CG  . TYR D  1 210 ? 18.610  60.669  -16.214 1.00 22.93 ? 211  TYR D CG  1 
ATOM   9007  C  CD1 . TYR D  1 210 ? 18.870  59.343  -15.920 1.00 24.87 ? 211  TYR D CD1 1 
ATOM   9008  C  CD2 . TYR D  1 210 ? 17.766  61.356  -15.379 1.00 24.20 ? 211  TYR D CD2 1 
ATOM   9009  C  CE1 . TYR D  1 210 ? 18.318  58.737  -14.821 1.00 24.62 ? 211  TYR D CE1 1 
ATOM   9010  C  CE2 . TYR D  1 210 ? 17.214  60.759  -14.280 1.00 22.25 ? 211  TYR D CE2 1 
ATOM   9011  C  CZ  . TYR D  1 210 ? 17.483  59.457  -14.001 1.00 23.69 ? 211  TYR D CZ  1 
ATOM   9012  O  OH  . TYR D  1 210 ? 16.906  58.861  -12.903 1.00 26.47 ? 211  TYR D OH  1 
ATOM   9013  N  N   . ASP D  1 211 ? 17.935  62.986  -20.163 1.00 22.54 ? 212  ASP D N   1 
ATOM   9014  C  CA  . ASP D  1 211 ? 18.245  63.885  -21.268 1.00 22.78 ? 212  ASP D CA  1 
ATOM   9015  C  C   . ASP D  1 211 ? 19.361  64.838  -20.866 1.00 21.95 ? 212  ASP D C   1 
ATOM   9016  O  O   . ASP D  1 211 ? 20.260  65.098  -21.657 1.00 19.70 ? 212  ASP D O   1 
ATOM   9017  C  CB  . ASP D  1 211 ? 17.022  64.718  -21.683 1.00 24.24 ? 212  ASP D CB  1 
ATOM   9018  C  CG  . ASP D  1 211 ? 15.881  63.866  -22.228 1.00 23.20 ? 212  ASP D CG  1 
ATOM   9019  O  OD1 . ASP D  1 211 ? 15.954  63.475  -23.394 1.00 25.33 ? 212  ASP D OD1 1 
ATOM   9020  O  OD2 . ASP D  1 211 ? 14.932  63.578  -21.485 1.00 30.86 ? 212  ASP D OD2 1 
ATOM   9021  N  N   . CYS D  1 212 ? 19.273  65.357  -19.643 1.00 22.09 ? 213  CYS D N   1 
ATOM   9022  C  CA  . CYS D  1 212 ? 20.245  66.327  -19.131 1.00 22.39 ? 213  CYS D CA  1 
ATOM   9023  C  C   . CYS D  1 212 ? 20.734  66.000  -17.729 1.00 20.03 ? 213  CYS D C   1 
ATOM   9024  O  O   . CYS D  1 212 ? 19.974  65.538  -16.872 1.00 19.58 ? 213  CYS D O   1 
ATOM   9025  C  CB  . CYS D  1 212 ? 19.645  67.737  -19.111 1.00 22.50 ? 213  CYS D CB  1 
ATOM   9026  S  SG  . CYS D  1 212 ? 18.939  68.237  -20.661 1.00 29.85 ? 213  CYS D SG  1 
ATOM   9027  N  N   . TYR D  1 213 ? 22.009  66.280  -17.494 1.00 18.95 ? 214  TYR D N   1 
ATOM   9028  C  CA  . TYR D  1 213 ? 22.615  66.096  -16.186 1.00 18.13 ? 214  TYR D CA  1 
ATOM   9029  C  C   . TYR D  1 213 ? 23.221  67.423  -15.797 1.00 17.20 ? 214  TYR D C   1 
ATOM   9030  O  O   . TYR D  1 213 ? 24.128  67.926  -16.468 1.00 17.13 ? 214  TYR D O   1 
ATOM   9031  C  CB  . TYR D  1 213 ? 23.709  65.025  -16.266 1.00 19.57 ? 214  TYR D CB  1 
ATOM   9032  C  CG  . TYR D  1 213 ? 24.485  64.688  -14.983 1.00 16.70 ? 214  TYR D CG  1 
ATOM   9033  C  CD1 . TYR D  1 213 ? 23.952  64.901  -13.719 1.00 17.55 ? 214  TYR D CD1 1 
ATOM   9034  C  CD2 . TYR D  1 213 ? 25.729  64.076  -15.066 1.00 20.84 ? 214  TYR D CD2 1 
ATOM   9035  C  CE1 . TYR D  1 213 ? 24.660  64.543  -12.576 1.00 17.42 ? 214  TYR D CE1 1 
ATOM   9036  C  CE2 . TYR D  1 213 ? 26.447  63.713  -13.930 1.00 18.05 ? 214  TYR D CE2 1 
ATOM   9037  C  CZ  . TYR D  1 213 ? 25.908  63.954  -12.700 1.00 15.23 ? 214  TYR D CZ  1 
ATOM   9038  O  OH  . TYR D  1 213 ? 26.608  63.615  -11.592 1.00 19.21 ? 214  TYR D OH  1 
ATOM   9039  N  N   . PHE D  1 214 ? 22.720  68.001  -14.723 1.00 17.25 ? 215  PHE D N   1 
ATOM   9040  C  CA  . PHE D  1 214 ? 23.305  69.219  -14.208 1.00 17.04 ? 215  PHE D CA  1 
ATOM   9041  C  C   . PHE D  1 214 ? 24.190  68.761  -13.070 1.00 16.65 ? 215  PHE D C   1 
ATOM   9042  O  O   . PHE D  1 214 ? 23.686  68.417  -11.999 1.00 15.55 ? 215  PHE D O   1 
ATOM   9043  C  CB  . PHE D  1 214 ? 22.236  70.216  -13.739 1.00 16.02 ? 215  PHE D CB  1 
ATOM   9044  C  CG  . PHE D  1 214 ? 22.793  71.563  -13.393 1.00 16.50 ? 215  PHE D CG  1 
ATOM   9045  C  CD1 . PHE D  1 214 ? 23.679  71.717  -12.325 1.00 19.28 ? 215  PHE D CD1 1 
ATOM   9046  C  CD2 . PHE D  1 214 ? 22.460  72.671  -14.137 1.00 16.40 ? 215  PHE D CD2 1 
ATOM   9047  C  CE1 . PHE D  1 214 ? 24.221  72.964  -12.008 1.00 17.83 ? 215  PHE D CE1 1 
ATOM   9048  C  CE2 . PHE D  1 214 ? 22.988  73.919  -13.821 1.00 20.78 ? 215  PHE D CE2 1 
ATOM   9049  C  CZ  . PHE D  1 214 ? 23.879  74.059  -12.751 1.00 18.78 ? 215  PHE D CZ  1 
ATOM   9050  N  N   . ASP D  1 215 ? 25.504  68.756  -13.311 1.00 17.41 ? 216  ASP D N   1 
ATOM   9051  C  CA  . ASP D  1 215 ? 26.451  68.079  -12.415 1.00 16.64 ? 216  ASP D CA  1 
ATOM   9052  C  C   . ASP D  1 215 ? 27.189  69.061  -11.521 1.00 16.63 ? 216  ASP D C   1 
ATOM   9053  O  O   . ASP D  1 215 ? 28.012  69.875  -12.010 1.00 16.47 ? 216  ASP D O   1 
ATOM   9054  C  CB  . ASP D  1 215 ? 27.476  67.299  -13.231 1.00 16.12 ? 216  ASP D CB  1 
ATOM   9055  C  CG  . ASP D  1 215 ? 28.364  66.405  -12.391 1.00 16.21 ? 216  ASP D CG  1 
ATOM   9056  O  OD1 . ASP D  1 215 ? 28.093  66.191  -11.194 1.00 15.70 ? 216  ASP D OD1 1 
ATOM   9057  O  OD2 . ASP D  1 215 ? 29.331  65.861  -12.969 1.00 20.21 ? 216  ASP D OD2 1 
ATOM   9058  N  N   . ASN D  1 216 ? 26.909  68.939  -10.225 1.00 13.75 ? 217  ASN D N   1 
ATOM   9059  C  CA  . ASN D  1 216 ? 27.501  69.732  -9.171  1.00 15.14 ? 217  ASN D CA  1 
ATOM   9060  C  C   . ASN D  1 216 ? 28.575  68.959  -8.391  1.00 17.56 ? 217  ASN D C   1 
ATOM   9061  O  O   . ASN D  1 216 ? 29.304  69.559  -7.611  1.00 17.26 ? 217  ASN D O   1 
ATOM   9062  C  CB  . ASN D  1 216 ? 26.426  70.178  -8.172  1.00 15.07 ? 217  ASN D CB  1 
ATOM   9063  C  CG  . ASN D  1 216 ? 25.496  71.272  -8.718  1.00 16.33 ? 217  ASN D CG  1 
ATOM   9064  O  OD1 . ASN D  1 216 ? 25.934  72.243  -9.338  1.00 15.58 ? 217  ASN D OD1 1 
ATOM   9065  N  ND2 . ASN D  1 216 ? 24.200  71.105  -8.484  1.00 15.11 ? 217  ASN D ND2 1 
ATOM   9066  N  N   . VAL D  1 217 ? 28.682  67.649  -8.624  1.00 17.60 ? 218  VAL D N   1 
ATOM   9067  C  CA  . VAL D  1 217 ? 29.310  66.730  -7.671  1.00 17.97 ? 218  VAL D CA  1 
ATOM   9068  C  C   . VAL D  1 217 ? 30.525  65.986  -8.233  1.00 17.77 ? 218  VAL D C   1 
ATOM   9069  O  O   . VAL D  1 217 ? 31.490  65.829  -7.540  1.00 15.65 ? 218  VAL D O   1 
ATOM   9070  C  CB  . VAL D  1 217 ? 28.263  65.684  -7.163  1.00 18.53 ? 218  VAL D CB  1 
ATOM   9071  C  CG1 . VAL D  1 217 ? 28.927  64.545  -6.421  1.00 13.81 ? 218  VAL D CG1 1 
ATOM   9072  C  CG2 . VAL D  1 217 ? 27.185  66.362  -6.293  1.00 16.69 ? 218  VAL D CG2 1 
ATOM   9073  N  N   . GLY D  1 218 ? 30.452  65.515  -9.478  1.00 18.68 ? 219  GLY D N   1 
ATOM   9074  C  CA  . GLY D  1 218 ? 31.542  64.773  -10.117 1.00 17.39 ? 219  GLY D CA  1 
ATOM   9075  C  C   . GLY D  1 218 ? 31.834  63.411  -9.523  1.00 18.77 ? 219  GLY D C   1 
ATOM   9076  O  O   . GLY D  1 218 ? 31.017  62.833  -8.800  1.00 19.54 ? 219  GLY D O   1 
ATOM   9077  N  N   . GLY D  1 219 ? 33.021  62.898  -9.823  1.00 18.63 ? 220  GLY D N   1 
ATOM   9078  C  CA  . GLY D  1 219 ? 33.497  61.646  -9.239  1.00 19.69 ? 220  GLY D CA  1 
ATOM   9079  C  C   . GLY D  1 219 ? 32.667  60.411  -9.570  1.00 20.26 ? 220  GLY D C   1 
ATOM   9080  O  O   . GLY D  1 219 ? 32.085  60.306  -10.658 1.00 20.31 ? 220  GLY D O   1 
ATOM   9081  N  N   . GLU D  1 220 ? 32.615  59.473  -8.632  1.00 20.41 ? 221  GLU D N   1 
ATOM   9082  C  CA  . GLU D  1 220 ? 31.941  58.187  -8.887  1.00 23.05 ? 221  GLU D CA  1 
ATOM   9083  C  C   . GLU D  1 220 ? 30.457  58.373  -9.149  1.00 19.41 ? 221  GLU D C   1 
ATOM   9084  O  O   . GLU D  1 220 ? 29.867  57.641  -9.951  1.00 18.50 ? 221  GLU D O   1 
ATOM   9085  C  CB  . GLU D  1 220 ? 32.162  57.194  -7.747  1.00 21.75 ? 221  GLU D CB  1 
ATOM   9086  C  CG  . GLU D  1 220 ? 33.603  56.721  -7.608  1.00 31.81 ? 221  GLU D CG  1 
ATOM   9087  C  CD  . GLU D  1 220 ? 34.096  55.861  -8.782  1.00 38.40 ? 221  GLU D CD  1 
ATOM   9088  O  OE1 . GLU D  1 220 ? 33.311  55.533  -9.716  1.00 36.74 ? 221  GLU D OE1 1 
ATOM   9089  O  OE2 . GLU D  1 220 ? 35.295  55.507  -8.753  1.00 40.50 ? 221  GLU D OE2 1 
ATOM   9090  N  N   . PHE D  1 221 ? 29.868  59.396  -8.541  1.00 19.35 ? 222  PHE D N   1 
ATOM   9091  C  CA  . PHE D  1 221 ? 28.426  59.639  -8.705  1.00 19.10 ? 222  PHE D CA  1 
ATOM   9092  C  C   . PHE D  1 221 ? 28.148  59.923  -10.181 1.00 18.72 ? 222  PHE D C   1 
ATOM   9093  O  O   . PHE D  1 221 ? 27.244  59.361  -10.786 1.00 17.56 ? 222  PHE D O   1 
ATOM   9094  C  CB  . PHE D  1 221 ? 27.983  60.804  -7.821  1.00 20.08 ? 222  PHE D CB  1 
ATOM   9095  C  CG  . PHE D  1 221 ? 26.498  61.027  -7.789  1.00 20.16 ? 222  PHE D CG  1 
ATOM   9096  C  CD1 . PHE D  1 221 ? 25.860  61.637  -8.851  1.00 20.59 ? 222  PHE D CD1 1 
ATOM   9097  C  CD2 . PHE D  1 221 ? 25.736  60.617  -6.707  1.00 22.30 ? 222  PHE D CD2 1 
ATOM   9098  C  CE1 . PHE D  1 221 ? 24.479  61.853  -8.823  1.00 20.14 ? 222  PHE D CE1 1 
ATOM   9099  C  CE2 . PHE D  1 221 ? 24.364  60.824  -6.693  1.00 22.75 ? 222  PHE D CE2 1 
ATOM   9100  C  CZ  . PHE D  1 221 ? 23.746  61.443  -7.755  1.00 19.37 ? 222  PHE D CZ  1 
ATOM   9101  N  N   . SER D  1 222 ? 28.941  60.812  -10.756 1.00 19.55 ? 223  SER D N   1 
ATOM   9102  C  CA  . SER D  1 222 ? 28.802  61.145  -12.152 1.00 19.12 ? 223  SER D CA  1 
ATOM   9103  C  C   . SER D  1 222 ? 29.068  59.964  -13.115 1.00 20.15 ? 223  SER D C   1 
ATOM   9104  O  O   . SER D  1 222 ? 28.401  59.850  -14.160 1.00 17.10 ? 223  SER D O   1 
ATOM   9105  C  CB  . SER D  1 222 ? 29.704  62.324  -12.459 1.00 18.92 ? 223  SER D CB  1 
ATOM   9106  O  OG  . SER D  1 222 ? 29.206  63.437  -11.747 1.00 17.70 ? 223  SER D OG  1 
ATOM   9107  N  N   . ASN D  1 223 ? 30.011  59.088  -12.753 1.00 19.22 ? 224  ASN D N   1 
ATOM   9108  C  CA  . ASN D  1 223 ? 30.323  57.913  -13.584 1.00 21.78 ? 224  ASN D CA  1 
ATOM   9109  C  C   . ASN D  1 223 ? 29.090  57.047  -13.698 1.00 20.78 ? 224  ASN D C   1 
ATOM   9110  O  O   . ASN D  1 223 ? 28.782  56.538  -14.761 1.00 24.09 ? 224  ASN D O   1 
ATOM   9111  C  CB  . ASN D  1 223 ? 31.495  57.098  -13.003 1.00 20.45 ? 224  ASN D CB  1 
ATOM   9112  C  CG  . ASN D  1 223 ? 32.791  57.836  -13.098 1.00 19.85 ? 224  ASN D CG  1 
ATOM   9113  O  OD1 . ASN D  1 223 ? 32.912  58.761  -13.880 1.00 20.50 ? 224  ASN D OD1 1 
ATOM   9114  N  ND2 . ASN D  1 223 ? 33.768  57.452  -12.303 1.00 19.84 ? 224  ASN D ND2 1 
ATOM   9115  N  N   . THR D  1 224 ? 28.374  56.922  -12.601 1.00 20.42 ? 225  THR D N   1 
ATOM   9116  C  CA  . THR D  1 224 ? 27.135  56.181  -12.573 1.00 20.87 ? 225  THR D CA  1 
ATOM   9117  C  C   . THR D  1 224 ? 26.003  56.879  -13.331 1.00 22.77 ? 225  THR D C   1 
ATOM   9118  O  O   . THR D  1 224 ? 25.242  56.197  -14.022 1.00 22.89 ? 225  THR D O   1 
ATOM   9119  C  CB  . THR D  1 224 ? 26.701  55.884  -11.135 1.00 21.08 ? 225  THR D CB  1 
ATOM   9120  O  OG1 . THR D  1 224 ? 27.756  55.189  -10.466 1.00 17.62 ? 225  THR D OG1 1 
ATOM   9121  C  CG2 . THR D  1 224 ? 25.415  54.993  -11.117 1.00 18.21 ? 225  THR D CG2 1 
ATOM   9122  N  N   . VAL D  1 225 ? 25.878  58.211  -13.207 1.00 21.88 ? 226  VAL D N   1 
ATOM   9123  C  CA  . VAL D  1 225 ? 24.852  58.961  -13.950 1.00 18.65 ? 226  VAL D CA  1 
ATOM   9124  C  C   . VAL D  1 225 ? 25.104  58.856  -15.454 1.00 20.91 ? 226  VAL D C   1 
ATOM   9125  O  O   . VAL D  1 225 ? 24.160  58.728  -16.242 1.00 21.45 ? 226  VAL D O   1 
ATOM   9126  C  CB  . VAL D  1 225 ? 24.753  60.466  -13.542 1.00 21.13 ? 226  VAL D CB  1 
ATOM   9127  C  CG1 . VAL D  1 225 ? 23.727  61.199  -14.408 1.00 17.50 ? 226  VAL D CG1 1 
ATOM   9128  C  CG2 . VAL D  1 225 ? 24.356  60.635  -12.063 1.00 16.76 ? 226  VAL D CG2 1 
ATOM   9129  N  N   . ILE D  1 226 ? 26.375  58.867  -15.852 1.00 20.01 ? 227  ILE D N   1 
ATOM   9130  C  CA  . ILE D  1 226 ? 26.739  58.780  -17.262 1.00 20.07 ? 227  ILE D CA  1 
ATOM   9131  C  C   . ILE D  1 226 ? 26.191  57.511  -17.895 1.00 21.52 ? 227  ILE D C   1 
ATOM   9132  O  O   . ILE D  1 226 ? 25.738  57.535  -19.035 1.00 20.02 ? 227  ILE D O   1 
ATOM   9133  C  CB  . ILE D  1 226 ? 28.280  58.945  -17.463 1.00 20.82 ? 227  ILE D CB  1 
ATOM   9134  C  CG1 . ILE D  1 226 ? 28.645  60.417  -17.229 1.00 21.42 ? 227  ILE D CG1 1 
ATOM   9135  C  CG2 . ILE D  1 226 ? 28.738  58.508  -18.873 1.00 16.34 ? 227  ILE D CG2 1 
ATOM   9136  C  CD1 . ILE D  1 226 ? 30.104  60.756  -17.371 1.00 26.65 ? 227  ILE D CD1 1 
ATOM   9137  N  N   . GLY D  1 227 ? 26.193  56.417  -17.132 1.00 22.04 ? 228  GLY D N   1 
ATOM   9138  C  CA  . GLY D  1 227 ? 25.683  55.145  -17.600 1.00 22.90 ? 228  GLY D CA  1 
ATOM   9139  C  C   . GLY D  1 227 ? 24.181  55.133  -17.874 1.00 24.83 ? 228  GLY D C   1 
ATOM   9140  O  O   . GLY D  1 227 ? 23.656  54.165  -18.419 1.00 25.29 ? 228  GLY D O   1 
ATOM   9141  N  N   . GLN D  1 228 ? 23.474  56.193  -17.497 1.00 23.83 ? 229  GLN D N   1 
ATOM   9142  C  CA  . GLN D  1 228 ? 22.050  56.269  -17.753 1.00 23.92 ? 229  GLN D CA  1 
ATOM   9143  C  C   . GLN D  1 228 ? 21.650  57.459  -18.594 1.00 24.17 ? 229  GLN D C   1 
ATOM   9144  O  O   . GLN D  1 228 ? 20.451  57.790  -18.664 1.00 23.80 ? 229  GLN D O   1 
ATOM   9145  C  CB  . GLN D  1 228 ? 21.311  56.270  -16.436 1.00 24.39 ? 229  GLN D CB  1 
ATOM   9146  C  CG  . GLN D  1 228 ? 21.907  55.208  -15.536 1.00 32.86 ? 229  GLN D CG  1 
ATOM   9147  C  CD  . GLN D  1 228 ? 20.921  54.506  -14.666 1.00 38.07 ? 229  GLN D CD  1 
ATOM   9148  O  OE1 . GLN D  1 228 ? 19.708  54.735  -14.750 1.00 42.41 ? 229  GLN D OE1 1 
ATOM   9149  N  NE2 . GLN D  1 228 ? 21.435  53.651  -13.788 1.00 41.72 ? 229  GLN D NE2 1 
ATOM   9150  N  N   . MET D  1 229 ? 22.632  58.095  -19.238 1.00 21.84 ? 230  MET D N   1 
ATOM   9151  C  CA  . MET D  1 229 ? 22.328  59.187  -20.141 1.00 23.58 ? 230  MET D CA  1 
ATOM   9152  C  C   . MET D  1 229 ? 21.778  58.633  -21.460 1.00 24.40 ? 230  MET D C   1 
ATOM   9153  O  O   . MET D  1 229 ? 22.276  57.636  -22.003 1.00 24.62 ? 230  MET D O   1 
ATOM   9154  C  CB  . MET D  1 229 ? 23.564  60.053  -20.413 1.00 24.29 ? 230  MET D CB  1 
ATOM   9155  C  CG  . MET D  1 229 ? 24.095  60.837  -19.181 1.00 22.10 ? 230  MET D CG  1 
ATOM   9156  S  SD  . MET D  1 229 ? 22.946  61.990  -18.436 1.00 24.66 ? 230  MET D SD  1 
ATOM   9157  C  CE  . MET D  1 229 ? 22.723  63.151  -19.797 1.00 18.31 ? 230  MET D CE  1 
ATOM   9158  N  N   . LYS D  1 230 ? 20.745  59.291  -21.965 1.00 23.74 ? 231  LYS D N   1 
ATOM   9159  C  CA  . LYS D  1 230 ? 20.197  58.981  -23.270 1.00 23.92 ? 231  LYS D CA  1 
ATOM   9160  C  C   . LYS D  1 230 ? 21.207  59.368  -24.334 1.00 23.00 ? 231  LYS D C   1 
ATOM   9161  O  O   . LYS D  1 230 ? 22.173  60.084  -24.048 1.00 22.21 ? 231  LYS D O   1 
ATOM   9162  C  CB  . LYS D  1 230 ? 18.910  59.758  -23.509 1.00 22.91 ? 231  LYS D CB  1 
ATOM   9163  C  CG  . LYS D  1 230 ? 17.753  59.455  -22.543 1.00 29.41 ? 231  LYS D CG  1 
ATOM   9164  C  CD  . LYS D  1 230 ? 16.464  60.008  -23.146 1.00 38.10 ? 231  LYS D CD  1 
ATOM   9165  C  CE  . LYS D  1 230 ? 15.371  60.284  -22.124 1.00 43.55 ? 231  LYS D CE  1 
ATOM   9166  N  NZ  . LYS D  1 230 ? 14.269  61.078  -22.779 1.00 41.32 ? 231  LYS D NZ  1 
ATOM   9167  N  N   . LYS D  1 231 ? 20.967  58.886  -25.550 1.00 22.88 ? 232  LYS D N   1 
ATOM   9168  C  CA  . LYS D  1 231 ? 21.749  59.240  -26.729 1.00 24.55 ? 232  LYS D CA  1 
ATOM   9169  C  C   . LYS D  1 231 ? 21.723  60.753  -26.901 1.00 23.73 ? 232  LYS D C   1 
ATOM   9170  O  O   . LYS D  1 231 ? 20.661  61.377  -26.744 1.00 24.72 ? 232  LYS D O   1 
ATOM   9171  C  CB  . LYS D  1 231 ? 21.180  58.545  -27.978 1.00 26.51 ? 232  LYS D CB  1 
ATOM   9172  C  CG  . LYS D  1 231 ? 22.175  58.428  -29.169 1.00 33.34 ? 232  LYS D CG  1 
ATOM   9173  C  CD  . LYS D  1 231 ? 22.848  57.045  -29.246 1.00 39.10 ? 232  LYS D CD  1 
ATOM   9174  C  CE  . LYS D  1 231 ? 23.507  56.776  -30.595 1.00 44.20 ? 232  LYS D CE  1 
ATOM   9175  N  NZ  . LYS D  1 231 ? 22.813  55.673  -31.366 1.00 47.37 ? 232  LYS D NZ  1 
ATOM   9176  N  N   . PHE D  1 232 ? 22.889  61.341  -27.192 1.00 20.87 ? 233  PHE D N   1 
ATOM   9177  C  CA  . PHE D  1 232 ? 23.045  62.793  -27.280 1.00 20.96 ? 233  PHE D CA  1 
ATOM   9178  C  C   . PHE D  1 232 ? 22.741  63.539  -25.991 1.00 19.96 ? 233  PHE D C   1 
ATOM   9179  O  O   . PHE D  1 232 ? 22.517  64.756  -26.007 1.00 21.28 ? 233  PHE D O   1 
ATOM   9180  C  CB  . PHE D  1 232 ? 22.184  63.360  -28.414 1.00 21.23 ? 233  PHE D CB  1 
ATOM   9181  C  CG  . PHE D  1 232 ? 22.336  62.623  -29.683 1.00 22.31 ? 233  PHE D CG  1 
ATOM   9182  C  CD1 . PHE D  1 232 ? 23.607  62.445  -30.249 1.00 20.68 ? 233  PHE D CD1 1 
ATOM   9183  C  CD2 . PHE D  1 232 ? 21.226  62.102  -30.334 1.00 30.23 ? 233  PHE D CD2 1 
ATOM   9184  C  CE1 . PHE D  1 232 ? 23.769  61.759  -31.415 1.00 25.18 ? 233  PHE D CE1 1 
ATOM   9185  C  CE2 . PHE D  1 232 ? 21.385  61.401  -31.522 1.00 30.33 ? 233  PHE D CE2 1 
ATOM   9186  C  CZ  . PHE D  1 232 ? 22.656  61.226  -32.060 1.00 28.20 ? 233  PHE D CZ  1 
ATOM   9187  N  N   . GLY D  1 233 ? 22.783  62.830  -24.871 1.00 21.54 ? 234  GLY D N   1 
ATOM   9188  C  CA  . GLY D  1 233 ? 22.620  63.466  -23.573 1.00 21.00 ? 234  GLY D CA  1 
ATOM   9189  C  C   . GLY D  1 233 ? 23.583  64.636  -23.381 1.00 20.54 ? 234  GLY D C   1 
ATOM   9190  O  O   . GLY D  1 233 ? 24.701  64.637  -23.902 1.00 19.11 ? 234  GLY D O   1 
ATOM   9191  N  N   . ARG D  1 234 ? 23.136  65.632  -22.628 1.00 19.84 ? 235  ARG D N   1 
ATOM   9192  C  CA  . ARG D  1 234 ? 23.908  66.840  -22.382 1.00 21.70 ? 235  ARG D CA  1 
ATOM   9193  C  C   . ARG D  1 234 ? 24.242  66.994  -20.894 1.00 18.98 ? 235  ARG D C   1 
ATOM   9194  O  O   . ARG D  1 234 ? 23.359  67.022  -20.025 1.00 22.50 ? 235  ARG D O   1 
ATOM   9195  C  CB  . ARG D  1 234 ? 23.126  68.055  -22.890 1.00 23.01 ? 235  ARG D CB  1 
ATOM   9196  C  CG  . ARG D  1 234 ? 22.960  68.080  -24.425 1.00 26.06 ? 235  ARG D CG  1 
ATOM   9197  C  CD  . ARG D  1 234 ? 21.595  68.682  -24.799 1.00 38.29 ? 235  ARG D CD  1 
ATOM   9198  N  NE  . ARG D  1 234 ? 20.505  67.700  -24.673 1.00 46.14 ? 235  ARG D NE  1 
ATOM   9199  C  CZ  . ARG D  1 234 ? 19.222  67.965  -24.379 1.00 47.75 ? 235  ARG D CZ  1 
ATOM   9200  N  NH1 . ARG D  1 234 ? 18.787  69.211  -24.144 1.00 46.41 ? 235  ARG D NH1 1 
ATOM   9201  N  NH2 . ARG D  1 234 ? 18.355  66.956  -24.312 1.00 47.65 ? 235  ARG D NH2 1 
ATOM   9202  N  N   . ILE D  1 235 ? 25.522  67.076  -20.589 1.00 20.51 ? 236  ILE D N   1 
ATOM   9203  C  CA  . ILE D  1 235 ? 25.963  67.237  -19.209 1.00 17.76 ? 236  ILE D CA  1 
ATOM   9204  C  C   . ILE D  1 235 ? 26.457  68.668  -19.109 1.00 17.13 ? 236  ILE D C   1 
ATOM   9205  O  O   . ILE D  1 235 ? 27.200  69.126  -19.960 1.00 16.30 ? 236  ILE D O   1 
ATOM   9206  C  CB  . ILE D  1 235 ? 27.059  66.240  -18.867 1.00 18.05 ? 236  ILE D CB  1 
ATOM   9207  C  CG1 . ILE D  1 235 ? 26.613  64.825  -19.209 1.00 19.55 ? 236  ILE D CG1 1 
ATOM   9208  C  CG2 . ILE D  1 235 ? 27.489  66.345  -17.373 1.00 18.31 ? 236  ILE D CG2 1 
ATOM   9209  C  CD1 . ILE D  1 235 ? 27.671  63.750  -18.863 1.00 18.54 ? 236  ILE D CD1 1 
ATOM   9210  N  N   . ALA D  1 236 ? 25.981  69.380  -18.095 1.00 16.12 ? 237  ALA D N   1 
ATOM   9211  C  CA  . ALA D  1 236 ? 26.518  70.670  -17.733 1.00 16.07 ? 237  ALA D CA  1 
ATOM   9212  C  C   . ALA D  1 236 ? 27.470  70.439  -16.545 1.00 14.49 ? 237  ALA D C   1 
ATOM   9213  O  O   . ALA D  1 236 ? 27.038  70.063  -15.482 1.00 14.06 ? 237  ALA D O   1 
ATOM   9214  C  CB  . ALA D  1 236 ? 25.374  71.644  -17.352 1.00 14.77 ? 237  ALA D CB  1 
ATOM   9215  N  N   . ILE D  1 237 ? 28.759  70.662  -16.749 1.00 14.69 ? 238  ILE D N   1 
ATOM   9216  C  CA  . ILE D  1 237 ? 29.761  70.441  -15.703 1.00 16.39 ? 238  ILE D CA  1 
ATOM   9217  C  C   . ILE D  1 237 ? 29.910  71.740  -14.945 1.00 17.17 ? 238  ILE D C   1 
ATOM   9218  O  O   . ILE D  1 237 ? 30.619  72.652  -15.396 1.00 18.33 ? 238  ILE D O   1 
ATOM   9219  C  CB  . ILE D  1 237 ? 31.124  69.992  -16.283 1.00 15.01 ? 238  ILE D CB  1 
ATOM   9220  C  CG1 . ILE D  1 237 ? 30.953  68.676  -17.038 1.00 19.55 ? 238  ILE D CG1 1 
ATOM   9221  C  CG2 . ILE D  1 237 ? 32.162  69.800  -15.172 1.00 14.57 ? 238  ILE D CG2 1 
ATOM   9222  C  CD1 . ILE D  1 237 ? 32.125  68.325  -17.993 1.00 19.44 ? 238  ILE D CD1 1 
ATOM   9223  N  N   . CYS D  1 238 ? 29.202  71.819  -13.818 1.00 15.51 ? 239  CYS D N   1 
ATOM   9224  C  CA  . CYS D  1 238 ? 29.088  73.033  -13.044 1.00 16.30 ? 239  CYS D CA  1 
ATOM   9225  C  C   . CYS D  1 238 ? 30.098  72.989  -11.903 1.00 17.20 ? 239  CYS D C   1 
ATOM   9226  O  O   . CYS D  1 238 ? 30.832  73.940  -11.691 1.00 16.34 ? 239  CYS D O   1 
ATOM   9227  C  CB  . CYS D  1 238 ? 27.682  73.166  -12.462 1.00 17.30 ? 239  CYS D CB  1 
ATOM   9228  S  SG  . CYS D  1 238 ? 27.476  74.616  -11.366 1.00 17.95 ? 239  CYS D SG  1 
ATOM   9229  N  N   . GLY D  1 239 ? 30.114  71.875  -11.175 1.00 18.18 ? 240  GLY D N   1 
ATOM   9230  C  CA  . GLY D  1 239 ? 31.082  71.662  -10.116 1.00 17.36 ? 240  GLY D CA  1 
ATOM   9231  C  C   . GLY D  1 239 ? 31.418  70.207  -9.926  1.00 17.11 ? 240  GLY D C   1 
ATOM   9232  O  O   . GLY D  1 239 ? 30.809  69.338  -10.551 1.00 15.14 ? 240  GLY D O   1 
ATOM   9233  N  N   . ALA D  1 240 ? 32.398  69.959  -9.050  1.00 14.29 ? 241  ALA D N   1 
ATOM   9234  C  CA  . ALA D  1 240 ? 32.810  68.612  -8.696  1.00 14.99 ? 241  ALA D CA  1 
ATOM   9235  C  C   . ALA D  1 240 ? 33.162  68.563  -7.232  1.00 15.78 ? 241  ALA D C   1 
ATOM   9236  O  O   . ALA D  1 240 ? 34.278  68.172  -6.872  1.00 13.11 ? 241  ALA D O   1 
ATOM   9237  C  CB  . ALA D  1 240 ? 34.008  68.152  -9.554  1.00 12.65 ? 241  ALA D CB  1 
ATOM   9238  N  N   . ILE D  1 241 ? 32.194  68.949  -6.393  1.00 15.98 ? 242  ILE D N   1 
ATOM   9239  C  CA  . ILE D  1 241 ? 32.450  69.132  -4.984  1.00 15.73 ? 242  ILE D CA  1 
ATOM   9240  C  C   . ILE D  1 241 ? 32.948  67.834  -4.292  1.00 16.77 ? 242  ILE D C   1 
ATOM   9241  O  O   . ILE D  1 241 ? 33.676  67.915  -3.295  1.00 15.02 ? 242  ILE D O   1 
ATOM   9242  C  CB  . ILE D  1 241 ? 31.245  69.778  -4.242  1.00 15.56 ? 242  ILE D CB  1 
ATOM   9243  C  CG1 . ILE D  1 241 ? 31.636  70.192  -2.823  1.00 17.75 ? 242  ILE D CG1 1 
ATOM   9244  C  CG2 . ILE D  1 241 ? 30.078  68.864  -4.201  1.00 11.49 ? 242  ILE D CG2 1 
ATOM   9245  C  CD1 . ILE D  1 241 ? 30.690  71.174  -2.175  1.00 15.84 ? 242  ILE D CD1 1 
ATOM   9246  N  N   . SER D  1 242 ? 32.592  66.663  -4.827  1.00 15.44 ? 243  SER D N   1 
ATOM   9247  C  CA  . SER D  1 242 ? 33.138  65.392  -4.301  1.00 18.07 ? 243  SER D CA  1 
ATOM   9248  C  C   . SER D  1 242 ? 34.675  65.310  -4.355  1.00 16.60 ? 243  SER D C   1 
ATOM   9249  O  O   . SER D  1 242 ? 35.268  64.507  -3.664  1.00 15.69 ? 243  SER D O   1 
ATOM   9250  C  CB  . SER D  1 242 ? 32.555  64.168  -5.026  1.00 15.40 ? 243  SER D CB  1 
ATOM   9251  O  OG  . SER D  1 242 ? 33.148  63.961  -6.300  1.00 17.13 ? 243  SER D OG  1 
ATOM   9252  N  N   . THR D  1 243 ? 35.300  66.123  -5.191  1.00 16.14 ? 244  THR D N   1 
ATOM   9253  C  CA  . THR D  1 243 ? 36.741  66.101  -5.325  1.00 16.88 ? 244  THR D CA  1 
ATOM   9254  C  C   . THR D  1 243 ? 37.463  67.228  -4.580  1.00 17.16 ? 244  THR D C   1 
ATOM   9255  O  O   . THR D  1 243 ? 38.679  67.177  -4.477  1.00 14.93 ? 244  THR D O   1 
ATOM   9256  C  CB  . THR D  1 243 ? 37.124  66.219  -6.786  1.00 15.05 ? 244  THR D CB  1 
ATOM   9257  O  OG1 . THR D  1 243 ? 36.784  67.520  -7.227  1.00 15.01 ? 244  THR D OG1 1 
ATOM   9258  C  CG2 . THR D  1 243 ? 36.383  65.163  -7.648  1.00 11.47 ? 244  THR D CG2 1 
ATOM   9259  N  N   . TYR D  1 244 ? 36.741  68.235  -4.073  1.00 16.56 ? 245  TYR D N   1 
ATOM   9260  C  CA  . TYR D  1 244 ? 37.420  69.467  -3.603  1.00 18.22 ? 245  TYR D CA  1 
ATOM   9261  C  C   . TYR D  1 244 ? 38.254  69.279  -2.334  1.00 18.50 ? 245  TYR D C   1 
ATOM   9262  O  O   . TYR D  1 244 ? 39.213  69.986  -2.136  1.00 16.27 ? 245  TYR D O   1 
ATOM   9263  C  CB  . TYR D  1 244 ? 36.454  70.637  -3.354  1.00 15.82 ? 245  TYR D CB  1 
ATOM   9264  C  CG  . TYR D  1 244 ? 35.634  71.128  -4.545  1.00 18.47 ? 245  TYR D CG  1 
ATOM   9265  C  CD1 . TYR D  1 244 ? 35.885  70.698  -5.840  1.00 18.84 ? 245  TYR D CD1 1 
ATOM   9266  C  CD2 . TYR D  1 244 ? 34.612  72.057  -4.356  1.00 14.23 ? 245  TYR D CD2 1 
ATOM   9267  C  CE1 . TYR D  1 244 ? 35.122  71.133  -6.890  1.00 20.74 ? 245  TYR D CE1 1 
ATOM   9268  C  CE2 . TYR D  1 244 ? 33.860  72.502  -5.398  1.00 18.63 ? 245  TYR D CE2 1 
ATOM   9269  C  CZ  . TYR D  1 244 ? 34.117  72.042  -6.673  1.00 22.75 ? 245  TYR D CZ  1 
ATOM   9270  O  OH  . TYR D  1 244 ? 33.355  72.493  -7.726  1.00 17.42 ? 245  TYR D OH  1 
ATOM   9271  N  N   . ASN D  1 245 ? 37.857  68.338  -1.482  1.00 20.07 ? 246  ASN D N   1 
ATOM   9272  C  CA  . ASN D  1 245 ? 38.550  68.090  -0.234  1.00 21.91 ? 246  ASN D CA  1 
ATOM   9273  C  C   . ASN D  1 245 ? 39.364  66.806  -0.245  1.00 23.25 ? 246  ASN D C   1 
ATOM   9274  O  O   . ASN D  1 245 ? 39.702  66.312  0.817   1.00 21.89 ? 246  ASN D O   1 
ATOM   9275  C  CB  . ASN D  1 245 ? 37.535  68.000  0.899   1.00 19.72 ? 246  ASN D CB  1 
ATOM   9276  C  CG  . ASN D  1 245 ? 36.784  69.254  1.065   1.00 20.59 ? 246  ASN D CG  1 
ATOM   9277  O  OD1 . ASN D  1 245 ? 37.325  70.221  1.626   1.00 13.08 ? 246  ASN D OD1 1 
ATOM   9278  N  ND2 . ASN D  1 245 ? 35.529  69.288  0.544   1.00 13.75 ? 246  ASN D ND2 1 
ATOM   9279  N  N   . ARG D  1 246 ? 39.669  66.268  -1.423  1.00 24.62 ? 247  ARG D N   1 
ATOM   9280  C  CA  . ARG D  1 246 ? 40.286  64.939  -1.488  1.00 27.07 ? 247  ARG D CA  1 
ATOM   9281  C  C   . ARG D  1 246 ? 41.711  64.949  -0.939  1.00 29.78 ? 247  ARG D C   1 
ATOM   9282  O  O   . ARG D  1 246 ? 42.434  65.949  -1.029  1.00 29.08 ? 247  ARG D O   1 
ATOM   9283  C  CB  . ARG D  1 246 ? 40.292  64.380  -2.908  1.00 22.95 ? 247  ARG D CB  1 
ATOM   9284  C  CG  . ARG D  1 246 ? 41.275  65.085  -3.817  1.00 25.51 ? 247  ARG D CG  1 
ATOM   9285  C  CD  . ARG D  1 246 ? 40.999  64.723  -5.263  1.00 29.01 ? 247  ARG D CD  1 
ATOM   9286  N  NE  . ARG D  1 246 ? 42.033  65.254  -6.129  1.00 22.33 ? 247  ARG D NE  1 
ATOM   9287  C  CZ  . ARG D  1 246 ? 41.947  66.362  -6.842  1.00 29.14 ? 247  ARG D CZ  1 
ATOM   9288  N  NH1 . ARG D  1 246 ? 40.861  67.131  -6.823  1.00 34.64 ? 247  ARG D NH1 1 
ATOM   9289  N  NH2 . ARG D  1 246 ? 42.981  66.706  -7.588  1.00 36.91 ? 247  ARG D NH2 1 
ATOM   9290  N  N   . THR D  1 247 ? 42.068  63.806  -0.371  1.00 35.08 ? 248  THR D N   1 
ATOM   9291  C  CA  . THR D  1 247 ? 43.371  63.559  0.218   1.00 38.85 ? 248  THR D CA  1 
ATOM   9292  C  C   . THR D  1 247 ? 44.027  62.386  -0.514  1.00 42.41 ? 248  THR D C   1 
ATOM   9293  O  O   . THR D  1 247 ? 44.917  61.751  0.025   1.00 45.88 ? 248  THR D O   1 
ATOM   9294  C  CB  . THR D  1 247 ? 43.239  63.224  1.736   1.00 38.12 ? 248  THR D CB  1 
ATOM   9295  O  OG1 . THR D  1 247 ? 42.509  62.001  1.923   1.00 34.61 ? 248  THR D OG1 1 
ATOM   9296  C  CG2 . THR D  1 247 ? 42.495  64.337  2.479   1.00 38.56 ? 248  THR D CG2 1 
ATOM   9297  N  N   . GLY D  1 248 ? 43.564  62.096  -1.730  1.00 41.84 ? 249  GLY D N   1 
ATOM   9298  C  CA  . GLY D  1 248 ? 44.194  61.101  -2.604  1.00 40.03 ? 249  GLY D CA  1 
ATOM   9299  C  C   . GLY D  1 248 ? 43.941  61.450  -4.073  1.00 37.46 ? 249  GLY D C   1 
ATOM   9300  O  O   . GLY D  1 248 ? 43.491  62.574  -4.387  1.00 33.89 ? 249  GLY D O   1 
ATOM   9301  N  N   . PRO D  1 249 ? 44.219  60.496  -4.981  1.00 34.26 ? 250  PRO D N   1 
ATOM   9302  C  CA  . PRO D  1 249 ? 43.996  60.814  -6.391  1.00 32.14 ? 250  PRO D CA  1 
ATOM   9303  C  C   . PRO D  1 249 ? 42.512  60.858  -6.734  1.00 28.42 ? 250  PRO D C   1 
ATOM   9304  O  O   . PRO D  1 249 ? 41.673  60.336  -5.994  1.00 26.45 ? 250  PRO D O   1 
ATOM   9305  C  CB  . PRO D  1 249 ? 44.727  59.692  -7.150  1.00 31.71 ? 250  PRO D CB  1 
ATOM   9306  C  CG  . PRO D  1 249 ? 44.973  58.622  -6.167  1.00 34.77 ? 250  PRO D CG  1 
ATOM   9307  C  CD  . PRO D  1 249 ? 44.923  59.215  -4.798  1.00 36.13 ? 250  PRO D CD  1 
ATOM   9308  N  N   . LEU D  1 250 ? 42.206  61.513  -7.845  1.00 26.90 ? 251  LEU D N   1 
ATOM   9309  C  CA  . LEU D  1 250 ? 40.853  61.530  -8.397  1.00 24.68 ? 251  LEU D CA  1 
ATOM   9310  C  C   . LEU D  1 250 ? 40.356  60.104  -8.654  1.00 24.61 ? 251  LEU D C   1 
ATOM   9311  O  O   . LEU D  1 250 ? 41.139  59.237  -9.034  1.00 25.48 ? 251  LEU D O   1 
ATOM   9312  C  CB  . LEU D  1 250 ? 40.884  62.339  -9.699  1.00 23.34 ? 251  LEU D CB  1 
ATOM   9313  C  CG  . LEU D  1 250 ? 41.139  63.839  -9.480  1.00 22.80 ? 251  LEU D CG  1 
ATOM   9314  C  CD1 . LEU D  1 250 ? 41.623  64.554  -10.758 1.00 23.15 ? 251  LEU D CD1 1 
ATOM   9315  C  CD2 . LEU D  1 250 ? 39.857  64.484  -8.933  1.00 17.87 ? 251  LEU D CD2 1 
ATOM   9316  N  N   . PRO D  1 251 ? 39.057  59.844  -8.465  1.00 24.47 ? 252  PRO D N   1 
ATOM   9317  C  CA  . PRO D  1 251 ? 38.561  58.548  -8.900  1.00 23.76 ? 252  PRO D CA  1 
ATOM   9318  C  C   . PRO D  1 251 ? 38.654  58.403  -10.421 1.00 25.70 ? 252  PRO D C   1 
ATOM   9319  O  O   . PRO D  1 251 ? 38.992  59.379  -11.109 1.00 22.30 ? 252  PRO D O   1 
ATOM   9320  C  CB  . PRO D  1 251 ? 37.097  58.587  -8.501  1.00 24.00 ? 252  PRO D CB  1 
ATOM   9321  C  CG  . PRO D  1 251 ? 36.744  60.003  -8.626  1.00 26.50 ? 252  PRO D CG  1 
ATOM   9322  C  CD  . PRO D  1 251 ? 37.948  60.749  -8.111  1.00 25.21 ? 252  PRO D CD  1 
ATOM   9323  N  N   . PRO D  1 252 ? 38.406  57.183  -10.932 1.00 25.17 ? 253  PRO D N   1 
ATOM   9324  C  CA  . PRO D  1 252 ? 38.432  56.906  -12.350 1.00 26.37 ? 253  PRO D CA  1 
ATOM   9325  C  C   . PRO D  1 252 ? 37.482  57.793  -13.145 1.00 27.62 ? 253  PRO D C   1 
ATOM   9326  O  O   . PRO D  1 252 ? 36.403  58.147  -12.659 1.00 25.77 ? 253  PRO D O   1 
ATOM   9327  C  CB  . PRO D  1 252 ? 37.977  55.444  -12.446 1.00 28.05 ? 253  PRO D CB  1 
ATOM   9328  C  CG  . PRO D  1 252 ? 37.916  54.907  -11.069 1.00 29.15 ? 253  PRO D CG  1 
ATOM   9329  C  CD  . PRO D  1 252 ? 38.339  55.960  -10.117 1.00 27.17 ? 253  PRO D CD  1 
ATOM   9330  N  N   . GLY D  1 253 ? 37.889  58.150  -14.361 1.00 27.20 ? 254  GLY D N   1 
ATOM   9331  C  CA  . GLY D  1 253 ? 37.011  58.841  -15.290 1.00 25.94 ? 254  GLY D CA  1 
ATOM   9332  C  C   . GLY D  1 253 ? 35.822  57.977  -15.699 1.00 26.71 ? 254  GLY D C   1 
ATOM   9333  O  O   . GLY D  1 253 ? 35.713  56.810  -15.303 1.00 26.51 ? 254  GLY D O   1 
ATOM   9334  N  N   . PRO D  1 254 ? 34.914  58.544  -16.501 1.00 29.10 ? 255  PRO D N   1 
ATOM   9335  C  CA  . PRO D  1 254 ? 33.734  57.787  -16.921 1.00 29.77 ? 255  PRO D CA  1 
ATOM   9336  C  C   . PRO D  1 254 ? 34.098  56.736  -17.967 1.00 29.55 ? 255  PRO D C   1 
ATOM   9337  O  O   . PRO D  1 254 ? 35.123  56.866  -18.628 1.00 29.98 ? 255  PRO D O   1 
ATOM   9338  C  CB  . PRO D  1 254 ? 32.834  58.851  -17.534 1.00 31.35 ? 255  PRO D CB  1 
ATOM   9339  C  CG  . PRO D  1 254 ? 33.686  60.143  -17.623 1.00 32.30 ? 255  PRO D CG  1 
ATOM   9340  C  CD  . PRO D  1 254 ? 35.060  59.819  -17.230 1.00 29.80 ? 255  PRO D CD  1 
ATOM   9341  N  N   . PRO D  1 255 ? 33.267  55.702  -18.120 1.00 30.64 ? 256  PRO D N   1 
ATOM   9342  C  CA  . PRO D  1 255 ? 33.625  54.649  -19.039 1.00 30.41 ? 256  PRO D CA  1 
ATOM   9343  C  C   . PRO D  1 255 ? 33.549  55.162  -20.480 1.00 28.74 ? 256  PRO D C   1 
ATOM   9344  O  O   . PRO D  1 255 ? 32.467  55.529  -20.939 1.00 26.51 ? 256  PRO D O   1 
ATOM   9345  C  CB  . PRO D  1 255 ? 32.569  53.565  -18.761 1.00 31.23 ? 256  PRO D CB  1 
ATOM   9346  C  CG  . PRO D  1 255 ? 31.787  54.038  -17.604 1.00 32.07 ? 256  PRO D CG  1 
ATOM   9347  C  CD  . PRO D  1 255 ? 31.903  55.510  -17.610 1.00 31.28 ? 256  PRO D CD  1 
ATOM   9348  N  N   . PRO D  1 256 ? 34.702  55.237  -21.173 1.00 27.61 ? 257  PRO D N   1 
ATOM   9349  C  CA  . PRO D  1 256 ? 34.699  55.816  -22.523 1.00 26.70 ? 257  PRO D CA  1 
ATOM   9350  C  C   . PRO D  1 256 ? 33.698  55.167  -23.499 1.00 25.74 ? 257  PRO D C   1 
ATOM   9351  O  O   . PRO D  1 256 ? 33.064  55.875  -24.290 1.00 27.88 ? 257  PRO D O   1 
ATOM   9352  C  CB  . PRO D  1 256 ? 36.158  55.619  -23.005 1.00 27.89 ? 257  PRO D CB  1 
ATOM   9353  C  CG  . PRO D  1 256 ? 36.975  55.412  -21.765 1.00 26.54 ? 257  PRO D CG  1 
ATOM   9354  C  CD  . PRO D  1 256 ? 36.038  54.719  -20.801 1.00 28.04 ? 257  PRO D CD  1 
ATOM   9355  N  N   . GLU D  1 257 ? 33.551  53.851  -23.439 1.00 24.63 ? 258  GLU D N   1 
ATOM   9356  C  CA  . GLU D  1 257 ? 32.625  53.122  -24.322 1.00 25.85 ? 258  GLU D CA  1 
ATOM   9357  C  C   . GLU D  1 257 ? 31.193  53.657  -24.193 1.00 25.02 ? 258  GLU D C   1 
ATOM   9358  O  O   . GLU D  1 257 ? 30.465  53.731  -25.176 1.00 24.37 ? 258  GLU D O   1 
ATOM   9359  C  CB  . GLU D  1 257 ? 32.654  51.597  -24.031 1.00 26.54 ? 258  GLU D CB  1 
ATOM   9360  N  N   . ILE D  1 258 ? 30.798  54.038  -22.988 1.00 22.84 ? 259  ILE D N   1 
ATOM   9361  C  CA  . ILE D  1 258 ? 29.460  54.562  -22.776 1.00 22.02 ? 259  ILE D CA  1 
ATOM   9362  C  C   . ILE D  1 258 ? 29.352  56.009  -23.252 1.00 21.24 ? 259  ILE D C   1 
ATOM   9363  O  O   . ILE D  1 258 ? 28.362  56.371  -23.893 1.00 22.04 ? 259  ILE D O   1 
ATOM   9364  C  CB  . ILE D  1 258 ? 29.032  54.472  -21.317 1.00 23.14 ? 259  ILE D CB  1 
ATOM   9365  C  CG1 . ILE D  1 258 ? 28.995  53.008  -20.882 1.00 28.19 ? 259  ILE D CG1 1 
ATOM   9366  C  CG2 . ILE D  1 258 ? 27.622  55.091  -21.115 1.00 19.91 ? 259  ILE D CG2 1 
ATOM   9367  C  CD1 . ILE D  1 258 ? 28.636  52.817  -19.400 1.00 30.20 ? 259  ILE D CD1 1 
ATOM   9368  N  N   . VAL D  1 259 ? 30.365  56.827  -22.966 1.00 19.81 ? 260  VAL D N   1 
ATOM   9369  C  CA  . VAL D  1 259 ? 30.384  58.220  -23.419 1.00 17.12 ? 260  VAL D CA  1 
ATOM   9370  C  C   . VAL D  1 259 ? 30.328  58.296  -24.946 1.00 17.06 ? 260  VAL D C   1 
ATOM   9371  O  O   . VAL D  1 259 ? 29.628  59.128  -25.519 1.00 18.45 ? 260  VAL D O   1 
ATOM   9372  C  CB  . VAL D  1 259 ? 31.669  58.944  -22.950 1.00 19.81 ? 260  VAL D CB  1 
ATOM   9373  C  CG1 . VAL D  1 259 ? 31.689  60.388  -23.484 1.00 17.85 ? 260  VAL D CG1 1 
ATOM   9374  C  CG2 . VAL D  1 259 ? 31.786  58.918  -21.437 1.00 17.26 ? 260  VAL D CG2 1 
ATOM   9375  N  N   . ILE D  1 260 ? 31.078  57.424  -25.598 1.00 17.26 ? 261  ILE D N   1 
ATOM   9376  C  CA  . ILE D  1 260 ? 31.180  57.429  -27.047 1.00 19.95 ? 261  ILE D CA  1 
ATOM   9377  C  C   . ILE D  1 260 ? 29.873  56.912  -27.654 1.00 21.22 ? 261  ILE D C   1 
ATOM   9378  O  O   . ILE D  1 260 ? 29.239  57.616  -28.431 1.00 19.14 ? 261  ILE D O   1 
ATOM   9379  C  CB  . ILE D  1 260 ? 32.356  56.604  -27.522 1.00 19.75 ? 261  ILE D CB  1 
ATOM   9380  C  CG1 . ILE D  1 260 ? 33.673  57.372  -27.289 1.00 20.95 ? 261  ILE D CG1 1 
ATOM   9381  C  CG2 . ILE D  1 260 ? 32.218  56.235  -28.982 1.00 17.41 ? 261  ILE D CG2 1 
ATOM   9382  C  CD1 . ILE D  1 260 ? 34.906  56.442  -27.342 1.00 18.98 ? 261  ILE D CD1 1 
ATOM   9383  N  N   . TYR D  1 261 ? 29.458  55.723  -27.236 1.00 20.60 ? 262  TYR D N   1 
ATOM   9384  C  CA  . TYR D  1 261 ? 28.340  55.030  -27.858 1.00 21.75 ? 262  TYR D CA  1 
ATOM   9385  C  C   . TYR D  1 261 ? 27.062  55.830  -27.695 1.00 21.79 ? 262  TYR D C   1 
ATOM   9386  O  O   . TYR D  1 261 ? 26.252  55.855  -28.604 1.00 21.09 ? 262  TYR D O   1 
ATOM   9387  C  CB  . TYR D  1 261 ? 28.187  53.611  -27.286 1.00 22.80 ? 262  TYR D CB  1 
ATOM   9388  C  CG  . TYR D  1 261 ? 27.336  52.685  -28.130 1.00 30.58 ? 262  TYR D CG  1 
ATOM   9389  N  N   . GLN D  1 262 ? 26.902  56.512  -26.553 1.00 21.36 ? 263  GLN D N   1 
ATOM   9390  C  CA  . GLN D  1 262 ? 25.763  57.394  -26.353 1.00 20.11 ? 263  GLN D CA  1 
ATOM   9391  C  C   . GLN D  1 262 ? 25.981  58.792  -26.911 1.00 20.46 ? 263  GLN D C   1 
ATOM   9392  O  O   . GLN D  1 262 ? 25.049  59.601  -26.891 1.00 20.73 ? 263  GLN D O   1 
ATOM   9393  C  CB  . GLN D  1 262 ? 25.384  57.503  -24.873 1.00 20.13 ? 263  GLN D CB  1 
ATOM   9394  C  CG  . GLN D  1 262 ? 24.944  56.221  -24.220 1.00 23.19 ? 263  GLN D CG  1 
ATOM   9395  C  CD  . GLN D  1 262 ? 23.672  55.650  -24.822 1.00 24.03 ? 263  GLN D CD  1 
ATOM   9396  O  OE1 . GLN D  1 262 ? 23.745  54.860  -25.741 1.00 27.78 ? 263  GLN D OE1 1 
ATOM   9397  N  NE2 . GLN D  1 262 ? 22.511  56.070  -24.318 1.00 21.01 ? 263  GLN D NE2 1 
ATOM   9398  N  N   . GLU D  1 263 ? 27.197  59.089  -27.380 1.00 18.13 ? 264  GLU D N   1 
ATOM   9399  C  CA  . GLU D  1 263 ? 27.499  60.358  -28.047 1.00 18.69 ? 264  GLU D CA  1 
ATOM   9400  C  C   . GLU D  1 263 ? 27.098  61.581  -27.193 1.00 19.36 ? 264  GLU D C   1 
ATOM   9401  O  O   . GLU D  1 263 ? 26.414  62.517  -27.655 1.00 19.99 ? 264  GLU D O   1 
ATOM   9402  C  CB  . GLU D  1 263 ? 26.842  60.395  -29.427 1.00 20.54 ? 264  GLU D CB  1 
ATOM   9403  C  CG  . GLU D  1 263 ? 27.292  59.259  -30.335 1.00 20.31 ? 264  GLU D CG  1 
ATOM   9404  C  CD  . GLU D  1 263 ? 26.732  59.371  -31.761 1.00 21.37 ? 264  GLU D CD  1 
ATOM   9405  O  OE1 . GLU D  1 263 ? 27.290  60.113  -32.602 1.00 22.46 ? 264  GLU D OE1 1 
ATOM   9406  O  OE2 . GLU D  1 263 ? 25.763  58.657  -32.037 1.00 20.92 ? 264  GLU D OE2 1 
ATOM   9407  N  N   . LEU D  1 264 ? 27.556  61.555  -25.946 1.00 17.86 ? 265  LEU D N   1 
ATOM   9408  C  CA  . LEU D  1 264 ? 27.219  62.570  -24.978 1.00 18.57 ? 265  LEU D CA  1 
ATOM   9409  C  C   . LEU D  1 264 ? 27.962  63.864  -25.237 1.00 19.45 ? 265  LEU D C   1 
ATOM   9410  O  O   . LEU D  1 264 ? 29.094  63.872  -25.743 1.00 20.07 ? 265  LEU D O   1 
ATOM   9411  C  CB  . LEU D  1 264 ? 27.565  62.093  -23.575 1.00 19.06 ? 265  LEU D CB  1 
ATOM   9412  C  CG  . LEU D  1 264 ? 26.936  60.790  -23.119 1.00 20.56 ? 265  LEU D CG  1 
ATOM   9413  C  CD1 . LEU D  1 264 ? 27.388  60.578  -21.714 1.00 18.75 ? 265  LEU D CD1 1 
ATOM   9414  C  CD2 . LEU D  1 264 ? 25.421  60.833  -23.185 1.00 19.37 ? 265  LEU D CD2 1 
ATOM   9415  N  N   . ARG D  1 265 ? 27.316  64.960  -24.877 1.00 19.50 ? 266  ARG D N   1 
ATOM   9416  C  CA  . ARG D  1 265 ? 27.916  66.264  -24.974 1.00 22.97 ? 266  ARG D CA  1 
ATOM   9417  C  C   . ARG D  1 265 ? 28.129  66.762  -23.563 1.00 23.39 ? 266  ARG D C   1 
ATOM   9418  O  O   . ARG D  1 265 ? 27.173  66.951  -22.823 1.00 23.92 ? 266  ARG D O   1 
ATOM   9419  C  CB  . ARG D  1 265 ? 26.981  67.207  -25.714 1.00 24.04 ? 266  ARG D CB  1 
ATOM   9420  C  CG  . ARG D  1 265 ? 27.543  68.593  -25.945 1.00 33.77 ? 266  ARG D CG  1 
ATOM   9421  C  CD  . ARG D  1 265 ? 26.437  69.492  -26.467 1.00 42.03 ? 266  ARG D CD  1 
ATOM   9422  N  NE  . ARG D  1 265 ? 26.899  70.846  -26.709 1.00 48.43 ? 266  ARG D NE  1 
ATOM   9423  C  CZ  . ARG D  1 265 ? 26.974  71.812  -25.792 1.00 53.90 ? 266  ARG D CZ  1 
ATOM   9424  N  NH1 . ARG D  1 265 ? 26.614  71.609  -24.522 1.00 48.65 ? 266  ARG D NH1 1 
ATOM   9425  N  NH2 . ARG D  1 265 ? 27.416  73.010  -26.166 1.00 54.64 ? 266  ARG D NH2 1 
ATOM   9426  N  N   . MET D  1 266 ? 29.380  66.993  -23.190 1.00 23.73 ? 267  MET D N   1 
ATOM   9427  C  CA  . MET D  1 266 ? 29.686  67.448  -21.845 1.00 25.49 ? 267  MET D CA  1 
ATOM   9428  C  C   . MET D  1 266 ? 30.356  68.812  -21.906 1.00 24.49 ? 267  MET D C   1 
ATOM   9429  O  O   . MET D  1 266 ? 31.406  68.951  -22.539 1.00 27.60 ? 267  MET D O   1 
ATOM   9430  C  CB  . MET D  1 266 ? 30.612  66.445  -21.180 1.00 25.00 ? 267  MET D CB  1 
ATOM   9431  C  CG  . MET D  1 266 ? 30.093  65.039  -21.246 1.00 29.55 ? 267  MET D CG  1 
ATOM   9432  S  SD  . MET D  1 266 ? 31.356  63.910  -20.696 1.00 36.10 ? 267  MET D SD  1 
ATOM   9433  C  CE  . MET D  1 266 ? 30.467  62.375  -20.767 1.00 42.65 ? 267  MET D CE  1 
ATOM   9434  N  N   . GLU D  1 267 ? 29.768  69.814  -21.251 1.00 22.24 ? 268  GLU D N   1 
ATOM   9435  C  CA  . GLU D  1 267 ? 30.363  71.160  -21.275 1.00 20.09 ? 268  GLU D CA  1 
ATOM   9436  C  C   . GLU D  1 267 ? 30.445  71.773  -19.907 1.00 16.48 ? 268  GLU D C   1 
ATOM   9437  O  O   . GLU D  1 267 ? 29.471  71.773  -19.158 1.00 18.52 ? 268  GLU D O   1 
ATOM   9438  C  CB  . GLU D  1 267 ? 29.628  72.109  -22.243 1.00 18.17 ? 268  GLU D CB  1 
ATOM   9439  C  CG  . GLU D  1 267 ? 30.278  73.497  -22.327 1.00 23.03 ? 268  GLU D CG  1 
ATOM   9440  C  CD  . GLU D  1 267 ? 29.609  74.430  -23.327 1.00 29.65 ? 268  GLU D CD  1 
ATOM   9441  O  OE1 . GLU D  1 267 ? 28.690  73.983  -24.044 1.00 32.08 ? 268  GLU D OE1 1 
ATOM   9442  O  OE2 . GLU D  1 267 ? 29.998  75.606  -23.380 1.00 31.15 ? 268  GLU D OE2 1 
ATOM   9443  N  N   . ALA D  1 268 ? 31.625  72.283  -19.574 1.00 16.95 ? 269  ALA D N   1 
ATOM   9444  C  CA  . ALA D  1 268 ? 31.828  73.002  -18.315 1.00 16.21 ? 269  ALA D CA  1 
ATOM   9445  C  C   . ALA D  1 268 ? 31.608  74.497  -18.557 1.00 16.72 ? 269  ALA D C   1 
ATOM   9446  O  O   . ALA D  1 268 ? 31.744  74.983  -19.690 1.00 16.30 ? 269  ALA D O   1 
ATOM   9447  C  CB  . ALA D  1 268 ? 33.214  72.728  -17.765 1.00 16.04 ? 269  ALA D CB  1 
ATOM   9448  N  N   . PHE D  1 269 ? 31.237  75.221  -17.511 1.00 16.10 ? 270  PHE D N   1 
ATOM   9449  C  CA  . PHE D  1 269 ? 31.056  76.638  -17.649 1.00 18.36 ? 270  PHE D CA  1 
ATOM   9450  C  C   . PHE D  1 269 ? 31.386  77.322  -16.352 1.00 17.31 ? 270  PHE D C   1 
ATOM   9451  O  O   . PHE D  1 269 ? 31.398  76.682  -15.313 1.00 18.81 ? 270  PHE D O   1 
ATOM   9452  C  CB  . PHE D  1 269 ? 29.605  76.935  -18.052 1.00 19.49 ? 270  PHE D CB  1 
ATOM   9453  C  CG  . PHE D  1 269 ? 28.646  76.572  -17.004 1.00 16.62 ? 270  PHE D CG  1 
ATOM   9454  C  CD1 . PHE D  1 269 ? 28.264  75.252  -16.843 1.00 14.51 ? 270  PHE D CD1 1 
ATOM   9455  C  CD2 . PHE D  1 269 ? 28.208  77.519  -16.094 1.00 15.86 ? 270  PHE D CD2 1 
ATOM   9456  C  CE1 . PHE D  1 269 ? 27.419  74.882  -15.825 1.00 16.06 ? 270  PHE D CE1 1 
ATOM   9457  C  CE2 . PHE D  1 269 ? 27.341  77.162  -15.095 1.00 19.06 ? 270  PHE D CE2 1 
ATOM   9458  C  CZ  . PHE D  1 269 ? 26.952  75.825  -14.953 1.00 16.38 ? 270  PHE D CZ  1 
ATOM   9459  N  N   . VAL D  1 270 ? 31.688  78.617  -16.440 1.00 17.93 ? 271  VAL D N   1 
ATOM   9460  C  CA  . VAL D  1 270 ? 31.837  79.497  -15.285 1.00 18.65 ? 271  VAL D CA  1 
ATOM   9461  C  C   . VAL D  1 270 ? 30.779  80.595  -15.384 1.00 18.77 ? 271  VAL D C   1 
ATOM   9462  O  O   . VAL D  1 270 ? 30.637  81.229  -16.428 1.00 18.22 ? 271  VAL D O   1 
ATOM   9463  C  CB  . VAL D  1 270 ? 33.250  80.104  -15.221 1.00 20.12 ? 271  VAL D CB  1 
ATOM   9464  C  CG1 . VAL D  1 270 ? 33.313  81.230  -14.199 1.00 17.83 ? 271  VAL D CG1 1 
ATOM   9465  C  CG2 . VAL D  1 270 ? 34.280  79.012  -14.865 1.00 19.03 ? 271  VAL D CG2 1 
ATOM   9466  N  N   . VAL D  1 271 ? 30.024  80.803  -14.313 1.00 18.51 ? 272  VAL D N   1 
ATOM   9467  C  CA  . VAL D  1 271 ? 28.887  81.732  -14.332 1.00 18.88 ? 272  VAL D CA  1 
ATOM   9468  C  C   . VAL D  1 271 ? 29.221  83.149  -14.840 1.00 20.66 ? 272  VAL D C   1 
ATOM   9469  O  O   . VAL D  1 271 ? 28.403  83.778  -15.536 1.00 20.23 ? 272  VAL D O   1 
ATOM   9470  C  CB  . VAL D  1 271 ? 28.215  81.791  -12.958 1.00 20.18 ? 272  VAL D CB  1 
ATOM   9471  C  CG1 . VAL D  1 271 ? 29.207  82.212  -11.880 1.00 21.60 ? 272  VAL D CG1 1 
ATOM   9472  C  CG2 . VAL D  1 271 ? 26.980  82.719  -12.983 1.00 19.25 ? 272  VAL D CG2 1 
ATOM   9473  N  N   . TYR D  1 272 ? 30.428  83.626  -14.545 1.00 21.09 ? 273  TYR D N   1 
ATOM   9474  C  CA  . TYR D  1 272 ? 30.825  84.985  -14.916 1.00 22.59 ? 273  TYR D CA  1 
ATOM   9475  C  C   . TYR D  1 272 ? 31.016  85.187  -16.413 1.00 22.48 ? 273  TYR D C   1 
ATOM   9476  O  O   . TYR D  1 272 ? 31.219  86.311  -16.852 1.00 23.01 ? 273  TYR D O   1 
ATOM   9477  C  CB  . TYR D  1 272 ? 32.115  85.413  -14.179 1.00 23.46 ? 273  TYR D CB  1 
ATOM   9478  C  CG  . TYR D  1 272 ? 32.068  85.175  -12.686 1.00 24.39 ? 273  TYR D CG  1 
ATOM   9479  C  CD1 . TYR D  1 272 ? 31.137  85.837  -11.881 1.00 23.51 ? 273  TYR D CD1 1 
ATOM   9480  C  CD2 . TYR D  1 272 ? 32.962  84.294  -12.076 1.00 20.22 ? 273  TYR D CD2 1 
ATOM   9481  C  CE1 . TYR D  1 272 ? 31.097  85.621  -10.521 1.00 25.34 ? 273  TYR D CE1 1 
ATOM   9482  C  CE2 . TYR D  1 272 ? 32.923  84.059  -10.724 1.00 23.68 ? 273  TYR D CE2 1 
ATOM   9483  C  CZ  . TYR D  1 272 ? 31.992  84.725  -9.942  1.00 27.26 ? 273  TYR D CZ  1 
ATOM   9484  O  OH  . TYR D  1 272 ? 31.960  84.475  -8.583  1.00 25.23 ? 273  TYR D OH  1 
ATOM   9485  N  N   . ARG D  1 273 ? 30.965  84.111  -17.195 1.00 23.91 ? 274  ARG D N   1 
ATOM   9486  C  CA  . ARG D  1 273 ? 30.949  84.209  -18.674 1.00 23.17 ? 274  ARG D CA  1 
ATOM   9487  C  C   . ARG D  1 273 ? 29.847  85.143  -19.209 1.00 24.74 ? 274  ARG D C   1 
ATOM   9488  O  O   . ARG D  1 273 ? 30.054  85.831  -20.204 1.00 24.90 ? 274  ARG D O   1 
ATOM   9489  C  CB  . ARG D  1 273 ? 30.746  82.812  -19.281 1.00 21.51 ? 274  ARG D CB  1 
ATOM   9490  C  CG  . ARG D  1 273 ? 30.818  82.736  -20.792 1.00 25.79 ? 274  ARG D CG  1 
ATOM   9491  C  CD  . ARG D  1 273 ? 30.040  81.527  -21.352 1.00 25.87 ? 274  ARG D CD  1 
ATOM   9492  N  NE  . ARG D  1 273 ? 30.644  80.253  -20.960 1.00 23.19 ? 274  ARG D NE  1 
ATOM   9493  C  CZ  . ARG D  1 273 ? 30.391  79.069  -21.530 1.00 25.38 ? 274  ARG D CZ  1 
ATOM   9494  N  NH1 . ARG D  1 273 ? 29.520  78.943  -22.521 1.00 24.94 ? 274  ARG D NH1 1 
ATOM   9495  N  NH2 . ARG D  1 273 ? 31.017  77.982  -21.098 1.00 25.55 ? 274  ARG D NH2 1 
ATOM   9496  N  N   . TRP D  1 274 ? 28.673  85.126  -18.578 1.00 23.46 ? 275  TRP D N   1 
ATOM   9497  C  CA  . TRP D  1 274 ? 27.525  85.909  -19.054 1.00 24.36 ? 275  TRP D CA  1 
ATOM   9498  C  C   . TRP D  1 274 ? 27.463  87.271  -18.336 1.00 25.11 ? 275  TRP D C   1 
ATOM   9499  O  O   . TRP D  1 274 ? 27.315  87.336  -17.134 1.00 25.18 ? 275  TRP D O   1 
ATOM   9500  C  CB  . TRP D  1 274 ? 26.231  85.121  -18.846 1.00 24.66 ? 275  TRP D CB  1 
ATOM   9501  C  CG  . TRP D  1 274 ? 26.145  83.925  -19.730 1.00 22.54 ? 275  TRP D CG  1 
ATOM   9502  C  CD1 . TRP D  1 274 ? 25.664  83.890  -21.004 1.00 21.72 ? 275  TRP D CD1 1 
ATOM   9503  C  CD2 . TRP D  1 274 ? 26.572  82.589  -19.429 1.00 21.34 ? 275  TRP D CD2 1 
ATOM   9504  N  NE1 . TRP D  1 274 ? 25.742  82.617  -21.508 1.00 24.64 ? 275  TRP D NE1 1 
ATOM   9505  C  CE2 . TRP D  1 274 ? 26.289  81.795  -20.563 1.00 20.77 ? 275  TRP D CE2 1 
ATOM   9506  C  CE3 . TRP D  1 274 ? 27.137  81.980  -18.302 1.00 23.42 ? 275  TRP D CE3 1 
ATOM   9507  C  CZ2 . TRP D  1 274 ? 26.560  80.422  -20.613 1.00 22.68 ? 275  TRP D CZ2 1 
ATOM   9508  C  CZ3 . TRP D  1 274 ? 27.410  80.614  -18.350 1.00 25.09 ? 275  TRP D CZ3 1 
ATOM   9509  C  CH2 . TRP D  1 274 ? 27.127  79.850  -19.498 1.00 22.03 ? 275  TRP D CH2 1 
ATOM   9510  N  N   . GLN D  1 275 ? 27.638  88.338  -19.105 1.00 26.24 ? 276  GLN D N   1 
ATOM   9511  C  CA  . GLN D  1 275 ? 27.701  89.707  -18.622 1.00 27.87 ? 276  GLN D CA  1 
ATOM   9512  C  C   . GLN D  1 275 ? 26.693  90.548  -19.429 1.00 29.13 ? 276  GLN D C   1 
ATOM   9513  O  O   . GLN D  1 275 ? 25.993  90.017  -20.289 1.00 27.62 ? 276  GLN D O   1 
ATOM   9514  C  CB  . GLN D  1 275 ? 29.125  90.269  -18.818 1.00 30.83 ? 276  GLN D CB  1 
ATOM   9515  C  CG  . GLN D  1 275 ? 30.227  89.565  -17.988 1.00 28.62 ? 276  GLN D CG  1 
ATOM   9516  C  CD  . GLN D  1 275 ? 30.028  89.746  -16.511 1.00 36.43 ? 276  GLN D CD  1 
ATOM   9517  O  OE1 . GLN D  1 275 ? 29.574  90.812  -16.059 1.00 39.94 ? 276  GLN D OE1 1 
ATOM   9518  N  NE2 . GLN D  1 275 ? 30.357  88.713  -15.733 1.00 35.90 ? 276  GLN D NE2 1 
ATOM   9519  N  N   . GLY D  1 276 ? 26.634  91.852  -19.156 1.00 29.69 ? 277  GLY D N   1 
ATOM   9520  C  CA  . GLY D  1 276 ? 25.782  92.761  -19.910 1.00 29.11 ? 277  GLY D CA  1 
ATOM   9521  C  C   . GLY D  1 276 ? 24.308  92.416  -19.831 1.00 29.74 ? 277  GLY D C   1 
ATOM   9522  O  O   . GLY D  1 276 ? 23.786  92.114  -18.762 1.00 28.82 ? 277  GLY D O   1 
ATOM   9523  N  N   . ASP D  1 277 ? 23.646  92.440  -20.984 1.00 30.48 ? 278  ASP D N   1 
ATOM   9524  C  CA  . ASP D  1 277 ? 22.191  92.295  -21.056 1.00 30.61 ? 278  ASP D CA  1 
ATOM   9525  C  C   . ASP D  1 277 ? 21.723  90.880  -20.750 1.00 27.66 ? 278  ASP D C   1 
ATOM   9526  O  O   . ASP D  1 277 ? 20.703  90.687  -20.071 1.00 29.05 ? 278  ASP D O   1 
ATOM   9527  C  CB  . ASP D  1 277 ? 21.681  92.738  -22.444 1.00 31.90 ? 278  ASP D CB  1 
ATOM   9528  C  CG  . ASP D  1 277 ? 21.791  94.259  -22.652 1.00 41.11 ? 278  ASP D CG  1 
ATOM   9529  O  OD1 . ASP D  1 277 ? 21.421  95.013  -21.709 1.00 38.63 ? 278  ASP D OD1 1 
ATOM   9530  O  OD2 . ASP D  1 277 ? 22.248  94.690  -23.749 1.00 47.20 ? 278  ASP D OD2 1 
ATOM   9531  N  N   . ALA D  1 278 ? 22.451  89.888  -21.244 1.00 27.24 ? 279  ALA D N   1 
ATOM   9532  C  CA  . ALA D  1 278 ? 22.129  88.496  -20.909 1.00 27.11 ? 279  ALA D CA  1 
ATOM   9533  C  C   . ALA D  1 278 ? 22.108  88.315  -19.390 1.00 24.53 ? 279  ALA D C   1 
ATOM   9534  O  O   . ALA D  1 278 ? 21.198  87.711  -18.849 1.00 26.91 ? 279  ALA D O   1 
ATOM   9535  C  CB  . ALA D  1 278 ? 23.113  87.537  -21.565 1.00 27.44 ? 279  ALA D CB  1 
ATOM   9536  N  N   . ARG D  1 279 ? 23.074  88.900  -18.697 1.00 24.46 ? 280  ARG D N   1 
ATOM   9537  C  CA  . ARG D  1 279 ? 23.143  88.774  -17.237 1.00 24.63 ? 280  ARG D CA  1 
ATOM   9538  C  C   . ARG D  1 279 ? 21.977  89.498  -16.616 1.00 26.26 ? 280  ARG D C   1 
ATOM   9539  O  O   . ARG D  1 279 ? 21.252  88.959  -15.752 1.00 25.93 ? 280  ARG D O   1 
ATOM   9540  C  CB  . ARG D  1 279 ? 24.474  89.337  -16.713 1.00 24.66 ? 280  ARG D CB  1 
ATOM   9541  C  CG  . ARG D  1 279 ? 24.676  89.198  -15.216 1.00 21.87 ? 280  ARG D CG  1 
ATOM   9542  C  CD  . ARG D  1 279 ? 26.054  89.702  -14.762 1.00 25.71 ? 280  ARG D CD  1 
ATOM   9543  N  NE  . ARG D  1 279 ? 26.199  89.600  -13.308 1.00 27.23 ? 280  ARG D NE  1 
ATOM   9544  C  CZ  . ARG D  1 279 ? 25.850  90.547  -12.430 1.00 32.14 ? 280  ARG D CZ  1 
ATOM   9545  N  NH1 . ARG D  1 279 ? 25.343  91.702  -12.825 1.00 31.29 ? 280  ARG D NH1 1 
ATOM   9546  N  NH2 . ARG D  1 279 ? 26.014  90.339  -11.134 1.00 31.09 ? 280  ARG D NH2 1 
ATOM   9547  N  N   . GLN D  1 280 ? 21.770  90.717  -17.103 1.00 26.70 ? 281  GLN D N   1 
ATOM   9548  C  CA  . GLN D  1 280 ? 20.744  91.594  -16.590 1.00 28.18 ? 281  GLN D CA  1 
ATOM   9549  C  C   . GLN D  1 280 ? 19.360  90.956  -16.798 1.00 27.52 ? 281  GLN D C   1 
ATOM   9550  O  O   . GLN D  1 280 ? 18.516  90.951  -15.890 1.00 25.80 ? 281  GLN D O   1 
ATOM   9551  C  CB  . GLN D  1 280 ? 20.885  92.948  -17.297 1.00 30.55 ? 281  GLN D CB  1 
ATOM   9552  C  CG  . GLN D  1 280 ? 20.235  94.107  -16.599 1.00 38.81 ? 281  GLN D CG  1 
ATOM   9553  C  CD  . GLN D  1 280 ? 20.941  94.494  -15.324 1.00 42.74 ? 281  GLN D CD  1 
ATOM   9554  O  OE1 . GLN D  1 280 ? 22.060  94.046  -15.049 1.00 42.59 ? 281  GLN D OE1 1 
ATOM   9555  N  NE2 . GLN D  1 280 ? 20.289  95.337  -14.532 1.00 40.70 ? 281  GLN D NE2 1 
ATOM   9556  N  N   . LYS D  1 281 ? 19.149  90.351  -17.970 1.00 27.36 ? 282  LYS D N   1 
ATOM   9557  C  CA  . LYS D  1 281 ? 17.888  89.657  -18.239 1.00 27.31 ? 282  LYS D CA  1 
ATOM   9558  C  C   . LYS D  1 281 ? 17.688  88.460  -17.289 1.00 26.66 ? 282  LYS D C   1 
ATOM   9559  O  O   . LYS D  1 281 ? 16.613  88.284  -16.684 1.00 25.71 ? 282  LYS D O   1 
ATOM   9560  C  CB  . LYS D  1 281 ? 17.833  89.223  -19.712 1.00 29.27 ? 282  LYS D CB  1 
ATOM   9561  C  CG  . LYS D  1 281 ? 16.505  88.583  -20.134 1.00 35.71 ? 282  LYS D CG  1 
ATOM   9562  C  CD  . LYS D  1 281 ? 16.567  88.002  -21.545 1.00 45.99 ? 282  LYS D CD  1 
ATOM   9563  N  N   . ALA D  1 282 ? 18.731  87.641  -17.131 1.00 24.90 ? 283  ALA D N   1 
ATOM   9564  C  CA  . ALA D  1 282 ? 18.624  86.497  -16.235 1.00 21.61 ? 283  ALA D CA  1 
ATOM   9565  C  C   . ALA D  1 282 ? 18.310  86.931  -14.829 1.00 19.60 ? 283  ALA D C   1 
ATOM   9566  O  O   . ALA D  1 282 ? 17.518  86.282  -14.151 1.00 21.40 ? 283  ALA D O   1 
ATOM   9567  C  CB  . ALA D  1 282 ? 19.910  85.647  -16.265 1.00 21.12 ? 283  ALA D CB  1 
ATOM   9568  N  N   . LEU D  1 283 ? 18.939  88.003  -14.356 1.00 21.22 ? 284  LEU D N   1 
ATOM   9569  C  CA  . LEU D  1 283 ? 18.661  88.500  -12.978 1.00 23.85 ? 284  LEU D CA  1 
ATOM   9570  C  C   . LEU D  1 283 ? 17.187  88.885  -12.801 1.00 23.32 ? 284  LEU D C   1 
ATOM   9571  O  O   . LEU D  1 283 ? 16.547  88.516  -11.823 1.00 24.09 ? 284  LEU D O   1 
ATOM   9572  C  CB  . LEU D  1 283 ? 19.571  89.691  -12.594 1.00 22.21 ? 284  LEU D CB  1 
ATOM   9573  C  CG  . LEU D  1 283 ? 21.051  89.343  -12.308 1.00 25.85 ? 284  LEU D CG  1 
ATOM   9574  C  CD1 . LEU D  1 283 ? 21.918  90.589  -12.128 1.00 17.79 ? 284  LEU D CD1 1 
ATOM   9575  C  CD2 . LEU D  1 283 ? 21.181  88.433  -11.062 1.00 19.85 ? 284  LEU D CD2 1 
ATOM   9576  N  N   . LYS D  1 284 ? 16.656  89.621  -13.767 1.00 26.62 ? 285  LYS D N   1 
ATOM   9577  C  CA  . LYS D  1 284 ? 15.229  90.025  -13.758 1.00 27.44 ? 285  LYS D CA  1 
ATOM   9578  C  C   . LYS D  1 284 ? 14.257  88.831  -13.813 1.00 27.99 ? 285  LYS D C   1 
ATOM   9579  O  O   . LYS D  1 284 ? 13.263  88.797  -13.081 1.00 29.28 ? 285  LYS D O   1 
ATOM   9580  C  CB  . LYS D  1 284 ? 14.965  91.007  -14.903 1.00 27.44 ? 285  LYS D CB  1 
ATOM   9581  C  CG  . LYS D  1 284 ? 15.628  92.367  -14.682 1.00 29.65 ? 285  LYS D CG  1 
ATOM   9582  C  CD  . LYS D  1 284 ? 15.469  93.336  -15.892 1.00 37.81 ? 285  LYS D CD  1 
ATOM   9583  C  CE  . LYS D  1 284 ? 16.139  94.689  -15.581 1.00 42.18 ? 285  LYS D CE  1 
ATOM   9584  N  NZ  . LYS D  1 284 ? 16.283  95.627  -16.742 1.00 44.56 ? 285  LYS D NZ  1 
ATOM   9585  N  N   . ASP D  1 285 ? 14.571  87.824  -14.634 1.00 29.00 ? 286  ASP D N   1 
ATOM   9586  C  CA  . ASP D  1 285 ? 13.772  86.591  -14.655 1.00 26.37 ? 286  ASP D CA  1 
ATOM   9587  C  C   . ASP D  1 285 ? 13.783  85.943  -13.310 1.00 26.63 ? 286  ASP D C   1 
ATOM   9588  O  O   . ASP D  1 285 ? 12.743  85.488  -12.818 1.00 29.74 ? 286  ASP D O   1 
ATOM   9589  C  CB  . ASP D  1 285 ? 14.304  85.584  -15.678 1.00 27.29 ? 286  ASP D CB  1 
ATOM   9590  C  CG  . ASP D  1 285 ? 14.082  86.020  -17.129 1.00 30.85 ? 286  ASP D CG  1 
ATOM   9591  O  OD1 . ASP D  1 285 ? 13.446  87.079  -17.378 1.00 31.31 ? 286  ASP D OD1 1 
ATOM   9592  O  OD2 . ASP D  1 285 ? 14.569  85.287  -18.023 1.00 29.83 ? 286  ASP D OD2 1 
ATOM   9593  N  N   . LEU D  1 286 ? 14.959  85.872  -12.699 1.00 26.72 ? 287  LEU D N   1 
ATOM   9594  C  CA  . LEU D  1 286 ? 15.084  85.210  -11.415 1.00 24.94 ? 287  LEU D CA  1 
ATOM   9595  C  C   . LEU D  1 286 ? 14.260  85.937  -10.348 1.00 25.31 ? 287  LEU D C   1 
ATOM   9596  O  O   . LEU D  1 286 ? 13.494  85.313  -9.615  1.00 27.15 ? 287  LEU D O   1 
ATOM   9597  C  CB  . LEU D  1 286 ? 16.561  85.091  -11.006 1.00 25.47 ? 287  LEU D CB  1 
ATOM   9598  C  CG  . LEU D  1 286 ? 17.412  84.061  -11.774 1.00 28.61 ? 287  LEU D CG  1 
ATOM   9599  C  CD1 . LEU D  1 286 ? 18.890  84.260  -11.515 1.00 22.11 ? 287  LEU D CD1 1 
ATOM   9600  C  CD2 . LEU D  1 286 ? 17.022  82.627  -11.418 1.00 16.56 ? 287  LEU D CD2 1 
ATOM   9601  N  N   . LEU D  1 287 ? 14.411  87.250  -10.246 1.00 25.19 ? 288  LEU D N   1 
ATOM   9602  C  CA  . LEU D  1 287 ? 13.565  88.027  -9.310  1.00 26.52 ? 288  LEU D CA  1 
ATOM   9603  C  C   . LEU D  1 287 ? 12.041  87.860  -9.592  1.00 26.45 ? 288  LEU D C   1 
ATOM   9604  O  O   . LEU D  1 287 ? 11.271  87.600  -8.681  1.00 27.54 ? 288  LEU D O   1 
ATOM   9605  C  CB  . LEU D  1 287 ? 13.953  89.503  -9.326  1.00 24.79 ? 288  LEU D CB  1 
ATOM   9606  C  CG  . LEU D  1 287 ? 13.175  90.430  -8.380  1.00 27.08 ? 288  LEU D CG  1 
ATOM   9607  C  CD1 . LEU D  1 287 ? 13.197  89.975  -6.939  1.00 22.42 ? 288  LEU D CD1 1 
ATOM   9608  C  CD2 . LEU D  1 287 ? 13.691  91.851  -8.499  1.00 25.38 ? 288  LEU D CD2 1 
ATOM   9609  N  N   . LYS D  1 288 ? 11.624  87.962  -10.848 1.00 28.15 ? 289  LYS D N   1 
ATOM   9610  C  CA  . LYS D  1 288 ? 10.199  87.774  -11.189 1.00 29.53 ? 289  LYS D CA  1 
ATOM   9611  C  C   . LYS D  1 288 ? 9.718   86.428  -10.675 1.00 30.95 ? 289  LYS D C   1 
ATOM   9612  O  O   . LYS D  1 288 ? 8.780   86.356  -9.870  1.00 34.92 ? 289  LYS D O   1 
ATOM   9613  C  CB  . LYS D  1 288 ? 9.980   87.897  -12.694 1.00 30.36 ? 289  LYS D CB  1 
ATOM   9614  C  CG  . LYS D  1 288 ? 8.517   87.752  -13.146 1.00 34.72 ? 289  LYS D CG  1 
ATOM   9615  C  CD  . LYS D  1 288 ? 8.389   87.855  -14.669 1.00 35.81 ? 289  LYS D CD  1 
ATOM   9616  C  CE  . LYS D  1 288 ? 8.683   86.523  -15.367 1.00 41.15 ? 289  LYS D CE  1 
ATOM   9617  N  NZ  . LYS D  1 288 ? 8.619   86.612  -16.872 1.00 39.81 ? 289  LYS D NZ  1 
ATOM   9618  N  N   . TRP D  1 289 ? 10.409  85.362  -11.070 1.00 31.25 ? 290  TRP D N   1 
ATOM   9619  C  CA  . TRP D  1 289 ? 10.078  84.017  -10.594 1.00 29.46 ? 290  TRP D CA  1 
ATOM   9620  C  C   . TRP D  1 289 ? 10.045  83.903  -9.083  1.00 28.56 ? 290  TRP D C   1 
ATOM   9621  O  O   . TRP D  1 289 ? 9.163   83.266  -8.540  1.00 31.62 ? 290  TRP D O   1 
ATOM   9622  C  CB  . TRP D  1 289 ? 11.021  82.959  -11.190 1.00 29.33 ? 290  TRP D CB  1 
ATOM   9623  C  CG  . TRP D  1 289 ? 10.891  82.830  -12.670 1.00 31.21 ? 290  TRP D CG  1 
ATOM   9624  C  CD1 . TRP D  1 289 ? 9.769   83.087  -13.419 1.00 31.60 ? 290  TRP D CD1 1 
ATOM   9625  C  CD2 . TRP D  1 289 ? 11.895  82.392  -13.595 1.00 28.67 ? 290  TRP D CD2 1 
ATOM   9626  N  NE1 . TRP D  1 289 ? 10.027  82.857  -14.746 1.00 33.59 ? 290  TRP D NE1 1 
ATOM   9627  C  CE2 . TRP D  1 289 ? 11.318  82.422  -14.882 1.00 30.67 ? 290  TRP D CE2 1 
ATOM   9628  C  CE3 . TRP D  1 289 ? 13.222  81.966  -13.462 1.00 30.61 ? 290  TRP D CE3 1 
ATOM   9629  C  CZ2 . TRP D  1 289 ? 12.025  82.061  -16.035 1.00 30.76 ? 290  TRP D CZ2 1 
ATOM   9630  C  CZ3 . TRP D  1 289 ? 13.923  81.600  -14.612 1.00 28.18 ? 290  TRP D CZ3 1 
ATOM   9631  C  CH2 . TRP D  1 289 ? 13.322  81.657  -15.882 1.00 27.52 ? 290  TRP D CH2 1 
ATOM   9632  N  N   . VAL D  1 290 ? 10.991  84.513  -8.390  1.00 29.60 ? 291  VAL D N   1 
ATOM   9633  C  CA  . VAL D  1 290 ? 10.910  84.538  -6.934  1.00 30.36 ? 291  VAL D CA  1 
ATOM   9634  C  C   . VAL D  1 290 ? 9.642   85.285  -6.466  1.00 32.50 ? 291  VAL D C   1 
ATOM   9635  O  O   . VAL D  1 290 ? 8.918   84.783  -5.614  1.00 32.55 ? 291  VAL D O   1 
ATOM   9636  C  CB  . VAL D  1 290 ? 12.172  85.172  -6.262  1.00 30.27 ? 291  VAL D CB  1 
ATOM   9637  C  CG1 . VAL D  1 290 ? 11.901  85.425  -4.796  1.00 27.43 ? 291  VAL D CG1 1 
ATOM   9638  C  CG2 . VAL D  1 290 ? 13.409  84.263  -6.399  1.00 28.58 ? 291  VAL D CG2 1 
ATOM   9639  N  N   . LEU D  1 291 ? 9.382   86.473  -7.013  1.00 34.01 ? 292  LEU D N   1 
ATOM   9640  C  CA  . LEU D  1 291 ? 8.204   87.272  -6.594  1.00 35.94 ? 292  LEU D CA  1 
ATOM   9641  C  C   . LEU D  1 291 ? 6.866   86.547  -6.869  1.00 38.16 ? 292  LEU D C   1 
ATOM   9642  O  O   . LEU D  1 291 ? 5.950   86.586  -6.037  1.00 39.11 ? 292  LEU D O   1 
ATOM   9643  C  CB  . LEU D  1 291 ? 8.199   88.640  -7.280  1.00 34.53 ? 292  LEU D CB  1 
ATOM   9644  C  CG  . LEU D  1 291 ? 9.246   89.652  -6.797  1.00 34.63 ? 292  LEU D CG  1 
ATOM   9645  C  CD1 . LEU D  1 291 ? 8.976   91.024  -7.405  1.00 35.14 ? 292  LEU D CD1 1 
ATOM   9646  C  CD2 . LEU D  1 291 ? 9.292   89.748  -5.263  1.00 34.09 ? 292  LEU D CD2 1 
ATOM   9647  N  N   . GLU D  1 292 ? 6.787   85.873  -8.024  1.00 37.78 ? 293  GLU D N   1 
ATOM   9648  C  CA  . GLU D  1 292 ? 5.622   85.060  -8.408  1.00 36.96 ? 293  GLU D CA  1 
ATOM   9649  C  C   . GLU D  1 292 ? 5.490   83.751  -7.641  1.00 37.66 ? 293  GLU D C   1 
ATOM   9650  O  O   . GLU D  1 292 ? 4.436   83.112  -7.699  1.00 40.09 ? 293  GLU D O   1 
ATOM   9651  C  CB  . GLU D  1 292 ? 5.671   84.726  -9.910  1.00 37.60 ? 293  GLU D CB  1 
ATOM   9652  C  CG  . GLU D  1 292 ? 5.497   85.935  -10.828 1.00 38.46 ? 293  GLU D CG  1 
ATOM   9653  C  CD  . GLU D  1 292 ? 5.690   85.612  -12.298 1.00 45.07 ? 293  GLU D CD  1 
ATOM   9654  O  OE1 . GLU D  1 292 ? 6.293   84.563  -12.628 1.00 48.65 ? 293  GLU D OE1 1 
ATOM   9655  O  OE2 . GLU D  1 292 ? 5.265   86.430  -13.134 1.00 46.17 ? 293  GLU D OE2 1 
ATOM   9656  N  N   . GLY D  1 293 ? 6.539   83.315  -6.947  1.00 36.67 ? 294  GLY D N   1 
ATOM   9657  C  CA  . GLY D  1 293 ? 6.487   82.034  -6.223  1.00 35.61 ? 294  GLY D CA  1 
ATOM   9658  C  C   . GLY D  1 293 ? 6.825   80.819  -7.086  1.00 34.99 ? 294  GLY D C   1 
ATOM   9659  O  O   . GLY D  1 293 ? 6.772   79.674  -6.607  1.00 34.36 ? 294  GLY D O   1 
ATOM   9660  N  N   . LYS D  1 294 ? 7.157   81.060  -8.353  1.00 34.07 ? 295  LYS D N   1 
ATOM   9661  C  CA  . LYS D  1 294 ? 7.666   80.003  -9.230  1.00 36.18 ? 295  LYS D CA  1 
ATOM   9662  C  C   . LYS D  1 294 ? 9.014   79.423  -8.741  1.00 34.30 ? 295  LYS D C   1 
ATOM   9663  O  O   . LYS D  1 294 ? 9.234   78.221  -8.850  1.00 36.09 ? 295  LYS D O   1 
ATOM   9664  C  CB  . LYS D  1 294 ? 7.777   80.501  -10.670 1.00 36.92 ? 295  LYS D CB  1 
ATOM   9665  C  CG  . LYS D  1 294 ? 6.419   80.789  -11.350 1.00 41.95 ? 295  LYS D CG  1 
ATOM   9666  C  CD  . LYS D  1 294 ? 6.530   80.713  -12.894 1.00 47.60 ? 295  LYS D CD  1 
ATOM   9667  C  CE  . LYS D  1 294 ? 5.186   80.884  -13.614 1.00 49.15 ? 295  LYS D CE  1 
ATOM   9668  N  NZ  . LYS D  1 294 ? 5.008   82.270  -14.096 1.00 50.41 ? 295  LYS D NZ  1 
ATOM   9669  N  N   . ILE D  1 295 ? 9.893   80.261  -8.181  1.00 32.47 ? 296  ILE D N   1 
ATOM   9670  C  CA  . ILE D  1 295 ? 11.071  79.774  -7.423  1.00 29.57 ? 296  ILE D CA  1 
ATOM   9671  C  C   . ILE D  1 295 ? 10.899  80.112  -5.961  1.00 30.94 ? 296  ILE D C   1 
ATOM   9672  O  O   . ILE D  1 295 ? 10.711  81.286  -5.598  1.00 30.54 ? 296  ILE D O   1 
ATOM   9673  C  CB  . ILE D  1 295 ? 12.385  80.429  -7.884  1.00 29.12 ? 296  ILE D CB  1 
ATOM   9674  C  CG1 . ILE D  1 295 ? 12.703  80.021  -9.309  1.00 28.18 ? 296  ILE D CG1 1 
ATOM   9675  C  CG2 . ILE D  1 295 ? 13.541  80.036  -6.942  1.00 25.70 ? 296  ILE D CG2 1 
ATOM   9676  C  CD1 . ILE D  1 295 ? 13.949  80.668  -9.899  1.00 27.72 ? 296  ILE D CD1 1 
ATOM   9677  N  N   . GLN D  1 296 ? 10.967  79.101  -5.111  1.00 30.39 ? 297  GLN D N   1 
ATOM   9678  C  CA  . GLN D  1 296 ? 10.976  79.355  -3.690  1.00 35.36 ? 297  GLN D CA  1 
ATOM   9679  C  C   . GLN D  1 296 ? 12.401  79.455  -3.158  1.00 34.51 ? 297  GLN D C   1 
ATOM   9680  O  O   . GLN D  1 296 ? 13.310  78.786  -3.634  1.00 35.65 ? 297  GLN D O   1 
ATOM   9681  C  CB  . GLN D  1 296 ? 10.190  78.275  -2.959  1.00 36.33 ? 297  GLN D CB  1 
ATOM   9682  C  CG  . GLN D  1 296 ? 8.800   78.110  -3.576  1.00 45.39 ? 297  GLN D CG  1 
ATOM   9683  C  CD  . GLN D  1 296 ? 7.832   77.430  -2.655  1.00 53.12 ? 297  GLN D CD  1 
ATOM   9684  O  OE1 . GLN D  1 296 ? 7.892   77.609  -1.434  1.00 59.40 ? 297  GLN D OE1 1 
ATOM   9685  N  NE2 . GLN D  1 296 ? 6.928   76.628  -3.229  1.00 52.12 ? 297  GLN D NE2 1 
ATOM   9686  N  N   . TYR D  1 297 ? 12.587  80.295  -2.155  1.00 36.05 ? 298  TYR D N   1 
ATOM   9687  C  CA  . TYR D  1 297 ? 13.884  80.417  -1.533  1.00 35.96 ? 298  TYR D CA  1 
ATOM   9688  C  C   . TYR D  1 297 ? 13.837  79.785  -0.178  1.00 35.11 ? 298  TYR D C   1 
ATOM   9689  O  O   . TYR D  1 297 ? 12.817  79.832  0.503   1.00 35.31 ? 298  TYR D O   1 
ATOM   9690  C  CB  . TYR D  1 297 ? 14.361  81.887  -1.460  1.00 36.03 ? 298  TYR D CB  1 
ATOM   9691  C  CG  . TYR D  1 297 ? 13.516  82.866  -0.663  1.00 37.82 ? 298  TYR D CG  1 
ATOM   9692  C  CD1 . TYR D  1 297 ? 13.762  83.095  0.686   1.00 39.66 ? 298  TYR D CD1 1 
ATOM   9693  C  CD2 . TYR D  1 297 ? 12.514  83.613  -1.280  1.00 43.50 ? 298  TYR D CD2 1 
ATOM   9694  C  CE1 . TYR D  1 297 ? 13.016  84.017  1.413   1.00 40.83 ? 298  TYR D CE1 1 
ATOM   9695  C  CE2 . TYR D  1 297 ? 11.752  84.542  -0.557  1.00 46.82 ? 298  TYR D CE2 1 
ATOM   9696  C  CZ  . TYR D  1 297 ? 12.011  84.734  0.791   1.00 45.22 ? 298  TYR D CZ  1 
ATOM   9697  O  OH  . TYR D  1 297 ? 11.264  85.644  1.505   1.00 51.81 ? 298  TYR D OH  1 
ATOM   9698  N  N   . LYS D  1 298 ? 14.936  79.125  0.166   1.00 35.27 ? 299  LYS D N   1 
ATOM   9699  C  CA  . LYS D  1 298 ? 15.259  78.815  1.548   1.00 36.46 ? 299  LYS D CA  1 
ATOM   9700  C  C   . LYS D  1 298 ? 16.733  79.162  1.790   1.00 34.77 ? 299  LYS D C   1 
ATOM   9701  O  O   . LYS D  1 298 ? 17.599  78.853  0.963   1.00 34.61 ? 299  LYS D O   1 
ATOM   9702  C  CB  . LYS D  1 298 ? 15.003  77.340  1.875   1.00 37.47 ? 299  LYS D CB  1 
ATOM   9703  C  CG  . LYS D  1 298 ? 14.824  77.082  3.372   1.00 41.08 ? 299  LYS D CG  1 
ATOM   9704  C  CD  . LYS D  1 298 ? 14.048  75.794  3.642   1.00 48.04 ? 299  LYS D CD  1 
ATOM   9705  C  CE  . LYS D  1 298 ? 14.003  75.439  5.128   1.00 50.06 ? 299  LYS D CE  1 
ATOM   9706  N  NZ  . LYS D  1 298 ? 13.207  76.429  5.877   1.00 52.89 ? 299  LYS D NZ  1 
ATOM   9707  N  N   . GLU D  1 299 ? 17.010  79.797  2.918   1.00 31.52 ? 300  GLU D N   1 
ATOM   9708  C  CA  . GLU D  1 299 ? 18.383  80.179  3.246   1.00 30.72 ? 300  GLU D CA  1 
ATOM   9709  C  C   . GLU D  1 299 ? 18.791  79.423  4.469   1.00 29.43 ? 300  GLU D C   1 
ATOM   9710  O  O   . GLU D  1 299 ? 17.939  79.087  5.297   1.00 28.43 ? 300  GLU D O   1 
ATOM   9711  C  CB  . GLU D  1 299 ? 18.491  81.685  3.498   1.00 30.15 ? 300  GLU D CB  1 
ATOM   9712  C  CG  . GLU D  1 299 ? 17.992  82.548  2.343   1.00 29.81 ? 300  GLU D CG  1 
ATOM   9713  C  CD  . GLU D  1 299 ? 18.173  84.045  2.600   1.00 32.25 ? 300  GLU D CD  1 
ATOM   9714  O  OE1 . GLU D  1 299 ? 17.384  84.626  3.392   1.00 30.10 ? 300  GLU D OE1 1 
ATOM   9715  O  OE2 . GLU D  1 299 ? 19.100  84.634  1.994   1.00 26.24 ? 300  GLU D OE2 1 
ATOM   9716  N  N   . TYR D  1 300 ? 20.083  79.117  4.567   1.00 26.88 ? 301  TYR D N   1 
ATOM   9717  C  CA  . TYR D  1 300 ? 20.645  78.490  5.759   1.00 25.51 ? 301  TYR D CA  1 
ATOM   9718  C  C   . TYR D  1 300 ? 21.535  79.556  6.395   1.00 27.61 ? 301  TYR D C   1 
ATOM   9719  O  O   . TYR D  1 300 ? 22.669  79.802  5.943   1.00 24.89 ? 301  TYR D O   1 
ATOM   9720  C  CB  . TYR D  1 300 ? 21.430  77.239  5.365   1.00 27.64 ? 301  TYR D CB  1 
ATOM   9721  C  CG  . TYR D  1 300 ? 21.993  76.409  6.515   1.00 24.31 ? 301  TYR D CG  1 
ATOM   9722  C  CD1 . TYR D  1 300 ? 21.189  75.513  7.211   1.00 27.59 ? 301  TYR D CD1 1 
ATOM   9723  C  CD2 . TYR D  1 300 ? 23.342  76.490  6.861   1.00 26.46 ? 301  TYR D CD2 1 
ATOM   9724  C  CE1 . TYR D  1 300 ? 21.701  74.743  8.254   1.00 28.81 ? 301  TYR D CE1 1 
ATOM   9725  C  CE2 . TYR D  1 300 ? 23.860  75.743  7.904   1.00 26.65 ? 301  TYR D CE2 1 
ATOM   9726  C  CZ  . TYR D  1 300 ? 23.029  74.875  8.594   1.00 31.11 ? 301  TYR D CZ  1 
ATOM   9727  O  OH  . TYR D  1 300 ? 23.529  74.114  9.603   1.00 33.99 ? 301  TYR D OH  1 
ATOM   9728  N  N   . ILE D  1 301 ? 21.002  80.201  7.432   1.00 28.67 ? 302  ILE D N   1 
ATOM   9729  C  CA  . ILE D  1 301 ? 21.586  81.414  7.958   1.00 29.32 ? 302  ILE D CA  1 
ATOM   9730  C  C   . ILE D  1 301 ? 22.337  81.142  9.234   1.00 29.32 ? 302  ILE D C   1 
ATOM   9731  O  O   . ILE D  1 301 ? 21.744  80.690  10.212  1.00 28.88 ? 302  ILE D O   1 
ATOM   9732  C  CB  . ILE D  1 301 ? 20.508  82.479  8.269   1.00 30.42 ? 302  ILE D CB  1 
ATOM   9733  C  CG1 . ILE D  1 301 ? 19.474  82.551  7.127   1.00 34.53 ? 302  ILE D CG1 1 
ATOM   9734  C  CG2 . ILE D  1 301 ? 21.178  83.820  8.552   1.00 29.25 ? 302  ILE D CG2 1 
ATOM   9735  C  CD1 . ILE D  1 301 ? 19.032  83.937  6.756   1.00 39.36 ? 302  ILE D CD1 1 
ATOM   9736  N  N   . ILE D  1 302 ? 23.637  81.429  9.229   1.00 28.96 ? 303  ILE D N   1 
ATOM   9737  C  CA  . ILE D  1 302 ? 24.438  81.317  10.432  1.00 28.26 ? 303  ILE D CA  1 
ATOM   9738  C  C   . ILE D  1 302 ? 24.690  82.715  10.957  1.00 29.30 ? 303  ILE D C   1 
ATOM   9739  O  O   . ILE D  1 302 ? 25.060  83.596  10.192  1.00 31.36 ? 303  ILE D O   1 
ATOM   9740  C  CB  . ILE D  1 302 ? 25.765  80.606  10.172  1.00 28.29 ? 303  ILE D CB  1 
ATOM   9741  C  CG1 . ILE D  1 302 ? 25.520  79.121  9.855   1.00 31.99 ? 303  ILE D CG1 1 
ATOM   9742  C  CG2 . ILE D  1 302 ? 26.699  80.713  11.398  1.00 26.56 ? 303  ILE D CG2 1 
ATOM   9743  C  CD1 . ILE D  1 302 ? 25.325  78.821  8.391   1.00 34.22 ? 303  ILE D CD1 1 
ATOM   9744  N  N   . GLU D  1 303 ? 24.504  82.908  12.260  1.00 28.23 ? 304  GLU D N   1 
ATOM   9745  C  CA  . GLU D  1 303 ? 24.593  84.235  12.891  1.00 29.03 ? 304  GLU D CA  1 
ATOM   9746  C  C   . GLU D  1 303 ? 25.953  84.490  13.484  1.00 27.30 ? 304  GLU D C   1 
ATOM   9747  O  O   . GLU D  1 303 ? 26.461  83.686  14.280  1.00 27.29 ? 304  GLU D O   1 
ATOM   9748  C  CB  . GLU D  1 303 ? 23.584  84.352  14.038  1.00 31.23 ? 304  GLU D CB  1 
ATOM   9749  C  CG  . GLU D  1 303 ? 22.140  84.138  13.615  1.00 37.63 ? 304  GLU D CG  1 
ATOM   9750  C  CD  . GLU D  1 303 ? 21.304  85.411  13.560  1.00 45.25 ? 304  GLU D CD  1 
ATOM   9751  O  OE1 . GLU D  1 303 ? 21.799  86.516  13.914  1.00 47.54 ? 304  GLU D OE1 1 
ATOM   9752  O  OE2 . GLU D  1 303 ? 20.122  85.276  13.164  1.00 48.78 ? 304  GLU D OE2 1 
ATOM   9753  N  N   . GLY D  1 304 ? 26.528  85.626  13.119  1.00 26.74 ? 305  GLY D N   1 
ATOM   9754  C  CA  . GLY D  1 304 ? 27.774  86.075  13.697  1.00 25.52 ? 305  GLY D CA  1 
ATOM   9755  C  C   . GLY D  1 304 ? 28.938  85.849  12.765  1.00 24.79 ? 305  GLY D C   1 
ATOM   9756  O  O   . GLY D  1 304 ? 29.241  84.730  12.381  1.00 26.56 ? 305  GLY D O   1 
ATOM   9757  N  N   . PHE D  1 305 ? 29.628  86.919  12.441  1.00 24.77 ? 306  PHE D N   1 
ATOM   9758  C  CA  . PHE D  1 305 ? 30.858  86.847  11.669  1.00 24.56 ? 306  PHE D CA  1 
ATOM   9759  C  C   . PHE D  1 305 ? 31.860  85.832  12.225  1.00 26.80 ? 306  PHE D C   1 
ATOM   9760  O  O   . PHE D  1 305 ? 32.624  85.241  11.467  1.00 24.88 ? 306  PHE D O   1 
ATOM   9761  C  CB  . PHE D  1 305 ? 31.489  88.217  11.646  1.00 22.32 ? 306  PHE D CB  1 
ATOM   9762  C  CG  . PHE D  1 305 ? 32.715  88.320  10.804  1.00 23.15 ? 306  PHE D CG  1 
ATOM   9763  C  CD1 . PHE D  1 305 ? 32.620  88.441  9.429   1.00 23.39 ? 306  PHE D CD1 1 
ATOM   9764  C  CD2 . PHE D  1 305 ? 33.977  88.332  11.389  1.00 19.17 ? 306  PHE D CD2 1 
ATOM   9765  C  CE1 . PHE D  1 305 ? 33.765  88.583  8.655   1.00 20.98 ? 306  PHE D CE1 1 
ATOM   9766  C  CE2 . PHE D  1 305 ? 35.109  88.467  10.626  1.00 20.00 ? 306  PHE D CE2 1 
ATOM   9767  C  CZ  . PHE D  1 305 ? 35.011  88.585  9.256   1.00 23.25 ? 306  PHE D CZ  1 
ATOM   9768  N  N   . GLU D  1 306 ? 31.848  85.632  13.538  1.00 27.96 ? 307  GLU D N   1 
ATOM   9769  C  CA  . GLU D  1 306 ? 32.827  84.760  14.212  1.00 28.90 ? 307  GLU D CA  1 
ATOM   9770  C  C   . GLU D  1 306 ? 32.582  83.289  13.880  1.00 27.90 ? 307  GLU D C   1 
ATOM   9771  O  O   . GLU D  1 306 ? 33.442  82.426  14.110  1.00 26.36 ? 307  GLU D O   1 
ATOM   9772  C  CB  . GLU D  1 306 ? 32.819  84.984  15.735  1.00 29.57 ? 307  GLU D CB  1 
ATOM   9773  C  CG  . GLU D  1 306 ? 31.430  85.033  16.418  1.00 39.98 ? 307  GLU D CG  1 
ATOM   9774  C  CD  . GLU D  1 306 ? 30.730  86.421  16.391  1.00 48.16 ? 307  GLU D CD  1 
ATOM   9775  O  OE1 . GLU D  1 306 ? 31.305  87.419  15.886  1.00 48.51 ? 307  GLU D OE1 1 
ATOM   9776  O  OE2 . GLU D  1 306 ? 29.581  86.504  16.883  1.00 55.30 ? 307  GLU D OE2 1 
ATOM   9777  N  N   . ASN D  1 307 ? 31.404  83.013  13.340  1.00 25.50 ? 308  ASN D N   1 
ATOM   9778  C  CA  . ASN D  1 307 ? 31.050  81.682  12.899  1.00 25.30 ? 308  ASN D CA  1 
ATOM   9779  C  C   . ASN D  1 307 ? 31.151  81.445  11.400  1.00 25.06 ? 308  ASN D C   1 
ATOM   9780  O  O   . ASN D  1 307 ? 30.696  80.405  10.918  1.00 23.43 ? 308  ASN D O   1 
ATOM   9781  C  CB  . ASN D  1 307 ? 29.639  81.364  13.341  1.00 26.23 ? 308  ASN D CB  1 
ATOM   9782  C  CG  . ASN D  1 307 ? 29.490  81.423  14.834  1.00 30.33 ? 308  ASN D CG  1 
ATOM   9783  O  OD1 . ASN D  1 307 ? 30.352  80.963  15.575  1.00 31.32 ? 308  ASN D OD1 1 
ATOM   9784  N  ND2 . ASN D  1 307 ? 28.400  82.016  15.287  1.00 32.85 ? 308  ASN D ND2 1 
ATOM   9785  N  N   . MET D  1 308 ? 31.765  82.384  10.675  1.00 22.26 ? 309  MET D N   1 
ATOM   9786  C  CA  . MET D  1 308 ? 31.860  82.273  9.231   1.00 22.35 ? 309  MET D CA  1 
ATOM   9787  C  C   . MET D  1 308 ? 32.602  80.998  8.789   1.00 20.22 ? 309  MET D C   1 
ATOM   9788  O  O   . MET D  1 308 ? 32.147  80.324  7.853   1.00 19.75 ? 309  MET D O   1 
ATOM   9789  C  CB  . MET D  1 308 ? 32.505  83.516  8.614   1.00 22.42 ? 309  MET D CB  1 
ATOM   9790  C  CG  . MET D  1 308 ? 32.396  83.541  7.090   1.00 25.20 ? 309  MET D CG  1 
ATOM   9791  S  SD  . MET D  1 308 ? 32.539  85.222  6.465   1.00 21.90 ? 309  MET D SD  1 
ATOM   9792  C  CE  . MET D  1 308 ? 32.291  84.971  4.695   1.00 20.67 ? 309  MET D CE  1 
ATOM   9793  N  N   . PRO D  1 309 ? 33.712  80.654  9.466   1.00 17.56 ? 310  PRO D N   1 
ATOM   9794  C  CA  . PRO D  1 309 ? 34.418  79.437  9.090   1.00 18.79 ? 310  PRO D CA  1 
ATOM   9795  C  C   . PRO D  1 309 ? 33.603  78.188  9.307   1.00 18.71 ? 310  PRO D C   1 
ATOM   9796  O  O   . PRO D  1 309 ? 33.572  77.299  8.425   1.00 20.14 ? 310  PRO D O   1 
ATOM   9797  C  CB  . PRO D  1 309 ? 35.681  79.461  9.970   1.00 20.22 ? 310  PRO D CB  1 
ATOM   9798  C  CG  . PRO D  1 309 ? 35.932  80.918  10.229  1.00 18.78 ? 310  PRO D CG  1 
ATOM   9799  C  CD  . PRO D  1 309 ? 34.535  81.495  10.364  1.00 21.83 ? 310  PRO D CD  1 
ATOM   9800  N  N   . ALA D  1 310 ? 32.908  78.123  10.426  1.00 19.82 ? 311  ALA D N   1 
ATOM   9801  C  CA  . ALA D  1 310 ? 31.986  77.024  10.659  1.00 21.03 ? 311  ALA D CA  1 
ATOM   9802  C  C   . ALA D  1 310 ? 30.880  76.977  9.590   1.00 21.38 ? 311  ALA D C   1 
ATOM   9803  O  O   . ALA D  1 310 ? 30.422  75.887  9.226   1.00 24.10 ? 311  ALA D O   1 
ATOM   9804  C  CB  . ALA D  1 310 ? 31.374  77.087  12.091  1.00 19.99 ? 311  ALA D CB  1 
ATOM   9805  N  N   . ALA D  1 311 ? 30.443  78.132  9.085   1.00 20.67 ? 312  ALA D N   1 
ATOM   9806  C  CA  . ALA D  1 311 ? 29.429  78.139  8.000   1.00 19.71 ? 312  ALA D CA  1 
ATOM   9807  C  C   . ALA D  1 311 ? 30.009  77.499  6.716   1.00 17.24 ? 312  ALA D C   1 
ATOM   9808  O  O   . ALA D  1 311 ? 29.349  76.755  6.014   1.00 19.49 ? 312  ALA D O   1 
ATOM   9809  C  CB  . ALA D  1 311 ? 28.909  79.597  7.714   1.00 16.14 ? 312  ALA D CB  1 
ATOM   9810  N  N   . PHE D  1 312 ? 31.260  77.791  6.442   1.00 18.30 ? 313  PHE D N   1 
ATOM   9811  C  CA  . PHE D  1 312 ? 31.960  77.284  5.246   1.00 17.66 ? 313  PHE D CA  1 
ATOM   9812  C  C   . PHE D  1 312 ? 32.159  75.785  5.391   1.00 18.15 ? 313  PHE D C   1 
ATOM   9813  O  O   . PHE D  1 312 ? 31.799  75.025  4.501   1.00 15.89 ? 313  PHE D O   1 
ATOM   9814  C  CB  . PHE D  1 312 ? 33.269  78.046  5.139   1.00 17.54 ? 313  PHE D CB  1 
ATOM   9815  C  CG  . PHE D  1 312 ? 34.212  77.557  4.110   1.00 19.22 ? 313  PHE D CG  1 
ATOM   9816  C  CD1 . PHE D  1 312 ? 33.862  77.524  2.784   1.00 19.56 ? 313  PHE D CD1 1 
ATOM   9817  C  CD2 . PHE D  1 312 ? 35.505  77.211  4.468   1.00 13.90 ? 313  PHE D CD2 1 
ATOM   9818  C  CE1 . PHE D  1 312 ? 34.773  77.125  1.833   1.00 18.91 ? 313  PHE D CE1 1 
ATOM   9819  C  CE2 . PHE D  1 312 ? 36.400  76.803  3.529   1.00 16.85 ? 313  PHE D CE2 1 
ATOM   9820  C  CZ  . PHE D  1 312 ? 36.045  76.751  2.218   1.00 19.79 ? 313  PHE D CZ  1 
ATOM   9821  N  N   . MET D  1 313 ? 32.675  75.371  6.541   1.00 17.83 ? 314  MET D N   1 
ATOM   9822  C  CA  . MET D  1 313 ? 32.919  73.962  6.796   1.00 18.22 ? 314  MET D CA  1 
ATOM   9823  C  C   . MET D  1 313 ? 31.627  73.169  6.840   1.00 18.57 ? 314  MET D C   1 
ATOM   9824  O  O   . MET D  1 313 ? 31.573  72.078  6.291   1.00 15.16 ? 314  MET D O   1 
ATOM   9825  C  CB  . MET D  1 313 ? 33.727  73.769  8.077   1.00 17.78 ? 314  MET D CB  1 
ATOM   9826  C  CG  . MET D  1 313 ? 35.206  74.137  7.895   1.00 18.38 ? 314  MET D CG  1 
ATOM   9827  S  SD  . MET D  1 313 ? 36.173  74.015  9.406   1.00 20.46 ? 314  MET D SD  1 
ATOM   9828  C  CE  . MET D  1 313 ? 35.737  75.576  10.224  1.00 19.83 ? 314  MET D CE  1 
ATOM   9829  N  N   . GLY D  1 314 ? 30.581  73.726  7.466   1.00 19.18 ? 315  GLY D N   1 
ATOM   9830  C  CA  . GLY D  1 314 ? 29.265  73.089  7.475   1.00 19.22 ? 315  GLY D CA  1 
ATOM   9831  C  C   . GLY D  1 314 ? 28.715  72.873  6.076   1.00 18.88 ? 315  GLY D C   1 
ATOM   9832  O  O   . GLY D  1 314 ? 28.165  71.814  5.767   1.00 21.74 ? 315  GLY D O   1 
ATOM   9833  N  N   . MET D  1 315 ? 28.856  73.877  5.218   1.00 18.25 ? 316  MET D N   1 
ATOM   9834  C  CA  A MET D  1 315 ? 28.327  73.796  3.854   0.50 18.89 ? 316  MET D CA  1 
ATOM   9835  C  CA  B MET D  1 315 ? 28.320  73.782  3.861   0.50 19.25 ? 316  MET D CA  1 
ATOM   9836  C  C   . MET D  1 315 ? 29.029  72.680  3.088   1.00 18.32 ? 316  MET D C   1 
ATOM   9837  O  O   . MET D  1 315 ? 28.389  71.932  2.335   1.00 18.45 ? 316  MET D O   1 
ATOM   9838  C  CB  A MET D  1 315 ? 28.490  75.141  3.127   0.50 17.92 ? 316  MET D CB  1 
ATOM   9839  C  CB  B MET D  1 315 ? 28.469  75.109  3.123   0.50 18.60 ? 316  MET D CB  1 
ATOM   9840  C  CG  A MET D  1 315 ? 28.171  75.126  1.633   0.50 16.42 ? 316  MET D CG  1 
ATOM   9841  C  CG  B MET D  1 315 ? 28.041  75.074  1.667   0.50 18.94 ? 316  MET D CG  1 
ATOM   9842  S  SD  A MET D  1 315 ? 29.587  74.680  0.617   0.50 14.68 ? 316  MET D SD  1 
ATOM   9843  S  SD  B MET D  1 315 ? 28.758  76.459  0.808   0.50 19.90 ? 316  MET D SD  1 
ATOM   9844  C  CE  A MET D  1 315 ? 30.740  75.991  1.023   0.50 2.03  ? 316  MET D CE  1 
ATOM   9845  C  CE  B MET D  1 315 ? 30.507  76.174  1.136   0.50 10.57 ? 316  MET D CE  1 
ATOM   9846  N  N   . LEU D  1 316 ? 30.346  72.579  3.292   1.00 17.80 ? 317  LEU D N   1 
ATOM   9847  C  CA  . LEU D  1 316 ? 31.159  71.601  2.590   1.00 17.93 ? 317  LEU D CA  1 
ATOM   9848  C  C   . LEU D  1 316 ? 30.792  70.196  3.040   1.00 17.77 ? 317  LEU D C   1 
ATOM   9849  O  O   . LEU D  1 316 ? 30.903  69.255  2.267   1.00 19.49 ? 317  LEU D O   1 
ATOM   9850  C  CB  . LEU D  1 316 ? 32.660  71.859  2.796   1.00 17.09 ? 317  LEU D CB  1 
ATOM   9851  C  CG  . LEU D  1 316 ? 33.272  73.123  2.176   1.00 16.83 ? 317  LEU D CG  1 
ATOM   9852  C  CD1 . LEU D  1 316 ? 34.733  73.251  2.663   1.00 12.72 ? 317  LEU D CD1 1 
ATOM   9853  C  CD2 . LEU D  1 316 ? 33.199  73.115  0.630   1.00 12.74 ? 317  LEU D CD2 1 
ATOM   9854  N  N   . LYS D  1 317 ? 30.331  70.077  4.278   1.00 18.07 ? 318  LYS D N   1 
ATOM   9855  C  CA  . LYS D  1 317 ? 29.900  68.812  4.863   1.00 20.42 ? 318  LYS D CA  1 
ATOM   9856  C  C   . LYS D  1 317 ? 28.414  68.522  4.663   1.00 21.33 ? 318  LYS D C   1 
ATOM   9857  O  O   . LYS D  1 317 ? 27.915  67.513  5.118   1.00 22.36 ? 318  LYS D O   1 
ATOM   9858  C  CB  . LYS D  1 317 ? 30.217  68.792  6.354   1.00 20.12 ? 318  LYS D CB  1 
ATOM   9859  C  CG  . LYS D  1 317 ? 31.676  68.581  6.642   1.00 24.05 ? 318  LYS D CG  1 
ATOM   9860  C  CD  . LYS D  1 317 ? 32.025  67.131  6.328   1.00 29.40 ? 318  LYS D CD  1 
ATOM   9861  C  CE  . LYS D  1 317 ? 33.282  66.639  6.986   1.00 26.13 ? 318  LYS D CE  1 
ATOM   9862  N  NZ  . LYS D  1 317 ? 33.394  65.141  6.785   1.00 21.75 ? 318  LYS D NZ  1 
ATOM   9863  N  N   . GLY D  1 318 ? 27.698  69.397  3.978   1.00 22.22 ? 319  GLY D N   1 
ATOM   9864  C  CA  . GLY D  1 318 ? 26.300  69.136  3.673   1.00 20.24 ? 319  GLY D CA  1 
ATOM   9865  C  C   . GLY D  1 318 ? 25.301  69.535  4.734   1.00 20.91 ? 319  GLY D C   1 
ATOM   9866  O  O   . GLY D  1 318 ? 24.171  69.043  4.715   1.00 22.54 ? 319  GLY D O   1 
ATOM   9867  N  N   . ASP D  1 319 ? 25.678  70.416  5.661   1.00 20.66 ? 320  ASP D N   1 
ATOM   9868  C  CA  . ASP D  1 319 ? 24.732  70.860  6.703   1.00 23.21 ? 320  ASP D CA  1 
ATOM   9869  C  C   . ASP D  1 319 ? 23.619  71.734  6.156   1.00 24.39 ? 320  ASP D C   1 
ATOM   9870  O  O   . ASP D  1 319 ? 22.557  71.825  6.764   1.00 27.56 ? 320  ASP D O   1 
ATOM   9871  C  CB  . ASP D  1 319 ? 25.444  71.657  7.803   1.00 24.84 ? 320  ASP D CB  1 
ATOM   9872  C  CG  . ASP D  1 319 ? 26.336  70.802  8.669   1.00 27.07 ? 320  ASP D CG  1 
ATOM   9873  O  OD1 . ASP D  1 319 ? 26.370  69.566  8.469   1.00 33.07 ? 320  ASP D OD1 1 
ATOM   9874  O  OD2 . ASP D  1 319 ? 27.000  71.378  9.559   1.00 34.92 ? 320  ASP D OD2 1 
ATOM   9875  N  N   . ASN D  1 320 ? 23.855  72.376  5.016   1.00 25.01 ? 321  ASN D N   1 
ATOM   9876  C  CA  . ASN D  1 320 ? 22.996  73.457  4.559   1.00 23.99 ? 321  ASN D CA  1 
ATOM   9877  C  C   . ASN D  1 320 ? 21.862  72.977  3.712   1.00 24.81 ? 321  ASN D C   1 
ATOM   9878  O  O   . ASN D  1 320 ? 22.063  72.122  2.851   1.00 26.01 ? 321  ASN D O   1 
ATOM   9879  C  CB  . ASN D  1 320 ? 23.788  74.488  3.748   1.00 21.99 ? 321  ASN D CB  1 
ATOM   9880  C  CG  . ASN D  1 320 ? 24.395  73.915  2.498   1.00 20.17 ? 321  ASN D CG  1 
ATOM   9881  O  OD1 . ASN D  1 320 ? 25.274  73.062  2.559   1.00 20.52 ? 321  ASN D OD1 1 
ATOM   9882  N  ND2 . ASN D  1 320 ? 23.936  74.385  1.347   1.00 19.20 ? 321  ASN D ND2 1 
ATOM   9883  N  N   . LEU D  1 321 ? 20.690  73.571  3.934   1.00 25.03 ? 322  LEU D N   1 
ATOM   9884  C  CA  . LEU D  1 321 ? 19.533  73.413  3.067   1.00 26.58 ? 322  LEU D CA  1 
ATOM   9885  C  C   . LEU D  1 321 ? 19.288  74.775  2.487   1.00 25.51 ? 322  LEU D C   1 
ATOM   9886  O  O   . LEU D  1 321 ? 18.959  75.711  3.199   1.00 28.00 ? 322  LEU D O   1 
ATOM   9887  C  CB  . LEU D  1 321 ? 18.312  72.936  3.854   1.00 28.97 ? 322  LEU D CB  1 
ATOM   9888  C  CG  . LEU D  1 321 ? 16.996  72.632  3.103   1.00 33.71 ? 322  LEU D CG  1 
ATOM   9889  C  CD1 . LEU D  1 321 ? 17.210  72.118  1.701   1.00 39.01 ? 322  LEU D CD1 1 
ATOM   9890  C  CD2 . LEU D  1 321 ? 16.167  71.605  3.879   1.00 36.13 ? 322  LEU D CD2 1 
ATOM   9891  N  N   . GLY D  1 322 ? 19.480  74.898  1.189   1.00 24.40 ? 323  GLY D N   1 
ATOM   9892  C  CA  . GLY D  1 322 ? 19.460  76.187  0.539   1.00 24.56 ? 323  GLY D CA  1 
ATOM   9893  C  C   . GLY D  1 322 ? 20.791  76.899  0.734   1.00 21.91 ? 323  GLY D C   1 
ATOM   9894  O  O   . GLY D  1 322 ? 21.732  76.316  1.235   1.00 20.30 ? 323  GLY D O   1 
ATOM   9895  N  N   . LYS D  1 323 ? 20.832  78.173  0.365   1.00 21.43 ? 324  LYS D N   1 
ATOM   9896  C  CA  . LYS D  1 323 ? 22.070  78.932  0.263   1.00 21.93 ? 324  LYS D CA  1 
ATOM   9897  C  C   . LYS D  1 323 ? 22.622  79.241  1.646   1.00 21.50 ? 324  LYS D C   1 
ATOM   9898  O  O   . LYS D  1 323 ? 21.921  79.812  2.456   1.00 20.96 ? 324  LYS D O   1 
ATOM   9899  C  CB  . LYS D  1 323 ? 21.815  80.247  -0.506  1.00 23.33 ? 324  LYS D CB  1 
ATOM   9900  C  CG  . LYS D  1 323 ? 23.027  81.235  -0.569  1.00 19.73 ? 324  LYS D CG  1 
ATOM   9901  C  CD  . LYS D  1 323 ? 24.071  80.752  -1.569  1.00 21.50 ? 324  LYS D CD  1 
ATOM   9902  C  CE  . LYS D  1 323 ? 25.437  81.460  -1.448  1.00 20.56 ? 324  LYS D CE  1 
ATOM   9903  N  NZ  . LYS D  1 323 ? 26.241  80.937  -0.287  1.00 13.34 ? 324  LYS D NZ  1 
ATOM   9904  N  N   . THR D  1 324 ? 23.885  78.893  1.893   1.00 21.93 ? 325  THR D N   1 
ATOM   9905  C  CA  . THR D  1 324 ? 24.558  79.198  3.159   1.00 18.84 ? 325  THR D CA  1 
ATOM   9906  C  C   . THR D  1 324 ? 24.889  80.689  3.199   1.00 20.86 ? 325  THR D C   1 
ATOM   9907  O  O   . THR D  1 324 ? 25.536  81.212  2.306   1.00 22.05 ? 325  THR D O   1 
ATOM   9908  C  CB  . THR D  1 324 ? 25.842  78.351  3.327   1.00 20.04 ? 325  THR D CB  1 
ATOM   9909  O  OG1 . THR D  1 324 ? 25.559  76.986  2.998   1.00 18.57 ? 325  THR D OG1 1 
ATOM   9910  C  CG2 . THR D  1 324 ? 26.395  78.404  4.758   1.00 16.37 ? 325  THR D CG2 1 
ATOM   9911  N  N   . ILE D  1 325 ? 24.435  81.365  4.252   1.00 22.27 ? 326  ILE D N   1 
ATOM   9912  C  CA  . ILE D  1 325 ? 24.564  82.805  4.393   1.00 21.39 ? 326  ILE D CA  1 
ATOM   9913  C  C   . ILE D  1 325 ? 24.990  83.110  5.815   1.00 21.58 ? 326  ILE D C   1 
ATOM   9914  O  O   . ILE D  1 325 ? 24.480  82.490  6.754   1.00 22.00 ? 326  ILE D O   1 
ATOM   9915  C  CB  . ILE D  1 325 ? 23.201  83.464  4.122   1.00 22.08 ? 326  ILE D CB  1 
ATOM   9916  C  CG1 . ILE D  1 325 ? 22.834  83.300  2.653   1.00 21.77 ? 326  ILE D CG1 1 
ATOM   9917  C  CG2 . ILE D  1 325 ? 23.198  84.947  4.556   1.00 24.22 ? 326  ILE D CG2 1 
ATOM   9918  C  CD1 . ILE D  1 325 ? 23.761  84.029  1.664   1.00 13.70 ? 326  ILE D CD1 1 
ATOM   9919  N  N   . VAL D  1 326 ? 25.966  84.004  5.975   1.00 22.07 ? 327  VAL D N   1 
ATOM   9920  C  CA  . VAL D  1 326 ? 26.367  84.479  7.302   1.00 21.96 ? 327  VAL D CA  1 
ATOM   9921  C  C   . VAL D  1 326 ? 25.813  85.883  7.523   1.00 24.71 ? 327  VAL D C   1 
ATOM   9922  O  O   . VAL D  1 326 ? 26.114  86.811  6.755   1.00 22.34 ? 327  VAL D O   1 
ATOM   9923  C  CB  . VAL D  1 326 ? 27.900  84.538  7.487   1.00 24.34 ? 327  VAL D CB  1 
ATOM   9924  C  CG1 . VAL D  1 326 ? 28.251  85.135  8.857   1.00 23.53 ? 327  VAL D CG1 1 
ATOM   9925  C  CG2 . VAL D  1 326 ? 28.513  83.142  7.362   1.00 22.35 ? 327  VAL D CG2 1 
ATOM   9926  N  N   . LYS D  1 327 ? 24.998  86.026  8.566   1.00 25.40 ? 328  LYS D N   1 
ATOM   9927  C  CA  . LYS D  1 327 ? 24.465  87.331  8.968   1.00 28.08 ? 328  LYS D CA  1 
ATOM   9928  C  C   . LYS D  1 327 ? 25.384  87.976  10.004  1.00 27.74 ? 328  LYS D C   1 
ATOM   9929  O  O   . LYS D  1 327 ? 25.545  87.448  11.106  1.00 27.66 ? 328  LYS D O   1 
ATOM   9930  C  CB  . LYS D  1 327 ? 23.067  87.191  9.562   1.00 28.99 ? 328  LYS D CB  1 
ATOM   9931  C  CG  . LYS D  1 327 ? 22.462  88.526  9.954   1.00 34.52 ? 328  LYS D CG  1 
ATOM   9932  C  CD  . LYS D  1 327 ? 21.055  88.371  10.495  1.00 39.45 ? 328  LYS D CD  1 
ATOM   9933  C  CE  . LYS D  1 327 ? 20.559  89.717  11.010  1.00 44.47 ? 328  LYS D CE  1 
ATOM   9934  N  NZ  . LYS D  1 327 ? 19.286  89.569  11.754  1.00 51.22 ? 328  LYS D NZ  1 
ATOM   9935  N  N   . ALA D  1 328 ? 25.984  89.104  9.641   1.00 27.10 ? 329  ALA D N   1 
ATOM   9936  C  CA  . ALA D  1 328 ? 26.781  89.877  10.584  1.00 30.18 ? 329  ALA D CA  1 
ATOM   9937  C  C   . ALA D  1 328 ? 25.864  90.562  11.582  1.00 30.86 ? 329  ALA D C   1 
ATOM   9938  O  O   . ALA D  1 328 ? 26.236  90.672  12.740  1.00 34.93 ? 329  ALA D O   1 
ATOM   9939  C  CB  . ALA D  1 328 ? 27.623  90.907  9.859   1.00 29.36 ? 329  ALA D CB  1 
HETATM 9940  P  PA  . NAP E  2 .   ? 53.372  59.928  15.417  1.00 17.94 ? 701  NAP A PA  1 
HETATM 9941  O  O1A . NAP E  2 .   ? 53.775  60.692  16.747  1.00 12.15 ? 701  NAP A O1A 1 
HETATM 9942  O  O2A . NAP E  2 .   ? 54.521  59.417  14.610  1.00 16.03 ? 701  NAP A O2A 1 
HETATM 9943  O  O5B . NAP E  2 .   ? 52.422  60.908  14.614  1.00 18.99 ? 701  NAP A O5B 1 
HETATM 9944  C  C5B . NAP E  2 .   ? 52.023  60.603  13.278  1.00 17.10 ? 701  NAP A C5B 1 
HETATM 9945  C  C4B . NAP E  2 .   ? 53.051  61.081  12.270  1.00 16.67 ? 701  NAP A C4B 1 
HETATM 9946  O  O4B . NAP E  2 .   ? 52.728  60.414  11.089  1.00 14.65 ? 701  NAP A O4B 1 
HETATM 9947  C  C3B . NAP E  2 .   ? 52.840  62.537  11.889  1.00 18.40 ? 701  NAP A C3B 1 
HETATM 9948  O  O3B . NAP E  2 .   ? 53.538  63.392  12.791  1.00 18.26 ? 701  NAP A O3B 1 
HETATM 9949  C  C2B . NAP E  2 .   ? 53.474  62.576  10.504  1.00 19.20 ? 701  NAP A C2B 1 
HETATM 9950  O  O2B . NAP E  2 .   ? 54.855  62.918  10.632  1.00 19.69 ? 701  NAP A O2B 1 
HETATM 9951  C  C1B . NAP E  2 .   ? 53.347  61.130  10.019  1.00 15.48 ? 701  NAP A C1B 1 
HETATM 9952  N  N9A . NAP E  2 .   ? 52.461  61.045  8.855   1.00 19.52 ? 701  NAP A N9A 1 
HETATM 9953  C  C8A . NAP E  2 .   ? 51.136  61.292  8.804   1.00 16.23 ? 701  NAP A C8A 1 
HETATM 9954  N  N7A . NAP E  2 .   ? 50.685  61.109  7.563   1.00 13.94 ? 701  NAP A N7A 1 
HETATM 9955  C  C5A . NAP E  2 .   ? 51.746  60.721  6.820   1.00 17.37 ? 701  NAP A C5A 1 
HETATM 9956  C  C6A . NAP E  2 .   ? 51.920  60.374  5.482   1.00 18.24 ? 701  NAP A C6A 1 
HETATM 9957  N  N6A . NAP E  2 .   ? 50.896  60.407  4.637   1.00 17.67 ? 701  NAP A N6A 1 
HETATM 9958  N  N1A . NAP E  2 .   ? 53.152  60.038  5.044   1.00 15.15 ? 701  NAP A N1A 1 
HETATM 9959  C  C2A . NAP E  2 .   ? 54.180  60.011  5.895   1.00 12.43 ? 701  NAP A C2A 1 
HETATM 9960  N  N3A . NAP E  2 .   ? 54.060  60.318  7.179   1.00 12.41 ? 701  NAP A N3A 1 
HETATM 9961  C  C4A . NAP E  2 .   ? 52.862  60.683  7.644   1.00 11.82 ? 701  NAP A C4A 1 
HETATM 9962  O  O3  . NAP E  2 .   ? 52.417  58.757  15.930  1.00 16.37 ? 701  NAP A O3  1 
HETATM 9963  P  PN  . NAP E  2 .   ? 52.865  57.406  16.564  1.00 20.33 ? 701  NAP A PN  1 
HETATM 9964  O  O1N . NAP E  2 .   ? 51.890  57.136  17.642  1.00 19.08 ? 701  NAP A O1N 1 
HETATM 9965  O  O2N . NAP E  2 .   ? 54.300  57.466  16.870  1.00 19.33 ? 701  NAP A O2N 1 
HETATM 9966  O  O5D . NAP E  2 .   ? 52.512  56.297  15.488  1.00 19.60 ? 701  NAP A O5D 1 
HETATM 9967  C  C5D . NAP E  2 .   ? 53.337  56.115  14.360  1.00 17.68 ? 701  NAP A C5D 1 
HETATM 9968  C  C4D . NAP E  2 .   ? 52.860  54.915  13.550  1.00 19.86 ? 701  NAP A C4D 1 
HETATM 9969  O  O4D . NAP E  2 .   ? 52.934  53.765  14.413  1.00 21.98 ? 701  NAP A O4D 1 
HETATM 9970  C  C3D . NAP E  2 .   ? 51.408  54.962  13.036  1.00 16.84 ? 701  NAP A C3D 1 
HETATM 9971  O  O3D . NAP E  2 .   ? 51.413  54.256  11.802  1.00 16.05 ? 701  NAP A O3D 1 
HETATM 9972  C  C2D . NAP E  2 .   ? 50.698  54.181  14.104  1.00 16.81 ? 701  NAP A C2D 1 
HETATM 9973  O  O2D . NAP E  2 .   ? 49.479  53.632  13.633  1.00 15.04 ? 701  NAP A O2D 1 
HETATM 9974  C  C1D . NAP E  2 .   ? 51.708  53.092  14.322  1.00 9.72  ? 701  NAP A C1D 1 
HETATM 9975  N  N1N . NAP E  2 .   ? 51.574  52.409  15.615  1.00 17.14 ? 701  NAP A N1N 1 
HETATM 9976  C  C2N . NAP E  2 .   ? 51.422  51.038  15.585  1.00 16.60 ? 701  NAP A C2N 1 
HETATM 9977  C  C3N . NAP E  2 .   ? 51.257  50.329  16.748  1.00 18.41 ? 701  NAP A C3N 1 
HETATM 9978  C  C7N . NAP E  2 .   ? 51.142  48.818  16.648  1.00 22.50 ? 701  NAP A C7N 1 
HETATM 9979  O  O7N . NAP E  2 .   ? 51.291  48.178  15.591  1.00 22.17 ? 701  NAP A O7N 1 
HETATM 9980  N  N7N . NAP E  2 .   ? 50.960  48.258  17.796  1.00 11.89 ? 701  NAP A N7N 1 
HETATM 9981  C  C4N . NAP E  2 .   ? 51.226  50.995  17.967  1.00 24.79 ? 701  NAP A C4N 1 
HETATM 9982  C  C5N . NAP E  2 .   ? 51.363  52.377  18.001  1.00 24.25 ? 701  NAP A C5N 1 
HETATM 9983  C  C6N . NAP E  2 .   ? 51.526  53.088  16.828  1.00 20.60 ? 701  NAP A C6N 1 
HETATM 9984  P  P2B . NAP E  2 .   ? 55.755  63.443  9.368   1.00 21.67 ? 701  NAP A P2B 1 
HETATM 9985  O  O1X . NAP E  2 .   ? 54.880  63.425  8.065   1.00 20.03 ? 701  NAP A O1X 1 
HETATM 9986  O  O2X . NAP E  2 .   ? 55.955  64.997  9.547   1.00 21.25 ? 701  NAP A O2X 1 
HETATM 9987  O  O3X . NAP E  2 .   ? 57.066  62.776  9.424   1.00 18.57 ? 701  NAP A O3X 1 
HETATM 9988  C  C1  . RAL F  3 .   ? 46.804  49.305  16.472  1.00 22.48 ? 801  RAL A C1  1 
HETATM 9989  C  C2  . RAL F  3 .   ? 47.828  50.243  16.439  1.00 25.57 ? 801  RAL A C2  1 
HETATM 9990  C  C3  . RAL F  3 .   ? 47.912  51.139  15.389  1.00 19.91 ? 801  RAL A C3  1 
HETATM 9991  O  O3  . RAL F  3 .   ? 48.887  52.076  15.384  1.00 19.88 ? 801  RAL A O3  1 
HETATM 9992  C  C4  . RAL F  3 .   ? 46.998  51.106  14.358  1.00 13.81 ? 801  RAL A C4  1 
HETATM 9993  C  C5  . RAL F  3 .   ? 45.989  50.169  14.405  1.00 21.21 ? 801  RAL A C5  1 
HETATM 9994  S  S6  . RAL F  3 .   ? 44.778  49.877  13.348  1.00 22.12 ? 801  RAL A S6  1 
HETATM 9995  C  C7  . RAL F  3 .   ? 44.060  48.609  14.175  1.00 25.52 ? 801  RAL A C7  1 
HETATM 9996  C  C8  . RAL F  3 .   ? 42.850  48.060  13.785  1.00 24.69 ? 801  RAL A C8  1 
HETATM 9997  C  C9  . RAL F  3 .   ? 41.833  48.457  14.661  1.00 32.23 ? 801  RAL A C9  1 
HETATM 9998  C  C10 . RAL F  3 .   ? 40.502  48.107  14.471  1.00 34.01 ? 801  RAL A C10 1 
HETATM 9999  C  C11 . RAL F  3 .   ? 40.167  47.387  13.340  1.00 26.26 ? 801  RAL A C11 1 
HETATM 10000 O  O11 . RAL F  3 .   ? 38.870  47.036  13.119  1.00 28.87 ? 801  RAL A O11 1 
HETATM 10001 C  C12 . RAL F  3 .   ? 41.164  47.041  12.443  1.00 23.60 ? 801  RAL A C12 1 
HETATM 10002 C  C13 . RAL F  3 .   ? 42.506  47.385  12.648  1.00 25.01 ? 801  RAL A C13 1 
HETATM 10003 C  C14 . RAL F  3 .   ? 45.869  49.257  15.463  1.00 17.29 ? 801  RAL A C14 1 
HETATM 10004 C  C15 . RAL F  3 .   ? 44.769  48.411  15.336  1.00 18.51 ? 801  RAL A C15 1 
HETATM 10005 C  C16 . RAL F  3 .   ? 44.421  47.341  16.375  1.00 14.30 ? 801  RAL A C16 1 
HETATM 10006 O  O16 . RAL F  3 .   ? 44.373  46.164  16.031  1.00 24.79 ? 801  RAL A O16 1 
HETATM 10007 C  C17 . RAL F  3 .   ? 44.243  47.739  17.853  1.00 19.23 ? 801  RAL A C17 1 
HETATM 10008 C  C18 . RAL F  3 .   ? 44.181  49.077  18.294  1.00 25.28 ? 801  RAL A C18 1 
HETATM 10009 C  C19 . RAL F  3 .   ? 44.059  49.366  19.673  1.00 26.46 ? 801  RAL A C19 1 
HETATM 10010 C  C20 . RAL F  3 .   ? 43.993  48.331  20.618  1.00 31.10 ? 801  RAL A C20 1 
HETATM 10011 C  C21 . RAL F  3 .   ? 44.063  47.016  20.158  1.00 28.99 ? 801  RAL A C21 1 
HETATM 10012 C  C22 . RAL F  3 .   ? 44.184  46.723  18.804  1.00 24.17 ? 801  RAL A C22 1 
HETATM 10013 O  O23 . RAL F  3 .   ? 43.871  48.517  21.980  1.00 33.98 ? 801  RAL A O23 1 
HETATM 10014 C  C24 . RAL F  3 .   ? 43.146  49.724  22.360  1.00 48.58 ? 801  RAL A C24 1 
HETATM 10015 C  C25 . RAL F  3 .   ? 42.322  49.652  23.658  1.00 44.08 ? 801  RAL A C25 1 
HETATM 10016 N  N26 . RAL F  3 .   ? 43.139  49.667  24.877  1.00 46.07 ? 801  RAL A N26 1 
HETATM 10017 C  C27 . RAL F  3 .   ? 44.090  48.523  24.887  1.00 54.12 ? 801  RAL A C27 1 
HETATM 10018 C  C28 . RAL F  3 .   ? 44.712  48.214  26.284  1.00 57.07 ? 801  RAL A C28 1 
HETATM 10019 C  C29 . RAL F  3 .   ? 44.208  49.117  27.413  1.00 52.00 ? 801  RAL A C29 1 
HETATM 10020 C  C30 . RAL F  3 .   ? 42.689  49.197  27.376  1.00 49.89 ? 801  RAL A C30 1 
HETATM 10021 C  C31 . RAL F  3 .   ? 42.148  49.613  25.986  1.00 51.42 ? 801  RAL A C31 1 
HETATM 10022 C  C1  . RAL G  3 .   ? 41.236  45.277  23.230  1.00 30.47 ? 802  RAL A C1  1 
HETATM 10023 C  C2  . RAL G  3 .   ? 40.682  45.953  24.316  1.00 32.61 ? 802  RAL A C2  1 
HETATM 10024 C  C3  . RAL G  3 .   ? 41.375  45.988  25.515  1.00 33.83 ? 802  RAL A C3  1 
HETATM 10025 O  O3  . RAL G  3 .   ? 40.794  46.664  26.546  1.00 34.87 ? 802  RAL A O3  1 
HETATM 10026 C  C4  . RAL G  3 .   ? 42.620  45.330  25.635  1.00 27.07 ? 802  RAL A C4  1 
HETATM 10027 C  C5  . RAL G  3 .   ? 43.167  44.650  24.533  1.00 23.20 ? 802  RAL A C5  1 
HETATM 10028 S  S6  . RAL G  3 .   ? 44.606  43.755  24.314  1.00 25.78 ? 802  RAL A S6  1 
HETATM 10029 C  C7  . RAL G  3 .   ? 44.329  43.333  22.675  1.00 21.05 ? 802  RAL A C7  1 
HETATM 10030 C  C8  . RAL G  3 .   ? 45.270  42.602  21.950  1.00 22.55 ? 802  RAL A C8  1 
HETATM 10031 C  C9  . RAL G  3 .   ? 45.545  42.874  20.602  1.00 18.84 ? 802  RAL A C9  1 
HETATM 10032 C  C10 . RAL G  3 .   ? 46.555  42.144  19.937  1.00 17.25 ? 802  RAL A C10 1 
HETATM 10033 C  C11 . RAL G  3 .   ? 47.298  41.172  20.620  1.00 18.47 ? 802  RAL A C11 1 
HETATM 10034 O  O11 . RAL G  3 .   ? 48.253  40.448  19.988  1.00 20.32 ? 802  RAL A O11 1 
HETATM 10035 C  C12 . RAL G  3 .   ? 47.043  40.929  21.968  1.00 18.90 ? 802  RAL A C12 1 
HETATM 10036 C  C13 . RAL G  3 .   ? 46.040  41.646  22.630  1.00 20.04 ? 802  RAL A C13 1 
HETATM 10037 C  C14 . RAL G  3 .   ? 42.458  44.616  23.309  1.00 23.27 ? 802  RAL A C14 1 
HETATM 10038 C  C15 . RAL G  3 .   ? 43.119  43.927  22.283  1.00 21.54 ? 802  RAL A C15 1 
HETATM 10039 C  C16 . RAL G  3 .   ? 42.413  43.784  20.938  1.00 23.62 ? 802  RAL A C16 1 
HETATM 10040 O  O16 . RAL G  3 .   ? 41.711  44.693  20.510  1.00 29.81 ? 802  RAL A O16 1 
HETATM 10041 C  C17 . RAL G  3 .   ? 42.371  42.406  20.281  1.00 28.82 ? 802  RAL A C17 1 
HETATM 10042 C  C18 . RAL G  3 .   ? 42.620  41.257  21.031  1.00 31.71 ? 802  RAL A C18 1 
HETATM 10043 C  C19 . RAL G  3 .   ? 42.612  40.005  20.442  1.00 36.70 ? 802  RAL A C19 1 
HETATM 10044 C  C20 . RAL G  3 .   ? 42.328  39.886  19.089  1.00 42.60 ? 802  RAL A C20 1 
HETATM 10045 C  C21 . RAL G  3 .   ? 42.060  41.021  18.341  1.00 43.89 ? 802  RAL A C21 1 
HETATM 10046 C  C22 . RAL G  3 .   ? 42.080  42.280  18.937  1.00 41.67 ? 802  RAL A C22 1 
HETATM 10047 O  O23 . RAL G  3 .   ? 42.302  38.651  18.520  1.00 57.47 ? 802  RAL A O23 1 
HETATM 10048 C  C24 . RAL G  3 .   ? 42.053  38.701  17.071  1.00 71.88 ? 802  RAL A C24 1 
HETATM 10049 C  C25 . RAL G  3 .   ? 41.254  37.474  16.579  1.00 77.25 ? 802  RAL A C25 1 
HETATM 10050 N  N26 . RAL G  3 .   ? 40.616  36.788  17.732  1.00 83.31 ? 802  RAL A N26 1 
HETATM 10051 C  C27 . RAL G  3 .   ? 39.388  36.399  17.059  1.00 86.31 ? 802  RAL A C27 1 
HETATM 10052 C  C28 . RAL G  3 .   ? 38.697  35.346  17.933  1.00 87.59 ? 802  RAL A C28 1 
HETATM 10053 C  C29 . RAL G  3 .   ? 39.622  34.173  18.313  1.00 86.14 ? 802  RAL A C29 1 
HETATM 10054 C  C30 . RAL G  3 .   ? 40.946  34.664  18.909  1.00 84.95 ? 802  RAL A C30 1 
HETATM 10055 C  C31 . RAL G  3 .   ? 41.580  35.697  17.978  1.00 84.75 ? 802  RAL A C31 1 
HETATM 10056 CL CL  . CL  H  4 .   ? 44.482  51.468  30.766  1.00 62.74 ? 1330 CL  A CL  1 
HETATM 10057 C  C1  . EDO I  5 .   ? 71.772  42.291  -2.657  1.00 47.15 ? 1331 EDO A C1  1 
HETATM 10058 O  O1  . EDO I  5 .   ? 70.354  42.383  -2.800  1.00 43.73 ? 1331 EDO A O1  1 
HETATM 10059 C  C2  . EDO I  5 .   ? 72.141  42.662  -1.231  1.00 47.66 ? 1331 EDO A C2  1 
HETATM 10060 O  O2  . EDO I  5 .   ? 71.314  41.909  -0.352  1.00 41.81 ? 1331 EDO A O2  1 
HETATM 10061 C  C1  . EDO J  5 .   ? 51.710  46.074  25.456  1.00 41.66 ? 1332 EDO A C1  1 
HETATM 10062 O  O1  . EDO J  5 .   ? 53.082  45.642  25.301  1.00 39.50 ? 1332 EDO A O1  1 
HETATM 10063 C  C2  . EDO J  5 .   ? 51.550  47.092  26.561  1.00 31.08 ? 1332 EDO A C2  1 
HETATM 10064 O  O2  . EDO J  5 .   ? 50.835  48.283  26.228  1.00 41.81 ? 1332 EDO A O2  1 
HETATM 10065 CL CL  . CL  K  4 .   ? 38.914  43.909  11.497  1.00 64.56 ? 1333 CL  A CL  1 
HETATM 10066 P  PA  . NAP L  2 .   ? 5.042   31.770  13.219  1.00 15.03 ? 701  NAP B PA  1 
HETATM 10067 O  O1A . NAP L  2 .   ? 5.215   33.322  13.704  1.00 16.53 ? 701  NAP B O1A 1 
HETATM 10068 O  O2A . NAP L  2 .   ? 4.239   31.623  11.996  1.00 21.20 ? 701  NAP B O2A 1 
HETATM 10069 O  O5B . NAP L  2 .   ? 4.370   31.062  14.505  1.00 20.67 ? 701  NAP B O5B 1 
HETATM 10070 C  C5B . NAP L  2 .   ? 3.927   29.736  14.309  1.00 16.47 ? 701  NAP B C5B 1 
HETATM 10071 C  C4B . NAP L  2 .   ? 2.461   29.727  13.809  1.00 18.21 ? 701  NAP B C4B 1 
HETATM 10072 O  O4B . NAP L  2 .   ? 2.148   28.372  13.408  1.00 15.61 ? 701  NAP B O4B 1 
HETATM 10073 C  C3B . NAP L  2 .   ? 1.506   29.952  14.999  1.00 22.17 ? 701  NAP B C3B 1 
HETATM 10074 O  O3B . NAP L  2 .   ? 1.323   31.376  15.304  1.00 22.58 ? 701  NAP B O3B 1 
HETATM 10075 C  C2B . NAP L  2 .   ? 0.204   29.265  14.502  1.00 22.18 ? 701  NAP B C2B 1 
HETATM 10076 O  O2B . NAP L  2 .   ? -0.645  30.254  13.941  1.00 20.51 ? 701  NAP B O2B 1 
HETATM 10077 C  C1B . NAP L  2 .   ? 0.689   28.310  13.368  1.00 24.65 ? 701  NAP B C1B 1 
HETATM 10078 N  N9A . NAP L  2 .   ? 0.362   26.854  13.588  1.00 17.53 ? 701  NAP B N9A 1 
HETATM 10079 C  C8A . NAP L  2 .   ? 0.803   26.123  14.613  1.00 14.11 ? 701  NAP B C8A 1 
HETATM 10080 N  N7A . NAP L  2 .   ? 0.348   24.864  14.501  1.00 17.61 ? 701  NAP B N7A 1 
HETATM 10081 C  C5A . NAP L  2 .   ? -0.392  24.823  13.375  1.00 18.81 ? 701  NAP B C5A 1 
HETATM 10082 C  C6A . NAP L  2 .   ? -1.114  23.805  12.770  1.00 16.49 ? 701  NAP B C6A 1 
HETATM 10083 N  N6A . NAP L  2 .   ? -1.103  22.611  13.345  1.00 11.72 ? 701  NAP B N6A 1 
HETATM 10084 N  N1A . NAP L  2 .   ? -1.782  24.036  11.639  1.00 18.70 ? 701  NAP B N1A 1 
HETATM 10085 C  C2A . NAP L  2 .   ? -1.747  25.255  11.096  1.00 28.80 ? 701  NAP B C2A 1 
HETATM 10086 N  N3A . NAP L  2 .   ? -1.065  26.276  11.641  1.00 21.63 ? 701  NAP B N3A 1 
HETATM 10087 C  C4A . NAP L  2 .   ? -0.375  26.067  12.791  1.00 14.16 ? 701  NAP B C4A 1 
HETATM 10088 O  O3  . NAP L  2 .   ? 6.473   31.018  13.062  1.00 18.96 ? 701  NAP B O3  1 
HETATM 10089 P  PN  . NAP L  2 .   ? 7.535   31.380  11.914  1.00 19.89 ? 701  NAP B PN  1 
HETATM 10090 O  O1N . NAP L  2 .   ? 8.849   31.620  12.550  1.00 20.47 ? 701  NAP B O1N 1 
HETATM 10091 O  O2N . NAP L  2 .   ? 6.937   32.388  11.078  1.00 17.26 ? 701  NAP B O2N 1 
HETATM 10092 O  O5D . NAP L  2 .   ? 7.659   29.978  11.100  1.00 21.16 ? 701  NAP B O5D 1 
HETATM 10093 C  C5D . NAP L  2 .   ? 6.637   29.613  10.154  1.00 20.05 ? 701  NAP B C5D 1 
HETATM 10094 C  C4D . NAP L  2 .   ? 6.957   28.318  9.443   1.00 17.21 ? 701  NAP B C4D 1 
HETATM 10095 O  O4D . NAP L  2 .   ? 8.192   28.623  8.769   1.00 18.11 ? 701  NAP B O4D 1 
HETATM 10096 C  C3D . NAP L  2 .   ? 7.252   27.196  10.446  1.00 16.19 ? 701  NAP B C3D 1 
HETATM 10097 O  O3D . NAP L  2 .   ? 6.762   25.933  9.980   1.00 16.32 ? 701  NAP B O3D 1 
HETATM 10098 C  C2D . NAP L  2 .   ? 8.782   27.202  10.524  1.00 15.85 ? 701  NAP B C2D 1 
HETATM 10099 O  O2D . NAP L  2 .   ? 9.334   25.912  10.747  1.00 18.43 ? 701  NAP B O2D 1 
HETATM 10100 C  C1D . NAP L  2 .   ? 9.085   27.557  9.083   1.00 19.10 ? 701  NAP B C1D 1 
HETATM 10101 N  N1N . NAP L  2 .   ? 10.381  28.171  8.866   1.00 20.14 ? 701  NAP B N1N 1 
HETATM 10102 C  C2N . NAP L  2 .   ? 11.194  27.610  7.894   1.00 20.55 ? 701  NAP B C2N 1 
HETATM 10103 C  C3N . NAP L  2 .   ? 12.430  28.158  7.635   1.00 14.28 ? 701  NAP B C3N 1 
HETATM 10104 C  C7N . NAP L  2 .   ? 13.290  27.518  6.545   1.00 22.93 ? 701  NAP B C7N 1 
HETATM 10105 O  O7N . NAP L  2 .   ? 12.882  26.609  5.797   1.00 19.29 ? 701  NAP B O7N 1 
HETATM 10106 N  N7N . NAP L  2 .   ? 14.456  28.091  6.400   1.00 10.31 ? 701  NAP B N7N 1 
HETATM 10107 C  C4N . NAP L  2 .   ? 12.855  29.279  8.343   1.00 17.86 ? 701  NAP B C4N 1 
HETATM 10108 C  C5N . NAP L  2 .   ? 12.048  29.856  9.319   1.00 16.79 ? 701  NAP B C5N 1 
HETATM 10109 C  C6N . NAP L  2 .   ? 10.797  29.297  9.579   1.00 21.80 ? 701  NAP B C6N 1 
HETATM 10110 P  P2B . NAP L  2 .   ? -2.190  29.920  13.491  1.00 26.41 ? 701  NAP B P2B 1 
HETATM 10111 O  O1X . NAP L  2 .   ? -3.164  30.871  14.331  1.00 31.40 ? 701  NAP B O1X 1 
HETATM 10112 O  O2X . NAP L  2 .   ? -2.320  30.544  12.077  1.00 21.88 ? 701  NAP B O2X 1 
HETATM 10113 O  O3X . NAP L  2 .   ? -2.506  28.489  13.685  1.00 27.94 ? 701  NAP B O3X 1 
HETATM 10114 CL CL  . CL  M  4 .   ? 41.449  34.364  14.271  1.00 34.58 ? 1330 CL  B CL  1 
HETATM 10115 CL CL  . CL  N  4 .   ? 10.917  47.839  -5.330  1.00 64.53 ? 1331 CL  B CL  1 
HETATM 10116 C  C1  . EDO O  5 .   ? 25.065  34.549  13.936  1.00 30.44 ? 1332 EDO B C1  1 
HETATM 10117 O  O1  . EDO O  5 .   ? 24.812  35.856  13.421  1.00 40.17 ? 1332 EDO B O1  1 
HETATM 10118 C  C2  . EDO O  5 .   ? 24.573  34.554  15.343  1.00 24.88 ? 1332 EDO B C2  1 
HETATM 10119 O  O2  . EDO O  5 .   ? 23.221  35.036  15.331  1.00 25.65 ? 1332 EDO B O2  1 
HETATM 10120 C  C1  . EDO P  5 .   ? 0.315   18.544  17.798  1.00 38.05 ? 1333 EDO B C1  1 
HETATM 10121 O  O1  . EDO P  5 .   ? 1.152   18.276  16.672  1.00 40.92 ? 1333 EDO B O1  1 
HETATM 10122 C  C2  . EDO P  5 .   ? 0.200   17.283  18.656  1.00 44.82 ? 1333 EDO B C2  1 
HETATM 10123 O  O2  . EDO P  5 .   ? 0.597   17.494  20.013  1.00 41.80 ? 1333 EDO B O2  1 
HETATM 10124 P  PA  . NAP Q  2 .   ? 1.943   63.257  41.581  1.00 21.73 ? 701  NAP C PA  1 
HETATM 10125 O  O1A . NAP Q  2 .   ? 1.572   63.384  40.015  1.00 28.11 ? 701  NAP C O1A 1 
HETATM 10126 O  O2A . NAP Q  2 .   ? 1.777   61.890  42.106  1.00 21.00 ? 701  NAP C O2A 1 
HETATM 10127 O  O5B . NAP Q  2 .   ? 1.135   64.357  42.381  1.00 21.31 ? 701  NAP C O5B 1 
HETATM 10128 C  C5B . NAP Q  2 .   ? 1.077   64.208  43.811  1.00 20.30 ? 701  NAP C C5B 1 
HETATM 10129 C  C4B . NAP Q  2 .   ? -0.148  63.415  44.280  1.00 23.54 ? 701  NAP C C4B 1 
HETATM 10130 O  O4B . NAP Q  2 .   ? 0.113   63.266  45.656  1.00 24.71 ? 701  NAP C O4B 1 
HETATM 10131 C  C3B . NAP Q  2 .   ? -1.395  64.297  44.338  1.00 26.18 ? 701  NAP C C3B 1 
HETATM 10132 O  O3B . NAP Q  2 .   ? -2.062  64.348  43.073  1.00 22.95 ? 701  NAP C O3B 1 
HETATM 10133 C  C2B . NAP Q  2 .   ? -2.225  63.560  45.400  1.00 19.47 ? 701  NAP C C2B 1 
HETATM 10134 O  O2B . NAP Q  2 .   ? -2.987  62.547  44.779  1.00 25.63 ? 701  NAP C O2B 1 
HETATM 10135 C  C1B . NAP Q  2 .   ? -1.142  62.880  46.241  1.00 22.36 ? 701  NAP C C1B 1 
HETATM 10136 N  N9A . NAP Q  2 .   ? -1.112  63.326  47.650  1.00 20.68 ? 701  NAP C N9A 1 
HETATM 10137 C  C8A . NAP Q  2 .   ? -0.822  64.542  48.098  1.00 21.64 ? 701  NAP C C8A 1 
HETATM 10138 N  N7A . NAP Q  2 .   ? -0.892  64.549  49.431  1.00 22.41 ? 701  NAP C N7A 1 
HETATM 10139 C  C5A . NAP Q  2 .   ? -1.215  63.321  49.834  1.00 18.08 ? 701  NAP C C5A 1 
HETATM 10140 C  C6A . NAP Q  2 .   ? -1.442  62.753  51.084  1.00 24.77 ? 701  NAP C C6A 1 
HETATM 10141 N  N6A . NAP Q  2 .   ? -1.334  63.485  52.201  1.00 17.87 ? 701  NAP C N6A 1 
HETATM 10142 N  N1A . NAP Q  2 .   ? -1.784  61.458  51.149  1.00 21.81 ? 701  NAP C N1A 1 
HETATM 10143 C  C2A . NAP Q  2 .   ? -1.890  60.736  50.042  1.00 29.30 ? 701  NAP C C2A 1 
HETATM 10144 N  N3A . NAP Q  2 .   ? -1.693  61.253  48.836  1.00 28.54 ? 701  NAP C N3A 1 
HETATM 10145 C  C4A . NAP Q  2 .   ? -1.361  62.548  48.708  1.00 24.54 ? 701  NAP C C4A 1 
HETATM 10146 O  O3  . NAP Q  2 .   ? 3.431   63.727  41.649  1.00 22.89 ? 701  NAP C O3  1 
HETATM 10147 P  PN  . NAP Q  2 .   ? 4.627   62.826  41.216  1.00 21.98 ? 701  NAP C PN  1 
HETATM 10148 O  O1N . NAP Q  2 .   ? 5.591   63.742  40.515  1.00 18.26 ? 701  NAP C O1N 1 
HETATM 10149 O  O2N . NAP Q  2 .   ? 4.099   61.623  40.570  1.00 20.63 ? 701  NAP C O2N 1 
HETATM 10150 O  O5D . NAP Q  2 .   ? 5.259   62.421  42.637  1.00 22.19 ? 701  NAP C O5D 1 
HETATM 10151 C  C5D . NAP Q  2 .   ? 4.827   61.198  43.357  1.00 19.19 ? 701  NAP C C5D 1 
HETATM 10152 C  C4D . NAP Q  2 .   ? 5.825   60.890  44.512  1.00 13.34 ? 701  NAP C C4D 1 
HETATM 10153 O  O4D . NAP Q  2 .   ? 7.117   60.544  43.954  1.00 16.13 ? 701  NAP C O4D 1 
HETATM 10154 C  C3D . NAP Q  2 .   ? 6.048   62.133  45.368  1.00 17.02 ? 701  NAP C C3D 1 
HETATM 10155 O  O3D . NAP Q  2 .   ? 6.083   61.728  46.744  1.00 16.20 ? 701  NAP C O3D 1 
HETATM 10156 C  C2D . NAP Q  2 .   ? 7.421   62.635  44.927  1.00 16.04 ? 701  NAP C C2D 1 
HETATM 10157 O  O2D . NAP Q  2 .   ? 8.075   63.324  46.021  1.00 18.42 ? 701  NAP C O2D 1 
HETATM 10158 C  C1D . NAP Q  2 .   ? 8.118   61.316  44.649  1.00 14.93 ? 701  NAP C C1D 1 
HETATM 10159 N  N1N . NAP Q  2 .   ? 9.221   61.335  43.675  1.00 17.09 ? 701  NAP C N1N 1 
HETATM 10160 C  C2N . NAP Q  2 .   ? 10.445  60.742  43.986  1.00 20.65 ? 701  NAP C C2N 1 
HETATM 10161 C  C3N . NAP Q  2 .   ? 11.498  60.726  43.062  1.00 14.93 ? 701  NAP C C3N 1 
HETATM 10162 C  C7N . NAP Q  2 .   ? 12.861  60.107  43.440  1.00 23.80 ? 701  NAP C C7N 1 
HETATM 10163 O  O7N . NAP Q  2 .   ? 13.865  60.296  42.760  1.00 22.32 ? 701  NAP C O7N 1 
HETATM 10164 N  N7N . NAP Q  2 .   ? 12.893  59.411  44.573  1.00 19.83 ? 701  NAP C N7N 1 
HETATM 10165 C  C4N . NAP Q  2 .   ? 11.313  61.310  41.820  1.00 19.71 ? 701  NAP C C4N 1 
HETATM 10166 C  C5N . NAP Q  2 .   ? 10.095  61.905  41.486  1.00 18.57 ? 701  NAP C C5N 1 
HETATM 10167 C  C6N . NAP Q  2 .   ? 9.044   61.906  42.395  1.00 18.59 ? 701  NAP C C6N 1 
HETATM 10168 P  P2B . NAP Q  2 .   ? -4.197  61.787  45.552  1.00 25.64 ? 701  NAP C P2B 1 
HETATM 10169 O  O1X . NAP Q  2 .   ? -4.103  62.228  47.099  1.00 27.64 ? 701  NAP C O1X 1 
HETATM 10170 O  O2X . NAP Q  2 .   ? -5.611  62.456  45.112  1.00 29.15 ? 701  NAP C O2X 1 
HETATM 10171 O  O3X . NAP Q  2 .   ? -4.219  60.341  45.386  1.00 22.54 ? 701  NAP C O3X 1 
HETATM 10172 C  C1  . EDO R  5 .   ? 26.863  53.034  30.593  1.00 56.12 ? 1330 EDO C C1  1 
HETATM 10173 O  O1  . EDO R  5 .   ? 27.198  54.409  30.324  1.00 44.84 ? 1330 EDO C O1  1 
HETATM 10174 C  C2  . EDO R  5 .   ? 26.412  52.846  32.045  1.00 57.39 ? 1330 EDO C C2  1 
HETATM 10175 O  O2  . EDO R  5 .   ? 24.976  52.858  32.201  1.00 51.38 ? 1330 EDO C O2  1 
HETATM 10176 C  C1  . EDO S  5 .   ? 14.192  62.230  26.787  1.00 46.30 ? 1331 EDO C C1  1 
HETATM 10177 O  O1  . EDO S  5 .   ? 14.101  62.569  25.399  1.00 47.61 ? 1331 EDO C O1  1 
HETATM 10178 C  C2  . EDO S  5 .   ? 13.346  63.192  27.601  1.00 41.92 ? 1331 EDO C C2  1 
HETATM 10179 O  O2  . EDO S  5 .   ? 13.102  62.683  28.909  1.00 35.86 ? 1331 EDO C O2  1 
HETATM 10180 C  C1  . EDO T  5 .   ? -8.456  52.529  59.774  1.00 52.08 ? 1332 EDO C C1  1 
HETATM 10181 O  O1  . EDO T  5 .   ? -7.630  51.605  59.050  1.00 51.47 ? 1332 EDO C O1  1 
HETATM 10182 C  C2  . EDO T  5 .   ? -8.118  53.946  59.323  1.00 54.26 ? 1332 EDO C C2  1 
HETATM 10183 O  O2  . EDO T  5 .   ? -8.936  54.323  58.203  1.00 51.23 ? 1332 EDO C O2  1 
HETATM 10184 CL CL  . CL  U  4 .   ? 16.410  83.682  53.456  1.00 59.52 ? 1333 CL  C CL  1 
HETATM 10185 P  PA  . NAP V  2 .   ? 25.631  73.981  -2.104  1.00 20.03 ? 701  NAP D PA  1 
HETATM 10186 O  O1A . NAP V  2 .   ? 24.588  75.012  -1.429  1.00 17.19 ? 701  NAP D O1A 1 
HETATM 10187 O  O2A . NAP V  2 .   ? 24.993  72.986  -3.021  1.00 22.98 ? 701  NAP D O2A 1 
HETATM 10188 O  O5B . NAP V  2 .   ? 26.445  73.347  -0.938  1.00 23.85 ? 701  NAP D O5B 1 
HETATM 10189 C  C5B . NAP V  2 .   ? 27.285  72.263  -1.239  1.00 17.81 ? 701  NAP D C5B 1 
HETATM 10190 C  C4B . NAP V  2 .   ? 26.520  70.952  -1.141  1.00 15.38 ? 701  NAP D C4B 1 
HETATM 10191 O  O4B . NAP V  2 .   ? 27.451  69.981  -1.696  1.00 21.42 ? 701  NAP D O4B 1 
HETATM 10192 C  C3B . NAP V  2 .   ? 26.375  70.461  0.273   1.00 19.57 ? 701  NAP D C3B 1 
HETATM 10193 O  O3B . NAP V  2 .   ? 25.191  70.956  0.912   1.00 19.68 ? 701  NAP D O3B 1 
HETATM 10194 C  C2B . NAP V  2 .   ? 26.240  68.942  0.068   1.00 23.65 ? 701  NAP D C2B 1 
HETATM 10195 O  O2B . NAP V  2 .   ? 24.866  68.599  -0.097  1.00 22.33 ? 701  NAP D O2B 1 
HETATM 10196 C  C1B . NAP V  2 .   ? 26.963  68.689  -1.250  1.00 19.78 ? 701  NAP D C1B 1 
HETATM 10197 N  N9A . NAP V  2 .   ? 28.133  67.794  -1.167  1.00 23.41 ? 701  NAP D N9A 1 
HETATM 10198 C  C8A . NAP V  2 .   ? 29.251  67.997  -0.476  1.00 22.08 ? 701  NAP D C8A 1 
HETATM 10199 N  N7A . NAP V  2 .   ? 30.082  66.971  -0.673  1.00 23.24 ? 701  NAP D N7A 1 
HETATM 10200 C  C5A . NAP V  2 .   ? 29.492  66.116  -1.477  1.00 21.59 ? 701  NAP D C5A 1 
HETATM 10201 C  C6A . NAP V  2 .   ? 29.872  64.899  -2.008  1.00 20.18 ? 701  NAP D C6A 1 
HETATM 10202 N  N6A . NAP V  2 .   ? 31.059  64.383  -1.721  1.00 17.14 ? 701  NAP D N6A 1 
HETATM 10203 N  N1A . NAP V  2 .   ? 29.015  64.271  -2.833  1.00 24.56 ? 701  NAP D N1A 1 
HETATM 10204 C  C2A . NAP V  2 .   ? 27.821  64.790  -3.110  1.00 23.03 ? 701  NAP D C2A 1 
HETATM 10205 N  N3A . NAP V  2 .   ? 27.427  65.954  -2.615  1.00 25.39 ? 701  NAP D N3A 1 
HETATM 10206 C  C4A . NAP V  2 .   ? 28.254  66.643  -1.811  1.00 22.18 ? 701  NAP D C4A 1 
HETATM 10207 O  O3  . NAP V  2 .   ? 26.735  74.850  -2.928  1.00 15.28 ? 701  NAP D O3  1 
HETATM 10208 P  PN  . NAP V  2 .   ? 26.413  75.703  -4.209  1.00 18.97 ? 701  NAP D PN  1 
HETATM 10209 O  O1N . NAP V  2 .   ? 26.840  77.095  -3.949  1.00 18.58 ? 701  NAP D O1N 1 
HETATM 10210 O  O2N . NAP V  2 .   ? 25.005  75.468  -4.554  1.00 23.74 ? 701  NAP D O2N 1 
HETATM 10211 O  O5D . NAP V  2 .   ? 27.410  75.073  -5.249  1.00 18.36 ? 701  NAP D O5D 1 
HETATM 10212 C  C5D . NAP V  2 .   ? 27.149  73.803  -5.753  1.00 19.77 ? 701  NAP D C5D 1 
HETATM 10213 C  C4D . NAP V  2 .   ? 28.136  73.401  -6.808  1.00 13.86 ? 701  NAP D C4D 1 
HETATM 10214 O  O4D . NAP V  2 .   ? 28.168  74.443  -7.803  1.00 13.94 ? 701  NAP D O4D 1 
HETATM 10215 C  C3D . NAP V  2 .   ? 29.572  73.240  -6.284  1.00 14.81 ? 701  NAP D C3D 1 
HETATM 10216 O  O3D . NAP V  2 .   ? 30.173  72.101  -6.959  1.00 18.69 ? 701  NAP D O3D 1 
HETATM 10217 C  C2D . NAP V  2 .   ? 30.221  74.550  -6.753  1.00 18.35 ? 701  NAP D C2D 1 
HETATM 10218 O  O2D . NAP V  2 .   ? 31.584  74.400  -6.929  1.00 16.44 ? 701  NAP D O2D 1 
HETATM 10219 C  C1D . NAP V  2 .   ? 29.571  74.702  -8.115  1.00 19.35 ? 701  NAP D C1D 1 
HETATM 10220 N  N1N . NAP V  2 .   ? 29.471  76.059  -8.656  1.00 10.99 ? 701  NAP D N1N 1 
HETATM 10221 C  C2N . NAP V  2 .   ? 29.957  76.308  -9.917  1.00 16.54 ? 701  NAP D C2N 1 
HETATM 10222 C  C3N . NAP V  2 .   ? 29.864  77.570  -10.443 1.00 16.68 ? 701  NAP D C3N 1 
HETATM 10223 C  C7N . NAP V  2 .   ? 30.380  77.837  -11.821 1.00 19.42 ? 701  NAP D C7N 1 
HETATM 10224 O  O7N . NAP V  2 .   ? 30.413  78.990  -12.234 1.00 18.84 ? 701  NAP D O7N 1 
HETATM 10225 N  N7N . NAP V  2 .   ? 30.735  76.767  -12.540 1.00 21.16 ? 701  NAP D N7N 1 
HETATM 10226 C  C4N . NAP V  2 .   ? 29.254  78.586  -9.737  1.00 18.01 ? 701  NAP D C4N 1 
HETATM 10227 C  C5N . NAP V  2 .   ? 28.735  78.330  -8.482  1.00 11.93 ? 701  NAP D C5N 1 
HETATM 10228 C  C6N . NAP V  2 .   ? 28.847  77.067  -7.933  1.00 13.10 ? 701  NAP D C6N 1 
HETATM 10229 P  P2B . NAP V  2 .   ? 24.313  67.081  0.001   1.00 27.24 ? 701  NAP D P2B 1 
HETATM 10230 O  O1X . NAP V  2 .   ? 25.620  66.172  0.039   1.00 23.42 ? 701  NAP D O1X 1 
HETATM 10231 O  O2X . NAP V  2 .   ? 23.721  66.914  1.440   1.00 30.42 ? 701  NAP D O2X 1 
HETATM 10232 O  O3X . NAP V  2 .   ? 23.361  66.808  -1.099  1.00 25.44 ? 701  NAP D O3X 1 
HETATM 10233 C  C1  . EDO W  5 .   ? 31.794  92.821  -6.187  1.00 23.64 ? 1330 EDO D C1  1 
HETATM 10234 O  O1  . EDO W  5 .   ? 31.099  91.828  -5.438  1.00 31.07 ? 1330 EDO D O1  1 
HETATM 10235 C  C2  . EDO W  5 .   ? 31.224  92.800  -7.593  1.00 38.83 ? 1330 EDO D C2  1 
HETATM 10236 O  O2  . EDO W  5 .   ? 29.794  92.932  -7.553  1.00 31.20 ? 1330 EDO D O2  1 
HETATM 10237 C  C1  . EDO X  5 .   ? 22.052  91.496  -7.360  1.00 42.23 ? 1331 EDO D C1  1 
HETATM 10238 O  O1  . EDO X  5 .   ? 22.490  90.323  -8.059  1.00 35.61 ? 1331 EDO D O1  1 
HETATM 10239 C  C2  . EDO X  5 .   ? 21.200  92.441  -8.205  1.00 35.73 ? 1331 EDO D C2  1 
HETATM 10240 O  O2  . EDO X  5 .   ? 22.027  93.418  -8.882  1.00 45.39 ? 1331 EDO D O2  1 
HETATM 10241 O  O   . HOH Y  6 .   ? 29.856  63.129  28.990  1.00 40.03 ? 2001 HOH A O   1 
HETATM 10242 O  O   . HOH Y  6 .   ? 34.980  57.353  11.659  1.00 17.15 ? 2002 HOH A O   1 
HETATM 10243 O  O   . HOH Y  6 .   ? 31.829  63.362  8.497   1.00 19.71 ? 2003 HOH A O   1 
HETATM 10244 O  O   . HOH Y  6 .   ? 35.587  57.036  9.161   1.00 20.84 ? 2004 HOH A O   1 
HETATM 10245 O  O   . HOH Y  6 .   ? 37.660  58.387  4.653   1.00 27.64 ? 2005 HOH A O   1 
HETATM 10246 O  O   . HOH Y  6 .   ? 39.338  65.378  5.324   1.00 21.37 ? 2006 HOH A O   1 
HETATM 10247 O  O   . HOH Y  6 .   ? 40.638  67.781  7.913   1.00 19.35 ? 2007 HOH A O   1 
HETATM 10248 O  O   . HOH Y  6 .   ? 34.258  71.283  11.011  1.00 20.63 ? 2008 HOH A O   1 
HETATM 10249 O  O   . HOH Y  6 .   ? 40.708  72.629  14.782  1.00 29.54 ? 2009 HOH A O   1 
HETATM 10250 O  O   . HOH Y  6 .   ? 31.859  71.331  9.631   1.00 37.12 ? 2010 HOH A O   1 
HETATM 10251 O  O   . HOH Y  6 .   ? 30.671  66.675  9.981   1.00 22.51 ? 2011 HOH A O   1 
HETATM 10252 O  O   . HOH Y  6 .   ? 35.709  64.135  8.107   1.00 16.68 ? 2012 HOH A O   1 
HETATM 10253 O  O   . HOH Y  6 .   ? 34.337  51.125  7.073   1.00 37.08 ? 2013 HOH A O   1 
HETATM 10254 O  O   . HOH Y  6 .   ? 30.815  70.190  20.589  1.00 24.31 ? 2014 HOH A O   1 
HETATM 10255 O  O   . HOH Y  6 .   ? 35.609  54.154  25.428  1.00 38.48 ? 2015 HOH A O   1 
HETATM 10256 O  O   . HOH Y  6 .   ? 40.325  66.030  34.244  1.00 28.16 ? 2016 HOH A O   1 
HETATM 10257 O  O   . HOH Y  6 .   ? 42.785  59.564  25.333  1.00 26.21 ? 2017 HOH A O   1 
HETATM 10258 O  O   . HOH Y  6 .   ? 49.825  56.235  23.619  1.00 20.73 ? 2018 HOH A O   1 
HETATM 10259 O  O   . HOH Y  6 .   ? 45.567  55.490  23.460  1.00 21.69 ? 2019 HOH A O   1 
HETATM 10260 O  O   . HOH Y  6 .   ? 37.300  56.112  7.407   1.00 39.54 ? 2020 HOH A O   1 
HETATM 10261 O  O   . HOH Y  6 .   ? 32.252  53.437  9.362   1.00 35.84 ? 2021 HOH A O   1 
HETATM 10262 O  O   . HOH Y  6 .   ? 36.933  49.985  7.574   1.00 35.45 ? 2022 HOH A O   1 
HETATM 10263 O  O   . HOH Y  6 .   ? 29.918  49.973  17.484  1.00 28.64 ? 2023 HOH A O   1 
HETATM 10264 O  O   . HOH Y  6 .   ? 31.660  52.377  21.229  1.00 33.14 ? 2024 HOH A O   1 
HETATM 10265 O  O   . HOH Y  6 .   ? 30.600  55.447  24.130  1.00 30.76 ? 2025 HOH A O   1 
HETATM 10266 O  O   . HOH Y  6 .   ? 47.822  54.686  24.715  1.00 19.01 ? 2026 HOH A O   1 
HETATM 10267 O  O   . HOH Y  6 .   ? 50.764  53.759  27.688  1.00 18.05 ? 2027 HOH A O   1 
HETATM 10268 O  O   . HOH Y  6 .   ? 69.451  62.703  1.719   1.00 36.63 ? 2028 HOH A O   1 
HETATM 10269 O  O   . HOH Y  6 .   ? 51.266  48.474  4.475   1.00 22.68 ? 2029 HOH A O   1 
HETATM 10270 O  O   . HOH Y  6 .   ? 53.550  48.667  2.504   1.00 24.57 ? 2030 HOH A O   1 
HETATM 10271 O  O   . HOH Y  6 .   ? 38.792  54.008  25.745  1.00 24.20 ? 2031 HOH A O   1 
HETATM 10272 O  O   . HOH Y  6 .   ? 41.475  58.736  28.078  1.00 32.86 ? 2032 HOH A O   1 
HETATM 10273 O  O   . HOH Y  6 .   ? 75.888  45.021  2.175   1.00 49.33 ? 2033 HOH A O   1 
HETATM 10274 O  O   . HOH Y  6 .   ? 37.301  54.770  34.556  1.00 30.53 ? 2034 HOH A O   1 
HETATM 10275 O  O   . HOH Y  6 .   ? 38.785  59.749  34.036  1.00 28.38 ? 2035 HOH A O   1 
HETATM 10276 O  O   . HOH Y  6 .   ? 45.073  48.394  40.399  1.00 40.45 ? 2036 HOH A O   1 
HETATM 10277 O  O   . HOH Y  6 .   ? 54.480  52.560  34.080  1.00 28.88 ? 2037 HOH A O   1 
HETATM 10278 O  O   . HOH Y  6 .   ? 57.165  47.643  39.214  1.00 41.21 ? 2038 HOH A O   1 
HETATM 10279 O  O   . HOH Y  6 .   ? 57.196  60.288  25.392  1.00 34.74 ? 2039 HOH A O   1 
HETATM 10280 O  O   . HOH Y  6 .   ? 53.508  52.833  31.662  1.00 37.70 ? 2040 HOH A O   1 
HETATM 10281 O  O   . HOH Y  6 .   ? 60.020  38.496  24.540  1.00 46.08 ? 2041 HOH A O   1 
HETATM 10282 O  O   . HOH Y  6 .   ? 63.896  41.745  23.090  1.00 35.51 ? 2042 HOH A O   1 
HETATM 10283 O  O   . HOH Y  6 .   ? 67.183  42.041  18.595  1.00 27.74 ? 2043 HOH A O   1 
HETATM 10284 O  O   . HOH Y  6 .   ? 57.747  59.201  6.198   1.00 29.93 ? 2044 HOH A O   1 
HETATM 10285 O  O   . HOH Y  6 .   ? 57.604  58.371  22.224  1.00 23.91 ? 2045 HOH A O   1 
HETATM 10286 O  O   . HOH Y  6 .   ? 67.535  44.348  24.745  1.00 38.49 ? 2046 HOH A O   1 
HETATM 10287 O  O   . HOH Y  6 .   ? 57.561  70.353  12.141  1.00 18.51 ? 2047 HOH A O   1 
HETATM 10288 O  O   . HOH Y  6 .   ? 59.920  72.029  6.243   1.00 25.31 ? 2048 HOH A O   1 
HETATM 10289 O  O   . HOH Y  6 .   ? 60.030  72.813  9.574   1.00 32.50 ? 2049 HOH A O   1 
HETATM 10290 O  O   . HOH Y  6 .   ? 73.357  63.327  12.989  1.00 34.59 ? 2050 HOH A O   1 
HETATM 10291 O  O   . HOH Y  6 .   ? 71.066  63.758  7.315   1.00 24.21 ? 2051 HOH A O   1 
HETATM 10292 O  O   . HOH Y  6 .   ? 66.073  66.575  3.574   1.00 24.32 ? 2052 HOH A O   1 
HETATM 10293 O  O   . HOH Y  6 .   ? 58.957  61.392  -0.983  1.00 31.17 ? 2053 HOH A O   1 
HETATM 10294 O  O   . HOH Y  6 .   ? 52.743  63.449  4.080   1.00 37.57 ? 2054 HOH A O   1 
HETATM 10295 O  O   . HOH Y  6 .   ? 51.390  65.060  5.371   1.00 36.99 ? 2055 HOH A O   1 
HETATM 10296 O  O   . HOH Y  6 .   ? 63.585  70.875  2.617   1.00 25.85 ? 2056 HOH A O   1 
HETATM 10297 O  O   . HOH Y  6 .   ? 60.042  60.618  -5.681  1.00 36.03 ? 2057 HOH A O   1 
HETATM 10298 O  O   . HOH Y  6 .   ? 60.896  58.146  -6.071  1.00 31.99 ? 2058 HOH A O   1 
HETATM 10299 O  O   . HOH Y  6 .   ? 68.297  63.729  -0.627  1.00 31.32 ? 2059 HOH A O   1 
HETATM 10300 O  O   . HOH Y  6 .   ? 74.907  51.915  4.709   1.00 40.16 ? 2060 HOH A O   1 
HETATM 10301 O  O   . HOH Y  6 .   ? 52.804  49.694  6.380   1.00 16.94 ? 2061 HOH A O   1 
HETATM 10302 O  O   . HOH Y  6 .   ? 55.613  47.652  3.645   1.00 21.35 ? 2062 HOH A O   1 
HETATM 10303 O  O   . HOH Y  6 .   ? 53.215  56.467  1.269   1.00 19.70 ? 2063 HOH A O   1 
HETATM 10304 O  O   . HOH Y  6 .   ? 50.165  50.359  2.892   1.00 21.35 ? 2064 HOH A O   1 
HETATM 10305 O  O   . HOH Y  6 .   ? 56.362  54.066  -5.432  1.00 37.35 ? 2065 HOH A O   1 
HETATM 10306 O  O   . HOH Y  6 .   ? 50.914  56.329  -0.493  1.00 20.75 ? 2066 HOH A O   1 
HETATM 10307 O  O   . HOH Y  6 .   ? 52.714  49.095  0.133   1.00 33.52 ? 2067 HOH A O   1 
HETATM 10308 O  O   . HOH Y  6 .   ? 63.504  52.065  -4.827  1.00 27.37 ? 2068 HOH A O   1 
HETATM 10309 O  O   . HOH Y  6 .   ? 76.298  46.309  4.413   1.00 43.13 ? 2069 HOH A O   1 
HETATM 10310 O  O   . HOH Y  6 .   ? 69.375  41.200  5.497   1.00 30.97 ? 2070 HOH A O   1 
HETATM 10311 O  O   . HOH Y  6 .   ? 65.024  37.421  6.966   1.00 38.63 ? 2071 HOH A O   1 
HETATM 10312 O  O   . HOH Y  6 .   ? 46.207  59.081  5.861   1.00 25.93 ? 2072 HOH A O   1 
HETATM 10313 O  O   . HOH Y  6 .   ? 48.837  55.803  0.858   1.00 29.03 ? 2073 HOH A O   1 
HETATM 10314 O  O   . HOH Y  6 .   ? 41.844  49.416  -1.902  1.00 34.57 ? 2074 HOH A O   1 
HETATM 10315 O  O   . HOH Y  6 .   ? 48.435  49.236  -1.513  1.00 36.38 ? 2075 HOH A O   1 
HETATM 10316 O  O   . HOH Y  6 .   ? 53.852  49.377  -6.960  1.00 45.46 ? 2076 HOH A O   1 
HETATM 10317 O  O   . HOH Y  6 .   ? 66.815  35.600  -4.341  1.00 34.53 ? 2077 HOH A O   1 
HETATM 10318 O  O   . HOH Y  6 .   ? 68.483  32.587  -2.735  1.00 22.01 ? 2078 HOH A O   1 
HETATM 10319 O  O   . HOH Y  6 .   ? 47.355  51.933  25.005  1.00 25.04 ? 2079 HOH A O   1 
HETATM 10320 O  O   . HOH Y  6 .   ? 53.226  43.841  32.469  1.00 42.98 ? 2080 HOH A O   1 
HETATM 10321 O  O   . HOH Y  6 .   ? 55.116  35.703  32.089  1.00 39.81 ? 2081 HOH A O   1 
HETATM 10322 O  O   . HOH Y  6 .   ? 51.677  51.611  29.110  1.00 32.86 ? 2082 HOH A O   1 
HETATM 10323 O  O   . HOH Y  6 .   ? 64.720  64.907  27.724  1.00 41.20 ? 2083 HOH A O   1 
HETATM 10324 O  O   . HOH Y  6 .   ? 55.486  70.877  23.548  1.00 31.94 ? 2084 HOH A O   1 
HETATM 10325 O  O   . HOH Y  6 .   ? 54.730  61.628  26.448  1.00 30.94 ? 2085 HOH A O   1 
HETATM 10326 O  O   . HOH Y  6 .   ? 57.638  68.923  20.594  1.00 21.07 ? 2086 HOH A O   1 
HETATM 10327 O  O   . HOH Y  6 .   ? 48.683  70.988  16.794  1.00 26.58 ? 2087 HOH A O   1 
HETATM 10328 O  O   . HOH Y  6 .   ? 39.523  70.896  19.340  1.00 25.39 ? 2088 HOH A O   1 
HETATM 10329 O  O   . HOH Y  6 .   ? 45.045  70.758  14.428  1.00 26.43 ? 2089 HOH A O   1 
HETATM 10330 O  O   . HOH Y  6 .   ? 51.549  60.227  1.492   1.00 26.39 ? 2090 HOH A O   1 
HETATM 10331 O  O   . HOH Y  6 .   ? 58.158  62.097  11.957  1.00 18.55 ? 2091 HOH A O   1 
HETATM 10332 O  O   . HOH Y  6 .   ? 50.731  58.977  19.330  1.00 23.15 ? 2092 HOH A O   1 
HETATM 10333 O  O   . HOH Y  6 .   ? 52.664  64.908  7.545   1.00 20.78 ? 2093 HOH A O   1 
HETATM 10334 O  O   . HOH Y  6 .   ? 50.364  55.411  19.010  1.00 20.24 ? 2094 HOH A O   1 
HETATM 10335 O  O   . HOH Y  6 .   ? 56.467  57.593  14.676  1.00 15.13 ? 2095 HOH A O   1 
HETATM 10336 O  O   . HOH Y  6 .   ? 56.065  63.312  13.728  1.00 23.23 ? 2096 HOH A O   1 
HETATM 10337 O  O   . HOH Y  6 .   ? 56.913  60.457  8.100   1.00 24.27 ? 2097 HOH A O   1 
HETATM 10338 O  O   . HOH Y  6 .   ? 53.810  59.233  2.410   1.00 19.21 ? 2098 HOH A O   1 
HETATM 10339 O  O   . HOH Y  6 .   ? 52.077  61.435  18.525  1.00 18.99 ? 2099 HOH A O   1 
HETATM 10340 O  O   . HOH Y  6 .   ? 48.599  54.397  17.179  1.00 18.42 ? 2100 HOH A O   1 
HETATM 10341 O  O   . HOH Z  6 .   ? 23.146  30.089  33.389  1.00 30.15 ? 2001 HOH B O   1 
HETATM 10342 O  O   . HOH Z  6 .   ? 8.241   13.203  29.481  1.00 23.93 ? 2002 HOH B O   1 
HETATM 10343 O  O   . HOH Z  6 .   ? 13.076  17.298  22.466  1.00 19.41 ? 2003 HOH B O   1 
HETATM 10344 O  O   . HOH Z  6 .   ? 14.693  12.754  21.683  1.00 35.36 ? 2004 HOH B O   1 
HETATM 10345 O  O   . HOH Z  6 .   ? 11.052  12.605  27.034  1.00 39.57 ? 2005 HOH B O   1 
HETATM 10346 O  O   . HOH Z  6 .   ? 6.535   14.420  20.579  1.00 23.30 ? 2006 HOH B O   1 
HETATM 10347 O  O   . HOH Z  6 .   ? 19.445  40.850  31.610  1.00 31.72 ? 2007 HOH B O   1 
HETATM 10348 O  O   . HOH Z  6 .   ? 9.608   26.399  33.050  1.00 30.01 ? 2008 HOH B O   1 
HETATM 10349 O  O   . HOH Z  6 .   ? 6.456   17.834  26.296  1.00 17.77 ? 2009 HOH B O   1 
HETATM 10350 O  O   . HOH Z  6 .   ? 13.134  26.185  36.354  1.00 34.04 ? 2010 HOH B O   1 
HETATM 10351 O  O   . HOH Z  6 .   ? 23.536  26.882  21.934  1.00 39.60 ? 2011 HOH B O   1 
HETATM 10352 O  O   . HOH Z  6 .   ? 27.305  28.968  31.234  1.00 31.24 ? 2012 HOH B O   1 
HETATM 10353 O  O   . HOH Z  6 .   ? 33.975  36.792  36.513  1.00 35.19 ? 2013 HOH B O   1 
HETATM 10354 O  O   . HOH Z  6 .   ? 32.691  37.894  32.289  1.00 37.99 ? 2014 HOH B O   1 
HETATM 10355 O  O   . HOH Z  6 .   ? 37.307  51.267  20.972  1.00 29.67 ? 2015 HOH B O   1 
HETATM 10356 O  O   . HOH Z  6 .   ? 38.907  33.583  31.136  1.00 30.70 ? 2016 HOH B O   1 
HETATM 10357 O  O   . HOH Z  6 .   ? 35.626  51.927  22.739  1.00 23.11 ? 2017 HOH B O   1 
HETATM 10358 O  O   . HOH Z  6 .   ? 6.863   17.127  3.012   1.00 28.79 ? 2018 HOH B O   1 
HETATM 10359 O  O   . HOH Z  6 .   ? 19.955  40.368  29.024  1.00 21.44 ? 2019 HOH B O   1 
HETATM 10360 O  O   . HOH Z  6 .   ? 10.001  46.103  22.787  1.00 25.30 ? 2020 HOH B O   1 
HETATM 10361 O  O   . HOH Z  6 .   ? 14.364  34.342  14.170  1.00 16.95 ? 2021 HOH B O   1 
HETATM 10362 O  O   . HOH Z  6 .   ? 16.511  31.727  16.290  1.00 14.65 ? 2022 HOH B O   1 
HETATM 10363 O  O   . HOH Z  6 .   ? 11.532  28.307  12.491  1.00 12.04 ? 2023 HOH B O   1 
HETATM 10364 O  O   . HOH Z  6 .   ? 19.485  12.867  26.472  1.00 42.17 ? 2024 HOH B O   1 
HETATM 10365 O  O   . HOH Z  6 .   ? 24.978  27.701  27.495  1.00 33.88 ? 2025 HOH B O   1 
HETATM 10366 O  O   . HOH Z  6 .   ? 24.577  23.665  26.032  1.00 32.26 ? 2026 HOH B O   1 
HETATM 10367 O  O   . HOH Z  6 .   ? 21.953  28.701  19.674  1.00 19.73 ? 2027 HOH B O   1 
HETATM 10368 O  O   . HOH Z  6 .   ? 17.702  37.122  12.167  1.00 19.35 ? 2028 HOH B O   1 
HETATM 10369 O  O   . HOH Z  6 .   ? 20.291  34.055  10.981  1.00 32.15 ? 2029 HOH B O   1 
HETATM 10370 O  O   . HOH Z  6 .   ? 16.919  33.567  14.325  1.00 18.20 ? 2030 HOH B O   1 
HETATM 10371 O  O   . HOH Z  6 .   ? 16.814  32.859  21.240  1.00 15.66 ? 2031 HOH B O   1 
HETATM 10372 O  O   . HOH Z  6 .   ? 24.126  36.919  25.562  1.00 28.34 ? 2032 HOH B O   1 
HETATM 10373 O  O   . HOH Z  6 .   ? 35.806  40.461  15.278  1.00 36.60 ? 2033 HOH B O   1 
HETATM 10374 O  O   . HOH Z  6 .   ? 36.557  50.629  18.199  1.00 23.12 ? 2034 HOH B O   1 
HETATM 10375 O  O   . HOH Z  6 .   ? 35.357  49.515  24.160  1.00 24.72 ? 2035 HOH B O   1 
HETATM 10376 O  O   . HOH Z  6 .   ? 5.463   18.702  4.217   1.00 20.46 ? 2036 HOH B O   1 
HETATM 10377 O  O   . HOH Z  6 .   ? 2.777   18.645  2.401   1.00 30.87 ? 2037 HOH B O   1 
HETATM 10378 O  O   . HOH Z  6 .   ? 4.856   19.018  -0.632  1.00 34.07 ? 2038 HOH B O   1 
HETATM 10379 O  O   . HOH Z  6 .   ? 25.234  46.858  14.816  1.00 33.53 ? 2039 HOH B O   1 
HETATM 10380 O  O   . HOH Z  6 .   ? -7.454  15.570  1.624   1.00 42.14 ? 2040 HOH B O   1 
HETATM 10381 O  O   . HOH Z  6 .   ? 26.556  33.605  17.680  1.00 29.90 ? 2041 HOH B O   1 
HETATM 10382 O  O   . HOH Z  6 .   ? 20.975  31.444  14.639  1.00 20.49 ? 2042 HOH B O   1 
HETATM 10383 O  O   . HOH Z  6 .   ? 19.555  33.778  22.240  1.00 31.17 ? 2043 HOH B O   1 
HETATM 10384 O  O   . HOH Z  6 .   ? 26.206  32.430  28.354  1.00 29.39 ? 2044 HOH B O   1 
HETATM 10385 O  O   . HOH Z  6 .   ? 28.034  34.675  22.866  1.00 26.30 ? 2045 HOH B O   1 
HETATM 10386 O  O   . HOH Z  6 .   ? 29.050  32.386  27.281  1.00 31.49 ? 2046 HOH B O   1 
HETATM 10387 O  O   . HOH Z  6 .   ? 3.675   12.003  -4.137  1.00 37.95 ? 2047 HOH B O   1 
HETATM 10388 O  O   . HOH Z  6 .   ? 27.574  33.395  20.423  1.00 27.68 ? 2048 HOH B O   1 
HETATM 10389 O  O   . HOH Z  6 .   ? 22.986  42.377  9.025   1.00 29.23 ? 2049 HOH B O   1 
HETATM 10390 O  O   . HOH Z  6 .   ? 27.990  45.979  8.759   1.00 32.87 ? 2050 HOH B O   1 
HETATM 10391 O  O   . HOH Z  6 .   ? 20.821  43.329  9.989   1.00 23.16 ? 2051 HOH B O   1 
HETATM 10392 O  O   . HOH Z  6 .   ? 25.033  47.840  5.612   1.00 41.20 ? 2052 HOH B O   1 
HETATM 10393 O  O   . HOH Z  6 .   ? 14.693  48.572  19.948  1.00 27.96 ? 2053 HOH B O   1 
HETATM 10394 O  O   . HOH Z  6 .   ? 10.679  41.325  14.957  1.00 23.04 ? 2054 HOH B O   1 
HETATM 10395 O  O   . HOH Z  6 .   ? 10.411  45.715  20.015  1.00 25.91 ? 2055 HOH B O   1 
HETATM 10396 O  O   . HOH Z  6 .   ? 9.475   41.436  12.721  1.00 14.82 ? 2056 HOH B O   1 
HETATM 10397 O  O   . HOH Z  6 .   ? 6.372   42.397  9.142   1.00 21.23 ? 2057 HOH B O   1 
HETATM 10398 O  O   . HOH Z  6 .   ? 19.271  41.179  10.375  1.00 21.34 ? 2058 HOH B O   1 
HETATM 10399 O  O   . HOH Z  6 .   ? 11.460  48.105  23.637  1.00 22.71 ? 2059 HOH B O   1 
HETATM 10400 O  O   . HOH Z  6 .   ? 15.302  37.384  -5.627  1.00 36.27 ? 2060 HOH B O   1 
HETATM 10401 O  O   . HOH Z  6 .   ? 10.066  28.300  -9.759  1.00 41.99 ? 2061 HOH B O   1 
HETATM 10402 O  O   . HOH Z  6 .   ? 8.237   38.798  10.470  1.00 27.49 ? 2062 HOH B O   1 
HETATM 10403 O  O   . HOH Z  6 .   ? 4.282   32.257  9.256   1.00 17.22 ? 2063 HOH B O   1 
HETATM 10404 O  O   . HOH Z  6 .   ? 0.669   45.952  3.819   1.00 30.98 ? 2064 HOH B O   1 
HETATM 10405 O  O   . HOH Z  6 .   ? 12.857  42.327  -5.450  1.00 42.22 ? 2065 HOH B O   1 
HETATM 10406 O  O   . HOH Z  6 .   ? -5.218  35.485  17.841  1.00 29.77 ? 2066 HOH B O   1 
HETATM 10407 O  O   . HOH Z  6 .   ? -14.825 32.164  13.357  1.00 32.92 ? 2067 HOH B O   1 
HETATM 10408 O  O   . HOH Z  6 .   ? -11.211 33.231  17.071  1.00 29.82 ? 2068 HOH B O   1 
HETATM 10409 O  O   . HOH Z  6 .   ? -4.869  42.906  16.428  1.00 31.47 ? 2069 HOH B O   1 
HETATM 10410 O  O   . HOH Z  6 .   ? -7.153  44.341  12.852  1.00 38.77 ? 2070 HOH B O   1 
HETATM 10411 O  O   . HOH Z  6 .   ? -7.461  43.546  -1.485  1.00 36.34 ? 2071 HOH B O   1 
HETATM 10412 O  O   . HOH Z  6 .   ? -11.231 37.993  3.345   1.00 33.49 ? 2072 HOH B O   1 
HETATM 10413 O  O   . HOH Z  6 .   ? -8.188  21.927  11.726  1.00 33.12 ? 2073 HOH B O   1 
HETATM 10414 O  O   . HOH Z  6 .   ? -11.580 19.838  3.783   1.00 36.11 ? 2074 HOH B O   1 
HETATM 10415 O  O   . HOH Z  6 .   ? -15.992 26.281  4.602   1.00 29.35 ? 2075 HOH B O   1 
HETATM 10416 O  O   . HOH Z  6 .   ? -8.138  33.601  -8.111  1.00 34.05 ? 2076 HOH B O   1 
HETATM 10417 O  O   . HOH Z  6 .   ? -10.068 32.013  -9.465  1.00 40.08 ? 2077 HOH B O   1 
HETATM 10418 O  O   . HOH Z  6 .   ? 5.175   21.332  4.258   1.00 13.87 ? 2078 HOH B O   1 
HETATM 10419 O  O   . HOH Z  6 .   ? 3.211   20.587  0.663   1.00 20.25 ? 2079 HOH B O   1 
HETATM 10420 O  O   . HOH Z  6 .   ? -2.190  20.130  8.420   1.00 24.24 ? 2080 HOH B O   1 
HETATM 10421 O  O   . HOH Z  6 .   ? 3.899   17.516  6.124   1.00 18.66 ? 2081 HOH B O   1 
HETATM 10422 O  O   . HOH Z  6 .   ? -6.236  16.347  3.834   1.00 33.62 ? 2082 HOH B O   1 
HETATM 10423 O  O   . HOH Z  6 .   ? -6.377  20.171  7.718   1.00 30.51 ? 2083 HOH B O   1 
HETATM 10424 O  O   . HOH Z  6 .   ? 1.116   16.668  3.060   1.00 23.32 ? 2084 HOH B O   1 
HETATM 10425 O  O   . HOH Z  6 .   ? -8.081  19.363  5.624   1.00 34.30 ? 2085 HOH B O   1 
HETATM 10426 O  O   . HOH Z  6 .   ? -8.798  20.260  -2.397  1.00 25.09 ? 2086 HOH B O   1 
HETATM 10427 O  O   . HOH Z  6 .   ? -4.634  20.118  -8.045  1.00 21.87 ? 2087 HOH B O   1 
HETATM 10428 O  O   . HOH Z  6 .   ? -9.443  26.012  -6.380  1.00 33.35 ? 2088 HOH B O   1 
HETATM 10429 O  O   . HOH Z  6 .   ? 6.856   24.755  -12.473 1.00 53.83 ? 2089 HOH B O   1 
HETATM 10430 O  O   . HOH Z  6 .   ? 2.357   27.366  -12.804 1.00 32.71 ? 2090 HOH B O   1 
HETATM 10431 O  O   . HOH Z  6 .   ? 2.758   32.274  -12.541 1.00 41.04 ? 2091 HOH B O   1 
HETATM 10432 O  O   . HOH Z  6 .   ? 1.571   15.401  12.369  1.00 21.86 ? 2092 HOH B O   1 
HETATM 10433 O  O   . HOH Z  6 .   ? -1.922  18.074  14.183  1.00 46.83 ? 2093 HOH B O   1 
HETATM 10434 O  O   . HOH Z  6 .   ? 0.347   16.921  10.523  1.00 22.32 ? 2094 HOH B O   1 
HETATM 10435 O  O   . HOH Z  6 .   ? 7.406   15.601  17.375  1.00 26.64 ? 2095 HOH B O   1 
HETATM 10436 O  O   . HOH Z  6 .   ? -3.549  12.216  0.998   1.00 35.00 ? 2096 HOH B O   1 
HETATM 10437 O  O   . HOH Z  6 .   ? 2.294   11.453  -2.089  1.00 41.08 ? 2097 HOH B O   1 
HETATM 10438 O  O   . HOH Z  6 .   ? -3.343  8.842   -5.964  1.00 32.81 ? 2098 HOH B O   1 
HETATM 10439 O  O   . HOH Z  6 .   ? 8.278   25.085  -6.365  1.00 32.97 ? 2099 HOH B O   1 
HETATM 10440 O  O   . HOH Z  6 .   ? 16.705  22.573  -4.077  1.00 30.53 ? 2100 HOH B O   1 
HETATM 10441 O  O   . HOH Z  6 .   ? 18.804  32.235  12.647  1.00 21.07 ? 2101 HOH B O   1 
HETATM 10442 O  O   . HOH Z  6 .   ? 19.374  28.959  -4.830  1.00 35.36 ? 2102 HOH B O   1 
HETATM 10443 O  O   . HOH Z  6 .   ? 19.821  33.937  4.204   1.00 22.45 ? 2103 HOH B O   1 
HETATM 10444 O  O   . HOH Z  6 .   ? 23.341  33.119  7.919   1.00 30.33 ? 2104 HOH B O   1 
HETATM 10445 O  O   . HOH Z  6 .   ? 24.502  32.849  -1.665  1.00 29.39 ? 2105 HOH B O   1 
HETATM 10446 O  O   . HOH Z  6 .   ? 26.892  36.167  3.900   1.00 29.86 ? 2106 HOH B O   1 
HETATM 10447 O  O   . HOH Z  6 .   ? 23.557  42.396  -4.971  1.00 41.98 ? 2107 HOH B O   1 
HETATM 10448 O  O   . HOH Z  6 .   ? 18.834  39.085  -3.415  1.00 26.36 ? 2108 HOH B O   1 
HETATM 10449 O  O   . HOH Z  6 .   ? 19.413  37.695  10.048  1.00 23.74 ? 2109 HOH B O   1 
HETATM 10450 O  O   . HOH Z  6 .   ? 20.575  34.056  6.555   1.00 25.47 ? 2110 HOH B O   1 
HETATM 10451 O  O   . HOH Z  6 .   ? 19.512  35.109  8.794   1.00 20.39 ? 2111 HOH B O   1 
HETATM 10452 O  O   . HOH Z  6 .   ? 16.995  47.766  -1.586  1.00 39.52 ? 2112 HOH B O   1 
HETATM 10453 O  O   . HOH Z  6 .   ? 4.051   48.904  11.065  1.00 34.51 ? 2113 HOH B O   1 
HETATM 10454 O  O   . HOH Z  6 .   ? 6.461   40.141  12.324  1.00 26.42 ? 2114 HOH B O   1 
HETATM 10455 O  O   . HOH Z  6 .   ? 7.025   46.613  17.395  1.00 26.97 ? 2115 HOH B O   1 
HETATM 10456 O  O   . HOH Z  6 .   ? 3.258   42.627  21.447  1.00 33.10 ? 2116 HOH B O   1 
HETATM 10457 O  O   . HOH Z  6 .   ? 4.676   39.324  28.717  1.00 31.72 ? 2117 HOH B O   1 
HETATM 10458 O  O   . HOH Z  6 .   ? 9.960   40.627  33.968  1.00 61.34 ? 2118 HOH B O   1 
HETATM 10459 O  O   . HOH Z  6 .   ? 8.029   30.654  31.127  1.00 24.42 ? 2119 HOH B O   1 
HETATM 10460 O  O   . HOH Z  6 .   ? 10.419  30.399  36.068  1.00 42.67 ? 2120 HOH B O   1 
HETATM 10461 O  O   . HOH Z  6 .   ? 5.723   32.455  32.084  1.00 34.87 ? 2121 HOH B O   1 
HETATM 10462 O  O   . HOH Z  6 .   ? 2.254   30.111  26.787  1.00 27.28 ? 2122 HOH B O   1 
HETATM 10463 O  O   . HOH Z  6 .   ? -4.873  23.393  23.126  1.00 26.12 ? 2123 HOH B O   1 
HETATM 10464 O  O   . HOH Z  6 .   ? -2.679  20.609  23.878  1.00 24.66 ? 2124 HOH B O   1 
HETATM 10465 O  O   . HOH Z  6 .   ? 0.927   41.175  17.902  1.00 29.36 ? 2125 HOH B O   1 
HETATM 10466 O  O   . HOH Z  6 .   ? 9.375   32.824  14.994  1.00 19.10 ? 2126 HOH B O   1 
HETATM 10467 O  O   . HOH Z  6 .   ? 9.548   48.685  25.551  1.00 21.29 ? 2127 HOH B O   1 
HETATM 10468 O  O   . HOH Z  6 .   ? -1.563  28.570  10.495  1.00 20.01 ? 2128 HOH B O   1 
HETATM 10469 O  O   . HOH Z  6 .   ? -3.026  22.204  10.019  1.00 12.51 ? 2129 HOH B O   1 
HETATM 10470 O  O   . HOH Z  6 .   ? -3.903  21.013  11.795  1.00 34.76 ? 2130 HOH B O   1 
HETATM 10471 O  O   . HOH Z  6 .   ? -2.822  27.210  16.244  1.00 24.26 ? 2131 HOH B O   1 
HETATM 10472 O  O   . HOH Z  6 .   ? 11.411  31.174  12.391  1.00 14.50 ? 2132 HOH B O   1 
HETATM 10473 O  O   . HOH Z  6 .   ? -4.457  30.688  16.596  1.00 32.29 ? 2133 HOH B O   1 
HETATM 10474 O  O   . HOH Z  6 .   ? 6.858   33.806  15.732  1.00 19.22 ? 2134 HOH B O   1 
HETATM 10475 O  O   . HOH Z  6 .   ? -0.970  32.843  11.315  1.00 17.19 ? 2135 HOH B O   1 
HETATM 10476 O  O   . HOH Z  6 .   ? 0.413   33.418  13.580  1.00 22.72 ? 2136 HOH B O   1 
HETATM 10477 O  O   . HOH Z  6 .   ? 0.660   17.656  22.547  1.00 17.85 ? 2137 HOH B O   1 
HETATM 10478 O  O   . HOH Z  6 .   ? 2.328   20.437  15.586  1.00 21.68 ? 2138 HOH B O   1 
HETATM 10479 O  O   . HOH AA 6 .   ? 9.189   75.812  53.953  1.00 33.57 ? 2001 HOH C O   1 
HETATM 10480 O  O   . HOH AA 6 .   ? 10.026  76.906  51.810  1.00 20.71 ? 2002 HOH C O   1 
HETATM 10481 O  O   . HOH AA 6 .   ? 5.779   73.612  56.952  1.00 25.35 ? 2003 HOH C O   1 
HETATM 10482 O  O   . HOH AA 6 .   ? 0.127   67.187  50.547  1.00 27.89 ? 2004 HOH C O   1 
HETATM 10483 O  O   . HOH AA 6 .   ? -2.368  76.475  50.997  1.00 18.30 ? 2005 HOH C O   1 
HETATM 10484 O  O   . HOH AA 6 .   ? -1.598  84.171  49.827  1.00 19.91 ? 2006 HOH C O   1 
HETATM 10485 O  O   . HOH AA 6 .   ? -4.159  80.250  43.891  1.00 30.97 ? 2007 HOH C O   1 
HETATM 10486 O  O   . HOH AA 6 .   ? -0.329  83.155  42.194  1.00 26.00 ? 2008 HOH C O   1 
HETATM 10487 O  O   . HOH AA 6 .   ? 1.612   84.178  43.524  1.00 33.19 ? 2009 HOH C O   1 
HETATM 10488 O  O   . HOH AA 6 .   ? 3.395   84.731  52.555  1.00 21.53 ? 2010 HOH C O   1 
HETATM 10489 O  O   . HOH AA 6 .   ? 3.852   88.446  42.050  1.00 32.49 ? 2011 HOH C O   1 
HETATM 10490 O  O   . HOH AA 6 .   ? 16.686  88.502  34.306  1.00 41.28 ? 2012 HOH C O   1 
HETATM 10491 O  O   . HOH AA 6 .   ? 7.754   81.058  27.376  1.00 30.58 ? 2013 HOH C O   1 
HETATM 10492 O  O   . HOH AA 6 .   ? 9.653   74.109  35.996  1.00 17.86 ? 2014 HOH C O   1 
HETATM 10493 O  O   . HOH AA 6 .   ? 11.350  69.476  37.597  1.00 21.20 ? 2015 HOH C O   1 
HETATM 10494 O  O   . HOH AA 6 .   ? 8.551   73.323  55.286  1.00 30.12 ? 2016 HOH C O   1 
HETATM 10495 O  O   . HOH AA 6 .   ? 18.448  79.435  53.716  1.00 37.44 ? 2017 HOH C O   1 
HETATM 10496 O  O   . HOH AA 6 .   ? 18.082  82.311  42.079  1.00 38.05 ? 2018 HOH C O   1 
HETATM 10497 O  O   . HOH AA 6 .   ? 16.032  74.695  38.154  1.00 23.29 ? 2019 HOH C O   1 
HETATM 10498 O  O   . HOH AA 6 .   ? 11.674  67.278  35.848  1.00 18.45 ? 2020 HOH C O   1 
HETATM 10499 O  O   . HOH AA 6 .   ? 19.385  83.906  16.186  1.00 35.26 ? 2021 HOH C O   1 
HETATM 10500 O  O   . HOH AA 6 .   ? 28.708  77.859  17.601  1.00 36.87 ? 2022 HOH C O   1 
HETATM 10501 O  O   . HOH AA 6 .   ? 8.710   57.297  54.595  1.00 22.58 ? 2023 HOH C O   1 
HETATM 10502 O  O   . HOH AA 6 .   ? 14.258  69.580  18.006  1.00 26.48 ? 2024 HOH C O   1 
HETATM 10503 O  O   . HOH AA 6 .   ? 8.723   56.073  58.962  1.00 40.58 ? 2025 HOH C O   1 
HETATM 10504 O  O   . HOH AA 6 .   ? 17.663  69.929  32.080  1.00 28.23 ? 2026 HOH C O   1 
HETATM 10505 O  O   . HOH AA 6 .   ? 15.577  70.530  37.616  1.00 41.23 ? 2027 HOH C O   1 
HETATM 10506 O  O   . HOH AA 6 .   ? 18.242  78.127  39.231  1.00 34.25 ? 2028 HOH C O   1 
HETATM 10507 O  O   . HOH AA 6 .   ? 11.423  75.288  34.064  1.00 31.36 ? 2029 HOH C O   1 
HETATM 10508 O  O   . HOH AA 6 .   ? 13.620  79.242  29.292  1.00 28.52 ? 2030 HOH C O   1 
HETATM 10509 O  O   . HOH AA 6 .   ? 19.026  83.137  31.611  1.00 32.26 ? 2031 HOH C O   1 
HETATM 10510 O  O   . HOH AA 6 .   ? 1.166   65.046  20.067  1.00 47.87 ? 2032 HOH C O   1 
HETATM 10511 O  O   . HOH AA 6 .   ? 11.993  64.859  32.483  1.00 20.63 ? 2033 HOH C O   1 
HETATM 10512 O  O   . HOH AA 6 .   ? 8.913   66.170  35.995  1.00 19.85 ? 2034 HOH C O   1 
HETATM 10513 O  O   . HOH AA 6 .   ? 3.572   62.069  31.234  1.00 18.48 ? 2035 HOH C O   1 
HETATM 10514 O  O   . HOH AA 6 .   ? 1.545   57.798  31.449  1.00 31.51 ? 2036 HOH C O   1 
HETATM 10515 O  O   . HOH AA 6 .   ? -0.581  58.636  33.175  1.00 51.55 ? 2037 HOH C O   1 
HETATM 10516 O  O   . HOH AA 6 .   ? -2.746  50.642  30.683  1.00 33.02 ? 2038 HOH C O   1 
HETATM 10517 O  O   . HOH AA 6 .   ? 0.435   47.977  31.101  1.00 30.51 ? 2039 HOH C O   1 
HETATM 10518 O  O   . HOH AA 6 .   ? 12.592  45.494  31.119  1.00 35.41 ? 2040 HOH C O   1 
HETATM 10519 O  O   . HOH AA 6 .   ? -10.092 64.106  40.886  1.00 34.47 ? 2041 HOH C O   1 
HETATM 10520 O  O   . HOH AA 6 .   ? -14.378 61.821  44.791  1.00 27.30 ? 2042 HOH C O   1 
HETATM 10521 O  O   . HOH AA 6 .   ? -11.635 48.225  41.599  1.00 30.53 ? 2043 HOH C O   1 
HETATM 10522 O  O   . HOH AA 6 .   ? -5.563  65.505  50.373  1.00 31.02 ? 2044 HOH C O   1 
HETATM 10523 O  O   . HOH AA 6 .   ? -13.338 50.422  54.528  1.00 41.67 ? 2045 HOH C O   1 
HETATM 10524 O  O   . HOH AA 6 .   ? -7.288  43.001  58.228  1.00 38.61 ? 2046 HOH C O   1 
HETATM 10525 O  O   . HOH AA 6 .   ? -13.400 48.973  50.399  1.00 39.87 ? 2047 HOH C O   1 
HETATM 10526 O  O   . HOH AA 6 .   ? -3.611  41.982  53.006  1.00 30.71 ? 2048 HOH C O   1 
HETATM 10527 O  O   . HOH AA 6 .   ? 7.668   38.351  48.744  1.00 28.75 ? 2049 HOH C O   1 
HETATM 10528 O  O   . HOH AA 6 .   ? 7.579   56.806  52.223  1.00 15.05 ? 2050 HOH C O   1 
HETATM 10529 O  O   . HOH AA 6 .   ? 7.057   53.044  53.908  1.00 23.97 ? 2051 HOH C O   1 
HETATM 10530 O  O   . HOH AA 6 .   ? 0.015   58.872  55.378  1.00 20.66 ? 2052 HOH C O   1 
HETATM 10531 O  O   . HOH AA 6 .   ? 6.998   59.040  56.023  1.00 20.51 ? 2053 HOH C O   1 
HETATM 10532 O  O   . HOH AA 6 .   ? 0.384   60.606  57.706  1.00 20.09 ? 2054 HOH C O   1 
HETATM 10533 O  O   . HOH AA 6 .   ? 5.605   55.585  58.054  1.00 33.94 ? 2055 HOH C O   1 
HETATM 10534 O  O   . HOH AA 6 .   ? -2.518  46.802  58.334  1.00 30.82 ? 2056 HOH C O   1 
HETATM 10535 O  O   . HOH AA 6 .   ? -4.357  54.960  58.071  1.00 44.52 ? 2057 HOH C O   1 
HETATM 10536 O  O   . HOH AA 6 .   ? 4.068   35.735  53.800  1.00 38.89 ? 2058 HOH C O   1 
HETATM 10537 O  O   . HOH AA 6 .   ? 1.862   64.472  61.227  1.00 37.62 ? 2059 HOH C O   1 
HETATM 10538 O  O   . HOH AA 6 .   ? 9.623   64.600  63.458  1.00 27.27 ? 2060 HOH C O   1 
HETATM 10539 O  O   . HOH AA 6 .   ? 9.388   52.909  64.544  1.00 33.07 ? 2061 HOH C O   1 
HETATM 10540 O  O   . HOH AA 6 .   ? 12.538  33.467  58.622  1.00 31.63 ? 2062 HOH C O   1 
HETATM 10541 O  O   . HOH AA 6 .   ? 10.164  35.892  60.183  1.00 31.30 ? 2063 HOH C O   1 
HETATM 10542 O  O   . HOH AA 6 .   ? 20.073  51.868  47.867  1.00 38.15 ? 2064 HOH C O   1 
HETATM 10543 O  O   . HOH AA 6 .   ? 21.617  50.659  41.367  1.00 25.50 ? 2065 HOH C O   1 
HETATM 10544 O  O   . HOH AA 6 .   ? 21.534  58.915  29.581  1.00 41.76 ? 2066 HOH C O   1 
HETATM 10545 O  O   . HOH AA 6 .   ? 17.687  60.949  35.051  1.00 30.40 ? 2067 HOH C O   1 
HETATM 10546 O  O   . HOH AA 6 .   ? 15.703  62.399  33.982  1.00 35.69 ? 2068 HOH C O   1 
HETATM 10547 O  O   . HOH AA 6 .   ? 15.775  47.494  28.539  1.00 33.63 ? 2069 HOH C O   1 
HETATM 10548 O  O   . HOH AA 6 .   ? 8.020   46.430  24.571  1.00 17.25 ? 2070 HOH C O   1 
HETATM 10549 O  O   . HOH AA 6 .   ? -2.947  57.645  25.751  1.00 39.23 ? 2071 HOH C O   1 
HETATM 10550 O  O   . HOH AA 6 .   ? 3.661   64.704  30.627  1.00 35.43 ? 2072 HOH C O   1 
HETATM 10551 O  O   . HOH AA 6 .   ? -3.533  63.852  28.122  1.00 36.60 ? 2073 HOH C O   1 
HETATM 10552 O  O   . HOH AA 6 .   ? -6.959  70.917  33.482  1.00 35.58 ? 2074 HOH C O   1 
HETATM 10553 O  O   . HOH AA 6 .   ? -0.677  81.326  40.325  1.00 28.22 ? 2075 HOH C O   1 
HETATM 10554 O  O   . HOH AA 6 .   ? -8.312  64.971  38.961  1.00 33.36 ? 2076 HOH C O   1 
HETATM 10555 O  O   . HOH AA 6 .   ? -5.362  72.623  39.804  1.00 32.05 ? 2077 HOH C O   1 
HETATM 10556 O  O   . HOH AA 6 .   ? 2.184   65.945  38.702  1.00 20.66 ? 2078 HOH C O   1 
HETATM 10557 O  O   . HOH AA 6 .   ? 8.099   64.359  40.144  1.00 22.61 ? 2079 HOH C O   1 
HETATM 10558 O  O   . HOH AA 6 .   ? -3.289  59.606  42.769  1.00 24.91 ? 2080 HOH C O   1 
HETATM 10559 O  O   . HOH AA 6 .   ? -2.538  62.264  41.606  1.00 25.60 ? 2081 HOH C O   1 
HETATM 10560 O  O   . HOH AA 6 .   ? -7.683  64.128  45.467  1.00 50.11 ? 2082 HOH C O   1 
HETATM 10561 O  O   . HOH AA 6 .   ? 2.441   59.337  41.802  1.00 19.54 ? 2083 HOH C O   1 
HETATM 10562 O  O   . HOH AA 6 .   ? -4.991  64.622  47.971  1.00 27.20 ? 2084 HOH C O   1 
HETATM 10563 O  O   . HOH AA 6 .   ? -2.643  59.183  47.030  1.00 24.34 ? 2085 HOH C O   1 
HETATM 10564 O  O   . HOH AA 6 .   ? 4.850   65.993  39.022  1.00 20.78 ? 2086 HOH C O   1 
HETATM 10565 O  O   . HOH AA 6 .   ? -2.127  59.825  53.744  1.00 22.14 ? 2087 HOH C O   1 
HETATM 10566 O  O   . HOH BA 6 .   ? 37.151  104.864 7.966   1.00 51.87 ? 2001 HOH D O   1 
HETATM 10567 O  O   . HOH BA 6 .   ? 38.453  103.536 15.479  1.00 55.64 ? 2002 HOH D O   1 
HETATM 10568 O  O   . HOH BA 6 .   ? 43.843  91.913  8.677   1.00 39.64 ? 2003 HOH D O   1 
HETATM 10569 O  O   . HOH BA 6 .   ? 41.170  92.858  10.320  1.00 38.13 ? 2004 HOH D O   1 
HETATM 10570 O  O   . HOH BA 6 .   ? 48.088  71.092  7.968   1.00 25.69 ? 2005 HOH D O   1 
HETATM 10571 O  O   . HOH BA 6 .   ? 44.394  75.750  0.606   1.00 12.91 ? 2006 HOH D O   1 
HETATM 10572 O  O   . HOH BA 6 .   ? 48.824  73.119  5.009   1.00 32.21 ? 2007 HOH D O   1 
HETATM 10573 O  O   . HOH BA 6 .   ? 45.841  72.249  7.169   1.00 18.12 ? 2008 HOH D O   1 
HETATM 10574 O  O   . HOH BA 6 .   ? 44.992  73.286  0.117   1.00 34.23 ? 2009 HOH D O   1 
HETATM 10575 O  O   . HOH BA 6 .   ? 43.658  68.108  0.581   1.00 22.87 ? 2010 HOH D O   1 
HETATM 10576 O  O   . HOH BA 6 .   ? 32.462  67.533  0.622   1.00 34.87 ? 2011 HOH D O   1 
HETATM 10577 O  O   . HOH BA 6 .   ? 31.930  64.400  4.278   1.00 29.34 ? 2012 HOH D O   1 
HETATM 10578 O  O   . HOH BA 6 .   ? 43.571  71.211  9.729   1.00 23.18 ? 2013 HOH D O   1 
HETATM 10579 O  O   . HOH BA 6 .   ? 42.361  71.104  13.784  1.00 32.01 ? 2014 HOH D O   1 
HETATM 10580 O  O   . HOH BA 6 .   ? 36.135  78.530  13.790  1.00 36.69 ? 2015 HOH D O   1 
HETATM 10581 O  O   . HOH BA 6 .   ? 38.836  78.999  13.575  1.00 24.93 ? 2016 HOH D O   1 
HETATM 10582 O  O   . HOH BA 6 .   ? 45.276  70.580  11.869  1.00 20.37 ? 2017 HOH D O   1 
HETATM 10583 O  O   . HOH BA 6 .   ? 42.509  71.163  6.471   1.00 12.96 ? 2018 HOH D O   1 
HETATM 10584 O  O   . HOH BA 6 .   ? 46.886  84.020  9.688   1.00 39.50 ? 2019 HOH D O   1 
HETATM 10585 O  O   . HOH BA 6 .   ? 41.449  83.268  15.237  1.00 25.39 ? 2020 HOH D O   1 
HETATM 10586 O  O   . HOH BA 6 .   ? 40.172  89.152  -1.150  1.00 37.71 ? 2021 HOH D O   1 
HETATM 10587 O  O   . HOH BA 6 .   ? 44.145  90.783  15.986  1.00 33.73 ? 2022 HOH D O   1 
HETATM 10588 O  O   . HOH BA 6 .   ? 41.548  105.598 3.120   1.00 34.95 ? 2023 HOH D O   1 
HETATM 10589 O  O   . HOH BA 6 .   ? 38.492  94.690  -1.938  1.00 37.38 ? 2024 HOH D O   1 
HETATM 10590 O  O   . HOH BA 6 .   ? 31.048  77.729  -5.630  1.00 9.03  ? 2025 HOH D O   1 
HETATM 10591 O  O   . HOH BA 6 .   ? 31.297  84.576  -3.113  1.00 18.21 ? 2026 HOH D O   1 
HETATM 10592 O  O   . HOH BA 6 .   ? 48.523  76.133  -2.359  1.00 35.69 ? 2027 HOH D O   1 
HETATM 10593 O  O   . HOH BA 6 .   ? 50.270  80.567  -2.899  1.00 42.50 ? 2028 HOH D O   1 
HETATM 10594 O  O   . HOH BA 6 .   ? 44.784  89.549  1.607   1.00 25.76 ? 2029 HOH D O   1 
HETATM 10595 O  O   . HOH BA 6 .   ? 44.443  89.570  5.622   1.00 33.02 ? 2030 HOH D O   1 
HETATM 10596 O  O   . HOH BA 6 .   ? 41.806  87.200  -0.790  1.00 34.60 ? 2031 HOH D O   1 
HETATM 10597 O  O   . HOH BA 6 .   ? 37.217  88.569  -2.314  1.00 21.51 ? 2032 HOH D O   1 
HETATM 10598 O  O   . HOH BA 6 .   ? 32.182  86.380  1.667   1.00 16.11 ? 2033 HOH D O   1 
HETATM 10599 O  O   . HOH BA 6 .   ? 29.274  85.227  -4.658  1.00 15.94 ? 2034 HOH D O   1 
HETATM 10600 O  O   . HOH BA 6 .   ? 25.898  87.383  -6.092  1.00 15.47 ? 2035 HOH D O   1 
HETATM 10601 O  O   . HOH BA 6 .   ? 33.797  66.302  -13.131 1.00 20.24 ? 2036 HOH D O   1 
HETATM 10602 O  O   . HOH BA 6 .   ? 21.508  98.696  -4.333  1.00 25.04 ? 2037 HOH D O   1 
HETATM 10603 O  O   . HOH BA 6 .   ? 20.459  101.025 -1.825  1.00 23.09 ? 2038 HOH D O   1 
HETATM 10604 O  O   . HOH BA 6 .   ? 33.125  87.434  -5.795  1.00 27.26 ? 2039 HOH D O   1 
HETATM 10605 O  O   . HOH BA 6 .   ? 32.735  89.521  1.670   1.00 31.58 ? 2040 HOH D O   1 
HETATM 10606 O  O   . HOH BA 6 .   ? 29.862  94.096  9.499   1.00 32.37 ? 2041 HOH D O   1 
HETATM 10607 O  O   . HOH BA 6 .   ? 38.800  95.302  4.997   1.00 38.14 ? 2042 HOH D O   1 
HETATM 10608 O  O   . HOH BA 6 .   ? 33.204  95.524  4.182   1.00 24.28 ? 2043 HOH D O   1 
HETATM 10609 O  O   . HOH BA 6 .   ? 35.539  97.380  -0.126  1.00 32.87 ? 2044 HOH D O   1 
HETATM 10610 O  O   . HOH BA 6 .   ? 36.393  64.122  0.709   1.00 28.97 ? 2045 HOH D O   1 
HETATM 10611 O  O   . HOH BA 6 .   ? 39.294  97.997  3.107   1.00 32.66 ? 2046 HOH D O   1 
HETATM 10612 O  O   . HOH BA 6 .   ? 38.486  100.342 -3.686  1.00 30.35 ? 2047 HOH D O   1 
HETATM 10613 O  O   . HOH BA 6 .   ? 34.498  94.781  -4.589  1.00 24.31 ? 2048 HOH D O   1 
HETATM 10614 O  O   . HOH BA 6 .   ? 35.835  95.809  -2.379  1.00 42.80 ? 2049 HOH D O   1 
HETATM 10615 O  O   . HOH BA 6 .   ? 15.016  93.362  -0.142  1.00 46.73 ? 2050 HOH D O   1 
HETATM 10616 O  O   . HOH BA 6 .   ? 17.092  91.596  4.269   1.00 27.02 ? 2051 HOH D O   1 
HETATM 10617 O  O   . HOH BA 6 .   ? 20.452  83.825  -0.312  1.00 18.33 ? 2052 HOH D O   1 
HETATM 10618 O  O   . HOH BA 6 .   ? 27.471  83.410  -3.885  1.00 18.63 ? 2053 HOH D O   1 
HETATM 10619 O  O   . HOH BA 6 .   ? 18.983  82.536  -2.443  1.00 25.70 ? 2054 HOH D O   1 
HETATM 10620 O  O   . HOH BA 6 .   ? 24.446  80.932  -23.491 1.00 45.65 ? 2055 HOH D O   1 
HETATM 10621 O  O   . HOH BA 6 .   ? 25.825  76.310  -24.826 1.00 40.19 ? 2056 HOH D O   1 
HETATM 10622 O  O   . HOH BA 6 .   ? 19.126  81.932  -22.131 1.00 36.27 ? 2057 HOH D O   1 
HETATM 10623 O  O   . HOH BA 6 .   ? 23.356  71.593  -25.411 1.00 53.12 ? 2058 HOH D O   1 
HETATM 10624 O  O   . HOH BA 6 .   ? 13.606  81.873  -20.320 1.00 41.99 ? 2059 HOH D O   1 
HETATM 10625 O  O   . HOH BA 6 .   ? 20.432  68.207  6.510   1.00 33.15 ? 2060 HOH D O   1 
HETATM 10626 O  O   . HOH BA 6 .   ? 19.247  61.687  6.983   1.00 32.45 ? 2061 HOH D O   1 
HETATM 10627 O  O   . HOH BA 6 .   ? 18.060  64.565  8.067   1.00 34.78 ? 2062 HOH D O   1 
HETATM 10628 O  O   . HOH BA 6 .   ? 16.118  58.114  -0.630  1.00 33.15 ? 2063 HOH D O   1 
HETATM 10629 O  O   . HOH BA 6 .   ? 27.335  65.753  2.310   1.00 24.32 ? 2064 HOH D O   1 
HETATM 10630 O  O   . HOH BA 6 .   ? 17.548  57.573  3.943   1.00 43.81 ? 2065 HOH D O   1 
HETATM 10631 O  O   . HOH BA 6 .   ? 25.541  52.392  -5.104  1.00 33.36 ? 2066 HOH D O   1 
HETATM 10632 O  O   . HOH BA 6 .   ? 25.783  52.069  -7.976  1.00 35.33 ? 2067 HOH D O   1 
HETATM 10633 O  O   . HOH BA 6 .   ? 14.153  55.416  -7.678  1.00 35.27 ? 2068 HOH D O   1 
HETATM 10634 O  O   . HOH BA 6 .   ? 17.688  55.148  -16.864 1.00 31.89 ? 2069 HOH D O   1 
HETATM 10635 O  O   . HOH BA 6 .   ? 11.475  56.754  -18.270 1.00 43.20 ? 2070 HOH D O   1 
HETATM 10636 O  O   . HOH BA 6 .   ? 19.471  54.877  -21.240 1.00 28.80 ? 2071 HOH D O   1 
HETATM 10637 O  O   . HOH BA 6 .   ? 29.985  64.596  -15.383 1.00 16.47 ? 2072 HOH D O   1 
HETATM 10638 O  O   . HOH BA 6 .   ? 31.543  67.314  -12.452 1.00 19.39 ? 2073 HOH D O   1 
HETATM 10639 O  O   . HOH BA 6 .   ? 31.051  61.388  -6.514  1.00 18.73 ? 2074 HOH D O   1 
HETATM 10640 O  O   . HOH BA 6 .   ? 34.985  64.698  -11.189 1.00 16.99 ? 2075 HOH D O   1 
HETATM 10641 O  O   . HOH BA 6 .   ? 33.638  60.143  -6.073  1.00 18.41 ? 2076 HOH D O   1 
HETATM 10642 O  O   . HOH BA 6 .   ? 33.551  61.395  -13.460 1.00 29.21 ? 2077 HOH D O   1 
HETATM 10643 O  O   . HOH BA 6 .   ? 28.614  53.834  -15.632 1.00 30.95 ? 2078 HOH D O   1 
HETATM 10644 O  O   . HOH BA 6 .   ? 27.605  52.709  -10.781 1.00 33.14 ? 2079 HOH D O   1 
HETATM 10645 O  O   . HOH BA 6 .   ? 24.484  53.583  -14.382 1.00 32.03 ? 2080 HOH D O   1 
HETATM 10646 O  O   . HOH BA 6 .   ? 24.155  56.003  -20.690 1.00 31.42 ? 2081 HOH D O   1 
HETATM 10647 O  O   . HOH BA 6 .   ? 18.718  56.737  -25.739 1.00 34.05 ? 2082 HOH D O   1 
HETATM 10648 O  O   . HOH BA 6 .   ? 23.661  66.923  -27.521 1.00 28.65 ? 2083 HOH D O   1 
HETATM 10649 O  O   . HOH BA 6 .   ? 34.957  67.067  -1.186  1.00 17.50 ? 2084 HOH D O   1 
HETATM 10650 O  O   . HOH BA 6 .   ? 35.320  62.195  -5.887  1.00 28.93 ? 2085 HOH D O   1 
HETATM 10651 O  O   . HOH BA 6 .   ? 37.882  62.648  -5.050  1.00 27.80 ? 2086 HOH D O   1 
HETATM 10652 O  O   . HOH BA 6 .   ? 40.430  71.502  -4.180  1.00 38.06 ? 2087 HOH D O   1 
HETATM 10653 O  O   . HOH BA 6 .   ? 38.533  64.579  2.432   1.00 26.87 ? 2088 HOH D O   1 
HETATM 10654 O  O   . HOH BA 6 .   ? 46.707  60.798  2.776   1.00 37.39 ? 2089 HOH D O   1 
HETATM 10655 O  O   . HOH BA 6 .   ? 45.779  63.791  -1.828  1.00 45.20 ? 2090 HOH D O   1 
HETATM 10656 O  O   . HOH BA 6 .   ? 34.181  51.740  -21.369 1.00 38.18 ? 2091 HOH D O   1 
HETATM 10657 O  O   . HOH BA 6 .   ? 24.839  63.924  -5.104  1.00 36.67 ? 2092 HOH D O   1 
HETATM 10658 O  O   . HOH BA 6 .   ? 30.537  85.968  -6.893  1.00 26.30 ? 2093 HOH D O   1 
HETATM 10659 O  O   . HOH BA 6 .   ? 26.675  85.839  -15.008 1.00 29.65 ? 2094 HOH D O   1 
HETATM 10660 O  O   . HOH BA 6 .   ? 27.664  93.196  -16.920 1.00 42.20 ? 2095 HOH D O   1 
HETATM 10661 O  O   . HOH BA 6 .   ? 27.745  86.996  -12.848 1.00 30.70 ? 2096 HOH D O   1 
HETATM 10662 O  O   . HOH BA 6 .   ? 26.990  87.218  -10.379 1.00 24.98 ? 2097 HOH D O   1 
HETATM 10663 O  O   . HOH BA 6 .   ? 10.192  81.198  -0.949  1.00 50.79 ? 2098 HOH D O   1 
HETATM 10664 O  O   . HOH BA 6 .   ? 14.477  80.877  4.289   1.00 26.34 ? 2099 HOH D O   1 
HETATM 10665 O  O   . HOH BA 6 .   ? 23.787  80.433  13.857  1.00 25.01 ? 2100 HOH D O   1 
HETATM 10666 O  O   . HOH BA 6 .   ? 33.756  79.655  13.014  1.00 16.85 ? 2101 HOH D O   1 
HETATM 10667 O  O   . HOH BA 6 .   ? 17.916  76.112  5.443   1.00 34.87 ? 2102 HOH D O   1 
HETATM 10668 O  O   . HOH BA 6 .   ? 25.561  77.157  0.003   1.00 15.39 ? 2103 HOH D O   1 
HETATM 10669 O  O   . HOH BA 6 .   ? 27.111  78.594  -1.774  1.00 23.06 ? 2104 HOH D O   1 
HETATM 10670 O  O   . HOH BA 6 .   ? 29.424  61.747  -4.146  1.00 21.96 ? 2105 HOH D O   1 
HETATM 10671 O  O   . HOH BA 6 .   ? 23.697  72.885  -5.312  1.00 17.14 ? 2106 HOH D O   1 
HETATM 10672 O  O   . HOH BA 6 .   ? 24.604  66.179  -3.342  1.00 26.67 ? 2107 HOH D O   1 
HETATM 10673 O  O   . HOH BA 6 .   ? 21.635  68.982  -1.481  1.00 27.95 ? 2108 HOH D O   1 
HETATM 10674 O  O   . HOH BA 6 .   ? 28.447  78.875  -5.173  1.00 16.45 ? 2109 HOH D O   1 
HETATM 10675 O  O   . HOH BA 6 .   ? 23.983  65.984  3.704   1.00 31.18 ? 2110 HOH D O   1 
HETATM 10676 O  O   . HOH BA 6 .   ? 22.706  71.141  0.070   1.00 28.42 ? 2111 HOH D O   1 
HETATM 10677 O  O   . HOH BA 6 .   ? 31.408  61.243  -2.461  1.00 26.56 ? 2112 HOH D O   1 
HETATM 10678 O  O   . HOH BA 6 .   ? 25.153  88.707  -8.354  1.00 36.46 ? 2113 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   2   2   SER SER A . n 
A 1 2   MET 2   3   3   MET MET A . n 
A 1 3   THR 3   4   4   THR THR A . n 
A 1 4   LYS 4   5   5   LYS LYS A . n 
A 1 5   THR 5   6   6   THR THR A . n 
A 1 6   TRP 6   7   7   TRP TRP A . n 
A 1 7   THR 7   8   8   THR THR A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   LYS 9   10  10  LYS LYS A . n 
A 1 10  LYS 10  11  11  LYS LYS A . n 
A 1 11  HIS 11  12  12  HIS HIS A . n 
A 1 12  PHE 12  13  13  PHE PHE A . n 
A 1 13  VAL 13  14  14  VAL VAL A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  TYR 15  16  16  TYR TYR A . n 
A 1 16  PRO 16  17  17  PRO PRO A . n 
A 1 17  THR 17  18  18  THR THR A . n 
A 1 18  ASN 18  19  19  ASN ASN A . n 
A 1 19  SER 19  20  20  SER SER A . n 
A 1 20  ASP 20  21  21  ASP ASP A . n 
A 1 21  PHE 21  22  22  PHE PHE A . n 
A 1 22  GLU 22  23  23  GLU GLU A . n 
A 1 23  LEU 23  24  24  LEU LEU A . n 
A 1 24  LYS 24  25  25  LYS LYS A . n 
A 1 25  THR 25  26  26  THR THR A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  GLU 27  28  28  GLU GLU A . n 
A 1 28  LEU 28  29  29  LEU LEU A . n 
A 1 29  PRO 29  30  30  PRO PRO A . n 
A 1 30  PRO 30  31  31  PRO PRO A . n 
A 1 31  LEU 31  32  32  LEU LEU A . n 
A 1 32  LYS 32  33  33  LYS LYS A . n 
A 1 33  ASN 33  34  34  ASN ASN A . n 
A 1 34  GLY 34  35  35  GLY GLY A . n 
A 1 35  GLU 35  36  36  GLU GLU A . n 
A 1 36  VAL 36  37  37  VAL VAL A . n 
A 1 37  LEU 37  38  38  LEU LEU A . n 
A 1 38  LEU 38  39  39  LEU LEU A . n 
A 1 39  GLU 39  40  40  GLU GLU A . n 
A 1 40  ALA 40  41  41  ALA ALA A . n 
A 1 41  LEU 41  42  42  LEU LEU A . n 
A 1 42  PHE 42  43  43  PHE PHE A . n 
A 1 43  LEU 43  44  44  LEU LEU A . n 
A 1 44  THR 44  45  45  THR THR A . n 
A 1 45  VAL 45  46  46  VAL VAL A . n 
A 1 46  ASP 46  47  47  ASP ASP A . n 
A 1 47  PRO 47  48  48  PRO PRO A . n 
A 1 48  TYR 48  49  49  TYR TYR A . n 
A 1 49  MET 49  50  50  MET MET A . n 
A 1 50  ARG 50  51  51  ARG ARG A . n 
A 1 51  VAL 51  52  52  VAL VAL A . n 
A 1 52  ALA 52  53  53  ALA ALA A . n 
A 1 53  ALA 53  54  54  ALA ALA A . n 
A 1 54  LYS 54  55  55  LYS LYS A . n 
A 1 55  ARG 55  56  56  ARG ARG A . n 
A 1 56  LEU 56  57  57  LEU LEU A . n 
A 1 57  LYS 57  58  58  LYS LYS A . n 
A 1 58  GLU 58  59  59  GLU GLU A . n 
A 1 59  GLY 59  60  60  GLY GLY A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  THR 61  62  62  THR THR A . n 
A 1 62  MET 62  63  63  MET MET A . n 
A 1 63  MET 63  64  64  MET MET A . n 
A 1 64  GLY 64  65  65  GLY GLY A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  GLN 66  67  67  GLN GLN A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  ALA 68  69  69  ALA ALA A . n 
A 1 69  LYS 69  70  70  LYS LYS A . n 
A 1 70  VAL 70  71  71  VAL VAL A . n 
A 1 71  VAL 71  72  72  VAL VAL A . n 
A 1 72  GLU 72  73  73  GLU GLU A . n 
A 1 73  SER 73  74  74  SER SER A . n 
A 1 74  LYS 74  75  75  LYS LYS A . n 
A 1 75  ASN 75  76  76  ASN ASN A . n 
A 1 76  VAL 76  77  77  VAL VAL A . n 
A 1 77  ALA 77  78  78  ALA ALA A . n 
A 1 78  LEU 78  79  79  LEU LEU A . n 
A 1 79  PRO 79  80  80  PRO PRO A . n 
A 1 80  LYS 80  81  81  LYS LYS A . n 
A 1 81  GLY 81  8