data_2Y1Y
# 
_entry.id   2Y1Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y1Y         
PDBE  EBI-46622    
WWPDB D_1290046622 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2WJ7 unspecified 'HUMAN ALPHAB CRYSTALLIN'                          
PDB 2Y22 unspecified 'HUMAN ALPHAB-CRYSTALLIN DOMAIN (RESIDUES 67-157)' 
PDB 2Y1Z unspecified 'HUMAN ALPHAB CRYSTALLIN ACD R120G'                
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y1Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Naylor, C.E.' 1 
'Bagneris, C.' 2 
'Clark, A.R.'  3 
'Keep, N.H.'   4 
'Slingsby, C.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal Structure of R120G Disease Mutant of Human Alphab-Crystallin Domain Dimer Shows Closure of a Groove' J.Mol.Biol. 
408 118  ? 2011 JMOBAK UK 0022-2836 0070 ? 21329698 10.1016/J.JMB.2011.02.020 
1       'Crystal Structures of Alpha-Crystallin Domain Dimers of Alphab-Crystallin and Hsp20.'                        J.Mol.Biol. 
392 1242 ? 2009 JMOBAK UK 0022-2836 0070 ? 19646995 10.1016/J.JMB.2009.07.069 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Clark, A.R.'   1  ? 
primary 'Naylor, C.E.'  2  ? 
primary 'Bagneris, C.'  3  ? 
primary 'Keep, N.H.'    4  ? 
primary 'Slingsby, C.'  5  ? 
1       'Bagneris, C.'  6  ? 
1       'Bateman, O.A.' 7  ? 
1       'Naylor, C.E.'  8  ? 
1       'Cronin, N.'    9  ? 
1       'Boelens, W.C.' 10 ? 
1       'Keep, N.H.'    11 ? 
1       'Slingsby, C.'  12 ? 
# 
_cell.entry_id           2Y1Y 
_cell.length_a           36.030 
_cell.length_b           36.030 
_cell.length_c           148.320 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y1Y 
_symmetry.space_group_name_H-M             'P 43 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                95 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ALPHA-CRYSTALLIN B CHAIN,'     10310.271 1  ? YES 'ALPHA-CRYSTALLIN DOMAIN (ACD), RESIDUES 71-157' 
'SELENOMETHIONE CONTAINING PROTEIN' 
2 non-polymer syn '(4R)-2-METHYLPENTANE-2,4-DIOL' 118.174   1  ? ?   ?                                                ? 
3 water       nat water                           18.015    63 ? ?   ?                                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ALPHAB-CRYSTALLIN, ALPHA(B)-CRYSTALLIN, HEAT SHOCK PROTEIN BETA-5, HSPB5, RENAL CARCINOMA ANTIGEN NY-REN-27, ROSENTHAL FIBER COMPONENT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GA(MSE)EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSS(MSE)SS
DGVLTVNGPRKQVSGPER
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSMSSDGVLTVNG
PRKQVSGPER
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MSE n 
1 4  GLU n 
1 5  LYS n 
1 6  ASP n 
1 7  ARG n 
1 8  PHE n 
1 9  SER n 
1 10 VAL n 
1 11 ASN n 
1 12 LEU n 
1 13 ASP n 
1 14 VAL n 
1 15 LYS n 
1 16 HIS n 
1 17 PHE n 
1 18 SER n 
1 19 PRO n 
1 20 GLU n 
1 21 GLU n 
1 22 LEU n 
1 23 LYS n 
1 24 VAL n 
1 25 LYS n 
1 26 VAL n 
1 27 LEU n 
1 28 GLY n 
1 29 ASP n 
1 30 VAL n 
1 31 ILE n 
1 32 GLU n 
1 33 VAL n 
1 34 HIS n 
1 35 GLY n 
1 36 LYS n 
1 37 HIS n 
1 38 GLU n 
1 39 GLU n 
1 40 ARG n 
1 41 GLN n 
1 42 ASP n 
1 43 GLU n 
1 44 HIS n 
1 45 GLY n 
1 46 PHE n 
1 47 ILE n 
1 48 SER n 
1 49 ARG n 
1 50 GLU n 
1 51 PHE n 
1 52 HIS n 
1 53 ARG n 
1 54 LYS n 
1 55 TYR n 
1 56 ARG n 
1 57 ILE n 
1 58 PRO n 
1 59 ALA n 
1 60 ASP n 
1 61 VAL n 
1 62 ASP n 
1 63 PRO n 
1 64 LEU n 
1 65 THR n 
1 66 ILE n 
1 67 THR n 
1 68 SER n 
1 69 SER n 
1 70 MSE n 
1 71 SER n 
1 72 SER n 
1 73 ASP n 
1 74 GLY n 
1 75 VAL n 
1 76 LEU n 
1 77 THR n 
1 78 VAL n 
1 79 ASN n 
1 80 GLY n 
1 81 PRO n 
1 82 ARG n 
1 83 LYS n 
1 84 GLN n 
1 85 VAL n 
1 86 SER n 
1 87 GLY n 
1 88 PRO n 
1 89 GLU n 
1 90 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               'PPROEX HT(B)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CRYAB_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P02511 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Y1Y 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 90 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02511 
_struct_ref_seq.db_align_beg                  71 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       71 
_struct_ref_seq.pdbx_auth_seq_align_end       157 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y1Y GLY A 1  ? UNP P02511 ?   ?   'expression tag'      68  1 
1 2Y1Y ALA A 2  ? UNP P02511 ?   ?   'expression tag'      69  2 
1 2Y1Y MSE A 3  ? UNP P02511 ?   ?   'expression tag'      70  3 
1 2Y1Y MSE A 70 ? UNP P02511 LEU 137 'engineered mutation' 137 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MRD non-polymer         . '(4R)-2-METHYLPENTANE-2,4-DIOL' ? 'C6 H14 O2'      118.174 
MSE 'L-peptide linking' n SELENOMETHIONINE                ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Y1Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   38 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;SITTING DROPS, 20 MG/ML PROTEIN IN 25 MM TRIS, PH8.5, 200 MM NACL. EQUILIBRATED AGAINST MOTHER LIQUOR OF 110 MM BICINE, PH 9.0, 40% MPD
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2009-05-09 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9794 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_wavelength             0.9794 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y1Y 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.01 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   7272 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.60 
_reflns.B_iso_Wilson_estimate        21.4 
_reflns.pdbx_redundancy              25.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.32 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    11.60 
_reflns_shell.pdbx_redundancy        26.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y1Y 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     7272 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.012 
_refine.ls_d_res_high                            2.000 
_refine.ls_percent_reflns_obs                    99.83 
_refine.ls_R_factor_obs                          0.2051 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2044 
_refine.ls_R_factor_R_free                       0.2211 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  588 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.6 
_refine.aniso_B[1][1]                            3.1894 
_refine.aniso_B[2][2]                            3.1894 
_refine.aniso_B[3][3]                            -6.3788 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.342 
_refine.solvent_model_param_bsol                 54.580 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2WJ7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.22 
_refine.pdbx_overall_phase_error                 18.40 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        603 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             63 
_refine_hist.number_atoms_total               674 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        35.012 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 638 'X-RAY DIFFRACTION' ? 
f_angle_d          0.673  ? ? 866 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.180 ? ? 240 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.049  ? ? 95  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 114 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.0000 2.2013  2971 0.1848 100.00 0.1808 . . 158 . . 
'X-RAY DIFFRACTION' . 2.2013 2.5197  3034 0.1998 100.00 0.2492 . . 123 . . 
'X-RAY DIFFRACTION' . 2.5197 3.1743  3005 0.2091 100.00 0.2484 . . 145 . . 
'X-RAY DIFFRACTION' . 3.1743 35.0171 2984 0.2055 100.00 0.2093 . . 162 . . 
# 
_struct.entry_id                  2Y1Y 
_struct.title                     'Human alphaB crystallin ACD(residues 71-157)' 
_struct.pdbx_descriptor           'ALPHA-CRYSTALLIN B CHAIN,' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y1Y 
_struct_keywords.pdbx_keywords   CHAPERONE 
_struct_keywords.text            'SMALL HEAT SHOCK PROTEIN, CHAPERONE, STRESS PROTEIN, EYE LENS PROTEIN, CATARACT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 18 ? GLU A 20 ? SER A 85  GLU A 87  5 ? 3 
HELX_P HELX_P2 2 ASP A 62 ? ILE A 66 ? ASP A 129 ILE A 133 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A SER 69 C ? ? ? 1_555 A MSE 70 N ? ? A SER 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2 covale both ? A MSE 70 C ? ? ? 1_555 A SER 71 N ? ? A MSE 137 A SER 138 1_555 ? ? ? ? ? ? ? 1.329 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 8  ? ASP A 13 ? PHE A 75  ASP A 80  
AA 2 VAL A 75 ? GLY A 80 ? VAL A 142 GLY A 147 
AA 3 THR A 67 ? MSE A 70 ? THR A 134 MSE A 137 
AB 1 LEU A 22 ? LEU A 27 ? LEU A 89  LEU A 94  
AB 2 VAL A 30 ? GLN A 41 ? VAL A 97  GLN A 108 
AB 3 PHE A 46 ? ARG A 56 ? PHE A 113 ARG A 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 12 ? N LEU A 79  O LEU A 76 ? O LEU A 143 
AA 2 3 N ASN A 79 ? N ASN A 146 O THR A 67 ? O THR A 134 
AB 1 2 N LEU A 27 ? N LEU A 94  O VAL A 30 ? O VAL A 97  
AB 2 3 N ARG A 40 ? N ARG A 107 O ILE A 47 ? O ILE A 114 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE MRD A 1151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 LEU A 22 ? LEU A 89   . ? 1_555 ? 
2 AC1 5 SER A 68 ? SER A 135  . ? 1_555 ? 
3 AC1 5 SER A 69 ? SER A 136  . ? 1_555 ? 
4 AC1 5 MSE A 70 ? MSE A 137  . ? 5_455 ? 
5 AC1 5 HOH C .  ? HOH A 2063 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y1Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y1Y 
_atom_sites.fract_transf_matrix[1][1]   0.027755 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.027755 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006742 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . ASP A 1 6  ? -12.859 -10.307 5.215  1.00 81.69 ? 73   ASP A N   1 
ATOM   2   C  CA  . ASP A 1 6  ? -11.461 -10.290 5.627  1.00 82.81 ? 73   ASP A CA  1 
ATOM   3   C  C   . ASP A 1 6  ? -10.778 -8.981  5.242  1.00 78.42 ? 73   ASP A C   1 
ATOM   4   O  O   . ASP A 1 6  ? -10.292 -8.832  4.121  1.00 83.39 ? 73   ASP A O   1 
ATOM   5   C  CB  . ASP A 1 6  ? -10.706 -11.468 5.010  1.00 89.09 ? 73   ASP A CB  1 
ATOM   6   C  CG  . ASP A 1 6  ? -9.229  -11.461 5.358  1.00 92.85 ? 73   ASP A CG  1 
ATOM   7   O  OD1 . ASP A 1 6  ? -8.864  -10.872 6.398  1.00 91.40 ? 73   ASP A OD1 1 
ATOM   8   O  OD2 . ASP A 1 6  ? -8.433  -12.046 4.593  1.00 96.96 ? 73   ASP A OD2 1 
ATOM   9   N  N   . ARG A 1 7  ? -10.746 -8.040  6.179  1.00 67.06 ? 74   ARG A N   1 
ATOM   10  C  CA  . ARG A 1 7  ? -10.085 -6.755  5.975  1.00 56.14 ? 74   ARG A CA  1 
ATOM   11  C  C   . ARG A 1 7  ? -10.311 -5.864  7.185  1.00 44.14 ? 74   ARG A C   1 
ATOM   12  O  O   . ARG A 1 7  ? -11.352 -5.946  7.836  1.00 46.00 ? 74   ARG A O   1 
ATOM   13  C  CB  . ARG A 1 7  ? -10.615 -6.056  4.721  1.00 53.11 ? 74   ARG A CB  1 
ATOM   14  C  CG  . ARG A 1 7  ? -12.020 -5.489  4.870  1.00 49.94 ? 74   ARG A CG  1 
ATOM   15  N  N   . PHE A 1 8  ? -9.334  -5.015  7.491  1.00 37.79 ? 75   PHE A N   1 
ATOM   16  C  CA  . PHE A 1 8  ? -9.496  -4.046  8.566  1.00 37.92 ? 75   PHE A CA  1 
ATOM   17  C  C   . PHE A 1 8  ? -10.483 -2.961  8.154  1.00 34.62 ? 75   PHE A C   1 
ATOM   18  O  O   . PHE A 1 8  ? -10.417 -2.437  7.041  1.00 28.30 ? 75   PHE A O   1 
ATOM   19  C  CB  . PHE A 1 8  ? -8.158  -3.413  8.948  1.00 38.73 ? 75   PHE A CB  1 
ATOM   20  C  CG  . PHE A 1 8  ? -8.292  -2.250  9.889  1.00 35.63 ? 75   PHE A CG  1 
ATOM   21  C  CD1 . PHE A 1 8  ? -8.615  -2.454  11.219 1.00 37.75 ? 75   PHE A CD1 1 
ATOM   22  C  CD2 . PHE A 1 8  ? -8.104  -0.954  9.440  1.00 37.90 ? 75   PHE A CD2 1 
ATOM   23  C  CE1 . PHE A 1 8  ? -8.746  -1.386  12.087 1.00 39.10 ? 75   PHE A CE1 1 
ATOM   24  C  CE2 . PHE A 1 8  ? -8.233  0.118   10.303 1.00 40.67 ? 75   PHE A CE2 1 
ATOM   25  C  CZ  . PHE A 1 8  ? -8.553  -0.099  11.629 1.00 42.03 ? 75   PHE A CZ  1 
ATOM   26  N  N   . SER A 1 9  ? -11.400 -2.625  9.052  1.00 32.04 ? 76   SER A N   1 
ATOM   27  C  CA  . SER A 1 9  ? -12.408 -1.623  8.742  1.00 34.67 ? 76   SER A CA  1 
ATOM   28  C  C   . SER A 1 9  ? -13.027 -1.023  9.997  1.00 33.49 ? 76   SER A C   1 
ATOM   29  O  O   . SER A 1 9  ? -13.425 -1.744  10.912 1.00 30.06 ? 76   SER A O   1 
ATOM   30  C  CB  . SER A 1 9  ? -13.502 -2.228  7.859  1.00 40.80 ? 76   SER A CB  1 
ATOM   31  O  OG  . SER A 1 9  ? -14.429 -1.238  7.452  1.00 47.80 ? 76   SER A OG  1 
ATOM   32  N  N   . VAL A 1 10 ? -13.092 0.304   10.036 1.00 28.50 ? 77   VAL A N   1 
ATOM   33  C  CA  . VAL A 1 10 ? -13.792 1.010   11.103 1.00 27.99 ? 77   VAL A CA  1 
ATOM   34  C  C   . VAL A 1 10 ? -14.809 1.962   10.492 1.00 28.86 ? 77   VAL A C   1 
ATOM   35  O  O   . VAL A 1 10 ? -14.561 2.560   9.444  1.00 24.66 ? 77   VAL A O   1 
ATOM   36  C  CB  . VAL A 1 10 ? -12.826 1.794   12.025 1.00 27.25 ? 77   VAL A CB  1 
ATOM   37  C  CG1 . VAL A 1 10 ? -11.959 0.835   12.830 1.00 29.25 ? 77   VAL A CG1 1 
ATOM   38  C  CG2 . VAL A 1 10 ? -11.962 2.755   11.218 1.00 21.80 ? 77   VAL A CG2 1 
ATOM   39  N  N   . ASN A 1 11 ? -15.961 2.084   11.143 1.00 25.85 ? 78   ASN A N   1 
ATOM   40  C  CA  . ASN A 1 11 ? -17.023 2.965   10.672 1.00 28.76 ? 78   ASN A CA  1 
ATOM   41  C  C   . ASN A 1 11 ? -17.275 4.092   11.663 1.00 28.65 ? 78   ASN A C   1 
ATOM   42  O  O   . ASN A 1 11 ? -17.138 3.911   12.874 1.00 22.96 ? 78   ASN A O   1 
ATOM   43  C  CB  . ASN A 1 11 ? -18.316 2.178   10.439 1.00 31.50 ? 78   ASN A CB  1 
ATOM   44  C  CG  . ASN A 1 11 ? -18.122 0.997   9.511  1.00 43.47 ? 78   ASN A CG  1 
ATOM   45  O  OD1 . ASN A 1 11 ? -17.852 1.163   8.320  1.00 43.14 ? 78   ASN A OD1 1 
ATOM   46  N  ND2 . ASN A 1 11 ? -18.261 -0.209  10.053 1.00 49.34 ? 78   ASN A ND2 1 
ATOM   47  N  N   . LEU A 1 12 ? -17.649 5.253   11.139 1.00 22.85 ? 79   LEU A N   1 
ATOM   48  C  CA  . LEU A 1 12 ? -17.896 6.428   11.960 1.00 26.10 ? 79   LEU A CA  1 
ATOM   49  C  C   . LEU A 1 12 ? -19.120 7.173   11.443 1.00 26.52 ? 79   LEU A C   1 
ATOM   50  O  O   . LEU A 1 12 ? -19.197 7.514   10.261 1.00 21.11 ? 79   LEU A O   1 
ATOM   51  C  CB  . LEU A 1 12 ? -16.668 7.341   11.944 1.00 34.12 ? 79   LEU A CB  1 
ATOM   52  C  CG  . LEU A 1 12 ? -16.677 8.607   12.799 1.00 38.55 ? 79   LEU A CG  1 
ATOM   53  C  CD1 . LEU A 1 12 ? -17.015 8.287   14.250 1.00 42.60 ? 79   LEU A CD1 1 
ATOM   54  C  CD2 . LEU A 1 12 ? -15.331 9.310   12.698 1.00 35.49 ? 79   LEU A CD2 1 
ATOM   55  N  N   . ASP A 1 13 ? -20.084 7.407   12.327 1.00 25.75 ? 80   ASP A N   1 
ATOM   56  C  CA  . ASP A 1 13 ? -21.282 8.156   11.968 1.00 29.41 ? 80   ASP A CA  1 
ATOM   57  C  C   . ASP A 1 13 ? -20.975 9.647   11.953 1.00 27.19 ? 80   ASP A C   1 
ATOM   58  O  O   . ASP A 1 13 ? -20.810 10.263  13.005 1.00 27.76 ? 80   ASP A O   1 
ATOM   59  C  CB  . ASP A 1 13 ? -22.415 7.859   12.955 1.00 35.28 ? 80   ASP A CB  1 
ATOM   60  C  CG  . ASP A 1 13 ? -23.695 8.610   12.624 1.00 45.07 ? 80   ASP A CG  1 
ATOM   61  O  OD1 . ASP A 1 13 ? -23.719 9.350   11.616 1.00 42.66 ? 80   ASP A OD1 1 
ATOM   62  O  OD2 . ASP A 1 13 ? -24.681 8.459   13.376 1.00 51.26 ? 80   ASP A OD2 1 
ATOM   63  N  N   . VAL A 1 14 ? -20.900 10.222  10.757 1.00 17.28 ? 81   VAL A N   1 
ATOM   64  C  CA  . VAL A 1 14 ? -20.585 11.641  10.604 1.00 19.10 ? 81   VAL A CA  1 
ATOM   65  C  C   . VAL A 1 14 ? -21.674 12.402  9.846  1.00 23.69 ? 81   VAL A C   1 
ATOM   66  O  O   . VAL A 1 14 ? -21.382 13.351  9.119  1.00 21.35 ? 81   VAL A O   1 
ATOM   67  C  CB  . VAL A 1 14 ? -19.251 11.831  9.863  1.00 24.62 ? 81   VAL A CB  1 
ATOM   68  C  CG1 . VAL A 1 14 ? -18.095 11.310  10.707 1.00 26.93 ? 81   VAL A CG1 1 
ATOM   69  C  CG2 . VAL A 1 14 ? -19.292 11.122  8.515  1.00 24.69 ? 81   VAL A CG2 1 
ATOM   70  N  N   . LYS A 1 15 ? -22.927 11.997  10.029 1.00 27.08 ? 82   LYS A N   1 
ATOM   71  C  CA  . LYS A 1 15 ? -24.032 12.578  9.266  1.00 31.10 ? 82   LYS A CA  1 
ATOM   72  C  C   . LYS A 1 15 ? -24.221 14.087  9.459  1.00 29.58 ? 82   LYS A C   1 
ATOM   73  O  O   . LYS A 1 15 ? -24.869 14.739  8.642  1.00 27.04 ? 82   LYS A O   1 
ATOM   74  C  CB  . LYS A 1 15 ? -25.340 11.831  9.545  1.00 35.40 ? 82   LYS A CB  1 
ATOM   75  C  CG  . LYS A 1 15 ? -25.721 11.745  11.012 1.00 40.85 ? 82   LYS A CG  1 
ATOM   76  C  CD  . LYS A 1 15 ? -26.947 10.862  11.201 1.00 48.81 ? 82   LYS A CD  1 
ATOM   77  C  CE  . LYS A 1 15 ? -27.257 10.646  12.673 1.00 51.62 ? 82   LYS A CE  1 
ATOM   78  N  NZ  . LYS A 1 15 ? -27.543 11.928  13.369 1.00 47.03 ? 82   LYS A NZ  1 
ATOM   79  N  N   . HIS A 1 16 ? -23.655 14.643  10.528 1.00 23.25 ? 83   HIS A N   1 
ATOM   80  C  CA  . HIS A 1 16 ? -23.756 16.084  10.765 1.00 21.97 ? 83   HIS A CA  1 
ATOM   81  C  C   . HIS A 1 16 ? -22.694 16.883  10.014 1.00 22.19 ? 83   HIS A C   1 
ATOM   82  O  O   . HIS A 1 16 ? -22.684 18.111  10.066 1.00 25.12 ? 83   HIS A O   1 
ATOM   83  C  CB  . HIS A 1 16 ? -23.672 16.401  12.262 1.00 23.39 ? 83   HIS A CB  1 
ATOM   84  C  CG  . HIS A 1 16 ? -24.835 15.891  13.052 1.00 24.76 ? 83   HIS A CG  1 
ATOM   85  N  ND1 . HIS A 1 16 ? -24.686 15.156  14.208 1.00 28.94 ? 83   HIS A ND1 1 
ATOM   86  C  CD2 . HIS A 1 16 ? -26.168 15.999  12.842 1.00 31.06 ? 83   HIS A CD2 1 
ATOM   87  C  CE1 . HIS A 1 16 ? -25.879 14.843  14.683 1.00 28.41 ? 83   HIS A CE1 1 
ATOM   88  N  NE2 . HIS A 1 16 ? -26.795 15.340  13.872 1.00 33.77 ? 83   HIS A NE2 1 
ATOM   89  N  N   . PHE A 1 17 ? -21.803 16.180  9.320  1.00 21.77 ? 84   PHE A N   1 
ATOM   90  C  CA  . PHE A 1 17 ? -20.692 16.817  8.621  1.00 24.27 ? 84   PHE A CA  1 
ATOM   91  C  C   . PHE A 1 17 ? -20.754 16.529  7.126  1.00 24.46 ? 84   PHE A C   1 
ATOM   92  O  O   . PHE A 1 17 ? -20.980 15.392  6.716  1.00 25.85 ? 84   PHE A O   1 
ATOM   93  C  CB  . PHE A 1 17 ? -19.348 16.316  9.174  1.00 18.14 ? 84   PHE A CB  1 
ATOM   94  C  CG  . PHE A 1 17 ? -19.129 16.634  10.632 1.00 18.67 ? 84   PHE A CG  1 
ATOM   95  C  CD1 . PHE A 1 17 ? -19.607 15.786  11.618 1.00 16.62 ? 84   PHE A CD1 1 
ATOM   96  C  CD2 . PHE A 1 17 ? -18.446 17.778  11.012 1.00 21.98 ? 84   PHE A CD2 1 
ATOM   97  C  CE1 . PHE A 1 17 ? -19.406 16.070  12.963 1.00 21.07 ? 84   PHE A CE1 1 
ATOM   98  C  CE2 . PHE A 1 17 ? -18.245 18.074  12.358 1.00 14.96 ? 84   PHE A CE2 1 
ATOM   99  C  CZ  . PHE A 1 17 ? -18.727 17.217  13.332 1.00 15.52 ? 84   PHE A CZ  1 
ATOM   100 N  N   . SER A 1 18 ? -20.554 17.558  6.310  1.00 21.92 ? 85   SER A N   1 
ATOM   101 C  CA  . SER A 1 18 ? -20.392 17.344  4.877  1.00 22.81 ? 85   SER A CA  1 
ATOM   102 C  C   . SER A 1 18 ? -18.998 16.772  4.628  1.00 24.12 ? 85   SER A C   1 
ATOM   103 O  O   . SER A 1 18 ? -18.092 16.962  5.441  1.00 24.96 ? 85   SER A O   1 
ATOM   104 C  CB  . SER A 1 18 ? -20.591 18.649  4.102  1.00 34.13 ? 85   SER A CB  1 
ATOM   105 O  OG  . SER A 1 18 ? -19.567 19.583  4.395  1.00 42.17 ? 85   SER A OG  1 
ATOM   106 N  N   . PRO A 1 19 ? -18.820 16.057  3.508  1.00 21.81 ? 86   PRO A N   1 
ATOM   107 C  CA  . PRO A 1 19 ? -17.517 15.455  3.204  1.00 22.80 ? 86   PRO A CA  1 
ATOM   108 C  C   . PRO A 1 19 ? -16.376 16.473  3.264  1.00 23.37 ? 86   PRO A C   1 
ATOM   109 O  O   . PRO A 1 19 ? -15.273 16.133  3.691  1.00 26.07 ? 86   PRO A O   1 
ATOM   110 C  CB  . PRO A 1 19 ? -17.699 14.935  1.774  1.00 24.91 ? 86   PRO A CB  1 
ATOM   111 C  CG  . PRO A 1 19 ? -19.166 14.678  1.658  1.00 23.98 ? 86   PRO A CG  1 
ATOM   112 C  CD  . PRO A 1 19 ? -19.834 15.740  2.486  1.00 22.28 ? 86   PRO A CD  1 
ATOM   113 N  N   . GLU A 1 20 ? -16.646 17.708  2.855  1.00 21.32 ? 87   GLU A N   1 
ATOM   114 C  CA  . GLU A 1 20 ? -15.617 18.744  2.819  1.00 24.11 ? 87   GLU A CA  1 
ATOM   115 C  C   . GLU A 1 20 ? -15.265 19.260  4.215  1.00 23.58 ? 87   GLU A C   1 
ATOM   116 O  O   . GLU A 1 20 ? -14.277 19.972  4.392  1.00 25.77 ? 87   GLU A O   1 
ATOM   117 C  CB  . GLU A 1 20 ? -16.054 19.907  1.920  1.00 29.22 ? 87   GLU A CB  1 
ATOM   118 C  CG  . GLU A 1 20 ? -16.146 19.550  0.442  1.00 44.35 ? 87   GLU A CG  1 
ATOM   119 N  N   . GLU A 1 21 ? -16.076 18.898  5.202  1.00 21.42 ? 88   GLU A N   1 
ATOM   120 C  CA  . GLU A 1 21 ? -15.825 19.300  6.581  1.00 16.35 ? 88   GLU A CA  1 
ATOM   121 C  C   . GLU A 1 21 ? -15.110 18.196  7.345  1.00 22.48 ? 88   GLU A C   1 
ATOM   122 O  O   . GLU A 1 21 ? -14.943 18.271  8.562  1.00 20.63 ? 88   GLU A O   1 
ATOM   123 C  CB  . GLU A 1 21 ? -17.140 19.668  7.266  1.00 19.43 ? 88   GLU A CB  1 
ATOM   124 C  CG  . GLU A 1 21 ? -17.781 20.914  6.680  1.00 26.19 ? 88   GLU A CG  1 
ATOM   125 C  CD  . GLU A 1 21 ? -19.226 21.081  7.094  1.00 28.14 ? 88   GLU A CD  1 
ATOM   126 O  OE1 . GLU A 1 21 ? -19.846 20.080  7.504  1.00 29.28 ? 88   GLU A OE1 1 
ATOM   127 O  OE2 . GLU A 1 21 ? -19.740 22.214  6.999  1.00 27.62 ? 88   GLU A OE2 1 
ATOM   128 N  N   . LEU A 1 22 ? -14.680 17.175  6.613  1.00 16.85 ? 89   LEU A N   1 
ATOM   129 C  CA  . LEU A 1 22 ? -13.984 16.041  7.203  1.00 18.52 ? 89   LEU A CA  1 
ATOM   130 C  C   . LEU A 1 22 ? -12.627 15.863  6.545  1.00 20.61 ? 89   LEU A C   1 
ATOM   131 O  O   . LEU A 1 22 ? -12.469 16.117  5.353  1.00 19.09 ? 89   LEU A O   1 
ATOM   132 C  CB  . LEU A 1 22 ? -14.810 14.766  7.031  1.00 18.30 ? 89   LEU A CB  1 
ATOM   133 C  CG  . LEU A 1 22 ? -16.127 14.732  7.808  1.00 24.92 ? 89   LEU A CG  1 
ATOM   134 C  CD1 . LEU A 1 22 ? -17.141 13.829  7.128  1.00 25.48 ? 89   LEU A CD1 1 
ATOM   135 C  CD2 . LEU A 1 22 ? -15.894 14.307  9.253  1.00 21.90 ? 89   LEU A CD2 1 
ATOM   136 N  N   . LYS A 1 23 ? -11.649 15.431  7.328  1.00 19.77 ? 90   LYS A N   1 
ATOM   137 C  CA  . LYS A 1 23 ? -10.333 15.120  6.793  1.00 22.11 ? 90   LYS A CA  1 
ATOM   138 C  C   . LYS A 1 23 ? -9.825  13.833  7.426  1.00 22.46 ? 90   LYS A C   1 
ATOM   139 O  O   . LYS A 1 23 ? -9.876  13.670  8.643  1.00 25.13 ? 90   LYS A O   1 
ATOM   140 C  CB  . LYS A 1 23 ? -9.355  16.265  7.061  1.00 25.27 ? 90   LYS A CB  1 
ATOM   141 N  N   . VAL A 1 24 ? -9.349  12.915  6.593  1.00 14.98 ? 91   VAL A N   1 
ATOM   142 C  CA  . VAL A 1 24 ? -8.767  11.675  7.081  1.00 19.38 ? 91   VAL A CA  1 
ATOM   143 C  C   . VAL A 1 24 ? -7.288  11.679  6.742  1.00 23.73 ? 91   VAL A C   1 
ATOM   144 O  O   . VAL A 1 24 ? -6.912  11.895  5.593  1.00 24.40 ? 91   VAL A O   1 
ATOM   145 C  CB  . VAL A 1 24 ? -9.430  10.440  6.442  1.00 23.81 ? 91   VAL A CB  1 
ATOM   146 C  CG1 . VAL A 1 24 ? -8.791  9.164   6.969  1.00 25.39 ? 91   VAL A CG1 1 
ATOM   147 C  CG2 . VAL A 1 24 ? -10.923 10.438  6.717  1.00 21.62 ? 91   VAL A CG2 1 
ATOM   148 N  N   . LYS A 1 25 ? -6.451  11.459  7.746  1.00 25.08 ? 92   LYS A N   1 
ATOM   149 C  CA  . LYS A 1 25 ? -5.011  11.439  7.538  1.00 33.12 ? 92   LYS A CA  1 
ATOM   150 C  C   . LYS A 1 25 ? -4.424  10.201  8.188  1.00 28.50 ? 92   LYS A C   1 
ATOM   151 O  O   . LYS A 1 25 ? -4.883  9.776   9.243  1.00 26.42 ? 92   LYS A O   1 
ATOM   152 C  CB  . LYS A 1 25 ? -4.361  12.691  8.132  1.00 44.16 ? 92   LYS A CB  1 
ATOM   153 C  CG  . LYS A 1 25 ? -4.865  13.997  7.541  1.00 50.97 ? 92   LYS A CG  1 
ATOM   154 N  N   . VAL A 1 26 ? -3.418  9.617   7.548  1.00 24.59 ? 93   VAL A N   1 
ATOM   155 C  CA  . VAL A 1 26 ? -2.699  8.501   8.140  1.00 28.37 ? 93   VAL A CA  1 
ATOM   156 C  C   . VAL A 1 26 ? -1.298  8.949   8.535  1.00 35.04 ? 93   VAL A C   1 
ATOM   157 O  O   . VAL A 1 26 ? -0.478  9.286   7.683  1.00 39.06 ? 93   VAL A O   1 
ATOM   158 C  CB  . VAL A 1 26 ? -2.618  7.297   7.182  1.00 34.58 ? 93   VAL A CB  1 
ATOM   159 C  CG1 . VAL A 1 26 ? -1.697  6.224   7.750  1.00 31.47 ? 93   VAL A CG1 1 
ATOM   160 C  CG2 . VAL A 1 26 ? -4.008  6.737   6.924  1.00 34.94 ? 93   VAL A CG2 1 
ATOM   161 N  N   . LEU A 1 27 ? -1.042  8.969   9.839  1.00 34.18 ? 94   LEU A N   1 
ATOM   162 C  CA  . LEU A 1 27 ? 0.256   9.361   10.368 1.00 40.47 ? 94   LEU A CA  1 
ATOM   163 C  C   . LEU A 1 27 ? 0.878   8.177   11.097 1.00 41.50 ? 94   LEU A C   1 
ATOM   164 O  O   . LEU A 1 27 ? 0.378   7.746   12.135 1.00 33.90 ? 94   LEU A O   1 
ATOM   165 C  CB  . LEU A 1 27 ? 0.108   10.551  11.318 1.00 43.63 ? 94   LEU A CB  1 
ATOM   166 N  N   . GLY A 1 28 ? 1.970   7.654   10.549 1.00 46.61 ? 95   GLY A N   1 
ATOM   167 C  CA  . GLY A 1 28 ? 2.562   6.438   11.073 1.00 43.10 ? 95   GLY A CA  1 
ATOM   168 C  C   . GLY A 1 28 ? 1.537   5.323   11.011 1.00 39.39 ? 95   GLY A C   1 
ATOM   169 O  O   . GLY A 1 28 ? 0.974   5.052   9.950  1.00 41.55 ? 95   GLY A O   1 
ATOM   170 N  N   . ASP A 1 29 ? 1.278   4.688   12.148 1.00 29.72 ? 96   ASP A N   1 
ATOM   171 C  CA  . ASP A 1 29 ? 0.268   3.635   12.211 1.00 34.01 ? 96   ASP A CA  1 
ATOM   172 C  C   . ASP A 1 29 ? -1.010  4.125   12.889 1.00 29.61 ? 96   ASP A C   1 
ATOM   173 O  O   . ASP A 1 29 ? -1.728  3.348   13.516 1.00 32.28 ? 96   ASP A O   1 
ATOM   174 C  CB  . ASP A 1 29 ? 0.814   2.398   12.930 1.00 42.91 ? 96   ASP A CB  1 
ATOM   175 C  CG  . ASP A 1 29 ? 1.159   2.670   14.379 1.00 52.62 ? 96   ASP A CG  1 
ATOM   176 O  OD1 . ASP A 1 29 ? 1.206   3.854   14.773 1.00 52.07 ? 96   ASP A OD1 1 
ATOM   177 O  OD2 . ASP A 1 29 ? 1.386   1.696   15.128 1.00 63.26 ? 96   ASP A OD2 1 
ATOM   178 N  N   . VAL A 1 30 ? -1.286  5.418   12.760 1.00 27.96 ? 97   VAL A N   1 
ATOM   179 C  CA  . VAL A 1 30 ? -2.498  6.000   13.332 1.00 26.65 ? 97   VAL A CA  1 
ATOM   180 C  C   . VAL A 1 30 ? -3.380  6.626   12.255 1.00 24.04 ? 97   VAL A C   1 
ATOM   181 O  O   . VAL A 1 30 ? -2.906  7.385   11.405 1.00 26.77 ? 97   VAL A O   1 
ATOM   182 C  CB  . VAL A 1 30 ? -2.176  7.067   14.399 1.00 30.27 ? 97   VAL A CB  1 
ATOM   183 C  CG1 . VAL A 1 30 ? -3.451  7.771   14.853 1.00 27.41 ? 97   VAL A CG1 1 
ATOM   184 C  CG2 . VAL A 1 30 ? -1.456  6.438   15.589 1.00 37.06 ? 97   VAL A CG2 1 
ATOM   185 N  N   . ILE A 1 31 ? -4.664  6.288   12.293 1.00 21.02 ? 98   ILE A N   1 
ATOM   186 C  CA  . ILE A 1 31 ? -5.658  6.926   11.444 1.00 17.89 ? 98   ILE A CA  1 
ATOM   187 C  C   . ILE A 1 31 ? -6.254  8.097   12.204 1.00 23.35 ? 98   ILE A C   1 
ATOM   188 O  O   . ILE A 1 31 ? -6.776  7.927   13.305 1.00 24.16 ? 98   ILE A O   1 
ATOM   189 C  CB  . ILE A 1 31 ? -6.801  5.966   11.093 1.00 21.81 ? 98   ILE A CB  1 
ATOM   190 C  CG1 . ILE A 1 31 ? -6.276  4.765   10.304 1.00 21.84 ? 98   ILE A CG1 1 
ATOM   191 C  CG2 . ILE A 1 31 ? -7.893  6.698   10.315 1.00 29.27 ? 98   ILE A CG2 1 
ATOM   192 C  CD1 . ILE A 1 31 ? -7.307  3.672   10.122 1.00 21.49 ? 98   ILE A CD1 1 
ATOM   193 N  N   . GLU A 1 32 ? -6.162  9.286   11.622 1.00 22.23 ? 99   GLU A N   1 
ATOM   194 C  CA  . GLU A 1 32 ? -6.747  10.471  12.233 1.00 25.63 ? 99   GLU A CA  1 
ATOM   195 C  C   . GLU A 1 32 ? -7.940  10.961  11.421 1.00 24.54 ? 99   GLU A C   1 
ATOM   196 O  O   . GLU A 1 32 ? -7.829  11.196  10.221 1.00 20.87 ? 99   GLU A O   1 
ATOM   197 C  CB  . GLU A 1 32 ? -5.705  11.584  12.351 1.00 29.38 ? 99   GLU A CB  1 
ATOM   198 C  CG  . GLU A 1 32 ? -4.558  11.263  13.292 1.00 35.23 ? 99   GLU A CG  1 
ATOM   199 C  CD  . GLU A 1 32 ? -3.564  12.403  13.407 1.00 49.53 ? 99   GLU A CD  1 
ATOM   200 O  OE1 . GLU A 1 32 ? -3.374  13.134  12.410 1.00 56.86 ? 99   GLU A OE1 1 
ATOM   201 O  OE2 . GLU A 1 32 ? -2.970  12.566  14.492 1.00 52.89 ? 99   GLU A OE2 1 
ATOM   202 N  N   . VAL A 1 33 ? -9.084  11.097  12.081 1.00 18.38 ? 100  VAL A N   1 
ATOM   203 C  CA  . VAL A 1 33 ? -10.258 11.679  11.447 1.00 19.37 ? 100  VAL A CA  1 
ATOM   204 C  C   . VAL A 1 33 ? -10.610 12.980  12.146 1.00 18.83 ? 100  VAL A C   1 
ATOM   205 O  O   . VAL A 1 33 ? -10.871 12.994  13.350 1.00 18.87 ? 100  VAL A O   1 
ATOM   206 C  CB  . VAL A 1 33 ? -11.474 10.737  11.501 1.00 18.65 ? 100  VAL A CB  1 
ATOM   207 C  CG1 . VAL A 1 33 ? -12.663 11.373  10.788 1.00 23.16 ? 100  VAL A CG1 1 
ATOM   208 C  CG2 . VAL A 1 33 ? -11.134 9.392   10.881 1.00 17.09 ? 100  VAL A CG2 1 
ATOM   209 N  N   . HIS A 1 34 ? -10.603 14.072  11.392 1.00 17.20 ? 101  HIS A N   1 
ATOM   210 C  CA  . HIS A 1 34 ? -10.965 15.372  11.939 1.00 19.45 ? 101  HIS A CA  1 
ATOM   211 C  C   . HIS A 1 34 ? -12.226 15.899  11.276 1.00 21.18 ? 101  HIS A C   1 
ATOM   212 O  O   . HIS A 1 34 ? -12.318 15.945  10.055 1.00 20.48 ? 101  HIS A O   1 
ATOM   213 C  CB  . HIS A 1 34 ? -9.828  16.380  11.763 1.00 22.52 ? 101  HIS A CB  1 
ATOM   214 C  CG  . HIS A 1 34 ? -10.147 17.740  12.304 1.00 30.17 ? 101  HIS A CG  1 
ATOM   215 N  ND1 . HIS A 1 34 ? -9.949  18.896  11.580 1.00 36.87 ? 101  HIS A ND1 1 
ATOM   216 C  CD2 . HIS A 1 34 ? -10.675 18.124  13.490 1.00 29.00 ? 101  HIS A CD2 1 
ATOM   217 C  CE1 . HIS A 1 34 ? -10.329 19.936  12.304 1.00 34.32 ? 101  HIS A CE1 1 
ATOM   218 N  NE2 . HIS A 1 34 ? -10.774 19.494  13.466 1.00 29.01 ? 101  HIS A NE2 1 
ATOM   219 N  N   . GLY A 1 35 ? -13.201 16.286  12.091 1.00 17.91 ? 102  GLY A N   1 
ATOM   220 C  CA  . GLY A 1 35 ? -14.430 16.864  11.581 1.00 16.31 ? 102  GLY A CA  1 
ATOM   221 C  C   . GLY A 1 35 ? -14.684 18.215  12.212 1.00 19.16 ? 102  GLY A C   1 
ATOM   222 O  O   . GLY A 1 35 ? -14.530 18.378  13.420 1.00 17.82 ? 102  GLY A O   1 
ATOM   223 N  N   . LYS A 1 36 ? -15.071 19.190  11.398 1.00 20.20 ? 103  LYS A N   1 
ATOM   224 C  CA  . LYS A 1 36 ? -15.374 20.520  11.913 1.00 21.75 ? 103  LYS A CA  1 
ATOM   225 C  C   . LYS A 1 36 ? -16.359 21.239  11.013 1.00 24.61 ? 103  LYS A C   1 
ATOM   226 O  O   . LYS A 1 36 ? -16.157 21.321  9.801  1.00 19.03 ? 103  LYS A O   1 
ATOM   227 C  CB  . LYS A 1 36 ? -14.096 21.356  12.042 1.00 24.16 ? 103  LYS A CB  1 
ATOM   228 C  CG  . LYS A 1 36 ? -14.325 22.748  12.621 1.00 33.04 ? 103  LYS A CG  1 
ATOM   229 C  CD  . LYS A 1 36 ? -13.036 23.556  12.668 1.00 36.50 ? 103  LYS A CD  1 
ATOM   230 C  CE  . LYS A 1 36 ? -13.247 24.896  13.361 1.00 35.37 ? 103  LYS A CE  1 
ATOM   231 N  N   . HIS A 1 37 ? -17.432 21.757  11.598 1.00 20.69 ? 104  HIS A N   1 
ATOM   232 C  CA  . HIS A 1 37 ? -18.341 22.601  10.827 1.00 26.30 ? 104  HIS A CA  1 
ATOM   233 C  C   . HIS A 1 37 ? -18.694 23.875  11.576 1.00 29.31 ? 104  HIS A C   1 
ATOM   234 O  O   . HIS A 1 37 ? -18.833 23.879  12.804 1.00 23.51 ? 104  HIS A O   1 
ATOM   235 C  CB  . HIS A 1 37 ? -19.592 21.836  10.359 1.00 22.26 ? 104  HIS A CB  1 
ATOM   236 C  CG  . HIS A 1 37 ? -20.617 21.607  11.428 1.00 21.20 ? 104  HIS A CG  1 
ATOM   237 N  ND1 . HIS A 1 37 ? -21.432 22.612  11.903 1.00 21.89 ? 104  HIS A ND1 1 
ATOM   238 C  CD2 . HIS A 1 37 ? -20.990 20.480  12.079 1.00 18.62 ? 104  HIS A CD2 1 
ATOM   239 C  CE1 . HIS A 1 37 ? -22.248 22.117  12.821 1.00 21.13 ? 104  HIS A CE1 1 
ATOM   240 N  NE2 . HIS A 1 37 ? -22.001 20.826  12.943 1.00 19.24 ? 104  HIS A NE2 1 
ATOM   241 N  N   . GLU A 1 38 ? -18.816 24.959  10.821 1.00 28.76 ? 105  GLU A N   1 
ATOM   242 C  CA  . GLU A 1 38 ? -19.093 26.269  11.385 1.00 32.79 ? 105  GLU A CA  1 
ATOM   243 C  C   . GLU A 1 38 ? -20.530 26.336  11.878 1.00 30.67 ? 105  GLU A C   1 
ATOM   244 O  O   . GLU A 1 38 ? -21.341 25.460  11.572 1.00 25.48 ? 105  GLU A O   1 
ATOM   245 C  CB  . GLU A 1 38 ? -18.852 27.356  10.331 1.00 41.29 ? 105  GLU A CB  1 
ATOM   246 C  CG  . GLU A 1 38 ? -17.504 27.257  9.637  1.00 48.92 ? 105  GLU A CG  1 
ATOM   247 C  CD  . GLU A 1 38 ? -16.339 27.321  10.608 1.00 60.24 ? 105  GLU A CD  1 
ATOM   248 O  OE1 . GLU A 1 38 ? -16.363 28.179  11.515 1.00 63.39 ? 105  GLU A OE1 1 
ATOM   249 O  OE2 . GLU A 1 38 ? -15.397 26.513  10.460 1.00 67.19 ? 105  GLU A OE2 1 
ATOM   250 N  N   . GLU A 1 39 ? -20.842 27.386  12.630 1.00 30.05 ? 106  GLU A N   1 
ATOM   251 C  CA  . GLU A 1 39 ? -22.182 27.563  13.168 1.00 32.67 ? 106  GLU A CA  1 
ATOM   252 C  C   . GLU A 1 39 ? -23.215 27.430  12.059 1.00 31.67 ? 106  GLU A C   1 
ATOM   253 O  O   . GLU A 1 39 ? -23.119 28.081  11.014 1.00 32.40 ? 106  GLU A O   1 
ATOM   254 C  CB  . GLU A 1 39 ? -22.311 28.911  13.874 1.00 36.43 ? 106  GLU A CB  1 
ATOM   255 C  CG  . GLU A 1 39 ? -23.580 29.054  14.693 1.00 41.58 ? 106  GLU A CG  1 
ATOM   256 C  CD  . GLU A 1 39 ? -23.557 30.282  15.578 1.00 46.86 ? 106  GLU A CD  1 
ATOM   257 O  OE1 . GLU A 1 39 ? -23.034 30.188  16.708 1.00 46.49 ? 106  GLU A OE1 1 
ATOM   258 O  OE2 . GLU A 1 39 ? -24.055 31.341  15.143 1.00 55.55 ? 106  GLU A OE2 1 
ATOM   259 N  N   . ARG A 1 40 ? -24.207 26.584  12.296 1.00 31.04 ? 107  ARG A N   1 
ATOM   260 C  CA  A ARG A 1 40 ? -25.183 26.215  11.278 0.50 37.88 ? 107  ARG A CA  1 
ATOM   261 C  CA  B ARG A 1 40 ? -25.206 26.312  11.280 0.50 36.97 ? 107  ARG A CA  1 
ATOM   262 C  C   . ARG A 1 40 ? -26.572 26.098  11.905 1.00 33.05 ? 107  ARG A C   1 
ATOM   263 O  O   . ARG A 1 40 ? -26.708 25.540  12.991 1.00 27.92 ? 107  ARG A O   1 
ATOM   264 C  CB  A ARG A 1 40 ? -24.769 24.871  10.673 0.50 40.61 ? 107  ARG A CB  1 
ATOM   265 C  CB  B ARG A 1 40 ? -24.789 25.113  10.424 0.50 40.50 ? 107  ARG A CB  1 
ATOM   266 C  CG  A ARG A 1 40 ? -25.421 24.509  9.352  0.50 41.54 ? 107  ARG A CG  1 
ATOM   267 C  CG  B ARG A 1 40 ? -25.613 23.854  10.623 0.50 40.49 ? 107  ARG A CG  1 
ATOM   268 C  CD  A ARG A 1 40 ? -24.837 23.204  8.817  0.50 41.86 ? 107  ARG A CD  1 
ATOM   269 C  CD  B ARG A 1 40 ? -24.890 22.670  10.005 0.50 41.83 ? 107  ARG A CD  1 
ATOM   270 N  NE  A ARG A 1 40 ? -25.179 22.060  9.660  0.50 40.68 ? 107  ARG A NE  1 
ATOM   271 N  NE  B ARG A 1 40 ? -23.963 23.116  8.970  0.50 40.14 ? 107  ARG A NE  1 
ATOM   272 C  CZ  A ARG A 1 40 ? -24.483 20.928  9.712  0.50 35.19 ? 107  ARG A CZ  1 
ATOM   273 C  CZ  B ARG A 1 40 ? -22.950 22.394  8.501  0.50 31.37 ? 107  ARG A CZ  1 
ATOM   274 N  NH1 A ARG A 1 40 ? -23.388 20.783  8.975  0.50 37.52 ? 107  ARG A NH1 1 
ATOM   275 N  NH1 B ARG A 1 40 ? -22.718 21.175  8.972  0.50 33.44 ? 107  ARG A NH1 1 
ATOM   276 N  NH2 A ARG A 1 40 ? -24.877 19.942  10.507 0.50 15.14 ? 107  ARG A NH2 1 
ATOM   277 N  NH2 B ARG A 1 40 ? -22.164 22.899  7.562  0.50 22.25 ? 107  ARG A NH2 1 
ATOM   278 N  N   . GLN A 1 41 ? -27.595 26.594  11.223 1.00 30.36 ? 108  GLN A N   1 
ATOM   279 C  CA  . GLN A 1 41 ? -28.951 26.498  11.744 1.00 30.55 ? 108  GLN A CA  1 
ATOM   280 C  C   . GLN A 1 41 ? -29.507 25.088  11.566 1.00 29.97 ? 108  GLN A C   1 
ATOM   281 O  O   . GLN A 1 41 ? -29.337 24.475  10.514 1.00 29.41 ? 108  GLN A O   1 
ATOM   282 C  CB  . GLN A 1 41 ? -29.866 27.522  11.061 1.00 33.48 ? 108  GLN A CB  1 
ATOM   283 C  CG  . GLN A 1 41 ? -31.267 27.570  11.645 1.00 35.05 ? 108  GLN A CG  1 
ATOM   284 C  CD  . GLN A 1 41 ? -32.146 28.633  11.013 1.00 39.19 ? 108  GLN A CD  1 
ATOM   285 O  OE1 . GLN A 1 41 ? -31.811 29.207  9.973  1.00 39.85 ? 108  GLN A OE1 1 
ATOM   286 N  NE2 . GLN A 1 41 ? -33.286 28.896  11.639 1.00 32.49 ? 108  GLN A NE2 1 
ATOM   287 N  N   . ASP A 1 42 ? -30.152 24.567  12.603 1.00 28.28 ? 109  ASP A N   1 
ATOM   288 C  CA  . ASP A 1 42 ? -30.900 23.320  12.470 1.00 31.87 ? 109  ASP A CA  1 
ATOM   289 C  C   . ASP A 1 42 ? -32.286 23.454  13.093 1.00 33.43 ? 109  ASP A C   1 
ATOM   290 O  O   . ASP A 1 42 ? -32.747 24.563  13.355 1.00 33.48 ? 109  ASP A O   1 
ATOM   291 C  CB  . ASP A 1 42 ? -30.130 22.129  13.055 1.00 31.18 ? 109  ASP A CB  1 
ATOM   292 C  CG  . ASP A 1 42 ? -29.972 22.205  14.562 1.00 31.44 ? 109  ASP A CG  1 
ATOM   293 O  OD1 . ASP A 1 42 ? -30.534 23.127  15.193 1.00 29.89 ? 109  ASP A OD1 1 
ATOM   294 O  OD2 . ASP A 1 42 ? -29.279 21.326  15.116 1.00 30.06 ? 109  ASP A OD2 1 
ATOM   295 N  N   . GLU A 1 43 ? -32.945 22.325  13.319 1.00 36.08 ? 110  GLU A N   1 
ATOM   296 C  CA  . GLU A 1 43 ? -34.311 22.321  13.830 1.00 45.36 ? 110  GLU A CA  1 
ATOM   297 C  C   . GLU A 1 43 ? -34.428 22.955  15.216 1.00 42.84 ? 110  GLU A C   1 
ATOM   298 O  O   . GLU A 1 43 ? -35.465 23.521  15.563 1.00 40.19 ? 110  GLU A O   1 
ATOM   299 C  CB  . GLU A 1 43 ? -34.846 20.888  13.873 1.00 58.85 ? 110  GLU A CB  1 
ATOM   300 C  CG  . GLU A 1 43 ? -36.244 20.758  14.450 1.00 71.52 ? 110  GLU A CG  1 
ATOM   301 C  CD  . GLU A 1 43 ? -36.640 19.314  14.690 1.00 77.84 ? 110  GLU A CD  1 
ATOM   302 O  OE1 . GLU A 1 43 ? -35.786 18.422  14.499 1.00 78.18 ? 110  GLU A OE1 1 
ATOM   303 O  OE2 . GLU A 1 43 ? -37.804 19.072  15.073 1.00 80.83 ? 110  GLU A OE2 1 
ATOM   304 N  N   . HIS A 1 44 ? -33.361 22.863  16.002 1.00 38.70 ? 111  HIS A N   1 
ATOM   305 C  CA  . HIS A 1 44 ? -33.409 23.275  17.402 1.00 39.93 ? 111  HIS A CA  1 
ATOM   306 C  C   . HIS A 1 44 ? -32.816 24.660  17.653 1.00 37.12 ? 111  HIS A C   1 
ATOM   307 O  O   . HIS A 1 44 ? -33.053 25.259  18.700 1.00 37.00 ? 111  HIS A O   1 
ATOM   308 C  CB  . HIS A 1 44 ? -32.701 22.237  18.278 1.00 40.98 ? 111  HIS A CB  1 
ATOM   309 C  CG  . HIS A 1 44 ? -33.201 20.840  18.078 1.00 49.81 ? 111  HIS A CG  1 
ATOM   310 N  ND1 . HIS A 1 44 ? -32.525 19.909  17.319 1.00 57.06 ? 111  HIS A ND1 1 
ATOM   311 C  CD2 . HIS A 1 44 ? -34.319 20.220  18.526 1.00 55.09 ? 111  HIS A CD2 1 
ATOM   312 C  CE1 . HIS A 1 44 ? -33.200 18.772  17.315 1.00 59.14 ? 111  HIS A CE1 1 
ATOM   313 N  NE2 . HIS A 1 44 ? -34.292 18.935  18.040 1.00 60.16 ? 111  HIS A NE2 1 
ATOM   314 N  N   . GLY A 1 45 ? -32.040 25.161  16.698 1.00 31.97 ? 112  GLY A N   1 
ATOM   315 C  CA  . GLY A 1 45 ? -31.399 26.456  16.842 1.00 32.84 ? 112  GLY A CA  1 
ATOM   316 C  C   . GLY A 1 45 ? -30.154 26.553  15.983 1.00 31.50 ? 112  GLY A C   1 
ATOM   317 O  O   . GLY A 1 45 ? -30.198 26.276  14.789 1.00 30.11 ? 112  GLY A O   1 
ATOM   318 N  N   . PHE A 1 46 ? -29.040 26.956  16.584 1.00 25.00 ? 113  PHE A N   1 
ATOM   319 C  CA  . PHE A 1 46 ? -27.778 27.027  15.856 1.00 24.27 ? 113  PHE A CA  1 
ATOM   320 C  C   . PHE A 1 46 ? -26.726 26.170  16.547 1.00 22.86 ? 113  PHE A C   1 
ATOM   321 O  O   . PHE A 1 46 ? -26.729 26.040  17.768 1.00 23.32 ? 113  PHE A O   1 
ATOM   322 C  CB  . PHE A 1 46 ? -27.304 28.474  15.731 1.00 31.68 ? 113  PHE A CB  1 
ATOM   323 C  CG  . PHE A 1 46 ? -28.195 29.325  14.869 1.00 39.38 ? 113  PHE A CG  1 
ATOM   324 C  CD1 . PHE A 1 46 ? -29.396 29.807  15.358 1.00 43.67 ? 113  PHE A CD1 1 
ATOM   325 C  CD2 . PHE A 1 46 ? -27.837 29.628  13.566 1.00 43.62 ? 113  PHE A CD2 1 
ATOM   326 C  CE1 . PHE A 1 46 ? -30.222 30.586  14.567 1.00 45.74 ? 113  PHE A CE1 1 
ATOM   327 C  CE2 . PHE A 1 46 ? -28.660 30.408  12.770 1.00 45.48 ? 113  PHE A CE2 1 
ATOM   328 C  CZ  . PHE A 1 46 ? -29.853 30.885  13.273 1.00 44.04 ? 113  PHE A CZ  1 
ATOM   329 N  N   . ILE A 1 47 ? -25.828 25.587  15.763 1.00 20.28 ? 114  ILE A N   1 
ATOM   330 C  CA  . ILE A 1 47 ? -24.850 24.656  16.311 1.00 21.33 ? 114  ILE A CA  1 
ATOM   331 C  C   . ILE A 1 47 ? -23.571 24.607  15.485 1.00 23.64 ? 114  ILE A C   1 
ATOM   332 O  O   . ILE A 1 47 ? -23.607 24.636  14.252 1.00 23.24 ? 114  ILE A O   1 
ATOM   333 C  CB  . ILE A 1 47 ? -25.441 23.228  16.398 1.00 27.55 ? 114  ILE A CB  1 
ATOM   334 C  CG1 . ILE A 1 47 ? -24.384 22.228  16.867 1.00 31.11 ? 114  ILE A CG1 1 
ATOM   335 C  CG2 . ILE A 1 47 ? -25.999 22.798  15.052 1.00 30.94 ? 114  ILE A CG2 1 
ATOM   336 C  CD1 . ILE A 1 47 ? -24.423 21.940  18.348 1.00 21.96 ? 114  ILE A CD1 1 
ATOM   337 N  N   . SER A 1 48 ? -22.439 24.549  16.176 1.00 22.25 ? 115  SER A N   1 
ATOM   338 C  CA  . SER A 1 48 ? -21.170 24.222  15.539 1.00 20.39 ? 115  SER A CA  1 
ATOM   339 C  C   . SER A 1 48 ? -20.606 22.998  16.242 1.00 20.24 ? 115  SER A C   1 
ATOM   340 O  O   . SER A 1 48 ? -20.842 22.803  17.433 1.00 18.27 ? 115  SER A O   1 
ATOM   341 C  CB  . SER A 1 48 ? -20.190 25.394  15.625 1.00 30.80 ? 115  SER A CB  1 
ATOM   342 O  OG  . SER A 1 48 ? -19.926 25.747  16.971 1.00 34.98 ? 115  SER A OG  1 
ATOM   343 N  N   . ARG A 1 49 ? -19.883 22.165  15.503 1.00 15.77 ? 116  ARG A N   1 
ATOM   344 C  CA  . ARG A 1 49 ? -19.329 20.933  16.058 1.00 16.67 ? 116  ARG A CA  1 
ATOM   345 C  C   . ARG A 1 49 ? -17.898 20.729  15.594 1.00 21.58 ? 116  ARG A C   1 
ATOM   346 O  O   . ARG A 1 49 ? -17.524 21.150  14.501 1.00 19.54 ? 116  ARG A O   1 
ATOM   347 C  CB  . ARG A 1 49 ? -20.148 19.716  15.612 1.00 19.58 ? 116  ARG A CB  1 
ATOM   348 C  CG  . ARG A 1 49 ? -21.595 19.678  16.075 1.00 23.41 ? 116  ARG A CG  1 
ATOM   349 C  CD  . ARG A 1 49 ? -22.271 18.412  15.547 1.00 20.02 ? 116  ARG A CD  1 
ATOM   350 N  NE  . ARG A 1 49 ? -23.682 18.323  15.912 1.00 22.63 ? 116  ARG A NE  1 
ATOM   351 C  CZ  . ARG A 1 49 ? -24.680 18.806  15.177 1.00 23.43 ? 116  ARG A CZ  1 
ATOM   352 N  NH1 . ARG A 1 49 ? -24.430 19.427  14.031 1.00 22.02 ? 116  ARG A NH1 1 
ATOM   353 N  NH2 . ARG A 1 49 ? -25.932 18.670  15.591 1.00 23.84 ? 116  ARG A NH2 1 
ATOM   354 N  N   . GLU A 1 50 ? -17.102 20.060  16.419 1.00 18.04 ? 117  GLU A N   1 
ATOM   355 C  CA  . GLU A 1 50 ? -15.768 19.652  16.002 1.00 23.74 ? 117  GLU A CA  1 
ATOM   356 C  C   . GLU A 1 50 ? -15.325 18.427  16.788 1.00 20.37 ? 117  GLU A C   1 
ATOM   357 O  O   . GLU A 1 50 ? -15.567 18.333  17.989 1.00 17.52 ? 117  GLU A O   1 
ATOM   358 C  CB  . GLU A 1 50 ? -14.760 20.790  16.183 1.00 30.84 ? 117  GLU A CB  1 
ATOM   359 C  CG  . GLU A 1 50 ? -13.367 20.452  15.670 1.00 33.21 ? 117  GLU A CG  1 
ATOM   360 C  CD  . GLU A 1 50 ? -12.390 21.606  15.800 1.00 36.09 ? 117  GLU A CD  1 
ATOM   361 O  OE1 . GLU A 1 50 ? -12.712 22.590  16.499 1.00 30.85 ? 117  GLU A OE1 1 
ATOM   362 O  OE2 . GLU A 1 50 ? -11.297 21.529  15.200 1.00 35.91 ? 117  GLU A OE2 1 
ATOM   363 N  N   . PHE A 1 51 ? -14.683 17.486  16.104 1.00 19.97 ? 118  PHE A N   1 
ATOM   364 C  CA  . PHE A 1 51 ? -14.140 16.311  16.770 1.00 17.01 ? 118  PHE A CA  1 
ATOM   365 C  C   . PHE A 1 51 ? -12.812 15.889  16.159 1.00 17.20 ? 118  PHE A C   1 
ATOM   366 O  O   . PHE A 1 51 ? -12.518 16.190  15.002 1.00 17.54 ? 118  PHE A O   1 
ATOM   367 C  CB  . PHE A 1 51 ? -15.136 15.145  16.732 1.00 17.52 ? 118  PHE A CB  1 
ATOM   368 C  CG  . PHE A 1 51 ? -15.231 14.465  15.391 1.00 17.44 ? 118  PHE A CG  1 
ATOM   369 C  CD1 . PHE A 1 51 ? -14.399 13.400  15.077 1.00 17.46 ? 118  PHE A CD1 1 
ATOM   370 C  CD2 . PHE A 1 51 ? -16.158 14.885  14.450 1.00 15.21 ? 118  PHE A CD2 1 
ATOM   371 C  CE1 . PHE A 1 51 ? -14.485 12.770  13.845 1.00 18.79 ? 118  PHE A CE1 1 
ATOM   372 C  CE2 . PHE A 1 51 ? -16.251 14.258  13.218 1.00 17.20 ? 118  PHE A CE2 1 
ATOM   373 C  CZ  . PHE A 1 51 ? -15.412 13.202  12.915 1.00 18.27 ? 118  PHE A CZ  1 
ATOM   374 N  N   . HIS A 1 52 ? -12.004 15.198  16.953 1.00 17.14 ? 119  HIS A N   1 
ATOM   375 C  CA  . HIS A 1 52 ? -10.768 14.617  16.456 1.00 23.58 ? 119  HIS A CA  1 
ATOM   376 C  C   . HIS A 1 52 ? -10.698 13.184  16.964 1.00 23.22 ? 119  HIS A C   1 
ATOM   377 O  O   . HIS A 1 52 ? -10.611 12.949  18.167 1.00 19.72 ? 119  HIS A O   1 
ATOM   378 C  CB  . HIS A 1 52 ? -9.558  15.432  16.917 1.00 27.12 ? 119  HIS A CB  1 
ATOM   379 C  CG  . HIS A 1 52 ? -8.279  15.055  16.236 1.00 39.92 ? 119  HIS A CG  1 
ATOM   380 N  ND1 . HIS A 1 52 ? -8.180  14.906  14.870 1.00 48.27 ? 119  HIS A ND1 1 
ATOM   381 C  CD2 . HIS A 1 52 ? -7.042  14.813  16.731 1.00 42.94 ? 119  HIS A CD2 1 
ATOM   382 C  CE1 . HIS A 1 52 ? -6.940  14.577  14.552 1.00 42.08 ? 119  HIS A CE1 1 
ATOM   383 N  NE2 . HIS A 1 52 ? -6.229  14.517  15.663 1.00 45.37 ? 119  HIS A NE2 1 
ATOM   384 N  N   . ARG A 1 53 ? -10.772 12.233  16.039 1.00 19.74 ? 120  ARG A N   1 
ATOM   385 C  CA  . ARG A 1 53 ? -10.790 10.816  16.380 1.00 19.91 ? 120  ARG A CA  1 
ATOM   386 C  C   . ARG A 1 53 ? -9.536  10.122  15.866 1.00 23.17 ? 120  ARG A C   1 
ATOM   387 O  O   . ARG A 1 53 ? -9.115  10.350  14.733 1.00 23.97 ? 120  ARG A O   1 
ATOM   388 C  CB  . ARG A 1 53 ? -12.031 10.146  15.786 1.00 23.31 ? 120  ARG A CB  1 
ATOM   389 C  CG  . ARG A 1 53 ? -11.917 8.632   15.654 1.00 27.73 ? 120  ARG A CG  1 
ATOM   390 C  CD  . ARG A 1 53 ? -11.910 7.951   17.012 1.00 28.85 ? 120  ARG A CD  1 
ATOM   391 N  NE  . ARG A 1 53 ? -13.239 7.921   17.617 1.00 25.28 ? 120  ARG A NE  1 
ATOM   392 C  CZ  . ARG A 1 53 ? -13.490 7.449   18.834 1.00 25.92 ? 120  ARG A CZ  1 
ATOM   393 N  NH1 . ARG A 1 53 ? -12.500 6.979   19.579 1.00 26.53 ? 120  ARG A NH1 1 
ATOM   394 N  NH2 . ARG A 1 53 ? -14.728 7.450   19.308 1.00 26.90 ? 120  ARG A NH2 1 
ATOM   395 N  N   . LYS A 1 54 ? -8.945  9.275   16.701 1.00 18.69 ? 121  LYS A N   1 
ATOM   396 C  CA  . LYS A 1 54 ? -7.747  8.539   16.314 1.00 24.13 ? 121  LYS A CA  1 
ATOM   397 C  C   . LYS A 1 54 ? -7.929  7.035   16.486 1.00 26.31 ? 121  LYS A C   1 
ATOM   398 O  O   . LYS A 1 54 ? -8.371  6.568   17.537 1.00 22.73 ? 121  LYS A O   1 
ATOM   399 C  CB  . LYS A 1 54 ? -6.534  9.020   17.112 1.00 27.89 ? 121  LYS A CB  1 
ATOM   400 C  CG  . LYS A 1 54 ? -6.158  10.469  16.843 1.00 35.23 ? 121  LYS A CG  1 
ATOM   401 C  CD  . LYS A 1 54 ? -5.016  10.926  17.737 1.00 39.19 ? 121  LYS A CD  1 
ATOM   402 C  CE  . LYS A 1 54 ? -4.752  12.414  17.562 1.00 43.53 ? 121  LYS A CE  1 
ATOM   403 N  NZ  . LYS A 1 54 ? -3.752  12.927  18.537 1.00 48.58 ? 121  LYS A NZ  1 
ATOM   404 N  N   . TYR A 1 55 ? -7.597  6.285   15.439 1.00 24.32 ? 122  TYR A N   1 
ATOM   405 C  CA  . TYR A 1 55 ? -7.615  4.829   15.486 1.00 23.16 ? 122  TYR A CA  1 
ATOM   406 C  C   . TYR A 1 55 ? -6.201  4.297   15.326 1.00 27.68 ? 122  TYR A C   1 
ATOM   407 O  O   . TYR A 1 55 ? -5.414  4.828   14.544 1.00 27.20 ? 122  TYR A O   1 
ATOM   408 C  CB  . TYR A 1 55 ? -8.455  4.254   14.345 1.00 25.87 ? 122  TYR A CB  1 
ATOM   409 C  CG  . TYR A 1 55 ? -9.907  4.666   14.322 1.00 27.94 ? 122  TYR A CG  1 
ATOM   410 C  CD1 . TYR A 1 55 ? -10.840 4.036   15.135 1.00 27.35 ? 122  TYR A CD1 1 
ATOM   411 C  CD2 . TYR A 1 55 ? -10.351 5.658   13.459 1.00 24.56 ? 122  TYR A CD2 1 
ATOM   412 C  CE1 . TYR A 1 55 ? -12.169 4.398   15.104 1.00 22.07 ? 122  TYR A CE1 1 
ATOM   413 C  CE2 . TYR A 1 55 ? -11.676 6.027   13.419 1.00 23.19 ? 122  TYR A CE2 1 
ATOM   414 C  CZ  . TYR A 1 55 ? -12.582 5.393   14.242 1.00 25.42 ? 122  TYR A CZ  1 
ATOM   415 O  OH  . TYR A 1 55 ? -13.905 5.756   14.208 1.00 27.47 ? 122  TYR A OH  1 
ATOM   416 N  N   . ARG A 1 56 ? -5.886  3.234   16.056 1.00 27.44 ? 123  ARG A N   1 
ATOM   417 C  CA  . ARG A 1 56 ? -4.624  2.538   15.867 1.00 27.44 ? 123  ARG A CA  1 
ATOM   418 C  C   . ARG A 1 56 ? -4.773  1.534   14.730 1.00 29.08 ? 123  ARG A C   1 
ATOM   419 O  O   . ARG A 1 56 ? -5.688  0.709   14.735 1.00 30.56 ? 123  ARG A O   1 
ATOM   420 C  CB  . ARG A 1 56 ? -4.214  1.817   17.152 1.00 24.59 ? 123  ARG A CB  1 
ATOM   421 C  CG  . ARG A 1 56 ? -2.883  1.079   17.060 1.00 37.81 ? 123  ARG A CG  1 
ATOM   422 C  CD  . ARG A 1 56 ? -1.709  2.048   17.072 1.00 45.90 ? 123  ARG A CD  1 
ATOM   423 N  N   . ILE A 1 57 ? -3.884  1.613   13.746 1.00 28.52 ? 124  ILE A N   1 
ATOM   424 C  CA  . ILE A 1 57 ? -3.867  0.638   12.663 1.00 31.08 ? 124  ILE A CA  1 
ATOM   425 C  C   . ILE A 1 57 ? -3.257  -0.663  13.174 1.00 35.34 ? 124  ILE A C   1 
ATOM   426 O  O   . ILE A 1 57 ? -2.178  -0.652  13.765 1.00 33.61 ? 124  ILE A O   1 
ATOM   427 C  CB  . ILE A 1 57 ? -3.058  1.148   11.457 1.00 32.34 ? 124  ILE A CB  1 
ATOM   428 C  CG1 . ILE A 1 57 ? -3.660  2.448   10.921 1.00 24.36 ? 124  ILE A CG1 1 
ATOM   429 C  CG2 . ILE A 1 57 ? -3.003  0.091   10.359 1.00 28.00 ? 124  ILE A CG2 1 
ATOM   430 C  CD1 . ILE A 1 57 ? -2.888  3.043   9.755  1.00 28.29 ? 124  ILE A CD1 1 
ATOM   431 N  N   . PRO A 1 58 ? -3.961  -1.786  12.972 1.00 36.88 ? 125  PRO A N   1 
ATOM   432 C  CA  . PRO A 1 58 ? -3.471  -3.093  13.421 1.00 43.16 ? 125  PRO A CA  1 
ATOM   433 C  C   . PRO A 1 58 ? -2.131  -3.449  12.781 1.00 42.72 ? 125  PRO A C   1 
ATOM   434 O  O   . PRO A 1 58 ? -1.824  -2.991  11.679 1.00 39.71 ? 125  PRO A O   1 
ATOM   435 C  CB  . PRO A 1 58 ? -4.566  -4.055  12.953 1.00 43.99 ? 125  PRO A CB  1 
ATOM   436 C  CG  . PRO A 1 58 ? -5.795  -3.212  12.885 1.00 41.98 ? 125  PRO A CG  1 
ATOM   437 C  CD  . PRO A 1 58 ? -5.324  -1.866  12.421 1.00 37.41 ? 125  PRO A CD  1 
ATOM   438 N  N   . ALA A 1 59 ? -1.345  -4.265  13.476 1.00 44.65 ? 126  ALA A N   1 
ATOM   439 C  CA  . ALA A 1 59 ? 0.003   -4.607  13.033 1.00 41.11 ? 126  ALA A CA  1 
ATOM   440 C  C   . ALA A 1 59 ? 0.034   -5.276  11.658 1.00 45.28 ? 126  ALA A C   1 
ATOM   441 O  O   . ALA A 1 59 ? 0.974   -5.081  10.886 1.00 47.53 ? 126  ALA A O   1 
ATOM   442 C  CB  . ALA A 1 59 ? 0.692   -5.486  14.073 1.00 43.65 ? 126  ALA A CB  1 
ATOM   443 N  N   . ASP A 1 60 ? -0.991  -6.066  11.352 1.00 47.13 ? 127  ASP A N   1 
ATOM   444 C  CA  . ASP A 1 60 ? -1.022  -6.807  10.093 1.00 50.00 ? 127  ASP A CA  1 
ATOM   445 C  C   . ASP A 1 60 ? -1.644  -5.999  8.955  1.00 46.79 ? 127  ASP A C   1 
ATOM   446 O  O   . ASP A 1 60 ? -1.985  -6.547  7.908  1.00 44.60 ? 127  ASP A O   1 
ATOM   447 C  CB  . ASP A 1 60 ? -1.748  -8.146  10.263 1.00 54.02 ? 127  ASP A CB  1 
ATOM   448 C  CG  . ASP A 1 60 ? -3.183  -7.982  10.722 1.00 60.01 ? 127  ASP A CG  1 
ATOM   449 O  OD1 . ASP A 1 60 ? -3.597  -6.836  10.999 1.00 59.94 ? 127  ASP A OD1 1 
ATOM   450 O  OD2 . ASP A 1 60 ? -3.897  -9.002  10.805 1.00 63.06 ? 127  ASP A OD2 1 
ATOM   451 N  N   . VAL A 1 61 ? -1.784  -4.694  9.163  1.00 41.57 ? 128  VAL A N   1 
ATOM   452 C  CA  . VAL A 1 61 ? -2.315  -3.808  8.134  1.00 38.99 ? 128  VAL A CA  1 
ATOM   453 C  C   . VAL A 1 61 ? -1.285  -2.757  7.733  1.00 35.00 ? 128  VAL A C   1 
ATOM   454 O  O   . VAL A 1 61 ? -0.805  -1.990  8.569  1.00 35.58 ? 128  VAL A O   1 
ATOM   455 C  CB  . VAL A 1 61 ? -3.606  -3.104  8.602  1.00 37.11 ? 128  VAL A CB  1 
ATOM   456 C  CG1 . VAL A 1 61 ? -4.115  -2.139  7.531  1.00 37.32 ? 128  VAL A CG1 1 
ATOM   457 C  CG2 . VAL A 1 61 ? -4.669  -4.132  8.959  1.00 36.73 ? 128  VAL A CG2 1 
ATOM   458 N  N   . ASP A 1 62 ? -0.942  -2.731  6.450  1.00 32.24 ? 129  ASP A N   1 
ATOM   459 C  CA  . ASP A 1 62 ? -0.037  -1.722  5.920  1.00 35.50 ? 129  ASP A CA  1 
ATOM   460 C  C   . ASP A 1 62 ? -0.755  -0.380  5.843  1.00 36.04 ? 129  ASP A C   1 
ATOM   461 O  O   . ASP A 1 62 ? -1.753  -0.250  5.135  1.00 38.25 ? 129  ASP A O   1 
ATOM   462 C  CB  . ASP A 1 62 ? 0.456   -2.135  4.531  1.00 40.04 ? 129  ASP A CB  1 
ATOM   463 C  CG  . ASP A 1 62 ? 1.470   -1.165  3.954  1.00 47.60 ? 129  ASP A CG  1 
ATOM   464 O  OD1 . ASP A 1 62 ? 1.747   -0.128  4.592  1.00 44.68 ? 129  ASP A OD1 1 
ATOM   465 O  OD2 . ASP A 1 62 ? 1.992   -1.441  2.853  1.00 60.80 ? 129  ASP A OD2 1 
ATOM   466 N  N   . PRO A 1 63 ? -0.249  0.625   6.575  1.00 33.85 ? 130  PRO A N   1 
ATOM   467 C  CA  . PRO A 1 63 ? -0.867  1.954   6.592  1.00 31.47 ? 130  PRO A CA  1 
ATOM   468 C  C   . PRO A 1 63 ? -0.968  2.554   5.191  1.00 31.82 ? 130  PRO A C   1 
ATOM   469 O  O   . PRO A 1 63 ? -1.902  3.305   4.913  1.00 24.98 ? 130  PRO A O   1 
ATOM   470 C  CB  . PRO A 1 63 ? 0.096   2.778   7.455  1.00 28.87 ? 130  PRO A CB  1 
ATOM   471 C  CG  . PRO A 1 63 ? 0.795   1.774   8.310  1.00 38.52 ? 130  PRO A CG  1 
ATOM   472 C  CD  . PRO A 1 63 ? 0.937   0.553   7.447  1.00 42.48 ? 130  PRO A CD  1 
ATOM   473 N  N   . LEU A 1 64 ? -0.020  2.213   4.322  1.00 29.88 ? 131  LEU A N   1 
ATOM   474 C  CA  . LEU A 1 64 ? 0.014   2.758   2.967  1.00 36.82 ? 131  LEU A CA  1 
ATOM   475 C  C   . LEU A 1 64 ? -1.193  2.330   2.141  1.00 29.54 ? 131  LEU A C   1 
ATOM   476 O  O   . LEU A 1 64 ? -1.542  2.982   1.158  1.00 30.01 ? 131  LEU A O   1 
ATOM   477 C  CB  . LEU A 1 64 ? 1.298   2.329   2.244  1.00 38.69 ? 131  LEU A CB  1 
ATOM   478 C  CG  . LEU A 1 64 ? 2.635   2.739   2.863  1.00 47.79 ? 131  LEU A CG  1 
ATOM   479 C  CD1 . LEU A 1 64 ? 3.796   2.154   2.068  1.00 53.36 ? 131  LEU A CD1 1 
ATOM   480 C  CD2 . LEU A 1 64 ? 2.748   4.253   2.953  1.00 46.19 ? 131  LEU A CD2 1 
ATOM   481 N  N   . THR A 1 65 ? -1.815  1.220   2.527  1.00 26.52 ? 132  THR A N   1 
ATOM   482 C  CA  . THR A 1 65 ? -2.923  0.667   1.757  1.00 31.32 ? 132  THR A CA  1 
ATOM   483 C  C   . THR A 1 65 ? -4.275  1.072   2.334  1.00 31.18 ? 132  THR A C   1 
ATOM   484 O  O   . THR A 1 65 ? -5.317  0.588   1.891  1.00 34.70 ? 132  THR A O   1 
ATOM   485 C  CB  . THR A 1 65 ? -2.838  -0.871  1.666  1.00 36.29 ? 132  THR A CB  1 
ATOM   486 O  OG1 . THR A 1 65 ? -2.883  -1.435  2.982  1.00 44.51 ? 132  THR A OG1 1 
ATOM   487 C  CG2 . THR A 1 65 ? -1.543  -1.294  0.981  1.00 44.34 ? 132  THR A CG2 1 
ATOM   488 N  N   . ILE A 1 66 ? -4.253  1.962   3.321  1.00 27.86 ? 133  ILE A N   1 
ATOM   489 C  CA  . ILE A 1 66 ? -5.480  2.452   3.937  1.00 27.04 ? 133  ILE A CA  1 
ATOM   490 C  C   . ILE A 1 66 ? -6.216  3.403   3.003  1.00 25.31 ? 133  ILE A C   1 
ATOM   491 O  O   . ILE A 1 66 ? -5.632  4.356   2.491  1.00 23.53 ? 133  ILE A O   1 
ATOM   492 C  CB  . ILE A 1 66 ? -5.196  3.193   5.263  1.00 29.25 ? 133  ILE A CB  1 
ATOM   493 C  CG1 . ILE A 1 66 ? -4.690  2.220   6.329  1.00 34.41 ? 133  ILE A CG1 1 
ATOM   494 C  CG2 . ILE A 1 66 ? -6.450  3.903   5.754  1.00 26.80 ? 133  ILE A CG2 1 
ATOM   495 C  CD1 . ILE A 1 66 ? -5.759  1.300   6.875  1.00 33.79 ? 133  ILE A CD1 1 
ATOM   496 N  N   . THR A 1 67 ? -7.501  3.137   2.786  1.00 23.69 ? 134  THR A N   1 
ATOM   497 C  CA  . THR A 1 67 ? -8.356  4.034   2.014  1.00 22.12 ? 134  THR A CA  1 
ATOM   498 C  C   . THR A 1 67 ? -9.616  4.336   2.812  1.00 18.48 ? 134  THR A C   1 
ATOM   499 O  O   . THR A 1 67 ? -9.819  3.782   3.889  1.00 23.49 ? 134  THR A O   1 
ATOM   500 C  CB  . THR A 1 67 ? -8.754  3.417   0.661  1.00 27.61 ? 134  THR A CB  1 
ATOM   501 O  OG1 . THR A 1 67 ? -9.515  2.223   0.886  1.00 29.12 ? 134  THR A OG1 1 
ATOM   502 C  CG2 . THR A 1 67 ? -7.517  3.078   -0.155 1.00 32.08 ? 134  THR A CG2 1 
ATOM   503 N  N   . SER A 1 68 ? -10.462 5.217   2.290  1.00 16.54 ? 135  SER A N   1 
ATOM   504 C  CA  . SER A 1 68 ? -11.714 5.527   2.963  1.00 17.78 ? 135  SER A CA  1 
ATOM   505 C  C   . SER A 1 68 ? -12.845 5.761   1.972  1.00 18.89 ? 135  SER A C   1 
ATOM   506 O  O   . SER A 1 68 ? -12.614 5.937   0.779  1.00 17.40 ? 135  SER A O   1 
ATOM   507 C  CB  . SER A 1 68 ? -11.552 6.735   3.895  1.00 22.52 ? 135  SER A CB  1 
ATOM   508 O  OG  . SER A 1 68 ? -11.203 7.904   3.174  1.00 23.72 ? 135  SER A OG  1 
ATOM   509 N  N   . SER A 1 69 ? -14.071 5.747   2.477  1.00 18.99 ? 136  SER A N   1 
ATOM   510 C  CA  . SER A 1 69 ? -15.235 6.011   1.649  1.00 24.13 ? 136  SER A CA  1 
ATOM   511 C  C   . SER A 1 69 ? -16.348 6.578   2.513  1.00 19.02 ? 136  SER A C   1 
ATOM   512 O  O   . SER A 1 69 ? -16.401 6.330   3.716  1.00 21.64 ? 136  SER A O   1 
ATOM   513 C  CB  . SER A 1 69 ? -15.706 4.736   0.948  1.00 26.16 ? 136  SER A CB  1 
ATOM   514 O  OG  . SER A 1 69 ? -16.178 3.786   1.884  1.00 33.41 ? 136  SER A OG  1 
HETATM 515 N  N   . MSE A 1 70 ? -17.232 7.346   1.892  1.00 16.86 ? 137  MSE A N   1 
HETATM 516 C  CA  A MSE A 1 70 ? -18.353 7.925   2.611  0.50 16.68 ? 137  MSE A CA  1 
HETATM 517 C  CA  B MSE A 1 70 ? -18.350 7.970   2.589  0.50 17.93 ? 137  MSE A CA  1 
HETATM 518 C  C   . MSE A 1 70 ? -19.666 7.579   1.928  1.00 16.87 ? 137  MSE A C   1 
HETATM 519 O  O   . MSE A 1 70 ? -19.812 7.729   0.718  1.00 18.29 ? 137  MSE A O   1 
HETATM 520 C  CB  A MSE A 1 70 ? -18.187 9.437   2.731  0.50 21.56 ? 137  MSE A CB  1 
HETATM 521 C  CB  B MSE A 1 70 ? -18.197 9.490   2.548  0.50 21.94 ? 137  MSE A CB  1 
HETATM 522 C  CG  A MSE A 1 70 ? -19.234 10.101  3.593  0.50 27.48 ? 137  MSE A CG  1 
HETATM 523 C  CG  B MSE A 1 70 ? -19.420 10.254  3.021  0.50 24.06 ? 137  MSE A CG  1 
HETATM 524 SE SE  A MSE A 1 70 ? -18.536 11.727  4.387  0.50 19.84 ? 137  MSE A SE  1 
HETATM 525 SE SE  B MSE A 1 70 ? -19.507 10.356  4.959  0.50 34.63 ? 137  MSE A SE  1 
HETATM 526 C  CE  A MSE A 1 70 ? -20.204 12.472  5.068  0.50 11.85 ? 137  MSE A CE  1 
HETATM 527 C  CE  B MSE A 1 70 ? -17.714 11.050  5.275  0.50 17.09 ? 137  MSE A CE  1 
ATOM   528 N  N   . SER A 1 71 ? -20.620 7.096   2.718  1.00 14.93 ? 138  SER A N   1 
ATOM   529 C  CA  . SER A 1 71 ? -21.905 6.660   2.183  1.00 16.48 ? 138  SER A CA  1 
ATOM   530 C  C   . SER A 1 71 ? -22.930 7.785   2.196  1.00 19.19 ? 138  SER A C   1 
ATOM   531 O  O   . SER A 1 71 ? -22.791 8.757   2.936  1.00 19.82 ? 138  SER A O   1 
ATOM   532 C  CB  . SER A 1 71 ? -22.447 5.477   2.988  1.00 25.13 ? 138  SER A CB  1 
ATOM   533 O  OG  . SER A 1 71 ? -22.850 5.895   4.283  1.00 26.93 ? 138  SER A OG  1 
ATOM   534 N  N   . SER A 1 72 ? -23.966 7.640   1.377  1.00 16.43 ? 139  SER A N   1 
ATOM   535 C  CA  . SER A 1 72 ? -25.058 8.604   1.357  1.00 21.66 ? 139  SER A CA  1 
ATOM   536 C  C   . SER A 1 72 ? -25.794 8.603   2.700  1.00 32.15 ? 139  SER A C   1 
ATOM   537 O  O   . SER A 1 72 ? -26.645 9.456   2.956  1.00 31.26 ? 139  SER A O   1 
ATOM   538 C  CB  . SER A 1 72 ? -26.020 8.286   0.211  1.00 21.85 ? 139  SER A CB  1 
ATOM   539 O  OG  . SER A 1 72 ? -26.345 6.906   0.196  1.00 23.68 ? 139  SER A OG  1 
ATOM   540 N  N   . ASP A 1 73 ? -25.454 7.633   3.546  1.00 37.28 ? 140  ASP A N   1 
ATOM   541 C  CA  . ASP A 1 73 ? -26.015 7.510   4.891  1.00 40.12 ? 140  ASP A CA  1 
ATOM   542 C  C   . ASP A 1 73 ? -25.354 8.471   5.874  1.00 34.04 ? 140  ASP A C   1 
ATOM   543 O  O   . ASP A 1 73 ? -25.879 8.726   6.958  1.00 36.44 ? 140  ASP A O   1 
ATOM   544 C  CB  . ASP A 1 73 ? -25.829 6.082   5.409  1.00 51.89 ? 140  ASP A CB  1 
ATOM   545 C  CG  . ASP A 1 73 ? -27.050 5.219   5.196  1.00 66.08 ? 140  ASP A CG  1 
ATOM   546 O  OD1 . ASP A 1 73 ? -27.805 5.479   4.237  1.00 68.48 ? 140  ASP A OD1 1 
ATOM   547 O  OD2 . ASP A 1 73 ? -27.256 4.280   5.994  1.00 74.92 ? 140  ASP A OD2 1 
ATOM   548 N  N   . GLY A 1 74 ? -24.194 8.995   5.496  1.00 22.24 ? 141  GLY A N   1 
ATOM   549 C  CA  . GLY A 1 74 ? -23.421 9.836   6.388  1.00 22.62 ? 141  GLY A CA  1 
ATOM   550 C  C   . GLY A 1 74 ? -22.494 9.003   7.255  1.00 24.49 ? 141  GLY A C   1 
ATOM   551 O  O   . GLY A 1 74 ? -22.085 9.432   8.332  1.00 26.87 ? 141  GLY A O   1 
ATOM   552 N  N   . VAL A 1 75 ? -22.168 7.804   6.783  1.00 23.67 ? 142  VAL A N   1 
ATOM   553 C  CA  . VAL A 1 75 ? -21.220 6.938   7.475  1.00 21.53 ? 142  VAL A CA  1 
ATOM   554 C  C   . VAL A 1 75 ? -19.863 6.948   6.778  1.00 17.00 ? 142  VAL A C   1 
ATOM   555 O  O   . VAL A 1 75 ? -19.764 6.681   5.578  1.00 15.66 ? 142  VAL A O   1 
ATOM   556 C  CB  . VAL A 1 75 ? -21.734 5.491   7.566  1.00 25.76 ? 142  VAL A CB  1 
ATOM   557 C  CG1 . VAL A 1 75 ? -20.654 4.578   8.122  1.00 23.13 ? 142  VAL A CG1 1 
ATOM   558 C  CG2 . VAL A 1 75 ? -22.992 5.428   8.427  1.00 27.52 ? 142  VAL A CG2 1 
ATOM   559 N  N   . LEU A 1 76 ? -18.824 7.279   7.536  1.00 15.61 ? 143  LEU A N   1 
ATOM   560 C  CA  . LEU A 1 76 ? -17.456 7.263   7.032  1.00 15.79 ? 143  LEU A CA  1 
ATOM   561 C  C   . LEU A 1 76 ? -16.809 5.929   7.352  1.00 21.40 ? 143  LEU A C   1 
ATOM   562 O  O   . LEU A 1 76 ? -16.831 5.481   8.499  1.00 21.18 ? 143  LEU A O   1 
ATOM   563 C  CB  . LEU A 1 76 ? -16.636 8.386   7.669  1.00 15.04 ? 143  LEU A CB  1 
ATOM   564 C  CG  . LEU A 1 76 ? -15.149 8.423   7.305  1.00 22.70 ? 143  LEU A CG  1 
ATOM   565 C  CD1 . LEU A 1 76 ? -14.956 8.718   5.818  1.00 20.49 ? 143  LEU A CD1 1 
ATOM   566 C  CD2 . LEU A 1 76 ? -14.422 9.456   8.146  1.00 26.80 ? 143  LEU A CD2 1 
ATOM   567 N  N   . THR A 1 77 ? -16.239 5.294   6.336  1.00 15.41 ? 144  THR A N   1 
ATOM   568 C  CA  . THR A 1 77 ? -15.552 4.024   6.515  1.00 19.43 ? 144  THR A CA  1 
ATOM   569 C  C   . THR A 1 77 ? -14.082 4.153   6.150  1.00 20.23 ? 144  THR A C   1 
ATOM   570 O  O   . THR A 1 77 ? -13.741 4.637   5.071  1.00 19.90 ? 144  THR A O   1 
ATOM   571 C  CB  . THR A 1 77 ? -16.189 2.914   5.654  1.00 26.88 ? 144  THR A CB  1 
ATOM   572 O  OG1 . THR A 1 77 ? -17.544 2.709   6.070  1.00 26.37 ? 144  THR A OG1 1 
ATOM   573 C  CG2 . THR A 1 77 ? -15.411 1.608   5.790  1.00 25.80 ? 144  THR A CG2 1 
ATOM   574 N  N   . VAL A 1 78 ? -13.216 3.732   7.065  1.00 16.91 ? 145  VAL A N   1 
ATOM   575 C  CA  . VAL A 1 78 ? -11.786 3.666   6.801  1.00 20.00 ? 145  VAL A CA  1 
ATOM   576 C  C   . VAL A 1 78 ? -11.368 2.202   6.823  1.00 22.94 ? 145  VAL A C   1 
ATOM   577 O  O   . VAL A 1 78 ? -11.641 1.485   7.784  1.00 22.87 ? 145  VAL A O   1 
ATOM   578 C  CB  . VAL A 1 78 ? -10.971 4.446   7.847  1.00 22.03 ? 145  VAL A CB  1 
ATOM   579 C  CG1 . VAL A 1 78 ? -9.499  4.469   7.457  1.00 27.16 ? 145  VAL A CG1 1 
ATOM   580 C  CG2 . VAL A 1 78 ? -11.508 5.863   7.997  1.00 20.46 ? 145  VAL A CG2 1 
ATOM   581 N  N   . ASN A 1 79 ? -10.713 1.751   5.762  1.00 22.79 ? 146  ASN A N   1 
ATOM   582 C  CA  . ASN A 1 79 ? -10.404 0.334   5.643  1.00 24.63 ? 146  ASN A CA  1 
ATOM   583 C  C   . ASN A 1 79 ? -9.085  0.043   4.941  1.00 29.09 ? 146  ASN A C   1 
ATOM   584 O  O   . ASN A 1 79 ? -8.541  0.887   4.229  1.00 27.51 ? 146  ASN A O   1 
ATOM   585 C  CB  . ASN A 1 79 ? -11.555 -0.405  4.952  1.00 32.15 ? 146  ASN A CB  1 
ATOM   586 C  CG  . ASN A 1 79 ? -11.960 0.236   3.642  1.00 40.02 ? 146  ASN A CG  1 
ATOM   587 O  OD1 . ASN A 1 79 ? -11.140 0.845   2.955  1.00 47.45 ? 146  ASN A OD1 1 
ATOM   588 N  ND2 . ASN A 1 79 ? -13.231 0.096   3.284  1.00 32.79 ? 146  ASN A ND2 1 
ATOM   589 N  N   . GLY A 1 80 ? -8.573  -1.164  5.157  1.00 31.92 ? 147  GLY A N   1 
ATOM   590 C  CA  . GLY A 1 80 ? -7.340  -1.594  4.527  1.00 34.39 ? 147  GLY A CA  1 
ATOM   591 C  C   . GLY A 1 80 ? -7.212  -3.104  4.534  1.00 34.83 ? 147  GLY A C   1 
ATOM   592 O  O   . GLY A 1 80 ? -7.709  -3.769  5.445  1.00 34.81 ? 147  GLY A O   1 
ATOM   593 N  N   . PRO A 1 81 ? -6.546  -3.655  3.512  1.00 33.12 ? 148  PRO A N   1 
ATOM   594 C  CA  . PRO A 1 81 ? -6.316  -5.098  3.403  1.00 38.53 ? 148  PRO A CA  1 
ATOM   595 C  C   . PRO A 1 81 ? -5.371  -5.563  4.499  1.00 40.91 ? 148  PRO A C   1 
ATOM   596 O  O   . PRO A 1 81 ? -4.522  -4.789  4.937  1.00 37.69 ? 148  PRO A O   1 
ATOM   597 C  CB  . PRO A 1 81 ? -5.626  -5.243  2.040  1.00 38.03 ? 148  PRO A CB  1 
ATOM   598 C  CG  . PRO A 1 81 ? -5.894  -3.968  1.316  1.00 41.09 ? 148  PRO A CG  1 
ATOM   599 C  CD  . PRO A 1 81 ? -5.975  -2.918  2.375  1.00 33.85 ? 148  PRO A CD  1 
ATOM   600 N  N   . ARG A 1 82 ? -5.513  -6.807  4.938  1.00 46.02 ? 149  ARG A N   1 
ATOM   601 C  CA  . ARG A 1 82 ? -4.563  -7.375  5.883  1.00 51.03 ? 149  ARG A CA  1 
ATOM   602 C  C   . ARG A 1 82 ? -3.442  -8.062  5.113  1.00 54.88 ? 149  ARG A C   1 
ATOM   603 O  O   . ARG A 1 82 ? -3.665  -8.595  4.026  1.00 54.48 ? 149  ARG A O   1 
ATOM   604 C  CB  . ARG A 1 82 ? -5.256  -8.349  6.838  1.00 54.58 ? 149  ARG A CB  1 
ATOM   605 C  CG  . ARG A 1 82 ? -6.333  -7.692  7.688  1.00 57.27 ? 149  ARG A CG  1 
ATOM   606 C  CD  . ARG A 1 82 ? -6.852  -8.620  8.772  1.00 59.88 ? 149  ARG A CD  1 
ATOM   607 N  NE  . ARG A 1 82 ? -7.957  -8.014  9.510  1.00 58.62 ? 149  ARG A NE  1 
ATOM   608 C  CZ  . ARG A 1 82 ? -7.808  -7.214  10.561 1.00 52.36 ? 149  ARG A CZ  1 
ATOM   609 N  NH1 . ARG A 1 82 ? -6.594  -6.918  11.006 1.00 52.63 ? 149  ARG A NH1 1 
ATOM   610 N  NH2 . ARG A 1 82 ? -8.873  -6.709  11.168 1.00 48.29 ? 149  ARG A NH2 1 
ATOM   611 N  N   . LYS A 1 83 ? -2.236  -8.030  5.668  1.00 56.18 ? 150  LYS A N   1 
ATOM   612 C  CA  . LYS A 1 83 ? -1.070  -8.577  4.982  1.00 60.75 ? 150  LYS A CA  1 
ATOM   613 C  C   . LYS A 1 83 ? -0.632  -9.905  5.592  1.00 63.01 ? 150  LYS A C   1 
ATOM   614 O  O   . LYS A 1 83 ? -0.970  -10.217 6.734  1.00 63.63 ? 150  LYS A O   1 
ATOM   615 C  CB  . LYS A 1 83 ? 0.084   -7.572  5.011  1.00 60.05 ? 150  LYS A CB  1 
ATOM   616 C  CG  . LYS A 1 83 ? 1.250   -7.940  4.109  1.00 63.99 ? 150  LYS A CG  1 
HETATM 617 C  C1  . MRD B 2 .  ? -15.607 11.351  0.091  1.00 42.89 ? 1151 MRD A C1  1 
HETATM 618 C  C2  . MRD B 2 .  ? -14.376 11.007  0.926  1.00 46.82 ? 1151 MRD A C2  1 
HETATM 619 O  O2  . MRD B 2 .  ? -13.226 11.495  0.291  1.00 50.11 ? 1151 MRD A O2  1 
HETATM 620 C  CM  . MRD B 2 .  ? -14.265 9.491   1.075  1.00 43.97 ? 1151 MRD A CM  1 
HETATM 621 C  C3  . MRD B 2 .  ? -14.511 11.639  2.309  1.00 46.36 ? 1151 MRD A C3  1 
HETATM 622 C  C4  . MRD B 2 .  ? -13.244 11.807  3.143  1.00 47.77 ? 1151 MRD A C4  1 
HETATM 623 O  O4  . MRD B 2 .  ? -12.466 10.642  3.216  1.00 50.76 ? 1151 MRD A O4  1 
HETATM 624 C  C5  . MRD B 2 .  ? -13.498 12.451  4.503  1.00 46.60 ? 1151 MRD A C5  1 
HETATM 625 O  O   . HOH C 3 .  ? -7.816  -8.218  3.844  1.00 43.34 ? 2001 HOH A O   1 
HETATM 626 O  O   . HOH C 3 .  ? -12.426 -8.950  2.511  1.00 56.66 ? 2002 HOH A O   1 
HETATM 627 O  O   . HOH C 3 .  ? -11.897 -4.553  11.349 1.00 41.08 ? 2003 HOH A O   1 
HETATM 628 O  O   . HOH C 3 .  ? -13.086 -2.286  13.612 1.00 54.46 ? 2004 HOH A O   1 
HETATM 629 O  O   . HOH C 3 .  ? -16.049 0.572   13.569 1.00 36.91 ? 2005 HOH A O   1 
HETATM 630 O  O   . HOH C 3 .  ? -24.237 8.004   16.089 1.00 47.57 ? 2006 HOH A O   1 
HETATM 631 O  O   . HOH C 3 .  ? -20.131 6.389   14.951 1.00 27.87 ? 2007 HOH A O   1 
HETATM 632 O  O   . HOH C 3 .  ? -21.570 14.427  15.759 1.00 35.74 ? 2008 HOH A O   1 
HETATM 633 O  O   . HOH C 3 .  ? -22.191 13.424  13.010 1.00 16.05 ? 2009 HOH A O   1 
HETATM 634 O  O   . HOH C 3 .  ? -22.934 13.693  5.936  1.00 47.04 ? 2010 HOH A O   1 
HETATM 635 O  O   . HOH C 3 .  ? -14.079 15.714  0.454  1.00 42.48 ? 2011 HOH A O   1 
HETATM 636 O  O   . HOH C 3 .  ? -11.827 18.897  8.781  1.00 36.69 ? 2012 HOH A O   1 
HETATM 637 O  O   . HOH C 3 .  ? -12.692 15.658  2.748  1.00 31.53 ? 2013 HOH A O   1 
HETATM 638 O  O   . HOH C 3 .  ? -7.189  14.467  9.925  1.00 46.56 ? 2014 HOH A O   1 
HETATM 639 O  O   . HOH C 3 .  ? -9.349  13.585  3.762  1.00 37.23 ? 2015 HOH A O   1 
HETATM 640 O  O   . HOH C 3 .  ? -5.766  14.305  4.448  1.00 52.29 ? 2016 HOH A O   1 
HETATM 641 O  O   . HOH C 3 .  ? -2.438  10.707  4.916  1.00 46.31 ? 2017 HOH A O   1 
HETATM 642 O  O   . HOH C 3 .  ? -5.530  15.516  11.821 1.00 52.33 ? 2018 HOH A O   1 
HETATM 643 O  O   . HOH C 3 .  ? -0.931  13.804  15.704 1.00 55.05 ? 2019 HOH A O   1 
HETATM 644 O  O   . HOH C 3 .  ? -11.203 -7.867  0.238  1.00 59.33 ? 2020 HOH A O   1 
HETATM 645 O  O   . HOH C 3 .  ? -14.931 -4.127  14.498 1.00 54.00 ? 2021 HOH A O   1 
HETATM 646 O  O   . HOH C 3 .  ? -10.720 -1.319  15.703 1.00 44.82 ? 2022 HOH A O   1 
HETATM 647 O  O   . HOH C 3 .  ? -14.817 1.780   15.928 1.00 47.34 ? 2023 HOH A O   1 
HETATM 648 O  O   . HOH C 3 .  ? -14.190 22.379  8.263  1.00 38.53 ? 2024 HOH A O   1 
HETATM 649 O  O   . HOH C 3 .  ? -18.831 13.514  17.675 1.00 60.48 ? 2025 HOH A O   1 
HETATM 650 O  O   . HOH C 3 .  ? -18.997 16.140  17.161 1.00 54.35 ? 2026 HOH A O   1 
HETATM 651 O  O   . HOH C 3 .  ? -18.130 24.716  7.966  1.00 27.39 ? 2027 HOH A O   1 
HETATM 652 O  O   . HOH C 3 .  ? -18.939 29.105  13.364 1.00 41.05 ? 2028 HOH A O   1 
HETATM 653 O  O   . HOH C 3 .  ? -20.438 28.894  17.326 1.00 48.33 ? 2029 HOH A O   1 
HETATM 654 O  O   . HOH C 3 .  ? -1.803  7.809   3.559  1.00 54.49 ? 2030 HOH A O   1 
HETATM 655 O  O   . HOH C 3 .  ? -33.809 27.421  14.262 1.00 49.32 ? 2031 HOH A O   1 
HETATM 656 O  O   . HOH C 3 .  ? -28.559 25.597  7.988  1.00 52.05 ? 2032 HOH A O   1 
HETATM 657 O  O   . HOH C 3 .  ? -28.148 21.925  9.801  1.00 54.98 ? 2033 HOH A O   1 
HETATM 658 O  O   . HOH C 3 .  ? -27.330 28.181  8.767  1.00 41.81 ? 2034 HOH A O   1 
HETATM 659 O  O   . HOH C 3 .  ? -17.893 11.546  16.161 1.00 50.45 ? 2035 HOH A O   1 
HETATM 660 O  O   . HOH C 3 .  ? -27.778 19.533  13.622 1.00 35.18 ? 2036 HOH A O   1 
HETATM 661 O  O   . HOH C 3 .  ? -30.375 20.335  9.745  1.00 53.57 ? 2037 HOH A O   1 
HETATM 662 O  O   . HOH C 3 .  ? -33.441 21.872  8.486  1.00 61.49 ? 2038 HOH A O   1 
HETATM 663 O  O   . HOH C 3 .  ? -33.345 24.522  8.887  1.00 65.28 ? 2039 HOH A O   1 
HETATM 664 O  O   . HOH C 3 .  ? -32.521 19.413  12.364 1.00 50.39 ? 2040 HOH A O   1 
HETATM 665 O  O   . HOH C 3 .  ? -33.822 27.944  19.325 1.00 25.55 ? 2041 HOH A O   1 
HETATM 666 O  O   . HOH C 3 .  ? -35.195 24.082  20.246 1.00 38.47 ? 2042 HOH A O   1 
HETATM 667 O  O   . HOH C 3 .  ? -23.429 15.522  17.645 1.00 60.81 ? 2043 HOH A O   1 
HETATM 668 O  O   . HOH C 3 .  ? 3.490   0.314   10.442 1.00 47.01 ? 2044 HOH A O   1 
HETATM 669 O  O   . HOH C 3 .  ? -9.661  23.365  14.325 1.00 46.20 ? 2045 HOH A O   1 
HETATM 670 O  O   . HOH C 3 .  ? -21.832 2.428   5.110  1.00 32.73 ? 2046 HOH A O   1 
HETATM 671 O  O   . HOH C 3 .  ? -15.747 4.189   15.163 1.00 29.87 ? 2047 HOH A O   1 
HETATM 672 O  O   . HOH C 3 .  ? -8.478  0.297   15.454 1.00 43.38 ? 2048 HOH A O   1 
HETATM 673 O  O   . HOH C 3 .  ? -5.617  -1.847  16.303 1.00 50.13 ? 2049 HOH A O   1 
HETATM 674 O  O   . HOH C 3 .  ? -2.426  -5.230  16.134 1.00 43.54 ? 2050 HOH A O   1 
HETATM 675 O  O   . HOH C 3 .  ? 0.892   -0.639  10.740 1.00 40.42 ? 2051 HOH A O   1 
HETATM 676 O  O   . HOH C 3 .  ? -2.781  5.378   3.540  1.00 38.59 ? 2052 HOH A O   1 
HETATM 677 O  O   . HOH C 3 .  ? 0.000   5.377   0.000  0.50 66.84 ? 2053 HOH A O   1 
HETATM 678 O  O   . HOH C 3 .  ? -6.212  -0.531  -0.522 1.00 36.47 ? 2054 HOH A O   1 
HETATM 679 O  O   . HOH C 3 .  ? -12.463 2.731   0.518  1.00 53.07 ? 2055 HOH A O   1 
HETATM 680 O  O   . HOH C 3 .  ? -8.357  8.420   2.893  1.00 40.91 ? 2056 HOH A O   1 
HETATM 681 O  O   . HOH C 3 .  ? -18.927 3.672   2.077  1.00 26.71 ? 2057 HOH A O   1 
HETATM 682 O  O   . HOH C 3 .  ? -24.072 3.681   5.362  1.00 36.42 ? 2058 HOH A O   1 
HETATM 683 O  O   . HOH C 3 .  ? -28.685 6.561   1.466  1.00 31.85 ? 2059 HOH A O   1 
HETATM 684 O  O   . HOH C 3 .  ? -25.630 7.949   9.677  1.00 40.34 ? 2060 HOH A O   1 
HETATM 685 O  O   . HOH C 3 .  ? -19.408 4.007   4.695  1.00 19.20 ? 2061 HOH A O   1 
HETATM 686 O  O   . HOH C 3 .  ? -2.094  -4.263  4.350  1.00 33.45 ? 2062 HOH A O   1 
HETATM 687 O  O   . HOH C 3 .  ? -13.313 11.689  -2.559 1.00 47.99 ? 2063 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N   . ASP A 6  ? 1.1803 0.9224 1.0010 0.1605  0.1304  -0.0637 73  ASP A N   
2   C  CA  . ASP A 6  ? 1.1932 0.9406 1.0126 0.1836  0.1301  -0.0521 73  ASP A CA  
3   C  C   . ASP A 6  ? 1.1137 0.9084 0.9576 0.1892  0.1201  -0.0473 73  ASP A C   
4   O  O   . ASP A 6  ? 1.1715 0.9794 1.0174 0.1940  0.1189  -0.0509 73  ASP A O   
5   C  CB  . ASP A 6  ? 1.2911 1.0078 1.0862 0.1991  0.1389  -0.0542 73  ASP A CB  
6   C  CG  . ASP A 6  ? 1.3351 1.0632 1.1297 0.2251  0.1383  -0.0435 73  ASP A CG  
7   O  OD1 . ASP A 6  ? 1.3066 1.0534 1.1128 0.2305  0.1336  -0.0338 73  ASP A OD1 
8   O  OD2 . ASP A 6  ? 1.3936 1.1140 1.1763 0.2403  0.1424  -0.0455 73  ASP A OD2 
9   N  N   . ARG A 7  ? 0.9564 0.7747 0.8168 0.1875  0.1135  -0.0394 74  ARG A N   
10  C  CA  . ARG A 7  ? 0.7975 0.6573 0.6781 0.1910  0.1049  -0.0342 74  ARG A CA  
11  C  C   . ARG A 7  ? 0.6352 0.5119 0.5299 0.1858  0.0992  -0.0269 74  ARG A C   
12  O  O   . ARG A 7  ? 0.6631 0.5273 0.5574 0.1737  0.0995  -0.0290 74  ARG A O   
13  C  CB  . ARG A 7  ? 0.7503 0.6279 0.6397 0.1797  0.0999  -0.0423 74  ARG A CB  
14  C  CG  . ARG A 7  ? 0.7059 0.5878 0.6038 0.1612  0.0952  -0.0478 74  ARG A CG  
15  N  N   . PHE A 8  ? 0.5410 0.4470 0.4477 0.1941  0.0943  -0.0189 75  PHE A N   
16  C  CA  . PHE A 8  ? 0.5321 0.4563 0.4522 0.1886  0.0885  -0.0125 75  PHE A CA  
17  C  C   . PHE A 8  ? 0.4815 0.4204 0.4135 0.1723  0.0816  -0.0172 75  PHE A C   
18  O  O   . PHE A 8  ? 0.3961 0.3480 0.3312 0.1697  0.0787  -0.0213 75  PHE A O   
19  C  CB  . PHE A 8  ? 0.5300 0.4831 0.4585 0.2001  0.0856  -0.0040 75  PHE A CB  
20  C  CG  . PHE A 8  ? 0.4792 0.4533 0.4214 0.1924  0.0792  0.0016  75  PHE A CG  
21  C  CD1 . PHE A 8  ? 0.5096 0.4738 0.4508 0.1922  0.0797  0.0065  75  PHE A CD1 
22  C  CD2 . PHE A 8  ? 0.4950 0.4961 0.4488 0.1851  0.0732  0.0018  75  PHE A CD2 
23  C  CE1 . PHE A 8  ? 0.5165 0.4995 0.4698 0.1852  0.0740  0.0110  75  PHE A CE1 
24  C  CE2 . PHE A 8  ? 0.5215 0.5384 0.4852 0.1779  0.0678  0.0064  75  PHE A CE2 
25  C  CZ  . PHE A 8  ? 0.5413 0.5501 0.5056 0.1781  0.0681  0.0109  75  PHE A CZ  
26  N  N   . SER A 9  ? 0.4479 0.3844 0.3850 0.1624  0.0792  -0.0167 76  SER A N   
27  C  CA  . SER A 9  ? 0.4735 0.4235 0.4204 0.1493  0.0725  -0.0216 76  SER A CA  
28  C  C   . SER A 9  ? 0.4541 0.4092 0.4090 0.1426  0.0691  -0.0179 76  SER A C   
29  O  O   . SER A 9  ? 0.4181 0.3561 0.3681 0.1407  0.0734  -0.0171 76  SER A O   
30  C  CB  . SER A 9  ? 0.5579 0.4938 0.4986 0.1401  0.0746  -0.0332 76  SER A CB  
31  O  OG  . SER A 9  ? 0.6380 0.5906 0.5874 0.1305  0.0674  -0.0383 76  SER A OG  
32  N  N   . VAL A 10 ? 0.3804 0.3571 0.3455 0.1389  0.0617  -0.0157 77  VAL A N   
33  C  CA  . VAL A 10 ? 0.3693 0.3523 0.3419 0.1322  0.0577  -0.0136 77  VAL A CA  
34  C  C   . VAL A 10 ? 0.3750 0.3691 0.3525 0.1242  0.0510  -0.0201 77  VAL A C   
35  O  O   . VAL A 10 ? 0.3194 0.3221 0.2956 0.1257  0.0476  -0.0217 77  VAL A O   
36  C  CB  . VAL A 10 ? 0.3531 0.3508 0.3313 0.1371  0.0552  -0.0034 77  VAL A CB  
37  C  CG1 . VAL A 10 ? 0.3831 0.3718 0.3563 0.1466  0.0610  0.0029  77  VAL A CG1 
38  C  CG2 . VAL A 10 ? 0.2776 0.2931 0.2577 0.1395  0.0515  -0.0012 77  VAL A CG2 
39  N  N   . ASN A 11 ? 0.3355 0.3294 0.3171 0.1164  0.0494  -0.0241 78  ASN A N   
40  C  CA  . ASN A 11 ? 0.3670 0.3732 0.3527 0.1111  0.0426  -0.0309 78  ASN A CA  
41  C  C   . ASN A 11 ? 0.3598 0.3769 0.3519 0.1099  0.0373  -0.0263 78  ASN A C   
42  O  O   . ASN A 11 ? 0.2878 0.3017 0.2828 0.1089  0.0397  -0.0212 78  ASN A O   
43  C  CB  . ASN A 11 ? 0.4032 0.4051 0.3885 0.1025  0.0449  -0.0425 78  ASN A CB  
44  C  CG  . ASN A 11 ? 0.5624 0.5500 0.5391 0.1022  0.0511  -0.0480 78  ASN A CG  
45  O  OD1 . ASN A 11 ? 0.5581 0.5497 0.5315 0.1057  0.0490  -0.0508 78  ASN A OD1 
46  N  ND2 . ASN A 11 ? 0.6452 0.6136 0.6160 0.0979  0.0592  -0.0497 78  ASN A ND2 
47  N  N   . LEU A 12 ? 0.2826 0.3108 0.2748 0.1107  0.0301  -0.0281 79  LEU A N   
48  C  CA  . LEU A 12 ? 0.3201 0.3561 0.3153 0.1105  0.0249  -0.0243 79  LEU A CA  
49  C  C   . LEU A 12 ? 0.3227 0.3678 0.3173 0.1103  0.0181  -0.0324 79  LEU A C   
50  O  O   . LEU A 12 ? 0.2558 0.3026 0.2438 0.1137  0.0148  -0.0359 79  LEU A O   
51  C  CB  . LEU A 12 ? 0.4227 0.4601 0.4135 0.1144  0.0234  -0.0150 79  LEU A CB  
52  C  CG  . LEU A 12 ? 0.4775 0.5191 0.4680 0.1137  0.0191  -0.0101 79  LEU A CG  
53  C  CD1 . LEU A 12 ? 0.5259 0.5684 0.5244 0.1106  0.0210  -0.0082 79  LEU A CD1 
54  C  CD2 . LEU A 12 ? 0.4404 0.4829 0.4250 0.1146  0.0196  -0.0020 79  LEU A CD2 
55  N  N   . ASP A 13 ? 0.3086 0.3605 0.3092 0.1073  0.0161  -0.0357 80  ASP A N   
56  C  CA  . ASP A 13 ? 0.3509 0.4151 0.3513 0.1094  0.0092  -0.0437 80  ASP A CA  
57  C  C   . ASP A 13 ? 0.3261 0.3890 0.3180 0.1164  0.0030  -0.0377 80  ASP A C   
58  O  O   . ASP A 13 ? 0.3333 0.3949 0.3265 0.1161  0.0024  -0.0321 80  ASP A O   
59  C  CB  . ASP A 13 ? 0.4187 0.4930 0.4286 0.1037  0.0099  -0.0502 80  ASP A CB  
60  C  CG  . ASP A 13 ? 0.5365 0.6287 0.5472 0.1077  0.0024  -0.0597 80  ASP A CG  
61  O  OD1 . ASP A 13 ? 0.5084 0.6023 0.5103 0.1159  -0.0036 -0.0608 80  ASP A OD1 
62  O  OD2 . ASP A 13 ? 0.6079 0.7130 0.6268 0.1032  0.0026  -0.0663 80  ASP A OD2 
63  N  N   . VAL A 14 ? 0.2047 0.2659 0.1858 0.1222  -0.0013 -0.0390 81  VAL A N   
64  C  CA  . VAL A 14 ? 0.2348 0.2888 0.2023 0.1284  -0.0063 -0.0333 81  VAL A CA  
65  C  C   . VAL A 14 ? 0.2942 0.3537 0.2523 0.1372  -0.0141 -0.0406 81  VAL A C   
66  O  O   . VAL A 14 ? 0.2738 0.3227 0.2147 0.1436  -0.0177 -0.0373 81  VAL A O   
67  C  CB  . VAL A 14 ? 0.3121 0.3543 0.2691 0.1281  -0.0035 -0.0260 81  VAL A CB  
68  C  CG1 . VAL A 14 ? 0.3396 0.3794 0.3042 0.1221  0.0031  -0.0182 81  VAL A CG1 
69  C  CG2 . VAL A 14 ? 0.3133 0.3572 0.2677 0.1295  -0.0029 -0.0315 81  VAL A CG2 
70  N  N   . LYS A 15 ? 0.3280 0.4046 0.2962 0.1378  -0.0165 -0.0506 82  LYS A N   
71  C  CA  . LYS A 15 ? 0.3776 0.4657 0.3385 0.1478  -0.0244 -0.0593 82  LYS A CA  
72  C  C   . LYS A 15 ? 0.3667 0.4460 0.3113 0.1591  -0.0309 -0.0552 82  LYS A C   
73  O  O   . LYS A 15 ? 0.3379 0.4201 0.2695 0.1709  -0.0378 -0.0598 82  LYS A O   
74  C  CB  . LYS A 15 ? 0.4183 0.5318 0.3949 0.1445  -0.0252 -0.0721 82  LYS A CB  
75  C  CG  . LYS A 15 ? 0.4809 0.6012 0.4700 0.1389  -0.0227 -0.0721 82  LYS A CG  
76  C  CD  . LYS A 15 ? 0.5681 0.7141 0.5722 0.1321  -0.0215 -0.0857 82  LYS A CD  
77  C  CE  . LYS A 15 ? 0.5981 0.7493 0.6139 0.1243  -0.0175 -0.0854 82  LYS A CE  
78  N  NZ  . LYS A 15 ? 0.5411 0.6939 0.5520 0.1346  -0.0232 -0.0822 82  LYS A NZ  
79  N  N   . HIS A 16 ? 0.2910 0.3582 0.2342 0.1563  -0.0286 -0.0468 83  HIS A N   
80  C  CA  . HIS A 16 ? 0.2857 0.3390 0.2102 0.1659  -0.0335 -0.0426 83  HIS A CA  
81  C  C   . HIS A 16 ? 0.3050 0.3321 0.2060 0.1674  -0.0328 -0.0337 83  HIS A C   
82  O  O   . HIS A 16 ? 0.3553 0.3641 0.2349 0.1747  -0.0360 -0.0298 83  HIS A O   
83  C  CB  . HIS A 16 ? 0.3020 0.3535 0.2334 0.1613  -0.0313 -0.0385 83  HIS A CB  
84  C  CG  . HIS A 16 ? 0.3051 0.3807 0.2548 0.1610  -0.0324 -0.0475 83  HIS A CG  
85  N  ND1 . HIS A 16 ? 0.3498 0.4325 0.3172 0.1499  -0.0267 -0.0462 83  HIS A ND1 
86  C  CD2 . HIS A 16 ? 0.3771 0.4733 0.3297 0.1702  -0.0383 -0.0584 83  HIS A CD2 
87  C  CE1 . HIS A 16 ? 0.3316 0.4364 0.3114 0.1506  -0.0284 -0.0558 83  HIS A CE1 
88  N  NE2 . HIS A 16 ? 0.3983 0.5140 0.3708 0.1627  -0.0355 -0.0638 83  HIS A NE2 
89  N  N   . PHE A 17 ? 0.2998 0.3241 0.2034 0.1601  -0.0281 -0.0310 84  PHE A N   
90  C  CA  . PHE A 17 ? 0.3455 0.3480 0.2286 0.1584  -0.0259 -0.0230 84  PHE A CA  
91  C  C   . PHE A 17 ? 0.3508 0.3535 0.2250 0.1631  -0.0276 -0.0267 84  PHE A C   
92  O  O   . PHE A 17 ? 0.3576 0.3768 0.2477 0.1604  -0.0263 -0.0327 84  PHE A O   
93  C  CB  . PHE A 17 ? 0.2652 0.2657 0.1582 0.1452  -0.0178 -0.0156 84  PHE A CB  
94  C  CG  . PHE A 17 ? 0.2698 0.2696 0.1698 0.1399  -0.0158 -0.0112 84  PHE A CG  
95  C  CD1 . PHE A 17 ? 0.2309 0.2473 0.1533 0.1369  -0.0145 -0.0144 84  PHE A CD1 
96  C  CD2 . PHE A 17 ? 0.3237 0.3053 0.2060 0.1368  -0.0147 -0.0043 84  PHE A CD2 
97  C  CE1 . PHE A 17 ? 0.2855 0.3017 0.2135 0.1323  -0.0128 -0.0104 84  PHE A CE1 
98  C  CE2 . PHE A 17 ? 0.2327 0.2147 0.1210 0.1315  -0.0129 -0.0008 84  PHE A CE2 
99  C  CZ  . PHE A 17 ? 0.2260 0.2261 0.1377 0.1299  -0.0123 -0.0037 84  PHE A CZ  
100 N  N   . SER A 18 ? 0.3347 0.3170 0.1812 0.1696  -0.0302 -0.0231 85  SER A N   
101 C  CA  . SER A 18 ? 0.3507 0.3303 0.1858 0.1727  -0.0309 -0.0250 85  SER A CA  
102 C  C   . SER A 18 ? 0.3668 0.3430 0.2067 0.1599  -0.0226 -0.0193 85  SER A C   
103 O  O   . SER A 18 ? 0.3784 0.3488 0.2212 0.1506  -0.0173 -0.0126 85  SER A O   
104 C  CB  . SER A 18 ? 0.5138 0.4691 0.3139 0.1841  -0.0357 -0.0222 85  SER A CB  
105 O  OG  . SER A 18 ? 0.6314 0.5596 0.4113 0.1770  -0.0309 -0.0125 85  SER A OG  
106 N  N   . PRO A 19 ? 0.3351 0.3174 0.1760 0.1598  -0.0214 -0.0227 86  PRO A N   
107 C  CA  . PRO A 19 ? 0.3462 0.3282 0.1919 0.1495  -0.0136 -0.0185 86  PRO A CA  
108 C  C   . PRO A 19 ? 0.3666 0.3290 0.1924 0.1429  -0.0093 -0.0092 86  PRO A C   
109 O  O   . PRO A 19 ? 0.3960 0.3633 0.2313 0.1328  -0.0026 -0.0048 86  PRO A O   
110 C  CB  . PRO A 19 ? 0.3736 0.3594 0.2135 0.1538  -0.0148 -0.0239 86  PRO A CB  
111 C  CG  . PRO A 19 ? 0.3552 0.3544 0.2015 0.1631  -0.0222 -0.0335 86  PRO A CG  
112 C  CD  . PRO A 19 ? 0.3387 0.3310 0.1768 0.1696  -0.0274 -0.0316 86  PRO A CD  
113 N  N   . GLU A 20 ? 0.3574 0.2981 0.1546 0.1485  -0.0129 -0.0066 87  GLU A N   
114 C  CA  . GLU A 20 ? 0.4083 0.3263 0.1813 0.1402  -0.0080 0.0013  87  GLU A CA  
115 C  C   . GLU A 20 ? 0.4013 0.3156 0.1789 0.1326  -0.0055 0.0059  87  GLU A C   
116 O  O   . GLU A 20 ? 0.4386 0.3392 0.2012 0.1216  0.0000  0.0117  87  GLU A O   
117 C  CB  . GLU A 20 ? 0.4951 0.3847 0.2306 0.1491  -0.0121 0.0028  87  GLU A CB  
118 C  CG  . GLU A 20 ? 0.6899 0.5800 0.4151 0.1546  -0.0134 -0.0003 87  GLU A CG  
119 N  N   . GLU A 21 ? 0.3628 0.2906 0.1606 0.1373  -0.0093 0.0026  88  GLU A N   
120 C  CA  . GLU A 21 ? 0.2968 0.2236 0.1009 0.1308  -0.0074 0.0063  88  GLU A CA  
121 C  C   . GLU A 21 ? 0.3564 0.3071 0.1906 0.1217  -0.0022 0.0069  88  GLU A C   
122 O  O   . GLU A 21 ? 0.3277 0.2835 0.1725 0.1168  -0.0008 0.0092  88  GLU A O   
123 C  CB  . GLU A 21 ? 0.3355 0.2616 0.1410 0.1418  -0.0144 0.0025  88  GLU A CB  
124 C  CG  . GLU A 21 ? 0.4414 0.3406 0.2130 0.1532  -0.0195 0.0028  88  GLU A CG  
125 C  CD  . GLU A 21 ? 0.4626 0.3686 0.2380 0.1682  -0.0276 -0.0032 88  GLU A CD  
126 O  OE1 . GLU A 21 ? 0.4579 0.3921 0.2625 0.1694  -0.0293 -0.0093 88  GLU A OE1 
127 O  OE2 . GLU A 21 ? 0.4730 0.3559 0.2204 0.1788  -0.0317 -0.0022 88  GLU A OE2 
128 N  N   . LEU A 22 ? 0.2768 0.2410 0.1226 0.1205  0.0007  0.0049  89  LEU A N   
129 C  CA  . LEU A 22 ? 0.2828 0.2674 0.1536 0.1148  0.0057  0.0055  89  LEU A CA  
130 C  C   . LEU A 22 ? 0.3092 0.2977 0.1761 0.1074  0.0122  0.0086  89  LEU A C   
131 O  O   . LEU A 22 ? 0.2983 0.2781 0.1491 0.1082  0.0125  0.0078  89  LEU A O   
132 C  CB  . LEU A 22 ? 0.2689 0.2673 0.1591 0.1213  0.0038  -0.0012 89  LEU A CB  
133 C  CG  . LEU A 22 ? 0.3485 0.3505 0.2477 0.1267  -0.0015 -0.0056 89  LEU A CG  
134 C  CD1 . LEU A 22 ? 0.3496 0.3611 0.2573 0.1326  -0.0044 -0.0144 89  LEU A CD1 
135 C  CD2 . LEU A 22 ? 0.3014 0.3125 0.2183 0.1217  0.0014  -0.0029 89  LEU A CD2 
136 N  N   . LYS A 23 ? 0.2890 0.2921 0.1700 0.1008  0.0172  0.0118  90  LYS A N   
137 C  CA  . LYS A 23 ? 0.3148 0.3290 0.1961 0.0948  0.0236  0.0136  90  LYS A CA  
138 C  C   . LYS A 23 ? 0.3040 0.3398 0.2096 0.0971  0.0269  0.0134  90  LYS A C   
139 O  O   . LYS A 23 ? 0.3315 0.3740 0.2492 0.0967  0.0265  0.0153  90  LYS A O   
140 C  CB  . LYS A 23 ? 0.3614 0.3715 0.2274 0.0826  0.0275  0.0182  90  LYS A CB  
141 N  N   . VAL A 24 ? 0.2046 0.2494 0.1153 0.1005  0.0302  0.0110  91  VAL A N   
142 C  CA  . VAL A 24 ? 0.2485 0.3104 0.1776 0.1048  0.0340  0.0111  91  VAL A CA  
143 C  C   . VAL A 24 ? 0.2981 0.3773 0.2262 0.1006  0.0399  0.0130  91  VAL A C   
144 O  O   . VAL A 24 ? 0.3108 0.3886 0.2277 0.0983  0.0420  0.0114  91  VAL A O   
145 C  CB  . VAL A 24 ? 0.3035 0.3618 0.2392 0.1135  0.0337  0.0056  91  VAL A CB  
146 C  CG1 . VAL A 24 ? 0.3148 0.3851 0.2648 0.1192  0.0383  0.0062  91  VAL A CG1 
147 C  CG2 . VAL A 24 ? 0.2794 0.3254 0.2166 0.1161  0.0281  0.0021  91  VAL A CG2 
148 N  N   . LYS A 25 ? 0.3054 0.4029 0.2446 0.0996  0.0426  0.0161  92  LYS A N   
149 C  CA  . LYS A 25 ? 0.3990 0.5199 0.3394 0.0960  0.0482  0.0170  92  LYS A CA  
150 C  C   . LYS A 25 ? 0.3286 0.4687 0.2857 0.1066  0.0506  0.0175  92  LYS A C   
151 O  O   . LYS A 25 ? 0.3001 0.4374 0.2663 0.1116  0.0484  0.0195  92  LYS A O   
152 C  CB  . LYS A 25 ? 0.5386 0.6673 0.4719 0.0822  0.0494  0.0199  92  LYS A CB  
153 C  CG  . LYS A 25 ? 0.6403 0.7449 0.5516 0.0720  0.0478  0.0201  92  LYS A CG  
154 N  N   . VAL A 26 ? 0.2719 0.4308 0.2315 0.1110  0.0553  0.0158  93  VAL A N   
155 C  CA  . VAL A 26 ? 0.3092 0.4874 0.2815 0.1232  0.0580  0.0165  93  VAL A CA  
156 C  C   . VAL A 26 ? 0.3805 0.5938 0.3569 0.1183  0.0613  0.0176  93  VAL A C   
157 O  O   . VAL A 26 ? 0.4276 0.6571 0.3993 0.1125  0.0651  0.0150  93  VAL A O   
158 C  CB  . VAL A 26 ? 0.3890 0.5636 0.3613 0.1358  0.0610  0.0127  93  VAL A CB  
159 C  CG1 . VAL A 26 ? 0.3397 0.5347 0.3212 0.1503  0.0643  0.0137  93  VAL A CG1 
160 C  CG2 . VAL A 26 ? 0.4051 0.5481 0.3744 0.1398  0.0581  0.0106  93  VAL A CG2 
161 N  N   . LEU A 27 ? 0.3624 0.5889 0.3473 0.1196  0.0599  0.0209  94  LEU A N   
162 C  CA  . LEU A 27 ? 0.4276 0.6920 0.4180 0.1149  0.0625  0.0211  94  LEU A CA  
163 C  C   . LEU A 27 ? 0.4297 0.7154 0.4318 0.1334  0.0633  0.0224  94  LEU A C   
164 O  O   . LEU A 27 ? 0.3353 0.6108 0.3418 0.1410  0.0603  0.0261  94  LEU A O   
165 C  CB  . LEU A 27 ? 0.4684 0.7329 0.4564 0.0995  0.0601  0.0236  94  LEU A CB  
166 N  N   . GLY A 28 ? 0.4836 0.7982 0.4891 0.1416  0.0673  0.0194  95  GLY A N   
167 C  CA  . GLY A 28 ? 0.4310 0.7627 0.4440 0.1633  0.0682  0.0204  95  GLY A CA  
168 C  C   . GLY A 28 ? 0.3985 0.6908 0.4073 0.1777  0.0672  0.0221  95  GLY A C   
169 O  O   . GLY A 28 ? 0.4359 0.7048 0.4381 0.1774  0.0685  0.0193  95  GLY A O   
170 N  N   . ASP A 29 ? 0.2779 0.5623 0.2890 0.1890  0.0652  0.0264  96  ASP A N   
171 C  CA  . ASP A 29 ? 0.3475 0.5923 0.3523 0.2000  0.0652  0.0278  96  ASP A CA  
172 C  C   . ASP A 29 ? 0.3014 0.5181 0.3054 0.1882  0.0614  0.0304  96  ASP A C   
173 O  O   . ASP A 29 ? 0.3447 0.5363 0.3454 0.1958  0.0612  0.0328  96  ASP A O   
174 C  CB  . ASP A 29 ? 0.4594 0.7082 0.4628 0.2231  0.0670  0.0307  96  ASP A CB  
175 C  CG  . ASP A 29 ? 0.5742 0.8419 0.5831 0.2250  0.0641  0.0358  96  ASP A CG  
176 O  OD1 . ASP A 29 ? 0.5594 0.8442 0.5749 0.2080  0.0612  0.0361  96  ASP A OD1 
177 O  OD2 . ASP A 29 ? 0.7118 0.9754 0.7165 0.2439  0.0648  0.0394  96  ASP A OD2 
178 N  N   . VAL A 30 ? 0.2790 0.4991 0.2841 0.1697  0.0588  0.0296  97  VAL A N   
179 C  CA  . VAL A 30 ? 0.2709 0.4669 0.2748 0.1590  0.0549  0.0312  97  VAL A CA  
180 C  C   . VAL A 30 ? 0.2470 0.4221 0.2443 0.1477  0.0535  0.0275  97  VAL A C   
181 O  O   . VAL A 30 ? 0.2793 0.4650 0.2728 0.1391  0.0544  0.0252  97  VAL A O   
182 C  CB  . VAL A 30 ? 0.3091 0.5237 0.3173 0.1484  0.0522  0.0343  97  VAL A CB  
183 C  CG1 . VAL A 30 ? 0.2822 0.4715 0.2878 0.1376  0.0483  0.0351  97  VAL A CG1 
184 C  CG2 . VAL A 30 ? 0.3865 0.6209 0.4006 0.1606  0.0525  0.0382  97  VAL A CG2 
185 N  N   . ILE A 31 ? 0.2192 0.3654 0.2141 0.1478  0.0516  0.0264  98  ILE A N   
186 C  CA  . ILE A 31 ? 0.1878 0.3155 0.1765 0.1385  0.0490  0.0227  98  ILE A CA  
187 C  C   . ILE A 31 ? 0.2584 0.3821 0.2466 0.1276  0.0446  0.0248  98  ILE A C   
188 O  O   . ILE A 31 ? 0.2690 0.3872 0.2618 0.1287  0.0430  0.0270  98  ILE A O   
189 C  CB  . ILE A 31 ? 0.2466 0.3488 0.2332 0.1436  0.0491  0.0190  98  ILE A CB  
190 C  CG1 . ILE A 31 ? 0.2483 0.3491 0.2325 0.1546  0.0539  0.0164  98  ILE A CG1 
191 C  CG2 . ILE A 31 ? 0.3478 0.4355 0.3288 0.1351  0.0452  0.0147  98  ILE A CG2 
192 C  CD1 . ILE A 31 ? 0.2537 0.3286 0.2344 0.1587  0.0555  0.0123  98  ILE A CD1 
193 N  N   . GLU A 32 ? 0.2465 0.3711 0.2269 0.1172  0.0432  0.0239  99  GLU A N   
194 C  CA  . GLU A 32 ? 0.2938 0.4104 0.2697 0.1075  0.0394  0.0254  99  GLU A CA  
195 C  C   . GLU A 32 ? 0.2907 0.3846 0.2570 0.1053  0.0357  0.0219  99  GLU A C   
196 O  O   . GLU A 32 ? 0.2489 0.3384 0.2058 0.1039  0.0364  0.0195  99  GLU A O   
197 C  CB  . GLU A 32 ? 0.3379 0.4702 0.3081 0.0966  0.0410  0.0274  99  GLU A CB  
198 C  CG  . GLU A 32 ? 0.3993 0.5597 0.3797 0.0981  0.0436  0.0302  99  GLU A CG  
199 C  CD  . GLU A 32 ? 0.5765 0.7547 0.5509 0.0841  0.0457  0.0306  99  GLU A CD  
200 O  OE1 . GLU A 32 ? 0.6754 0.8478 0.6372 0.0751  0.0475  0.0286  99  GLU A OE1 
201 O  OE2 . GLU A 32 ? 0.6102 0.8081 0.5911 0.0815  0.0459  0.0327  99  GLU A OE2 
202 N  N   . VAL A 33 ? 0.2164 0.2976 0.1845 0.1057  0.0318  0.0212  100 VAL A N   
203 C  CA  . VAL A 33 ? 0.2378 0.3014 0.1966 0.1050  0.0274  0.0175  100 VAL A CA  
204 C  C   . VAL A 33 ? 0.2360 0.2924 0.1869 0.0988  0.0240  0.0196  100 VAL A C   
205 O  O   . VAL A 33 ? 0.2332 0.2923 0.1916 0.0982  0.0230  0.0214  100 VAL A O   
206 C  CB  . VAL A 33 ? 0.2287 0.2847 0.1952 0.1111  0.0256  0.0128  100 VAL A CB  
207 C  CG1 . VAL A 33 ? 0.2929 0.3367 0.2502 0.1116  0.0204  0.0079  100 VAL A CG1 
208 C  CG2 . VAL A 33 ? 0.2063 0.2651 0.1781 0.1168  0.0298  0.0105  100 VAL A CG2 
209 N  N   . HIS A 34 ? 0.2250 0.2701 0.1584 0.0945  0.0227  0.0194  101 HIS A N   
210 C  CA  . HIS A 34 ? 0.2620 0.2945 0.1827 0.0896  0.0198  0.0211  101 HIS A CA  
211 C  C   . HIS A 34 ? 0.2944 0.3080 0.2023 0.0956  0.0144  0.0174  101 HIS A C   
212 O  O   . HIS A 34 ? 0.2916 0.2979 0.1887 0.0983  0.0139  0.0152  101 HIS A O   
213 C  CB  . HIS A 34 ? 0.3064 0.3376 0.2116 0.0784  0.0236  0.0244  101 HIS A CB  
214 C  CG  . HIS A 34 ? 0.4152 0.4282 0.3029 0.0725  0.0217  0.0260  101 HIS A CG  
215 N  ND1 . HIS A 34 ? 0.5160 0.5082 0.3768 0.0662  0.0229  0.0267  101 HIS A ND1 
216 C  CD2 . HIS A 34 ? 0.4005 0.4101 0.2912 0.0724  0.0192  0.0268  101 HIS A CD2 
217 C  CE1 . HIS A 34 ? 0.4939 0.4690 0.3410 0.0628  0.0212  0.0279  101 HIS A CE1 
218 N  NE2 . HIS A 34 ? 0.4165 0.4034 0.2825 0.0666  0.0188  0.0278  101 HIS A NE2 
219 N  N   . GLY A 35 ? 0.2547 0.2622 0.1636 0.0986  0.0102  0.0162  102 GLY A N   
220 C  CA  . GLY A 35 ? 0.2433 0.2364 0.1399 0.1064  0.0044  0.0122  102 GLY A CA  
221 C  C   . GLY A 35 ? 0.2908 0.2672 0.1701 0.1050  0.0021  0.0144  102 GLY A C   
222 O  O   . GLY A 35 ? 0.2699 0.2508 0.1565 0.1004  0.0031  0.0166  102 GLY A O   
223 N  N   . LYS A 36 ? 0.3193 0.2746 0.1736 0.1094  -0.0008 0.0138  103 LYS A N   
224 C  CA  . LYS A 36 ? 0.3535 0.2869 0.1860 0.1098  -0.0028 0.0156  103 LYS A CA  
225 C  C   . LYS A 36 ? 0.4042 0.3175 0.2133 0.1227  -0.0085 0.0128  103 LYS A C   
226 O  O   . LYS A 36 ? 0.3417 0.2456 0.1359 0.1247  -0.0083 0.0129  103 LYS A O   
227 C  CB  . LYS A 36 ? 0.3944 0.3146 0.2091 0.0956  0.0034  0.0212  103 LYS A CB  
228 C  CG  . LYS A 36 ? 0.5247 0.4175 0.3132 0.0941  0.0026  0.0231  103 LYS A CG  
229 C  CD  . LYS A 36 ? 0.5796 0.4589 0.3483 0.0769  0.0099  0.0274  103 LYS A CD  
230 C  CE  . LYS A 36 ? 0.5842 0.4338 0.3258 0.0739  0.0101  0.0288  103 LYS A CE  
231 N  N   . HIS A 37 ? 0.3579 0.2655 0.1628 0.1326  -0.0139 0.0099  104 HIS A N   
232 C  CA  . HIS A 37 ? 0.4446 0.3316 0.2229 0.1474  -0.0198 0.0075  104 HIS A CA  
233 C  C   . HIS A 37 ? 0.4989 0.3610 0.2539 0.1517  -0.0214 0.0092  104 HIS A C   
234 O  O   . HIS A 37 ? 0.4180 0.2886 0.1866 0.1483  -0.0209 0.0089  104 HIS A O   
235 C  CB  . HIS A 37 ? 0.3808 0.2898 0.1753 0.1615  -0.0265 -0.0006 104 HIS A CB  
236 C  CG  . HIS A 37 ? 0.3548 0.2822 0.1684 0.1675  -0.0302 -0.0059 104 HIS A CG  
237 N  ND1 . HIS A 37 ? 0.3734 0.2880 0.1705 0.1790  -0.0350 -0.0075 104 HIS A ND1 
238 C  CD2 . HIS A 37 ? 0.3015 0.2583 0.1475 0.1637  -0.0296 -0.0103 104 HIS A CD2 
239 C  CE1 . HIS A 37 ? 0.3477 0.2865 0.1686 0.1815  -0.0371 -0.0130 104 HIS A CE1 
240 N  NE2 . HIS A 37 ? 0.3058 0.2694 0.1557 0.1716  -0.0337 -0.0147 104 HIS A NE2 
241 N  N   . GLU A 38 ? 0.5156 0.3443 0.2329 0.1593  -0.0229 0.0111  105 GLU A N   
242 C  CA  . GLU A 38 ? 0.5875 0.3839 0.2745 0.1643  -0.0237 0.0131  105 GLU A CA  
243 C  C   . GLU A 38 ? 0.5544 0.3623 0.2488 0.1836  -0.0318 0.0067  105 GLU A C   
244 O  O   . GLU A 38 ? 0.4705 0.3088 0.1887 0.1931  -0.0369 0.0004  105 GLU A O   
245 C  CB  . GLU A 38 ? 0.7250 0.4784 0.3653 0.1685  -0.0227 0.0170  105 GLU A CB  
246 C  CG  . GLU A 38 ? 0.8272 0.5723 0.4592 0.1497  -0.0147 0.0221  105 GLU A CG  
247 C  CD  . GLU A 38 ? 0.9664 0.7150 0.6073 0.1269  -0.0064 0.0256  105 GLU A CD  
248 O  OE1 . GLU A 38 ? 1.0182 0.7468 0.6437 0.1238  -0.0049 0.0269  105 GLU A OE1 
249 O  OE2 . GLU A 38 ? 1.0392 0.8117 0.7021 0.1126  -0.0015 0.0267  105 GLU A OE2 
250 N  N   . GLU A 39 ? 0.5618 0.3455 0.2345 0.1890  -0.0325 0.0076  106 GLU A N   
251 C  CA  . GLU A 39 ? 0.5897 0.3845 0.2673 0.2081  -0.0399 0.0011  106 GLU A CA  
252 C  C   . GLU A 39 ? 0.5761 0.3795 0.2476 0.2296  -0.0480 -0.0046 106 GLU A C   
253 O  O   . GLU A 39 ? 0.6066 0.3805 0.2439 0.2381  -0.0492 -0.0017 106 GLU A O   
254 C  CB  . GLU A 39 ? 0.6608 0.4184 0.3049 0.2135  -0.0393 0.0033  106 GLU A CB  
255 C  CG  . GLU A 39 ? 0.7174 0.4912 0.3711 0.2310  -0.0457 -0.0036 106 GLU A CG  
256 C  CD  . GLU A 39 ? 0.8061 0.5442 0.4301 0.2332  -0.0436 -0.0013 106 GLU A CD  
257 O  OE1 . GLU A 39 ? 0.7944 0.5385 0.4334 0.2169  -0.0386 0.0004  106 GLU A OE1 
258 O  OE2 . GLU A 39 ? 0.9415 0.6440 0.5252 0.2517  -0.0469 -0.0011 106 GLU A OE2 
259 N  N   . ARG A 40 ? 0.5438 0.3882 0.2474 0.2379  -0.0532 -0.0129 107 ARG A N   
260 C  CA  A ARG A 40 ? 0.6229 0.4874 0.3290 0.2554  -0.0608 -0.0202 107 ARG A CA  
261 C  CA  B ARG A 40 ? 0.6131 0.4751 0.3165 0.2565  -0.0611 -0.0201 107 ARG A CA  
262 C  C   . ARG A 40 ? 0.5456 0.4414 0.2687 0.2712  -0.0677 -0.0303 107 ARG A C   
263 O  O   . ARG A 40 ? 0.4628 0.3828 0.2152 0.2615  -0.0653 -0.0330 107 ARG A O   
264 C  CB  A ARG A 40 ? 0.6379 0.5311 0.3739 0.2421  -0.0582 -0.0219 107 ARG A CB  
265 C  CB  B ARG A 40 ? 0.6424 0.5278 0.3687 0.2457  -0.0591 -0.0212 107 ARG A CB  
266 C  CG  A ARG A 40 ? 0.6460 0.5532 0.3790 0.2555  -0.0644 -0.0278 107 ARG A CG  
267 C  CG  B ARG A 40 ? 0.6126 0.5467 0.3793 0.2452  -0.0618 -0.0311 107 ARG A CG  
268 C  CD  A ARG A 40 ? 0.6338 0.5632 0.3936 0.2397  -0.0601 -0.0286 107 ARG A CD  
269 C  CD  B ARG A 40 ? 0.6177 0.5665 0.4051 0.2296  -0.0571 -0.0303 107 ARG A CD  
270 N  NE  A ARG A 40 ? 0.5931 0.5596 0.3930 0.2298  -0.0583 -0.0347 107 ARG A NE  
271 N  NE  B ARG A 40 ? 0.6153 0.5340 0.3757 0.2271  -0.0546 -0.0229 107 ARG A NE  
272 C  CZ  A ARG A 40 ? 0.5107 0.4912 0.3351 0.2127  -0.0521 -0.0335 107 ARG A CZ  
273 C  CZ  B ARG A 40 ? 0.5007 0.4207 0.2706 0.2119  -0.0485 -0.0191 107 ARG A CZ  
274 N  NH1 A ARG A 40 ? 0.5484 0.5130 0.3641 0.2036  -0.0474 -0.0271 107 ARG A NH1 
275 N  NH1 B ARG A 40 ? 0.5064 0.4537 0.3106 0.1990  -0.0445 -0.0214 107 ARG A NH1 
276 N  NH2 A ARG A 40 ? 0.2367 0.2460 0.0925 0.2049  -0.0503 -0.0389 107 ARG A NH2 
277 N  NH2 B ARG A 40 ? 0.4031 0.2961 0.1463 0.2099  -0.0461 -0.0130 107 ARG A NH2 
278 N  N   . GLN A 41 ? 0.5171 0.4146 0.2220 0.2956  -0.0761 -0.0361 108 GLN A N   
279 C  CA  . GLN A 41 ? 0.5023 0.4350 0.2234 0.3118  -0.0829 -0.0472 108 GLN A CA  
280 C  C   . GLN A 41 ? 0.4634 0.4491 0.2264 0.3044  -0.0842 -0.0570 108 GLN A C   
281 O  O   . GLN A 41 ? 0.4522 0.4463 0.2190 0.3016  -0.0848 -0.0582 108 GLN A O   
282 C  CB  . GLN A 41 ? 0.5556 0.4748 0.2416 0.3428  -0.0920 -0.0508 108 GLN A CB  
283 C  CG  . GLN A 41 ? 0.5583 0.5150 0.2583 0.3619  -0.0992 -0.0628 108 GLN A CG  
284 C  CD  . GLN A 41 ? 0.6278 0.5708 0.2905 0.3959  -0.1086 -0.0662 108 GLN A CD  
285 O  OE1 . GLN A 41 ? 0.6596 0.5679 0.2867 0.4061  -0.1105 -0.0603 108 GLN A OE1 
286 N  NE2 . GLN A 41 ? 0.5313 0.5022 0.2008 0.4146  -0.1145 -0.0760 108 GLN A NE2 
287 N  N   . ASP A 42 ? 0.4208 0.4404 0.2135 0.3001  -0.0837 -0.0643 109 ASP A N   
288 C  CA  . ASP A 42 ? 0.4376 0.5073 0.2659 0.2945  -0.0850 -0.0757 109 ASP A CA  
289 C  C   . ASP A 42 ? 0.4413 0.5475 0.2814 0.3090  -0.0907 -0.0881 109 ASP A C   
290 O  O   . ASP A 42 ? 0.4542 0.5466 0.2713 0.3289  -0.0956 -0.0883 109 ASP A O   
291 C  CB  . ASP A 42 ? 0.4156 0.4949 0.2743 0.2668  -0.0759 -0.0726 109 ASP A CB  
292 C  CG  . ASP A 42 ? 0.4153 0.4935 0.2859 0.2567  -0.0709 -0.0698 109 ASP A CG  
293 O  OD1 . ASP A 42 ? 0.4013 0.4747 0.2597 0.2703  -0.0744 -0.0715 109 ASP A OD1 
294 O  OD2 . ASP A 42 ? 0.3898 0.4715 0.2810 0.2361  -0.0635 -0.0659 109 ASP A OD2 
295 N  N   . GLU A 43 ? 0.4481 0.6001 0.3226 0.2987  -0.0896 -0.0989 110 GLU A N   
296 C  CA  . GLU A 43 ? 0.5464 0.7415 0.4355 0.3102  -0.0946 -0.1129 110 GLU A CA  
297 C  C   . GLU A 43 ? 0.5173 0.7047 0.4056 0.3118  -0.0925 -0.1108 110 GLU A C   
298 O  O   . GLU A 43 ? 0.4774 0.6864 0.3631 0.3304  -0.0983 -0.1197 110 GLU A O   
299 C  CB  . GLU A 43 ? 0.6895 0.9315 0.6151 0.2922  -0.0912 -0.1245 110 GLU A CB  
300 C  CG  . GLU A 43 ? 0.8269 1.1194 0.7712 0.2993  -0.0947 -0.1404 110 GLU A CG  
301 C  CD  . GLU A 43 ? 0.8824 1.2144 0.8608 0.2756  -0.0885 -0.1508 110 GLU A CD  
302 O  OE1 . GLU A 43 ? 0.8893 1.2053 0.8758 0.2547  -0.0813 -0.1445 110 GLU A OE1 
303 O  OE2 . GLU A 43 ? 0.8991 1.2775 0.8947 0.2777  -0.0904 -0.1657 110 GLU A OE2 
304 N  N   . HIS A 44 ? 0.4739 0.6324 0.3642 0.2930  -0.0844 -0.0994 111 HIS A N   
305 C  CA  . HIS A 44 ? 0.4897 0.6439 0.3836 0.2900  -0.0812 -0.0976 111 HIS A CA  
306 C  C   . HIS A 44 ? 0.4821 0.5877 0.3406 0.3013  -0.0820 -0.0872 111 HIS A C   
307 O  O   . HIS A 44 ? 0.4834 0.5843 0.3381 0.3054  -0.0813 -0.0874 111 HIS A O   
308 C  CB  . HIS A 44 ? 0.4930 0.6510 0.4129 0.2619  -0.0716 -0.0930 111 HIS A CB  
309 C  CG  . HIS A 44 ? 0.5813 0.7794 0.5317 0.2481  -0.0690 -0.1025 111 HIS A CG  
310 N  ND1 . HIS A 44 ? 0.6722 0.8658 0.6300 0.2341  -0.0652 -0.0992 111 HIS A ND1 
311 C  CD2 . HIS A 44 ? 0.6257 0.8681 0.5993 0.2455  -0.0690 -0.1160 111 HIS A CD2 
312 C  CE1 . HIS A 44 ? 0.6781 0.9082 0.6607 0.2231  -0.0628 -0.1099 111 HIS A CE1 
313 N  NE2 . HIS A 44 ? 0.6774 0.9382 0.6702 0.2288  -0.0648 -0.1204 111 HIS A NE2 
314 N  N   . GLY A 45 ? 0.4384 0.5066 0.2697 0.3050  -0.0827 -0.0784 112 GLY A N   
315 C  CA  . GLY A 45 ? 0.4790 0.4960 0.2726 0.3126  -0.0820 -0.0685 112 GLY A CA  
316 C  C   . GLY A 45 ? 0.4811 0.4604 0.2555 0.3020  -0.0782 -0.0572 112 GLY A C   
317 O  O   . GLY A 45 ? 0.4639 0.4467 0.2335 0.3073  -0.0813 -0.0584 112 GLY A O   
318 N  N   . PHE A 46 ? 0.4138 0.3591 0.1771 0.2866  -0.0713 -0.0469 113 PHE A N   
319 C  CA  . PHE A 46 ? 0.4208 0.3338 0.1676 0.2736  -0.0664 -0.0368 113 PHE A CA  
320 C  C   . PHE A 46 ? 0.3911 0.3127 0.1646 0.2463  -0.0580 -0.0313 113 PHE A C   
321 O  O   . PHE A 46 ? 0.3882 0.3200 0.1777 0.2380  -0.0551 -0.0317 113 PHE A O   
322 C  CB  . PHE A 46 ? 0.5485 0.4072 0.2481 0.2811  -0.0655 -0.0293 113 PHE A CB  
323 C  CG  . PHE A 46 ? 0.6622 0.5052 0.3287 0.3099  -0.0735 -0.0330 113 PHE A CG  
324 C  CD1 . PHE A 46 ? 0.7136 0.5692 0.3763 0.3323  -0.0799 -0.0409 113 PHE A CD1 
325 C  CD2 . PHE A 46 ? 0.7339 0.5509 0.3724 0.3156  -0.0746 -0.0286 113 PHE A CD2 
326 C  CE1 . PHE A 46 ? 0.7547 0.5975 0.3857 0.3617  -0.0879 -0.0444 113 PHE A CE1 
327 C  CE2 . PHE A 46 ? 0.7738 0.5752 0.3791 0.3440  -0.0824 -0.0316 113 PHE A CE2 
328 C  CZ  . PHE A 46 ? 0.7524 0.5670 0.3539 0.3680  -0.0892 -0.0395 113 PHE A CZ  
329 N  N   . ILE A 47 ? 0.3585 0.2764 0.1358 0.2337  -0.0544 -0.0264 114 ILE A N   
330 C  CA  . ILE A 47 ? 0.3592 0.2891 0.1623 0.2108  -0.0471 -0.0219 114 ILE A CA  
331 C  C   . ILE A 47 ? 0.3992 0.3087 0.1905 0.1987  -0.0422 -0.0140 114 ILE A C   
332 O  O   . ILE A 47 ? 0.4010 0.3032 0.1789 0.2056  -0.0447 -0.0144 114 ILE A O   
333 C  CB  . ILE A 47 ? 0.4107 0.3839 0.2521 0.2066  -0.0475 -0.0293 114 ILE A CB  
334 C  CG1 . ILE A 47 ? 0.4455 0.4271 0.3094 0.1856  -0.0400 -0.0239 114 ILE A CG1 
335 C  CG2 . ILE A 47 ? 0.4495 0.4354 0.2907 0.2166  -0.0523 -0.0351 114 ILE A CG2 
336 C  CD1 . ILE A 47 ? 0.3191 0.3135 0.2017 0.1768  -0.0367 -0.0237 114 ILE A CD1 
337 N  N   . SER A 48 ? 0.3825 0.2846 0.1784 0.1807  -0.0353 -0.0073 115 SER A N   
338 C  CA  . SER A 48 ? 0.3621 0.2566 0.1559 0.1665  -0.0298 -0.0011 115 SER A CA  
339 C  C   . SER A 48 ? 0.3392 0.2622 0.1676 0.1521  -0.0251 -0.0001 115 SER A C   
340 O  O   . SER A 48 ? 0.3046 0.2405 0.1489 0.1489  -0.0244 -0.0011 115 SER A O   
341 C  CB  . SER A 48 ? 0.5168 0.3747 0.2787 0.1578  -0.0252 0.0060  115 SER A CB  
342 O  OG  . SER A 48 ? 0.5690 0.4253 0.3346 0.1492  -0.0222 0.0078  115 SER A OG  
343 N  N   . ARG A 49 ? 0.2762 0.2083 0.1148 0.1447  -0.0220 0.0018  116 ARG A N   
344 C  CA  . ARG A 49 ? 0.2695 0.2261 0.1378 0.1337  -0.0176 0.0029  116 ARG A CA  
345 C  C   . ARG A 49 ? 0.3340 0.2866 0.1994 0.1218  -0.0117 0.0089  116 ARG A C   
346 O  O   . ARG A 49 ? 0.3195 0.2570 0.1659 0.1225  -0.0114 0.0104  116 ARG A O   
347 C  CB  . ARG A 49 ? 0.2912 0.2715 0.1814 0.1392  -0.0198 -0.0038 116 ARG A CB  
348 C  CG  . ARG A 49 ? 0.3322 0.3262 0.2310 0.1492  -0.0249 -0.0117 116 ARG A CG  
349 C  CD  . ARG A 49 ? 0.2745 0.2923 0.1938 0.1505  -0.0256 -0.0191 116 ARG A CD  
350 N  NE  . ARG A 49 ? 0.2983 0.3346 0.2269 0.1585  -0.0300 -0.0283 116 ARG A NE  
351 C  CZ  . ARG A 49 ? 0.3104 0.3508 0.2290 0.1723  -0.0366 -0.0354 116 ARG A CZ  
352 N  NH1 . ARG A 49 ? 0.3055 0.3288 0.2023 0.1801  -0.0396 -0.0333 116 ARG A NH1 
353 N  NH2 . ARG A 49 ? 0.3043 0.3674 0.2340 0.1787  -0.0402 -0.0447 116 ARG A NH2 
354 N  N   . GLU A 50 ? 0.2779 0.2457 0.1617 0.1115  -0.0071 0.0122  117 GLU A N   
355 C  CA  . GLU A 50 ? 0.3477 0.3204 0.2338 0.1017  -0.0017 0.0166  117 GLU A CA  
356 C  C   . GLU A 50 ? 0.2883 0.2847 0.2010 0.0974  0.0016  0.0178  117 GLU A C   
357 O  O   . GLU A 50 ? 0.2464 0.2500 0.1693 0.0960  0.0016  0.0182  117 GLU A O   
358 C  CB  . GLU A 50 ? 0.4502 0.4066 0.3151 0.0911  0.0019  0.0214  117 GLU A CB  
359 C  CG  . GLU A 50 ? 0.4767 0.4421 0.3431 0.0807  0.0077  0.0247  117 GLU A CG  
360 C  CD  . GLU A 50 ? 0.5255 0.4763 0.3695 0.0674  0.0120  0.0280  117 GLU A CD  
361 O  OE1 . GLU A 50 ? 0.4698 0.4034 0.2989 0.0654  0.0111  0.0283  117 GLU A OE1 
362 O  OE2 . GLU A 50 ? 0.5224 0.4793 0.3628 0.0582  0.0169  0.0297  117 GLU A OE2 
363 N  N   . PHE A 51 ? 0.2766 0.2837 0.1985 0.0963  0.0046  0.0184  118 PHE A N   
364 C  CA  . PHE A 51 ? 0.2259 0.2518 0.1686 0.0940  0.0083  0.0203  118 PHE A CA  
365 C  C   . PHE A 51 ? 0.2252 0.2597 0.1687 0.0898  0.0129  0.0234  118 PHE A C   
366 O  O   . PHE A 51 ? 0.2358 0.2633 0.1675 0.0894  0.0134  0.0227  118 PHE A O   
367 C  CB  . PHE A 51 ? 0.2250 0.2577 0.1829 0.1008  0.0071  0.0155  118 PHE A CB  
368 C  CG  . PHE A 51 ? 0.2242 0.2566 0.1818 0.1049  0.0074  0.0119  118 PHE A CG  
369 C  CD1 . PHE A 51 ? 0.2189 0.2596 0.1849 0.1043  0.0120  0.0136  118 PHE A CD1 
370 C  CD2 . PHE A 51 ? 0.2019 0.2262 0.1498 0.1104  0.0029  0.0067  118 PHE A CD2 
371 C  CE1 . PHE A 51 ? 0.2365 0.2761 0.2015 0.1079  0.0126  0.0098  118 PHE A CE1 
372 C  CE2 . PHE A 51 ? 0.2270 0.2521 0.1744 0.1138  0.0031  0.0030  118 PHE A CE2 
373 C  CZ  . PHE A 51 ? 0.2354 0.2674 0.1913 0.1118  0.0081  0.0045  118 PHE A CZ  
374 N  N   . HIS A 52 ? 0.2147 0.2654 0.1713 0.0875  0.0163  0.0266  119 HIS A N   
375 C  CA  . HIS A 52 ? 0.2904 0.3547 0.2507 0.0862  0.0207  0.0287  119 HIS A CA  
376 C  C   . HIS A 52 ? 0.2764 0.3523 0.2534 0.0930  0.0228  0.0294  119 HIS A C   
377 O  O   . HIS A 52 ? 0.2270 0.3103 0.2118 0.0929  0.0232  0.0321  119 HIS A O   
378 C  CB  . HIS A 52 ? 0.3339 0.4082 0.2883 0.0762  0.0234  0.0322  119 HIS A CB  
379 C  CG  . HIS A 52 ? 0.4899 0.5809 0.4458 0.0741  0.0278  0.0331  119 HIS A CG  
380 N  ND1 . HIS A 52 ? 0.5998 0.6854 0.5489 0.0758  0.0290  0.0309  119 HIS A ND1 
381 C  CD2 . HIS A 52 ? 0.5176 0.6331 0.4807 0.0708  0.0313  0.0353  119 HIS A CD2 
382 C  CE1 . HIS A 52 ? 0.5135 0.6192 0.4660 0.0735  0.0333  0.0317  119 HIS A CE1 
383 N  NE2 . HIS A 52 ? 0.5457 0.6711 0.5070 0.0708  0.0347  0.0341  119 HIS A NE2 
384 N  N   . ARG A 53 ? 0.2317 0.3065 0.2118 0.0990  0.0243  0.0269  120 ARG A N   
385 C  CA  . ARG A 53 ? 0.2289 0.3076 0.2200 0.1060  0.0270  0.0271  120 ARG A CA  
386 C  C   . ARG A 53 ? 0.2654 0.3566 0.2582 0.1102  0.0313  0.0290  120 ARG A C   
387 O  O   . ARG A 53 ? 0.2772 0.3695 0.2641 0.1092  0.0321  0.0272  120 ARG A O   
388 C  CB  . ARG A 53 ? 0.2761 0.3416 0.2681 0.1097  0.0260  0.0213  120 ARG A CB  
389 C  CG  . ARG A 53 ? 0.3310 0.3945 0.3283 0.1160  0.0304  0.0203  120 ARG A CG  
390 C  CD  . ARG A 53 ? 0.3430 0.4071 0.3462 0.1180  0.0327  0.0239  120 ARG A CD  
391 N  NE  . ARG A 53 ? 0.2999 0.3551 0.3056 0.1145  0.0311  0.0205  120 ARG A NE  
392 C  CZ  . ARG A 53 ? 0.3076 0.3606 0.3166 0.1143  0.0329  0.0229  120 ARG A CZ  
393 N  NH1 . ARG A 53 ? 0.3134 0.3715 0.3230 0.1190  0.0358  0.0293  120 ARG A NH1 
394 N  NH2 . ARG A 53 ? 0.3211 0.3684 0.3325 0.1100  0.0318  0.0187  120 ARG A NH2 
395 N  N   . LYS A 54 ? 0.2031 0.3039 0.2030 0.1159  0.0341  0.0324  121 LYS A N   
396 C  CA  . LYS A 54 ? 0.2668 0.3817 0.2683 0.1230  0.0380  0.0340  121 LYS A CA  
397 C  C   . LYS A 54 ? 0.2968 0.4023 0.3005 0.1343  0.0412  0.0341  121 LYS A C   
398 O  O   . LYS A 54 ? 0.2532 0.3516 0.2589 0.1367  0.0415  0.0364  121 LYS A O   
399 C  CB  . LYS A 54 ? 0.3051 0.4449 0.3098 0.1211  0.0386  0.0382  121 LYS A CB  
400 C  CG  . LYS A 54 ? 0.3973 0.5451 0.3963 0.1080  0.0372  0.0375  121 LYS A CG  
401 C  CD  . LYS A 54 ? 0.4373 0.6121 0.4398 0.1038  0.0381  0.0404  121 LYS A CD  
402 C  CE  . LYS A 54 ? 0.4946 0.6716 0.4879 0.0878  0.0376  0.0392  121 LYS A CE  
403 N  NZ  . LYS A 54 ? 0.5486 0.7522 0.5449 0.0808  0.0385  0.0408  121 LYS A NZ  
404 N  N   . TYR A 55 ? 0.2929 0.3803 0.2509 0.2160  -0.0114 0.0546  122 TYR A N   
405 C  CA  . TYR A 55 ? 0.2983 0.3508 0.2309 0.2318  0.0018  0.0555  122 TYR A CA  
406 C  C   . TYR A 55 ? 0.3521 0.4241 0.2757 0.2546  0.0022  0.0598  122 TYR A C   
407 O  O   . TYR A 55 ? 0.3287 0.4371 0.2675 0.2533  -0.0051 0.0593  122 TYR A O   
408 C  CB  . TYR A 55 ? 0.3421 0.3692 0.2715 0.2201  0.0096  0.0491  122 TYR A CB  
409 C  CG  . TYR A 55 ? 0.3707 0.3816 0.3094 0.1978  0.0101  0.0442  122 TYR A CG  
410 C  CD1 . TYR A 55 ? 0.3806 0.3548 0.3036 0.1960  0.0196  0.0436  122 TYR A CD1 
411 C  CD2 . TYR A 55 ? 0.3128 0.3456 0.2749 0.1791  0.0016  0.0402  122 TYR A CD2 
412 C  CE1 . TYR A 55 ? 0.3139 0.2781 0.2466 0.1760  0.0203  0.0388  122 TYR A CE1 
413 C  CE2 . TYR A 55 ? 0.2962 0.3179 0.2670 0.1609  0.0020  0.0360  122 TYR A CE2 
414 C  CZ  . TYR A 55 ? 0.3397 0.3291 0.2969 0.1594  0.0113  0.0351  122 TYR A CZ  
415 O  OH  . TYR A 55 ? 0.3644 0.3475 0.3317 0.1416  0.0119  0.0308  122 TYR A OH  
416 N  N   . ARG A 56 ? 0.3656 0.4133 0.2636 0.2763  0.0111  0.0643  123 ARG A N   
417 C  CA  . ARG A 56 ? 0.3651 0.4266 0.2508 0.3018  0.0137  0.0686  123 ARG A CA  
418 C  C   . ARG A 56 ? 0.4002 0.4334 0.2712 0.3054  0.0249  0.0647  123 ARG A C   
419 O  O   . ARG A 56 ? 0.4419 0.4262 0.2929 0.3016  0.0365  0.0620  123 ARG A O   
420 C  CB  . ARG A 56 ? 0.3425 0.3880 0.2037 0.3260  0.0188  0.0758  123 ARG A CB  
421 C  CG  . ARG A 56 ? 0.5092 0.5712 0.3562 0.3565  0.0215  0.0813  123 ARG A CG  
422 C  CD  . ARG A 56 ? 0.5816 0.7097 0.4527 0.3594  0.0073  0.0838  123 ARG A CD  
423 N  N   . ILE A 57 ? 0.3800 0.4438 0.2599 0.3112  0.0219  0.0640  124 ILE A N   
424 C  CA  . ILE A 57 ? 0.4262 0.4648 0.2899 0.3172  0.0327  0.0605  124 ILE A CA  
425 C  C   . ILE A 57 ? 0.5008 0.5113 0.3305 0.3488  0.0447  0.0659  124 ILE A C   
426 O  O   . ILE A 57 ? 0.4695 0.5095 0.2979 0.3713  0.0408  0.0726  124 ILE A O   
427 C  CB  . ILE A 57 ? 0.4212 0.5031 0.3045 0.3145  0.0261  0.0583  124 ILE A CB  
428 C  CG1 . ILE A 57 ? 0.3020 0.4081 0.2156 0.2841  0.0147  0.0535  124 ILE A CG1 
429 C  CG2 . ILE A 57 ? 0.3819 0.4360 0.2458 0.3223  0.0381  0.0545  124 ILE A CG2 
430 C  CD1 . ILE A 57 ? 0.3314 0.4797 0.2638 0.2790  0.0079  0.0515  124 ILE A CD1 
431 N  N   . PRO A 58 ? 0.5495 0.5021 0.3498 0.3505  0.0595  0.0632  125 PRO A N   
432 C  CA  . PRO A 58 ? 0.6542 0.5698 0.4160 0.3809  0.0729  0.0683  125 PRO A CA  
433 C  C   . PRO A 58 ? 0.6407 0.5840 0.3986 0.4069  0.0737  0.0713  125 PRO A C   
434 O  O   . PRO A 58 ? 0.5854 0.5598 0.3635 0.3975  0.0687  0.0669  125 PRO A O   
435 C  CB  . PRO A 58 ? 0.6954 0.5461 0.4300 0.3688  0.0882  0.0620  125 PRO A CB  
436 C  CG  . PRO A 58 ? 0.6609 0.5144 0.4196 0.3338  0.0817  0.0557  125 PRO A CG  
437 C  CD  . PRO A 58 ? 0.5681 0.4855 0.3678 0.3229  0.0647  0.0551  125 PRO A CD  
438 N  N   . ALA A 59 ? 0.6776 0.6102 0.4088 0.4404  0.0803  0.0790  126 ALA A N   
439 C  CA  . ALA A 59 ? 0.6235 0.5878 0.3508 0.4699  0.0810  0.0830  126 ALA A CA  
440 C  C   . ALA A 59 ? 0.6879 0.6301 0.4025 0.4707  0.0914  0.0771  126 ALA A C   
441 O  O   . ALA A 59 ? 0.6977 0.6824 0.4257 0.4807  0.0877  0.0770  126 ALA A O   
442 C  CB  . ALA A 59 ? 0.6717 0.6198 0.3671 0.5077  0.0880  0.0927  126 ALA A CB  
443 N  N   . ASP A 60 ? 0.7422 0.6186 0.4300 0.4592  0.1047  0.0717  127 ASP A N   
444 C  CA  . ASP A 60 ? 0.7941 0.6417 0.4638 0.4596  0.1161  0.0655  127 ASP A CA  
445 C  C   . ASP A 60 ? 0.7365 0.6046 0.4367 0.4243  0.1086  0.0561  127 ASP A C   
446 O  O   . ASP A 60 ? 0.7235 0.5618 0.4093 0.4161  0.1178  0.0492  127 ASP A O   
447 C  CB  . ASP A 60 ? 0.8894 0.6532 0.5099 0.4649  0.1356  0.0638  127 ASP A CB  
448 C  CG  . ASP A 60 ? 0.9770 0.7054 0.5976 0.4330  0.1366  0.0591  127 ASP A CG  
449 O  OD1 . ASP A 60 ? 0.9504 0.7185 0.6085 0.4103  0.1222  0.0580  127 ASP A OD1 
450 O  OD2 . ASP A 60 ? 1.0512 0.7117 0.6332 0.4305  0.1525  0.0563  127 ASP A OD2 
451 N  N   . VAL A 61 ? 0.6404 0.5583 0.3806 0.4038  0.0922  0.0560  128 VAL A N   
452 C  CA  . VAL A 61 ? 0.5898 0.5317 0.3599 0.3722  0.0836  0.0484  128 VAL A CA  
453 C  C   . VAL A 61 ? 0.5040 0.5173 0.3084 0.3736  0.0695  0.0505  128 VAL A C   
454 O  O   . VAL A 61 ? 0.4918 0.5451 0.3151 0.3772  0.0585  0.0559  128 VAL A O   
455 C  CB  . VAL A 61 ? 0.5639 0.4961 0.3501 0.3415  0.0774  0.0451  128 VAL A CB  
456 C  CG1 . VAL A 61 ? 0.5473 0.5068 0.3639 0.3115  0.0678  0.0382  128 VAL A CG1 
457 C  CG2 . VAL A 61 ? 0.5929 0.4568 0.3458 0.3366  0.0919  0.0422  128 VAL A CG2 
458 N  N   . ASP A 62 ? 0.4620 0.4906 0.2725 0.3695  0.0702  0.0458  129 ASP A N   
459 C  CA  . ASP A 62 ? 0.4708 0.5653 0.3129 0.3664  0.0578  0.0467  129 ASP A CA  
460 C  C   . ASP A 62 ? 0.4587 0.5774 0.3332 0.3329  0.0439  0.0437  129 ASP A C   
461 O  O   . ASP A 62 ? 0.4933 0.5895 0.3706 0.3093  0.0448  0.0371  129 ASP A O   
462 C  CB  . ASP A 62 ? 0.5287 0.6275 0.3653 0.3708  0.0641  0.0422  129 ASP A CB  
463 C  CG  . ASP A 62 ? 0.5915 0.7587 0.4582 0.3685  0.0528  0.0432  129 ASP A CG  
464 O  OD1 . ASP A 62 ? 0.5319 0.7419 0.4239 0.3606  0.0398  0.0468  129 ASP A OD1 
465 O  OD2 . ASP A 62 ? 0.7564 0.9336 0.6201 0.3735  0.0574  0.0401  129 ASP A OD2 
466 N  N   . PRO A 63 ? 0.4080 0.5726 0.3057 0.3312  0.0313  0.0483  130 PRO A N   
467 C  CA  . PRO A 63 ? 0.3613 0.5473 0.2870 0.3016  0.0184  0.0461  130 PRO A CA  
468 C  C   . PRO A 63 ? 0.3543 0.5583 0.2963 0.2813  0.0142  0.0405  130 PRO A C   
469 O  O   . PRO A 63 ? 0.2649 0.4637 0.2205 0.2558  0.0082  0.0368  130 PRO A O   
470 C  CB  . PRO A 63 ? 0.3057 0.5428 0.2484 0.3085  0.0074  0.0521  130 PRO A CB  
471 C  CG  . PRO A 63 ? 0.4380 0.6671 0.3586 0.3410  0.0149  0.0581  130 PRO A CG  
472 C  CD  . PRO A 63 ? 0.5063 0.7047 0.4031 0.3574  0.0287  0.0559  130 PRO A CD  
473 N  N   . LEU A 64 ? 0.3236 0.5487 0.2630 0.2937  0.0177  0.0400  131 LEU A N   
474 C  CA  . LEU A 64 ? 0.4004 0.6450 0.3536 0.2762  0.0141  0.0350  131 LEU A CA  
475 C  C   . LEU A 64 ? 0.3268 0.5261 0.2693 0.2597  0.0203  0.0281  131 LEU A C   
476 O  O   . LEU A 64 ? 0.3247 0.5351 0.2806 0.2389  0.0151  0.0239  131 LEU A O   
477 C  CB  . LEU A 64 ? 0.4154 0.6897 0.3650 0.2957  0.0186  0.0358  131 LEU A CB  
478 C  CG  . LEU A 64 ? 0.5081 0.8378 0.4700 0.3119  0.0124  0.0419  131 LEU A CG  
479 C  CD1 . LEU A 64 ? 0.5720 0.9276 0.5279 0.3329  0.0191  0.0421  131 LEU A CD1 
480 C  CD2 . LEU A 64 ? 0.4636 0.8370 0.4545 0.2876  -0.0025 0.0424  131 LEU A CD2 
481 N  N   . THR A 65 ? 0.3140 0.4628 0.2308 0.2687  0.0318  0.0269  132 THR A N   
482 C  CA  . THR A 65 ? 0.3938 0.4991 0.2970 0.2532  0.0393  0.0197  132 THR A CA  
483 C  C   . THR A 65 ? 0.3972 0.4807 0.3068 0.2318  0.0354  0.0179  132 THR A C   
484 O  O   . THR A 65 ? 0.4576 0.5052 0.3557 0.2178  0.0415  0.0119  132 THR A O   
485 C  CB  . THR A 65 ? 0.4849 0.5428 0.3513 0.2731  0.0563  0.0180  132 THR A CB  
486 O  OG1 . THR A 65 ? 0.6028 0.6358 0.4527 0.2896  0.0616  0.0231  132 THR A OG1 
487 C  CG2 . THR A 65 ? 0.5821 0.6614 0.4413 0.2954  0.0611  0.0193  132 THR A CG2 
488 N  N   . ILE A 66 ? 0.3414 0.4482 0.2690 0.2290  0.0254  0.0227  133 ILE A N   
489 C  CA  . ILE A 66 ? 0.3335 0.4246 0.2692 0.2104  0.0212  0.0216  133 ILE A CA  
490 C  C   . ILE A 66 ? 0.2999 0.4059 0.2560 0.1842  0.0125  0.0170  133 ILE A C   
491 O  O   . ILE A 66 ? 0.2583 0.4026 0.2333 0.1786  0.0029  0.0183  133 ILE A O   
492 C  CB  . ILE A 66 ? 0.3504 0.4626 0.2984 0.2154  0.0130  0.0280  133 ILE A CB  
493 C  CG1 . ILE A 66 ? 0.4299 0.5222 0.3554 0.2408  0.0217  0.0329  133 ILE A CG1 
494 C  CG2 . ILE A 66 ? 0.3187 0.4209 0.2786 0.1946  0.0075  0.0264  133 ILE A CG2 
495 C  CD1 . ILE A 66 ? 0.4475 0.4861 0.3504 0.2393  0.0327  0.0308  133 ILE A CD1 
496 N  N   . THR A 67 ? 0.2909 0.3670 0.2422 0.1680  0.0162  0.0117  134 THR A N   
497 C  CA  . THR A 67 ? 0.2605 0.3496 0.2303 0.1442  0.0076  0.0079  134 THR A CA  
498 C  C   . THR A 67 ? 0.2176 0.2916 0.1931 0.1314  0.0058  0.0072  134 THR A C   
499 O  O   . THR A 67 ? 0.2926 0.3438 0.2561 0.1398  0.0121  0.0091  134 THR A O   
500 C  CB  . THR A 67 ? 0.3386 0.4124 0.2981 0.1345  0.0135  0.0008  134 THR A CB  
501 O  OG1 . THR A 67 ? 0.3804 0.4099 0.3163 0.1340  0.0261  -0.0037 134 THR A OG1 
502 C  CG2 . THR A 67 ? 0.3928 0.4807 0.3455 0.1480  0.0164  0.0011  134 THR A CG2 
503 N  N   . SER A 68 ? 0.1828 0.2699 0.1756 0.1121  -0.0024 0.0048  135 SER A N   
504 C  CA  . SER A 68 ? 0.2000 0.2763 0.1994 0.1002  -0.0039 0.0037  135 SER A CA  
505 C  C   . SER A 68 ? 0.2111 0.2886 0.2181 0.0802  -0.0066 -0.0022 135 SER A C   
506 O  O   . SER A 68 ? 0.1867 0.2775 0.1970 0.0745  -0.0098 -0.0045 135 SER A O   
507 C  CB  . SER A 68 ? 0.2466 0.3455 0.2635 0.1014  -0.0142 0.0096  135 SER A CB  
508 O  OG  . SER A 68 ? 0.2458 0.3758 0.2798 0.0941  -0.0254 0.0111  135 SER A OG  
509 N  N   . SER A 69 ? 0.2156 0.2809 0.2252 0.0696  -0.0051 -0.0046 136 SER A N   
510 C  CA  . SER A 69 ? 0.2757 0.3469 0.2942 0.0509  -0.0083 -0.0099 136 SER A CA  
511 C  C   . SER A 69 ? 0.2060 0.2798 0.2367 0.0434  -0.0114 -0.0092 136 SER A C   
512 O  O   . SER A 69 ? 0.2459 0.3052 0.2713 0.0504  -0.0067 -0.0068 136 SER A O   
513 C  CB  . SER A 69 ? 0.3165 0.3620 0.3155 0.0432  0.0029  -0.0177 136 SER A CB  
514 O  OG  . SER A 69 ? 0.4245 0.4382 0.4069 0.0445  0.0143  -0.0195 136 SER A OG  
515 N  N   . MSE A 70 ? 0.1670 0.2601 0.2135 0.0303  -0.0192 -0.0111 137 MSE A N   
516 C  CA  A MSE A 70 ? 0.1585 0.2575 0.2176 0.0238  -0.0221 -0.0107 137 MSE A CA  
517 C  CA  B MSE A 70 ? 0.1738 0.2738 0.2335 0.0238  -0.0226 -0.0106 137 MSE A CA  
518 C  C   . MSE A 70 ? 0.1594 0.2608 0.2209 0.0070  -0.0201 -0.0178 137 MSE A C   
519 O  O   . MSE A 70 ? 0.1714 0.2867 0.2367 -0.0011 -0.0247 -0.0207 137 MSE A O   
520 C  CB  A MSE A 70 ? 0.2059 0.3300 0.2832 0.0268  -0.0348 -0.0047 137 MSE A CB  
521 C  CB  B MSE A 70 ? 0.2097 0.3361 0.2878 0.0257  -0.0357 -0.0049 137 MSE A CB  
522 C  CG  A MSE A 70 ? 0.2753 0.4045 0.3642 0.0239  -0.0374 -0.0034 137 MSE A CG  
523 C  CG  B MSE A 70 ? 0.2284 0.3652 0.3207 0.0197  -0.0400 -0.0046 137 MSE A CG  
524 SE SE  A MSE A 70 ? 0.1701 0.3137 0.2699 0.0341  -0.0485 0.0054  137 MSE A SE  
525 SE SE  B MSE A 70 ? 0.3676 0.4898 0.4584 0.0293  -0.0356 -0.0005 137 MSE A SE  
526 C  CE  A MSE A 70 ? 0.0620 0.2126 0.1757 0.0286  -0.0507 0.0050  137 MSE A CE  
527 C  CE  B MSE A 70 ? 0.1445 0.2723 0.2326 0.0438  -0.0420 0.0071  137 MSE A CE  
528 N  N   . SER A 71 ? 0.1397 0.2290 0.1987 0.0011  -0.0131 -0.0207 138 SER A N   
529 C  CA  . SER A 71 ? 0.1574 0.2508 0.2180 -0.0166 -0.0099 -0.0283 138 SER A CA  
530 C  C   . SER A 71 ? 0.1736 0.2979 0.2575 -0.0219 -0.0196 -0.0269 138 SER A C   
531 O  O   . SER A 71 ? 0.1748 0.3083 0.2699 -0.0122 -0.0258 -0.0206 138 SER A O   
532 C  CB  . SER A 71 ? 0.2824 0.3466 0.3260 -0.0224 0.0042  -0.0329 138 SER A CB  
533 O  OG  . SER A 71 ? 0.3026 0.3669 0.3538 -0.0175 0.0047  -0.0291 138 SER A OG  
534 N  N   . SER A 72 ? 0.1314 0.2717 0.2210 -0.0371 -0.0207 -0.0331 139 SER A N   
535 C  CA  . SER A 72 ? 0.1803 0.3518 0.2910 -0.0413 -0.0291 -0.0322 139 SER A CA  
536 C  C   . SER A 72 ? 0.3129 0.4804 0.4281 -0.0405 -0.0236 -0.0317 139 SER A C   
537 O  O   . SER A 72 ? 0.2878 0.4795 0.4203 -0.0400 -0.0294 -0.0299 139 SER A O   
538 C  CB  . SER A 72 ? 0.1748 0.3663 0.2892 -0.0584 -0.0305 -0.0396 139 SER A CB  
539 O  OG  . SER A 72 ? 0.2108 0.3811 0.3080 -0.0723 -0.0179 -0.0480 139 SER A OG  
540 N  N   . ASP A 73 ? 0.3941 0.5301 0.4922 -0.0393 -0.0118 -0.0330 140 ASP A N   
541 C  CA  . ASP A 73 ? 0.4331 0.5599 0.5314 -0.0382 -0.0050 -0.0323 140 ASP A CA  
542 C  C   . ASP A 73 ? 0.3545 0.4801 0.4589 -0.0205 -0.0105 -0.0236 140 ASP A C   
543 O  O   . ASP A 73 ? 0.3835 0.5086 0.4926 -0.0179 -0.0078 -0.0220 140 ASP A O   
544 C  CB  . ASP A 73 ? 0.6031 0.6921 0.6764 -0.0430 0.0102  -0.0365 140 ASP A CB  
545 C  CG  . ASP A 73 ? 0.7844 0.8735 0.8529 -0.0643 0.0191  -0.0458 140 ASP A CG  
546 O  OD1 . ASP A 73 ? 0.8007 0.9191 0.8823 -0.0765 0.0134  -0.0503 140 ASP A OD1 
547 O  OD2 . ASP A 73 ? 0.9119 0.9722 0.9627 -0.0693 0.0321  -0.0485 140 ASP A OD2 
548 N  N   . GLY A 74 ? 0.2053 0.3310 0.3088 -0.0094 -0.0177 -0.0184 141 GLY A N   
549 C  CA  . GLY A 74 ? 0.2102 0.3332 0.3161 0.0055  -0.0225 -0.0108 141 GLY A CA  
550 C  C   . GLY A 74 ? 0.2499 0.3435 0.3372 0.0144  -0.0140 -0.0090 141 GLY A C   
551 O  O   . GLY A 74 ? 0.2822 0.3700 0.3688 0.0247  -0.0147 -0.0039 141 GLY A O   
552 N  N   . VAL A 75 ? 0.2515 0.3258 0.3219 0.0108  -0.0056 -0.0131 142 VAL A N   
553 C  CA  . VAL A 75 ? 0.2411 0.2863 0.2908 0.0217  0.0029  -0.0109 142 VAL A CA  
554 C  C   . VAL A 75 ? 0.1849 0.2319 0.2291 0.0318  -0.0012 -0.0081 142 VAL A C   
555 O  O   . VAL A 75 ? 0.1668 0.2187 0.2095 0.0256  -0.0022 -0.0118 142 VAL A O   
556 C  CB  . VAL A 75 ? 0.3116 0.3268 0.3402 0.0130  0.0175  -0.0172 142 VAL A CB  
557 C  CG1 . VAL A 75 ? 0.2973 0.2805 0.3012 0.0272  0.0262  -0.0142 142 VAL A CG1 
558 C  CG2 . VAL A 75 ? 0.3334 0.3465 0.3659 0.0031  0.0230  -0.0197 142 VAL A CG2 
559 N  N   . LEU A 76 ? 0.1686 0.2142 0.2102 0.0469  -0.0038 -0.0016 143 LEU A N   
560 C  CA  . LEU A 76 ? 0.1710 0.2214 0.2075 0.0578  -0.0070 0.0014  143 LEU A CA  
561 C  C   . LEU A 76 ? 0.2601 0.2811 0.2718 0.0681  0.0049  0.0011  143 LEU A C   
562 O  O   . LEU A 76 ? 0.2677 0.2691 0.2679 0.0753  0.0115  0.0033  143 LEU A O   
563 C  CB  . LEU A 76 ? 0.1520 0.2209 0.1987 0.0678  -0.0166 0.0084  143 LEU A CB  
564 C  CG  . LEU A 76 ? 0.2469 0.3260 0.2895 0.0792  -0.0199 0.0119  143 LEU A CG  
565 C  CD1 . LEU A 76 ? 0.2109 0.3071 0.2606 0.0718  -0.0252 0.0095  143 LEU A CD1 
566 C  CD2 . LEU A 76 ? 0.2908 0.3865 0.3411 0.0866  -0.0281 0.0181  143 LEU A CD2 
567 N  N   . THR A 77 ? 0.1892 0.2056 0.1908 0.0696  0.0080  -0.0015 144 THR A N   
568 C  CA  . THR A 77 ? 0.2588 0.2455 0.2341 0.0818  0.0197  -0.0016 144 THR A CA  
569 C  C   . THR A 77 ? 0.2643 0.2659 0.2384 0.0978  0.0157  0.0028  144 THR A C   
570 O  O   . THR A 77 ? 0.2492 0.2729 0.2341 0.0935  0.0090  0.0016  144 THR A O   
571 C  CB  . THR A 77 ? 0.3674 0.3287 0.3253 0.0701  0.0303  -0.0095 144 THR A CB  
572 O  OG1 . THR A 77 ? 0.3649 0.3140 0.3229 0.0543  0.0351  -0.0140 144 THR A OG1 
573 C  CG2 . THR A 77 ? 0.3758 0.3019 0.3024 0.0848  0.0432  -0.0093 144 THR A CG2 
574 N  N   . VAL A 78 ? 0.2301 0.2215 0.1910 0.1165  0.0198  0.0080  145 VAL A N   
575 C  CA  . VAL A 78 ? 0.2656 0.2716 0.2228 0.1339  0.0180  0.0121  145 VAL A CA  
576 C  C   . VAL A 78 ? 0.3249 0.2954 0.2512 0.1484  0.0322  0.0113  145 VAL A C   
577 O  O   . VAL A 78 ? 0.3404 0.2803 0.2481 0.1552  0.0411  0.0127  145 VAL A O   
578 C  CB  . VAL A 78 ? 0.2802 0.3095 0.2472 0.1462  0.0099  0.0195  145 VAL A CB  
579 C  CG1 . VAL A 78 ? 0.3373 0.3907 0.3041 0.1620  0.0070  0.0231  145 VAL A CG1 
580 C  CG2 . VAL A 78 ? 0.2432 0.2985 0.2355 0.1318  -0.0023 0.0202  145 VAL A CG2 
581 N  N   . ASN A 79 ? 0.3251 0.2973 0.2437 0.1536  0.0352  0.0091  146 ASN A N   
582 C  CA  . ASN A 79 ? 0.3722 0.3056 0.2580 0.1668  0.0500  0.0075  146 ASN A CA  
583 C  C   . ASN A 79 ? 0.4263 0.3734 0.3056 0.1850  0.0511  0.0094  146 ASN A C   
584 O  O   . ASN A 79 ? 0.3861 0.3724 0.2868 0.1819  0.0409  0.0099  146 ASN A O   
585 C  CB  . ASN A 79 ? 0.4836 0.3832 0.3549 0.1477  0.0593  -0.0013 146 ASN A CB  
586 C  CG  . ASN A 79 ? 0.5684 0.4930 0.4591 0.1282  0.0513  -0.0068 146 ASN A CG  
587 O  OD1 . ASN A 79 ? 0.6470 0.6038 0.5520 0.1330  0.0432  -0.0049 146 ASN A OD1 
588 N  ND2 . ASN A 79 ? 0.4813 0.3926 0.3721 0.1059  0.0537  -0.0137 146 ASN A ND2 
589 N  N   . GLY A 80 ? 0.4837 0.3974 0.3318 0.2048  0.0641  0.0105  147 GLY A N   
590 C  CA  . GLY A 80 ? 0.5149 0.4384 0.3532 0.2252  0.0675  0.0123  147 GLY A CA  
591 C  C   . GLY A 80 ? 0.5520 0.4228 0.3487 0.2415  0.0852  0.0109  147 GLY A C   
592 O  O   . GLY A 80 ? 0.5721 0.4036 0.3470 0.2452  0.0941  0.0121  147 GLY A O   
593 N  N   . PRO A 81 ? 0.5359 0.4033 0.3193 0.2513  0.0914  0.0083  148 PRO A N   
594 C  CA  . PRO A 81 ? 0.6362 0.4511 0.3765 0.2691  0.1093  0.0068  148 PRO A CA  
595 C  C   . PRO A 81 ? 0.6736 0.4835 0.3973 0.3026  0.1137  0.0161  148 PRO A C   
596 O  O   . PRO A 81 ? 0.6085 0.4674 0.3562 0.3150  0.1024  0.0229  148 PRO A O   
597 C  CB  . PRO A 81 ? 0.6256 0.4547 0.3645 0.2734  0.1110  0.0030  148 PRO A CB  
598 C  CG  . PRO A 81 ? 0.6348 0.5130 0.4133 0.2493  0.0953  0.0002  148 PRO A CG  
599 C  CD  . PRO A 81 ? 0.5223 0.4343 0.3294 0.2459  0.0821  0.0064  148 PRO A CD  
600 N  N   . ARG A 82 ? 0.7719 0.5230 0.4535 0.3166  0.1300  0.0166  149 ARG A N   
601 C  CA  . ARG A 82 ? 0.8452 0.5880 0.5057 0.3523  0.1355  0.0258  149 ARG A CA  
602 C  C   . ARG A 82 ? 0.9008 0.6428 0.5417 0.3796  0.1437  0.0267  149 ARG A C   
603 O  O   . ARG A 82 ? 0.9097 0.6258 0.5344 0.3714  0.1524  0.0192  149 ARG A O   
604 C  CB  . ARG A 82 ? 0.9248 0.6022 0.5468 0.3558  0.1495  0.0270  149 ARG A CB  
605 C  CG  . ARG A 82 ? 0.9517 0.6317 0.5926 0.3310  0.1422  0.0265  149 ARG A CG  
606 C  CD  . ARG A 82 ? 1.0175 0.6375 0.6203 0.3378  0.1557  0.0293  149 ARG A CD  
607 N  NE  . ARG A 82 ? 0.9947 0.6172 0.6155 0.3121  0.1499  0.0278  149 ARG A NE  
608 C  CZ  . ARG A 82 ? 0.8967 0.5524 0.5403 0.3167  0.1386  0.0346  149 ARG A CZ  
609 N  NH1 . ARG A 82 ? 0.8855 0.5770 0.5372 0.3445  0.1314  0.0432  149 ARG A NH1 
610 N  NH2 . ARG A 82 ? 0.8408 0.4955 0.4986 0.2931  0.1348  0.0325  149 ARG A NH2 
611 N  N   . LYS A 83 ? 0.9062 0.6792 0.5491 0.4120  0.1408  0.0358  150 LYS A N   
612 C  CA  . LYS A 83 ? 0.9656 0.7485 0.5943 0.4409  0.1473  0.0375  150 LYS A CA  
613 C  C   . LYS A 83 ? 1.0284 0.7580 0.6076 0.4766  0.1643  0.0431  150 LYS A C   
614 O  O   . LYS A 83 ? 1.0518 0.7518 0.6140 0.4834  0.1677  0.0482  150 LYS A O   
615 C  CB  . LYS A 83 ? 0.9167 0.7809 0.5841 0.4527  0.1318  0.0432  150 LYS A CB  
616 C  CG  . LYS A 83 ? 0.9609 0.8481 0.6223 0.4773  0.1367  0.0436  150 LYS A CG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  68  ?   ?   ?   A . n 
A 1 2  ALA 2  69  ?   ?   ?   A . n 
A 1 3  MSE 3  70  ?   ?   ?   A . n 
A 1 4  GLU 4  71  ?   ?   ?   A . n 
A 1 5  LYS 5  72  ?   ?   ?   A . n 
A 1 6  ASP 6  73  73  ASP ASP A . n 
A 1 7  ARG 7  74  74  ARG ARG A . n 
A 1 8  PHE 8  75  75  PHE PHE A . n 
A 1 9  SER 9  76  76  SER SER A . n 
A 1 10 VAL 10 77  77  VAL VAL A . n 
A 1 11 ASN 11 78  78  ASN ASN A . n 
A 1 12 LEU 12 79  79  LEU LEU A . n 
A 1 13 ASP 13 80  80  ASP ASP A . n 
A 1 14 VAL 14 81  81  VAL VAL A . n 
A 1 15 LYS 15 82  82  LYS LYS A . n 
A 1 16 HIS 16 83  83  HIS HIS A . n 
A 1 17 PHE 17 84  84  PHE PHE A . n 
A 1 18 SER 18 85  85  SER SER A . n 
A 1 19 PRO 19 86  86  PRO PRO A . n 
A 1 20 GLU 20 87  87  GLU GLU A . n 
A 1 21 GLU 21 88  88  GLU GLU A . n 
A 1 22 LEU 22 89  89  LEU LEU A . n 
A 1 23 LYS 23 90  90  LYS LYS A . n 
A 1 24 VAL 24 91  91  VAL VAL A . n 
A 1 25 LYS 25 92  92  LYS LYS A . n 
A 1 26 VAL 26 93  93  VAL VAL A . n 
A 1 27 LEU 27 94  94  LEU LEU A . n 
A 1 28 GLY 28 95  95  GLY GLY A . n 
A 1 29 ASP 29 96  96  ASP ASP A . n 
A 1 30 VAL 30 97  97  VAL VAL A . n 
A 1 31 ILE 31 98  98  ILE ILE A . n 
A 1 32 GLU 32 99  99  GLU GLU A . n 
A 1 33 VAL 33 100 100 VAL VAL A . n 
A 1 34 HIS 34 101 101 HIS HIS A . n 
A 1 35 GLY 35 102 102 GLY GLY A . n 
A 1 36 LYS 36 103 103 LYS LYS A . n 
A 1 37 HIS 37 104 104 HIS HIS A . n 
A 1 38 GLU 38 105 105 GLU GLU A . n 
A 1 39 GLU 39 106 106 GLU GLU A . n 
A 1 40 ARG 40 107 107 ARG ARG A . n 
A 1 41 GLN 41 108 108 GLN GLN A . n 
A 1 42 ASP 42 109 109 ASP ASP A . n 
A 1 43 GLU 43 110 110 GLU GLU A . n 
A 1 44 HIS 44 111 111 HIS HIS A . n 
A 1 45 GLY 45 112 112 GLY GLY A . n 
A 1 46 PHE 46 113 113 PHE PHE A . n 
A 1 47 ILE 47 114 114 ILE ILE A . n 
A 1 48 SER 48 115 115 SER SER A . n 
A 1 49 ARG 49 116 116 ARG ARG A . n 
A 1 50 GLU 50 117 117 GLU GLU A . n 
A 1 51 PHE 51 118 118 PHE PHE A . n 
A 1 52 HIS 52 119 119 HIS HIS A . n 
A 1 53 ARG 53 120 120 ARG ARG A . n 
A 1 54 LYS 54 121 121 LYS LYS A . n 
A 1 55 TYR 55 122 122 TYR TYR A . n 
A 1 56 ARG 56 123 123 ARG ARG A . n 
A 1 57 ILE 57 124 124 ILE ILE A . n 
A 1 58 PRO 58 125 125 PRO PRO A . n 
A 1 59 ALA 59 126 126 ALA ALA A . n 
A 1 60 ASP 60 127 127 ASP ASP A . n 
A 1 61 VAL 61 128 128 VAL VAL A . n 
A 1 62 ASP 62 129 129 ASP ASP A . n 
A 1 63 PRO 63 130 130 PRO PRO A . n 
A 1 64 LEU 64 131 131 LEU LEU A . n 
A 1 65 THR 65 132 132 THR THR A . n 
A 1 66 ILE 66 133 133 ILE ILE A . n 
A 1 67 THR 67 134 134 THR THR A . n 
A 1 68 SER 68 135 135 SER SER A . n 
A 1 69 SER 69 136 136 SER SER A . n 
A 1 70 MSE 70 137 137 MSE MSE A . n 
A 1 71 SER 71 138 138 SER SER A . n 
A 1 72 SER 72 139 139 SER SER A . n 
A 1 73 ASP 73 140 140 ASP ASP A . n 
A 1 74 GLY 74 141 141 GLY GLY A . n 
A 1 75 VAL 75 142 142 VAL VAL A . n 
A 1 76 LEU 76 143 143 LEU LEU A . n 
A 1 77 THR 77 144 144 THR THR A . n 
A 1 78 VAL 78 145 145 VAL VAL A . n 
A 1 79 ASN 79 146 146 ASN ASN A . n 
A 1 80 GLY 80 147 147 GLY GLY A . n 
A 1 81 PRO 81 148 148 PRO PRO A . n 
A 1 82 ARG 82 149 149 ARG ARG A . n 
A 1 83 LYS 83 150 150 LYS LYS A . n 
A 1 84 GLN 84 151 ?   ?   ?   A . n 
A 1 85 VAL 85 152 ?   ?   ?   A . n 
A 1 86 SER 86 153 ?   ?   ?   A . n 
A 1 87 GLY 87 154 ?   ?   ?   A . n 
A 1 88 PRO 88 155 ?   ?   ?   A . n 
A 1 89 GLU 89 156 ?   ?   ?   A . n 
A 1 90 ARG 90 157 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MRD 1  1151 1151 MRD MRD A . 
C 3 HOH 1  2001 2001 HOH HOH A . 
C 3 HOH 2  2002 2002 HOH HOH A . 
C 3 HOH 3  2003 2003 HOH HOH A . 
C 3 HOH 4  2004 2004 HOH HOH A . 
C 3 HOH 5  2005 2005 HOH HOH A . 
C 3 HOH 6  2006 2006 HOH HOH A . 
C 3 HOH 7  2007 2007 HOH HOH A . 
C 3 HOH 8  2008 2008 HOH HOH A . 
C 3 HOH 9  2009 2009 HOH HOH A . 
C 3 HOH 10 2010 2010 HOH HOH A . 
C 3 HOH 11 2011 2011 HOH HOH A . 
C 3 HOH 12 2012 2012 HOH HOH A . 
C 3 HOH 13 2013 2013 HOH HOH A . 
C 3 HOH 14 2014 2014 HOH HOH A . 
C 3 HOH 15 2015 2015 HOH HOH A . 
C 3 HOH 16 2016 2016 HOH HOH A . 
C 3 HOH 17 2017 2017 HOH HOH A . 
C 3 HOH 18 2018 2018 HOH HOH A . 
C 3 HOH 19 2019 2019 HOH HOH A . 
C 3 HOH 20 2020 2020 HOH HOH A . 
C 3 HOH 21 2021 2021 HOH HOH A . 
C 3 HOH 22 2022 2022 HOH HOH A . 
C 3 HOH 23 2023 2023 HOH HOH A . 
C 3 HOH 24 2024 2024 HOH HOH A . 
C 3 HOH 25 2025 2025 HOH HOH A . 
C 3 HOH 26 2026 2026 HOH HOH A . 
C 3 HOH 27 2027 2027 HOH HOH A . 
C 3 HOH 28 2028 2028 HOH HOH A . 
C 3 HOH 29 2029 2029 HOH HOH A . 
C 3 HOH 30 2030 2030 HOH HOH A . 
C 3 HOH 31 2031 2031 HOH HOH A . 
C 3 HOH 32 2032 2032 HOH HOH A . 
C 3 HOH 33 2033 2033 HOH HOH A . 
C 3 HOH 34 2034 2034 HOH HOH A . 
C 3 HOH 35 2035 2035 HOH HOH A . 
C 3 HOH 36 2036 2036 HOH HOH A . 
C 3 HOH 37 2037 2037 HOH HOH A . 
C 3 HOH 38 2038 2038 HOH HOH A . 
C 3 HOH 39 2039 2039 HOH HOH A . 
C 3 HOH 40 2040 2040 HOH HOH A . 
C 3 HOH 41 2041 2041 HOH HOH A . 
C 3 HOH 42 2042 2042 HOH HOH A . 
C 3 HOH 43 2043 2043 HOH HOH A . 
C 3 HOH 44 2044 2044 HOH HOH A . 
C 3 HOH 45 2045 2045 HOH HOH A . 
C 3 HOH 46 2046 2046 HOH HOH A . 
C 3 HOH 47 2047 2047 HOH HOH A . 
C 3 HOH 48 2048 2048 HOH HOH A . 
C 3 HOH 49 2049 2049 HOH HOH A . 
C 3 HOH 50 2050 2050 HOH HOH A . 
C 3 HOH 51 2051 2051 HOH HOH A . 
C 3 HOH 52 2052 2052 HOH HOH A . 
C 3 HOH 53 2053 2053 HOH HOH A . 
C 3 HOH 54 2054 2054 HOH HOH A . 
C 3 HOH 55 2055 2055 HOH HOH A . 
C 3 HOH 56 2056 2056 HOH HOH A . 
C 3 HOH 57 2057 2057 HOH HOH A . 
C 3 HOH 58 2058 2058 HOH HOH A . 
C 3 HOH 59 2059 2059 HOH HOH A . 
C 3 HOH 60 2060 2060 HOH HOH A . 
C 3 HOH 61 2061 2061 HOH HOH A . 
C 3 HOH 62 2062 2062 HOH HOH A . 
C 3 HOH 63 2063 2063 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    MSE 
_pdbx_struct_mod_residue.label_seq_id     70 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     MSE 
_pdbx_struct_mod_residue.auth_seq_id      137 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   MET 
_pdbx_struct_mod_residue.details          SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1490  ? 
1 MORE         -33.1 ? 
1 'SSA (A^2)'  9540  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 5_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -36.0300000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2053 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-02 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Experimental preparation'  
6 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' exptl_crystal_grow   
2 4 'Structure model' pdbx_database_proc   
3 4 'Structure model' pdbx_database_status 
4 4 'Structure model' struct_conn          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -16.6765 14.6408 11.6912 0.1515 0.1684 0.0840 0.1195 -0.0005 -0.0012 0.5863 0.5387 2.8965 -0.0504 
-0.4371 0.6533 0.0052  0.1148 -0.1072 -0.2119 -0.1405 0.0473 -0.2641 -0.0370 0.1444 
'X-RAY DIFFRACTION' 2 ? refined -10.1100 2.2138  6.4863  0.2636 0.2531 0.1893 0.1641 0.0299  0.0147  0.5606 0.6657 2.8189 0.0672  
-0.5549 0.0955 -0.3277 0.0825 -0.2089 0.0870  0.0600  0.0355 0.8231  0.4060  0.1593 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 1:58'  
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND RESID 59:87' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
MOSFLM 'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id             2Y1Y 
_pdbx_entry_details.compound_details     'ENGINEERED RESIDUE IN CHAIN A, LEU 137 TO MSE' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;ALPHA-CRYSTALLIN DOMAIN ONLY. HUMAN ALPHAB CRYSTALLIN
ACD(RESIDUES 71-157). LEUCINE 137 MUTATED TO METHIONINE
FOR PHASING.
;
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     74 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             175.83 
_pdbx_validate_torsion.psi             147.71 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2025 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.83 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 74  ? CD  ? A ARG 7  CD  
2  1 Y 1 A ARG 74  ? NE  ? A ARG 7  NE  
3  1 Y 1 A ARG 74  ? CZ  ? A ARG 7  CZ  
4  1 Y 1 A ARG 74  ? NH1 ? A ARG 7  NH1 
5  1 Y 1 A ARG 74  ? NH2 ? A ARG 7  NH2 
6  1 Y 1 A GLU 87  ? CD  ? A GLU 20 CD  
7  1 Y 1 A GLU 87  ? OE1 ? A GLU 20 OE1 
8  1 Y 1 A GLU 87  ? OE2 ? A GLU 20 OE2 
9  1 Y 1 A LYS 90  ? CG  ? A LYS 23 CG  
10 1 Y 1 A LYS 90  ? CD  ? A LYS 23 CD  
11 1 Y 1 A LYS 90  ? CE  ? A LYS 23 CE  
12 1 Y 1 A LYS 90  ? NZ  ? A LYS 23 NZ  
13 1 Y 1 A LYS 92  ? CD  ? A LYS 25 CD  
14 1 Y 1 A LYS 92  ? CE  ? A LYS 25 CE  
15 1 Y 1 A LYS 92  ? NZ  ? A LYS 25 NZ  
16 1 Y 1 A LEU 94  ? CG  ? A LEU 27 CG  
17 1 Y 1 A LEU 94  ? CD1 ? A LEU 27 CD1 
18 1 Y 1 A LEU 94  ? CD2 ? A LEU 27 CD2 
19 1 Y 1 A LYS 103 ? NZ  ? A LYS 36 NZ  
20 1 Y 1 A ARG 123 ? NE  ? A ARG 56 NE  
21 1 Y 1 A ARG 123 ? CZ  ? A ARG 56 CZ  
22 1 Y 1 A ARG 123 ? NH1 ? A ARG 56 NH1 
23 1 Y 1 A ARG 123 ? NH2 ? A ARG 56 NH2 
24 1 Y 1 A LYS 150 ? CD  ? A LYS 83 CD  
25 1 Y 1 A LYS 150 ? CE  ? A LYS 83 CE  
26 1 Y 1 A LYS 150 ? NZ  ? A LYS 83 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 68  ? A GLY 1  
2  1 Y 1 A ALA 69  ? A ALA 2  
3  1 Y 1 A MSE 70  ? A MSE 3  
4  1 Y 1 A GLU 71  ? A GLU 4  
5  1 Y 1 A LYS 72  ? A LYS 5  
6  1 Y 1 A GLN 151 ? A GLN 84 
7  1 Y 1 A VAL 152 ? A VAL 85 
8  1 Y 1 A SER 153 ? A SER 86 
9  1 Y 1 A GLY 154 ? A GLY 87 
10 1 Y 1 A PRO 155 ? A PRO 88 
11 1 Y 1 A GLU 156 ? A GLU 89 
12 1 Y 1 A ARG 157 ? A ARG 90 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(4R)-2-METHYLPENTANE-2,4-DIOL' MRD 
3 water                           HOH 
#