data_2Y2V
# 
_entry.id   2Y2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y2V         
PDBE  EBI-46648    
WWPDB D_1290046648 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2011-11-30 
_pdbx_database_PDB_obs_spr.pdb_id           2Y2V 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2JGG 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2XUG unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (1 WK)' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2XUJ unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (10 MTH)' 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (1 MTH)' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX (10 MTH)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2XUQ unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI-SYN INHIBITORS' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 2Y2U unspecified 'NONAGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY VX-UPDATE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y2V 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Akfur, C.'     1 
'Artursson, E.' 2 
'Ekstrom, F.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Methylphosphonate Adducts of Acetylcholinesterase Investigated by Time Correlated Single Photon Counting and X-Ray Crystallography' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Akfur, C.'     1 ? 
primary 'Artursson, E.' 2 ? 
primary 'Ekstrom, F.'   3 ? 
# 
_cell.entry_id           2Y2V 
_cell.length_a           79.488 
_cell.length_b           111.643 
_cell.length_c           227.026 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y2V 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                     60354.070 2   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 
'CATALYTIC SER203 PHOSPHONYLATED BY SARIN' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ?       ? ?                                   ? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                  106.120   3   ?       ? ?                                   ? 
4 non-polymer syn '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE'     148.200   2   ?       ? ?                                   ? 
5 non-polymer syn 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL    296.357   1   ?       ? ?                                   ? 
6 non-polymer syn 2-ETHOXYETHANOL                          90.121    1   ?       ? ?                                   ? 
7 water       nat water                                    18.015    727 ?       ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGE(SGB)AGAASVGMHILSLPSRSLFHRAVLQSGTPNGPW
ATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALI
NTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRD
AMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRL
MKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SGB n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Y2V A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 2Y2V B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y2V ALA A 544 ? UNP P21836 ? ? 'expression tag' 544 1  
1 2Y2V THR A 545 ? UNP P21836 ? ? 'expression tag' 545 2  
1 2Y2V GLU A 546 ? UNP P21836 ? ? 'expression tag' 546 3  
1 2Y2V ALA A 547 ? UNP P21836 ? ? 'expression tag' 547 4  
1 2Y2V PRO A 548 ? UNP P21836 ? ? 'expression tag' 548 5  
2 2Y2V ALA B 544 ? UNP P21836 ? ? 'expression tag' 544 6  
2 2Y2V THR B 545 ? UNP P21836 ? ? 'expression tag' 545 7  
2 2Y2V GLU B 546 ? UNP P21836 ? ? 'expression tag' 546 8  
2 2Y2V ALA B 547 ? UNP P21836 ? ? 'expression tag' 547 9  
2 2Y2V PRO B 548 ? UNP P21836 ? ? 'expression tag' 548 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                            ? 'C3 H7 N O2 S'   121.158 
ETX non-polymer                  . 2-ETHOXYETHANOL                                     ? 'C4 H10 O2'      90.121  
GLN 'L-peptide linking'          y GLUTAMINE                                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                               ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                              ? 'C6 H15 N2 O2 1' 147.195 
ME2 non-polymer                  . '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE'                ? 'C7 H16 O3'      148.200 
MET 'L-peptide linking'          y METHIONINE                                          ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose            ? 'C8 H15 N O6'    221.208 
P15 non-polymer                  . 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL               ? 'C13 H28 O7'     296.357 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                             ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                              ? 'C3 H7 N O3'     105.093 
SGB 'L-peptide linking'          n 'O-[(S)-METHYL(1-METHYLETHOXY)PHOSPHORYL]-L-SERINE' ? 'C7 H16 N O5 P'  225.179 
THR 'L-peptide linking'          y THREONINE                                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Y2V 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.9 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '26-30% (V/V) PEG 750MME, 0.1 M HEPES PH 7.0.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARRESEARCH SX-165' 
_diffrn_detector.pdbx_collection_date   2009-05-13 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03908 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-2' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-2 
_diffrn_source.pdbx_wavelength             1.03908 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y2V 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.14 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   306983 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.80 
_reflns.B_iso_Wilson_estimate        50.46 
_reflns.pdbx_redundancy              4.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.58 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.46 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.20 
_reflns_shell.pdbx_redundancy        4.1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y2V 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     74170 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.979 
_refine.ls_d_res_high                            2.45 
_refine.ls_percent_reflns_obs                    98.79 
_refine.ls_R_factor_obs                          0.1854 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1847 
_refine.ls_R_factor_R_free                       0.2244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1474 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            1.6269 
_refine.aniso_B[2][2]                            2.1234 
_refine.aniso_B[3][3]                            -3.7503 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.330 
_refine.solvent_model_param_bsol                 66.816 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.17 
_refine.pdbx_overall_phase_error                 20.96 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8272 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         109 
_refine_hist.number_atoms_solvent             727 
_refine_hist.number_atoms_total               9108 
_refine_hist.d_res_high                       2.45 
_refine_hist.d_res_low                        28.979 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8704  'X-RAY DIFFRACTION' ? 
f_angle_d          1.119  ? ? 11870 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.056 ? ? 3124  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.075  ? ? 1276  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1550  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.4500 2.5290  6539 0.2420 99.00  0.2680 . . 126 . . 
'X-RAY DIFFRACTION' . 2.5290 2.6194  6520 0.2262 99.00  0.2881 . . 126 . . 
'X-RAY DIFFRACTION' . 2.6194 2.7242  6588 0.2229 99.00  0.2656 . . 151 . . 
'X-RAY DIFFRACTION' . 2.7242 2.8480  6599 0.2132 100.00 0.2864 . . 134 . . 
'X-RAY DIFFRACTION' . 2.8480 2.9981  6566 0.2195 100.00 0.2674 . . 133 . . 
'X-RAY DIFFRACTION' . 2.9981 3.1857  6646 0.2072 100.00 0.2553 . . 153 . . 
'X-RAY DIFFRACTION' . 3.1857 3.4313  6630 0.1887 100.00 0.2235 . . 114 . . 
'X-RAY DIFFRACTION' . 3.4313 3.7759  6611 0.1641 99.00  0.2006 . . 145 . . 
'X-RAY DIFFRACTION' . 3.7759 4.3208  6621 0.1472 99.00  0.1847 . . 125 . . 
'X-RAY DIFFRACTION' . 4.3208 5.4378  6651 0.1357 98.00  0.1660 . . 131 . . 
'X-RAY DIFFRACTION' . 5.4378 28.9811 6725 0.1692 96.00  0.2033 . . 136 . . 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.735238 
_struct_ncs_oper.matrix[1][2]   -0.403452 
_struct_ncs_oper.matrix[1][3]   -0.545658 
_struct_ncs_oper.matrix[2][1]   -0.405135 
_struct_ncs_oper.matrix[2][2]   -0.905799 
_struct_ncs_oper.matrix[2][3]   0.124070 
_struct_ncs_oper.matrix[3][1]   -0.543407 
_struct_ncs_oper.matrix[3][2]   0.129439 
_struct_ncs_oper.matrix[3][3]   -0.829430 
_struct_ncs_oper.vector[1]      1.07587 
_struct_ncs_oper.vector[2]      23.93320 
_struct_ncs_oper.vector[3]      -13.38590 
# 
_struct.entry_id                  2Y2V 
_struct.title                     'Nonaged form of Mouse Acetylcholinesterase inhibited by sarin-Update' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y2V 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CHOLINESTERASE, METHYLPHOSPHONATE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 3 ? 
J N N 2 ? 
K N N 6 ? 
L N N 4 ? 
M N N 7 ? 
N N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SGB A 203 ? LEU A 214 ? SGB A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? GLY A 256 ? SER A 240 GLY A 256 1 ? 17 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SGB B 203 ? LEU B 214 ? SGB B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? GLU B 285 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P41 41 TRP B 286 ? LEU B 289 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? GLY B 456 ? GLU B 450 GLY B 456 1 ? 7  
HELX_P HELX_P50 50 LEU B 457 ? ASN B 464 ? LEU B 457 ASN B 464 5 ? 8  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ALA B 542 ? ARG B 525 ALA B 542 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.064 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.069 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1 covale one  ? A GLU 202 C   ? ? ? 1_555 A SGB 203 N  ? ? A GLU 202 A SGB 203 1_555 ? ? ? ? ? ? ? 1.330 ? ?               
covale2 covale both ? A SGB 203 C   ? ? ? 1_555 A ALA 204 N  ? ? A SGB 203 A ALA 204 1_555 ? ? ? ? ? ? ? 1.332 ? ?               
covale3 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 A NAG 601 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale4 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale5 covale one  ? B GLU 202 C   ? ? ? 1_555 B SGB 203 N  ? ? B GLU 202 B SGB 203 1_555 ? ? ? ? ? ? ? 1.337 ? ?               
covale6 covale both ? B SGB 203 C   ? ? ? 1_555 B ALA 204 N  ? ? B SGB 203 B ALA 204 1_555 ? ? ? ? ? ? ? 1.333 ? ?               
covale7 covale one  ? B ASN 350 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 2.37  
2 SER 541 A . ? SER 541 A ALA 542 A ? ALA 542 A 1 -0.80 
3 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 5.68  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
_database_PDB_matrix.entry_id          2Y2V 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y2V 
_atom_sites.fract_transf_matrix[1][1]   0.012581 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008957 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004405 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 31.911  15.422  55.414  1.00   74.30  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 30.584  14.822  55.452  1.00   76.29  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 29.890  15.320  56.719  1.00   76.34  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 30.496  16.048  57.509  1.00   80.09  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.697  13.289  55.428  1.00   65.85  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 29.612  12.575  54.627  1.00   53.62  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 29.847  11.072  54.498  1.00   59.54  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 30.958  10.674  54.061  1.00   50.54  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 28.915  10.291  54.829  1.00   53.74  ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 28.624  14.957  56.914  1.00   66.70  ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 27.930  15.338  58.134  1.00   51.42  ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 26.701  16.184  57.895  1.00   57.28  ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 25.582  15.746  58.178  1.00   54.26  ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 26.917  17.390  57.364  1.00   70.06  ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 25.847  18.359  57.095  1.00   69.24  ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.542  18.492  55.602  1.00   64.33  ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 24.981  19.489  55.159  1.00   69.88  ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 26.209  19.736  57.671  1.00   68.01  ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 25.508  20.084  58.991  1.00   77.23  ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 26.400  19.858  60.211  1.00   75.40  ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 25.708  20.067  61.491  1.00   72.88  ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 24.486  19.620  61.789  1.00   70.11  ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 23.783  18.911  60.913  1.00   65.32  ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 23.966  19.870  62.980  1.00   59.53  ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 25.911  17.471  54.842  1.00   59.00  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.798  17.474  53.397  1.00   57.57  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.536  16.730  53.033  1.00   56.95  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.016  15.974  53.848  1.00   55.55  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.987  16.716  52.822  1.00   63.27  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.694  17.395  51.685  1.00   71.72  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.172  17.089  51.705  1.00   77.76  ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 29.568  16.175  52.465  1.00   76.56  ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.936  17.763  50.981  1.00   79.19  ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.041  16.930  51.816  1.00   54.01  ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 22.886  16.164  51.352  1.00   54.64  ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.299  14.708  51.205  1.00   55.90  ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.055  14.364  50.295  1.00   56.62  ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.356  16.703  50.017  1.00   47.27  ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.128  15.950  49.529  1.00   52.79  ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 20.889  14.825  50.013  1.00   53.57  ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.395  16.481  48.661  1.00   52.24  ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.802  13.841  52.101  1.00   58.35  ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.180  12.421  52.134  1.00   51.57  ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 22.903  11.712  50.814  1.00   51.52  ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.560  10.730  50.474  1.00   51.28  ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.254  11.850  53.217  1.00   51.41  ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.087  12.809  53.238  1.00   52.24  ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 21.773  14.134  53.112  1.00   57.10  ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 21.938  12.210  50.058  1.00   52.07  ? 7    GLN A N   1 
ATOM   50   C CA  A GLN A 1 7   ? 21.557  11.530  48.831  0.50   50.70  ? 7    GLN A CA  1 
ATOM   51   C CA  B GLN A 1 7   ? 21.533  11.565  48.809  0.50   50.70  ? 7    GLN A CA  1 
ATOM   52   C C   . GLN A 1 7   ? 22.429  11.909  47.617  1.00   52.19  ? 7    GLN A C   1 
ATOM   53   O O   . GLN A 1 7   ? 22.191  11.453  46.501  1.00   53.58  ? 7    GLN A O   1 
ATOM   54   C CB  A GLN A 1 7   ? 20.049  11.693  48.604  0.50   50.24  ? 7    GLN A CB  1 
ATOM   55   C CB  B GLN A 1 7   ? 20.074  11.896  48.488  0.50   50.14  ? 7    GLN A CB  1 
ATOM   56   C CG  A GLN A 1 7   ? 19.240  10.918  49.672  0.50   52.71  ? 7    GLN A CG  1 
ATOM   57   C CG  B GLN A 1 7   ? 19.613  11.466  47.099  0.50   52.96  ? 7    GLN A CG  1 
ATOM   58   C CD  A GLN A 1 7   ? 17.816  11.419  49.877  0.50   50.21  ? 7    GLN A CD  1 
ATOM   59   C CD  B GLN A 1 7   ? 19.466  9.958   46.934  0.50   48.85  ? 7    GLN A CD  1 
ATOM   60   O OE1 A GLN A 1 7   ? 16.919  10.640  50.201  0.50   43.62  ? 7    GLN A OE1 1 
ATOM   61   O OE1 B GLN A 1 7   ? 19.222  9.476   45.837  0.50   50.84  ? 7    GLN A OE1 1 
ATOM   62   N NE2 A GLN A 1 7   ? 17.609  12.720  49.708  0.50   44.63  ? 7    GLN A NE2 1 
ATOM   63   N NE2 B GLN A 1 7   ? 19.606  9.217   48.021  0.50   49.01  ? 7    GLN A NE2 1 
ATOM   64   N N   . LEU A 1 8   ? 23.472  12.707  47.855  1.00   50.21  ? 8    LEU A N   1 
ATOM   65   C CA  . LEU A 1 8   ? 24.405  13.096  46.787  1.00   48.17  ? 8    LEU A CA  1 
ATOM   66   C C   . LEU A 1 8   ? 25.820  12.544  46.973  1.00   50.42  ? 8    LEU A C   1 
ATOM   67   O O   . LEU A 1 8   ? 26.749  12.943  46.265  1.00   49.66  ? 8    LEU A O   1 
ATOM   68   C CB  . LEU A 1 8   ? 24.471  14.622  46.646  1.00   42.21  ? 8    LEU A CB  1 
ATOM   69   C CG  . LEU A 1 8   ? 23.161  15.304  46.234  1.00   48.02  ? 8    LEU A CG  1 
ATOM   70   C CD1 . LEU A 1 8   ? 23.320  16.806  46.340  1.00   40.53  ? 8    LEU A CD1 1 
ATOM   71   C CD2 . LEU A 1 8   ? 22.707  14.870  44.811  1.00   36.77  ? 8    LEU A CD2 1 
ATOM   72   N N   . LEU A 1 9   ? 25.992  11.638  47.927  1.00   46.86  ? 9    LEU A N   1 
ATOM   73   C CA  . LEU A 1 9   ? 27.309  11.079  48.178  1.00   45.08  ? 9    LEU A CA  1 
ATOM   74   C C   . LEU A 1 9   ? 27.362  9.677   47.622  1.00   47.97  ? 9    LEU A C   1 
ATOM   75   O O   . LEU A 1 9   ? 26.513  8.846   47.944  1.00   45.00  ? 9    LEU A O   1 
ATOM   76   C CB  . LEU A 1 9   ? 27.643  11.114  49.668  1.00   48.36  ? 9    LEU A CB  1 
ATOM   77   C CG  . LEU A 1 9   ? 27.552  12.535  50.255  1.00   55.68  ? 9    LEU A CG  1 
ATOM   78   C CD1 . LEU A 1 9   ? 27.503  12.548  51.802  1.00   49.57  ? 9    LEU A CD1 1 
ATOM   79   C CD2 . LEU A 1 9   ? 28.682  13.422  49.728  1.00   48.37  ? 9    LEU A CD2 1 
ATOM   80   N N   . VAL A 1 10  ? 28.345  9.421   46.762  1.00   44.41  ? 10   VAL A N   1 
ATOM   81   C CA  . VAL A 1 10  ? 28.417  8.149   46.056  1.00   45.90  ? 10   VAL A CA  1 
ATOM   82   C C   . VAL A 1 10  ? 29.868  7.711   45.955  1.00   45.13  ? 10   VAL A C   1 
ATOM   83   O O   . VAL A 1 10  ? 30.770  8.544   45.846  1.00   49.84  ? 10   VAL A O   1 
ATOM   84   C CB  . VAL A 1 10  ? 27.774  8.267   44.639  1.00   42.79  ? 10   VAL A CB  1 
ATOM   85   C CG1 . VAL A 1 10  ? 27.991  7.013   43.829  1.00   42.91  ? 10   VAL A CG1 1 
ATOM   86   C CG2 . VAL A 1 10  ? 26.298  8.531   44.769  1.00   45.40  ? 10   VAL A CG2 1 
ATOM   87   N N   . ARG A 1 11  ? 30.099  6.406   46.012  1.00   40.57  ? 11   ARG A N   1 
ATOM   88   C CA  . ARG A 1 11  ? 31.439  5.882   45.808  1.00   34.52  ? 11   ARG A CA  1 
ATOM   89   C C   . ARG A 1 11  ? 31.515  5.110   44.498  1.00   40.85  ? 11   ARG A C   1 
ATOM   90   O O   . ARG A 1 11  ? 30.604  4.338   44.174  1.00   41.82  ? 11   ARG A O   1 
ATOM   91   C CB  . ARG A 1 11  ? 31.857  4.980   46.971  1.00   40.92  ? 11   ARG A CB  1 
ATOM   92   C CG  . ARG A 1 11  ? 33.140  4.194   46.705  1.00   41.01  ? 11   ARG A CG  1 
ATOM   93   C CD  . ARG A 1 11  ? 33.605  3.415   47.933  1.00   42.59  ? 11   ARG A CD  1 
ATOM   94   N NE  . ARG A 1 11  ? 34.061  4.294   49.006  1.00   43.58  ? 11   ARG A NE  1 
ATOM   95   C CZ  . ARG A 1 11  ? 35.302  4.751   49.115  1.00   42.44  ? 11   ARG A CZ  1 
ATOM   96   N NH1 . ARG A 1 11  ? 36.204  4.414   48.207  1.00   45.92  ? 11   ARG A NH1 1 
ATOM   97   N NH2 . ARG A 1 11  ? 35.637  5.553   50.118  1.00   42.08  ? 11   ARG A NH2 1 
ATOM   98   N N   . VAL A 1 12  ? 32.588  5.345   43.743  1.00   31.66  ? 12   VAL A N   1 
ATOM   99   C CA  . VAL A 1 12  ? 32.915  4.554   42.560  1.00   35.86  ? 12   VAL A CA  1 
ATOM   100  C C   . VAL A 1 12  ? 34.322  3.963   42.706  1.00   37.14  ? 12   VAL A C   1 
ATOM   101  O O   . VAL A 1 12  ? 35.056  4.313   43.634  1.00   38.89  ? 12   VAL A O   1 
ATOM   102  C CB  . VAL A 1 12  ? 32.830  5.397   41.263  1.00   31.30  ? 12   VAL A CB  1 
ATOM   103  C CG1 . VAL A 1 12  ? 31.405  5.828   41.017  1.00   37.80  ? 12   VAL A CG1 1 
ATOM   104  C CG2 . VAL A 1 12  ? 33.749  6.614   41.357  1.00   33.27  ? 12   VAL A CG2 1 
ATOM   105  N N   . ARG A 1 13  ? 34.689  3.082   41.783  1.00   33.88  ? 13   ARG A N   1 
ATOM   106  C CA  . ARG A 1 13  ? 35.970  2.365   41.826  1.00   43.55  ? 13   ARG A CA  1 
ATOM   107  C C   . ARG A 1 13  ? 37.176  3.245   42.164  1.00   40.52  ? 13   ARG A C   1 
ATOM   108  O O   . ARG A 1 13  ? 38.068  2.827   42.878  1.00   45.70  ? 13   ARG A O   1 
ATOM   109  C CB  . ARG A 1 13  ? 36.206  1.648   40.493  1.00   41.08  ? 13   ARG A CB  1 
ATOM   110  C CG  . ARG A 1 13  ? 37.563  0.986   40.337  1.00   46.83  ? 13   ARG A CG  1 
ATOM   111  C CD  . ARG A 1 13  ? 37.807  -0.133  41.355  1.00   46.98  ? 13   ARG A CD  1 
ATOM   112  N NE  . ARG A 1 13  ? 38.891  0.255   42.249  1.00   52.82  ? 13   ARG A NE  1 
ATOM   113  C CZ  . ARG A 1 13  ? 40.045  -0.390  42.341  1.00   44.67  ? 13   ARG A CZ  1 
ATOM   114  N NH1 . ARG A 1 13  ? 40.246  -1.478  41.629  1.00   47.42  ? 13   ARG A NH1 1 
ATOM   115  N NH2 . ARG A 1 13  ? 40.981  0.037   43.169  1.00   52.30  ? 13   ARG A NH2 1 
ATOM   116  N N   . GLY A 1 14  ? 37.194  4.465   41.648  1.00   43.52  ? 14   GLY A N   1 
ATOM   117  C CA  . GLY A 1 14  ? 38.321  5.349   41.856  1.00   44.67  ? 14   GLY A CA  1 
ATOM   118  C C   . GLY A 1 14  ? 38.270  6.183   43.123  1.00   46.38  ? 14   GLY A C   1 
ATOM   119  O O   . GLY A 1 14  ? 39.258  6.822   43.496  1.00   47.11  ? 14   GLY A O   1 
ATOM   120  N N   . GLY A 1 15  ? 37.123  6.194   43.791  1.00   42.85  ? 15   GLY A N   1 
ATOM   121  C CA  . GLY A 1 15  ? 36.987  7.005   44.983  1.00   41.58  ? 15   GLY A CA  1 
ATOM   122  C C   . GLY A 1 15  ? 35.585  7.511   45.257  1.00   44.01  ? 15   GLY A C   1 
ATOM   123  O O   . GLY A 1 15  ? 34.597  7.001   44.714  1.00   39.58  ? 15   GLY A O   1 
ATOM   124  N N   . GLN A 1 16  ? 35.521  8.531   46.105  1.00   39.68  ? 16   GLN A N   1 
ATOM   125  C CA  . GLN A 1 16  ? 34.269  9.099   46.588  1.00   45.45  ? 16   GLN A CA  1 
ATOM   126  C C   . GLN A 1 16  ? 33.883  10.357  45.832  1.00   46.03  ? 16   GLN A C   1 
ATOM   127  O O   . GLN A 1 16  ? 34.745  11.185  45.517  1.00   46.22  ? 16   GLN A O   1 
ATOM   128  C CB  . GLN A 1 16  ? 34.396  9.436   48.076  1.00   42.20  ? 16   GLN A CB  1 
ATOM   129  C CG  . GLN A 1 16  ? 33.889  8.353   48.988  1.00   41.29  ? 16   GLN A CG  1 
ATOM   130  C CD  . GLN A 1 16  ? 34.099  8.694   50.443  1.00   52.98  ? 16   GLN A CD  1 
ATOM   131  O OE1 . GLN A 1 16  ? 35.228  8.959   50.870  1.00   49.01  ? 16   GLN A OE1 1 
ATOM   132  N NE2 . GLN A 1 16  ? 33.010  8.700   51.218  1.00   41.17  ? 16   GLN A NE2 1 
ATOM   133  N N   . LEU A 1 17  ? 32.586  10.519  45.574  1.00   40.66  ? 17   LEU A N   1 
ATOM   134  C CA  . LEU A 1 17  ? 32.100  11.675  44.827  1.00   43.84  ? 17   LEU A CA  1 
ATOM   135  C C   . LEU A 1 17  ? 30.989  12.410  45.560  1.00   43.30  ? 17   LEU A C   1 
ATOM   136  O O   . LEU A 1 17  ? 30.179  11.807  46.256  1.00   43.11  ? 17   LEU A O   1 
ATOM   137  C CB  . LEU A 1 17  ? 31.567  11.255  43.450  1.00   42.11  ? 17   LEU A CB  1 
ATOM   138  C CG  . LEU A 1 17  ? 32.445  10.426  42.521  1.00   41.96  ? 17   LEU A CG  1 
ATOM   139  C CD1 . LEU A 1 17  ? 31.597  9.823   41.426  1.00   36.80  ? 17   LEU A CD1 1 
ATOM   140  C CD2 . LEU A 1 17  ? 33.563  11.271  41.931  1.00   44.37  ? 17   LEU A CD2 1 
ATOM   141  N N   . ARG A 1 18  ? 30.953  13.721  45.375  1.00   42.43  ? 18   ARG A N   1 
ATOM   142  C CA  . ARG A 1 18  ? 29.824  14.513  45.793  1.00   44.73  ? 18   ARG A CA  1 
ATOM   143  C C   . ARG A 1 18  ? 29.174  15.138  44.561  1.00   47.83  ? 18   ARG A C   1 
ATOM   144  O O   . ARG A 1 18  ? 29.834  15.847  43.801  1.00   43.82  ? 18   ARG A O   1 
ATOM   145  C CB  . ARG A 1 18  ? 30.272  15.608  46.751  1.00   40.14  ? 18   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 18  ? 29.140  16.495  47.218  1.00   42.14  ? 18   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 18  ? 29.631  17.466  48.275  1.00   56.17  ? 18   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 18  ? 30.912  18.039  47.882  1.00   50.95  ? 18   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 18  ? 32.063  17.817  48.506  1.00   55.34  ? 18   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 18  ? 32.112  17.049  49.592  1.00   52.87  ? 18   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 18  ? 33.171  18.382  48.044  1.00   59.42  ? 18   ARG A NH2 1 
ATOM   152  N N   . GLY A 1 19  ? 27.885  14.872  44.369  1.00   37.94  ? 19   GLY A N   1 
ATOM   153  C CA  . GLY A 1 19  ? 27.144  15.435  43.258  1.00   39.92  ? 19   GLY A CA  1 
ATOM   154  C C   . GLY A 1 19  ? 26.246  16.601  43.649  1.00   50.03  ? 19   GLY A C   1 
ATOM   155  O O   . GLY A 1 19  ? 26.373  17.164  44.747  1.00   42.24  ? 19   GLY A O   1 
ATOM   156  N N   . ILE A 1 20  ? 25.328  16.960  42.750  1.00   41.76  ? 20   ILE A N   1 
ATOM   157  C CA  . ILE A 1 20  ? 24.507  18.145  42.946  1.00   42.20  ? 20   ILE A CA  1 
ATOM   158  C C   . ILE A 1 20  ? 23.009  17.913  42.669  1.00   44.30  ? 20   ILE A C   1 
ATOM   159  O O   . ILE A 1 20  ? 22.633  17.181  41.741  1.00   44.27  ? 20   ILE A O   1 
ATOM   160  C CB  . ILE A 1 20  ? 25.072  19.334  42.126  1.00   42.21  ? 20   ILE A CB  1 
ATOM   161  C CG1 . ILE A 1 20  ? 24.295  20.614  42.411  1.00   46.82  ? 20   ILE A CG1 1 
ATOM   162  C CG2 . ILE A 1 20  ? 25.070  19.028  40.642  1.00   41.84  ? 20   ILE A CG2 1 
ATOM   163  C CD1 . ILE A 1 20  ? 24.933  21.853  41.823  1.00   41.72  ? 20   ILE A CD1 1 
ATOM   164  N N   . ARG A 1 21  ? 22.158  18.511  43.501  1.00   40.29  ? 21   ARG A N   1 
ATOM   165  C CA  . ARG A 1 21  ? 20.714  18.479  43.269  1.00   44.89  ? 21   ARG A CA  1 
ATOM   166  C C   . ARG A 1 21  ? 20.399  19.543  42.224  1.00   45.98  ? 21   ARG A C   1 
ATOM   167  O O   . ARG A 1 21  ? 20.643  20.729  42.461  1.00   43.15  ? 21   ARG A O   1 
ATOM   168  C CB  . ARG A 1 21  ? 19.957  18.796  44.565  1.00   44.73  ? 21   ARG A CB  1 
ATOM   169  C CG  . ARG A 1 21  ? 18.571  18.156  44.689  1.00   49.43  ? 21   ARG A CG  1 
ATOM   170  C CD  . ARG A 1 21  ? 17.840  18.615  45.961  1.00   43.80  ? 21   ARG A CD  1 
ATOM   171  N NE  . ARG A 1 21  ? 16.865  19.657  45.659  1.00   65.56  ? 21   ARG A NE  1 
ATOM   172  C CZ  . ARG A 1 21  ? 15.544  19.493  45.730  1.00   69.49  ? 21   ARG A CZ  1 
ATOM   173  N NH1 . ARG A 1 21  ? 15.035  18.332  46.128  1.00   65.96  ? 21   ARG A NH1 1 
ATOM   174  N NH2 . ARG A 1 21  ? 14.729  20.494  45.416  1.00   68.02  ? 21   ARG A NH2 1 
ATOM   175  N N   . LEU A 1 22  ? 19.883  19.129  41.071  1.00   39.29  ? 22   LEU A N   1 
ATOM   176  C CA  . LEU A 1 22  ? 19.566  20.071  39.997  1.00   46.54  ? 22   LEU A CA  1 
ATOM   177  C C   . LEU A 1 22  ? 18.065  20.218  39.848  1.00   46.95  ? 22   LEU A C   1 
ATOM   178  O O   . LEU A 1 22  ? 17.322  19.258  40.033  1.00   49.29  ? 22   LEU A O   1 
ATOM   179  C CB  . LEU A 1 22  ? 20.158  19.619  38.655  1.00   41.25  ? 22   LEU A CB  1 
ATOM   180  C CG  . LEU A 1 22  ? 21.677  19.671  38.485  1.00   46.13  ? 22   LEU A CG  1 
ATOM   181  C CD1 . LEU A 1 22  ? 22.040  19.302  37.060  1.00   46.42  ? 22   LEU A CD1 1 
ATOM   182  C CD2 . LEU A 1 22  ? 22.227  21.028  38.850  1.00   40.52  ? 22   LEU A CD2 1 
ATOM   183  N N   . LYS A 1 23  ? 17.614  21.414  39.493  1.00   50.50  ? 23   LYS A N   1 
ATOM   184  C CA  . LYS A 1 23  ? 16.191  21.616  39.290  1.00   50.93  ? 23   LYS A CA  1 
ATOM   185  C C   . LYS A 1 23  ? 15.796  21.331  37.847  1.00   52.90  ? 23   LYS A C   1 
ATOM   186  O O   . LYS A 1 23  ? 16.384  21.860  36.908  1.00   53.52  ? 23   LYS A O   1 
ATOM   187  C CB  . LYS A 1 23  ? 15.769  23.026  39.700  1.00   57.97  ? 23   LYS A CB  1 
ATOM   188  C CG  . LYS A 1 23  ? 14.267  23.157  39.937  1.00   75.69  ? 23   LYS A CG  1 
ATOM   189  C CD  . LYS A 1 23  ? 13.836  24.613  40.109  1.00   85.77  ? 23   LYS A CD  1 
ATOM   190  C CE  . LYS A 1 23  ? 12.311  24.758  40.052  1.00   90.52  ? 23   LYS A CE  1 
ATOM   191  N NZ  . LYS A 1 23  ? 11.744  24.488  38.690  1.00   75.88  ? 23   LYS A NZ  1 
ATOM   192  N N   . ALA A 1 24  ? 14.814  20.458  37.682  1.00   48.58  ? 24   ALA A N   1 
ATOM   193  C CA  . ALA A 1 24  ? 14.185  20.248  36.393  1.00   51.10  ? 24   ALA A CA  1 
ATOM   194  C C   . ALA A 1 24  ? 12.732  20.713  36.508  1.00   57.89  ? 24   ALA A C   1 
ATOM   195  O O   . ALA A 1 24  ? 12.201  20.853  37.616  1.00   52.81  ? 24   ALA A O   1 
ATOM   196  C CB  . ALA A 1 24  ? 14.262  18.787  35.995  1.00   47.29  ? 24   ALA A CB  1 
ATOM   197  N N   . PRO A 1 25  ? 12.082  20.963  35.365  1.00   55.24  ? 25   PRO A N   1 
ATOM   198  C CA  . PRO A 1 25  ? 10.722  21.509  35.400  1.00   49.99  ? 25   PRO A CA  1 
ATOM   199  C C   . PRO A 1 25  ? 9.805   20.781  36.381  1.00   47.44  ? 25   PRO A C   1 
ATOM   200  O O   . PRO A 1 25  ? 9.075   21.433  37.117  1.00   54.24  ? 25   PRO A O   1 
ATOM   201  C CB  . PRO A 1 25  ? 10.237  21.315  33.965  1.00   50.71  ? 25   PRO A CB  1 
ATOM   202  C CG  . PRO A 1 25  ? 11.494  21.396  33.144  1.00   53.59  ? 25   PRO A CG  1 
ATOM   203  C CD  . PRO A 1 25  ? 12.576  20.775  33.989  1.00   47.62  ? 25   PRO A CD  1 
ATOM   204  N N   . GLY A 1 26  ? 9.843   19.456  36.394  1.00   48.74  ? 26   GLY A N   1 
ATOM   205  C CA  . GLY A 1 26  ? 8.934   18.683  37.218  1.00   45.68  ? 26   GLY A CA  1 
ATOM   206  C C   . GLY A 1 26  ? 9.525   18.150  38.519  1.00   58.90  ? 26   GLY A C   1 
ATOM   207  O O   . GLY A 1 26  ? 8.929   17.279  39.155  1.00   51.74  ? 26   GLY A O   1 
ATOM   208  N N   . GLY A 1 27  ? 10.689  18.663  38.921  1.00   50.86  ? 27   GLY A N   1 
ATOM   209  C CA  . GLY A 1 27  ? 11.320  18.223  40.154  1.00   43.96  ? 27   GLY A CA  1 
ATOM   210  C C   . GLY A 1 27  ? 12.828  18.087  40.061  1.00   49.49  ? 27   GLY A C   1 
ATOM   211  O O   . GLY A 1 27  ? 13.416  18.357  39.015  1.00   49.71  ? 27   GLY A O   1 
ATOM   212  N N   . PRO A 1 28  ? 13.466  17.640  41.153  1.00   49.96  ? 28   PRO A N   1 
ATOM   213  C CA  . PRO A 1 28  ? 14.927  17.577  41.250  1.00   44.40  ? 28   PRO A CA  1 
ATOM   214  C C   . PRO A 1 28  ? 15.506  16.339  40.567  1.00   46.54  ? 28   PRO A C   1 
ATOM   215  O O   . PRO A 1 28  ? 14.814  15.324  40.459  1.00   40.72  ? 28   PRO A O   1 
ATOM   216  C CB  . PRO A 1 28  ? 15.174  17.461  42.760  1.00   49.68  ? 28   PRO A CB  1 
ATOM   217  C CG  . PRO A 1 28  ? 13.809  17.244  43.403  1.00   46.82  ? 28   PRO A CG  1 
ATOM   218  C CD  . PRO A 1 28  ? 12.818  17.012  42.314  1.00   45.21  ? 28   PRO A CD  1 
ATOM   219  N N   . VAL A 1 29  ? 16.763  16.429  40.129  1.00   42.65  ? 29   VAL A N   1 
ATOM   220  C CA  . VAL A 1 29  ? 17.510  15.268  39.651  1.00   45.44  ? 29   VAL A CA  1 
ATOM   221  C C   . VAL A 1 29  ? 18.891  15.292  40.298  1.00   44.85  ? 29   VAL A C   1 
ATOM   222  O O   . VAL A 1 29  ? 19.350  16.344  40.734  1.00   46.95  ? 29   VAL A O   1 
ATOM   223  C CB  . VAL A 1 29  ? 17.683  15.264  38.103  1.00   42.81  ? 29   VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 29  ? 16.342  15.451  37.391  1.00   37.78  ? 29   VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 29  ? 18.669  16.343  37.675  1.00   39.69  ? 29   VAL A CG2 1 
ATOM   226  N N   . SER A 1 30  ? 19.552  14.140  40.355  1.00   41.85  ? 30   SER A N   1 
ATOM   227  C CA  . SER A 1 30  ? 20.933  14.073  40.826  1.00   46.08  ? 30   SER A CA  1 
ATOM   228  C C   . SER A 1 30  ? 21.886  14.187  39.642  1.00   43.38  ? 30   SER A C   1 
ATOM   229  O O   . SER A 1 30  ? 21.718  13.495  38.645  1.00   40.50  ? 30   SER A O   1 
ATOM   230  C CB  . SER A 1 30  ? 21.210  12.741  41.537  1.00   46.30  ? 30   SER A CB  1 
ATOM   231  O OG  . SER A 1 30  ? 20.237  12.432  42.517  1.00   53.24  ? 30   SER A OG  1 
ATOM   232  N N   . ALA A 1 31  ? 22.901  15.034  39.755  1.00   41.32  ? 31   ALA A N   1 
ATOM   233  C CA  . ALA A 1 31  ? 23.911  15.111  38.705  1.00   39.82  ? 31   ALA A CA  1 
ATOM   234  C C   . ALA A 1 31  ? 25.312  14.957  39.274  1.00   43.28  ? 31   ALA A C   1 
ATOM   235  O O   . ALA A 1 31  ? 25.629  15.508  40.331  1.00   42.01  ? 31   ALA A O   1 
ATOM   236  C CB  . ALA A 1 31  ? 23.798  16.416  37.934  1.00   37.75  ? 31   ALA A CB  1 
ATOM   237  N N   . PHE A 1 32  ? 26.138  14.197  38.563  1.00   39.14  ? 32   PHE A N   1 
ATOM   238  C CA  . PHE A 1 32  ? 27.524  13.983  38.932  1.00   36.86  ? 32   PHE A CA  1 
ATOM   239  C C   . PHE A 1 32  ? 28.393  14.305  37.730  1.00   38.30  ? 32   PHE A C   1 
ATOM   240  O O   . PHE A 1 32  ? 28.587  13.469  36.836  1.00   40.78  ? 32   PHE A O   1 
ATOM   241  C CB  . PHE A 1 32  ? 27.748  12.536  39.373  1.00   37.19  ? 32   PHE A CB  1 
ATOM   242  C CG  . PHE A 1 32  ? 27.028  12.165  40.646  1.00   39.42  ? 32   PHE A CG  1 
ATOM   243  C CD1 . PHE A 1 32  ? 27.644  12.323  41.880  1.00   39.77  ? 32   PHE A CD1 1 
ATOM   244  C CD2 . PHE A 1 32  ? 25.749  11.641  40.605  1.00   34.92  ? 32   PHE A CD2 1 
ATOM   245  C CE1 . PHE A 1 32  ? 26.983  11.982  43.057  1.00   40.54  ? 32   PHE A CE1 1 
ATOM   246  C CE2 . PHE A 1 32  ? 25.088  11.291  41.768  1.00   44.20  ? 32   PHE A CE2 1 
ATOM   247  C CZ  . PHE A 1 32  ? 25.706  11.466  43.001  1.00   37.35  ? 32   PHE A CZ  1 
ATOM   248  N N   . LEU A 1 33  ? 28.905  15.527  37.709  1.00   39.81  ? 33   LEU A N   1 
ATOM   249  C CA  . LEU A 1 33  ? 29.582  16.057  36.532  1.00   40.66  ? 33   LEU A CA  1 
ATOM   250  C C   . LEU A 1 33  ? 31.092  16.092  36.718  1.00   38.38  ? 33   LEU A C   1 
ATOM   251  O O   . LEU A 1 33  ? 31.590  16.326  37.825  1.00   41.18  ? 33   LEU A O   1 
ATOM   252  C CB  . LEU A 1 33  ? 29.049  17.455  36.211  1.00   41.42  ? 33   LEU A CB  1 
ATOM   253  C CG  . LEU A 1 33  ? 27.525  17.582  36.324  1.00   40.94  ? 33   LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 33  ? 27.068  19.044  36.220  1.00   37.97  ? 33   LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 33  ? 26.821  16.699  35.286  1.00   33.32  ? 33   LEU A CD2 1 
ATOM   256  N N   . GLY A 1 34  ? 31.812  15.833  35.631  1.00   34.23  ? 34   GLY A N   1 
ATOM   257  C CA  . GLY A 1 34  ? 33.260  15.899  35.631  1.00   35.30  ? 34   GLY A CA  1 
ATOM   258  C C   . GLY A 1 34  ? 33.948  14.781  36.387  1.00   39.97  ? 34   GLY A C   1 
ATOM   259  O O   . GLY A 1 34  ? 34.972  15.000  37.025  1.00   40.30  ? 34   GLY A O   1 
ATOM   260  N N   . ILE A 1 35  ? 33.384  13.579  36.323  1.00   43.06  ? 35   ILE A N   1 
ATOM   261  C CA  . ILE A 1 35  ? 34.024  12.406  36.904  1.00   37.06  ? 35   ILE A CA  1 
ATOM   262  C C   . ILE A 1 35  ? 35.133  11.925  35.986  1.00   38.43  ? 35   ILE A C   1 
ATOM   263  O O   . ILE A 1 35  ? 34.873  11.553  34.846  1.00   41.74  ? 35   ILE A O   1 
ATOM   264  C CB  . ILE A 1 35  ? 33.030  11.246  37.053  1.00   39.67  ? 35   ILE A CB  1 
ATOM   265  C CG1 . ILE A 1 35  ? 31.809  11.687  37.856  1.00   36.51  ? 35   ILE A CG1 1 
ATOM   266  C CG2 . ILE A 1 35  ? 33.718  10.051  37.682  1.00   36.86  ? 35   ILE A CG2 1 
ATOM   267  C CD1 . ILE A 1 35  ? 30.669  10.689  37.831  1.00   36.88  ? 35   ILE A CD1 1 
ATOM   268  N N   . PRO A 1 36  ? 36.375  11.918  36.480  1.00   45.66  ? 36   PRO A N   1 
ATOM   269  C CA  . PRO A 1 36  ? 37.504  11.482  35.647  1.00   42.06  ? 36   PRO A CA  1 
ATOM   270  C C   . PRO A 1 36  ? 37.394  9.988   35.382  1.00   40.89  ? 36   PRO A C   1 
ATOM   271  O O   . PRO A 1 36  ? 37.023  9.268   36.297  1.00   44.34  ? 36   PRO A O   1 
ATOM   272  C CB  . PRO A 1 36  ? 38.729  11.736  36.545  1.00   45.35  ? 36   PRO A CB  1 
ATOM   273  C CG  . PRO A 1 36  ? 38.196  12.311  37.866  1.00   38.90  ? 36   PRO A CG  1 
ATOM   274  C CD  . PRO A 1 36  ? 36.735  12.052  37.905  1.00   42.34  ? 36   PRO A CD  1 
ATOM   275  N N   . PHE A 1 37  ? 37.692  9.525   34.172  1.00   44.03  ? 37   PHE A N   1 
ATOM   276  C CA  . PHE A 1 37  ? 37.644  8.091   33.892  1.00   36.31  ? 37   PHE A CA  1 
ATOM   277  C C   . PHE A 1 37  ? 38.944  7.570   33.296  1.00   38.68  ? 37   PHE A C   1 
ATOM   278  O O   . PHE A 1 37  ? 39.103  6.374   33.074  1.00   45.28  ? 37   PHE A O   1 
ATOM   279  C CB  . PHE A 1 37  ? 36.434  7.717   33.017  1.00   38.50  ? 37   PHE A CB  1 
ATOM   280  C CG  . PHE A 1 37  ? 36.491  8.254   31.605  1.00   38.07  ? 37   PHE A CG  1 
ATOM   281  C CD1 . PHE A 1 37  ? 35.971  9.512   31.299  1.00   39.06  ? 37   PHE A CD1 1 
ATOM   282  C CD2 . PHE A 1 37  ? 37.023  7.487   30.577  1.00   32.79  ? 37   PHE A CD2 1 
ATOM   283  C CE1 . PHE A 1 37  ? 36.014  10.004  29.998  1.00   39.80  ? 37   PHE A CE1 1 
ATOM   284  C CE2 . PHE A 1 37  ? 37.075  7.978   29.273  1.00   39.29  ? 37   PHE A CE2 1 
ATOM   285  C CZ  . PHE A 1 37  ? 36.572  9.235   28.979  1.00   33.00  ? 37   PHE A CZ  1 
ATOM   286  N N   . ALA A 1 38  ? 39.879  8.479   33.058  1.00   40.87  ? 38   ALA A N   1 
ATOM   287  C CA  . ALA A 1 38  ? 41.161  8.145   32.458  1.00   38.36  ? 38   ALA A CA  1 
ATOM   288  C C   . ALA A 1 38  ? 42.226  9.041   33.054  1.00   42.58  ? 38   ALA A C   1 
ATOM   289  O O   . ALA A 1 38  ? 41.924  10.129  33.561  1.00   41.68  ? 38   ALA A O   1 
ATOM   290  C CB  . ALA A 1 38  ? 41.105  8.353   30.950  1.00   38.41  ? 38   ALA A CB  1 
ATOM   291  N N   . GLU A 1 39  ? 43.471  8.586   33.001  1.00   42.77  ? 39   GLU A N   1 
ATOM   292  C CA  . GLU A 1 39  ? 44.588  9.470   33.275  1.00   46.16  ? 39   GLU A CA  1 
ATOM   293  C C   . GLU A 1 39  ? 44.600  10.536  32.185  1.00   43.05  ? 39   GLU A C   1 
ATOM   294  O O   . GLU A 1 39  ? 44.398  10.233  31.011  1.00   43.64  ? 39   GLU A O   1 
ATOM   295  C CB  . GLU A 1 39  ? 45.903  8.692   33.269  1.00   45.71  ? 39   GLU A CB  1 
ATOM   296  C CG  . GLU A 1 39  ? 46.139  7.868   34.523  1.00   53.51  ? 39   GLU A CG  1 
ATOM   297  C CD  . GLU A 1 39  ? 46.235  8.718   35.772  1.00   49.44  ? 39   GLU A CD  1 
ATOM   298  O OE1 . GLU A 1 39  ? 47.158  9.553   35.865  1.00   60.91  ? 39   GLU A OE1 1 
ATOM   299  O OE2 . GLU A 1 39  ? 45.391  8.549   36.669  1.00   49.17  ? 39   GLU A OE2 1 
ATOM   300  N N   . PRO A 1 40  ? 44.823  11.791  32.571  1.00   40.11  ? 40   PRO A N   1 
ATOM   301  C CA  . PRO A 1 40  ? 44.959  12.877  31.592  1.00   44.50  ? 40   PRO A CA  1 
ATOM   302  C C   . PRO A 1 40  ? 45.863  12.468  30.429  1.00   44.28  ? 40   PRO A C   1 
ATOM   303  O O   . PRO A 1 40  ? 47.001  12.089  30.662  1.00   44.60  ? 40   PRO A O   1 
ATOM   304  C CB  . PRO A 1 40  ? 45.629  13.988  32.405  1.00   40.75  ? 40   PRO A CB  1 
ATOM   305  C CG  . PRO A 1 40  ? 45.166  13.736  33.805  1.00   41.17  ? 40   PRO A CG  1 
ATOM   306  C CD  . PRO A 1 40  ? 45.119  12.234  33.942  1.00   41.59  ? 40   PRO A CD  1 
ATOM   307  N N   . PRO A 1 41  ? 45.357  12.538  29.191  1.00   44.36  ? 41   PRO A N   1 
ATOM   308  C CA  . PRO A 1 41  ? 46.144  12.150  28.016  1.00   44.20  ? 41   PRO A CA  1 
ATOM   309  C C   . PRO A 1 41  ? 47.095  13.269  27.606  1.00   42.93  ? 41   PRO A C   1 
ATOM   310  O O   . PRO A 1 41  ? 47.135  13.654  26.440  1.00   39.30  ? 41   PRO A O   1 
ATOM   311  C CB  . PRO A 1 41  ? 45.087  11.953  26.916  1.00   42.04  ? 41   PRO A CB  1 
ATOM   312  C CG  . PRO A 1 41  ? 43.777  12.433  27.487  1.00   44.20  ? 41   PRO A CG  1 
ATOM   313  C CD  . PRO A 1 41  ? 44.039  13.076  28.823  1.00   43.07  ? 41   PRO A CD  1 
ATOM   314  N N   . VAL A 1 42  ? 47.857  13.780  28.562  1.00   43.72  ? 42   VAL A N   1 
ATOM   315  C CA  . VAL A 1 42  ? 48.734  14.915  28.308  1.00   43.75  ? 42   VAL A CA  1 
ATOM   316  C C   . VAL A 1 42  ? 50.213  14.521  28.187  1.00   49.64  ? 42   VAL A C   1 
ATOM   317  O O   . VAL A 1 42  ? 50.603  13.391  28.498  1.00   46.59  ? 42   VAL A O   1 
ATOM   318  C CB  . VAL A 1 42  ? 48.593  15.971  29.412  1.00   44.45  ? 42   VAL A CB  1 
ATOM   319  C CG1 . VAL A 1 42  ? 47.124  16.353  29.596  1.00   42.76  ? 42   VAL A CG1 1 
ATOM   320  C CG2 . VAL A 1 42  ? 49.165  15.437  30.708  1.00   38.73  ? 42   VAL A CG2 1 
ATOM   321  N N   . GLY A 1 43  ? 51.025  15.470  27.724  1.00   45.48  ? 43   GLY A N   1 
ATOM   322  C CA  . GLY A 1 43  ? 52.454  15.275  27.605  1.00   44.86  ? 43   GLY A CA  1 
ATOM   323  C C   . GLY A 1 43  ? 52.791  14.050  26.787  1.00   49.81  ? 43   GLY A C   1 
ATOM   324  O O   . GLY A 1 43  ? 52.364  13.929  25.640  1.00   50.11  ? 43   GLY A O   1 
ATOM   325  N N   . SER A 1 44  ? 53.554  13.136  27.378  1.00   49.46  ? 44   SER A N   1 
ATOM   326  C CA  . SER A 1 44  ? 54.000  11.944  26.664  1.00   52.60  ? 44   SER A CA  1 
ATOM   327  C C   . SER A 1 44  ? 52.841  11.013  26.338  1.00   46.04  ? 44   SER A C   1 
ATOM   328  O O   . SER A 1 44  ? 53.019  10.038  25.630  1.00   43.66  ? 44   SER A O   1 
ATOM   329  C CB  . SER A 1 44  ? 55.060  11.190  27.467  1.00   50.92  ? 44   SER A CB  1 
ATOM   330  O OG  . SER A 1 44  ? 54.494  10.623  28.636  1.00   55.14  ? 44   SER A OG  1 
ATOM   331  N N   . ARG A 1 45  ? 51.653  11.317  26.852  1.00   49.95  ? 45   ARG A N   1 
ATOM   332  C CA  . ARG A 1 45  ? 50.482  10.486  26.582  1.00   45.61  ? 45   ARG A CA  1 
ATOM   333  C C   . ARG A 1 45  ? 49.661  10.975  25.384  1.00   43.48  ? 45   ARG A C   1 
ATOM   334  O O   . ARG A 1 45  ? 48.710  10.312  24.960  1.00   39.77  ? 45   ARG A O   1 
ATOM   335  C CB  . ARG A 1 45  ? 49.589  10.401  27.814  1.00   47.98  ? 45   ARG A CB  1 
ATOM   336  C CG  . ARG A 1 45  ? 50.220  9.729   29.019  1.00   52.45  ? 45   ARG A CG  1 
ATOM   337  C CD  . ARG A 1 45  ? 49.220  9.771   30.179  1.00   59.65  ? 45   ARG A CD  1 
ATOM   338  N NE  . ARG A 1 45  ? 49.705  9.144   31.406  1.00   72.48  ? 45   ARG A NE  1 
ATOM   339  C CZ  . ARG A 1 45  ? 49.601  7.846   31.675  1.00   75.45  ? 45   ARG A CZ  1 
ATOM   340  N NH1 . ARG A 1 45  ? 49.041  7.020   30.794  1.00   71.06  ? 45   ARG A NH1 1 
ATOM   341  N NH2 . ARG A 1 45  ? 50.067  7.375   32.823  1.00   79.65  ? 45   ARG A NH2 1 
ATOM   342  N N   . ARG A 1 46  ? 50.017  12.131  24.836  1.00   41.75  ? 46   ARG A N   1 
ATOM   343  C CA  . ARG A 1 46  ? 49.310  12.640  23.658  1.00   41.23  ? 46   ARG A CA  1 
ATOM   344  C C   . ARG A 1 46  ? 49.430  11.630  22.523  1.00   42.72  ? 46   ARG A C   1 
ATOM   345  O O   . ARG A 1 46  ? 50.526  11.141  22.253  1.00   43.66  ? 46   ARG A O   1 
ATOM   346  C CB  . ARG A 1 46  ? 49.862  14.007  23.238  1.00   42.15  ? 46   ARG A CB  1 
ATOM   347  C CG  . ARG A 1 46  ? 49.216  14.596  22.007  1.00   43.75  ? 46   ARG A CG  1 
ATOM   348  C CD  . ARG A 1 46  ? 49.989  15.788  21.475  1.00   38.62  ? 46   ARG A CD  1 
ATOM   349  N NE  . ARG A 1 46  ? 49.779  16.992  22.270  1.00   38.25  ? 46   ARG A NE  1 
ATOM   350  C CZ  . ARG A 1 46  ? 50.424  18.134  22.060  1.00   36.79  ? 46   ARG A CZ  1 
ATOM   351  N NH1 . ARG A 1 46  ? 51.315  18.215  21.084  1.00   37.78  ? 46   ARG A NH1 1 
ATOM   352  N NH2 . ARG A 1 46  ? 50.184  19.192  22.820  1.00   34.14  ? 46   ARG A NH2 1 
ATOM   353  N N   . PHE A 1 47  ? 48.295  11.309  21.892  1.00   42.98  ? 47   PHE A N   1 
ATOM   354  C CA  . PHE A 1 47  ? 48.195  10.351  20.775  1.00   39.47  ? 47   PHE A CA  1 
ATOM   355  C C   . PHE A 1 47  ? 48.091  8.908   21.250  1.00   40.02  ? 47   PHE A C   1 
ATOM   356  O O   . PHE A 1 47  ? 47.862  7.993   20.453  1.00   39.26  ? 47   PHE A O   1 
ATOM   357  C CB  . PHE A 1 47  ? 49.353  10.480  19.764  1.00   37.36  ? 47   PHE A CB  1 
ATOM   358  C CG  . PHE A 1 47  ? 49.595  11.885  19.283  1.00   41.40  ? 47   PHE A CG  1 
ATOM   359  C CD1 . PHE A 1 47  ? 48.575  12.623  18.704  1.00   42.15  ? 47   PHE A CD1 1 
ATOM   360  C CD2 . PHE A 1 47  ? 50.853  12.462  19.393  1.00   42.02  ? 47   PHE A CD2 1 
ATOM   361  C CE1 . PHE A 1 47  ? 48.798  13.910  18.260  1.00   39.25  ? 47   PHE A CE1 1 
ATOM   362  C CE2 . PHE A 1 47  ? 51.081  13.749  18.961  1.00   43.06  ? 47   PHE A CE2 1 
ATOM   363  C CZ  . PHE A 1 47  ? 50.051  14.477  18.397  1.00   43.84  ? 47   PHE A CZ  1 
ATOM   364  N N   . MET A 1 48  ? 48.254  8.708   22.550  1.00   40.98  ? 48   MET A N   1 
ATOM   365  C CA  . MET A 1 48  ? 48.271  7.365   23.122  1.00   41.73  ? 48   MET A CA  1 
ATOM   366  C C   . MET A 1 48  ? 46.896  6.917   23.578  1.00   42.66  ? 48   MET A C   1 
ATOM   367  O O   . MET A 1 48  ? 46.068  7.748   23.971  1.00   40.24  ? 48   MET A O   1 
ATOM   368  C CB  . MET A 1 48  ? 49.200  7.330   24.331  1.00   42.75  ? 48   MET A CB  1 
ATOM   369  C CG  . MET A 1 48  ? 50.641  7.674   24.025  1.00   52.02  ? 48   MET A CG  1 
ATOM   370  S SD  . MET A 1 48  ? 51.634  6.182   23.860  1.00   74.49  ? 48   MET A SD  1 
ATOM   371  C CE  . MET A 1 48  ? 51.073  5.610   22.267  1.00   48.85  ? 48   MET A CE  1 
ATOM   372  N N   . PRO A 1 49  ? 46.663  5.594   23.559  1.00   39.79  ? 49   PRO A N   1 
ATOM   373  C CA  . PRO A 1 49  ? 45.452  4.999   24.140  1.00   40.99  ? 49   PRO A CA  1 
ATOM   374  C C   . PRO A 1 49  ? 45.344  5.413   25.594  1.00   39.34  ? 49   PRO A C   1 
ATOM   375  O O   . PRO A 1 49  ? 46.364  5.543   26.274  1.00   41.27  ? 49   PRO A O   1 
ATOM   376  C CB  . PRO A 1 49  ? 45.704  3.486   24.040  1.00   36.78  ? 49   PRO A CB  1 
ATOM   377  C CG  . PRO A 1 49  ? 46.752  3.342   22.958  1.00   38.22  ? 49   PRO A CG  1 
ATOM   378  C CD  . PRO A 1 49  ? 47.600  4.578   23.045  1.00   40.11  ? 49   PRO A CD  1 
ATOM   379  N N   . PRO A 1 50  ? 44.118  5.638   26.068  1.00   37.03  ? 50   PRO A N   1 
ATOM   380  C CA  . PRO A 1 50  ? 43.895  6.116   27.430  1.00   41.41  ? 50   PRO A CA  1 
ATOM   381  C C   . PRO A 1 50  ? 44.214  5.013   28.420  1.00   42.47  ? 50   PRO A C   1 
ATOM   382  O O   . PRO A 1 50  ? 43.986  3.834   28.139  1.00   42.46  ? 50   PRO A O   1 
ATOM   383  C CB  . PRO A 1 50  ? 42.391  6.378   27.451  1.00   36.27  ? 50   PRO A CB  1 
ATOM   384  C CG  . PRO A 1 50  ? 41.863  5.367   26.498  1.00   33.86  ? 50   PRO A CG  1 
ATOM   385  C CD  . PRO A 1 50  ? 42.849  5.409   25.366  1.00   35.25  ? 50   PRO A CD  1 
ATOM   386  N N   . GLU A 1 51  ? 44.752  5.408   29.563  1.00   43.72  ? 51   GLU A N   1 
ATOM   387  C CA  . GLU A 1 51  ? 44.989  4.509   30.674  1.00   49.38  ? 51   GLU A CA  1 
ATOM   388  C C   . GLU A 1 51  ? 43.943  4.885   31.727  1.00   48.89  ? 51   GLU A C   1 
ATOM   389  O O   . GLU A 1 51  ? 43.663  6.066   31.908  1.00   50.67  ? 51   GLU A O   1 
ATOM   390  C CB  . GLU A 1 51  ? 46.413  4.732   31.178  1.00   54.94  ? 51   GLU A CB  1 
ATOM   391  C CG  . GLU A 1 51  ? 46.730  4.165   32.561  1.00   73.19  ? 51   GLU A CG  1 
ATOM   392  C CD  . GLU A 1 51  ? 48.147  4.526   33.035  1.00   90.21  ? 51   GLU A CD  1 
ATOM   393  O OE1 . GLU A 1 51  ? 49.025  4.771   32.167  1.00   88.37  ? 51   GLU A OE1 1 
ATOM   394  O OE2 . GLU A 1 51  ? 48.375  4.563   34.273  1.00   84.86  ? 51   GLU A OE2 1 
ATOM   395  N N   . PRO A 1 52  ? 43.340  3.893   32.406  1.00   47.83  ? 52   PRO A N   1 
ATOM   396  C CA  . PRO A 1 52  ? 42.298  4.175   33.413  1.00   47.78  ? 52   PRO A CA  1 
ATOM   397  C C   . PRO A 1 52  ? 42.751  5.125   34.525  1.00   45.82  ? 52   PRO A C   1 
ATOM   398  O O   . PRO A 1 52  ? 43.914  5.115   34.915  1.00   44.41  ? 52   PRO A O   1 
ATOM   399  C CB  . PRO A 1 52  ? 41.994  2.795   34.001  1.00   41.91  ? 52   PRO A CB  1 
ATOM   400  C CG  . PRO A 1 52  ? 42.343  1.846   32.902  1.00   53.10  ? 52   PRO A CG  1 
ATOM   401  C CD  . PRO A 1 52  ? 43.542  2.447   32.216  1.00   45.22  ? 52   PRO A CD  1 
ATOM   402  N N   . LYS A 1 53  ? 41.824  5.942   35.016  1.00   38.70  ? 53   LYS A N   1 
ATOM   403  C CA  . LYS A 1 53  ? 42.116  6.916   36.054  1.00   42.24  ? 53   LYS A CA  1 
ATOM   404  C C   . LYS A 1 53  ? 42.514  6.209   37.344  1.00   48.97  ? 53   LYS A C   1 
ATOM   405  O O   . LYS A 1 53  ? 41.844  5.273   37.784  1.00   47.55  ? 53   LYS A O   1 
ATOM   406  C CB  . LYS A 1 53  ? 40.889  7.805   36.293  1.00   40.64  ? 53   LYS A CB  1 
ATOM   407  C CG  . LYS A 1 53  ? 40.958  8.699   37.523  1.00   35.01  ? 53   LYS A CG  1 
ATOM   408  C CD  . LYS A 1 53  ? 42.020  9.752   37.354  1.00   40.67  ? 53   LYS A CD  1 
ATOM   409  C CE  . LYS A 1 53  ? 41.888  10.865  38.371  1.00   35.85  ? 53   LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 53  ? 43.094  11.723  38.271  1.00   47.74  ? 53   LYS A NZ  1 
ATOM   411  N N   . ARG A 1 54  ? 43.603  6.662   37.948  1.00   44.68  ? 54   ARG A N   1 
ATOM   412  C CA  . ARG A 1 54  ? 44.086  6.062   39.179  1.00   50.18  ? 54   ARG A CA  1 
ATOM   413  C C   . ARG A 1 54  ? 43.275  6.635   40.320  1.00   45.11  ? 54   ARG A C   1 
ATOM   414  O O   . ARG A 1 54  ? 42.940  7.815   40.290  1.00   44.15  ? 54   ARG A O   1 
ATOM   415  C CB  . ARG A 1 54  ? 45.580  6.336   39.361  1.00   51.51  ? 54   ARG A CB  1 
ATOM   416  C CG  . ARG A 1 54  ? 46.414  5.805   38.210  1.00   58.95  ? 54   ARG A CG  1 
ATOM   417  C CD  . ARG A 1 54  ? 47.875  5.708   38.581  1.00   66.73  ? 54   ARG A CD  1 
ATOM   418  N NE  . ARG A 1 54  ? 48.491  7.024   38.695  1.00   76.69  ? 54   ARG A NE  1 
ATOM   419  C CZ  . ARG A 1 54  ? 49.197  7.599   37.724  1.00   89.17  ? 54   ARG A CZ  1 
ATOM   420  N NH1 . ARG A 1 54  ? 49.377  6.968   36.562  1.00   78.24  ? 54   ARG A NH1 1 
ATOM   421  N NH2 . ARG A 1 54  ? 49.729  8.804   37.916  1.00   84.93  ? 54   ARG A NH2 1 
ATOM   422  N N   . PRO A 1 55  ? 42.927  5.797   41.315  1.00   46.69  ? 55   PRO A N   1 
ATOM   423  C CA  . PRO A 1 55  ? 42.047  6.254   42.400  1.00   46.10  ? 55   PRO A CA  1 
ATOM   424  C C   . PRO A 1 55  ? 42.569  7.513   43.074  1.00   45.98  ? 55   PRO A C   1 
ATOM   425  O O   . PRO A 1 55  ? 43.783  7.750   43.112  1.00   46.40  ? 55   PRO A O   1 
ATOM   426  C CB  . PRO A 1 55  ? 42.050  5.074   43.379  1.00   43.23  ? 55   PRO A CB  1 
ATOM   427  C CG  . PRO A 1 55  ? 42.307  3.888   42.523  1.00   46.97  ? 55   PRO A CG  1 
ATOM   428  C CD  . PRO A 1 55  ? 43.246  4.364   41.431  1.00   46.61  ? 55   PRO A CD  1 
ATOM   429  N N   . TRP A 1 56  ? 41.651  8.320   43.590  1.00   43.46  ? 56   TRP A N   1 
ATOM   430  C CA  . TRP A 1 56  ? 42.010  9.561   44.264  1.00   47.07  ? 56   TRP A CA  1 
ATOM   431  C C   . TRP A 1 56  ? 41.665  9.449   45.743  1.00   55.00  ? 56   TRP A C   1 
ATOM   432  O O   . TRP A 1 56  ? 40.989  8.503   46.165  1.00   53.66  ? 56   TRP A O   1 
ATOM   433  C CB  . TRP A 1 56  ? 41.243  10.737  43.650  1.00   48.04  ? 56   TRP A CB  1 
ATOM   434  C CG  . TRP A 1 56  ? 39.767  10.523  43.669  1.00   48.02  ? 56   TRP A CG  1 
ATOM   435  C CD1 . TRP A 1 56  ? 38.901  10.849  44.672  1.00   48.29  ? 56   TRP A CD1 1 
ATOM   436  C CD2 . TRP A 1 56  ? 38.979  9.914   42.641  1.00   46.45  ? 56   TRP A CD2 1 
ATOM   437  N NE1 . TRP A 1 56  ? 37.621  10.486  44.330  1.00   47.22  ? 56   TRP A NE1 1 
ATOM   438  C CE2 . TRP A 1 56  ? 37.644  9.908   43.086  1.00   46.48  ? 56   TRP A CE2 1 
ATOM   439  C CE3 . TRP A 1 56  ? 39.272  9.378   41.385  1.00   44.36  ? 56   TRP A CE3 1 
ATOM   440  C CZ2 . TRP A 1 56  ? 36.608  9.386   42.320  1.00   44.64  ? 56   TRP A CZ2 1 
ATOM   441  C CZ3 . TRP A 1 56  ? 38.241  8.852   40.629  1.00   43.05  ? 56   TRP A CZ3 1 
ATOM   442  C CH2 . TRP A 1 56  ? 36.928  8.861   41.096  1.00   42.65  ? 56   TRP A CH2 1 
ATOM   443  N N   . SER A 1 57  ? 42.104  10.421  46.536  1.00   56.03  ? 57   SER A N   1 
ATOM   444  C CA  . SER A 1 57  ? 41.740  10.421  47.947  1.00   58.19  ? 57   SER A CA  1 
ATOM   445  C C   . SER A 1 57  ? 40.793  11.563  48.238  1.00   51.41  ? 57   SER A C   1 
ATOM   446  O O   . SER A 1 57  ? 40.881  12.626  47.630  1.00   59.64  ? 57   SER A O   1 
ATOM   447  C CB  . SER A 1 57  ? 42.976  10.512  48.845  1.00   58.59  ? 57   SER A CB  1 
ATOM   448  O OG  . SER A 1 57  ? 43.525  11.816  48.814  1.00   66.90  ? 57   SER A OG  1 
ATOM   449  N N   . GLY A 1 58  ? 39.888  11.334  49.176  1.00   50.46  ? 58   GLY A N   1 
ATOM   450  C CA  . GLY A 1 58  ? 38.959  12.360  49.589  1.00   52.26  ? 58   GLY A CA  1 
ATOM   451  C C   . GLY A 1 58  ? 37.712  12.316  48.739  1.00   49.90  ? 58   GLY A C   1 
ATOM   452  O O   . GLY A 1 58  ? 37.520  11.405  47.928  1.00   46.31  ? 58   GLY A O   1 
ATOM   453  N N   . VAL A 1 59  ? 36.858  13.308  48.926  1.00   44.05  ? 59   VAL A N   1 
ATOM   454  C CA  . VAL A 1 59  ? 35.635  13.392  48.150  1.00   49.13  ? 59   VAL A CA  1 
ATOM   455  C C   . VAL A 1 59  ? 35.886  14.272  46.936  1.00   52.26  ? 59   VAL A C   1 
ATOM   456  O O   . VAL A 1 59  ? 36.088  15.487  47.059  1.00   52.86  ? 59   VAL A O   1 
ATOM   457  C CB  . VAL A 1 59  ? 34.481  13.971  48.986  1.00   49.06  ? 59   VAL A CB  1 
ATOM   458  C CG1 . VAL A 1 59  ? 33.197  13.947  48.193  1.00   43.15  ? 59   VAL A CG1 1 
ATOM   459  C CG2 . VAL A 1 59  ? 34.340  13.195  50.284  1.00   41.72  ? 59   VAL A CG2 1 
ATOM   460  N N   . LEU A 1 60  ? 35.909  13.649  45.765  1.00   45.44  ? 60   LEU A N   1 
ATOM   461  C CA  . LEU A 1 60  ? 36.011  14.398  44.532  1.00   48.97  ? 60   LEU A CA  1 
ATOM   462  C C   . LEU A 1 60  ? 34.726  15.189  44.348  1.00   47.14  ? 60   LEU A C   1 
ATOM   463  O O   . LEU A 1 60  ? 33.619  14.641  44.436  1.00   50.48  ? 60   LEU A O   1 
ATOM   464  C CB  . LEU A 1 60  ? 36.261  13.476  43.339  1.00   48.82  ? 60   LEU A CB  1 
ATOM   465  C CG  . LEU A 1 60  ? 36.535  14.209  42.021  1.00   50.54  ? 60   LEU A CG  1 
ATOM   466  C CD1 . LEU A 1 60  ? 37.677  13.559  41.244  1.00   45.95  ? 60   LEU A CD1 1 
ATOM   467  C CD2 . LEU A 1 60  ? 35.267  14.289  41.176  1.00   49.48  ? 60   LEU A CD2 1 
ATOM   468  N N   . ASP A 1 61  ? 34.864  16.485  44.122  1.00   40.86  ? 61   ASP A N   1 
ATOM   469  C CA  . ASP A 1 61  ? 33.689  17.281  43.853  1.00   46.80  ? 61   ASP A CA  1 
ATOM   470  C C   . ASP A 1 61  ? 33.248  17.110  42.397  1.00   42.89  ? 61   ASP A C   1 
ATOM   471  O O   . ASP A 1 61  ? 34.011  17.376  41.467  1.00   39.24  ? 61   ASP A O   1 
ATOM   472  C CB  . ASP A 1 61  ? 33.920  18.747  44.196  1.00   42.88  ? 61   ASP A CB  1 
ATOM   473  C CG  . ASP A 1 61  ? 32.735  19.604  43.825  1.00   56.51  ? 61   ASP A CG  1 
ATOM   474  O OD1 . ASP A 1 61  ? 32.623  19.941  42.625  1.00   53.80  ? 61   ASP A OD1 1 
ATOM   475  O OD2 . ASP A 1 61  ? 31.906  19.913  44.719  1.00   56.29  ? 61   ASP A OD2 1 
ATOM   476  N N   . ALA A 1 62  ? 32.008  16.660  42.223  1.00   44.27  ? 62   ALA A N   1 
ATOM   477  C CA  . ALA A 1 62  ? 31.456  16.333  40.915  1.00   39.56  ? 62   ALA A CA  1 
ATOM   478  C C   . ALA A 1 62  ? 30.216  17.172  40.637  1.00   46.40  ? 62   ALA A C   1 
ATOM   479  O O   . ALA A 1 62  ? 29.152  16.629  40.286  1.00   38.02  ? 62   ALA A O   1 
ATOM   480  C CB  . ALA A 1 62  ? 31.106  14.865  40.861  1.00   35.11  ? 62   ALA A CB  1 
ATOM   481  N N   . THR A 1 63  ? 30.353  18.490  40.799  1.00   40.76  ? 63   THR A N   1 
ATOM   482  C CA  . THR A 1 63  ? 29.211  19.406  40.704  1.00   42.25  ? 63   THR A CA  1 
ATOM   483  C C   . THR A 1 63  ? 29.278  20.378  39.515  1.00   43.42  ? 63   THR A C   1 
ATOM   484  O O   . THR A 1 63  ? 28.386  21.207  39.331  1.00   42.92  ? 63   THR A O   1 
ATOM   485  C CB  . THR A 1 63  ? 29.055  20.230  42.003  1.00   46.75  ? 63   THR A CB  1 
ATOM   486  O OG1 . THR A 1 63  ? 30.170  21.122  42.139  1.00   39.72  ? 63   THR A OG1 1 
ATOM   487  C CG2 . THR A 1 63  ? 28.976  19.309  43.230  1.00   40.11  ? 63   THR A CG2 1 
ATOM   488  N N   . THR A 1 64  ? 30.339  20.287  38.720  1.00   40.06  ? 64   THR A N   1 
ATOM   489  C CA  . THR A 1 64  ? 30.471  21.118  37.536  1.00   43.20  ? 64   THR A CA  1 
ATOM   490  C C   . THR A 1 64  ? 31.133  20.380  36.392  1.00   40.58  ? 64   THR A C   1 
ATOM   491  O O   . THR A 1 64  ? 32.002  19.538  36.591  1.00   46.08  ? 64   THR A O   1 
ATOM   492  C CB  . THR A 1 64  ? 31.309  22.385  37.801  1.00   44.60  ? 64   THR A CB  1 
ATOM   493  O OG1 . THR A 1 64  ? 32.683  22.015  37.987  1.00   47.65  ? 64   THR A OG1 1 
ATOM   494  C CG2 . THR A 1 64  ? 30.807  23.100  39.035  1.00   43.25  ? 64   THR A CG2 1 
ATOM   495  N N   . PHE A 1 65  ? 30.731  20.731  35.183  1.00   41.34  ? 65   PHE A N   1 
ATOM   496  C CA  . PHE A 1 65  ? 31.363  20.193  33.995  1.00   43.73  ? 65   PHE A CA  1 
ATOM   497  C C   . PHE A 1 65  ? 32.862  20.462  33.984  1.00   41.57  ? 65   PHE A C   1 
ATOM   498  O O   . PHE A 1 65  ? 33.326  21.522  34.392  1.00   43.76  ? 65   PHE A O   1 
ATOM   499  C CB  . PHE A 1 65  ? 30.733  20.787  32.746  1.00   34.06  ? 65   PHE A CB  1 
ATOM   500  C CG  . PHE A 1 65  ? 29.328  20.319  32.490  1.00   34.63  ? 65   PHE A CG  1 
ATOM   501  C CD1 . PHE A 1 65  ? 29.060  18.977  32.260  1.00   31.81  ? 65   PHE A CD1 1 
ATOM   502  C CD2 . PHE A 1 65  ? 28.277  21.230  32.436  1.00   34.25  ? 65   PHE A CD2 1 
ATOM   503  C CE1 . PHE A 1 65  ? 27.760  18.543  31.997  1.00   37.22  ? 65   PHE A CE1 1 
ATOM   504  C CE2 . PHE A 1 65  ? 26.977  20.813  32.166  1.00   37.97  ? 65   PHE A CE2 1 
ATOM   505  C CZ  . PHE A 1 65  ? 26.715  19.462  31.952  1.00   36.13  ? 65   PHE A CZ  1 
ATOM   506  N N   . GLN A 1 66  ? 33.602  19.484  33.491  1.00   37.05  ? 66   GLN A N   1 
ATOM   507  C CA  . GLN A 1 66  ? 35.037  19.581  33.340  1.00   35.94  ? 66   GLN A CA  1 
ATOM   508  C C   . GLN A 1 66  ? 35.464  20.107  31.960  1.00   41.78  ? 66   GLN A C   1 
ATOM   509  O O   . GLN A 1 66  ? 34.626  20.360  31.096  1.00   35.05  ? 66   GLN A O   1 
ATOM   510  C CB  . GLN A 1 66  ? 35.655  18.216  33.613  1.00   35.95  ? 66   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 66  ? 36.088  18.059  35.044  1.00   38.52  ? 66   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 66  ? 37.355  18.852  35.343  1.00   48.67  ? 66   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 66  ? 37.819  19.656  34.520  1.00   43.43  ? 66   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 66  ? 37.933  18.613  36.518  1.00   45.79  ? 66   GLN A NE2 1 
ATOM   515  N N   . ASN A 1 67  ? 36.771  20.280  31.771  1.00   40.88  ? 67   ASN A N   1 
ATOM   516  C CA  . ASN A 1 67  ? 37.308  20.832  30.530  1.00   37.12  ? 67   ASN A CA  1 
ATOM   517  C C   . ASN A 1 67  ? 36.732  20.165  29.291  1.00   36.94  ? 67   ASN A C   1 
ATOM   518  O O   . ASN A 1 67  ? 36.378  18.998  29.307  1.00   37.78  ? 67   ASN A O   1 
ATOM   519  C CB  . ASN A 1 67  ? 38.832  20.695  30.490  1.00   38.66  ? 67   ASN A CB  1 
ATOM   520  C CG  . ASN A 1 67  ? 39.512  21.386  31.652  1.00   37.60  ? 67   ASN A CG  1 
ATOM   521  O OD1 . ASN A 1 67  ? 39.107  22.466  32.078  1.00   39.10  ? 67   ASN A OD1 1 
ATOM   522  N ND2 . ASN A 1 67  ? 40.557  20.763  32.167  1.00   43.60  ? 67   ASN A ND2 1 
ATOM   523  N N   . VAL A 1 68  ? 36.647  20.930  28.217  1.00   34.98  ? 68   VAL A N   1 
ATOM   524  C CA  . VAL A 1 68  ? 36.335  20.405  26.907  1.00   32.95  ? 68   VAL A CA  1 
ATOM   525  C C   . VAL A 1 68  ? 37.633  19.984  26.212  1.00   34.63  ? 68   VAL A C   1 
ATOM   526  O O   . VAL A 1 68  ? 38.666  20.645  26.350  1.00   36.81  ? 68   VAL A O   1 
ATOM   527  C CB  . VAL A 1 68  ? 35.616  21.487  26.091  1.00   39.60  ? 68   VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 68  ? 35.522  21.094  24.617  1.00   31.00  ? 68   VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 68  ? 34.236  21.768  26.710  1.00   26.70  ? 68   VAL A CG2 1 
ATOM   530  N N   . CYS A 1 69  ? 37.596  18.875  25.483  1.00   33.92  ? 69   CYS A N   1 
ATOM   531  C CA  . CYS A 1 69  ? 38.799  18.399  24.812  1.00   33.31  ? 69   CYS A CA  1 
ATOM   532  C C   . CYS A 1 69  ? 39.288  19.431  23.801  1.00   41.71  ? 69   CYS A C   1 
ATOM   533  O O   . CYS A 1 69  ? 38.484  20.067  23.094  1.00   34.97  ? 69   CYS A O   1 
ATOM   534  C CB  . CYS A 1 69  ? 38.557  17.055  24.137  1.00   32.16  ? 69   CYS A CB  1 
ATOM   535  S SG  . CYS A 1 69  ? 38.354  15.681  25.297  1.00   42.72  ? 69   CYS A SG  1 
ATOM   536  N N   . TYR A 1 70  ? 40.605  19.594  23.732  1.00   37.90  ? 70   TYR A N   1 
ATOM   537  C CA  . TYR A 1 70  ? 41.185  20.609  22.865  1.00   36.18  ? 70   TYR A CA  1 
ATOM   538  C C   . TYR A 1 70  ? 40.697  20.485  21.420  1.00   39.32  ? 70   TYR A C   1 
ATOM   539  O O   . TYR A 1 70  ? 40.778  19.413  20.812  1.00   34.75  ? 70   TYR A O   1 
ATOM   540  C CB  . TYR A 1 70  ? 42.712  20.589  22.925  1.00   40.29  ? 70   TYR A CB  1 
ATOM   541  C CG  . TYR A 1 70  ? 43.246  21.987  22.895  1.00   42.04  ? 70   TYR A CG  1 
ATOM   542  C CD1 . TYR A 1 70  ? 43.353  22.671  21.699  1.00   42.06  ? 70   TYR A CD1 1 
ATOM   543  C CD2 . TYR A 1 70  ? 43.577  22.654  24.071  1.00   39.74  ? 70   TYR A CD2 1 
ATOM   544  C CE1 . TYR A 1 70  ? 43.812  23.966  21.659  1.00   44.49  ? 70   TYR A CE1 1 
ATOM   545  C CE2 . TYR A 1 70  ? 44.038  23.951  24.043  1.00   36.97  ? 70   TYR A CE2 1 
ATOM   546  C CZ  . TYR A 1 70  ? 44.149  24.602  22.831  1.00   45.32  ? 70   TYR A CZ  1 
ATOM   547  O OH  . TYR A 1 70  ? 44.589  25.901  22.775  1.00   51.83  ? 70   TYR A OH  1 
ATOM   548  N N   . GLN A 1 71  ? 40.183  21.587  20.876  1.00   36.55  ? 71   GLN A N   1 
ATOM   549  C CA  . GLN A 1 71  ? 39.568  21.544  19.558  1.00   31.38  ? 71   GLN A CA  1 
ATOM   550  C C   . GLN A 1 71  ? 39.489  22.886  18.851  1.00   35.62  ? 71   GLN A C   1 
ATOM   551  O O   . GLN A 1 71  ? 39.599  23.941  19.467  1.00   34.53  ? 71   GLN A O   1 
ATOM   552  C CB  . GLN A 1 71  ? 38.147  20.974  19.659  1.00   35.88  ? 71   GLN A CB  1 
ATOM   553  C CG  . GLN A 1 71  ? 37.192  21.860  20.453  1.00   27.85  ? 71   GLN A CG  1 
ATOM   554  C CD  . GLN A 1 71  ? 35.894  21.157  20.778  1.00   37.00  ? 71   GLN A CD  1 
ATOM   555  O OE1 . GLN A 1 71  ? 34.839  21.500  20.247  1.00   32.04  ? 71   GLN A OE1 1 
ATOM   556  N NE2 . GLN A 1 71  ? 35.970  20.142  21.631  1.00   36.99  ? 71   GLN A NE2 1 
ATOM   557  N N   . TYR A 1 72  ? 39.274  22.802  17.541  1.00   37.49  ? 72   TYR A N   1 
ATOM   558  C CA  . TYR A 1 72  ? 38.925  23.925  16.699  1.00   43.61  ? 72   TYR A CA  1 
ATOM   559  C C   . TYR A 1 72  ? 37.654  24.614  17.197  1.00   42.01  ? 72   TYR A C   1 
ATOM   560  O O   . TYR A 1 72  ? 36.686  23.952  17.565  1.00   40.28  ? 72   TYR A O   1 
ATOM   561  C CB  . TYR A 1 72  ? 38.720  23.427  15.266  1.00   42.87  ? 72   TYR A CB  1 
ATOM   562  C CG  . TYR A 1 72  ? 38.347  24.514  14.286  1.00   46.49  ? 72   TYR A CG  1 
ATOM   563  C CD1 . TYR A 1 72  ? 39.305  25.413  13.819  1.00   48.85  ? 72   TYR A CD1 1 
ATOM   564  C CD2 . TYR A 1 72  ? 37.037  24.645  13.825  1.00   48.79  ? 72   TYR A CD2 1 
ATOM   565  C CE1 . TYR A 1 72  ? 38.971  26.409  12.922  1.00   47.91  ? 72   TYR A CE1 1 
ATOM   566  C CE2 . TYR A 1 72  ? 36.690  25.638  12.924  1.00   48.00  ? 72   TYR A CE2 1 
ATOM   567  C CZ  . TYR A 1 72  ? 37.662  26.517  12.475  1.00   57.00  ? 72   TYR A CZ  1 
ATOM   568  O OH  . TYR A 1 72  ? 37.327  27.516  11.584  1.00   63.15  ? 72   TYR A OH  1 
ATOM   569  N N   . VAL A 1 73  ? 37.674  25.943  17.208  1.00   38.60  ? 73   VAL A N   1 
ATOM   570  C CA  . VAL A 1 73  ? 36.542  26.746  17.646  1.00   43.37  ? 73   VAL A CA  1 
ATOM   571  C C   . VAL A 1 73  ? 35.961  27.497  16.441  1.00   48.34  ? 73   VAL A C   1 
ATOM   572  O O   . VAL A 1 73  ? 36.676  28.189  15.726  1.00   47.23  ? 73   VAL A O   1 
ATOM   573  C CB  . VAL A 1 73  ? 36.969  27.722  18.771  1.00   42.13  ? 73   VAL A CB  1 
ATOM   574  C CG1 . VAL A 1 73  ? 35.897  28.755  19.060  1.00   37.85  ? 73   VAL A CG1 1 
ATOM   575  C CG2 . VAL A 1 73  ? 37.306  26.952  20.035  1.00   42.57  ? 73   VAL A CG2 1 
ATOM   576  N N   . ASP A 1 74  ? 34.662  27.345  16.211  1.00   54.31  ? 74   ASP A N   1 
ATOM   577  C CA  . ASP A 1 74  ? 34.040  27.854  14.986  1.00   48.82  ? 74   ASP A CA  1 
ATOM   578  C C   . ASP A 1 74  ? 33.927  29.379  14.943  1.00   50.52  ? 74   ASP A C   1 
ATOM   579  O O   . ASP A 1 74  ? 33.627  30.024  15.952  1.00   53.88  ? 74   ASP A O   1 
ATOM   580  C CB  . ASP A 1 74  ? 32.668  27.222  14.782  1.00   47.35  ? 74   ASP A CB  1 
ATOM   581  C CG  . ASP A 1 74  ? 32.106  27.489  13.401  1.00   56.70  ? 74   ASP A CG  1 
ATOM   582  O OD1 . ASP A 1 74  ? 31.489  28.561  13.203  1.00   55.83  ? 74   ASP A OD1 1 
ATOM   583  O OD2 . ASP A 1 74  ? 32.296  26.630  12.514  1.00   59.50  ? 74   ASP A OD2 1 
ATOM   584  N N   . THR A 1 75  ? 34.143  29.944  13.757  1.00   51.61  ? 75   THR A N   1 
ATOM   585  C CA  . THR A 1 75  ? 34.218  31.396  13.585  1.00   60.29  ? 75   THR A CA  1 
ATOM   586  C C   . THR A 1 75  ? 33.388  31.925  12.413  1.00   56.44  ? 75   THR A C   1 
ATOM   587  O O   . THR A 1 75  ? 33.412  33.120  12.129  1.00   58.25  ? 75   THR A O   1 
ATOM   588  C CB  . THR A 1 75  ? 35.670  31.844  13.326  1.00   56.04  ? 75   THR A CB  1 
ATOM   589  O OG1 . THR A 1 75  ? 36.207  31.072  12.246  1.00   55.22  ? 75   THR A OG1 1 
ATOM   590  C CG2 . THR A 1 75  ? 36.528  31.660  14.563  1.00   47.46  ? 75   THR A CG2 1 
ATOM   591  N N   . LEU A 1 76  ? 32.664  31.044  11.731  1.00   54.34  ? 76   LEU A N   1 
ATOM   592  C CA  . LEU A 1 76  ? 31.931  31.441  10.535  1.00   53.61  ? 76   LEU A CA  1 
ATOM   593  C C   . LEU A 1 76  ? 30.962  32.598  10.800  1.00   55.61  ? 76   LEU A C   1 
ATOM   594  O O   . LEU A 1 76  ? 30.885  33.535  10.016  1.00   56.30  ? 76   LEU A O   1 
ATOM   595  C CB  . LEU A 1 76  ? 31.183  30.253  9.924   1.00   53.31  ? 76   LEU A CB  1 
ATOM   596  C CG  . LEU A 1 76  ? 30.714  30.555  8.498   1.00   56.33  ? 76   LEU A CG  1 
ATOM   597  C CD1 . LEU A 1 76  ? 31.902  31.054  7.683   1.00   53.35  ? 76   LEU A CD1 1 
ATOM   598  C CD2 . LEU A 1 76  ? 30.056  29.348  7.833   1.00   50.72  ? 76   LEU A CD2 1 
ATOM   599  N N   . TYR A 1 77  ? 30.220  32.528  11.898  1.00   51.46  ? 77   TYR A N   1 
ATOM   600  C CA  . TYR A 1 77  ? 29.265  33.578  12.236  1.00   52.56  ? 77   TYR A CA  1 
ATOM   601  C C   . TYR A 1 77  ? 29.365  33.948  13.704  1.00   52.99  ? 77   TYR A C   1 
ATOM   602  O O   . TYR A 1 77  ? 28.523  33.561  14.514  1.00   56.16  ? 77   TYR A O   1 
ATOM   603  C CB  . TYR A 1 77  ? 27.843  33.132  11.936  1.00   45.41  ? 77   TYR A CB  1 
ATOM   604  C CG  . TYR A 1 77  ? 27.585  32.845  10.486  1.00   49.15  ? 77   TYR A CG  1 
ATOM   605  C CD1 . TYR A 1 77  ? 27.433  33.877  9.579   1.00   46.77  ? 77   TYR A CD1 1 
ATOM   606  C CD2 . TYR A 1 77  ? 27.476  31.540  10.023  1.00   45.10  ? 77   TYR A CD2 1 
ATOM   607  C CE1 . TYR A 1 77  ? 27.181  33.626  8.248   1.00   48.72  ? 77   TYR A CE1 1 
ATOM   608  C CE2 . TYR A 1 77  ? 27.223  31.275  8.690   1.00   46.25  ? 77   TYR A CE2 1 
ATOM   609  C CZ  . TYR A 1 77  ? 27.072  32.326  7.803   1.00   50.88  ? 77   TYR A CZ  1 
ATOM   610  O OH  . TYR A 1 77  ? 26.821  32.091  6.461   1.00   49.27  ? 77   TYR A OH  1 
ATOM   611  N N   . PRO A 1 78  ? 30.395  34.717  14.049  1.00   61.88  ? 78   PRO A N   1 
ATOM   612  C CA  . PRO A 1 78  ? 30.670  35.126  15.434  1.00   63.15  ? 78   PRO A CA  1 
ATOM   613  C C   . PRO A 1 78  ? 29.471  35.792  16.119  1.00   63.33  ? 78   PRO A C   1 
ATOM   614  O O   . PRO A 1 78  ? 29.006  36.828  15.652  1.00   63.30  ? 78   PRO A O   1 
ATOM   615  C CB  . PRO A 1 78  ? 31.813  36.129  15.273  1.00   58.01  ? 78   PRO A CB  1 
ATOM   616  C CG  . PRO A 1 78  ? 32.492  35.720  13.990  1.00   61.69  ? 78   PRO A CG  1 
ATOM   617  C CD  . PRO A 1 78  ? 31.386  35.247  13.094  1.00   57.51  ? 78   PRO A CD  1 
ATOM   618  N N   . GLY A 1 79  ? 28.986  35.201  17.211  1.00   64.45  ? 79   GLY A N   1 
ATOM   619  C CA  . GLY A 1 79  ? 27.916  35.799  18.000  1.00   59.78  ? 79   GLY A CA  1 
ATOM   620  C C   . GLY A 1 79  ? 26.558  35.172  17.746  1.00   62.13  ? 79   GLY A C   1 
ATOM   621  O O   . GLY A 1 79  ? 25.619  35.335  18.533  1.00   48.81  ? 79   GLY A O   1 
ATOM   622  N N   . PHE A 1 80  ? 26.476  34.436  16.639  1.00   57.72  ? 80   PHE A N   1 
ATOM   623  C CA  . PHE A 1 80  ? 25.243  33.830  16.155  1.00   45.67  ? 80   PHE A CA  1 
ATOM   624  C C   . PHE A 1 80  ? 24.972  32.521  16.895  1.00   49.23  ? 80   PHE A C   1 
ATOM   625  O O   . PHE A 1 80  ? 25.818  31.626  16.915  1.00   50.29  ? 80   PHE A O   1 
ATOM   626  C CB  . PHE A 1 80  ? 25.414  33.595  14.655  1.00   46.97  ? 80   PHE A CB  1 
ATOM   627  C CG  . PHE A 1 80  ? 24.348  32.759  14.023  1.00   46.99  ? 80   PHE A CG  1 
ATOM   628  C CD1 . PHE A 1 80  ? 23.029  33.184  13.995  1.00   41.77  ? 80   PHE A CD1 1 
ATOM   629  C CD2 . PHE A 1 80  ? 24.678  31.562  13.404  1.00   48.72  ? 80   PHE A CD2 1 
ATOM   630  C CE1 . PHE A 1 80  ? 22.054  32.419  13.387  1.00   43.19  ? 80   PHE A CE1 1 
ATOM   631  C CE2 . PHE A 1 80  ? 23.707  30.786  12.793  1.00   42.82  ? 80   PHE A CE2 1 
ATOM   632  C CZ  . PHE A 1 80  ? 22.395  31.218  12.778  1.00   43.98  ? 80   PHE A CZ  1 
ATOM   633  N N   . GLU A 1 81  ? 23.800  32.404  17.510  1.00   42.93  ? 81   GLU A N   1 
ATOM   634  C CA  . GLU A 1 81  ? 23.506  31.237  18.346  1.00   47.21  ? 81   GLU A CA  1 
ATOM   635  C C   . GLU A 1 81  ? 23.516  29.921  17.567  1.00   46.49  ? 81   GLU A C   1 
ATOM   636  O O   . GLU A 1 81  ? 23.810  28.866  18.124  1.00   43.47  ? 81   GLU A O   1 
ATOM   637  C CB  . GLU A 1 81  ? 22.165  31.401  19.077  1.00   41.11  ? 81   GLU A CB  1 
ATOM   638  N N   . GLY A 1 82  ? 23.175  29.987  16.285  1.00   41.60  ? 82   GLY A N   1 
ATOM   639  C CA  . GLY A 1 82  ? 23.093  28.796  15.465  1.00   41.07  ? 82   GLY A CA  1 
ATOM   640  C C   . GLY A 1 82  ? 24.402  28.029  15.406  1.00   42.68  ? 82   GLY A C   1 
ATOM   641  O O   . GLY A 1 82  ? 24.401  26.802  15.320  1.00   39.71  ? 82   GLY A O   1 
ATOM   642  N N   . THR A 1 83  ? 25.516  28.756  15.439  1.00   41.65  ? 83   THR A N   1 
ATOM   643  C CA  . THR A 1 83  ? 26.840  28.146  15.469  1.00   44.39  ? 83   THR A CA  1 
ATOM   644  C C   . THR A 1 83  ? 27.439  28.064  16.887  1.00   44.50  ? 83   THR A C   1 
ATOM   645  O O   . THR A 1 83  ? 28.168  27.123  17.204  1.00   43.72  ? 83   THR A O   1 
ATOM   646  C CB  . THR A 1 83  ? 27.823  28.867  14.517  1.00   41.97  ? 83   THR A CB  1 
ATOM   647  O OG1 . THR A 1 83  ? 27.906  30.250  14.864  1.00   48.98  ? 83   THR A OG1 1 
ATOM   648  C CG2 . THR A 1 83  ? 27.365  28.757  13.083  1.00   39.02  ? 83   THR A CG2 1 
ATOM   649  N N   . GLU A 1 84  ? 27.112  29.028  17.742  1.00   44.76  ? 84   GLU A N   1 
ATOM   650  C CA  . GLU A 1 84  ? 27.742  29.114  19.057  1.00   45.33  ? 84   GLU A CA  1 
ATOM   651  C C   . GLU A 1 84  ? 27.306  27.983  19.989  1.00   48.45  ? 84   GLU A C   1 
ATOM   652  O O   . GLU A 1 84  ? 28.085  27.531  20.833  1.00   44.89  ? 84   GLU A O   1 
ATOM   653  C CB  . GLU A 1 84  ? 27.460  30.466  19.721  1.00   47.15  ? 84   GLU A CB  1 
ATOM   654  C CG  . GLU A 1 84  ? 27.997  31.686  18.976  1.00   54.65  ? 84   GLU A CG  1 
ATOM   655  C CD  . GLU A 1 84  ? 29.514  31.844  19.047  1.00   68.57  ? 84   GLU A CD  1 
ATOM   656  O OE1 . GLU A 1 84  ? 30.188  31.004  19.700  1.00   67.32  ? 84   GLU A OE1 1 
ATOM   657  O OE2 . GLU A 1 84  ? 30.029  32.823  18.444  1.00   64.08  ? 84   GLU A OE2 1 
ATOM   658  N N   . MET A 1 85  ? 26.065  27.530  19.839  1.00   42.92  ? 85   MET A N   1 
ATOM   659  C CA  . MET A 1 85  ? 25.542  26.458  20.679  1.00   44.69  ? 85   MET A CA  1 
ATOM   660  C C   . MET A 1 85  ? 26.414  25.195  20.613  1.00   39.12  ? 85   MET A C   1 
ATOM   661  O O   . MET A 1 85  ? 26.472  24.427  21.567  1.00   45.41  ? 85   MET A O   1 
ATOM   662  C CB  . MET A 1 85  ? 24.095  26.130  20.293  1.00   47.27  ? 85   MET A CB  1 
ATOM   663  C CG  . MET A 1 85  ? 23.933  25.605  18.861  1.00   47.57  ? 85   MET A CG  1 
ATOM   664  S SD  . MET A 1 85  ? 22.198  25.354  18.417  1.00   51.34  ? 85   MET A SD  1 
ATOM   665  C CE  . MET A 1 85  ? 21.842  23.825  19.269  1.00   45.21  ? 85   MET A CE  1 
ATOM   666  N N   . TRP A 1 86  ? 27.086  24.989  19.488  1.00   35.44  ? 86   TRP A N   1 
ATOM   667  C CA  . TRP A 1 86  ? 27.954  23.833  19.315  1.00   41.40  ? 86   TRP A CA  1 
ATOM   668  C C   . TRP A 1 86  ? 29.401  24.078  19.788  1.00   41.85  ? 86   TRP A C   1 
ATOM   669  O O   . TRP A 1 86  ? 30.194  23.148  19.872  1.00   38.45  ? 86   TRP A O   1 
ATOM   670  C CB  . TRP A 1 86  ? 27.941  23.369  17.857  1.00   37.88  ? 86   TRP A CB  1 
ATOM   671  C CG  . TRP A 1 86  ? 26.559  23.246  17.288  1.00   43.86  ? 86   TRP A CG  1 
ATOM   672  C CD1 . TRP A 1 86  ? 25.943  24.124  16.450  1.00   41.54  ? 86   TRP A CD1 1 
ATOM   673  C CD2 . TRP A 1 86  ? 25.621  22.183  17.517  1.00   39.53  ? 86   TRP A CD2 1 
ATOM   674  N NE1 . TRP A 1 86  ? 24.684  23.676  16.144  1.00   41.95  ? 86   TRP A NE1 1 
ATOM   675  C CE2 . TRP A 1 86  ? 24.458  22.492  16.789  1.00   40.66  ? 86   TRP A CE2 1 
ATOM   676  C CE3 . TRP A 1 86  ? 25.647  21.009  18.278  1.00   37.18  ? 86   TRP A CE3 1 
ATOM   677  C CZ2 . TRP A 1 86  ? 23.334  21.661  16.788  1.00   42.70  ? 86   TRP A CZ2 1 
ATOM   678  C CZ3 . TRP A 1 86  ? 24.525  20.186  18.279  1.00   34.18  ? 86   TRP A CZ3 1 
ATOM   679  C CH2 . TRP A 1 86  ? 23.389  20.516  17.543  1.00   36.41  ? 86   TRP A CH2 1 
ATOM   680  N N   . ASN A 1 87  ? 29.735  25.322  20.106  1.00   35.83  ? 87   ASN A N   1 
ATOM   681  C CA  . ASN A 1 87  ? 31.093  25.661  20.521  1.00   39.25  ? 87   ASN A CA  1 
ATOM   682  C C   . ASN A 1 87  ? 31.379  25.296  21.983  1.00   43.74  ? 87   ASN A C   1 
ATOM   683  O O   . ASN A 1 87  ? 30.460  25.176  22.785  1.00   38.98  ? 87   ASN A O   1 
ATOM   684  C CB  . ASN A 1 87  ? 31.348  27.155  20.288  1.00   37.43  ? 87   ASN A CB  1 
ATOM   685  C CG  . ASN A 1 87  ? 31.866  27.448  18.891  1.00   44.09  ? 87   ASN A CG  1 
ATOM   686  O OD1 . ASN A 1 87  ? 32.222  26.537  18.138  1.00   46.16  ? 87   ASN A OD1 1 
ATOM   687  N ND2 . ASN A 1 87  ? 31.924  28.723  18.544  1.00   43.08  ? 87   ASN A ND2 1 
ATOM   688  N N   . PRO A 1 88  ? 32.661  25.134  22.337  1.00   44.44  ? 88   PRO A N   1 
ATOM   689  C CA  . PRO A 1 88  ? 33.014  24.765  23.718  1.00   40.23  ? 88   PRO A CA  1 
ATOM   690  C C   . PRO A 1 88  ? 32.438  25.729  24.744  1.00   40.63  ? 88   PRO A C   1 
ATOM   691  O O   . PRO A 1 88  ? 32.466  26.926  24.512  1.00   41.05  ? 88   PRO A O   1 
ATOM   692  C CB  . PRO A 1 88  ? 34.541  24.833  23.724  1.00   30.65  ? 88   PRO A CB  1 
ATOM   693  C CG  . PRO A 1 88  ? 34.923  24.541  22.313  1.00   37.32  ? 88   PRO A CG  1 
ATOM   694  C CD  . PRO A 1 88  ? 33.842  25.190  21.459  1.00   37.89  ? 88   PRO A CD  1 
ATOM   695  N N   . ASN A 1 89  ? 31.910  25.201  25.847  1.00   39.91  ? 89   ASN A N   1 
ATOM   696  C CA  . ASN A 1 89  ? 31.312  26.024  26.887  1.00   35.90  ? 89   ASN A CA  1 
ATOM   697  C C   . ASN A 1 89  ? 32.073  25.885  28.214  1.00   39.99  ? 89   ASN A C   1 
ATOM   698  O O   . ASN A 1 89  ? 31.617  26.332  29.258  1.00   43.38  ? 89   ASN A O   1 
ATOM   699  C CB  . ASN A 1 89  ? 29.811  25.725  27.040  1.00   33.42  ? 89   ASN A CB  1 
ATOM   700  C CG  . ASN A 1 89  ? 29.527  24.322  27.601  1.00   39.28  ? 89   ASN A CG  1 
ATOM   701  O OD1 . ASN A 1 89  ? 30.312  23.391  27.423  1.00   35.98  ? 89   ASN A OD1 1 
ATOM   702  N ND2 . ASN A 1 89  ? 28.381  24.173  28.262  1.00   36.68  ? 89   ASN A ND2 1 
ATOM   703  N N   A ARG A 1 90  ? 33.230  25.241  28.159  0.55   38.75  ? 90   ARG A N   1 
ATOM   704  N N   B ARG A 1 90  ? 33.233  25.241  28.143  0.45   38.70  ? 90   ARG A N   1 
ATOM   705  C CA  A ARG A 1 90  ? 34.167  25.228  29.278  0.55   39.62  ? 90   ARG A CA  1 
ATOM   706  C CA  B ARG A 1 90  ? 34.173  25.162  29.258  0.45   39.39  ? 90   ARG A CA  1 
ATOM   707  C C   A ARG A 1 90  ? 35.564  25.345  28.698  0.55   39.77  ? 90   ARG A C   1 
ATOM   708  C C   B ARG A 1 90  ? 35.566  25.366  28.689  0.45   39.65  ? 90   ARG A C   1 
ATOM   709  O O   A ARG A 1 90  ? 35.746  25.259  27.481  0.55   38.85  ? 90   ARG A O   1 
ATOM   710  O O   B ARG A 1 90  ? 35.750  25.357  27.470  0.45   38.94  ? 90   ARG A O   1 
ATOM   711  C CB  A ARG A 1 90  ? 34.045  23.949  30.110  0.55   38.19  ? 90   ARG A CB  1 
ATOM   712  C CB  B ARG A 1 90  ? 34.103  23.798  29.946  0.45   38.15  ? 90   ARG A CB  1 
ATOM   713  C CG  A ARG A 1 90  ? 32.733  23.818  30.875  0.55   37.73  ? 90   ARG A CG  1 
ATOM   714  C CG  B ARG A 1 90  ? 32.701  23.368  30.330  0.45   37.39  ? 90   ARG A CG  1 
ATOM   715  C CD  A ARG A 1 90  ? 32.639  24.807  32.035  0.55   38.97  ? 90   ARG A CD  1 
ATOM   716  C CD  B ARG A 1 90  ? 32.158  24.238  31.438  0.45   38.79  ? 90   ARG A CD  1 
ATOM   717  N NE  A ARG A 1 90  ? 31.377  24.653  32.750  0.55   43.46  ? 90   ARG A NE  1 
ATOM   718  N NE  B ARG A 1 90  ? 32.765  23.941  32.730  0.45   38.52  ? 90   ARG A NE  1 
ATOM   719  C CZ  A ARG A 1 90  ? 30.251  25.288  32.432  0.55   45.53  ? 90   ARG A CZ  1 
ATOM   720  C CZ  B ARG A 1 90  ? 32.611  24.703  33.806  0.45   42.93  ? 90   ARG A CZ  1 
ATOM   721  N NH1 A ARG A 1 90  ? 30.227  26.147  31.416  0.55   39.43  ? 90   ARG A NH1 1 
ATOM   722  N NH1 B ARG A 1 90  ? 31.875  25.802  33.726  0.45   46.04  ? 90   ARG A NH1 1 
ATOM   723  N NH2 A ARG A 1 90  ? 29.147  25.067  33.133  0.55   39.34  ? 90   ARG A NH2 1 
ATOM   724  N NH2 B ARG A 1 90  ? 33.190  24.377  34.957  0.45   41.84  ? 90   ARG A NH2 1 
ATOM   725  N N   . GLU A 1 91  ? 36.543  25.549  29.568  1.00   39.05  ? 91   GLU A N   1 
ATOM   726  C CA  . GLU A 1 91  ? 37.922  25.719  29.144  1.00   38.41  ? 91   GLU A CA  1 
ATOM   727  C C   . GLU A 1 91  ? 38.418  24.552  28.275  1.00   41.73  ? 91   GLU A C   1 
ATOM   728  O O   . GLU A 1 91  ? 38.111  23.373  28.537  1.00   36.29  ? 91   GLU A O   1 
ATOM   729  C CB  . GLU A 1 91  ? 38.808  25.874  30.373  1.00   41.91  ? 91   GLU A CB  1 
ATOM   730  C CG  . GLU A 1 91  ? 40.291  25.939  30.082  1.00   41.76  ? 91   GLU A CG  1 
ATOM   731  C CD  . GLU A 1 91  ? 41.110  26.145  31.348  1.00   46.72  ? 91   GLU A CD  1 
ATOM   732  O OE1 . GLU A 1 91  ? 40.551  26.653  32.339  1.00   44.12  ? 91   GLU A OE1 1 
ATOM   733  O OE2 . GLU A 1 91  ? 42.308  25.788  31.356  1.00   52.54  ? 91   GLU A OE2 1 
ATOM   734  N N   . LEU A 1 92  ? 39.165  24.896  27.231  1.00   38.43  ? 92   LEU A N   1 
ATOM   735  C CA  . LEU A 1 92  ? 39.774  23.903  26.361  1.00   40.66  ? 92   LEU A CA  1 
ATOM   736  C C   . LEU A 1 92  ? 41.011  23.342  27.026  1.00   42.34  ? 92   LEU A C   1 
ATOM   737  O O   . LEU A 1 92  ? 41.802  24.087  27.596  1.00   46.57  ? 92   LEU A O   1 
ATOM   738  C CB  . LEU A 1 92  ? 40.173  24.520  25.023  1.00   39.97  ? 92   LEU A CB  1 
ATOM   739  C CG  . LEU A 1 92  ? 39.064  24.961  24.067  1.00   43.68  ? 92   LEU A CG  1 
ATOM   740  C CD1 . LEU A 1 92  ? 39.655  25.207  22.692  1.00   32.56  ? 92   LEU A CD1 1 
ATOM   741  C CD2 . LEU A 1 92  ? 37.989  23.892  23.997  1.00   40.10  ? 92   LEU A CD2 1 
ATOM   742  N N   . SER A 1 93  ? 41.187  22.029  26.935  1.00   39.89  ? 93   SER A N   1 
ATOM   743  C CA  . SER A 1 93  ? 42.345  21.389  27.524  1.00   34.76  ? 93   SER A CA  1 
ATOM   744  C C   . SER A 1 93  ? 42.518  19.952  27.036  1.00   40.76  ? 93   SER A C   1 
ATOM   745  O O   . SER A 1 93  ? 41.538  19.238  26.799  1.00   40.55  ? 93   SER A O   1 
ATOM   746  C CB  . SER A 1 93  ? 42.227  21.412  29.056  1.00   39.63  ? 93   SER A CB  1 
ATOM   747  O OG  . SER A 1 93  ? 43.242  20.634  29.665  1.00   38.61  ? 93   SER A OG  1 
ATOM   748  N N   . GLU A 1 94  ? 43.771  19.527  26.919  1.00   39.17  ? 94   GLU A N   1 
ATOM   749  C CA  . GLU A 1 94  ? 44.079  18.145  26.607  1.00   39.86  ? 94   GLU A CA  1 
ATOM   750  C C   . GLU A 1 94  ? 43.680  17.253  27.772  1.00   41.11  ? 94   GLU A C   1 
ATOM   751  O O   . GLU A 1 94  ? 43.473  16.049  27.616  1.00   41.14  ? 94   GLU A O   1 
ATOM   752  C CB  . GLU A 1 94  ? 45.558  17.985  26.312  1.00   40.77  ? 94   GLU A CB  1 
ATOM   753  C CG  . GLU A 1 94  ? 45.973  18.589  24.999  1.00   40.65  ? 94   GLU A CG  1 
ATOM   754  C CD  . GLU A 1 94  ? 47.398  18.256  24.651  1.00   44.01  ? 94   GLU A CD  1 
ATOM   755  O OE1 . GLU A 1 94  ? 47.650  17.145  24.139  1.00   42.65  ? 94   GLU A OE1 1 
ATOM   756  O OE2 . GLU A 1 94  ? 48.269  19.114  24.886  1.00   47.24  ? 94   GLU A OE2 1 
ATOM   757  N N   . ASP A 1 95  ? 43.553  17.858  28.941  1.00   35.60  ? 95   ASP A N   1 
ATOM   758  C CA  . ASP A 1 95  ? 43.118  17.121  30.114  1.00   42.45  ? 95   ASP A CA  1 
ATOM   759  C C   . ASP A 1 95  ? 41.608  17.289  30.225  1.00   39.91  ? 95   ASP A C   1 
ATOM   760  O O   . ASP A 1 95  ? 41.105  18.253  30.823  1.00   36.96  ? 95   ASP A O   1 
ATOM   761  C CB  . ASP A 1 95  ? 43.857  17.626  31.356  1.00   38.96  ? 95   ASP A CB  1 
ATOM   762  C CG  . ASP A 1 95  ? 43.177  17.236  32.649  1.00   40.59  ? 95   ASP A CG  1 
ATOM   763  O OD1 . ASP A 1 95  ? 42.571  16.149  32.733  1.00   39.61  ? 95   ASP A OD1 1 
ATOM   764  O OD2 . ASP A 1 95  ? 43.255  18.034  33.597  1.00   52.06  ? 95   ASP A OD2 1 
ATOM   765  N N   . CYS A 1 96  ? 40.895  16.329  29.648  1.00   38.14  ? 96   CYS A N   1 
ATOM   766  C CA  . CYS A 1 96  ? 39.482  16.499  29.343  1.00   36.65  ? 96   CYS A CA  1 
ATOM   767  C C   . CYS A 1 96  ? 38.721  15.187  29.403  1.00   34.74  ? 96   CYS A C   1 
ATOM   768  O O   . CYS A 1 96  ? 37.525  15.149  29.119  1.00   35.32  ? 96   CYS A O   1 
ATOM   769  C CB  . CYS A 1 96  ? 39.328  17.091  27.933  1.00   35.20  ? 96   CYS A CB  1 
ATOM   770  S SG  . CYS A 1 96  ? 39.881  15.964  26.615  1.00   41.92  ? 96   CYS A SG  1 
ATOM   771  N N   . LEU A 1 97  ? 39.408  14.108  29.756  1.00   35.15  ? 97   LEU A N   1 
ATOM   772  C CA  . LEU A 1 97  ? 38.749  12.805  29.830  1.00   36.63  ? 97   LEU A CA  1 
ATOM   773  C C   . LEU A 1 97  ? 37.890  12.641  31.104  1.00   38.70  ? 97   LEU A C   1 
ATOM   774  O O   . LEU A 1 97  ? 38.291  11.993  32.071  1.00   40.59  ? 97   LEU A O   1 
ATOM   775  C CB  . LEU A 1 97  ? 39.768  11.673  29.649  1.00   32.76  ? 97   LEU A CB  1 
ATOM   776  C CG  . LEU A 1 97  ? 40.439  11.727  28.271  1.00   33.60  ? 97   LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 97  ? 41.245  10.469  27.954  1.00   31.91  ? 97   LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 97  ? 39.402  11.977  27.184  1.00   34.99  ? 97   LEU A CD2 1 
ATOM   779  N N   . TYR A 1 98  ? 36.707  13.252  31.086  1.00   33.41  ? 98   TYR A N   1 
ATOM   780  C CA  . TYR A 1 98  ? 35.772  13.191  32.198  1.00   36.81  ? 98   TYR A CA  1 
ATOM   781  C C   . TYR A 1 98  ? 34.394  12.797  31.675  1.00   36.24  ? 98   TYR A C   1 
ATOM   782  O O   . TYR A 1 98  ? 34.120  12.938  30.490  1.00   33.70  ? 98   TYR A O   1 
ATOM   783  C CB  . TYR A 1 98  ? 35.701  14.548  32.912  1.00   39.18  ? 98   TYR A CB  1 
ATOM   784  C CG  . TYR A 1 98  ? 37.034  15.028  33.434  1.00   39.38  ? 98   TYR A CG  1 
ATOM   785  C CD1 . TYR A 1 98  ? 37.952  15.645  32.587  1.00   40.00  ? 98   TYR A CD1 1 
ATOM   786  C CD2 . TYR A 1 98  ? 37.383  14.862  34.776  1.00   37.95  ? 98   TYR A CD2 1 
ATOM   787  C CE1 . TYR A 1 98  ? 39.192  16.079  33.058  1.00   40.34  ? 98   TYR A CE1 1 
ATOM   788  C CE2 . TYR A 1 98  ? 38.623  15.293  35.256  1.00   41.65  ? 98   TYR A CE2 1 
ATOM   789  C CZ  . TYR A 1 98  ? 39.516  15.897  34.391  1.00   45.59  ? 98   TYR A CZ  1 
ATOM   790  O OH  . TYR A 1 98  ? 40.732  16.326  34.851  1.00   46.96  ? 98   TYR A OH  1 
ATOM   791  N N   . LEU A 1 99  ? 33.531  12.287  32.546  1.00   34.64  ? 99   LEU A N   1 
ATOM   792  C CA  . LEU A 1 99  ? 32.171  11.955  32.126  1.00   35.84  ? 99   LEU A CA  1 
ATOM   793  C C   . LEU A 1 99  ? 31.139  12.463  33.133  1.00   36.00  ? 99   LEU A C   1 
ATOM   794  O O   . LEU A 1 99  ? 31.486  12.884  34.237  1.00   34.13  ? 99   LEU A O   1 
ATOM   795  C CB  . LEU A 1 99  ? 32.010  10.446  31.864  1.00   32.75  ? 99   LEU A CB  1 
ATOM   796  C CG  . LEU A 1 99  ? 32.344  9.457   32.999  1.00   37.68  ? 99   LEU A CG  1 
ATOM   797  C CD1 . LEU A 1 99  ? 31.306  9.495   34.114  1.00   32.74  ? 99   LEU A CD1 1 
ATOM   798  C CD2 . LEU A 1 99  ? 32.473  8.032   32.478  1.00   32.58  ? 99   LEU A CD2 1 
ATOM   799  N N   . ASN A 1 100 ? 29.871  12.394  32.740  1.00   35.05  ? 100  ASN A N   1 
ATOM   800  C CA  . ASN A 1 100 ? 28.772  12.981  33.491  1.00   34.50  ? 100  ASN A CA  1 
ATOM   801  C C   . ASN A 1 100 ? 27.673  11.955  33.684  1.00   36.66  ? 100  ASN A C   1 
ATOM   802  O O   . ASN A 1 100 ? 27.487  11.091  32.831  1.00   37.23  ? 100  ASN A O   1 
ATOM   803  C CB  . ASN A 1 100 ? 28.226  14.192  32.725  1.00   33.38  ? 100  ASN A CB  1 
ATOM   804  C CG  . ASN A 1 100 ? 29.335  15.139  32.259  1.00   41.10  ? 100  ASN A CG  1 
ATOM   805  O OD1 . ASN A 1 100 ? 30.077  15.701  33.077  1.00   39.44  ? 100  ASN A OD1 1 
ATOM   806  N ND2 . ASN A 1 100 ? 29.461  15.306  30.942  1.00   36.64  ? 100  ASN A ND2 1 
ATOM   807  N N   . VAL A 1 101 ? 26.955  12.050  34.804  1.00   39.96  ? 101  VAL A N   1 
ATOM   808  C CA  . VAL A 1 101 ? 25.856  11.141  35.125  1.00   35.13  ? 101  VAL A CA  1 
ATOM   809  C C   . VAL A 1 101 ? 24.663  11.911  35.684  1.00   39.44  ? 101  VAL A C   1 
ATOM   810  O O   . VAL A 1 101 ? 24.821  12.701  36.610  1.00   39.37  ? 101  VAL A O   1 
ATOM   811  C CB  . VAL A 1 101 ? 26.267  10.124  36.209  1.00   38.53  ? 101  VAL A CB  1 
ATOM   812  C CG1 . VAL A 1 101 ? 25.049  9.343   36.700  1.00   35.70  ? 101  VAL A CG1 1 
ATOM   813  C CG2 . VAL A 1 101 ? 27.341  9.189   35.697  1.00   34.00  ? 101  VAL A CG2 1 
ATOM   814  N N   . TRP A 1 102 ? 23.479  11.687  35.120  1.00   32.64  ? 102  TRP A N   1 
ATOM   815  C CA  . TRP A 1 102 ? 22.249  12.232  35.684  1.00   38.03  ? 102  TRP A CA  1 
ATOM   816  C C   . TRP A 1 102 ? 21.376  11.044  36.045  1.00   44.94  ? 102  TRP A C   1 
ATOM   817  O O   . TRP A 1 102 ? 21.289  10.070  35.286  1.00   39.18  ? 102  TRP A O   1 
ATOM   818  C CB  . TRP A 1 102 ? 21.464  13.093  34.687  1.00   39.09  ? 102  TRP A CB  1 
ATOM   819  C CG  . TRP A 1 102 ? 22.050  14.417  34.298  1.00   41.46  ? 102  TRP A CG  1 
ATOM   820  C CD1 . TRP A 1 102 ? 21.732  15.646  34.817  1.00   40.66  ? 102  TRP A CD1 1 
ATOM   821  C CD2 . TRP A 1 102 ? 23.014  14.660  33.264  1.00   39.57  ? 102  TRP A CD2 1 
ATOM   822  N NE1 . TRP A 1 102 ? 22.454  16.633  34.182  1.00   37.03  ? 102  TRP A NE1 1 
ATOM   823  C CE2 . TRP A 1 102 ? 23.251  16.053  33.229  1.00   40.18  ? 102  TRP A CE2 1 
ATOM   824  C CE3 . TRP A 1 102 ? 23.700  13.839  32.372  1.00   34.96  ? 102  TRP A CE3 1 
ATOM   825  C CZ2 . TRP A 1 102 ? 24.142  16.633  32.333  1.00   44.28  ? 102  TRP A CZ2 1 
ATOM   826  C CZ3 . TRP A 1 102 ? 24.576  14.416  31.477  1.00   37.67  ? 102  TRP A CZ3 1 
ATOM   827  C CH2 . TRP A 1 102 ? 24.797  15.798  31.467  1.00   45.46  ? 102  TRP A CH2 1 
ATOM   828  N N   . THR A 1 103 ? 20.726  11.130  37.199  1.00   41.55  ? 103  THR A N   1 
ATOM   829  C CA  . THR A 1 103 ? 19.829  10.086  37.653  1.00   41.88  ? 103  THR A CA  1 
ATOM   830  C C   . THR A 1 103 ? 18.698  10.782  38.359  1.00   43.44  ? 103  THR A C   1 
ATOM   831  O O   . THR A 1 103 ? 18.836  11.943  38.752  1.00   40.90  ? 103  THR A O   1 
ATOM   832  C CB  . THR A 1 103 ? 20.515  9.114   38.659  1.00   45.84  ? 103  THR A CB  1 
ATOM   833  O OG1 . THR A 1 103 ? 20.806  9.805   39.879  1.00   40.88  ? 103  THR A OG1 1 
ATOM   834  C CG2 . THR A 1 103 ? 21.811  8.552   38.090  1.00   45.11  ? 103  THR A CG2 1 
ATOM   835  N N   . PRO A 1 104 ? 17.569  10.081  38.517  1.00   43.40  ? 104  PRO A N   1 
ATOM   836  C CA  . PRO A 1 104 ? 16.436  10.574  39.303  1.00   40.01  ? 104  PRO A CA  1 
ATOM   837  C C   . PRO A 1 104 ? 16.866  10.976  40.709  1.00   41.66  ? 104  PRO A C   1 
ATOM   838  O O   . PRO A 1 104 ? 17.928  10.584  41.164  1.00   46.82  ? 104  PRO A O   1 
ATOM   839  C CB  . PRO A 1 104 ? 15.505  9.362   39.358  1.00   43.34  ? 104  PRO A CB  1 
ATOM   840  C CG  . PRO A 1 104 ? 15.776  8.642   38.063  1.00   43.82  ? 104  PRO A CG  1 
ATOM   841  C CD  . PRO A 1 104 ? 17.270  8.802   37.848  1.00   43.84  ? 104  PRO A CD  1 
ATOM   842  N N   . TYR A 1 105 ? 16.056  11.773  41.386  1.00   46.07  ? 105  TYR A N   1 
ATOM   843  C CA  . TYR A 1 105 ? 16.377  12.185  42.745  1.00   49.46  ? 105  TYR A CA  1 
ATOM   844  C C   . TYR A 1 105 ? 15.152  12.044  43.613  1.00   51.25  ? 105  TYR A C   1 
ATOM   845  O O   . TYR A 1 105 ? 14.148  12.710  43.370  1.00   57.34  ? 105  TYR A O   1 
ATOM   846  C CB  . TYR A 1 105 ? 16.839  13.631  42.777  1.00   41.81  ? 105  TYR A CB  1 
ATOM   847  C CG  . TYR A 1 105 ? 17.167  14.155  44.152  1.00   45.33  ? 105  TYR A CG  1 
ATOM   848  C CD1 . TYR A 1 105 ? 16.164  14.384  45.093  1.00   47.40  ? 105  TYR A CD1 1 
ATOM   849  C CD2 . TYR A 1 105 ? 18.481  14.444  44.512  1.00   47.38  ? 105  TYR A CD2 1 
ATOM   850  C CE1 . TYR A 1 105 ? 16.460  14.878  46.355  1.00   41.79  ? 105  TYR A CE1 1 
ATOM   851  C CE2 . TYR A 1 105 ? 18.786  14.938  45.774  1.00   46.35  ? 105  TYR A CE2 1 
ATOM   852  C CZ  . TYR A 1 105 ? 17.770  15.156  46.689  1.00   46.50  ? 105  TYR A CZ  1 
ATOM   853  O OH  . TYR A 1 105 ? 18.070  15.653  47.936  1.00   40.55  ? 105  TYR A OH  1 
ATOM   854  N N   . PRO A 1 106 ? 15.230  11.194  44.645  1.00   55.15  ? 106  PRO A N   1 
ATOM   855  C CA  . PRO A 1 106 ? 16.406  10.416  45.051  1.00   49.27  ? 106  PRO A CA  1 
ATOM   856  C C   . PRO A 1 106 ? 16.730  9.387   43.995  1.00   44.83  ? 106  PRO A C   1 
ATOM   857  O O   . PRO A 1 106 ? 15.874  9.130   43.165  1.00   45.20  ? 106  PRO A O   1 
ATOM   858  C CB  . PRO A 1 106 ? 15.924  9.681   46.307  1.00   57.07  ? 106  PRO A CB  1 
ATOM   859  C CG  . PRO A 1 106 ? 14.645  10.359  46.708  1.00   55.02  ? 106  PRO A CG  1 
ATOM   860  C CD  . PRO A 1 106 ? 14.044  10.864  45.453  1.00   52.65  ? 106  PRO A CD  1 
ATOM   861  N N   . ARG A 1 107 ? 17.931  8.816   44.031  1.00   50.74  ? 107  ARG A N   1 
ATOM   862  C CA  . ARG A 1 107 ? 18.347  7.803   43.058  1.00   51.88  ? 107  ARG A CA  1 
ATOM   863  C C   . ARG A 1 107 ? 17.369  6.639   43.056  1.00   48.81  ? 107  ARG A C   1 
ATOM   864  O O   . ARG A 1 107 ? 16.691  6.412   44.042  1.00   55.37  ? 107  ARG A O   1 
ATOM   865  C CB  . ARG A 1 107 ? 19.782  7.323   43.334  1.00   46.03  ? 107  ARG A CB  1 
ATOM   866  C CG  . ARG A 1 107 ? 20.824  8.454   43.322  1.00   51.96  ? 107  ARG A CG  1 
ATOM   867  C CD  . ARG A 1 107 ? 22.244  7.927   43.329  1.00   54.21  ? 107  ARG A CD  1 
ATOM   868  N NE  . ARG A 1 107 ? 22.535  7.070   44.480  1.00   54.44  ? 107  ARG A NE  1 
ATOM   869  C CZ  . ARG A 1 107 ? 23.126  7.494   45.592  1.00   53.60  ? 107  ARG A CZ  1 
ATOM   870  N NH1 . ARG A 1 107 ? 23.471  8.766   45.700  1.00   52.24  ? 107  ARG A NH1 1 
ATOM   871  N NH2 . ARG A 1 107 ? 23.364  6.657   46.602  1.00   53.24  ? 107  ARG A NH2 1 
ATOM   872  N N   . PRO A 1 108 ? 17.278  5.918   41.927  1.00   55.27  ? 108  PRO A N   1 
ATOM   873  C CA  . PRO A 1 108 ? 16.400  4.759   41.727  1.00   58.40  ? 108  PRO A CA  1 
ATOM   874  C C   . PRO A 1 108 ? 16.549  3.666   42.786  1.00   61.62  ? 108  PRO A C   1 
ATOM   875  O O   . PRO A 1 108 ? 17.648  3.416   43.282  1.00   60.18  ? 108  PRO A O   1 
ATOM   876  C CB  . PRO A 1 108 ? 16.856  4.215   40.370  1.00   55.72  ? 108  PRO A CB  1 
ATOM   877  C CG  . PRO A 1 108 ? 17.371  5.390   39.653  1.00   49.56  ? 108  PRO A CG  1 
ATOM   878  C CD  . PRO A 1 108 ? 17.978  6.293   40.685  1.00   51.69  ? 108  PRO A CD  1 
ATOM   879  N N   . ALA A 1 109 ? 15.436  3.013   43.106  1.00   65.03  ? 109  ALA A N   1 
ATOM   880  C CA  . ALA A 1 109 ? 15.433  1.907   44.060  1.00   74.71  ? 109  ALA A CA  1 
ATOM   881  C C   . ALA A 1 109 ? 15.782  0.576   43.383  1.00   72.60  ? 109  ALA A C   1 
ATOM   882  O O   . ALA A 1 109 ? 16.519  -0.238  43.938  1.00   71.66  ? 109  ALA A O   1 
ATOM   883  C CB  . ALA A 1 109 ? 14.083  1.816   44.754  1.00   78.47  ? 109  ALA A CB  1 
ATOM   884  N N   . SER A 1 110 ? 15.248  0.363   42.185  1.00   62.79  ? 110  SER A N   1 
ATOM   885  C CA  . SER A 1 110 ? 15.581  -0.815  41.395  1.00   59.70  ? 110  SER A CA  1 
ATOM   886  C C   . SER A 1 110 ? 16.519  -0.434  40.245  1.00   62.54  ? 110  SER A C   1 
ATOM   887  O O   . SER A 1 110 ? 16.608  0.732   39.874  1.00   57.71  ? 110  SER A O   1 
ATOM   888  C CB  . SER A 1 110 ? 14.305  -1.449  40.851  1.00   61.15  ? 110  SER A CB  1 
ATOM   889  O OG  . SER A 1 110 ? 13.421  -0.449  40.375  1.00   74.56  ? 110  SER A OG  1 
ATOM   890  N N   . PRO A 1 111 ? 17.228  -1.418  39.680  1.00   60.86  ? 111  PRO A N   1 
ATOM   891  C CA  . PRO A 1 111 ? 18.192  -1.151  38.604  1.00   54.27  ? 111  PRO A CA  1 
ATOM   892  C C   . PRO A 1 111 ? 17.539  -0.539  37.368  1.00   55.74  ? 111  PRO A C   1 
ATOM   893  O O   . PRO A 1 111 ? 16.670  -1.156  36.745  1.00   56.68  ? 111  PRO A O   1 
ATOM   894  C CB  . PRO A 1 111 ? 18.749  -2.542  38.279  1.00   52.90  ? 111  PRO A CB  1 
ATOM   895  C CG  . PRO A 1 111 ? 18.531  -3.333  39.539  1.00   54.84  ? 111  PRO A CG  1 
ATOM   896  C CD  . PRO A 1 111 ? 17.227  -2.834  40.081  1.00   57.62  ? 111  PRO A CD  1 
ATOM   897  N N   . THR A 1 112 ? 17.975  0.666   37.018  1.00   47.00  ? 112  THR A N   1 
ATOM   898  C CA  . THR A 1 112 ? 17.406  1.415   35.910  1.00   45.93  ? 112  THR A CA  1 
ATOM   899  C C   . THR A 1 112 ? 18.258  1.346   34.635  1.00   43.79  ? 112  THR A C   1 
ATOM   900  O O   . THR A 1 112 ? 19.488  1.467   34.688  1.00   42.51  ? 112  THR A O   1 
ATOM   901  C CB  . THR A 1 112 ? 17.236  2.872   36.316  1.00   49.47  ? 112  THR A CB  1 
ATOM   902  O OG1 . THR A 1 112 ? 16.539  2.921   37.561  1.00   58.42  ? 112  THR A OG1 1 
ATOM   903  C CG2 . THR A 1 112 ? 16.453  3.638   35.266  1.00   48.32  ? 112  THR A CG2 1 
ATOM   904  N N   . PRO A 1 113 ? 17.598  1.148   33.487  1.00   42.48  ? 113  PRO A N   1 
ATOM   905  C CA  . PRO A 1 113 ? 18.224  1.145   32.162  1.00   43.89  ? 113  PRO A CA  1 
ATOM   906  C C   . PRO A 1 113 ? 18.999  2.436   31.914  1.00   45.59  ? 113  PRO A C   1 
ATOM   907  O O   . PRO A 1 113 ? 18.556  3.540   32.269  1.00   41.01  ? 113  PRO A O   1 
ATOM   908  C CB  . PRO A 1 113 ? 17.029  1.062   31.214  1.00   44.93  ? 113  PRO A CB  1 
ATOM   909  C CG  . PRO A 1 113 ? 15.982  0.371   32.012  1.00   53.95  ? 113  PRO A CG  1 
ATOM   910  C CD  . PRO A 1 113 ? 16.151  0.897   33.406  1.00   48.33  ? 113  PRO A CD  1 
ATOM   911  N N   . VAL A 1 114 ? 20.165  2.276   31.304  1.00   38.49  ? 114  VAL A N   1 
ATOM   912  C CA  . VAL A 1 114 ? 21.116  3.355   31.144  1.00   35.80  ? 114  VAL A CA  1 
ATOM   913  C C   . VAL A 1 114 ? 21.184  3.812   29.685  1.00   37.46  ? 114  VAL A C   1 
ATOM   914  O O   . VAL A 1 114 ? 21.241  2.991   28.771  1.00   34.62  ? 114  VAL A O   1 
ATOM   915  C CB  . VAL A 1 114 ? 22.502  2.878   31.608  1.00   42.20  ? 114  VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 114 ? 23.544  4.012   31.499  1.00   34.44  ? 114  VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 114 ? 22.396  2.338   33.034  1.00   36.21  ? 114  VAL A CG2 1 
ATOM   918  N N   . LEU A 1 115 ? 21.138  5.119   29.468  1.00   35.14  ? 115  LEU A N   1 
ATOM   919  C CA  . LEU A 1 115 ? 21.419  5.681   28.149  1.00   31.90  ? 115  LEU A CA  1 
ATOM   920  C C   . LEU A 1 115 ? 22.812  6.302   28.195  1.00   37.13  ? 115  LEU A C   1 
ATOM   921  O O   . LEU A 1 115 ? 23.123  7.063   29.124  1.00   39.05  ? 115  LEU A O   1 
ATOM   922  C CB  . LEU A 1 115 ? 20.376  6.731   27.778  1.00   35.88  ? 115  LEU A CB  1 
ATOM   923  C CG  . LEU A 1 115 ? 18.955  6.247   27.453  1.00   41.93  ? 115  LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 115 ? 18.008  7.409   27.226  1.00   43.04  ? 115  LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 115 ? 18.998  5.392   26.233  1.00   47.15  ? 115  LEU A CD2 1 
ATOM   926  N N   . ILE A 1 116 ? 23.670  5.956   27.236  1.00   36.89  ? 116  ILE A N   1 
ATOM   927  C CA  . ILE A 1 116 ? 24.975  6.626   27.131  1.00   33.98  ? 116  ILE A CA  1 
ATOM   928  C C   . ILE A 1 116 ? 25.043  7.472   25.866  1.00   37.03  ? 116  ILE A C   1 
ATOM   929  O O   . ILE A 1 116 ? 24.919  6.942   24.758  1.00   35.83  ? 116  ILE A O   1 
ATOM   930  C CB  . ILE A 1 116 ? 26.169  5.643   27.115  1.00   35.14  ? 116  ILE A CB  1 
ATOM   931  C CG1 . ILE A 1 116 ? 26.171  4.752   28.359  1.00   38.23  ? 116  ILE A CG1 1 
ATOM   932  C CG2 . ILE A 1 116 ? 27.485  6.415   27.045  1.00   36.56  ? 116  ILE A CG2 1 
ATOM   933  C CD1 . ILE A 1 116 ? 27.195  3.649   28.308  1.00   34.92  ? 116  ILE A CD1 1 
ATOM   934  N N   . TRP A 1 117 ? 25.246  8.778   26.034  1.00   33.85  ? 117  TRP A N   1 
ATOM   935  C CA  . TRP A 1 117 ? 25.315  9.705   24.904  1.00   32.98  ? 117  TRP A CA  1 
ATOM   936  C C   . TRP A 1 117 ? 26.732  9.898   24.373  1.00   37.11  ? 117  TRP A C   1 
ATOM   937  O O   . TRP A 1 117 ? 27.676  10.078  25.143  1.00   36.26  ? 117  TRP A O   1 
ATOM   938  C CB  . TRP A 1 117 ? 24.733  11.066  25.291  1.00   34.49  ? 117  TRP A CB  1 
ATOM   939  C CG  . TRP A 1 117 ? 24.844  12.120  24.194  1.00   36.34  ? 117  TRP A CG  1 
ATOM   940  C CD1 . TRP A 1 117 ? 25.674  13.208  24.177  1.00   33.96  ? 117  TRP A CD1 1 
ATOM   941  C CD2 . TRP A 1 117 ? 24.087  12.177  22.975  1.00   31.89  ? 117  TRP A CD2 1 
ATOM   942  N NE1 . TRP A 1 117 ? 25.483  13.934  23.026  1.00   36.38  ? 117  TRP A NE1 1 
ATOM   943  C CE2 . TRP A 1 117 ? 24.507  13.330  22.276  1.00   30.28  ? 117  TRP A CE2 1 
ATOM   944  C CE3 . TRP A 1 117 ? 23.088  11.372  22.415  1.00   28.74  ? 117  TRP A CE3 1 
ATOM   945  C CZ2 . TRP A 1 117 ? 23.969  13.696  21.037  1.00   33.44  ? 117  TRP A CZ2 1 
ATOM   946  C CZ3 . TRP A 1 117 ? 22.552  11.735  21.182  1.00   32.56  ? 117  TRP A CZ3 1 
ATOM   947  C CH2 . TRP A 1 117 ? 22.992  12.888  20.508  1.00   35.79  ? 117  TRP A CH2 1 
ATOM   948  N N   . ILE A 1 118 ? 26.874  9.865   23.053  1.00   35.07  ? 118  ILE A N   1 
ATOM   949  C CA  . ILE A 1 118 ? 28.149  10.176  22.412  1.00   31.21  ? 118  ILE A CA  1 
ATOM   950  C C   . ILE A 1 118 ? 27.948  11.317  21.427  1.00   35.14  ? 118  ILE A C   1 
ATOM   951  O O   . ILE A 1 118 ? 27.290  11.136  20.393  1.00   36.40  ? 118  ILE A O   1 
ATOM   952  C CB  . ILE A 1 118 ? 28.717  8.972   21.646  1.00   33.14  ? 118  ILE A CB  1 
ATOM   953  C CG1 . ILE A 1 118 ? 28.869  7.767   22.579  1.00   35.02  ? 118  ILE A CG1 1 
ATOM   954  C CG2 . ILE A 1 118 ? 30.063  9.338   21.029  1.00   30.88  ? 118  ILE A CG2 1 
ATOM   955  C CD1 . ILE A 1 118 ? 29.356  6.516   21.866  1.00   32.34  ? 118  ILE A CD1 1 
ATOM   956  N N   . TYR A 1 119 ? 28.495  12.490  21.750  1.00   30.36  ? 119  TYR A N   1 
ATOM   957  C CA  . TYR A 1 119 ? 28.292  13.669  20.916  1.00   31.84  ? 119  TYR A CA  1 
ATOM   958  C C   . TYR A 1 119 ? 28.980  13.571  19.556  1.00   35.28  ? 119  TYR A C   1 
ATOM   959  O O   . TYR A 1 119 ? 29.962  12.850  19.397  1.00   31.76  ? 119  TYR A O   1 
ATOM   960  C CB  . TYR A 1 119 ? 28.761  14.937  21.628  1.00   31.90  ? 119  TYR A CB  1 
ATOM   961  C CG  . TYR A 1 119 ? 30.223  14.938  22.020  1.00   34.99  ? 119  TYR A CG  1 
ATOM   962  C CD1 . TYR A 1 119 ? 31.235  15.111  21.061  1.00   31.93  ? 119  TYR A CD1 1 
ATOM   963  C CD2 . TYR A 1 119 ? 30.593  14.809  23.362  1.00   32.77  ? 119  TYR A CD2 1 
ATOM   964  C CE1 . TYR A 1 119 ? 32.581  15.126  21.439  1.00   34.89  ? 119  TYR A CE1 1 
ATOM   965  C CE2 . TYR A 1 119 ? 31.913  14.826  23.749  1.00   31.91  ? 119  TYR A CE2 1 
ATOM   966  C CZ  . TYR A 1 119 ? 32.908  14.982  22.796  1.00   36.57  ? 119  TYR A CZ  1 
ATOM   967  O OH  . TYR A 1 119 ? 34.216  14.982  23.215  1.00   32.25  ? 119  TYR A OH  1 
ATOM   968  N N   . GLY A 1 120 ? 28.453  14.310  18.584  1.00   32.18  ? 120  GLY A N   1 
ATOM   969  C CA  . GLY A 1 120 ? 29.104  14.471  17.296  1.00   30.82  ? 120  GLY A CA  1 
ATOM   970  C C   . GLY A 1 120 ? 29.910  15.759  17.221  1.00   31.25  ? 120  GLY A C   1 
ATOM   971  O O   . GLY A 1 120 ? 30.193  16.397  18.241  1.00   35.81  ? 120  GLY A O   1 
ATOM   972  N N   . GLY A 1 121 ? 30.274  16.156  16.007  1.00   37.74  ? 121  GLY A N   1 
ATOM   973  C CA  . GLY A 1 121 ? 31.143  17.308  15.802  1.00   33.44  ? 121  GLY A CA  1 
ATOM   974  C C   . GLY A 1 121 ? 32.279  16.936  14.862  1.00   34.91  ? 121  GLY A C   1 
ATOM   975  O O   . GLY A 1 121 ? 33.403  17.441  14.978  1.00   33.69  ? 121  GLY A O   1 
ATOM   976  N N   . GLY A 1 122 ? 31.982  16.026  13.941  1.00   27.83  ? 122  GLY A N   1 
ATOM   977  C CA  . GLY A 1 122 ? 32.915  15.634  12.892  1.00   34.90  ? 122  GLY A CA  1 
ATOM   978  C C   . GLY A 1 122 ? 34.203  14.949  13.335  1.00   39.47  ? 122  GLY A C   1 
ATOM   979  O O   . GLY A 1 122 ? 35.140  14.849  12.543  1.00   36.30  ? 122  GLY A O   1 
ATOM   980  N N   . PHE A 1 123 ? 34.250  14.473  14.583  1.00   34.11  ? 123  PHE A N   1 
ATOM   981  C CA  . PHE A 1 123 ? 35.482  13.941  15.178  1.00   33.11  ? 123  PHE A CA  1 
ATOM   982  C C   . PHE A 1 123 ? 36.551  15.014  15.390  1.00   31.83  ? 123  PHE A C   1 
ATOM   983  O O   . PHE A 1 123 ? 37.690  14.685  15.681  1.00   35.02  ? 123  PHE A O   1 
ATOM   984  C CB  . PHE A 1 123 ? 36.067  12.781  14.349  1.00   33.82  ? 123  PHE A CB  1 
ATOM   985  C CG  . PHE A 1 123 ? 35.199  11.557  14.333  1.00   35.96  ? 123  PHE A CG  1 
ATOM   986  C CD1 . PHE A 1 123 ? 35.037  10.787  15.488  1.00   31.83  ? 123  PHE A CD1 1 
ATOM   987  C CD2 . PHE A 1 123 ? 34.532  11.180  13.175  1.00   34.51  ? 123  PHE A CD2 1 
ATOM   988  C CE1 . PHE A 1 123 ? 34.221  9.674   15.490  1.00   31.81  ? 123  PHE A CE1 1 
ATOM   989  C CE2 . PHE A 1 123 ? 33.714  10.052  13.163  1.00   32.48  ? 123  PHE A CE2 1 
ATOM   990  C CZ  . PHE A 1 123 ? 33.558  9.300   14.323  1.00   34.71  ? 123  PHE A CZ  1 
ATOM   991  N N   . TYR A 1 124 ? 36.188  16.289  15.247  1.00   31.85  ? 124  TYR A N   1 
ATOM   992  C CA  . TYR A 1 124 ? 37.145  17.394  15.443  1.00   37.09  ? 124  TYR A CA  1 
ATOM   993  C C   . TYR A 1 124 ? 36.670  18.397  16.497  1.00   35.05  ? 124  TYR A C   1 
ATOM   994  O O   . TYR A 1 124 ? 37.390  19.321  16.854  1.00   36.41  ? 124  TYR A O   1 
ATOM   995  C CB  . TYR A 1 124 ? 37.428  18.135  14.122  1.00   33.64  ? 124  TYR A CB  1 
ATOM   996  C CG  . TYR A 1 124 ? 36.289  19.020  13.671  1.00   37.53  ? 124  TYR A CG  1 
ATOM   997  C CD1 . TYR A 1 124 ? 36.133  20.308  14.186  1.00   34.48  ? 124  TYR A CD1 1 
ATOM   998  C CD2 . TYR A 1 124 ? 35.356  18.565  12.736  1.00   38.31  ? 124  TYR A CD2 1 
ATOM   999  C CE1 . TYR A 1 124 ? 35.077  21.119  13.786  1.00   37.16  ? 124  TYR A CE1 1 
ATOM   1000 C CE2 . TYR A 1 124 ? 34.299  19.366  12.328  1.00   40.01  ? 124  TYR A CE2 1 
ATOM   1001 C CZ  . TYR A 1 124 ? 34.167  20.644  12.859  1.00   41.54  ? 124  TYR A CZ  1 
ATOM   1002 O OH  . TYR A 1 124 ? 33.129  21.443  12.455  1.00   41.88  ? 124  TYR A OH  1 
ATOM   1003 N N   . SER A 1 125 ? 35.447  18.218  16.979  1.00   32.43  ? 125  SER A N   1 
ATOM   1004 C CA  . SER A 1 125 ? 34.867  19.117  17.963  1.00   31.28  ? 125  SER A CA  1 
ATOM   1005 C C   . SER A 1 125 ? 33.802  18.385  18.758  1.00   33.31  ? 125  SER A C   1 
ATOM   1006 O O   . SER A 1 125 ? 33.497  17.218  18.479  1.00   29.95  ? 125  SER A O   1 
ATOM   1007 C CB  . SER A 1 125 ? 34.220  20.315  17.269  1.00   33.81  ? 125  SER A CB  1 
ATOM   1008 O OG  . SER A 1 125 ? 33.291  19.877  16.293  1.00   32.19  ? 125  SER A OG  1 
ATOM   1009 N N   . GLY A 1 126 ? 33.212  19.092  19.719  1.00   29.56  ? 126  GLY A N   1 
ATOM   1010 C CA  . GLY A 1 126 ? 32.155  18.527  20.537  1.00   37.11  ? 126  GLY A CA  1 
ATOM   1011 C C   . GLY A 1 126 ? 32.485  18.452  22.017  1.00   35.07  ? 126  GLY A C   1 
ATOM   1012 O O   . GLY A 1 126 ? 33.643  18.607  22.428  1.00   32.31  ? 126  GLY A O   1 
ATOM   1013 N N   . ALA A 1 127 ? 31.457  18.206  22.821  1.00   30.75  ? 127  ALA A N   1 
ATOM   1014 C CA  . ALA A 1 127 ? 31.598  18.250  24.273  1.00   34.62  ? 127  ALA A CA  1 
ATOM   1015 C C   . ALA A 1 127 ? 30.320  17.752  24.914  1.00   36.96  ? 127  ALA A C   1 
ATOM   1016 O O   . ALA A 1 127 ? 29.230  18.018  24.415  1.00   35.22  ? 127  ALA A O   1 
ATOM   1017 C CB  . ALA A 1 127 ? 31.915  19.672  24.739  1.00   31.59  ? 127  ALA A CB  1 
ATOM   1018 N N   . ALA A 1 128 ? 30.447  17.026  26.021  1.00   37.17  ? 128  ALA A N   1 
ATOM   1019 C CA  . ALA A 1 128 ? 29.276  16.422  26.638  1.00   33.98  ? 128  ALA A CA  1 
ATOM   1020 C C   . ALA A 1 128 ? 28.574  17.444  27.510  1.00   35.31  ? 128  ALA A C   1 
ATOM   1021 O O   . ALA A 1 128 ? 27.486  17.197  28.036  1.00   34.27  ? 128  ALA A O   1 
ATOM   1022 C CB  . ALA A 1 128 ? 29.662  15.171  27.442  1.00   32.45  ? 128  ALA A CB  1 
ATOM   1023 N N   . SER A 1 129 ? 29.209  18.600  27.660  1.00   31.59  ? 129  SER A N   1 
ATOM   1024 C CA  . SER A 1 129 ? 28.684  19.650  28.537  1.00   35.13  ? 129  SER A CA  1 
ATOM   1025 C C   . SER A 1 129 ? 27.775  20.669  27.830  1.00   37.95  ? 129  SER A C   1 
ATOM   1026 O O   . SER A 1 129 ? 27.260  21.580  28.479  1.00   40.65  ? 129  SER A O   1 
ATOM   1027 C CB  . SER A 1 129 ? 29.840  20.392  29.199  1.00   33.06  ? 129  SER A CB  1 
ATOM   1028 O OG  . SER A 1 129 ? 30.705  20.934  28.207  1.00   35.06  ? 129  SER A OG  1 
ATOM   1029 N N   . LEU A 1 130 ? 27.587  20.540  26.513  1.00   33.55  ? 130  LEU A N   1 
ATOM   1030 C CA  . LEU A 1 130 ? 26.696  21.469  25.787  1.00   36.40  ? 130  LEU A CA  1 
ATOM   1031 C C   . LEU A 1 130 ? 25.259  21.441  26.303  1.00   36.06  ? 130  LEU A C   1 
ATOM   1032 O O   . LEU A 1 130 ? 24.748  20.395  26.720  1.00   35.87  ? 130  LEU A O   1 
ATOM   1033 C CB  . LEU A 1 130 ? 26.693  21.187  24.289  1.00   31.80  ? 130  LEU A CB  1 
ATOM   1034 C CG  . LEU A 1 130 ? 28.058  21.167  23.605  1.00   37.65  ? 130  LEU A CG  1 
ATOM   1035 C CD1 . LEU A 1 130 ? 27.865  20.987  22.125  1.00   35.52  ? 130  LEU A CD1 1 
ATOM   1036 C CD2 . LEU A 1 130 ? 28.861  22.442  23.911  1.00   34.79  ? 130  LEU A CD2 1 
ATOM   1037 N N   . ASP A 1 131 ? 24.604  22.593  26.261  1.00   36.49  ? 131  ASP A N   1 
ATOM   1038 C CA  . ASP A 1 131 ? 23.223  22.686  26.732  1.00   37.66  ? 131  ASP A CA  1 
ATOM   1039 C C   . ASP A 1 131 ? 22.269  21.699  26.056  1.00   36.42  ? 131  ASP A C   1 
ATOM   1040 O O   . ASP A 1 131 ? 21.337  21.223  26.686  1.00   42.21  ? 131  ASP A O   1 
ATOM   1041 C CB  . ASP A 1 131 ? 22.687  24.108  26.588  1.00   33.94  ? 131  ASP A CB  1 
ATOM   1042 C CG  . ASP A 1 131 ? 23.235  25.050  27.645  1.00   44.58  ? 131  ASP A CG  1 
ATOM   1043 O OD1 . ASP A 1 131 ? 24.050  24.612  28.478  1.00   43.98  ? 131  ASP A OD1 1 
ATOM   1044 O OD2 . ASP A 1 131 ? 22.851  26.240  27.648  1.00   53.49  ? 131  ASP A OD2 1 
ATOM   1045 N N   . VAL A 1 132 ? 22.481  21.401  24.778  1.00   36.36  ? 132  VAL A N   1 
ATOM   1046 C CA  . VAL A 1 132 ? 21.571  20.499  24.074  1.00   35.21  ? 132  VAL A CA  1 
ATOM   1047 C C   . VAL A 1 132 ? 21.738  19.045  24.495  1.00   35.79  ? 132  VAL A C   1 
ATOM   1048 O O   . VAL A 1 132 ? 20.947  18.184  24.097  1.00   35.94  ? 132  VAL A O   1 
ATOM   1049 C CB  . VAL A 1 132 ? 21.723  20.581  22.552  1.00   34.64  ? 132  VAL A CB  1 
ATOM   1050 C CG1 . VAL A 1 132 ? 21.173  21.889  22.057  1.00   43.48  ? 132  VAL A CG1 1 
ATOM   1051 C CG2 . VAL A 1 132 ? 23.180  20.408  22.163  1.00   39.64  ? 132  VAL A CG2 1 
ATOM   1052 N N   . TYR A 1 133 ? 22.759  18.760  25.292  1.00   33.38  ? 133  TYR A N   1 
ATOM   1053 C CA  . TYR A 1 133 ? 22.926  17.393  25.787  1.00   36.10  ? 133  TYR A CA  1 
ATOM   1054 C C   . TYR A 1 133 ? 22.541  17.260  27.265  1.00   37.25  ? 133  TYR A C   1 
ATOM   1055 O O   . TYR A 1 133 ? 22.896  16.277  27.914  1.00   37.28  ? 133  TYR A O   1 
ATOM   1056 C CB  . TYR A 1 133 ? 24.358  16.887  25.547  1.00   29.89  ? 133  TYR A CB  1 
ATOM   1057 C CG  . TYR A 1 133 ? 24.848  17.076  24.133  1.00   28.07  ? 133  TYR A CG  1 
ATOM   1058 C CD1 . TYR A 1 133 ? 23.995  16.885  23.045  1.00   32.99  ? 133  TYR A CD1 1 
ATOM   1059 C CD2 . TYR A 1 133 ? 26.168  17.432  23.879  1.00   31.57  ? 133  TYR A CD2 1 
ATOM   1060 C CE1 . TYR A 1 133 ? 24.442  17.062  21.735  1.00   31.26  ? 133  TYR A CE1 1 
ATOM   1061 C CE2 . TYR A 1 133 ? 26.636  17.601  22.577  1.00   33.68  ? 133  TYR A CE2 1 
ATOM   1062 C CZ  . TYR A 1 133 ? 25.771  17.417  21.509  1.00   35.71  ? 133  TYR A CZ  1 
ATOM   1063 O OH  . TYR A 1 133 ? 26.235  17.603  20.224  1.00   30.58  ? 133  TYR A OH  1 
ATOM   1064 N N   . ASP A 1 134 ? 21.815  18.247  27.788  1.00   36.82  ? 134  ASP A N   1 
ATOM   1065 C CA  . ASP A 1 134 ? 21.418  18.262  29.202  1.00   39.34  ? 134  ASP A CA  1 
ATOM   1066 C C   . ASP A 1 134 ? 20.516  17.077  29.580  1.00   41.30  ? 134  ASP A C   1 
ATOM   1067 O O   . ASP A 1 134 ? 19.362  16.987  29.143  1.00   34.64  ? 134  ASP A O   1 
ATOM   1068 C CB  . ASP A 1 134 ? 20.722  19.583  29.533  1.00   39.70  ? 134  ASP A CB  1 
ATOM   1069 C CG  . ASP A 1 134 ? 20.441  19.755  31.025  1.00   44.01  ? 134  ASP A CG  1 
ATOM   1070 O OD1 . ASP A 1 134 ? 20.493  18.771  31.790  1.00   46.91  ? 134  ASP A OD1 1 
ATOM   1071 O OD2 . ASP A 1 134 ? 20.145  20.891  31.435  1.00   44.74  ? 134  ASP A OD2 1 
ATOM   1072 N N   . GLY A 1 135 ? 21.049  16.183  30.411  1.00   40.80  ? 135  GLY A N   1 
ATOM   1073 C CA  . GLY A 1 135 ? 20.339  14.976  30.794  1.00   36.40  ? 135  GLY A CA  1 
ATOM   1074 C C   . GLY A 1 135 ? 19.267  15.123  31.862  1.00   35.92  ? 135  GLY A C   1 
ATOM   1075 O O   . GLY A 1 135 ? 18.621  14.143  32.219  1.00   34.05  ? 135  GLY A O   1 
ATOM   1076 N N   . ARG A 1 136 ? 19.050  16.330  32.372  1.00   35.19  ? 136  ARG A N   1 
ATOM   1077 C CA  . ARG A 1 136 ? 18.124  16.463  33.499  1.00   42.14  ? 136  ARG A CA  1 
ATOM   1078 C C   . ARG A 1 136 ? 16.691  16.063  33.140  1.00   45.55  ? 136  ARG A C   1 
ATOM   1079 O O   . ARG A 1 136 ? 15.985  15.497  33.976  1.00   42.29  ? 136  ARG A O   1 
ATOM   1080 C CB  . ARG A 1 136 ? 18.197  17.838  34.190  1.00   37.60  ? 136  ARG A CB  1 
ATOM   1081 C CG  . ARG A 1 136 ? 17.488  18.991  33.490  1.00   45.07  ? 136  ARG A CG  1 
ATOM   1082 C CD  . ARG A 1 136 ? 17.757  20.320  34.210  1.00   40.56  ? 136  ARG A CD  1 
ATOM   1083 N NE  . ARG A 1 136 ? 19.142  20.758  34.032  1.00   45.64  ? 136  ARG A NE  1 
ATOM   1084 C CZ  . ARG A 1 136 ? 19.768  21.672  34.780  1.00   47.60  ? 136  ARG A CZ  1 
ATOM   1085 N NH1 . ARG A 1 136 ? 19.153  22.275  35.792  1.00   47.27  ? 136  ARG A NH1 1 
ATOM   1086 N NH2 . ARG A 1 136 ? 21.027  21.988  34.514  1.00   50.38  ? 136  ARG A NH2 1 
ATOM   1087 N N   . PHE A 1 137 ? 16.286  16.301  31.891  1.00   43.88  ? 137  PHE A N   1 
ATOM   1088 C CA  . PHE A 1 137 ? 14.908  16.033  31.462  1.00   38.72  ? 137  PHE A CA  1 
ATOM   1089 C C   . PHE A 1 137 ? 14.590  14.545  31.287  1.00   39.07  ? 137  PHE A C   1 
ATOM   1090 O O   . PHE A 1 137 ? 13.561  14.071  31.779  1.00   39.43  ? 137  PHE A O   1 
ATOM   1091 C CB  . PHE A 1 137 ? 14.573  16.819  30.190  1.00   38.76  ? 137  PHE A CB  1 
ATOM   1092 C CG  . PHE A 1 137 ? 14.865  18.274  30.305  1.00   40.37  ? 137  PHE A CG  1 
ATOM   1093 C CD1 . PHE A 1 137 ? 14.023  19.105  31.024  1.00   46.05  ? 137  PHE A CD1 1 
ATOM   1094 C CD2 . PHE A 1 137 ? 15.994  18.818  29.722  1.00   38.03  ? 137  PHE A CD2 1 
ATOM   1095 C CE1 . PHE A 1 137 ? 14.297  20.458  31.149  1.00   43.31  ? 137  PHE A CE1 1 
ATOM   1096 C CE2 . PHE A 1 137 ? 16.270  20.170  29.849  1.00   37.97  ? 137  PHE A CE2 1 
ATOM   1097 C CZ  . PHE A 1 137 ? 15.421  20.987  30.559  1.00   38.45  ? 137  PHE A CZ  1 
ATOM   1098 N N   . LEU A 1 138 ? 15.456  13.820  30.580  1.00   36.21  ? 138  LEU A N   1 
ATOM   1099 C CA  . LEU A 1 138 ? 15.331  12.367  30.479  1.00   39.21  ? 138  LEU A CA  1 
ATOM   1100 C C   . LEU A 1 138 ? 15.384  11.693  31.872  1.00   44.09  ? 138  LEU A C   1 
ATOM   1101 O O   . LEU A 1 138 ? 14.582  10.798  32.181  1.00   35.50  ? 138  LEU A O   1 
ATOM   1102 C CB  . LEU A 1 138 ? 16.383  11.786  29.518  1.00   36.80  ? 138  LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 138 ? 16.075  11.932  28.014  1.00   42.05  ? 138  LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 138 ? 17.299  11.797  27.127  1.00   33.42  ? 138  LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 138 ? 15.012  10.945  27.572  1.00   41.42  ? 138  LEU A CD2 1 
ATOM   1106 N N   . ALA A 1 139 ? 16.306  12.143  32.719  1.00   36.67  ? 139  ALA A N   1 
ATOM   1107 C CA  . ALA A 1 139 ? 16.364  11.644  34.098  1.00   46.59  ? 139  ALA A CA  1 
ATOM   1108 C C   . ALA A 1 139 ? 15.054  11.901  34.860  1.00   45.26  ? 139  ALA A C   1 
ATOM   1109 O O   . ALA A 1 139 ? 14.449  10.974  35.393  1.00   41.26  ? 139  ALA A O   1 
ATOM   1110 C CB  . ALA A 1 139 ? 17.547  12.253  34.850  1.00   40.71  ? 139  ALA A CB  1 
ATOM   1111 N N   . GLN A 1 140 ? 14.616  13.158  34.893  1.00   46.93  ? 140  GLN A N   1 
ATOM   1112 C CA  . GLN A 1 140 ? 13.447  13.543  35.688  1.00   42.91  ? 140  GLN A CA  1 
ATOM   1113 C C   . GLN A 1 140 ? 12.138  12.958  35.153  1.00   48.13  ? 140  GLN A C   1 
ATOM   1114 O O   . GLN A 1 140 ? 11.345  12.414  35.924  1.00   49.08  ? 140  GLN A O   1 
ATOM   1115 C CB  . GLN A 1 140 ? 13.341  15.068  35.814  1.00   38.73  ? 140  GLN A CB  1 
ATOM   1116 C CG  . GLN A 1 140 ? 12.566  15.539  37.040  1.00   43.81  ? 140  GLN A CG  1 
ATOM   1117 C CD  . GLN A 1 140 ? 11.071  15.247  36.930  1.00   52.27  ? 140  GLN A CD  1 
ATOM   1118 O OE1 . GLN A 1 140 ? 10.477  15.383  35.853  1.00   50.06  ? 140  GLN A OE1 1 
ATOM   1119 N NE2 . GLN A 1 140 ? 10.457  14.843  38.043  1.00   48.32  ? 140  GLN A NE2 1 
ATOM   1120 N N   . VAL A 1 141 ? 11.915  13.051  33.842  1.00   45.42  ? 141  VAL A N   1 
ATOM   1121 C CA  . VAL A 1 141 ? 10.625  12.659  33.282  1.00   42.30  ? 141  VAL A CA  1 
ATOM   1122 C C   . VAL A 1 141 ? 10.495  11.157  33.036  1.00   46.48  ? 141  VAL A C   1 
ATOM   1123 O O   . VAL A 1 141 ? 9.437   10.578  33.287  1.00   51.57  ? 141  VAL A O   1 
ATOM   1124 C CB  . VAL A 1 141 ? 10.290  13.454  32.000  1.00   46.15  ? 141  VAL A CB  1 
ATOM   1125 C CG1 . VAL A 1 141 ? 8.950   13.014  31.425  1.00   39.39  ? 141  VAL A CG1 1 
ATOM   1126 C CG2 . VAL A 1 141 ? 10.271  14.934  32.297  1.00   34.60  ? 141  VAL A CG2 1 
ATOM   1127 N N   . GLU A 1 142 ? 11.569  10.528  32.562  1.00   40.75  ? 142  GLU A N   1 
ATOM   1128 C CA  . GLU A 1 142 ? 11.537  9.106   32.224  1.00   38.92  ? 142  GLU A CA  1 
ATOM   1129 C C   . GLU A 1 142 ? 12.245  8.222   33.242  1.00   44.38  ? 142  GLU A C   1 
ATOM   1130 O O   . GLU A 1 142 ? 12.225  6.999   33.121  1.00   46.52  ? 142  GLU A O   1 
ATOM   1131 C CB  . GLU A 1 142 ? 12.159  8.870   30.852  1.00   43.64  ? 142  GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 142 ? 11.350  9.442   29.711  1.00   46.98  ? 142  GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 142 ? 10.002  8.774   29.570  1.00   54.90  ? 142  GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 142 ? 9.842   7.631   30.069  1.00   55.97  ? 142  GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 142 ? 9.110   9.395   28.955  1.00   54.09  ? 142  GLU A OE2 1 
ATOM   1136 N N   . GLY A 1 143 ? 12.884  8.843   34.227  1.00   41.57  ? 143  GLY A N   1 
ATOM   1137 C CA  . GLY A 1 143 ? 13.622  8.113   35.239  1.00   44.96  ? 143  GLY A CA  1 
ATOM   1138 C C   . GLY A 1 143 ? 14.861  7.419   34.708  1.00   46.96  ? 143  GLY A C   1 
ATOM   1139 O O   . GLY A 1 143 ? 15.308  6.416   35.267  1.00   49.48  ? 143  GLY A O   1 
ATOM   1140 N N   . ALA A 1 144 ? 15.421  7.957   33.627  1.00   48.76  ? 144  ALA A N   1 
ATOM   1141 C CA  . ALA A 1 144 ? 16.604  7.375   32.994  1.00   44.10  ? 144  ALA A CA  1 
ATOM   1142 C C   . ALA A 1 144 ? 17.872  7.625   33.802  1.00   40.86  ? 144  ALA A C   1 
ATOM   1143 O O   . ALA A 1 144 ? 17.991  8.637   34.487  1.00   40.15  ? 144  ALA A O   1 
ATOM   1144 C CB  . ALA A 1 144 ? 16.769  7.938   31.604  1.00   42.44  ? 144  ALA A CB  1 
ATOM   1145 N N   . VAL A 1 145 ? 18.810  6.691   33.747  1.00   42.34  ? 145  VAL A N   1 
ATOM   1146 C CA  . VAL A 1 145 ? 20.175  7.011   34.143  1.00   36.62  ? 145  VAL A CA  1 
ATOM   1147 C C   . VAL A 1 145 ? 20.927  7.391   32.862  1.00   45.29  ? 145  VAL A C   1 
ATOM   1148 O O   . VAL A 1 145 ? 21.070  6.575   31.932  1.00   37.58  ? 145  VAL A O   1 
ATOM   1149 C CB  . VAL A 1 145 ? 20.866  5.854   34.865  1.00   38.59  ? 145  VAL A CB  1 
ATOM   1150 C CG1 . VAL A 1 145 ? 22.352  6.162   35.062  1.00   39.74  ? 145  VAL A CG1 1 
ATOM   1151 C CG2 . VAL A 1 145 ? 20.191  5.596   36.220  1.00   38.13  ? 145  VAL A CG2 1 
ATOM   1152 N N   . LEU A 1 146 ? 21.354  8.649   32.793  1.00   35.86  ? 146  LEU A N   1 
ATOM   1153 C CA  . LEU A 1 146 ? 22.005  9.149   31.592  1.00   37.90  ? 146  LEU A CA  1 
ATOM   1154 C C   . LEU A 1 146 ? 23.491  9.438   31.829  1.00   38.27  ? 146  LEU A C   1 
ATOM   1155 O O   . LEU A 1 146 ? 23.873  10.088  32.810  1.00   34.76  ? 146  LEU A O   1 
ATOM   1156 C CB  . LEU A 1 146 ? 21.277  10.381  31.043  1.00   33.11  ? 146  LEU A CB  1 
ATOM   1157 C CG  . LEU A 1 146 ? 21.364  10.515  29.518  1.00   39.91  ? 146  LEU A CG  1 
ATOM   1158 C CD1 . LEU A 1 146 ? 20.064  11.054  28.918  1.00   42.55  ? 146  LEU A CD1 1 
ATOM   1159 C CD2 . LEU A 1 146 ? 22.530  11.389  29.134  1.00   40.99  ? 146  LEU A CD2 1 
ATOM   1160 N N   . VAL A 1 147 ? 24.319  8.936   30.920  1.00   34.62  ? 147  VAL A N   1 
ATOM   1161 C CA  . VAL A 1 147 ? 25.755  9.110   31.012  1.00   33.12  ? 147  VAL A CA  1 
ATOM   1162 C C   . VAL A 1 147 ? 26.267  9.697   29.711  1.00   37.91  ? 147  VAL A C   1 
ATOM   1163 O O   . VAL A 1 147 ? 25.852  9.284   28.636  1.00   36.80  ? 147  VAL A O   1 
ATOM   1164 C CB  . VAL A 1 147 ? 26.472  7.763   31.245  1.00   33.71  ? 147  VAL A CB  1 
ATOM   1165 C CG1 . VAL A 1 147 ? 27.984  7.958   31.277  1.00   32.30  ? 147  VAL A CG1 1 
ATOM   1166 C CG2 . VAL A 1 147 ? 25.980  7.098   32.527  1.00   35.09  ? 147  VAL A CG2 1 
ATOM   1167 N N   . SER A 1 148 ? 27.176  10.655  29.808  1.00   31.50  ? 148  SER A N   1 
ATOM   1168 C CA  . SER A 1 148 ? 27.806  11.205  28.626  1.00   35.60  ? 148  SER A CA  1 
ATOM   1169 C C   . SER A 1 148 ? 29.281  11.436  28.926  1.00   32.98  ? 148  SER A C   1 
ATOM   1170 O O   . SER A 1 148 ? 29.642  11.852  30.029  1.00   35.87  ? 148  SER A O   1 
ATOM   1171 C CB  . SER A 1 148 ? 27.134  12.524  28.237  1.00   34.00  ? 148  SER A CB  1 
ATOM   1172 O OG  . SER A 1 148 ? 27.236  13.442  29.309  1.00   34.27  ? 148  SER A OG  1 
ATOM   1173 N N   . MET A 1 149 ? 30.139  11.177  27.948  1.00   32.77  ? 149  MET A N   1 
ATOM   1174 C CA  . MET A 1 149 ? 31.581  11.324  28.167  1.00   29.57  ? 149  MET A CA  1 
ATOM   1175 C C   . MET A 1 149 ? 32.236  12.278  27.180  1.00   35.61  ? 149  MET A C   1 
ATOM   1176 O O   . MET A 1 149 ? 31.817  12.375  26.015  1.00   34.38  ? 149  MET A O   1 
ATOM   1177 C CB  . MET A 1 149 ? 32.269  9.968   28.051  1.00   30.16  ? 149  MET A CB  1 
ATOM   1178 C CG  . MET A 1 149 ? 32.671  9.591   26.613  1.00   34.93  ? 149  MET A CG  1 
ATOM   1179 S SD  . MET A 1 149 ? 31.297  9.063   25.572  1.00   41.09  ? 149  MET A SD  1 
ATOM   1180 C CE  . MET A 1 149 ? 30.866  7.482   26.279  1.00   33.43  ? 149  MET A CE  1 
ATOM   1181 N N   . ASN A 1 150 ? 33.267  12.979  27.644  1.00   34.95  ? 150  ASN A N   1 
ATOM   1182 C CA  . ASN A 1 150 ? 34.193  13.632  26.720  1.00   34.09  ? 150  ASN A CA  1 
ATOM   1183 C C   . ASN A 1 150 ? 35.096  12.570  26.081  1.00   37.17  ? 150  ASN A C   1 
ATOM   1184 O O   . ASN A 1 150 ? 35.431  11.569  26.713  1.00   37.42  ? 150  ASN A O   1 
ATOM   1185 C CB  . ASN A 1 150 ? 35.047  14.683  27.432  1.00   32.27  ? 150  ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 150 ? 34.279  15.972  27.749  1.00   38.77  ? 150  ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 150 ? 33.095  16.123  27.430  1.00   31.71  ? 150  ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 150 ? 34.972  16.916  28.372  1.00   36.87  ? 150  ASN A ND2 1 
ATOM   1189 N N   . TYR A 1 151 ? 35.457  12.767  24.819  1.00   37.93  ? 151  TYR A N   1 
ATOM   1190 C CA  . TYR A 1 151 ? 36.495  11.957  24.188  1.00   33.92  ? 151  TYR A CA  1 
ATOM   1191 C C   . TYR A 1 151 ? 37.332  12.846  23.288  1.00   37.65  ? 151  TYR A C   1 
ATOM   1192 O O   . TYR A 1 151 ? 36.839  13.863  22.776  1.00   39.09  ? 151  TYR A O   1 
ATOM   1193 C CB  . TYR A 1 151 ? 35.902  10.793  23.397  1.00   33.62  ? 151  TYR A CB  1 
ATOM   1194 C CG  . TYR A 1 151 ? 35.018  11.211  22.248  1.00   37.46  ? 151  TYR A CG  1 
ATOM   1195 C CD1 . TYR A 1 151 ? 33.656  11.445  22.441  1.00   32.81  ? 151  TYR A CD1 1 
ATOM   1196 C CD2 . TYR A 1 151 ? 35.545  11.380  20.963  1.00   33.62  ? 151  TYR A CD2 1 
ATOM   1197 C CE1 . TYR A 1 151 ? 32.839  11.832  21.381  1.00   33.87  ? 151  TYR A CE1 1 
ATOM   1198 C CE2 . TYR A 1 151 ? 34.745  11.771  19.908  1.00   30.64  ? 151  TYR A CE2 1 
ATOM   1199 C CZ  . TYR A 1 151 ? 33.394  11.998  20.113  1.00   34.21  ? 151  TYR A CZ  1 
ATOM   1200 O OH  . TYR A 1 151 ? 32.600  12.368  19.043  1.00   29.87  ? 151  TYR A OH  1 
ATOM   1201 N N   . ARG A 1 152 ? 38.597  12.480  23.111  1.00   35.24  ? 152  ARG A N   1 
ATOM   1202 C CA  . ARG A 1 152 ? 39.522  13.303  22.335  1.00   36.10  ? 152  ARG A CA  1 
ATOM   1203 C C   . ARG A 1 152 ? 39.128  13.374  20.867  1.00   35.30  ? 152  ARG A C   1 
ATOM   1204 O O   . ARG A 1 152 ? 38.828  12.357  20.228  1.00   38.70  ? 152  ARG A O   1 
ATOM   1205 C CB  . ARG A 1 152 ? 40.960  12.789  22.455  1.00   37.22  ? 152  ARG A CB  1 
ATOM   1206 C CG  . ARG A 1 152 ? 41.627  13.090  23.786  1.00   36.68  ? 152  ARG A CG  1 
ATOM   1207 C CD  . ARG A 1 152 ? 42.965  12.361  23.883  1.00   36.68  ? 152  ARG A CD  1 
ATOM   1208 N NE  . ARG A 1 152 ? 42.772  10.948  24.158  1.00   32.82  ? 152  ARG A NE  1 
ATOM   1209 C CZ  . ARG A 1 152 ? 43.741  10.036  24.167  1.00   40.13  ? 152  ARG A CZ  1 
ATOM   1210 N NH1 . ARG A 1 152 ? 44.998  10.376  23.893  1.00   34.08  ? 152  ARG A NH1 1 
ATOM   1211 N NH2 . ARG A 1 152 ? 43.442  8.770   24.443  1.00   35.32  ? 152  ARG A NH2 1 
ATOM   1212 N N   . VAL A 1 153 ? 39.151  14.586  20.336  1.00   30.06  ? 153  VAL A N   1 
ATOM   1213 C CA  . VAL A 1 153 ? 38.838  14.811  18.944  1.00   33.73  ? 153  VAL A CA  1 
ATOM   1214 C C   . VAL A 1 153 ? 40.055  15.406  18.219  1.00   40.51  ? 153  VAL A C   1 
ATOM   1215 O O   . VAL A 1 153 ? 41.067  15.772  18.849  1.00   33.15  ? 153  VAL A O   1 
ATOM   1216 C CB  . VAL A 1 153 ? 37.649  15.762  18.830  1.00   35.20  ? 153  VAL A CB  1 
ATOM   1217 C CG1 . VAL A 1 153 ? 36.384  15.069  19.298  1.00   35.90  ? 153  VAL A CG1 1 
ATOM   1218 C CG2 . VAL A 1 153 ? 37.896  17.006  19.651  1.00   23.82  ? 153  VAL A CG2 1 
ATOM   1219 N N   . GLY A 1 154 ? 39.950  15.511  16.898  1.00   34.72  ? 154  GLY A N   1 
ATOM   1220 C CA  . GLY A 1 154 ? 41.001  16.130  16.107  1.00   34.76  ? 154  GLY A CA  1 
ATOM   1221 C C   . GLY A 1 154 ? 42.247  15.266  16.073  1.00   37.71  ? 154  GLY A C   1 
ATOM   1222 O O   . GLY A 1 154 ? 42.178  14.034  16.131  1.00   40.11  ? 154  GLY A O   1 
ATOM   1223 N N   . THR A 1 155 ? 43.396  15.916  15.979  1.00   37.26  ? 155  THR A N   1 
ATOM   1224 C CA  . THR A 1 155 ? 44.672  15.218  16.020  1.00   42.15  ? 155  THR A CA  1 
ATOM   1225 C C   . THR A 1 155 ? 44.830  14.414  17.324  1.00   40.12  ? 155  THR A C   1 
ATOM   1226 O O   . THR A 1 155 ? 45.194  13.238  17.299  1.00   41.55  ? 155  THR A O   1 
ATOM   1227 C CB  . THR A 1 155 ? 45.856  16.196  15.839  1.00   38.00  ? 155  THR A CB  1 
ATOM   1228 O OG1 . THR A 1 155 ? 45.801  17.225  16.837  1.00   33.57  ? 155  THR A OG1 1 
ATOM   1229 C CG2 . THR A 1 155 ? 45.810  16.822  14.460  1.00   33.64  ? 155  THR A CG2 1 
ATOM   1230 N N   . PHE A 1 156 ? 44.527  15.048  18.451  1.00   35.64  ? 156  PHE A N   1 
ATOM   1231 C CA  . PHE A 1 156 ? 44.683  14.416  19.761  1.00   39.13  ? 156  PHE A CA  1 
ATOM   1232 C C   . PHE A 1 156 ? 43.922  13.099  19.837  1.00   41.65  ? 156  PHE A C   1 
ATOM   1233 O O   . PHE A 1 156 ? 44.366  12.158  20.485  1.00   40.10  ? 156  PHE A O   1 
ATOM   1234 C CB  . PHE A 1 156 ? 44.226  15.368  20.867  1.00   34.96  ? 156  PHE A CB  1 
ATOM   1235 C CG  . PHE A 1 156 ? 44.701  16.783  20.669  1.00   41.04  ? 156  PHE A CG  1 
ATOM   1236 C CD1 . PHE A 1 156 ? 45.941  17.188  21.141  1.00   39.33  ? 156  PHE A CD1 1 
ATOM   1237 C CD2 . PHE A 1 156 ? 43.922  17.698  19.976  1.00   39.68  ? 156  PHE A CD2 1 
ATOM   1238 C CE1 . PHE A 1 156 ? 46.385  18.481  20.948  1.00   39.65  ? 156  PHE A CE1 1 
ATOM   1239 C CE2 . PHE A 1 156 ? 44.359  18.996  19.783  1.00   36.50  ? 156  PHE A CE2 1 
ATOM   1240 C CZ  . PHE A 1 156 ? 45.590  19.388  20.266  1.00   39.11  ? 156  PHE A CZ  1 
ATOM   1241 N N   . GLY A 1 157 ? 42.792  13.024  19.143  1.00   40.97  ? 157  GLY A N   1 
ATOM   1242 C CA  . GLY A 1 157 ? 41.963  11.840  19.206  1.00   36.60  ? 157  GLY A CA  1 
ATOM   1243 C C   . GLY A 1 157 ? 42.152  10.871  18.060  1.00   37.02  ? 157  GLY A C   1 
ATOM   1244 O O   . GLY A 1 157 ? 41.805  9.699   18.185  1.00   36.97  ? 157  GLY A O   1 
ATOM   1245 N N   . PHE A 1 158 ? 42.698  11.343  16.942  1.00   37.25  ? 158  PHE A N   1 
ATOM   1246 C CA  . PHE A 1 158 ? 42.634  10.546  15.719  1.00   35.40  ? 158  PHE A CA  1 
ATOM   1247 C C   . PHE A 1 158 ? 43.843  10.606  14.796  1.00   37.02  ? 158  PHE A C   1 
ATOM   1248 O O   . PHE A 1 158 ? 43.919  9.860   13.825  1.00   34.55  ? 158  PHE A O   1 
ATOM   1249 C CB  . PHE A 1 158 ? 41.315  10.809  14.972  1.00   33.21  ? 158  PHE A CB  1 
ATOM   1250 C CG  . PHE A 1 158 ? 40.108  10.409  15.773  1.00   35.46  ? 158  PHE A CG  1 
ATOM   1251 C CD1 . PHE A 1 158 ? 39.718  9.075   15.839  1.00   34.41  ? 158  PHE A CD1 1 
ATOM   1252 C CD2 . PHE A 1 158 ? 39.422  11.345  16.531  1.00   31.57  ? 158  PHE A CD2 1 
ATOM   1253 C CE1 . PHE A 1 158 ? 38.641  8.696   16.610  1.00   32.72  ? 158  PHE A CE1 1 
ATOM   1254 C CE2 . PHE A 1 158 ? 38.331  10.978  17.303  1.00   31.29  ? 158  PHE A CE2 1 
ATOM   1255 C CZ  . PHE A 1 158 ? 37.941  9.648   17.345  1.00   32.53  ? 158  PHE A CZ  1 
ATOM   1256 N N   . LEU A 1 159 ? 44.801  11.468  15.101  1.00   39.38  ? 159  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 159 ? 46.022  11.447  14.317  1.00   39.46  ? 159  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 159 ? 46.679  10.081  14.458  1.00   39.46  ? 159  LEU A C   1 
ATOM   1259 O O   . LEU A 1 159 ? 46.864  9.571   15.558  1.00   40.82  ? 159  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 159 ? 46.968  12.569  14.722  1.00   38.50  ? 159  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 159 ? 48.219  12.649  13.848  1.00   44.66  ? 159  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 159 ? 48.639  14.104  13.628  1.00   39.68  ? 159  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 159 ? 49.354  11.813  14.454  1.00   43.25  ? 159  LEU A CD2 1 
ATOM   1264 N N   . ALA A 1 160 ? 47.012  9.479   13.329  1.00   39.66  ? 160  ALA A N   1 
ATOM   1265 C CA  . ALA A 1 160 ? 47.521  8.124   13.336  1.00   35.62  ? 160  ALA A CA  1 
ATOM   1266 C C   . ALA A 1 160 ? 48.699  7.922   12.380  1.00   39.11  ? 160  ALA A C   1 
ATOM   1267 O O   . ALA A 1 160 ? 48.730  8.437   11.260  1.00   37.91  ? 160  ALA A O   1 
ATOM   1268 C CB  . ALA A 1 160 ? 46.412  7.156   13.022  1.00   42.33  ? 160  ALA A CB  1 
ATOM   1269 N N   . LEU A 1 161 ? 49.691  7.191   12.866  1.00   43.54  ? 161  LEU A N   1 
ATOM   1270 C CA  . LEU A 1 161 ? 50.731  6.634   12.019  1.00   43.72  ? 161  LEU A CA  1 
ATOM   1271 C C   . LEU A 1 161 ? 50.540  5.146   12.136  1.00   42.42  ? 161  LEU A C   1 
ATOM   1272 O O   . LEU A 1 161 ? 51.136  4.500   12.998  1.00   43.60  ? 161  LEU A O   1 
ATOM   1273 C CB  . LEU A 1 161 ? 52.106  7.077   12.501  1.00   40.60  ? 161  LEU A CB  1 
ATOM   1274 C CG  . LEU A 1 161 ? 52.202  8.569   12.192  1.00   44.27  ? 161  LEU A CG  1 
ATOM   1275 C CD1 . LEU A 1 161 ? 53.331  9.235   12.920  1.00   51.29  ? 161  LEU A CD1 1 
ATOM   1276 C CD2 . LEU A 1 161 ? 52.323  8.763   10.697  1.00   42.16  ? 161  LEU A CD2 1 
ATOM   1277 N N   . PRO A 1 162 ? 49.647  4.605   11.301  1.00   46.24  ? 162  PRO A N   1 
ATOM   1278 C CA  . PRO A 1 162 ? 49.180  3.224   11.451  1.00   47.43  ? 162  PRO A CA  1 
ATOM   1279 C C   . PRO A 1 162 ? 50.353  2.272   11.572  1.00   52.89  ? 162  PRO A C   1 
ATOM   1280 O O   . PRO A 1 162 ? 51.293  2.365   10.781  1.00   49.38  ? 162  PRO A O   1 
ATOM   1281 C CB  . PRO A 1 162 ? 48.405  2.980   10.159  1.00   40.62  ? 162  PRO A CB  1 
ATOM   1282 C CG  . PRO A 1 162 ? 47.901  4.340   9.784   1.00   41.32  ? 162  PRO A CG  1 
ATOM   1283 C CD  . PRO A 1 162 ? 48.995  5.292   10.175  1.00   39.20  ? 162  PRO A CD  1 
ATOM   1284 N N   . GLY A 1 163 ? 50.304  1.389   12.567  1.00   57.39  ? 163  GLY A N   1 
ATOM   1285 C CA  . GLY A 1 163 ? 51.360  0.421   12.790  1.00   45.64  ? 163  GLY A CA  1 
ATOM   1286 C C   . GLY A 1 163 ? 52.303  0.826   13.902  1.00   52.55  ? 163  GLY A C   1 
ATOM   1287 O O   . GLY A 1 163 ? 52.847  -0.032  14.593  1.00   56.89  ? 163  GLY A O   1 
ATOM   1288 N N   . SER A 1 164 ? 52.501  2.130   14.077  1.00   46.80  ? 164  SER A N   1 
ATOM   1289 C CA  . SER A 1 164 ? 53.383  2.633   15.127  1.00   46.05  ? 164  SER A CA  1 
ATOM   1290 C C   . SER A 1 164 ? 52.861  2.335   16.536  1.00   53.41  ? 164  SER A C   1 
ATOM   1291 O O   . SER A 1 164 ? 51.703  1.949   16.731  1.00   56.27  ? 164  SER A O   1 
ATOM   1292 C CB  . SER A 1 164 ? 53.604  4.139   14.980  1.00   48.57  ? 164  SER A CB  1 
ATOM   1293 O OG  . SER A 1 164 ? 52.456  4.865   15.392  1.00   50.67  ? 164  SER A OG  1 
ATOM   1294 N N   . ARG A 1 165 ? 53.728  2.536   17.519  1.00   53.38  ? 165  ARG A N   1 
ATOM   1295 C CA  . ARG A 1 165 ? 53.381  2.275   18.901  1.00   62.16  ? 165  ARG A CA  1 
ATOM   1296 C C   . ARG A 1 165 ? 52.841  3.553   19.526  1.00   58.68  ? 165  ARG A C   1 
ATOM   1297 O O   . ARG A 1 165 ? 51.937  3.520   20.360  1.00   58.39  ? 165  ARG A O   1 
ATOM   1298 C CB  . ARG A 1 165 ? 54.628  1.824   19.657  1.00   69.37  ? 165  ARG A CB  1 
ATOM   1299 C CG  . ARG A 1 165 ? 54.355  1.060   20.936  1.00   77.72  ? 165  ARG A CG  1 
ATOM   1300 C CD  . ARG A 1 165 ? 55.470  1.311   21.937  1.00   83.69  ? 165  ARG A CD  1 
ATOM   1301 N NE  . ARG A 1 165 ? 55.138  2.407   22.848  1.00   96.18  ? 165  ARG A NE  1 
ATOM   1302 C CZ  . ARG A 1 165 ? 55.972  3.387   23.190  1.00   93.19  ? 165  ARG A CZ  1 
ATOM   1303 N NH1 . ARG A 1 165 ? 57.197  3.433   22.675  1.00   90.74  ? 165  ARG A NH1 1 
ATOM   1304 N NH2 . ARG A 1 165 ? 55.573  4.332   24.035  1.00   82.56  ? 165  ARG A NH2 1 
ATOM   1305 N N   . GLU A 1 166 ? 53.397  4.678   19.087  1.00   48.82  ? 166  GLU A N   1 
ATOM   1306 C CA  . GLU A 1 166 ? 53.154  5.974   19.700  1.00   45.23  ? 166  GLU A CA  1 
ATOM   1307 C C   . GLU A 1 166 ? 51.942  6.755   19.139  1.00   51.88  ? 166  GLU A C   1 
ATOM   1308 O O   . GLU A 1 166 ? 51.606  7.831   19.642  1.00   46.46  ? 166  GLU A O   1 
ATOM   1309 C CB  . GLU A 1 166 ? 54.426  6.826   19.602  1.00   51.50  ? 166  GLU A CB  1 
ATOM   1310 C CG  . GLU A 1 166 ? 55.705  6.131   20.099  1.00   58.35  ? 166  GLU A CG  1 
ATOM   1311 C CD  . GLU A 1 166 ? 56.420  5.296   19.019  1.00   69.33  ? 166  GLU A CD  1 
ATOM   1312 O OE1 . GLU A 1 166 ? 55.796  4.938   17.982  1.00   56.13  ? 166  GLU A OE1 1 
ATOM   1313 O OE2 . GLU A 1 166 ? 57.625  5.001   19.221  1.00   66.91  ? 166  GLU A OE2 1 
ATOM   1314 N N   . ALA A 1 167 ? 51.288  6.208   18.115  1.00   48.05  ? 167  ALA A N   1 
ATOM   1315 C CA  . ALA A 1 167 ? 50.148  6.863   17.482  1.00   43.26  ? 167  ALA A CA  1 
ATOM   1316 C C   . ALA A 1 167 ? 49.408  5.859   16.636  1.00   43.99  ? 167  ALA A C   1 
ATOM   1317 O O   . ALA A 1 167 ? 49.415  5.953   15.407  1.00   44.64  ? 167  ALA A O   1 
ATOM   1318 C CB  . ALA A 1 167 ? 50.606  8.029   16.618  1.00   44.20  ? 167  ALA A CB  1 
ATOM   1319 N N   . PRO A 1 168 ? 48.756  4.895   17.296  1.00   45.30  ? 168  PRO A N   1 
ATOM   1320 C CA  . PRO A 1 168 ? 48.095  3.744   16.666  1.00   36.81  ? 168  PRO A CA  1 
ATOM   1321 C C   . PRO A 1 168 ? 46.815  4.134   15.926  1.00   44.85  ? 168  PRO A C   1 
ATOM   1322 O O   . PRO A 1 168 ? 46.343  3.387   15.057  1.00   42.09  ? 168  PRO A O   1 
ATOM   1323 C CB  . PRO A 1 168 ? 47.722  2.852   17.856  1.00   44.24  ? 168  PRO A CB  1 
ATOM   1324 C CG  . PRO A 1 168 ? 48.137  3.589   19.097  1.00   39.17  ? 168  PRO A CG  1 
ATOM   1325 C CD  . PRO A 1 168 ? 48.499  4.975   18.742  1.00   42.36  ? 168  PRO A CD  1 
ATOM   1326 N N   . GLY A 1 169 ? 46.251  5.285   16.283  1.00   39.91  ? 169  GLY A N   1 
ATOM   1327 C CA  . GLY A 1 169 ? 44.980  5.706   15.726  1.00   42.01  ? 169  GLY A CA  1 
ATOM   1328 C C   . GLY A 1 169 ? 43.786  5.314   16.584  1.00   43.80  ? 169  GLY A C   1 
ATOM   1329 O O   . GLY A 1 169 ? 43.882  4.453   17.469  1.00   42.17  ? 169  GLY A O   1 
ATOM   1330 N N   . ASN A 1 170 ? 42.664  5.978   16.336  1.00   38.03  ? 170  ASN A N   1 
ATOM   1331 C CA  . ASN A 1 170 ? 41.399  5.642   16.975  1.00   34.25  ? 170  ASN A CA  1 
ATOM   1332 C C   . ASN A 1 170 ? 41.373  5.835   18.505  1.00   35.53  ? 170  ASN A C   1 
ATOM   1333 O O   . ASN A 1 170 ? 40.459  5.348   19.173  1.00   36.59  ? 170  ASN A O   1 
ATOM   1334 C CB  . ASN A 1 170 ? 40.987  4.204   16.608  1.00   30.22  ? 170  ASN A CB  1 
ATOM   1335 C CG  . ASN A 1 170 ? 40.732  4.024   15.117  1.00   40.13  ? 170  ASN A CG  1 
ATOM   1336 O OD1 . ASN A 1 170 ? 40.330  4.957   14.427  1.00   41.30  ? 170  ASN A OD1 1 
ATOM   1337 N ND2 . ASN A 1 170 ? 40.970  2.815   14.613  1.00   37.49  ? 170  ASN A ND2 1 
ATOM   1338 N N   . VAL A 1 171 ? 42.346  6.539   19.073  1.00   31.69  ? 171  VAL A N   1 
ATOM   1339 C CA  . VAL A 1 171 ? 42.371  6.638   20.532  1.00   33.68  ? 171  VAL A CA  1 
ATOM   1340 C C   . VAL A 1 171 ? 41.153  7.392   21.100  1.00   39.19  ? 171  VAL A C   1 
ATOM   1341 O O   . VAL A 1 171 ? 40.756  7.169   22.247  1.00   36.97  ? 171  VAL A O   1 
ATOM   1342 C CB  . VAL A 1 171 ? 43.727  7.143   21.097  1.00   34.55  ? 171  VAL A CB  1 
ATOM   1343 C CG1 . VAL A 1 171 ? 44.876  6.374   20.453  1.00   34.23  ? 171  VAL A CG1 1 
ATOM   1344 C CG2 . VAL A 1 171 ? 43.896  8.634   20.909  1.00   34.31  ? 171  VAL A CG2 1 
ATOM   1345 N N   . GLY A 1 172 ? 40.537  8.243   20.283  1.00   35.19  ? 172  GLY A N   1 
ATOM   1346 C CA  . GLY A 1 172 ? 39.280  8.869   20.658  1.00   32.71  ? 172  GLY A CA  1 
ATOM   1347 C C   . GLY A 1 172 ? 38.178  7.849   20.902  1.00   34.75  ? 172  GLY A C   1 
ATOM   1348 O O   . GLY A 1 172 ? 37.375  7.986   21.827  1.00   33.71  ? 172  GLY A O   1 
ATOM   1349 N N   . LEU A 1 173 ? 38.143  6.826   20.054  1.00   30.24  ? 173  LEU A N   1 
ATOM   1350 C CA  . LEU A 1 173 ? 37.186  5.741   20.178  1.00   30.64  ? 173  LEU A CA  1 
ATOM   1351 C C   . LEU A 1 173 ? 37.489  4.873   21.408  1.00   36.25  ? 173  LEU A C   1 
ATOM   1352 O O   . LEU A 1 173 ? 36.578  4.391   22.083  1.00   35.90  ? 173  LEU A O   1 
ATOM   1353 C CB  . LEU A 1 173 ? 37.197  4.889   18.906  1.00   31.89  ? 173  LEU A CB  1 
ATOM   1354 C CG  . LEU A 1 173 ? 36.533  5.537   17.693  1.00   31.56  ? 173  LEU A CG  1 
ATOM   1355 C CD1 . LEU A 1 173 ? 36.634  4.644   16.455  1.00   33.20  ? 173  LEU A CD1 1 
ATOM   1356 C CD2 . LEU A 1 173 ? 35.085  5.832   18.019  1.00   34.30  ? 173  LEU A CD2 1 
ATOM   1357 N N   . LEU A 1 174 ? 38.773  4.686   21.691  1.00   34.73  ? 174  LEU A N   1 
ATOM   1358 C CA  . LEU A 1 174 ? 39.193  3.995   22.894  1.00   37.13  ? 174  LEU A CA  1 
ATOM   1359 C C   . LEU A 1 174 ? 38.782  4.776   24.143  1.00   39.47  ? 174  LEU A C   1 
ATOM   1360 O O   . LEU A 1 174 ? 38.398  4.161   25.129  1.00   36.51  ? 174  LEU A O   1 
ATOM   1361 C CB  . LEU A 1 174 ? 40.703  3.722   22.884  1.00   36.37  ? 174  LEU A CB  1 
ATOM   1362 C CG  . LEU A 1 174 ? 41.203  2.763   21.797  1.00   37.90  ? 174  LEU A CG  1 
ATOM   1363 C CD1 . LEU A 1 174 ? 42.709  2.682   21.833  1.00   36.39  ? 174  LEU A CD1 1 
ATOM   1364 C CD2 . LEU A 1 174 ? 40.584  1.386   21.944  1.00   34.60  ? 174  LEU A CD2 1 
ATOM   1365 N N   . ASP A 1 175 ? 38.846  6.114   24.093  1.00   37.96  ? 175  ASP A N   1 
ATOM   1366 C CA  . ASP A 1 175 ? 38.347  6.952   25.194  1.00   37.38  ? 175  ASP A CA  1 
ATOM   1367 C C   . ASP A 1 175 ? 36.885  6.605   25.459  1.00   37.52  ? 175  ASP A C   1 
ATOM   1368 O O   . ASP A 1 175 ? 36.457  6.417   26.603  1.00   32.64  ? 175  ASP A O   1 
ATOM   1369 C CB  . ASP A 1 175 ? 38.435  8.453   24.870  1.00   30.01  ? 175  ASP A CB  1 
ATOM   1370 C CG  . ASP A 1 175 ? 39.873  8.958   24.727  1.00   39.38  ? 175  ASP A CG  1 
ATOM   1371 O OD1 . ASP A 1 175 ? 40.824  8.265   25.159  1.00   37.94  ? 175  ASP A OD1 1 
ATOM   1372 O OD2 . ASP A 1 175 ? 40.050  10.069  24.174  1.00   39.43  ? 175  ASP A OD2 1 
ATOM   1373 N N   . GLN A 1 176 ? 36.118  6.527   24.379  1.00   37.30  ? 176  GLN A N   1 
ATOM   1374 C CA  . GLN A 1 176 ? 34.721  6.158   24.471  1.00   37.85  ? 176  GLN A CA  1 
ATOM   1375 C C   . GLN A 1 176 ? 34.575  4.776   25.106  1.00   39.50  ? 176  GLN A C   1 
ATOM   1376 O O   . GLN A 1 176 ? 33.809  4.599   26.059  1.00   38.86  ? 176  GLN A O   1 
ATOM   1377 C CB  . GLN A 1 176 ? 34.056  6.201   23.090  1.00   35.83  ? 176  GLN A CB  1 
ATOM   1378 C CG  . GLN A 1 176 ? 33.952  7.596   22.490  1.00   32.84  ? 176  GLN A CG  1 
ATOM   1379 C CD  . GLN A 1 176 ? 33.416  7.576   21.068  1.00   40.69  ? 176  GLN A CD  1 
ATOM   1380 O OE1 . GLN A 1 176 ? 32.802  6.595   20.643  1.00   39.39  ? 176  GLN A OE1 1 
ATOM   1381 N NE2 . GLN A 1 176 ? 33.644  8.663   20.324  1.00   34.69  ? 176  GLN A NE2 1 
ATOM   1382 N N   . ARG A 1 177 ? 35.306  3.799   24.574  1.00   39.72  ? 177  ARG A N   1 
ATOM   1383 C CA  . ARG A 1 177 ? 35.237  2.437   25.100  1.00   40.69  ? 177  ARG A CA  1 
ATOM   1384 C C   . ARG A 1 177 ? 35.585  2.374   26.593  1.00   40.88  ? 177  ARG A C   1 
ATOM   1385 O O   . ARG A 1 177 ? 34.939  1.660   27.355  1.00   38.38  ? 177  ARG A O   1 
ATOM   1386 C CB  . ARG A 1 177 ? 36.152  1.500   24.316  1.00   37.44  ? 177  ARG A CB  1 
ATOM   1387 C CG  . ARG A 1 177 ? 36.271  0.116   24.931  1.00   40.54  ? 177  ARG A CG  1 
ATOM   1388 C CD  . ARG A 1 177 ? 37.189  -0.761  24.105  1.00   36.49  ? 177  ARG A CD  1 
ATOM   1389 N NE  . ARG A 1 177 ? 36.589  -1.073  22.811  1.00   42.28  ? 177  ARG A NE  1 
ATOM   1390 C CZ  . ARG A 1 177 ? 37.279  -1.515  21.765  1.00   38.47  ? 177  ARG A CZ  1 
ATOM   1391 N NH1 . ARG A 1 177 ? 38.588  -1.688  21.872  1.00   38.59  ? 177  ARG A NH1 1 
ATOM   1392 N NH2 . ARG A 1 177 ? 36.667  -1.788  20.622  1.00   37.02  ? 177  ARG A NH2 1 
ATOM   1393 N N   . LEU A 1 178 ? 36.603  3.124   27.003  1.00   35.65  ? 178  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 178 ? 37.001  3.136   28.399  1.00   37.97  ? 178  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 178 ? 35.843  3.620   29.273  1.00   41.56  ? 178  LEU A C   1 
ATOM   1396 O O   . LEU A 1 178 ? 35.603  3.093   30.355  1.00   43.07  ? 178  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 178 ? 38.236  4.002   28.597  1.00   32.26  ? 178  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 178 ? 38.688  4.225   30.040  1.00   42.01  ? 178  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 178 ? 38.821  2.916   30.805  1.00   36.11  ? 178  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 178 ? 39.995  5.005   30.041  1.00   34.72  ? 178  LEU A CD2 1 
ATOM   1401 N N   . ALA A 1 179 ? 35.108  4.607   28.779  1.00   39.90  ? 179  ALA A N   1 
ATOM   1402 C CA  . ALA A 1 179 ? 33.968  5.136   29.509  1.00   34.33  ? 179  ALA A CA  1 
ATOM   1403 C C   . ALA A 1 179 ? 32.783  4.152   29.524  1.00   35.04  ? 179  ALA A C   1 
ATOM   1404 O O   . ALA A 1 179 ? 32.030  4.107   30.494  1.00   37.46  ? 179  ALA A O   1 
ATOM   1405 C CB  . ALA A 1 179 ? 33.561  6.509   28.951  1.00   28.93  ? 179  ALA A CB  1 
ATOM   1406 N N   . LEU A 1 180 ? 32.618  3.360   28.467  1.00   31.39  ? 180  LEU A N   1 
ATOM   1407 C CA  . LEU A 1 180 ? 31.599  2.308   28.491  1.00   42.95  ? 180  LEU A CA  1 
ATOM   1408 C C   . LEU A 1 180 ? 31.943  1.262   29.555  1.00   43.23  ? 180  LEU A C   1 
ATOM   1409 O O   . LEU A 1 180 ? 31.049  0.723   30.203  1.00   39.28  ? 180  LEU A O   1 
ATOM   1410 C CB  . LEU A 1 180 ? 31.408  1.627   27.124  1.00   32.81  ? 180  LEU A CB  1 
ATOM   1411 C CG  . LEU A 1 180 ? 31.128  2.519   25.913  1.00   41.05  ? 180  LEU A CG  1 
ATOM   1412 C CD1 . LEU A 1 180 ? 30.691  1.688   24.717  1.00   36.74  ? 180  LEU A CD1 1 
ATOM   1413 C CD2 . LEU A 1 180 ? 30.089  3.578   26.230  1.00   38.06  ? 180  LEU A CD2 1 
ATOM   1414 N N   . GLN A 1 181 ? 33.238  0.987   29.715  1.00   37.71  ? 181  GLN A N   1 
ATOM   1415 C CA  . GLN A 1 181 ? 33.720  0.021   30.691  1.00   41.72  ? 181  GLN A CA  1 
ATOM   1416 C C   . GLN A 1 181 ? 33.481  0.571   32.089  1.00   45.38  ? 181  GLN A C   1 
ATOM   1417 O O   . GLN A 1 181 ? 33.048  -0.147  32.991  1.00   42.73  ? 181  GLN A O   1 
ATOM   1418 C CB  . GLN A 1 181 ? 35.213  -0.268  30.478  1.00   39.20  ? 181  GLN A CB  1 
ATOM   1419 C CG  . GLN A 1 181 ? 35.521  -1.067  29.220  1.00   47.00  ? 181  GLN A CG  1 
ATOM   1420 C CD  . GLN A 1 181 ? 37.016  -1.144  28.903  1.00   48.67  ? 181  GLN A CD  1 
ATOM   1421 O OE1 . GLN A 1 181 ? 37.817  -0.367  29.421  1.00   53.16  ? 181  GLN A OE1 1 
ATOM   1422 N NE2 . GLN A 1 181 ? 37.390  -2.079  28.041  1.00   43.89  ? 181  GLN A NE2 1 
ATOM   1423 N N   . TRP A 1 182 ? 33.765  1.857   32.255  1.00   41.41  ? 182  TRP A N   1 
ATOM   1424 C CA  . TRP A 1 182 ? 33.509  2.538   33.510  1.00   40.06  ? 182  TRP A CA  1 
ATOM   1425 C C   . TRP A 1 182 ? 32.046  2.389   33.928  1.00   40.38  ? 182  TRP A C   1 
ATOM   1426 O O   . TRP A 1 182 ? 31.740  2.223   35.104  1.00   39.22  ? 182  TRP A O   1 
ATOM   1427 C CB  . TRP A 1 182 ? 33.873  4.011   33.382  1.00   40.42  ? 182  TRP A CB  1 
ATOM   1428 C CG  . TRP A 1 182 ? 33.783  4.766   34.673  1.00   41.80  ? 182  TRP A CG  1 
ATOM   1429 C CD1 . TRP A 1 182 ? 34.811  5.063   35.530  1.00   36.42  ? 182  TRP A CD1 1 
ATOM   1430 C CD2 . TRP A 1 182 ? 32.603  5.338   35.249  1.00   34.62  ? 182  TRP A CD2 1 
ATOM   1431 N NE1 . TRP A 1 182 ? 34.337  5.780   36.603  1.00   41.56  ? 182  TRP A NE1 1 
ATOM   1432 C CE2 . TRP A 1 182 ? 32.986  5.962   36.455  1.00   35.90  ? 182  TRP A CE2 1 
ATOM   1433 C CE3 . TRP A 1 182 ? 31.263  5.384   34.862  1.00   34.35  ? 182  TRP A CE3 1 
ATOM   1434 C CZ2 . TRP A 1 182 ? 32.072  6.621   37.279  1.00   38.68  ? 182  TRP A CZ2 1 
ATOM   1435 C CZ3 . TRP A 1 182 ? 30.353  6.040   35.684  1.00   35.18  ? 182  TRP A CZ3 1 
ATOM   1436 C CH2 . TRP A 1 182 ? 30.762  6.644   36.878  1.00   34.84  ? 182  TRP A CH2 1 
ATOM   1437 N N   . VAL A 1 183 ? 31.141  2.430   32.958  1.00   38.14  ? 183  VAL A N   1 
ATOM   1438 C CA  . VAL A 1 183 ? 29.728  2.341   33.270  1.00   38.14  ? 183  VAL A CA  1 
ATOM   1439 C C   . VAL A 1 183 ? 29.389  0.918   33.724  1.00   44.24  ? 183  VAL A C   1 
ATOM   1440 O O   . VAL A 1 183 ? 28.630  0.720   34.685  1.00   36.95  ? 183  VAL A O   1 
ATOM   1441 C CB  . VAL A 1 183 ? 28.860  2.769   32.072  1.00   36.99  ? 183  VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 183 ? 27.424  2.305   32.243  1.00   33.39  ? 183  VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 183 ? 28.923  4.272   31.891  1.00   30.68  ? 183  VAL A CG2 1 
ATOM   1444 N N   . GLN A 1 184 ? 29.971  -0.068  33.047  1.00   39.53  ? 184  GLN A N   1 
ATOM   1445 C CA  . GLN A 1 184 ? 29.789  -1.464  33.445  1.00   45.56  ? 184  GLN A CA  1 
ATOM   1446 C C   . GLN A 1 184 ? 30.170  -1.694  34.905  1.00   44.31  ? 184  GLN A C   1 
ATOM   1447 O O   . GLN A 1 184 ? 29.418  -2.313  35.647  1.00   46.95  ? 184  GLN A O   1 
ATOM   1448 C CB  . GLN A 1 184 ? 30.594  -2.397  32.548  1.00   42.18  ? 184  GLN A CB  1 
ATOM   1449 C CG  . GLN A 1 184 ? 29.976  -2.577  31.204  1.00   44.41  ? 184  GLN A CG  1 
ATOM   1450 C CD  . GLN A 1 184 ? 28.651  -3.294  31.286  1.00   52.56  ? 184  GLN A CD  1 
ATOM   1451 O OE1 . GLN A 1 184 ? 28.599  -4.499  31.555  1.00   51.18  ? 184  GLN A OE1 1 
ATOM   1452 N NE2 . GLN A 1 184 ? 27.567  -2.564  31.039  1.00   44.65  ? 184  GLN A NE2 1 
ATOM   1453 N N   . GLU A 1 185 ? 31.330  -1.189  35.312  1.00   35.94  ? 185  GLU A N   1 
ATOM   1454 C CA  . GLU A 1 185 ? 31.813  -1.409  36.664  1.00   40.33  ? 185  GLU A CA  1 
ATOM   1455 C C   . GLU A 1 185 ? 31.102  -0.567  37.729  1.00   45.28  ? 185  GLU A C   1 
ATOM   1456 O O   . GLU A 1 185 ? 30.880  -1.044  38.840  1.00   48.34  ? 185  GLU A O   1 
ATOM   1457 C CB  . GLU A 1 185 ? 33.331  -1.172  36.758  1.00   40.91  ? 185  GLU A CB  1 
ATOM   1458 C CG  . GLU A 1 185 ? 33.843  -1.124  38.204  1.00   42.38  ? 185  GLU A CG  1 
ATOM   1459 C CD  . GLU A 1 185 ? 35.352  -1.376  38.347  1.00   55.20  ? 185  GLU A CD  1 
ATOM   1460 O OE1 . GLU A 1 185 ? 36.121  -1.114  37.384  1.00   45.24  ? 185  GLU A OE1 1 
ATOM   1461 O OE2 . GLU A 1 185 ? 35.766  -1.840  39.440  1.00   48.21  ? 185  GLU A OE2 1 
ATOM   1462 N N   . ASN A 1 186 ? 30.743  0.673   37.391  1.00   42.58  ? 186  ASN A N   1 
ATOM   1463 C CA  . ASN A 1 186 ? 30.367  1.668   38.399  1.00   32.58  ? 186  ASN A CA  1 
ATOM   1464 C C   . ASN A 1 186 ? 28.920  2.169   38.387  1.00   35.59  ? 186  ASN A C   1 
ATOM   1465 O O   . ASN A 1 186 ? 28.493  2.809   39.342  1.00   37.11  ? 186  ASN A O   1 
ATOM   1466 C CB  . ASN A 1 186 ? 31.268  2.889   38.266  1.00   32.50  ? 186  ASN A CB  1 
ATOM   1467 C CG  . ASN A 1 186 ? 32.727  2.564   38.468  1.00   39.39  ? 186  ASN A CG  1 
ATOM   1468 O OD1 . ASN A 1 186 ? 33.161  2.280   39.587  1.00   38.85  ? 186  ASN A OD1 1 
ATOM   1469 N ND2 . ASN A 1 186 ? 33.505  2.627   37.385  1.00   35.01  ? 186  ASN A ND2 1 
ATOM   1470 N N   . ILE A 1 187 ? 28.176  1.925   37.314  1.00   36.33  ? 187  ILE A N   1 
ATOM   1471 C CA  . ILE A 1 187 ? 26.873  2.574   37.176  1.00   36.45  ? 187  ILE A CA  1 
ATOM   1472 C C   . ILE A 1 187 ? 25.851  2.057   38.195  1.00   41.37  ? 187  ILE A C   1 
ATOM   1473 O O   . ILE A 1 187 ? 24.909  2.768   38.567  1.00   38.89  ? 187  ILE A O   1 
ATOM   1474 C CB  . ILE A 1 187 ? 26.304  2.507   35.729  1.00   35.38  ? 187  ILE A CB  1 
ATOM   1475 C CG1 . ILE A 1 187 ? 25.319  3.663   35.491  1.00   36.80  ? 187  ILE A CG1 1 
ATOM   1476 C CG2 . ILE A 1 187 ? 25.641  1.172   35.458  1.00   32.92  ? 187  ILE A CG2 1 
ATOM   1477 C CD1 . ILE A 1 187 ? 25.931  5.055   35.670  1.00   29.67  ? 187  ILE A CD1 1 
ATOM   1478 N N   . ALA A 1 188 ? 26.041  0.826   38.659  1.00   38.50  ? 188  ALA A N   1 
ATOM   1479 C CA  . ALA A 1 188 ? 25.174  0.290   39.701  1.00   38.41  ? 188  ALA A CA  1 
ATOM   1480 C C   . ALA A 1 188 ? 25.193  1.150   40.980  1.00   41.92  ? 188  ALA A C   1 
ATOM   1481 O O   . ALA A 1 188 ? 24.199  1.224   41.678  1.00   42.96  ? 188  ALA A O   1 
ATOM   1482 C CB  . ALA A 1 188 ? 25.510  -1.165  40.002  1.00   33.83  ? 188  ALA A CB  1 
ATOM   1483 N N   . ALA A 1 189 ? 26.307  1.815   41.275  1.00   36.76  ? 189  ALA A N   1 
ATOM   1484 C CA  . ALA A 1 189 ? 26.361  2.704   42.432  1.00   34.84  ? 189  ALA A CA  1 
ATOM   1485 C C   . ALA A 1 189 ? 25.317  3.822   42.363  1.00   43.17  ? 189  ALA A C   1 
ATOM   1486 O O   . ALA A 1 189 ? 24.942  4.399   43.385  1.00   50.17  ? 189  ALA A O   1 
ATOM   1487 C CB  . ALA A 1 189 ? 27.744  3.303   42.584  1.00   34.24  ? 189  ALA A CB  1 
ATOM   1488 N N   . PHE A 1 190 ? 24.863  4.146   41.160  1.00   40.02  ? 190  PHE A N   1 
ATOM   1489 C CA  . PHE A 1 190 ? 23.950  5.265   40.977  1.00   41.25  ? 190  PHE A CA  1 
ATOM   1490 C C   . PHE A 1 190 ? 22.531  4.746   40.804  1.00   42.74  ? 190  PHE A C   1 
ATOM   1491 O O   . PHE A 1 190 ? 21.578  5.519   40.732  1.00   49.14  ? 190  PHE A O   1 
ATOM   1492 C CB  . PHE A 1 190 ? 24.360  6.094   39.757  1.00   38.87  ? 190  PHE A CB  1 
ATOM   1493 C CG  . PHE A 1 190 ? 25.740  6.675   39.852  1.00   34.73  ? 190  PHE A CG  1 
ATOM   1494 C CD1 . PHE A 1 190 ? 26.852  5.921   39.504  1.00   34.88  ? 190  PHE A CD1 1 
ATOM   1495 C CD2 . PHE A 1 190 ? 25.930  7.977   40.285  1.00   36.62  ? 190  PHE A CD2 1 
ATOM   1496 C CE1 . PHE A 1 190 ? 28.134  6.461   39.580  1.00   35.78  ? 190  PHE A CE1 1 
ATOM   1497 C CE2 . PHE A 1 190 ? 27.213  8.522   40.378  1.00   39.50  ? 190  PHE A CE2 1 
ATOM   1498 C CZ  . PHE A 1 190 ? 28.314  7.768   40.023  1.00   31.84  ? 190  PHE A CZ  1 
ATOM   1499 N N   . GLY A 1 191 ? 22.394  3.428   40.747  1.00   40.08  ? 191  GLY A N   1 
ATOM   1500 C CA  . GLY A 1 191 ? 21.102  2.811   40.537  1.00   35.89  ? 191  GLY A CA  1 
ATOM   1501 C C   . GLY A 1 191 ? 20.894  2.405   39.091  1.00   43.56  ? 191  GLY A C   1 
ATOM   1502 O O   . GLY A 1 191 ? 19.796  2.015   38.703  1.00   42.61  ? 191  GLY A O   1 
ATOM   1503 N N   . GLY A 1 192 ? 21.949  2.486   38.286  1.00   39.62  ? 192  GLY A N   1 
ATOM   1504 C CA  . GLY A 1 192 ? 21.835  2.107   36.891  1.00   43.39  ? 192  GLY A CA  1 
ATOM   1505 C C   . GLY A 1 192 ? 22.090  0.633   36.652  1.00   42.54  ? 192  GLY A C   1 
ATOM   1506 O O   . GLY A 1 192 ? 22.915  0.029   37.325  1.00   41.54  ? 192  GLY A O   1 
ATOM   1507 N N   . ASP A 1 193 ? 21.382  0.058   35.685  1.00   43.07  ? 193  ASP A N   1 
ATOM   1508 C CA  . ASP A 1 193 ? 21.514  -1.357  35.361  1.00   39.51  ? 193  ASP A CA  1 
ATOM   1509 C C   . ASP A 1 193 ? 22.559  -1.586  34.280  1.00   42.02  ? 193  ASP A C   1 
ATOM   1510 O O   . ASP A 1 193 ? 22.329  -1.275  33.117  1.00   40.91  ? 193  ASP A O   1 
ATOM   1511 C CB  . ASP A 1 193 ? 20.165  -1.898  34.883  1.00   45.73  ? 193  ASP A CB  1 
ATOM   1512 C CG  . ASP A 1 193 ? 20.175  -3.410  34.652  1.00   47.13  ? 193  ASP A CG  1 
ATOM   1513 O OD1 . ASP A 1 193 ? 21.244  -4.045  34.770  1.00   47.52  ? 193  ASP A OD1 1 
ATOM   1514 O OD2 . ASP A 1 193 ? 19.097  -3.965  34.358  1.00   43.48  ? 193  ASP A OD2 1 
ATOM   1515 N N   . PRO A 1 194 ? 23.708  -2.155  34.656  1.00   43.66  ? 194  PRO A N   1 
ATOM   1516 C CA  . PRO A 1 194 ? 24.781  -2.436  33.695  1.00   40.57  ? 194  PRO A CA  1 
ATOM   1517 C C   . PRO A 1 194 ? 24.356  -3.432  32.615  1.00   45.07  ? 194  PRO A C   1 
ATOM   1518 O O   . PRO A 1 194 ? 25.022  -3.557  31.583  1.00   45.01  ? 194  PRO A O   1 
ATOM   1519 C CB  . PRO A 1 194 ? 25.883  -3.037  34.575  1.00   42.84  ? 194  PRO A CB  1 
ATOM   1520 C CG  . PRO A 1 194 ? 25.145  -3.567  35.771  1.00   43.29  ? 194  PRO A CG  1 
ATOM   1521 C CD  . PRO A 1 194 ? 24.095  -2.525  36.024  1.00   38.69  ? 194  PRO A CD  1 
ATOM   1522 N N   . MET A 1 195 ? 23.250  -4.131  32.844  1.00   45.54  ? 195  MET A N   1 
ATOM   1523 C CA  . MET A 1 195 ? 22.805  -5.161  31.907  1.00   51.88  ? 195  MET A CA  1 
ATOM   1524 C C   . MET A 1 195 ? 21.744  -4.626  30.947  1.00   47.09  ? 195  MET A C   1 
ATOM   1525 O O   . MET A 1 195 ? 21.227  -5.351  30.095  1.00   45.59  ? 195  MET A O   1 
ATOM   1526 C CB  . MET A 1 195 ? 22.335  -6.421  32.657  1.00   45.47  ? 195  MET A CB  1 
ATOM   1527 C CG  . MET A 1 195 ? 23.460  -7.038  33.494  1.00   58.54  ? 195  MET A CG  1 
ATOM   1528 S SD  . MET A 1 195 ? 23.273  -8.772  33.970  1.00   69.73  ? 195  MET A SD  1 
ATOM   1529 C CE  . MET A 1 195 ? 21.536  -8.790  34.418  1.00   50.05  ? 195  MET A CE  1 
ATOM   1530 N N   . SER A 1 196 ? 21.432  -3.345  31.092  1.00   39.58  ? 196  SER A N   1 
ATOM   1531 C CA  . SER A 1 196 ? 20.607  -2.649  30.121  1.00   40.76  ? 196  SER A CA  1 
ATOM   1532 C C   . SER A 1 196 ? 21.242  -1.298  29.758  1.00   45.29  ? 196  SER A C   1 
ATOM   1533 O O   . SER A 1 196 ? 20.843  -0.243  30.278  1.00   38.61  ? 196  SER A O   1 
ATOM   1534 C CB  . SER A 1 196 ? 19.194  -2.454  30.663  1.00   42.88  ? 196  SER A CB  1 
ATOM   1535 O OG  . SER A 1 196 ? 18.320  -2.020  29.639  1.00   41.02  ? 196  SER A OG  1 
ATOM   1536 N N   . VAL A 1 197 ? 22.242  -1.350  28.876  1.00   45.15  ? 197  VAL A N   1 
ATOM   1537 C CA  . VAL A 1 197 ? 22.955  -0.161  28.400  1.00   38.49  ? 197  VAL A CA  1 
ATOM   1538 C C   . VAL A 1 197 ? 22.728  0.090   26.906  1.00   40.61  ? 197  VAL A C   1 
ATOM   1539 O O   . VAL A 1 197 ? 23.085  -0.739  26.055  1.00   41.73  ? 197  VAL A O   1 
ATOM   1540 C CB  . VAL A 1 197 ? 24.481  -0.270  28.639  1.00   46.64  ? 197  VAL A CB  1 
ATOM   1541 C CG1 . VAL A 1 197 ? 25.210  0.895   27.941  1.00   42.37  ? 197  VAL A CG1 1 
ATOM   1542 C CG2 . VAL A 1 197 ? 24.805  -0.314  30.142  1.00   43.36  ? 197  VAL A CG2 1 
ATOM   1543 N N   . THR A 1 198 ? 22.131  1.236   26.594  1.00   41.60  ? 198  THR A N   1 
ATOM   1544 C CA  . THR A 1 198 ? 21.853  1.632   25.214  1.00   36.76  ? 198  THR A CA  1 
ATOM   1545 C C   . THR A 1 198 ? 22.740  2.809   24.817  1.00   36.49  ? 198  THR A C   1 
ATOM   1546 O O   . THR A 1 198 ? 22.725  3.849   25.479  1.00   42.21  ? 198  THR A O   1 
ATOM   1547 C CB  . THR A 1 198 ? 20.382  2.058   25.054  1.00   37.50  ? 198  THR A CB  1 
ATOM   1548 O OG1 . THR A 1 198 ? 19.527  0.965   25.386  1.00   42.62  ? 198  THR A OG1 1 
ATOM   1549 C CG2 . THR A 1 198 ? 20.096  2.482   23.627  1.00   39.52  ? 198  THR A CG2 1 
ATOM   1550 N N   . LEU A 1 199 ? 23.527  2.649   23.757  1.00   36.91  ? 199  LEU A N   1 
ATOM   1551 C CA  . LEU A 1 199 ? 24.291  3.772   23.216  1.00   36.15  ? 199  LEU A CA  1 
ATOM   1552 C C   . LEU A 1 199 ? 23.415  4.633   22.311  1.00   38.45  ? 199  LEU A C   1 
ATOM   1553 O O   . LEU A 1 199 ? 22.610  4.109   21.543  1.00   41.94  ? 199  LEU A O   1 
ATOM   1554 C CB  . LEU A 1 199 ? 25.488  3.281   22.420  1.00   36.30  ? 199  LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 199 ? 26.431  2.302   23.121  1.00   41.40  ? 199  LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 199 ? 27.551  1.889   22.176  1.00   30.62  ? 199  LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 199 ? 26.980  2.886   24.415  1.00   37.89  ? 199  LEU A CD2 1 
ATOM   1558 N N   . PHE A 1 200 ? 23.544  5.950   22.417  1.00   35.89  ? 200  PHE A N   1 
ATOM   1559 C CA  . PHE A 1 200 ? 22.988  6.831   21.389  1.00   35.48  ? 200  PHE A CA  1 
ATOM   1560 C C   . PHE A 1 200 ? 23.872  8.034   21.123  1.00   32.91  ? 200  PHE A C   1 
ATOM   1561 O O   . PHE A 1 200 ? 24.581  8.500   22.013  1.00   31.98  ? 200  PHE A O   1 
ATOM   1562 C CB  . PHE A 1 200 ? 21.519  7.216   21.648  1.00   33.66  ? 200  PHE A CB  1 
ATOM   1563 C CG  . PHE A 1 200 ? 21.302  8.214   22.761  1.00   35.57  ? 200  PHE A CG  1 
ATOM   1564 C CD1 . PHE A 1 200 ? 21.962  8.097   23.980  1.00   37.33  ? 200  PHE A CD1 1 
ATOM   1565 C CD2 . PHE A 1 200 ? 20.373  9.243   22.604  1.00   30.78  ? 200  PHE A CD2 1 
ATOM   1566 C CE1 . PHE A 1 200 ? 21.725  9.006   25.014  1.00   36.65  ? 200  PHE A CE1 1 
ATOM   1567 C CE2 . PHE A 1 200 ? 20.124  10.153  23.631  1.00   34.39  ? 200  PHE A CE2 1 
ATOM   1568 C CZ  . PHE A 1 200 ? 20.798  10.036  24.844  1.00   34.59  ? 200  PHE A CZ  1 
ATOM   1569 N N   . GLY A 1 201 ? 23.844  8.503   19.878  1.00   32.76  ? 201  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 201 ? 24.674  9.612   19.450  1.00   32.64  ? 201  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 201 ? 24.252  10.151  18.091  1.00   35.99  ? 201  GLY A C   1 
ATOM   1572 O O   . GLY A 1 201 ? 23.502  9.526   17.343  1.00   32.05  ? 201  GLY A O   1 
ATOM   1573 N N   . GLU A 1 202 ? 24.762  11.323  17.758  1.00   32.03  ? 202  GLU A N   1 
ATOM   1574 C CA  . GLU A 1 202 ? 24.328  11.999  16.564  1.00   34.20  ? 202  GLU A CA  1 
ATOM   1575 C C   . GLU A 1 202 ? 25.522  12.412  15.716  1.00   36.08  ? 202  GLU A C   1 
ATOM   1576 O O   . GLU A 1 202 ? 26.556  12.818  16.239  1.00   36.81  ? 202  GLU A O   1 
ATOM   1577 C CB  . GLU A 1 202 ? 23.475  13.202  16.958  1.00   36.98  ? 202  GLU A CB  1 
ATOM   1578 C CG  . GLU A 1 202 ? 22.837  13.925  15.809  1.00   40.09  ? 202  GLU A CG  1 
ATOM   1579 C CD  . GLU A 1 202 ? 23.740  14.972  15.235  1.00   42.18  ? 202  GLU A CD  1 
ATOM   1580 O OE1 . GLU A 1 202 ? 24.755  15.300  15.897  1.00   39.44  ? 202  GLU A OE1 1 
ATOM   1581 O OE2 . GLU A 1 202 ? 23.419  15.469  14.134  1.00   37.88  ? 202  GLU A OE2 1 
HETATM 1582 N N   . SGB A 1 203 ? 25.366  12.296  14.400  1.00   40.52  ? 203  SGB A N   1 
HETATM 1583 C CA  . SGB A 1 203 ? 26.424  12.618  13.441  1.00   40.21  ? 203  SGB A CA  1 
HETATM 1584 C C   . SGB A 1 203 ? 27.671  11.749  13.667  1.00   39.61  ? 203  SGB A C   1 
HETATM 1585 O O   . SGB A 1 203 ? 27.590  10.540  13.499  1.00   39.53  ? 203  SGB A O   1 
HETATM 1586 C CB  . SGB A 1 203 ? 26.674  14.122  13.487  1.00   38.26  ? 203  SGB A CB  1 
HETATM 1587 O OG  . SGB A 1 203 ? 27.382  14.451  12.297  1.00   51.48  ? 203  SGB A OG  1 
HETATM 1588 O O1  . SGB A 1 203 ? 29.527  15.168  13.506  1.00   38.66  ? 203  SGB A O1  1 
HETATM 1589 P P1  . SGB A 1 203 ? 28.608  15.510  12.351  1.00   55.00  ? 203  SGB A P1  1 
HETATM 1590 C C1  . SGB A 1 203 ? 29.302  15.343  10.718  1.00   47.38  ? 203  SGB A C1  1 
HETATM 1591 O O2  . SGB A 1 203 ? 27.954  16.985  12.384  1.00   53.62  ? 203  SGB A O2  1 
HETATM 1592 C C2  . SGB A 1 203 ? 28.726  18.143  12.718  1.00   54.71  ? 203  SGB A C2  1 
HETATM 1593 C C4  . SGB A 1 203 ? 27.814  19.360  12.641  1.00   52.36  ? 203  SGB A C4  1 
HETATM 1594 C C3  . SGB A 1 203 ? 29.891  18.314  11.753  1.00   49.33  ? 203  SGB A C3  1 
ATOM   1595 N N   . ALA A 1 204 ? 28.805  12.330  14.055  1.00   30.07  ? 204  ALA A N   1 
ATOM   1596 C CA  . ALA A 1 204 ? 29.985  11.504  14.343  1.00   35.54  ? 204  ALA A CA  1 
ATOM   1597 C C   . ALA A 1 204 ? 29.800  10.641  15.609  1.00   37.78  ? 204  ALA A C   1 
ATOM   1598 O O   . ALA A 1 204 ? 30.423  9.576   15.743  1.00   34.48  ? 204  ALA A O   1 
ATOM   1599 C CB  . ALA A 1 204 ? 31.262  12.355  14.445  1.00   30.49  ? 204  ALA A CB  1 
ATOM   1600 N N   . GLY A 1 205 ? 28.962  11.112  16.537  1.00   32.93  ? 205  GLY A N   1 
ATOM   1601 C CA  . GLY A 1 205 ? 28.565  10.318  17.689  1.00   30.29  ? 205  GLY A CA  1 
ATOM   1602 C C   . GLY A 1 205 ? 27.860  9.056   17.189  1.00   38.41  ? 205  GLY A C   1 
ATOM   1603 O O   . GLY A 1 205 ? 28.172  7.937   17.607  1.00   38.18  ? 205  GLY A O   1 
ATOM   1604 N N   . ALA A 1 206 ? 26.922  9.243   16.268  1.00   33.47  ? 206  ALA A N   1 
ATOM   1605 C CA  . ALA A 1 206 ? 26.255  8.127   15.612  1.00   35.83  ? 206  ALA A CA  1 
ATOM   1606 C C   . ALA A 1 206 ? 27.250  7.189   14.935  1.00   41.13  ? 206  ALA A C   1 
ATOM   1607 O O   . ALA A 1 206 ? 27.121  5.973   15.046  1.00   40.26  ? 206  ALA A O   1 
ATOM   1608 C CB  . ALA A 1 206 ? 25.229  8.633   14.591  1.00   31.86  ? 206  ALA A CB  1 
ATOM   1609 N N   . ALA A 1 207 ? 28.228  7.743   14.221  1.00   37.28  ? 207  ALA A N   1 
ATOM   1610 C CA  . ALA A 1 207 ? 29.223  6.900   13.576  1.00   35.82  ? 207  ALA A CA  1 
ATOM   1611 C C   . ALA A 1 207 ? 30.001  6.122   14.633  1.00   41.42  ? 207  ALA A C   1 
ATOM   1612 O O   . ALA A 1 207 ? 30.321  4.943   14.443  1.00   44.39  ? 207  ALA A O   1 
ATOM   1613 C CB  . ALA A 1 207 ? 30.161  7.729   12.723  1.00   34.76  ? 207  ALA A CB  1 
ATOM   1614 N N   . SER A 1 208 ? 30.310  6.801   15.737  1.00   38.75  ? 208  SER A N   1 
ATOM   1615 C CA  . SER A 1 208 ? 31.010  6.198   16.870  1.00   40.17  ? 208  SER A CA  1 
ATOM   1616 C C   . SER A 1 208 ? 30.243  4.995   17.397  1.00   38.04  ? 208  SER A C   1 
ATOM   1617 O O   . SER A 1 208 ? 30.829  3.945   17.650  1.00   35.27  ? 208  SER A O   1 
ATOM   1618 C CB  . SER A 1 208 ? 31.207  7.219   18.001  1.00   34.09  ? 208  SER A CB  1 
ATOM   1619 O OG  . SER A 1 208 ? 32.226  8.151   17.686  1.00   38.48  ? 208  SER A OG  1 
ATOM   1620 N N   . VAL A 1 209 ? 28.936  5.165   17.576  1.00   34.26  ? 209  VAL A N   1 
ATOM   1621 C CA  . VAL A 1 209 ? 28.069  4.084   18.013  1.00   34.63  ? 209  VAL A CA  1 
ATOM   1622 C C   . VAL A 1 209 ? 28.191  2.926   17.025  1.00   40.95  ? 209  VAL A C   1 
ATOM   1623 O O   . VAL A 1 209 ? 28.406  1.780   17.413  1.00   38.77  ? 209  VAL A O   1 
ATOM   1624 C CB  . VAL A 1 209 ? 26.597  4.542   18.086  1.00   35.57  ? 209  VAL A CB  1 
ATOM   1625 C CG1 . VAL A 1 209 ? 25.672  3.356   18.276  1.00   29.01  ? 209  VAL A CG1 1 
ATOM   1626 C CG2 . VAL A 1 209 ? 26.410  5.541   19.202  1.00   31.50  ? 209  VAL A CG2 1 
ATOM   1627 N N   . GLY A 1 210 ? 28.084  3.236   15.740  1.00   37.85  ? 210  GLY A N   1 
ATOM   1628 C CA  . GLY A 1 210 ? 28.186  2.218   14.712  1.00   36.17  ? 210  GLY A CA  1 
ATOM   1629 C C   . GLY A 1 210 ? 29.492  1.460   14.791  1.00   36.04  ? 210  GLY A C   1 
ATOM   1630 O O   . GLY A 1 210 ? 29.551  0.259   14.534  1.00   43.50  ? 210  GLY A O   1 
ATOM   1631 N N   . MET A 1 211 ? 30.553  2.154   15.162  1.00   36.14  ? 211  MET A N   1 
ATOM   1632 C CA  . MET A 1 211 ? 31.849  1.509   15.233  1.00   37.20  ? 211  MET A CA  1 
ATOM   1633 C C   . MET A 1 211 ? 31.984  0.593   16.429  1.00   35.78  ? 211  MET A C   1 
ATOM   1634 O O   . MET A 1 211 ? 32.703  -0.406  16.371  1.00   40.83  ? 211  MET A O   1 
ATOM   1635 C CB  . MET A 1 211 ? 32.966  2.544   15.184  1.00   36.73  ? 211  MET A CB  1 
ATOM   1636 C CG  . MET A 1 211 ? 33.221  2.969   13.758  1.00   45.96  ? 211  MET A CG  1 
ATOM   1637 S SD  . MET A 1 211 ? 34.274  4.382   13.596  1.00   46.33  ? 211  MET A SD  1 
ATOM   1638 C CE  . MET A 1 211 ? 33.441  5.206   12.243  1.00   45.39  ? 211  MET A CE  1 
ATOM   1639 N N   . HIS A 1 212 ? 31.298  0.938   17.513  1.00   33.24  ? 212  HIS A N   1 
ATOM   1640 C CA  . HIS A 1 212 ? 31.263  0.077   18.683  1.00   39.49  ? 212  HIS A CA  1 
ATOM   1641 C C   . HIS A 1 212 ? 30.512  -1.225  18.392  1.00   41.57  ? 212  HIS A C   1 
ATOM   1642 O O   . HIS A 1 212 ? 30.888  -2.286  18.879  1.00   39.43  ? 212  HIS A O   1 
ATOM   1643 C CB  . HIS A 1 212 ? 30.665  0.810   19.880  1.00   34.17  ? 212  HIS A CB  1 
ATOM   1644 C CG  . HIS A 1 212 ? 31.551  1.890   20.413  1.00   34.17  ? 212  HIS A CG  1 
ATOM   1645 N ND1 . HIS A 1 212 ? 32.810  1.635   20.907  1.00   30.84  ? 212  HIS A ND1 1 
ATOM   1646 C CD2 . HIS A 1 212 ? 31.370  3.228   20.512  1.00   35.64  ? 212  HIS A CD2 1 
ATOM   1647 C CE1 . HIS A 1 212 ? 33.367  2.770   21.293  1.00   37.47  ? 212  HIS A CE1 1 
ATOM   1648 N NE2 . HIS A 1 212 ? 32.515  3.753   21.060  1.00   35.30  ? 212  HIS A NE2 1 
ATOM   1649 N N   . ILE A 1 213 ? 29.448  -1.127  17.600  1.00   36.06  ? 213  ILE A N   1 
ATOM   1650 C CA  . ILE A 1 213 ? 28.769  -2.297  17.080  1.00   39.46  ? 213  ILE A CA  1 
ATOM   1651 C C   . ILE A 1 213 ? 29.724  -3.177  16.264  1.00   45.29  ? 213  ILE A C   1 
ATOM   1652 O O   . ILE A 1 213 ? 29.673  -4.398  16.343  1.00   49.71  ? 213  ILE A O   1 
ATOM   1653 C CB  . ILE A 1 213 ? 27.595  -1.887  16.190  1.00   42.90  ? 213  ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 213 ? 26.563  -1.101  17.007  1.00   37.02  ? 213  ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 213 ? 26.985  -3.114  15.505  1.00   41.01  ? 213  ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 213 ? 25.388  -0.638  16.198  1.00   38.25  ? 213  ILE A CD1 1 
ATOM   1657 N N   . LEU A 1 214 ? 30.602  -2.551  15.488  1.00   44.29  ? 214  LEU A N   1 
ATOM   1658 C CA  . LEU A 1 214 ? 31.473  -3.280  14.570  1.00   42.01  ? 214  LEU A CA  1 
ATOM   1659 C C   . LEU A 1 214 ? 32.788  -3.720  15.200  1.00   40.51  ? 214  LEU A C   1 
ATOM   1660 O O   . LEU A 1 214 ? 33.623  -4.347  14.543  1.00   40.06  ? 214  LEU A O   1 
ATOM   1661 C CB  . LEU A 1 214 ? 31.768  -2.428  13.331  1.00   34.32  ? 214  LEU A CB  1 
ATOM   1662 C CG  . LEU A 1 214 ? 30.537  -1.981  12.561  1.00   46.50  ? 214  LEU A CG  1 
ATOM   1663 C CD1 . LEU A 1 214 ? 30.941  -1.210  11.305  1.00   41.15  ? 214  LEU A CD1 1 
ATOM   1664 C CD2 . LEU A 1 214 ? 29.673  -3.192  12.226  1.00   43.32  ? 214  LEU A CD2 1 
ATOM   1665 N N   . SER A 1 215 ? 32.991  -3.374  16.459  1.00   37.05  ? 215  SER A N   1 
ATOM   1666 C CA  . SER A 1 215 ? 34.225  -3.740  17.123  1.00   38.75  ? 215  SER A CA  1 
ATOM   1667 C C   . SER A 1 215 ? 33.933  -4.633  18.325  1.00   43.18  ? 215  SER A C   1 
ATOM   1668 O O   . SER A 1 215 ? 33.281  -4.222  19.285  1.00   42.29  ? 215  SER A O   1 
ATOM   1669 C CB  . SER A 1 215 ? 34.994  -2.493  17.529  1.00   41.50  ? 215  SER A CB  1 
ATOM   1670 O OG  . SER A 1 215 ? 36.242  -2.834  18.075  1.00   36.75  ? 215  SER A OG  1 
ATOM   1671 N N   . LEU A 1 216 ? 34.430  -5.861  18.262  1.00   51.01  ? 216  LEU A N   1 
ATOM   1672 C CA  . LEU A 1 216 ? 34.060  -6.899  19.221  1.00   49.09  ? 216  LEU A CA  1 
ATOM   1673 C C   . LEU A 1 216 ? 34.250  -6.532  20.685  1.00   43.79  ? 216  LEU A C   1 
ATOM   1674 O O   . LEU A 1 216 ? 33.370  -6.795  21.509  1.00   44.03  ? 216  LEU A O   1 
ATOM   1675 C CB  . LEU A 1 216 ? 34.778  -8.210  18.890  1.00   56.94  ? 216  LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 216 ? 33.866  -9.116  18.063  1.00   67.60  ? 216  LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 216 ? 34.641  -10.016 17.108  1.00   67.75  ? 216  LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 216 ? 32.951  -9.914  19.005  1.00   64.00  ? 216  LEU A CD2 1 
ATOM   1679 N N   . PRO A 1 217 ? 35.398  -5.925  21.018  1.00   43.53  ? 217  PRO A N   1 
ATOM   1680 C CA  . PRO A 1 217 ? 35.623  -5.579  22.428  1.00   39.77  ? 217  PRO A CA  1 
ATOM   1681 C C   . PRO A 1 217 ? 34.592  -4.585  22.986  1.00   45.21  ? 217  PRO A C   1 
ATOM   1682 O O   . PRO A 1 217 ? 34.370  -4.579  24.193  1.00   53.49  ? 217  PRO A O   1 
ATOM   1683 C CB  . PRO A 1 217 ? 37.029  -4.971  22.425  1.00   37.94  ? 217  PRO A CB  1 
ATOM   1684 C CG  . PRO A 1 217 ? 37.694  -5.556  21.196  1.00   36.62  ? 217  PRO A CG  1 
ATOM   1685 C CD  . PRO A 1 217 ? 36.586  -5.678  20.181  1.00   40.17  ? 217  PRO A CD  1 
ATOM   1686 N N   . SER A 1 218 ? 33.970  -3.768  22.142  1.00   42.00  ? 218  SER A N   1 
ATOM   1687 C CA  . SER A 1 218 ? 32.933  -2.854  22.624  1.00   44.90  ? 218  SER A CA  1 
ATOM   1688 C C   . SER A 1 218 ? 31.616  -3.578  22.801  1.00   47.68  ? 218  SER A C   1 
ATOM   1689 O O   . SER A 1 218 ? 30.767  -3.165  23.598  1.00   46.26  ? 218  SER A O   1 
ATOM   1690 C CB  . SER A 1 218 ? 32.731  -1.684  21.661  1.00   38.85  ? 218  SER A CB  1 
ATOM   1691 O OG  . SER A 1 218 ? 33.925  -0.939  21.540  1.00   41.32  ? 218  SER A OG  1 
ATOM   1692 N N   . ARG A 1 219 ? 31.453  -4.659  22.045  1.00   47.54  ? 219  ARG A N   1 
ATOM   1693 C CA  . ARG A 1 219 ? 30.175  -5.353  21.961  1.00   47.14  ? 219  ARG A CA  1 
ATOM   1694 C C   . ARG A 1 219 ? 29.669  -5.836  23.311  1.00   46.82  ? 219  ARG A C   1 
ATOM   1695 O O   . ARG A 1 219 ? 28.483  -5.721  23.615  1.00   51.96  ? 219  ARG A O   1 
ATOM   1696 C CB  . ARG A 1 219 ? 30.264  -6.507  20.961  1.00   49.08  ? 219  ARG A CB  1 
ATOM   1697 C CG  . ARG A 1 219 ? 29.988  -6.073  19.536  1.00   45.37  ? 219  ARG A CG  1 
ATOM   1698 C CD  . ARG A 1 219 ? 28.655  -5.342  19.451  1.00   46.82  ? 219  ARG A CD  1 
ATOM   1699 N NE  . ARG A 1 219 ? 27.524  -6.238  19.198  1.00   58.22  ? 219  ARG A NE  1 
ATOM   1700 C CZ  . ARG A 1 219 ? 27.292  -6.842  18.031  1.00   66.34  ? 219  ARG A CZ  1 
ATOM   1701 N NH1 . ARG A 1 219 ? 28.124  -6.661  17.008  1.00   63.30  ? 219  ARG A NH1 1 
ATOM   1702 N NH2 . ARG A 1 219 ? 26.239  -7.639  17.882  1.00   69.05  ? 219  ARG A NH2 1 
ATOM   1703 N N   . SER A 1 220 ? 30.573  -6.367  24.123  1.00   46.75  ? 220  SER A N   1 
ATOM   1704 C CA  . SER A 1 220 ? 30.205  -6.845  25.445  1.00   49.49  ? 220  SER A CA  1 
ATOM   1705 C C   . SER A 1 220 ? 29.810  -5.710  26.395  1.00   49.07  ? 220  SER A C   1 
ATOM   1706 O O   . SER A 1 220 ? 29.430  -5.962  27.536  1.00   51.32  ? 220  SER A O   1 
ATOM   1707 C CB  . SER A 1 220 ? 31.359  -7.642  26.050  1.00   54.95  ? 220  SER A CB  1 
ATOM   1708 O OG  . SER A 1 220 ? 32.424  -6.797  26.442  1.00   53.81  ? 220  SER A OG  1 
ATOM   1709 N N   . LEU A 1 221 ? 29.891  -4.467  25.927  1.00   46.07  ? 221  LEU A N   1 
ATOM   1710 C CA  . LEU A 1 221 ? 29.748  -3.315  26.818  1.00   42.13  ? 221  LEU A CA  1 
ATOM   1711 C C   . LEU A 1 221 ? 28.424  -2.593  26.710  1.00   39.79  ? 221  LEU A C   1 
ATOM   1712 O O   . LEU A 1 221 ? 28.187  -1.632  27.446  1.00   39.08  ? 221  LEU A O   1 
ATOM   1713 C CB  . LEU A 1 221 ? 30.876  -2.316  26.587  1.00   39.79  ? 221  LEU A CB  1 
ATOM   1714 C CG  . LEU A 1 221 ? 32.260  -2.873  26.874  1.00   45.51  ? 221  LEU A CG  1 
ATOM   1715 C CD1 . LEU A 1 221 ? 33.319  -1.826  26.559  1.00   44.59  ? 221  LEU A CD1 1 
ATOM   1716 C CD2 . LEU A 1 221 ? 32.325  -3.315  28.335  1.00   42.16  ? 221  LEU A CD2 1 
ATOM   1717 N N   . PHE A 1 222 ? 27.573  -3.050  25.793  1.00   37.55  ? 222  PHE A N   1 
ATOM   1718 C CA  . PHE A 1 222 ? 26.272  -2.427  25.570  1.00   40.89  ? 222  PHE A CA  1 
ATOM   1719 C C   . PHE A 1 222 ? 25.309  -3.423  24.908  1.00   41.97  ? 222  PHE A C   1 
ATOM   1720 O O   . PHE A 1 222 ? 25.742  -4.443  24.380  1.00   45.85  ? 222  PHE A O   1 
ATOM   1721 C CB  . PHE A 1 222 ? 26.428  -1.150  24.726  1.00   34.28  ? 222  PHE A CB  1 
ATOM   1722 C CG  . PHE A 1 222 ? 26.867  -1.402  23.305  1.00   33.23  ? 222  PHE A CG  1 
ATOM   1723 C CD1 . PHE A 1 222 ? 28.198  -1.628  23.002  1.00   40.63  ? 222  PHE A CD1 1 
ATOM   1724 C CD2 . PHE A 1 222 ? 25.948  -1.401  22.269  1.00   42.92  ? 222  PHE A CD2 1 
ATOM   1725 C CE1 . PHE A 1 222 ? 28.605  -1.856  21.694  1.00   38.91  ? 222  PHE A CE1 1 
ATOM   1726 C CE2 . PHE A 1 222 ? 26.355  -1.633  20.951  1.00   38.67  ? 222  PHE A CE2 1 
ATOM   1727 C CZ  . PHE A 1 222 ? 27.685  -1.860  20.675  1.00   36.38  ? 222  PHE A CZ  1 
ATOM   1728 N N   . HIS A 1 223 ? 24.015  -3.116  24.913  1.00   40.54  ? 223  HIS A N   1 
ATOM   1729 C CA  . HIS A 1 223 ? 22.996  -4.071  24.461  1.00   45.58  ? 223  HIS A CA  1 
ATOM   1730 C C   . HIS A 1 223 ? 22.134  -3.575  23.297  1.00   47.66  ? 223  HIS A C   1 
ATOM   1731 O O   . HIS A 1 223 ? 21.614  -4.374  22.516  1.00   52.15  ? 223  HIS A O   1 
ATOM   1732 C CB  . HIS A 1 223 ? 22.105  -4.454  25.645  1.00   38.35  ? 223  HIS A CB  1 
ATOM   1733 C CG  . HIS A 1 223 ? 22.876  -4.663  26.910  1.00   46.70  ? 223  HIS A CG  1 
ATOM   1734 N ND1 . HIS A 1 223 ? 23.528  -5.845  27.196  1.00   42.50  ? 223  HIS A ND1 1 
ATOM   1735 C CD2 . HIS A 1 223 ? 23.152  -3.823  27.935  1.00   36.90  ? 223  HIS A CD2 1 
ATOM   1736 C CE1 . HIS A 1 223 ? 24.147  -5.732  28.357  1.00   43.18  ? 223  HIS A CE1 1 
ATOM   1737 N NE2 . HIS A 1 223 ? 23.937  -4.513  28.824  1.00   43.41  ? 223  HIS A NE2 1 
ATOM   1738 N N   . ARG A 1 224 ? 21.974  -2.261  23.196  1.00   41.57  ? 224  ARG A N   1 
ATOM   1739 C CA  . ARG A 1 224 ? 21.178  -1.665  22.128  1.00   46.48  ? 224  ARG A CA  1 
ATOM   1740 C C   . ARG A 1 224 ? 21.821  -0.358  21.641  1.00   43.89  ? 224  ARG A C   1 
ATOM   1741 O O   . ARG A 1 224 ? 22.722  0.177   22.283  1.00   44.38  ? 224  ARG A O   1 
ATOM   1742 C CB  . ARG A 1 224 ? 19.742  -1.435  22.602  1.00   45.03  ? 224  ARG A CB  1 
ATOM   1743 C CG  . ARG A 1 224 ? 18.898  -2.688  22.561  1.00   54.69  ? 224  ARG A CG  1 
ATOM   1744 C CD  . ARG A 1 224 ? 17.549  -2.481  23.221  1.00   51.68  ? 224  ARG A CD  1 
ATOM   1745 N NE  . ARG A 1 224 ? 17.716  -2.163  24.628  1.00   59.65  ? 224  ARG A NE  1 
ATOM   1746 C CZ  . ARG A 1 224 ? 18.056  -3.052  25.559  1.00   58.57  ? 224  ARG A CZ  1 
ATOM   1747 N NH1 . ARG A 1 224 ? 18.256  -4.324  25.230  1.00   52.46  ? 224  ARG A NH1 1 
ATOM   1748 N NH2 . ARG A 1 224 ? 18.194  -2.665  26.824  1.00   51.42  ? 224  ARG A NH2 1 
ATOM   1749 N N   . ALA A 1 225 ? 21.368  0.159   20.510  1.00   39.70  ? 225  ALA A N   1 
ATOM   1750 C CA  . ALA A 1 225 ? 22.079  1.272   19.908  1.00   39.96  ? 225  ALA A CA  1 
ATOM   1751 C C   . ALA A 1 225 ? 21.195  2.153   19.047  1.00   37.52  ? 225  ALA A C   1 
ATOM   1752 O O   . ALA A 1 225 ? 20.424  1.662   18.234  1.00   39.43  ? 225  ALA A O   1 
ATOM   1753 C CB  . ALA A 1 225 ? 23.262  0.757   19.100  1.00   37.17  ? 225  ALA A CB  1 
ATOM   1754 N N   . VAL A 1 226 ? 21.325  3.458   19.248  1.00   33.29  ? 226  VAL A N   1 
ATOM   1755 C CA  . VAL A 1 226 ? 20.657  4.461   18.435  1.00   37.71  ? 226  VAL A CA  1 
ATOM   1756 C C   . VAL A 1 226 ? 21.678  5.286   17.629  1.00   38.23  ? 226  VAL A C   1 
ATOM   1757 O O   . VAL A 1 226 ? 22.656  5.798   18.181  1.00   39.38  ? 226  VAL A O   1 
ATOM   1758 C CB  . VAL A 1 226 ? 19.845  5.423   19.309  1.00   38.39  ? 226  VAL A CB  1 
ATOM   1759 C CG1 . VAL A 1 226 ? 19.115  6.437   18.427  1.00   40.41  ? 226  VAL A CG1 1 
ATOM   1760 C CG2 . VAL A 1 226 ? 18.868  4.650   20.177  1.00   35.36  ? 226  VAL A CG2 1 
ATOM   1761 N N   . LEU A 1 227 ? 21.443  5.408   16.329  1.00   35.71  ? 227  LEU A N   1 
ATOM   1762 C CA  . LEU A 1 227 ? 22.315  6.177   15.447  1.00   34.30  ? 227  LEU A CA  1 
ATOM   1763 C C   . LEU A 1 227 ? 21.510  7.277   14.764  1.00   37.95  ? 227  LEU A C   1 
ATOM   1764 O O   . LEU A 1 227 ? 20.704  7.011   13.867  1.00   35.00  ? 227  LEU A O   1 
ATOM   1765 C CB  . LEU A 1 227 ? 22.941  5.280   14.379  1.00   30.95  ? 227  LEU A CB  1 
ATOM   1766 C CG  . LEU A 1 227 ? 24.003  4.270   14.808  1.00   34.92  ? 227  LEU A CG  1 
ATOM   1767 C CD1 . LEU A 1 227 ? 23.342  3.037   15.408  1.00   32.46  ? 227  LEU A CD1 1 
ATOM   1768 C CD2 . LEU A 1 227 ? 24.906  3.899   13.633  1.00   30.78  ? 227  LEU A CD2 1 
ATOM   1769 N N   . GLN A 1 228 ? 21.729  8.510   15.202  1.00   34.97  ? 228  GLN A N   1 
ATOM   1770 C CA  . GLN A 1 228 ? 21.016  9.655   14.663  1.00   37.13  ? 228  GLN A CA  1 
ATOM   1771 C C   . GLN A 1 228 ? 21.896  10.369  13.634  1.00   38.54  ? 228  GLN A C   1 
ATOM   1772 O O   . GLN A 1 228 ? 22.978  10.850  13.966  1.00   33.82  ? 228  GLN A O   1 
ATOM   1773 C CB  . GLN A 1 228 ? 20.622  10.600  15.809  1.00   32.28  ? 228  GLN A CB  1 
ATOM   1774 C CG  . GLN A 1 228 ? 19.965  9.873   16.979  1.00   31.76  ? 228  GLN A CG  1 
ATOM   1775 C CD  . GLN A 1 228 ? 19.658  10.772  18.170  1.00   32.89  ? 228  GLN A CD  1 
ATOM   1776 O OE1 . GLN A 1 228 ? 19.538  10.296  19.301  1.00   34.69  ? 228  GLN A OE1 1 
ATOM   1777 N NE2 . GLN A 1 228 ? 19.542  12.074  17.926  1.00   31.51  ? 228  GLN A NE2 1 
ATOM   1778 N N   . SER A 1 229 ? 21.431  10.411  12.386  1.00   37.92  ? 229  SER A N   1 
ATOM   1779 C CA  . SER A 1 229 ? 22.104  11.135  11.305  1.00   32.81  ? 229  SER A CA  1 
ATOM   1780 C C   . SER A 1 229 ? 23.597  10.852  11.193  1.00   34.70  ? 229  SER A C   1 
ATOM   1781 O O   . SER A 1 229 ? 24.406  11.767  11.051  1.00   38.83  ? 229  SER A O   1 
ATOM   1782 C CB  . SER A 1 229 ? 21.897  12.636  11.453  1.00   33.31  ? 229  SER A CB  1 
ATOM   1783 O OG  . SER A 1 229 ? 20.543  12.931  11.698  1.00   38.14  ? 229  SER A OG  1 
ATOM   1784 N N   . GLY A 1 230 ? 23.969  9.587   11.245  1.00   34.45  ? 230  GLY A N   1 
ATOM   1785 C CA  . GLY A 1 230 ? 25.366  9.240   11.113  1.00   36.40  ? 230  GLY A CA  1 
ATOM   1786 C C   . GLY A 1 230 ? 25.556  7.745   11.038  1.00   39.50  ? 230  GLY A C   1 
ATOM   1787 O O   . GLY A 1 230 ? 24.739  6.976   11.559  1.00   34.74  ? 230  GLY A O   1 
ATOM   1788 N N   . THR A 1 231 ? 26.641  7.330   10.396  1.00   35.15  ? 231  THR A N   1 
ATOM   1789 C CA  . THR A 1 231 ? 26.895  5.911   10.196  1.00   41.69  ? 231  THR A CA  1 
ATOM   1790 C C   . THR A 1 231 ? 28.390  5.666   10.185  1.00   37.36  ? 231  THR A C   1 
ATOM   1791 O O   . THR A 1 231 ? 29.152  6.581   9.902   1.00   38.13  ? 231  THR A O   1 
ATOM   1792 C CB  . THR A 1 231 ? 26.301  5.425   8.856   1.00   39.30  ? 231  THR A CB  1 
ATOM   1793 O OG1 . THR A 1 231 ? 27.018  6.025   7.775   1.00   37.76  ? 231  THR A OG1 1 
ATOM   1794 C CG2 . THR A 1 231 ? 24.831  5.797   8.747   1.00   35.86  ? 231  THR A CG2 1 
ATOM   1795 N N   . PRO A 1 232 ? 28.820  4.433   10.491  1.00   38.98  ? 232  PRO A N   1 
ATOM   1796 C CA  . PRO A 1 232 ? 30.267  4.197   10.425  1.00   35.40  ? 232  PRO A CA  1 
ATOM   1797 C C   . PRO A 1 232 ? 30.682  3.999   8.970   1.00   36.74  ? 232  PRO A C   1 
ATOM   1798 O O   . PRO A 1 232 ? 31.816  4.305   8.607   1.00   40.22  ? 232  PRO A O   1 
ATOM   1799 C CB  . PRO A 1 232 ? 30.462  2.901   11.232  1.00   30.50  ? 232  PRO A CB  1 
ATOM   1800 C CG  . PRO A 1 232 ? 29.062  2.364   11.531  1.00   33.81  ? 232  PRO A CG  1 
ATOM   1801 C CD  . PRO A 1 232 ? 28.062  3.209   10.812  1.00   39.38  ? 232  PRO A CD  1 
ATOM   1802 N N   . ASN A 1 233 ? 29.770  3.481   8.152   1.00   33.99  ? 233  ASN A N   1 
ATOM   1803 C CA  . ASN A 1 233 ? 29.997  3.400   6.718   1.00   39.58  ? 233  ASN A CA  1 
ATOM   1804 C C   . ASN A 1 233 ? 29.802  4.790   6.126   1.00   40.12  ? 233  ASN A C   1 
ATOM   1805 O O   . ASN A 1 233 ? 29.416  5.718   6.846   1.00   37.39  ? 233  ASN A O   1 
ATOM   1806 C CB  . ASN A 1 233 ? 29.037  2.395   6.066   1.00   34.10  ? 233  ASN A CB  1 
ATOM   1807 C CG  . ASN A 1 233 ? 27.592  2.658   6.422   1.00   37.33  ? 233  ASN A CG  1 
ATOM   1808 O OD1 . ASN A 1 233 ? 27.212  2.592   7.592   1.00   40.26  ? 233  ASN A OD1 1 
ATOM   1809 N ND2 . ASN A 1 233 ? 26.773  2.959   5.421   1.00   35.00  ? 233  ASN A ND2 1 
ATOM   1810 N N   . GLY A 1 234 ? 30.064  4.944   4.829   1.00   40.98  ? 234  GLY A N   1 
ATOM   1811 C CA  . GLY A 1 234 ? 29.918  6.242   4.180   1.00   39.54  ? 234  GLY A CA  1 
ATOM   1812 C C   . GLY A 1 234 ? 31.241  6.956   3.942   1.00   41.91  ? 234  GLY A C   1 
ATOM   1813 O O   . GLY A 1 234 ? 32.300  6.442   4.281   1.00   44.57  ? 234  GLY A O   1 
ATOM   1814 N N   . PRO A 1 235 ? 31.190  8.163   3.367   1.00   44.38  ? 235  PRO A N   1 
ATOM   1815 C CA  . PRO A 1 235 ? 32.393  8.769   2.793   1.00   39.35  ? 235  PRO A CA  1 
ATOM   1816 C C   . PRO A 1 235 ? 33.267  9.580   3.762   1.00   41.06  ? 235  PRO A C   1 
ATOM   1817 O O   . PRO A 1 235 ? 34.404  9.901   3.403   1.00   37.32  ? 235  PRO A O   1 
ATOM   1818 C CB  . PRO A 1 235 ? 31.828  9.697   1.708   1.00   36.12  ? 235  PRO A CB  1 
ATOM   1819 C CG  . PRO A 1 235 ? 30.309  9.665   1.861   1.00   43.12  ? 235  PRO A CG  1 
ATOM   1820 C CD  . PRO A 1 235 ? 30.006  9.007   3.160   1.00   40.90  ? 235  PRO A CD  1 
ATOM   1821 N N   . TRP A 1 236 ? 32.768  9.908   4.951   1.00   40.72  ? 236  TRP A N   1 
ATOM   1822 C CA  . TRP A 1 236 ? 33.499  10.809  5.852   1.00   38.32  ? 236  TRP A CA  1 
ATOM   1823 C C   . TRP A 1 236 ? 33.953  10.187  7.186   1.00   38.67  ? 236  TRP A C   1 
ATOM   1824 O O   . TRP A 1 236 ? 34.867  10.702  7.820   1.00   37.72  ? 236  TRP A O   1 
ATOM   1825 C CB  . TRP A 1 236 ? 32.660  12.064  6.145   1.00   36.79  ? 236  TRP A CB  1 
ATOM   1826 C CG  . TRP A 1 236 ? 31.308  11.742  6.734   1.00   36.91  ? 236  TRP A CG  1 
ATOM   1827 C CD1 . TRP A 1 236 ? 30.143  11.561  6.047   1.00   36.44  ? 236  TRP A CD1 1 
ATOM   1828 C CD2 . TRP A 1 236 ? 30.991  11.536  8.124   1.00   30.21  ? 236  TRP A CD2 1 
ATOM   1829 N NE1 . TRP A 1 236 ? 29.117  11.268  6.922   1.00   39.05  ? 236  TRP A NE1 1 
ATOM   1830 C CE2 . TRP A 1 236 ? 29.612  11.240  8.199   1.00   36.36  ? 236  TRP A CE2 1 
ATOM   1831 C CE3 . TRP A 1 236 ? 31.734  11.580  9.306   1.00   35.03  ? 236  TRP A CE3 1 
ATOM   1832 C CZ2 . TRP A 1 236 ? 28.961  10.982  9.414   1.00   37.64  ? 236  TRP A CZ2 1 
ATOM   1833 C CZ3 . TRP A 1 236 ? 31.084  11.328  10.517  1.00   35.08  ? 236  TRP A CZ3 1 
ATOM   1834 C CH2 . TRP A 1 236 ? 29.712  11.035  10.559  1.00   35.08  ? 236  TRP A CH2 1 
ATOM   1835 N N   . ALA A 1 237 ? 33.318  9.104   7.620   1.00   36.71  ? 237  ALA A N   1 
ATOM   1836 C CA  . ALA A 1 237 ? 33.511  8.627   9.003   1.00   38.83  ? 237  ALA A CA  1 
ATOM   1837 C C   . ALA A 1 237 ? 34.836  7.885   9.242   1.00   37.42  ? 237  ALA A C   1 
ATOM   1838 O O   . ALA A 1 237 ? 35.299  7.780   10.377  1.00   35.65  ? 237  ALA A O   1 
ATOM   1839 C CB  . ALA A 1 237 ? 32.320  7.774   9.468   1.00   27.05  ? 237  ALA A CB  1 
ATOM   1840 N N   . THR A 1 238 ? 35.447  7.375   8.181   1.00   33.32  ? 238  THR A N   1 
ATOM   1841 C CA  . THR A 1 238 ? 36.745  6.715   8.313   1.00   34.07  ? 238  THR A CA  1 
ATOM   1842 C C   . THR A 1 238 ? 37.699  7.092   7.177   1.00   37.85  ? 238  THR A C   1 
ATOM   1843 O O   . THR A 1 238 ? 37.274  7.577   6.135   1.00   38.80  ? 238  THR A O   1 
ATOM   1844 C CB  . THR A 1 238 ? 36.596  5.183   8.340   1.00   37.18  ? 238  THR A CB  1 
ATOM   1845 O OG1 . THR A 1 238 ? 35.929  4.745   7.148   1.00   33.85  ? 238  THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 238 ? 35.792  4.742   9.557   1.00   36.67  ? 238  THR A CG2 1 
ATOM   1847 N N   . VAL A 1 239 ? 38.991  6.880   7.388   1.00   39.15  ? 239  VAL A N   1 
ATOM   1848 C CA  . VAL A 1 239 ? 39.963  6.975   6.310   1.00   40.27  ? 239  VAL A CA  1 
ATOM   1849 C C   . VAL A 1 239 ? 40.796  5.693   6.327   1.00   44.11  ? 239  VAL A C   1 
ATOM   1850 O O   . VAL A 1 239 ? 40.882  5.025   7.353   1.00   41.35  ? 239  VAL A O   1 
ATOM   1851 C CB  . VAL A 1 239 ? 40.914  8.200   6.454   1.00   36.99  ? 239  VAL A CB  1 
ATOM   1852 C CG1 . VAL A 1 239 ? 40.196  9.502   6.127   1.00   32.84  ? 239  VAL A CG1 1 
ATOM   1853 C CG2 . VAL A 1 239 ? 41.548  8.237   7.832   1.00   32.61  ? 239  VAL A CG2 1 
ATOM   1854 N N   . SER A 1 240 ? 41.412  5.356   5.198   1.00   40.82  ? 240  SER A N   1 
ATOM   1855 C CA  . SER A 1 240 ? 42.282  4.187   5.126   1.00   46.73  ? 240  SER A CA  1 
ATOM   1856 C C   . SER A 1 240 ? 43.565  4.447   5.907   1.00   40.15  ? 240  SER A C   1 
ATOM   1857 O O   . SER A 1 240 ? 43.892  5.588   6.227   1.00   40.30  ? 240  SER A O   1 
ATOM   1858 C CB  . SER A 1 240 ? 42.640  3.891   3.673   1.00   37.58  ? 240  SER A CB  1 
ATOM   1859 O OG  . SER A 1 240 ? 43.465  4.924   3.173   1.00   43.94  ? 240  SER A OG  1 
ATOM   1860 N N   . ALA A 1 241 ? 44.301  3.387   6.203   1.00   38.87  ? 241  ALA A N   1 
ATOM   1861 C CA  . ALA A 1 241 ? 45.598  3.540   6.845   1.00   43.19  ? 241  ALA A CA  1 
ATOM   1862 C C   . ALA A 1 241 ? 46.512  4.456   6.028   1.00   43.13  ? 241  ALA A C   1 
ATOM   1863 O O   . ALA A 1 241 ? 47.197  5.314   6.580   1.00   39.46  ? 241  ALA A O   1 
ATOM   1864 C CB  . ALA A 1 241 ? 46.247  2.185   7.051   1.00   40.45  ? 241  ALA A CB  1 
ATOM   1865 N N   . GLY A 1 242 ? 46.509  4.280   4.710   1.00   42.77  ? 242  GLY A N   1 
ATOM   1866 C CA  . GLY A 1 242 ? 47.359  5.079   3.847   1.00   44.26  ? 242  GLY A CA  1 
ATOM   1867 C C   . GLY A 1 242 ? 47.036  6.556   3.934   1.00   43.62  ? 242  GLY A C   1 
ATOM   1868 O O   . GLY A 1 242 ? 47.921  7.395   4.095   1.00   41.97  ? 242  GLY A O   1 
ATOM   1869 N N   . GLU A 1 243 ? 45.753  6.876   3.818   1.00   41.23  ? 243  GLU A N   1 
ATOM   1870 C CA  . GLU A 1 243 ? 45.324  8.260   3.910   1.00   36.31  ? 243  GLU A CA  1 
ATOM   1871 C C   . GLU A 1 243 ? 45.614  8.829   5.313   1.00   41.75  ? 243  GLU A C   1 
ATOM   1872 O O   . GLU A 1 243 ? 46.095  9.964   5.447   1.00   41.88  ? 243  GLU A O   1 
ATOM   1873 C CB  . GLU A 1 243 ? 43.844  8.380   3.503   1.00   40.73  ? 243  GLU A CB  1 
ATOM   1874 C CG  . GLU A 1 243 ? 43.277  9.785   3.509   1.00   42.18  ? 243  GLU A CG  1 
ATOM   1875 C CD  . GLU A 1 243 ? 44.041  10.763  2.613   1.00   47.76  ? 243  GLU A CD  1 
ATOM   1876 O OE1 . GLU A 1 243 ? 44.920  10.324  1.836   1.00   46.94  ? 243  GLU A OE1 1 
ATOM   1877 O OE2 . GLU A 1 243 ? 43.751  11.982  2.687   1.00   42.35  ? 243  GLU A OE2 1 
ATOM   1878 N N   . ALA A 1 244 ? 45.365  8.045   6.360   1.00   35.58  ? 244  ALA A N   1 
ATOM   1879 C CA  . ALA A 1 244 ? 45.689  8.521   7.711   1.00   42.72  ? 244  ALA A CA  1 
ATOM   1880 C C   . ALA A 1 244 ? 47.170  8.865   7.816   1.00   39.77  ? 244  ALA A C   1 
ATOM   1881 O O   . ALA A 1 244 ? 47.536  9.942   8.311   1.00   41.73  ? 244  ALA A O   1 
ATOM   1882 C CB  . ALA A 1 244 ? 45.295  7.502   8.781   1.00   37.81  ? 244  ALA A CB  1 
ATOM   1883 N N   . ARG A 1 245 ? 48.019  7.957   7.336   1.00   35.78  ? 245  ARG A N   1 
ATOM   1884 C CA  . ARG A 1 245 ? 49.466  8.164   7.397   1.00   38.97  ? 245  ARG A CA  1 
ATOM   1885 C C   . ARG A 1 245 ? 49.845  9.435   6.647   1.00   40.08  ? 245  ARG A C   1 
ATOM   1886 O O   . ARG A 1 245 ? 50.577  10.281  7.157   1.00   43.92  ? 245  ARG A O   1 
ATOM   1887 C CB  . ARG A 1 245 ? 50.232  6.954   6.838   1.00   47.38  ? 245  ARG A CB  1 
ATOM   1888 C CG  . ARG A 1 245 ? 51.747  7.172   6.686   1.00   42.22  ? 245  ARG A CG  1 
ATOM   1889 C CD  . ARG A 1 245 ? 52.512  5.850   6.629   1.00   43.34  ? 245  ARG A CD  1 
ATOM   1890 N NE  . ARG A 1 245 ? 52.439  5.095   7.881   1.00   47.44  ? 245  ARG A NE  1 
ATOM   1891 C CZ  . ARG A 1 245 ? 53.314  5.200   8.873   1.00   45.23  ? 245  ARG A CZ  1 
ATOM   1892 N NH1 . ARG A 1 245 ? 54.337  6.029   8.773   1.00   47.67  ? 245  ARG A NH1 1 
ATOM   1893 N NH2 . ARG A 1 245 ? 53.162  4.485   9.973   1.00   47.13  ? 245  ARG A NH2 1 
ATOM   1894 N N   . ARG A 1 246 ? 49.320  9.569   5.437   1.00   35.36  ? 246  ARG A N   1 
ATOM   1895 C CA  . ARG A 1 246 ? 49.569  10.743  4.608   1.00   41.45  ? 246  ARG A CA  1 
ATOM   1896 C C   . ARG A 1 246 ? 49.190  12.060  5.296   1.00   44.79  ? 246  ARG A C   1 
ATOM   1897 O O   . ARG A 1 246 ? 50.005  12.982  5.369   1.00   40.79  ? 246  ARG A O   1 
ATOM   1898 C CB  . ARG A 1 246 ? 48.816  10.600  3.295   1.00   46.33  ? 246  ARG A CB  1 
ATOM   1899 C CG  . ARG A 1 246 ? 49.148  11.653  2.300   1.00   42.74  ? 246  ARG A CG  1 
ATOM   1900 C CD  . ARG A 1 246 ? 47.931  11.973  1.465   1.00   44.06  ? 246  ARG A CD  1 
ATOM   1901 N NE  . ARG A 1 246 ? 47.815  13.420  1.385   1.00   51.98  ? 246  ARG A NE  1 
ATOM   1902 C CZ  . ARG A 1 246 ? 46.768  14.124  1.779   1.00   41.33  ? 246  ARG A CZ  1 
ATOM   1903 N NH1 . ARG A 1 246 ? 45.690  13.526  2.254   1.00   46.87  ? 246  ARG A NH1 1 
ATOM   1904 N NH2 . ARG A 1 246 ? 46.793  15.439  1.665   1.00   59.84  ? 246  ARG A NH2 1 
ATOM   1905 N N   . ARG A 1 247 ? 47.962  12.151  5.809   1.00   43.01  ? 247  ARG A N   1 
ATOM   1906 C CA  . ARG A 1 247 ? 47.548  13.339  6.563   1.00   41.54  ? 247  ARG A CA  1 
ATOM   1907 C C   . ARG A 1 247 ? 48.393  13.605  7.816   1.00   43.45  ? 247  ARG A C   1 
ATOM   1908 O O   . ARG A 1 247 ? 48.695  14.750  8.136   1.00   43.07  ? 247  ARG A O   1 
ATOM   1909 C CB  . ARG A 1 247 ? 46.077  13.249  6.955   1.00   41.24  ? 247  ARG A CB  1 
ATOM   1910 C CG  . ARG A 1 247 ? 45.133  13.315  5.774   1.00   41.87  ? 247  ARG A CG  1 
ATOM   1911 C CD  . ARG A 1 247 ? 43.714  13.105  6.230   1.00   39.30  ? 247  ARG A CD  1 
ATOM   1912 N NE  . ARG A 1 247 ? 42.820  12.821  5.123   1.00   36.78  ? 247  ARG A NE  1 
ATOM   1913 C CZ  . ARG A 1 247 ? 41.499  12.809  5.224   1.00   42.95  ? 247  ARG A CZ  1 
ATOM   1914 N NH1 . ARG A 1 247 ? 40.917  13.071  6.395   1.00   42.11  ? 247  ARG A NH1 1 
ATOM   1915 N NH2 . ARG A 1 247 ? 40.760  12.543  4.156   1.00   39.84  ? 247  ARG A NH2 1 
ATOM   1916 N N   . ALA A 1 248 ? 48.766  12.553  8.534   1.00   46.59  ? 248  ALA A N   1 
ATOM   1917 C CA  . ALA A 1 248 ? 49.572  12.738  9.738   1.00   43.33  ? 248  ALA A CA  1 
ATOM   1918 C C   . ALA A 1 248 ? 50.942  13.317  9.407   1.00   41.64  ? 248  ALA A C   1 
ATOM   1919 O O   . ALA A 1 248 ? 51.421  14.233  10.086  1.00   43.10  ? 248  ALA A O   1 
ATOM   1920 C CB  . ALA A 1 248 ? 49.708  11.432  10.511  1.00   40.92  ? 248  ALA A CB  1 
ATOM   1921 N N   . THR A 1 249 ? 51.583  12.807  8.361   1.00   42.32  ? 249  THR A N   1 
ATOM   1922 C CA  . THR A 1 249 ? 52.927  13.300  8.066   1.00   47.57  ? 249  THR A CA  1 
ATOM   1923 C C   . THR A 1 249 ? 52.873  14.709  7.478   1.00   41.71  ? 249  THR A C   1 
ATOM   1924 O O   . THR A 1 249 ? 53.730  15.540  7.788   1.00   46.40  ? 249  THR A O   1 
ATOM   1925 C CB  . THR A 1 249 ? 53.767  12.324  7.204   1.00   45.23  ? 249  THR A CB  1 
ATOM   1926 O OG1 . THR A 1 249 ? 53.804  12.769  5.849   1.00   57.65  ? 249  THR A OG1 1 
ATOM   1927 C CG2 . THR A 1 249 ? 53.192  10.924  7.271   1.00   42.55  ? 249  THR A CG2 1 
ATOM   1928 N N   . LEU A 1 250 ? 51.847  14.996  6.677   1.00   39.28  ? 250  LEU A N   1 
ATOM   1929 C CA  . LEU A 1 250 ? 51.671  16.351  6.163   1.00   40.02  ? 250  LEU A CA  1 
ATOM   1930 C C   . LEU A 1 250 ? 51.520  17.347  7.301   1.00   42.40  ? 250  LEU A C   1 
ATOM   1931 O O   . LEU A 1 250 ? 52.153  18.407  7.300   1.00   43.76  ? 250  LEU A O   1 
ATOM   1932 C CB  . LEU A 1 250 ? 50.476  16.466  5.209   1.00   41.62  ? 250  LEU A CB  1 
ATOM   1933 C CG  . LEU A 1 250 ? 50.230  17.886  4.646   1.00   43.07  ? 250  LEU A CG  1 
ATOM   1934 C CD1 . LEU A 1 250 ? 51.527  18.552  4.171   1.00   44.70  ? 250  LEU A CD1 1 
ATOM   1935 C CD2 . LEU A 1 250 ? 49.203  17.908  3.518   1.00   39.24  ? 250  LEU A CD2 1 
ATOM   1936 N N   . LEU A 1 251 ? 50.678  17.017  8.277   1.00   44.89  ? 251  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 251 ? 50.452  17.946  9.376   1.00   39.50  ? 251  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 251 ? 51.715  18.153  10.210  1.00   38.27  ? 251  LEU A C   1 
ATOM   1939 O O   . LEU A 1 251 ? 52.014  19.278  10.621  1.00   39.58  ? 251  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 251 ? 49.275  17.522  10.255  1.00   37.97  ? 251  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 251 ? 49.228  18.444  11.475  1.00   39.84  ? 251  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 251 ? 47.897  19.151  11.624  1.00   46.83  ? 251  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 251 ? 49.634  17.707  12.740  1.00   39.40  ? 251  LEU A CD2 1 
ATOM   1944 N N   . ALA A 1 252 ? 52.446  17.069  10.466  1.00   40.01  ? 252  ALA A N   1 
ATOM   1945 C CA  . ALA A 1 252 ? 53.779  17.177  11.078  1.00   47.67  ? 252  ALA A CA  1 
ATOM   1946 C C   . ALA A 1 252 ? 54.664  18.214  10.361  1.00   45.11  ? 252  ALA A C   1 
ATOM   1947 O O   . ALA A 1 252 ? 55.219  19.108  11.004  1.00   41.64  ? 252  ALA A O   1 
ATOM   1948 C CB  . ALA A 1 252 ? 54.463  15.831  11.118  1.00   44.78  ? 252  ALA A CB  1 
ATOM   1949 N N   A ARG A 1 253 ? 54.792  18.090  9.042   0.54   43.10  ? 253  ARG A N   1 
ATOM   1950 N N   B ARG A 1 253 ? 54.773  18.100  9.039   0.46   43.13  ? 253  ARG A N   1 
ATOM   1951 C CA  A ARG A 1 253 ? 55.541  19.070  8.255   0.54   45.07  ? 253  ARG A CA  1 
ATOM   1952 C CA  B ARG A 1 253 ? 55.555  19.054  8.249   0.46   45.08  ? 253  ARG A CA  1 
ATOM   1953 C C   A ARG A 1 253 ? 55.091  20.491  8.545   0.54   46.83  ? 253  ARG A C   1 
ATOM   1954 C C   B ARG A 1 253 ? 55.103  20.498  8.466   0.46   46.80  ? 253  ARG A C   1 
ATOM   1955 O O   A ARG A 1 253 ? 55.895  21.346  8.929   0.54   45.71  ? 253  ARG A O   1 
ATOM   1956 O O   B ARG A 1 253 ? 55.924  21.377  8.735   0.46   45.77  ? 253  ARG A O   1 
ATOM   1957 C CB  A ARG A 1 253 ? 55.396  18.797  6.764   0.54   44.31  ? 253  ARG A CB  1 
ATOM   1958 C CB  B ARG A 1 253 ? 55.523  18.697  6.761   0.46   44.38  ? 253  ARG A CB  1 
ATOM   1959 C CG  A ARG A 1 253 ? 56.551  18.052  6.159   0.54   49.99  ? 253  ARG A CG  1 
ATOM   1960 C CG  B ARG A 1 253 ? 56.275  17.421  6.411   0.46   47.20  ? 253  ARG A CG  1 
ATOM   1961 C CD  A ARG A 1 253 ? 56.299  17.798  4.689   0.54   54.25  ? 253  ARG A CD  1 
ATOM   1962 C CD  B ARG A 1 253 ? 56.660  17.399  4.933   0.46   54.87  ? 253  ARG A CD  1 
ATOM   1963 N NE  A ARG A 1 253 ? 55.599  16.534  4.502   0.54   55.11  ? 253  ARG A NE  1 
ATOM   1964 N NE  B ARG A 1 253 ? 57.748  16.464  4.645   0.46   55.89  ? 253  ARG A NE  1 
ATOM   1965 C CZ  A ARG A 1 253 ? 54.870  16.237  3.436   0.54   55.43  ? 253  ARG A CZ  1 
ATOM   1966 C CZ  B ARG A 1 253 ? 57.587  15.280  4.058   0.46   58.80  ? 253  ARG A CZ  1 
ATOM   1967 N NH1 A ARG A 1 253 ? 54.733  17.131  2.459   0.54   52.76  ? 253  ARG A NH1 1 
ATOM   1968 N NH1 B ARG A 1 253 ? 56.377  14.873  3.690   0.46   56.93  ? 253  ARG A NH1 1 
ATOM   1969 N NH2 A ARG A 1 253 ? 54.271  15.054  3.359   0.54   46.68  ? 253  ARG A NH2 1 
ATOM   1970 N NH2 B ARG A 1 253 ? 58.638  14.503  3.833   0.46   55.10  ? 253  ARG A NH2 1 
ATOM   1971 N N   . LEU A 1 254 ? 53.796  20.733  8.367   1.00   44.01  ? 254  LEU A N   1 
ATOM   1972 C CA  . LEU A 1 254 ? 53.230  22.071  8.564   1.00   44.60  ? 254  LEU A CA  1 
ATOM   1973 C C   . LEU A 1 254 ? 53.598  22.741  9.894   1.00   48.52  ? 254  LEU A C   1 
ATOM   1974 O O   . LEU A 1 254 ? 53.609  23.972  9.989   1.00   50.17  ? 254  LEU A O   1 
ATOM   1975 C CB  . LEU A 1 254 ? 51.706  22.045  8.362   1.00   40.77  ? 254  LEU A CB  1 
ATOM   1976 C CG  . LEU A 1 254 ? 51.366  21.522  6.954   1.00   48.22  ? 254  LEU A CG  1 
ATOM   1977 C CD1 . LEU A 1 254 ? 49.882  21.326  6.711   1.00   41.87  ? 254  LEU A CD1 1 
ATOM   1978 C CD2 . LEU A 1 254 ? 51.974  22.422  5.882   1.00   42.58  ? 254  LEU A CD2 1 
ATOM   1979 N N   . VAL A 1 255 ? 53.901  21.945  10.916  1.00   46.77  ? 255  VAL A N   1 
ATOM   1980 C CA  . VAL A 1 255 ? 54.239  22.504  12.223  1.00   46.24  ? 255  VAL A CA  1 
ATOM   1981 C C   . VAL A 1 255 ? 55.724  22.336  12.529  1.00   52.89  ? 255  VAL A C   1 
ATOM   1982 O O   . VAL A 1 255 ? 56.200  22.736  13.595  1.00   54.18  ? 255  VAL A O   1 
ATOM   1983 C CB  . VAL A 1 255 ? 53.381  21.904  13.382  1.00   48.85  ? 255  VAL A CB  1 
ATOM   1984 C CG1 . VAL A 1 255 ? 51.901  22.178  13.150  1.00   47.83  ? 255  VAL A CG1 1 
ATOM   1985 C CG2 . VAL A 1 255 ? 53.643  20.414  13.553  1.00   38.42  ? 255  VAL A CG2 1 
ATOM   1986 N N   . GLY A 1 256 ? 56.446  21.739  11.586  1.00   52.00  ? 256  GLY A N   1 
ATOM   1987 C CA  . GLY A 1 256 ? 57.894  21.687  11.655  1.00   53.73  ? 256  GLY A CA  1 
ATOM   1988 C C   . GLY A 1 256 ? 58.453  20.451  12.327  1.00   56.12  ? 256  GLY A C   1 
ATOM   1989 O O   . GLY A 1 256 ? 59.088  20.552  13.371  1.00   59.62  ? 256  GLY A O   1 
ATOM   1990 N N   . CYS A 1 257 ? 58.236  19.291  11.715  1.00   51.25  ? 257  CYS A N   1 
ATOM   1991 C CA  . CYS A 1 257 ? 58.648  18.028  12.295  1.00   51.42  ? 257  CYS A CA  1 
ATOM   1992 C C   . CYS A 1 257 ? 59.158  17.094  11.210  1.00   66.65  ? 257  CYS A C   1 
ATOM   1993 O O   . CYS A 1 257 ? 58.371  16.609  10.404  1.00   65.58  ? 257  CYS A O   1 
ATOM   1994 C CB  . CYS A 1 257 ? 57.473  17.375  13.024  1.00   47.38  ? 257  CYS A CB  1 
ATOM   1995 S SG  . CYS A 1 257 ? 56.997  18.168  14.594  1.00   55.64  ? 257  CYS A SG  1 
ATOM   1996 N N   . ASN A 1 265 ? 61.120  7.609   10.178  1.00   76.46  ? 265  ASN A N   1 
ATOM   1997 C CA  . ASN A 1 265 ? 61.012  6.975   11.493  1.00   75.12  ? 265  ASN A CA  1 
ATOM   1998 C C   . ASN A 1 265 ? 59.854  7.561   12.317  1.00   60.97  ? 265  ASN A C   1 
ATOM   1999 O O   . ASN A 1 265 ? 59.872  8.740   12.696  1.00   63.70  ? 265  ASN A O   1 
ATOM   2000 C CB  . ASN A 1 265 ? 62.346  7.096   12.238  1.00   74.38  ? 265  ASN A CB  1 
ATOM   2001 C CG  . ASN A 1 265 ? 62.329  6.421   13.595  1.00   71.12  ? 265  ASN A CG  1 
ATOM   2002 O OD1 . ASN A 1 265 ? 62.192  7.085   14.622  1.00   74.02  ? 265  ASN A OD1 1 
ATOM   2003 N ND2 . ASN A 1 265 ? 62.482  5.098   13.609  1.00   66.94  ? 265  ASN A ND2 1 
ATOM   2004 N N   . ASP A 1 266 ? 58.840  6.743   12.583  1.00   59.02  ? 266  ASP A N   1 
ATOM   2005 C CA  . ASP A 1 266 ? 57.627  7.251   13.224  1.00   57.72  ? 266  ASP A CA  1 
ATOM   2006 C C   . ASP A 1 266 ? 57.926  7.835   14.595  1.00   54.86  ? 266  ASP A C   1 
ATOM   2007 O O   . ASP A 1 266 ? 57.497  8.941   14.912  1.00   57.24  ? 266  ASP A O   1 
ATOM   2008 C CB  . ASP A 1 266 ? 56.543  6.173   13.311  1.00   50.46  ? 266  ASP A CB  1 
ATOM   2009 C CG  . ASP A 1 266 ? 55.936  5.848   11.957  1.00   50.87  ? 266  ASP A CG  1 
ATOM   2010 O OD1 . ASP A 1 266 ? 56.091  6.657   11.019  1.00   56.76  ? 266  ASP A OD1 1 
ATOM   2011 O OD2 . ASP A 1 266 ? 55.296  4.787   11.822  1.00   50.70  ? 266  ASP A OD2 1 
ATOM   2012 N N   . THR A 1 267 ? 58.694  7.102   15.389  1.00   57.43  ? 267  THR A N   1 
ATOM   2013 C CA  . THR A 1 267 ? 59.044  7.524   16.744  1.00   54.53  ? 267  THR A CA  1 
ATOM   2014 C C   . THR A 1 267 ? 59.466  8.994   16.874  1.00   51.37  ? 267  THR A C   1 
ATOM   2015 O O   . THR A 1 267 ? 58.981  9.706   17.751  1.00   52.39  ? 267  THR A O   1 
ATOM   2016 C CB  . THR A 1 267 ? 60.140  6.617   17.337  1.00   53.24  ? 267  THR A CB  1 
ATOM   2017 O OG1 . THR A 1 267 ? 59.707  5.251   17.288  1.00   51.72  ? 267  THR A OG1 1 
ATOM   2018 C CG2 . THR A 1 267 ? 60.418  6.998   18.776  1.00   49.05  ? 267  THR A CG2 1 
ATOM   2019 N N   . GLU A 1 268 ? 60.367  9.451   16.013  1.00   56.25  ? 268  GLU A N   1 
ATOM   2020 C CA  . GLU A 1 268 ? 60.859  10.830  16.106  1.00   59.10  ? 268  GLU A CA  1 
ATOM   2021 C C   . GLU A 1 268 ? 59.819  11.851  15.646  1.00   51.53  ? 268  GLU A C   1 
ATOM   2022 O O   . GLU A 1 268 ? 59.658  12.909  16.248  1.00   51.08  ? 268  GLU A O   1 
ATOM   2023 C CB  . GLU A 1 268 ? 62.127  11.004  15.271  1.00   68.46  ? 268  GLU A CB  1 
ATOM   2024 C CG  . GLU A 1 268 ? 63.068  9.819   15.300  1.00   80.79  ? 268  GLU A CG  1 
ATOM   2025 C CD  . GLU A 1 268 ? 64.113  9.892   14.200  1.00   100.60 ? 268  GLU A CD  1 
ATOM   2026 O OE1 . GLU A 1 268 ? 64.646  11.002  13.956  1.00   96.97  ? 268  GLU A OE1 1 
ATOM   2027 O OE2 . GLU A 1 268 ? 64.395  8.841   13.579  1.00   97.79  ? 268  GLU A OE2 1 
ATOM   2028 N N   . LEU A 1 269 ? 59.125  11.533  14.561  1.00   52.30  ? 269  LEU A N   1 
ATOM   2029 C CA  . LEU A 1 269 ? 58.053  12.386  14.078  1.00   54.38  ? 269  LEU A CA  1 
ATOM   2030 C C   . LEU A 1 269 ? 57.038  12.636  15.200  1.00   50.87  ? 269  LEU A C   1 
ATOM   2031 O O   . LEU A 1 269 ? 56.745  13.778  15.561  1.00   48.98  ? 269  LEU A O   1 
ATOM   2032 C CB  . LEU A 1 269 ? 57.388  11.728  12.871  1.00   51.36  ? 269  LEU A CB  1 
ATOM   2033 C CG  . LEU A 1 269 ? 56.366  12.551  12.105  1.00   53.89  ? 269  LEU A CG  1 
ATOM   2034 C CD1 . LEU A 1 269 ? 56.350  12.104  10.671  1.00   54.37  ? 269  LEU A CD1 1 
ATOM   2035 C CD2 . LEU A 1 269 ? 54.988  12.406  12.729  1.00   55.04  ? 269  LEU A CD2 1 
ATOM   2036 N N   . ILE A 1 270 ? 56.531  11.549  15.768  1.00   50.66  ? 270  ILE A N   1 
ATOM   2037 C CA  . ILE A 1 270 ? 55.579  11.620  16.860  1.00   45.32  ? 270  ILE A CA  1 
ATOM   2038 C C   . ILE A 1 270 ? 56.145  12.353  18.057  1.00   47.73  ? 270  ILE A C   1 
ATOM   2039 O O   . ILE A 1 270 ? 55.440  13.110  18.718  1.00   45.87  ? 270  ILE A O   1 
ATOM   2040 C CB  . ILE A 1 270 ? 55.177  10.229  17.291  1.00   45.01  ? 270  ILE A CB  1 
ATOM   2041 C CG1 . ILE A 1 270 ? 54.644  9.469   16.079  1.00   48.41  ? 270  ILE A CG1 1 
ATOM   2042 C CG2 . ILE A 1 270 ? 54.153  10.301  18.425  1.00   41.74  ? 270  ILE A CG2 1 
ATOM   2043 C CD1 . ILE A 1 270 ? 54.506  7.981   16.303  1.00   52.86  ? 270  ILE A CD1 1 
ATOM   2044 N N   . ALA A 1 271 ? 57.422  12.135  18.341  1.00   45.32  ? 271  ALA A N   1 
ATOM   2045 C CA  . ALA A 1 271 ? 58.012  12.768  19.502  1.00   46.14  ? 271  ALA A CA  1 
ATOM   2046 C C   . ALA A 1 271 ? 58.085  14.275  19.279  1.00   46.64  ? 271  ALA A C   1 
ATOM   2047 O O   . ALA A 1 271 ? 57.918  15.067  20.209  1.00   46.68  ? 271  ALA A O   1 
ATOM   2048 C CB  . ALA A 1 271 ? 59.370  12.178  19.799  1.00   44.69  ? 271  ALA A CB  1 
ATOM   2049 N N   . CYS A 1 272 ? 58.310  14.678  18.036  1.00   51.58  ? 272  CYS A N   1 
ATOM   2050 C CA  . CYS A 1 272 ? 58.319  16.100  17.719  1.00   48.02  ? 272  CYS A CA  1 
ATOM   2051 C C   . CYS A 1 272 ? 56.923  16.672  17.886  1.00   43.20  ? 272  CYS A C   1 
ATOM   2052 O O   . CYS A 1 272 ? 56.744  17.710  18.526  1.00   44.93  ? 272  CYS A O   1 
ATOM   2053 C CB  . CYS A 1 272 ? 58.812  16.352  16.293  1.00   49.66  ? 272  CYS A CB  1 
ATOM   2054 S SG  . CYS A 1 272 ? 58.655  18.101  15.805  1.00   64.98  ? 272  CYS A SG  1 
ATOM   2055 N N   . LEU A 1 273 ? 55.936  15.992  17.303  1.00   41.84  ? 273  LEU A N   1 
ATOM   2056 C CA  . LEU A 1 273 ? 54.540  16.399  17.457  1.00   44.70  ? 273  LEU A CA  1 
ATOM   2057 C C   . LEU A 1 273 ? 54.163  16.588  18.932  1.00   47.68  ? 273  LEU A C   1 
ATOM   2058 O O   . LEU A 1 273 ? 53.453  17.539  19.283  1.00   44.50  ? 273  LEU A O   1 
ATOM   2059 C CB  . LEU A 1 273 ? 53.591  15.392  16.805  1.00   44.32  ? 273  LEU A CB  1 
ATOM   2060 C CG  . LEU A 1 273 ? 53.502  15.348  15.279  1.00   46.79  ? 273  LEU A CG  1 
ATOM   2061 C CD1 . LEU A 1 273 ? 52.549  14.249  14.843  1.00   47.46  ? 273  LEU A CD1 1 
ATOM   2062 C CD2 . LEU A 1 273 ? 53.064  16.684  14.718  1.00   43.28  ? 273  LEU A CD2 1 
ATOM   2063 N N   . ARG A 1 274 ? 54.640  15.693  19.796  1.00   40.62  ? 274  ARG A N   1 
ATOM   2064 C CA  . ARG A 1 274 ? 54.333  15.817  21.214  1.00   45.54  ? 274  ARG A CA  1 
ATOM   2065 C C   . ARG A 1 274 ? 54.939  17.072  21.847  1.00   45.21  ? 274  ARG A C   1 
ATOM   2066 O O   . ARG A 1 274 ? 54.499  17.490  22.917  1.00   47.97  ? 274  ARG A O   1 
ATOM   2067 C CB  . ARG A 1 274 ? 54.706  14.552  22.000  1.00   40.79  ? 274  ARG A CB  1 
ATOM   2068 C CG  . ARG A 1 274 ? 53.785  13.366  21.733  1.00   39.49  ? 274  ARG A CG  1 
ATOM   2069 C CD  . ARG A 1 274 ? 54.059  12.241  22.728  1.00   46.72  ? 274  ARG A CD  1 
ATOM   2070 N NE  . ARG A 1 274 ? 55.499  12.068  22.905  1.00   58.42  ? 274  ARG A NE  1 
ATOM   2071 C CZ  . ARG A 1 274 ? 56.206  11.063  22.394  1.00   53.11  ? 274  ARG A CZ  1 
ATOM   2072 N NH1 . ARG A 1 274 ? 55.598  10.112  21.692  1.00   46.91  ? 274  ARG A NH1 1 
ATOM   2073 N NH2 . ARG A 1 274 ? 57.519  11.006  22.595  1.00   47.67  ? 274  ARG A NH2 1 
ATOM   2074 N N   . THR A 1 275 ? 55.921  17.693  21.192  1.00   41.70  ? 275  THR A N   1 
ATOM   2075 C CA  . THR A 1 275 ? 56.499  18.928  21.749  1.00   44.27  ? 275  THR A CA  1 
ATOM   2076 C C   . THR A 1 275 ? 55.714  20.167  21.340  1.00   41.76  ? 275  THR A C   1 
ATOM   2077 O O   . THR A 1 275 ? 55.926  21.243  21.882  1.00   48.54  ? 275  THR A O   1 
ATOM   2078 C CB  . THR A 1 275 ? 57.981  19.146  21.351  1.00   46.79  ? 275  THR A CB  1 
ATOM   2079 O OG1 . THR A 1 275 ? 58.059  19.557  19.980  1.00   44.58  ? 275  THR A OG1 1 
ATOM   2080 C CG2 . THR A 1 275 ? 58.802  17.876  21.559  1.00   36.16  ? 275  THR A CG2 1 
ATOM   2081 N N   . ARG A 1 276 ? 54.810  20.015  20.380  1.00   41.62  ? 276  ARG A N   1 
ATOM   2082 C CA  . ARG A 1 276 ? 54.028  21.142  19.875  1.00   43.46  ? 276  ARG A CA  1 
ATOM   2083 C C   . ARG A 1 276 ? 52.880  21.553  20.800  1.00   43.36  ? 276  ARG A C   1 
ATOM   2084 O O   . ARG A 1 276 ? 52.179  20.708  21.361  1.00   45.30  ? 276  ARG A O   1 
ATOM   2085 C CB  . ARG A 1 276 ? 53.487  20.809  18.488  1.00   45.83  ? 276  ARG A CB  1 
ATOM   2086 C CG  . ARG A 1 276 ? 54.577  20.587  17.483  1.00   40.82  ? 276  ARG A CG  1 
ATOM   2087 C CD  . ARG A 1 276 ? 55.340  21.889  17.283  1.00   52.24  ? 276  ARG A CD  1 
ATOM   2088 N NE  . ARG A 1 276 ? 56.531  21.690  16.467  1.00   67.48  ? 276  ARG A NE  1 
ATOM   2089 C CZ  . ARG A 1 276 ? 57.773  21.739  16.937  1.00   69.62  ? 276  ARG A CZ  1 
ATOM   2090 N NH1 . ARG A 1 276 ? 57.982  22.002  18.224  1.00   65.11  ? 276  ARG A NH1 1 
ATOM   2091 N NH2 . ARG A 1 276 ? 58.804  21.538  16.121  1.00   62.85  ? 276  ARG A NH2 1 
ATOM   2092 N N   . PRO A 1 277 ? 52.692  22.864  20.973  1.00   45.51  ? 277  PRO A N   1 
ATOM   2093 C CA  . PRO A 1 277 ? 51.560  23.367  21.758  1.00   43.05  ? 277  PRO A CA  1 
ATOM   2094 C C   . PRO A 1 277 ? 50.257  22.872  21.128  1.00   42.63  ? 277  PRO A C   1 
ATOM   2095 O O   . PRO A 1 277 ? 50.179  22.782  19.906  1.00   41.39  ? 277  PRO A O   1 
ATOM   2096 C CB  . PRO A 1 277 ? 51.662  24.887  21.596  1.00   42.26  ? 277  PRO A CB  1 
ATOM   2097 C CG  . PRO A 1 277 ? 53.020  25.151  21.055  1.00   43.44  ? 277  PRO A CG  1 
ATOM   2098 C CD  . PRO A 1 277 ? 53.448  23.937  20.310  1.00   40.83  ? 277  PRO A CD  1 
ATOM   2099 N N   . ALA A 1 278 ? 49.254  22.548  21.933  1.00   41.49  ? 278  ALA A N   1 
ATOM   2100 C CA  . ALA A 1 278 ? 48.006  22.035  21.376  1.00   43.45  ? 278  ALA A CA  1 
ATOM   2101 C C   . ALA A 1 278 ? 47.499  22.945  20.261  1.00   38.60  ? 278  ALA A C   1 
ATOM   2102 O O   . ALA A 1 278 ? 47.080  22.472  19.199  1.00   41.29  ? 278  ALA A O   1 
ATOM   2103 C CB  . ALA A 1 278 ? 46.933  21.853  22.465  1.00   33.81  ? 278  ALA A CB  1 
ATOM   2104 N N   . GLN A 1 279 ? 47.553  24.250  20.503  1.00   40.32  ? 279  GLN A N   1 
ATOM   2105 C CA  . GLN A 1 279 ? 46.975  25.207  19.569  1.00   44.68  ? 279  GLN A CA  1 
ATOM   2106 C C   . GLN A 1 279 ? 47.633  25.190  18.199  1.00   42.51  ? 279  GLN A C   1 
ATOM   2107 O O   . GLN A 1 279 ? 46.994  25.517  17.204  1.00   43.48  ? 279  GLN A O   1 
ATOM   2108 C CB  . GLN A 1 279 ? 46.985  26.623  20.131  1.00   40.75  ? 279  GLN A CB  1 
ATOM   2109 C CG  . GLN A 1 279 ? 46.162  27.576  19.292  1.00   44.33  ? 279  GLN A CG  1 
ATOM   2110 C CD  . GLN A 1 279 ? 44.683  27.252  19.341  1.00   47.37  ? 279  GLN A CD  1 
ATOM   2111 O OE1 . GLN A 1 279 ? 44.080  27.190  20.417  1.00   52.33  ? 279  GLN A OE1 1 
ATOM   2112 N NE2 . GLN A 1 279 ? 44.089  27.042  18.179  1.00   47.93  ? 279  GLN A NE2 1 
ATOM   2113 N N   . ASP A 1 280 ? 48.898  24.796  18.138  1.00   44.01  ? 280  ASP A N   1 
ATOM   2114 C CA  . ASP A 1 280 ? 49.582  24.771  16.856  1.00   44.40  ? 280  ASP A CA  1 
ATOM   2115 C C   . ASP A 1 280 ? 49.034  23.659  15.988  1.00   43.29  ? 280  ASP A C   1 
ATOM   2116 O O   . ASP A 1 280 ? 48.920  23.816  14.773  1.00   41.71  ? 280  ASP A O   1 
ATOM   2117 C CB  . ASP A 1 280 ? 51.089  24.617  17.024  1.00   44.92  ? 280  ASP A CB  1 
ATOM   2118 C CG  . ASP A 1 280 ? 51.764  25.905  17.461  1.00   62.86  ? 280  ASP A CG  1 
ATOM   2119 O OD1 . ASP A 1 280 ? 51.047  26.891  17.788  1.00   61.54  ? 280  ASP A OD1 1 
ATOM   2120 O OD2 . ASP A 1 280 ? 53.019  25.925  17.481  1.00   65.45  ? 280  ASP A OD2 1 
ATOM   2121 N N   . LEU A 1 281 ? 48.692  22.533  16.610  1.00   42.45  ? 281  LEU A N   1 
ATOM   2122 C CA  . LEU A 1 281 ? 48.121  21.419  15.860  1.00   42.48  ? 281  LEU A CA  1 
ATOM   2123 C C   . LEU A 1 281 ? 46.747  21.818  15.326  1.00   41.71  ? 281  LEU A C   1 
ATOM   2124 O O   . LEU A 1 281 ? 46.437  21.607  14.150  1.00   42.40  ? 281  LEU A O   1 
ATOM   2125 C CB  . LEU A 1 281 ? 48.035  20.154  16.717  1.00   41.78  ? 281  LEU A CB  1 
ATOM   2126 C CG  . LEU A 1 281 ? 49.318  19.630  17.383  1.00   44.22  ? 281  LEU A CG  1 
ATOM   2127 C CD1 . LEU A 1 281 ? 49.028  18.342  18.133  1.00   37.46  ? 281  LEU A CD1 1 
ATOM   2128 C CD2 . LEU A 1 281 ? 50.444  19.403  16.371  1.00   40.07  ? 281  LEU A CD2 1 
ATOM   2129 N N   . VAL A 1 282 ? 45.936  22.421  16.187  1.00   41.48  ? 282  VAL A N   1 
ATOM   2130 C CA  . VAL A 1 282 ? 44.629  22.914  15.772  1.00   43.72  ? 282  VAL A CA  1 
ATOM   2131 C C   . VAL A 1 282 ? 44.752  23.907  14.604  1.00   46.70  ? 282  VAL A C   1 
ATOM   2132 O O   . VAL A 1 282 ? 43.994  23.824  13.632  1.00   37.27  ? 282  VAL A O   1 
ATOM   2133 C CB  . VAL A 1 282 ? 43.852  23.535  16.958  1.00   39.11  ? 282  VAL A CB  1 
ATOM   2134 C CG1 . VAL A 1 282 ? 42.596  24.197  16.473  1.00   39.17  ? 282  VAL A CG1 1 
ATOM   2135 C CG2 . VAL A 1 282 ? 43.507  22.452  17.994  1.00   39.11  ? 282  VAL A CG2 1 
ATOM   2136 N N   . ASP A 1 283 ? 45.715  24.827  14.690  1.00   41.79  ? 283  ASP A N   1 
ATOM   2137 C CA  . ASP A 1 283 ? 45.893  25.844  13.651  1.00   41.90  ? 283  ASP A CA  1 
ATOM   2138 C C   . ASP A 1 283 ? 46.187  25.265  12.252  1.00   45.29  ? 283  ASP A C   1 
ATOM   2139 O O   . ASP A 1 283 ? 45.939  25.931  11.251  1.00   43.42  ? 283  ASP A O   1 
ATOM   2140 C CB  . ASP A 1 283 ? 46.977  26.861  14.032  1.00   38.55  ? 283  ASP A CB  1 
ATOM   2141 C CG  . ASP A 1 283 ? 46.562  27.783  15.181  1.00   47.74  ? 283  ASP A CG  1 
ATOM   2142 O OD1 . ASP A 1 283 ? 45.369  27.815  15.555  1.00   43.59  ? 283  ASP A OD1 1 
ATOM   2143 O OD2 . ASP A 1 283 ? 47.448  28.487  15.716  1.00   55.34  ? 283  ASP A OD2 1 
ATOM   2144 N N   . HIS A 1 284 ? 46.699  24.040  12.168  1.00   38.34  ? 284  HIS A N   1 
ATOM   2145 C CA  . HIS A 1 284 ? 46.945  23.451  10.851  1.00   39.24  ? 284  HIS A CA  1 
ATOM   2146 C C   . HIS A 1 284 ? 46.062  22.275  10.493  1.00   38.62  ? 284  HIS A C   1 
ATOM   2147 O O   . HIS A 1 284 ? 46.195  21.706  9.409   1.00   41.43  ? 284  HIS A O   1 
ATOM   2148 C CB  . HIS A 1 284 ? 48.411  23.051  10.689  1.00   41.87  ? 284  HIS A CB  1 
ATOM   2149 C CG  . HIS A 1 284 ? 49.343  24.215  10.724  1.00   48.04  ? 284  HIS A CG  1 
ATOM   2150 N ND1 . HIS A 1 284 ? 49.893  24.688  11.896  1.00   50.46  ? 284  HIS A ND1 1 
ATOM   2151 C CD2 . HIS A 1 284 ? 49.777  25.038  9.740   1.00   49.83  ? 284  HIS A CD2 1 
ATOM   2152 C CE1 . HIS A 1 284 ? 50.647  25.741  11.628  1.00   54.47  ? 284  HIS A CE1 1 
ATOM   2153 N NE2 . HIS A 1 284 ? 50.591  25.975  10.328  1.00   50.74  ? 284  HIS A NE2 1 
ATOM   2154 N N   . GLU A 1 285 ? 45.147  21.910  11.377  1.00   38.08  ? 285  GLU A N   1 
ATOM   2155 C CA  . GLU A 1 285 ? 44.407  20.673  11.157  1.00   41.66  ? 285  GLU A CA  1 
ATOM   2156 C C   . GLU A 1 285 ? 43.552  20.647  9.882   1.00   38.20  ? 285  GLU A C   1 
ATOM   2157 O O   . GLU A 1 285 ? 43.359  19.585  9.301   1.00   39.74  ? 285  GLU A O   1 
ATOM   2158 C CB  . GLU A 1 285 ? 43.616  20.271  12.399  1.00   41.35  ? 285  GLU A CB  1 
ATOM   2159 C CG  . GLU A 1 285 ? 42.123  20.318  12.262  1.00   46.03  ? 285  GLU A CG  1 
ATOM   2160 C CD  . GLU A 1 285 ? 41.442  19.716  13.477  1.00   49.93  ? 285  GLU A CD  1 
ATOM   2161 O OE1 . GLU A 1 285 ? 41.511  20.331  14.556  1.00   38.98  ? 285  GLU A OE1 1 
ATOM   2162 O OE2 . GLU A 1 285 ? 40.852  18.624  13.354  1.00   49.60  ? 285  GLU A OE2 1 
ATOM   2163 N N   . TRP A 1 286 ? 43.081  21.806  9.421   1.00   37.42  ? 286  TRP A N   1 
ATOM   2164 C CA  . TRP A 1 286 ? 42.275  21.854  8.195   1.00   39.23  ? 286  TRP A CA  1 
ATOM   2165 C C   . TRP A 1 286 ? 43.084  21.911  6.902   1.00   44.19  ? 286  TRP A C   1 
ATOM   2166 O O   . TRP A 1 286 ? 42.519  21.879  5.818   1.00   48.29  ? 286  TRP A O   1 
ATOM   2167 C CB  . TRP A 1 286 ? 41.270  23.007  8.248   1.00   42.43  ? 286  TRP A CB  1 
ATOM   2168 C CG  . TRP A 1 286 ? 40.254  22.771  9.304   1.00   48.76  ? 286  TRP A CG  1 
ATOM   2169 C CD1 . TRP A 1 286 ? 40.239  23.294  10.564  1.00   45.22  ? 286  TRP A CD1 1 
ATOM   2170 C CD2 . TRP A 1 286 ? 39.131  21.886  9.222   1.00   53.73  ? 286  TRP A CD2 1 
ATOM   2171 N NE1 . TRP A 1 286 ? 39.162  22.808  11.264  1.00   51.52  ? 286  TRP A NE1 1 
ATOM   2172 C CE2 . TRP A 1 286 ? 38.464  21.943  10.461  1.00   51.44  ? 286  TRP A CE2 1 
ATOM   2173 C CE3 . TRP A 1 286 ? 38.618  21.061  8.213   1.00   48.34  ? 286  TRP A CE3 1 
ATOM   2174 C CZ2 . TRP A 1 286 ? 37.309  21.214  10.718  1.00   50.68  ? 286  TRP A CZ2 1 
ATOM   2175 C CZ3 . TRP A 1 286 ? 37.471  20.346  8.464   1.00   53.67  ? 286  TRP A CZ3 1 
ATOM   2176 C CH2 . TRP A 1 286 ? 36.828  20.424  9.712   1.00   56.62  ? 286  TRP A CH2 1 
ATOM   2177 N N   . HIS A 1 287 ? 44.408  21.969  7.021   1.00   46.17  ? 287  HIS A N   1 
ATOM   2178 C CA  . HIS A 1 287 ? 45.267  22.130  5.858   1.00   42.76  ? 287  HIS A CA  1 
ATOM   2179 C C   . HIS A 1 287 ? 45.728  20.826  5.233   1.00   39.67  ? 287  HIS A C   1 
ATOM   2180 O O   . HIS A 1 287 ? 46.562  20.845  4.347   1.00   47.79  ? 287  HIS A O   1 
ATOM   2181 C CB  . HIS A 1 287 ? 46.497  22.961  6.217   1.00   43.86  ? 287  HIS A CB  1 
ATOM   2182 C CG  . HIS A 1 287 ? 46.182  24.371  6.592   1.00   45.17  ? 287  HIS A CG  1 
ATOM   2183 N ND1 . HIS A 1 287 ? 46.347  24.854  7.870   1.00   51.49  ? 287  HIS A ND1 1 
ATOM   2184 C CD2 . HIS A 1 287 ? 45.702  25.401  5.860   1.00   49.17  ? 287  HIS A CD2 1 
ATOM   2185 C CE1 . HIS A 1 287 ? 45.985  26.123  7.909   1.00   46.39  ? 287  HIS A CE1 1 
ATOM   2186 N NE2 . HIS A 1 287 ? 45.590  26.479  6.702   1.00   52.75  ? 287  HIS A NE2 1 
ATOM   2187 N N   . VAL A 1 288 ? 45.205  19.694  5.680   1.00   43.72  ? 288  VAL A N   1 
ATOM   2188 C CA  . VAL A 1 288 ? 45.711  18.416  5.181   1.00   41.91  ? 288  VAL A CA  1 
ATOM   2189 C C   . VAL A 1 288 ? 44.707  17.634  4.342   1.00   42.49  ? 288  VAL A C   1 
ATOM   2190 O O   . VAL A 1 288 ? 45.025  16.544  3.862   1.00   45.17  ? 288  VAL A O   1 
ATOM   2191 C CB  . VAL A 1 288 ? 46.247  17.509  6.330   1.00   45.96  ? 288  VAL A CB  1 
ATOM   2192 C CG1 . VAL A 1 288 ? 47.250  18.282  7.219   1.00   35.57  ? 288  VAL A CG1 1 
ATOM   2193 C CG2 . VAL A 1 288 ? 45.096  16.924  7.155   1.00   33.84  ? 288  VAL A CG2 1 
ATOM   2194 N N   . LEU A 1 289 ? 43.502  18.178  4.167   1.00   43.20  ? 289  LEU A N   1 
ATOM   2195 C CA  . LEU A 1 289 ? 42.481  17.520  3.338   1.00   44.28  ? 289  LEU A CA  1 
ATOM   2196 C C   . LEU A 1 289 ? 42.898  17.488  1.870   1.00   47.82  ? 289  LEU A C   1 
ATOM   2197 O O   . LEU A 1 289 ? 43.447  18.456  1.358   1.00   48.15  ? 289  LEU A O   1 
ATOM   2198 C CB  . LEU A 1 289 ? 41.105  18.181  3.495   1.00   41.32  ? 289  LEU A CB  1 
ATOM   2199 C CG  . LEU A 1 289 ? 40.353  17.923  4.808   1.00   46.21  ? 289  LEU A CG  1 
ATOM   2200 C CD1 . LEU A 1 289 ? 39.099  18.794  4.902   1.00   42.15  ? 289  LEU A CD1 1 
ATOM   2201 C CD2 . LEU A 1 289 ? 40.027  16.423  4.975   1.00   33.61  ? 289  LEU A CD2 1 
ATOM   2202 N N   . PRO A 1 290 ? 42.639  16.360  1.192   1.00   46.58  ? 290  PRO A N   1 
ATOM   2203 C CA  . PRO A 1 290 ? 43.126  16.105  -0.170  1.00   46.93  ? 290  PRO A CA  1 
ATOM   2204 C C   . PRO A 1 290 ? 42.506  17.042  -1.199  1.00   54.06  ? 290  PRO A C   1 
ATOM   2205 O O   . PRO A 1 290 ? 43.202  17.477  -2.115  1.00   51.53  ? 290  PRO A O   1 
ATOM   2206 C CB  . PRO A 1 290 ? 42.676  14.667  -0.450  1.00   45.88  ? 290  PRO A CB  1 
ATOM   2207 C CG  . PRO A 1 290 ? 42.263  14.102  0.868   1.00   53.23  ? 290  PRO A CG  1 
ATOM   2208 C CD  . PRO A 1 290 ? 41.811  15.259  1.700   1.00   46.73  ? 290  PRO A CD  1 
ATOM   2209 N N   . GLN A 1 291 ? 41.216  17.335  -1.054  1.00   50.70  ? 291  GLN A N   1 
ATOM   2210 C CA  . GLN A 1 291 ? 40.542  18.272  -1.944  1.00   52.33  ? 291  GLN A CA  1 
ATOM   2211 C C   . GLN A 1 291 ? 39.777  19.338  -1.163  1.00   55.41  ? 291  GLN A C   1 
ATOM   2212 O O   . GLN A 1 291 ? 39.485  19.173  0.018   1.00   56.68  ? 291  GLN A O   1 
ATOM   2213 C CB  . GLN A 1 291 ? 39.562  17.536  -2.867  1.00   50.07  ? 291  GLN A CB  1 
ATOM   2214 C CG  . GLN A 1 291 ? 40.127  16.310  -3.559  1.00   51.09  ? 291  GLN A CG  1 
ATOM   2215 C CD  . GLN A 1 291 ? 39.914  15.038  -2.763  1.00   54.86  ? 291  GLN A CD  1 
ATOM   2216 O OE1 . GLN A 1 291 ? 40.466  13.983  -3.092  1.00   61.15  ? 291  GLN A OE1 1 
ATOM   2217 N NE2 . GLN A 1 291 ? 39.106  15.128  -1.709  1.00   54.22  ? 291  GLN A NE2 1 
ATOM   2218 N N   . GLU A 1 292 ? 39.459  20.434  -1.843  1.00   56.48  ? 292  GLU A N   1 
ATOM   2219 C CA  . GLU A 1 292 ? 38.498  21.401  -1.353  1.00   49.75  ? 292  GLU A CA  1 
ATOM   2220 C C   . GLU A 1 292 ? 37.214  20.636  -1.128  1.00   48.30  ? 292  GLU A C   1 
ATOM   2221 O O   . GLU A 1 292 ? 36.775  19.891  -2.007  1.00   49.04  ? 292  GLU A O   1 
ATOM   2222 C CB  . GLU A 1 292 ? 38.271  22.471  -2.416  1.00   54.27  ? 292  GLU A CB  1 
ATOM   2223 C CG  . GLU A 1 292 ? 37.605  23.737  -1.914  1.00   57.33  ? 292  GLU A CG  1 
ATOM   2224 C CD  . GLU A 1 292 ? 37.275  24.704  -3.046  1.00   68.01  ? 292  GLU A CD  1 
ATOM   2225 O OE1 . GLU A 1 292 ? 37.417  24.310  -4.226  1.00   71.49  ? 292  GLU A OE1 1 
ATOM   2226 O OE2 . GLU A 1 292 ? 36.870  25.855  -2.756  1.00   69.50  ? 292  GLU A OE2 1 
ATOM   2227 N N   . SER A 1 293 ? 36.598  20.802  0.035   1.00   44.82  ? 293  SER A N   1 
ATOM   2228 C CA  . SER A 1 293 ? 35.444  19.960  0.356   1.00   45.87  ? 293  SER A CA  1 
ATOM   2229 C C   . SER A 1 293 ? 34.545  20.527  1.435   1.00   37.93  ? 293  SER A C   1 
ATOM   2230 O O   . SER A 1 293 ? 34.939  21.421  2.171   1.00   41.05  ? 293  SER A O   1 
ATOM   2231 C CB  . SER A 1 293 ? 35.931  18.579  0.800   1.00   42.09  ? 293  SER A CB  1 
ATOM   2232 O OG  . SER A 1 293 ? 36.915  18.715  1.807   1.00   44.60  ? 293  SER A OG  1 
ATOM   2233 N N   . ILE A 1 294 ? 33.325  20.007  1.509   1.00   40.36  ? 294  ILE A N   1 
ATOM   2234 C CA  . ILE A 1 294 ? 32.530  20.108  2.733   1.00   38.97  ? 294  ILE A CA  1 
ATOM   2235 C C   . ILE A 1 294 ? 32.184  18.695  3.246   1.00   38.39  ? 294  ILE A C   1 
ATOM   2236 O O   . ILE A 1 294 ? 32.330  17.712  2.522   1.00   36.59  ? 294  ILE A O   1 
ATOM   2237 C CB  . ILE A 1 294 ? 31.260  20.961  2.548   1.00   41.51  ? 294  ILE A CB  1 
ATOM   2238 C CG1 . ILE A 1 294 ? 30.423  20.443  1.384   1.00   38.57  ? 294  ILE A CG1 1 
ATOM   2239 C CG2 . ILE A 1 294 ? 31.618  22.447  2.360   1.00   37.07  ? 294  ILE A CG2 1 
ATOM   2240 C CD1 . ILE A 1 294 ? 29.090  21.148  1.258   1.00   34.49  ? 294  ILE A CD1 1 
ATOM   2241 N N   . PHE A 1 295 ? 31.758  18.598  4.500   1.00   38.57  ? 295  PHE A N   1 
ATOM   2242 C CA  . PHE A 1 295 ? 31.457  17.310  5.120   1.00   35.82  ? 295  PHE A CA  1 
ATOM   2243 C C   . PHE A 1 295 ? 32.642  16.343  5.025   1.00   35.77  ? 295  PHE A C   1 
ATOM   2244 O O   . PHE A 1 295 ? 32.470  15.151  4.764   1.00   32.66  ? 295  PHE A O   1 
ATOM   2245 C CB  . PHE A 1 295 ? 30.202  16.683  4.493   1.00   33.32  ? 295  PHE A CB  1 
ATOM   2246 C CG  . PHE A 1 295 ? 29.276  16.037  5.495   1.00   39.23  ? 295  PHE A CG  1 
ATOM   2247 C CD1 . PHE A 1 295 ? 29.761  15.099  6.414   1.00   33.95  ? 295  PHE A CD1 1 
ATOM   2248 C CD2 . PHE A 1 295 ? 27.914  16.366  5.518   1.00   36.53  ? 295  PHE A CD2 1 
ATOM   2249 C CE1 . PHE A 1 295 ? 28.911  14.498  7.339   1.00   36.94  ? 295  PHE A CE1 1 
ATOM   2250 C CE2 . PHE A 1 295 ? 27.055  15.779  6.436   1.00   32.76  ? 295  PHE A CE2 1 
ATOM   2251 C CZ  . PHE A 1 295 ? 27.545  14.838  7.350   1.00   42.17  ? 295  PHE A CZ  1 
ATOM   2252 N N   . ARG A 1 296 ? 33.846  16.877  5.203   1.00   36.07  ? 296  ARG A N   1 
ATOM   2253 C CA  . ARG A 1 296 ? 35.055  16.070  5.304   1.00   36.29  ? 296  ARG A CA  1 
ATOM   2254 C C   . ARG A 1 296 ? 35.874  16.586  6.480   1.00   37.60  ? 296  ARG A C   1 
ATOM   2255 O O   . ARG A 1 296 ? 35.959  17.789  6.721   1.00   38.43  ? 296  ARG A O   1 
ATOM   2256 C CB  . ARG A 1 296 ? 35.897  16.119  4.020   1.00   35.78  ? 296  ARG A CB  1 
ATOM   2257 C CG  . ARG A 1 296 ? 35.273  15.451  2.819   1.00   30.56  ? 296  ARG A CG  1 
ATOM   2258 C CD  . ARG A 1 296 ? 35.011  13.963  3.052   1.00   37.18  ? 296  ARG A CD  1 
ATOM   2259 N NE  . ARG A 1 296 ? 34.508  13.337  1.830   1.00   39.88  ? 296  ARG A NE  1 
ATOM   2260 C CZ  . ARG A 1 296 ? 33.221  13.263  1.497   1.00   40.60  ? 296  ARG A CZ  1 
ATOM   2261 N NH1 . ARG A 1 296 ? 32.286  13.752  2.308   1.00   39.58  ? 296  ARG A NH1 1 
ATOM   2262 N NH2 . ARG A 1 296 ? 32.865  12.698  0.357   1.00   33.28  ? 296  ARG A NH2 1 
ATOM   2263 N N   . PHE A 1 297 ? 36.493  15.673  7.206   1.00   37.16  ? 297  PHE A N   1 
ATOM   2264 C CA  . PHE A 1 297 ? 37.188  16.052  8.423   1.00   39.25  ? 297  PHE A CA  1 
ATOM   2265 C C   . PHE A 1 297 ? 38.532  15.380  8.422   1.00   39.66  ? 297  PHE A C   1 
ATOM   2266 O O   . PHE A 1 297 ? 38.646  14.240  7.987   1.00   40.37  ? 297  PHE A O   1 
ATOM   2267 C CB  . PHE A 1 297 ? 36.339  15.665  9.622   1.00   36.42  ? 297  PHE A CB  1 
ATOM   2268 C CG  . PHE A 1 297 ? 34.888  15.959  9.413   1.00   38.72  ? 297  PHE A CG  1 
ATOM   2269 C CD1 . PHE A 1 297 ? 34.432  17.279  9.381   1.00   35.45  ? 297  PHE A CD1 1 
ATOM   2270 C CD2 . PHE A 1 297 ? 33.988  14.938  9.185   1.00   33.61  ? 297  PHE A CD2 1 
ATOM   2271 C CE1 . PHE A 1 297 ? 33.103  17.561  9.160   1.00   35.54  ? 297  PHE A CE1 1 
ATOM   2272 C CE2 . PHE A 1 297 ? 32.639  15.223  8.960   1.00   35.16  ? 297  PHE A CE2 1 
ATOM   2273 C CZ  . PHE A 1 297 ? 32.201  16.530  8.958   1.00   33.58  ? 297  PHE A CZ  1 
ATOM   2274 N N   . SER A 1 298 ? 39.548  16.107  8.877   1.00   35.86  ? 298  SER A N   1 
ATOM   2275 C CA  . SER A 1 298 ? 40.923  15.692  8.676   1.00   39.25  ? 298  SER A CA  1 
ATOM   2276 C C   . SER A 1 298 ? 41.303  14.421  9.431   1.00   42.26  ? 298  SER A C   1 
ATOM   2277 O O   . SER A 1 298 ? 41.977  13.536  8.881   1.00   38.38  ? 298  SER A O   1 
ATOM   2278 C CB  . SER A 1 298 ? 41.864  16.827  9.037   1.00   35.53  ? 298  SER A CB  1 
ATOM   2279 O OG  . SER A 1 298 ? 41.725  17.847  8.081   1.00   41.99  ? 298  SER A OG  1 
ATOM   2280 N N   . PHE A 1 299 ? 40.854  14.327  10.678  1.00   33.76  ? 299  PHE A N   1 
ATOM   2281 C CA  . PHE A 1 299 ? 41.260  13.225  11.544  1.00   33.58  ? 299  PHE A CA  1 
ATOM   2282 C C   . PHE A 1 299 ? 40.065  12.541  12.148  1.00   37.77  ? 299  PHE A C   1 
ATOM   2283 O O   . PHE A 1 299 ? 39.444  13.050  13.086  1.00   34.65  ? 299  PHE A O   1 
ATOM   2284 C CB  . PHE A 1 299 ? 42.224  13.711  12.619  1.00   34.89  ? 299  PHE A CB  1 
ATOM   2285 C CG  . PHE A 1 299 ? 43.483  14.274  12.055  1.00   36.70  ? 299  PHE A CG  1 
ATOM   2286 C CD1 . PHE A 1 299 ? 44.532  13.441  11.716  1.00   35.82  ? 299  PHE A CD1 1 
ATOM   2287 C CD2 . PHE A 1 299 ? 43.597  15.632  11.806  1.00   38.51  ? 299  PHE A CD2 1 
ATOM   2288 C CE1 . PHE A 1 299 ? 45.690  13.949  11.169  1.00   34.96  ? 299  PHE A CE1 1 
ATOM   2289 C CE2 . PHE A 1 299 ? 44.751  16.149  11.257  1.00   39.47  ? 299  PHE A CE2 1 
ATOM   2290 C CZ  . PHE A 1 299 ? 45.803  15.305  10.942  1.00   36.18  ? 299  PHE A CZ  1 
ATOM   2291 N N   . VAL A 1 300 ? 39.756  11.386  11.567  1.00   34.86  ? 300  VAL A N   1 
ATOM   2292 C CA  . VAL A 1 300 ? 38.619  10.572  11.930  1.00   31.50  ? 300  VAL A CA  1 
ATOM   2293 C C   . VAL A 1 300 ? 39.100  9.139   12.200  1.00   37.31  ? 300  VAL A C   1 
ATOM   2294 O O   . VAL A 1 300 ? 40.284  8.827   12.021  1.00   31.46  ? 300  VAL A O   1 
ATOM   2295 C CB  . VAL A 1 300 ? 37.587  10.569  10.783  1.00   31.15  ? 300  VAL A CB  1 
ATOM   2296 C CG1 . VAL A 1 300 ? 37.112  11.978  10.498  1.00   33.01  ? 300  VAL A CG1 1 
ATOM   2297 C CG2 . VAL A 1 300 ? 38.185  9.943   9.525   1.00   34.84  ? 300  VAL A CG2 1 
ATOM   2298 N N   . PRO A 1 301 ? 38.184  8.251   12.623  1.00   36.84  ? 301  PRO A N   1 
ATOM   2299 C CA  . PRO A 1 301 ? 38.626  6.862   12.786  1.00   31.61  ? 301  PRO A CA  1 
ATOM   2300 C C   . PRO A 1 301 ? 39.304  6.298   11.538  1.00   38.79  ? 301  PRO A C   1 
ATOM   2301 O O   . PRO A 1 301 ? 38.873  6.486   10.389  1.00   34.59  ? 301  PRO A O   1 
ATOM   2302 C CB  . PRO A 1 301 ? 37.329  6.117   13.100  1.00   30.08  ? 301  PRO A CB  1 
ATOM   2303 C CG  . PRO A 1 301 ? 36.487  7.159   13.811  1.00   36.82  ? 301  PRO A CG  1 
ATOM   2304 C CD  . PRO A 1 301 ? 36.799  8.455   13.092  1.00   35.82  ? 301  PRO A CD  1 
ATOM   2305 N N   . VAL A 1 302 ? 40.399  5.602   11.782  1.00   38.12  ? 302  VAL A N   1 
ATOM   2306 C CA  . VAL A 1 302 ? 41.135  4.973   10.711  1.00   39.07  ? 302  VAL A CA  1 
ATOM   2307 C C   . VAL A 1 302 ? 40.878  3.462   10.702  1.00   40.76  ? 302  VAL A C   1 
ATOM   2308 O O   . VAL A 1 302 ? 40.682  2.852   11.758  1.00   38.88  ? 302  VAL A O   1 
ATOM   2309 C CB  . VAL A 1 302 ? 42.642  5.247   10.861  1.00   36.74  ? 302  VAL A CB  1 
ATOM   2310 C CG1 . VAL A 1 302 ? 43.141  4.725   12.204  1.00   34.70  ? 302  VAL A CG1 1 
ATOM   2311 C CG2 . VAL A 1 302 ? 43.412  4.613   9.718   1.00   40.30  ? 302  VAL A CG2 1 
ATOM   2312 N N   . VAL A 1 303 ? 40.872  2.869   9.509   1.00   42.23  ? 303  VAL A N   1 
ATOM   2313 C CA  . VAL A 1 303 ? 40.781  1.416   9.360   1.00   40.52  ? 303  VAL A CA  1 
ATOM   2314 C C   . VAL A 1 303 ? 42.134  0.782   9.699   1.00   44.73  ? 303  VAL A C   1 
ATOM   2315 O O   . VAL A 1 303 ? 42.997  0.604   8.836   1.00   42.78  ? 303  VAL A O   1 
ATOM   2316 C CB  . VAL A 1 303 ? 40.350  1.034   7.941   1.00   40.63  ? 303  VAL A CB  1 
ATOM   2317 C CG1 . VAL A 1 303 ? 40.260  -0.478  7.797   1.00   45.19  ? 303  VAL A CG1 1 
ATOM   2318 C CG2 . VAL A 1 303 ? 39.013  1.684   7.615   1.00   41.46  ? 303  VAL A CG2 1 
ATOM   2319 N N   . ASP A 1 304 ? 42.315  0.466   10.976  1.00   47.04  ? 304  ASP A N   1 
ATOM   2320 C CA  . ASP A 1 304 ? 43.616  0.061   11.501  1.00   48.47  ? 304  ASP A CA  1 
ATOM   2321 C C   . ASP A 1 304 ? 43.862  -1.444  11.426  1.00   52.69  ? 304  ASP A C   1 
ATOM   2322 O O   . ASP A 1 304 ? 44.963  -1.905  11.724  1.00   46.63  ? 304  ASP A O   1 
ATOM   2323 C CB  . ASP A 1 304 ? 43.784  0.539   12.955  1.00   42.42  ? 304  ASP A CB  1 
ATOM   2324 C CG  . ASP A 1 304 ? 42.646  0.087   13.865  1.00   45.42  ? 304  ASP A CG  1 
ATOM   2325 O OD1 . ASP A 1 304 ? 41.717  -0.606  13.384  1.00   42.56  ? 304  ASP A OD1 1 
ATOM   2326 O OD2 . ASP A 1 304 ? 42.680  0.437   15.068  1.00   45.17  ? 304  ASP A OD2 1 
ATOM   2327 N N   . GLY A 1 305 ? 42.839  -2.199  11.034  1.00   43.02  ? 305  GLY A N   1 
ATOM   2328 C CA  . GLY A 1 305 ? 42.891  -3.644  11.123  1.00   45.93  ? 305  GLY A CA  1 
ATOM   2329 C C   . GLY A 1 305 ? 42.993  -4.129  12.562  1.00   51.79  ? 305  GLY A C   1 
ATOM   2330 O O   . GLY A 1 305 ? 43.507  -5.217  12.812  1.00   49.02  ? 305  GLY A O   1 
ATOM   2331 N N   . ASP A 1 306 ? 42.514  -3.317  13.505  1.00   49.22  ? 306  ASP A N   1 
ATOM   2332 C CA  . ASP A 1 306 ? 42.519  -3.666  14.929  1.00   45.78  ? 306  ASP A CA  1 
ATOM   2333 C C   . ASP A 1 306 ? 41.169  -3.311  15.566  1.00   48.93  ? 306  ASP A C   1 
ATOM   2334 O O   . ASP A 1 306 ? 40.275  -4.156  15.624  1.00   50.25  ? 306  ASP A O   1 
ATOM   2335 C CB  . ASP A 1 306 ? 43.685  -2.992  15.671  1.00   44.62  ? 306  ASP A CB  1 
ATOM   2336 C CG  . ASP A 1 306 ? 43.700  -3.308  17.174  1.00   48.86  ? 306  ASP A CG  1 
ATOM   2337 O OD1 . ASP A 1 306 ? 43.050  -4.283  17.604  1.00   51.45  ? 306  ASP A OD1 1 
ATOM   2338 O OD2 . ASP A 1 306 ? 44.364  -2.579  17.934  1.00   46.60  ? 306  ASP A OD2 1 
ATOM   2339 N N   . PHE A 1 307 ? 41.015  -2.072  16.039  1.00   46.22  ? 307  PHE A N   1 
ATOM   2340 C CA  . PHE A 1 307 ? 39.689  -1.584  16.419  1.00   41.57  ? 307  PHE A CA  1 
ATOM   2341 C C   . PHE A 1 307 ? 38.718  -1.863  15.274  1.00   39.95  ? 307  PHE A C   1 
ATOM   2342 O O   . PHE A 1 307 ? 37.606  -2.326  15.486  1.00   46.68  ? 307  PHE A O   1 
ATOM   2343 C CB  . PHE A 1 307 ? 39.714  -0.083  16.732  1.00   38.36  ? 307  PHE A CB  1 
ATOM   2344 C CG  . PHE A 1 307 ? 38.493  0.401   17.480  1.00   37.91  ? 307  PHE A CG  1 
ATOM   2345 C CD1 . PHE A 1 307 ? 37.267  0.519   16.835  1.00   35.89  ? 307  PHE A CD1 1 
ATOM   2346 C CD2 . PHE A 1 307 ? 38.573  0.740   18.831  1.00   37.90  ? 307  PHE A CD2 1 
ATOM   2347 C CE1 . PHE A 1 307 ? 36.141  0.949   17.517  1.00   34.40  ? 307  PHE A CE1 1 
ATOM   2348 C CE2 . PHE A 1 307 ? 37.443  1.180   19.526  1.00   36.65  ? 307  PHE A CE2 1 
ATOM   2349 C CZ  . PHE A 1 307 ? 36.224  1.279   18.867  1.00   31.22  ? 307  PHE A CZ  1 
ATOM   2350 N N   . LEU A 1 308 ? 39.149  -1.566  14.056  1.00   39.63  ? 308  LEU A N   1 
ATOM   2351 C CA  . LEU A 1 308 ? 38.339  -1.831  12.881  1.00   47.36  ? 308  LEU A CA  1 
ATOM   2352 C C   . LEU A 1 308 ? 39.045  -2.863  12.017  1.00   49.96  ? 308  LEU A C   1 
ATOM   2353 O O   . LEU A 1 308 ? 39.979  -2.529  11.292  1.00   49.92  ? 308  LEU A O   1 
ATOM   2354 C CB  . LEU A 1 308 ? 38.102  -0.544  12.082  1.00   44.01  ? 308  LEU A CB  1 
ATOM   2355 C CG  . LEU A 1 308 ? 37.085  0.459   12.628  1.00   40.74  ? 308  LEU A CG  1 
ATOM   2356 C CD1 . LEU A 1 308 ? 36.873  1.580   11.633  1.00   38.20  ? 308  LEU A CD1 1 
ATOM   2357 C CD2 . LEU A 1 308 ? 35.773  -0.234  12.929  1.00   41.42  ? 308  LEU A CD2 1 
ATOM   2358 N N   . SER A 1 309 ? 38.597  -4.112  12.090  1.00   45.62  ? 309  SER A N   1 
ATOM   2359 C CA  . SER A 1 309 ? 39.305  -5.204  11.433  1.00   49.87  ? 309  SER A CA  1 
ATOM   2360 C C   . SER A 1 309 ? 39.318  -5.039  9.915   1.00   52.49  ? 309  SER A C   1 
ATOM   2361 O O   . SER A 1 309 ? 40.234  -5.501  9.236   1.00   60.35  ? 309  SER A O   1 
ATOM   2362 C CB  . SER A 1 309 ? 38.726  -6.563  11.845  1.00   49.48  ? 309  SER A CB  1 
ATOM   2363 O OG  . SER A 1 309 ? 37.348  -6.659  11.541  1.00   53.06  ? 309  SER A OG  1 
ATOM   2364 N N   . ASP A 1 310 ? 38.313  -4.343  9.403   1.00   49.90  ? 310  ASP A N   1 
ATOM   2365 C CA  . ASP A 1 310 ? 38.170  -4.075  7.976   1.00   51.23  ? 310  ASP A CA  1 
ATOM   2366 C C   . ASP A 1 310 ? 37.312  -2.805  7.808   1.00   47.41  ? 310  ASP A C   1 
ATOM   2367 O O   . ASP A 1 310 ? 36.912  -2.183  8.799   1.00   45.63  ? 310  ASP A O   1 
ATOM   2368 C CB  . ASP A 1 310 ? 37.493  -5.274  7.303   1.00   54.09  ? 310  ASP A CB  1 
ATOM   2369 C CG  . ASP A 1 310 ? 37.751  -5.340  5.806   1.00   60.04  ? 310  ASP A CG  1 
ATOM   2370 O OD1 . ASP A 1 310 ? 38.055  -4.296  5.188   1.00   59.53  ? 310  ASP A OD1 1 
ATOM   2371 O OD2 . ASP A 1 310 ? 37.645  -6.450  5.245   1.00   61.61  ? 310  ASP A OD2 1 
ATOM   2372 N N   . THR A 1 311 ? 37.014  -2.421  6.572   1.00   42.20  ? 311  THR A N   1 
ATOM   2373 C CA  . THR A 1 311 ? 36.200  -1.230  6.340   1.00   45.71  ? 311  THR A CA  1 
ATOM   2374 C C   . THR A 1 311 ? 34.807  -1.462  6.903   1.00   50.29  ? 311  THR A C   1 
ATOM   2375 O O   . THR A 1 311 ? 34.323  -2.597  6.915   1.00   48.40  ? 311  THR A O   1 
ATOM   2376 C CB  . THR A 1 311 ? 36.074  -0.887  4.838   1.00   49.64  ? 311  THR A CB  1 
ATOM   2377 O OG1 . THR A 1 311 ? 35.232  -1.852  4.189   1.00   50.87  ? 311  THR A OG1 1 
ATOM   2378 C CG2 . THR A 1 311 ? 37.446  -0.873  4.170   1.00   46.62  ? 311  THR A CG2 1 
ATOM   2379 N N   . PRO A 1 312 ? 34.158  -0.393  7.384   1.00   47.95  ? 312  PRO A N   1 
ATOM   2380 C CA  . PRO A 1 312 ? 32.788  -0.575  7.869   1.00   47.23  ? 312  PRO A CA  1 
ATOM   2381 C C   . PRO A 1 312 ? 31.901  -1.209  6.809   1.00   45.97  ? 312  PRO A C   1 
ATOM   2382 O O   . PRO A 1 312 ? 31.050  -2.031  7.149   1.00   49.43  ? 312  PRO A O   1 
ATOM   2383 C CB  . PRO A 1 312 ? 32.335  0.853   8.176   1.00   44.45  ? 312  PRO A CB  1 
ATOM   2384 C CG  . PRO A 1 312 ? 33.597  1.564   8.523   1.00   47.58  ? 312  PRO A CG  1 
ATOM   2385 C CD  . PRO A 1 312 ? 34.667  0.965   7.645   1.00   44.02  ? 312  PRO A CD  1 
ATOM   2386 N N   . GLU A 1 313 ? 32.101  -0.846  5.545   1.00   49.40  ? 313  GLU A N   1 
ATOM   2387 C CA  . GLU A 1 313 ? 31.317  -1.443  4.464   1.00   55.03  ? 313  GLU A CA  1 
ATOM   2388 C C   . GLU A 1 313 ? 31.439  -2.972  4.490   1.00   55.30  ? 313  GLU A C   1 
ATOM   2389 O O   . GLU A 1 313 ? 30.439  -3.689  4.475   1.00   53.11  ? 313  GLU A O   1 
ATOM   2390 C CB  . GLU A 1 313 ? 31.741  -0.891  3.096   1.00   54.85  ? 313  GLU A CB  1 
ATOM   2391 C CG  . GLU A 1 313 ? 30.654  -1.002  2.028   1.00   69.82  ? 313  GLU A CG  1 
ATOM   2392 C CD  . GLU A 1 313 ? 31.186  -0.872  0.597   1.00   84.99  ? 313  GLU A CD  1 
ATOM   2393 O OE1 . GLU A 1 313 ? 32.390  -0.561  0.421   1.00   77.90  ? 313  GLU A OE1 1 
ATOM   2394 O OE2 . GLU A 1 313 ? 30.390  -1.085  -0.353  1.00   82.08  ? 313  GLU A OE2 1 
ATOM   2395 N N   . ALA A 1 314 ? 32.674  -3.458  4.541   1.00   47.69  ? 314  ALA A N   1 
ATOM   2396 C CA  . ALA A 1 314 ? 32.927  -4.886  4.596   1.00   48.90  ? 314  ALA A CA  1 
ATOM   2397 C C   . ALA A 1 314 ? 32.308  -5.508  5.842   1.00   55.28  ? 314  ALA A C   1 
ATOM   2398 O O   . ALA A 1 314 ? 31.620  -6.523  5.752   1.00   60.08  ? 314  ALA A O   1 
ATOM   2399 C CB  . ALA A 1 314 ? 34.422  -5.161  4.542   1.00   45.29  ? 314  ALA A CB  1 
ATOM   2400 N N   . LEU A 1 315 ? 32.537  -4.888  6.997   1.00   47.67  ? 315  LEU A N   1 
ATOM   2401 C CA  . LEU A 1 315 ? 32.011  -5.393  8.269   1.00   47.31  ? 315  LEU A CA  1 
ATOM   2402 C C   . LEU A 1 315 ? 30.478  -5.455  8.358   1.00   53.14  ? 315  LEU A C   1 
ATOM   2403 O O   . LEU A 1 315 ? 29.940  -6.394  8.937   1.00   60.49  ? 315  LEU A O   1 
ATOM   2404 C CB  . LEU A 1 315 ? 32.580  -4.603  9.458   1.00   47.48  ? 315  LEU A CB  1 
ATOM   2405 C CG  . LEU A 1 315 ? 34.105  -4.610  9.552   1.00   52.10  ? 315  LEU A CG  1 
ATOM   2406 C CD1 . LEU A 1 315 ? 34.569  -3.920  10.807  1.00   45.35  ? 315  LEU A CD1 1 
ATOM   2407 C CD2 . LEU A 1 315 ? 34.622  -6.039  9.487   1.00   45.39  ? 315  LEU A CD2 1 
ATOM   2408 N N   . ILE A 1 316 ? 29.770  -4.471  7.812   1.00   47.61  ? 316  ILE A N   1 
ATOM   2409 C CA  . ILE A 1 316 ? 28.308  -4.522  7.854   1.00   54.18  ? 316  ILE A CA  1 
ATOM   2410 C C   . ILE A 1 316 ? 27.754  -5.475  6.791   1.00   61.95  ? 316  ILE A C   1 
ATOM   2411 O O   . ILE A 1 316 ? 26.736  -6.125  7.008   1.00   60.84  ? 316  ILE A O   1 
ATOM   2412 C CB  . ILE A 1 316 ? 27.615  -3.119  7.732   1.00   51.47  ? 316  ILE A CB  1 
ATOM   2413 C CG1 . ILE A 1 316 ? 27.635  -2.594  6.298   1.00   55.83  ? 316  ILE A CG1 1 
ATOM   2414 C CG2 . ILE A 1 316 ? 28.234  -2.098  8.686   1.00   56.79  ? 316  ILE A CG2 1 
ATOM   2415 C CD1 . ILE A 1 316 ? 26.813  -1.309  6.096   1.00   46.79  ? 316  ILE A CD1 1 
ATOM   2416 N N   . ASN A 1 317 ? 28.436  -5.553  5.650   1.00   63.03  ? 317  ASN A N   1 
ATOM   2417 C CA  . ASN A 1 317 ? 28.012  -6.410  4.547   1.00   64.51  ? 317  ASN A CA  1 
ATOM   2418 C C   . ASN A 1 317 ? 28.023  -7.882  4.929   1.00   64.99  ? 317  ASN A C   1 
ATOM   2419 O O   . ASN A 1 317 ? 27.334  -8.688  4.316   1.00   70.70  ? 317  ASN A O   1 
ATOM   2420 C CB  . ASN A 1 317 ? 28.919  -6.218  3.323   1.00   62.42  ? 317  ASN A CB  1 
ATOM   2421 C CG  . ASN A 1 317 ? 28.562  -4.981  2.495   1.00   71.85  ? 317  ASN A CG  1 
ATOM   2422 O OD1 . ASN A 1 317 ? 27.591  -4.264  2.784   1.00   75.47  ? 317  ASN A OD1 1 
ATOM   2423 N ND2 . ASN A 1 317 ? 29.355  -4.729  1.453   1.00   64.89  ? 317  ASN A ND2 1 
ATOM   2424 N N   . THR A 1 318 ? 28.803  -8.234  5.944   1.00   61.93  ? 318  THR A N   1 
ATOM   2425 C CA  . THR A 1 318 ? 29.078  -9.637  6.208   1.00   62.33  ? 318  THR A CA  1 
ATOM   2426 C C   . THR A 1 318 ? 28.895  -10.049 7.660   1.00   64.11  ? 318  THR A C   1 
ATOM   2427 O O   . THR A 1 318 ? 29.066  -11.213 8.002   1.00   73.79  ? 318  THR A O   1 
ATOM   2428 C CB  . THR A 1 318 ? 30.525  -9.961  5.848   1.00   63.53  ? 318  THR A CB  1 
ATOM   2429 O OG1 . THR A 1 318 ? 31.379  -9.494  6.897   1.00   60.92  ? 318  THR A OG1 1 
ATOM   2430 C CG2 . THR A 1 318 ? 30.913  -9.284  4.534   1.00   65.54  ? 318  THR A CG2 1 
ATOM   2431 N N   . GLY A 1 319 ? 28.576  -9.100  8.524   1.00   61.97  ? 319  GLY A N   1 
ATOM   2432 C CA  . GLY A 1 319 ? 28.484  -9.403  9.938   1.00   65.30  ? 319  GLY A CA  1 
ATOM   2433 C C   . GLY A 1 319 ? 27.195  -10.089 10.348  1.00   63.47  ? 319  GLY A C   1 
ATOM   2434 O O   . GLY A 1 319 ? 26.159  -9.968  9.690   1.00   59.09  ? 319  GLY A O   1 
ATOM   2435 N N   . ASP A 1 320 ? 27.265  -10.811 11.458  1.00   61.66  ? 320  ASP A N   1 
ATOM   2436 C CA  . ASP A 1 320 ? 26.092  -11.420 12.054  1.00   67.46  ? 320  ASP A CA  1 
ATOM   2437 C C   . ASP A 1 320 ? 25.533  -10.464 13.105  1.00   68.36  ? 320  ASP A C   1 
ATOM   2438 O O   . ASP A 1 320 ? 26.212  -10.152 14.089  1.00   69.94  ? 320  ASP A O   1 
ATOM   2439 C CB  . ASP A 1 320 ? 26.486  -12.747 12.706  1.00   76.69  ? 320  ASP A CB  1 
ATOM   2440 C CG  . ASP A 1 320 ? 25.294  -13.534 13.204  1.00   78.14  ? 320  ASP A CG  1 
ATOM   2441 O OD1 . ASP A 1 320 ? 24.198  -13.422 12.606  1.00   78.08  ? 320  ASP A OD1 1 
ATOM   2442 O OD2 . ASP A 1 320 ? 25.463  -14.275 14.194  1.00   76.79  ? 320  ASP A OD2 1 
ATOM   2443 N N   . PHE A 1 321 ? 24.304  -9.995  12.896  1.00   64.31  ? 321  PHE A N   1 
ATOM   2444 C CA  . PHE A 1 321 ? 23.699  -9.028  13.816  1.00   65.64  ? 321  PHE A CA  1 
ATOM   2445 C C   . PHE A 1 321 ? 22.380  -9.520  14.412  1.00   68.92  ? 321  PHE A C   1 
ATOM   2446 O O   . PHE A 1 321 ? 21.453  -8.733  14.612  1.00   66.21  ? 321  PHE A O   1 
ATOM   2447 C CB  . PHE A 1 321 ? 23.488  -7.672  13.119  1.00   65.41  ? 321  PHE A CB  1 
ATOM   2448 C CG  . PHE A 1 321 ? 24.748  -7.086  12.532  1.00   56.47  ? 321  PHE A CG  1 
ATOM   2449 C CD1 . PHE A 1 321 ? 25.769  -6.641  13.355  1.00   48.32  ? 321  PHE A CD1 1 
ATOM   2450 C CD2 . PHE A 1 321 ? 24.912  -6.994  11.157  1.00   60.16  ? 321  PHE A CD2 1 
ATOM   2451 C CE1 . PHE A 1 321 ? 26.930  -6.119  12.827  1.00   52.45  ? 321  PHE A CE1 1 
ATOM   2452 C CE2 . PHE A 1 321 ? 26.075  -6.466  10.617  1.00   62.50  ? 321  PHE A CE2 1 
ATOM   2453 C CZ  . PHE A 1 321 ? 27.083  -6.025  11.458  1.00   58.98  ? 321  PHE A CZ  1 
ATOM   2454 N N   . GLN A 1 322 ? 22.304  -10.815 14.710  1.00   70.20  ? 322  GLN A N   1 
ATOM   2455 C CA  . GLN A 1 322 ? 21.061  -11.411 15.191  1.00   69.78  ? 322  GLN A CA  1 
ATOM   2456 C C   . GLN A 1 322 ? 20.610  -10.838 16.531  1.00   66.25  ? 322  GLN A C   1 
ATOM   2457 O O   . GLN A 1 322 ? 19.418  -10.628 16.763  1.00   68.49  ? 322  GLN A O   1 
ATOM   2458 C CB  . GLN A 1 322 ? 21.206  -12.924 15.295  1.00   72.39  ? 322  GLN A CB  1 
ATOM   2459 C CG  . GLN A 1 322 ? 21.457  -13.601 13.963  1.00   85.96  ? 322  GLN A CG  1 
ATOM   2460 C CD  . GLN A 1 322 ? 21.857  -15.054 14.122  1.00   97.13  ? 322  GLN A CD  1 
ATOM   2461 O OE1 . GLN A 1 322 ? 22.209  -15.497 15.218  1.00   90.93  ? 322  GLN A OE1 1 
ATOM   2462 N NE2 . GLN A 1 322 ? 21.807  -15.806 13.026  1.00   100.80 ? 322  GLN A NE2 1 
ATOM   2463 N N   . ASP A 1 323 ? 21.570  -10.575 17.405  1.00   60.87  ? 323  ASP A N   1 
ATOM   2464 C CA  . ASP A 1 323 ? 21.267  -10.102 18.756  1.00   75.16  ? 323  ASP A CA  1 
ATOM   2465 C C   . ASP A 1 323 ? 21.033  -8.591  18.850  1.00   69.50  ? 323  ASP A C   1 
ATOM   2466 O O   . ASP A 1 323 ? 20.853  -8.056  19.944  1.00   64.13  ? 323  ASP A O   1 
ATOM   2467 C CB  . ASP A 1 323 ? 22.403  -10.491 19.712  1.00   73.26  ? 323  ASP A CB  1 
ATOM   2468 C CG  . ASP A 1 323 ? 23.739  -9.846  19.336  1.00   78.43  ? 323  ASP A CG  1 
ATOM   2469 O OD1 . ASP A 1 323 ? 24.029  -9.689  18.123  1.00   74.24  ? 323  ASP A OD1 1 
ATOM   2470 O OD2 . ASP A 1 323 ? 24.505  -9.502  20.264  1.00   79.44  ? 323  ASP A OD2 1 
ATOM   2471 N N   . LEU A 1 324 ? 21.036  -7.905  17.712  1.00   67.76  ? 324  LEU A N   1 
ATOM   2472 C CA  . LEU A 1 324 ? 21.090  -6.446  17.725  1.00   63.98  ? 324  LEU A CA  1 
ATOM   2473 C C   . LEU A 1 324 ? 19.748  -5.750  17.533  1.00   53.30  ? 324  LEU A C   1 
ATOM   2474 O O   . LEU A 1 324 ? 19.000  -6.058  16.609  1.00   52.10  ? 324  LEU A O   1 
ATOM   2475 C CB  . LEU A 1 324 ? 22.078  -5.935  16.674  1.00   62.37  ? 324  LEU A CB  1 
ATOM   2476 C CG  . LEU A 1 324 ? 22.562  -4.507  16.940  1.00   57.12  ? 324  LEU A CG  1 
ATOM   2477 C CD1 . LEU A 1 324 ? 23.140  -4.425  18.343  1.00   56.36  ? 324  LEU A CD1 1 
ATOM   2478 C CD2 . LEU A 1 324 ? 23.596  -4.083  15.911  1.00   61.11  ? 324  LEU A CD2 1 
ATOM   2479 N N   . GLN A 1 325 ? 19.454  -4.799  18.409  1.00   50.32  ? 325  GLN A N   1 
ATOM   2480 C CA  . GLN A 1 325 ? 18.335  -3.901  18.164  1.00   56.53  ? 325  GLN A CA  1 
ATOM   2481 C C   . GLN A 1 325 ? 18.846  -2.469  17.983  1.00   50.61  ? 325  GLN A C   1 
ATOM   2482 O O   . GLN A 1 325 ? 19.562  -1.935  18.830  1.00   51.46  ? 325  GLN A O   1 
ATOM   2483 C CB  . GLN A 1 325 ? 17.309  -3.996  19.283  1.00   50.59  ? 325  GLN A CB  1 
ATOM   2484 C CG  . GLN A 1 325 ? 16.980  -5.421  19.658  1.00   54.99  ? 325  GLN A CG  1 
ATOM   2485 C CD  . GLN A 1 325 ? 16.875  -5.585  21.151  1.00   60.57  ? 325  GLN A CD  1 
ATOM   2486 O OE1 . GLN A 1 325 ? 15.843  -5.286  21.741  1.00   72.29  ? 325  GLN A OE1 1 
ATOM   2487 N NE2 . GLN A 1 325 ? 17.954  -6.039  21.779  1.00   57.42  ? 325  GLN A NE2 1 
ATOM   2488 N N   . VAL A 1 326 ? 18.495  -1.871  16.853  1.00   45.04  ? 326  VAL A N   1 
ATOM   2489 C CA  . VAL A 1 326 ? 19.012  -0.565  16.491  1.00   39.97  ? 326  VAL A CA  1 
ATOM   2490 C C   . VAL A 1 326 ? 17.889  0.369   16.087  1.00   40.36  ? 326  VAL A C   1 
ATOM   2491 O O   . VAL A 1 326 ? 16.935  -0.027  15.420  1.00   46.01  ? 326  VAL A O   1 
ATOM   2492 C CB  . VAL A 1 326 ? 20.044  -0.667  15.340  1.00   45.06  ? 326  VAL A CB  1 
ATOM   2493 C CG1 . VAL A 1 326 ? 20.354  0.681   14.787  1.00   50.44  ? 326  VAL A CG1 1 
ATOM   2494 C CG2 . VAL A 1 326 ? 21.328  -1.302  15.826  1.00   46.43  ? 326  VAL A CG2 1 
ATOM   2495 N N   . LEU A 1 327 ? 17.991  1.612   16.531  1.00   39.75  ? 327  LEU A N   1 
ATOM   2496 C CA  . LEU A 1 327 ? 17.131  2.673   16.041  1.00   44.28  ? 327  LEU A CA  1 
ATOM   2497 C C   . LEU A 1 327 ? 18.009  3.631   15.225  1.00   42.80  ? 327  LEU A C   1 
ATOM   2498 O O   . LEU A 1 327 ? 19.082  4.026   15.679  1.00   42.47  ? 327  LEU A O   1 
ATOM   2499 C CB  . LEU A 1 327 ? 16.446  3.381   17.212  1.00   39.39  ? 327  LEU A CB  1 
ATOM   2500 C CG  . LEU A 1 327 ? 15.629  4.635   16.881  1.00   45.06  ? 327  LEU A CG  1 
ATOM   2501 C CD1 . LEU A 1 327 ? 14.604  4.349   15.811  1.00   44.21  ? 327  LEU A CD1 1 
ATOM   2502 C CD2 . LEU A 1 327 ? 14.949  5.132   18.123  1.00   43.52  ? 327  LEU A CD2 1 
ATOM   2503 N N   . VAL A 1 328 ? 17.573  3.973   14.013  1.00   40.50  ? 328  VAL A N   1 
ATOM   2504 C CA  . VAL A 1 328 ? 18.357  4.819   13.112  1.00   36.02  ? 328  VAL A CA  1 
ATOM   2505 C C   . VAL A 1 328 ? 17.444  5.780   12.393  1.00   40.14  ? 328  VAL A C   1 
ATOM   2506 O O   . VAL A 1 328 ? 16.288  5.456   12.143  1.00   42.38  ? 328  VAL A O   1 
ATOM   2507 C CB  . VAL A 1 328 ? 19.095  4.009   12.022  1.00   37.53  ? 328  VAL A CB  1 
ATOM   2508 C CG1 . VAL A 1 328 ? 20.087  3.046   12.637  1.00   40.04  ? 328  VAL A CG1 1 
ATOM   2509 C CG2 . VAL A 1 328 ? 18.101  3.268   11.125  1.00   33.79  ? 328  VAL A CG2 1 
ATOM   2510 N N   . GLY A 1 329 ? 17.958  6.951   12.033  1.00   36.40  ? 329  GLY A N   1 
ATOM   2511 C CA  . GLY A 1 329 ? 17.153  7.910   11.299  1.00   35.31  ? 329  GLY A CA  1 
ATOM   2512 C C   . GLY A 1 329 ? 17.889  9.156   10.858  1.00   37.22  ? 329  GLY A C   1 
ATOM   2513 O O   . GLY A 1 329 ? 19.083  9.315   11.106  1.00   37.98  ? 329  GLY A O   1 
ATOM   2514 N N   . VAL A 1 330 ? 17.157  10.055  10.212  1.00   38.45  ? 330  VAL A N   1 
ATOM   2515 C CA  . VAL A 1 330 ? 17.746  11.239  9.610   1.00   34.16  ? 330  VAL A CA  1 
ATOM   2516 C C   . VAL A 1 330 ? 16.822  12.413  9.837   1.00   35.40  ? 330  VAL A C   1 
ATOM   2517 O O   . VAL A 1 330 ? 15.666  12.228  10.211  1.00   37.76  ? 330  VAL A O   1 
ATOM   2518 C CB  . VAL A 1 330 ? 17.953  11.040  8.093   1.00   39.98  ? 330  VAL A CB  1 
ATOM   2519 C CG1 . VAL A 1 330 ? 18.835  9.815   7.828   1.00   32.21  ? 330  VAL A CG1 1 
ATOM   2520 C CG2 . VAL A 1 330 ? 16.608  10.900  7.380   1.00   33.59  ? 330  VAL A CG2 1 
ATOM   2521 N N   . VAL A 1 331 ? 17.331  13.624  9.643   1.00   35.87  ? 331  VAL A N   1 
ATOM   2522 C CA  . VAL A 1 331 ? 16.473  14.808  9.627   1.00   31.23  ? 331  VAL A CA  1 
ATOM   2523 C C   . VAL A 1 331 ? 16.128  15.120  8.165   1.00   40.37  ? 331  VAL A C   1 
ATOM   2524 O O   . VAL A 1 331 ? 16.748  14.575  7.243   1.00   32.56  ? 331  VAL A O   1 
ATOM   2525 C CB  . VAL A 1 331 ? 17.133  16.024  10.296  1.00   33.99  ? 331  VAL A CB  1 
ATOM   2526 C CG1 . VAL A 1 331 ? 17.391  15.750  11.771  1.00   32.37  ? 331  VAL A CG1 1 
ATOM   2527 C CG2 . VAL A 1 331 ? 18.430  16.410  9.577   1.00   34.74  ? 331  VAL A CG2 1 
ATOM   2528 N N   . LYS A 1 332 ? 15.140  15.986  7.960   1.00   34.90  ? 332  LYS A N   1 
ATOM   2529 C CA  . LYS A 1 332 ? 14.628  16.245  6.631   1.00   40.20  ? 332  LYS A CA  1 
ATOM   2530 C C   . LYS A 1 332 ? 15.655  16.878  5.681   1.00   38.47  ? 332  LYS A C   1 
ATOM   2531 O O   . LYS A 1 332 ? 15.696  16.538  4.503   1.00   43.59  ? 332  LYS A O   1 
ATOM   2532 C CB  . LYS A 1 332 ? 13.334  17.077  6.699   1.00   47.43  ? 332  LYS A CB  1 
ATOM   2533 C CG  . LYS A 1 332 ? 12.709  17.389  5.326   1.00   40.77  ? 332  LYS A CG  1 
ATOM   2534 C CD  . LYS A 1 332 ? 11.256  17.830  5.468   1.00   53.42  ? 332  LYS A CD  1 
ATOM   2535 C CE  . LYS A 1 332 ? 10.912  19.005  4.546   1.00   63.25  ? 332  LYS A CE  1 
ATOM   2536 N NZ  . LYS A 1 332 ? 11.538  20.294  5.031   1.00   63.94  ? 332  LYS A NZ  1 
ATOM   2537 N N   . ASP A 1 333 ? 16.484  17.779  6.198   1.00   38.79  ? 333  ASP A N   1 
ATOM   2538 C CA  . ASP A 1 333 ? 17.498  18.466  5.387   1.00   35.48  ? 333  ASP A CA  1 
ATOM   2539 C C   . ASP A 1 333 ? 18.923  18.298  5.933   1.00   39.44  ? 333  ASP A C   1 
ATOM   2540 O O   . ASP A 1 333 ? 19.537  19.247  6.452   1.00   35.50  ? 333  ASP A O   1 
ATOM   2541 C CB  . ASP A 1 333 ? 17.149  19.948  5.255   1.00   35.13  ? 333  ASP A CB  1 
ATOM   2542 C CG  . ASP A 1 333 ? 15.727  20.160  4.768   1.00   42.50  ? 333  ASP A CG  1 
ATOM   2543 O OD1 . ASP A 1 333 ? 14.805  20.173  5.616   1.00   42.90  ? 333  ASP A OD1 1 
ATOM   2544 O OD2 . ASP A 1 333 ? 15.533  20.288  3.536   1.00   38.59  ? 333  ASP A OD2 1 
ATOM   2545 N N   . GLU A 1 334 ? 19.440  17.081  5.812   1.00   35.22  ? 334  GLU A N   1 
ATOM   2546 C CA  . GLU A 1 334 ? 20.762  16.756  6.325   1.00   37.70  ? 334  GLU A CA  1 
ATOM   2547 C C   . GLU A 1 334 ? 21.834  17.680  5.749   1.00   37.42  ? 334  GLU A C   1 
ATOM   2548 O O   . GLU A 1 334 ? 22.746  18.092  6.464   1.00   38.08  ? 334  GLU A O   1 
ATOM   2549 C CB  . GLU A 1 334 ? 21.101  15.287  6.035   1.00   35.93  ? 334  GLU A CB  1 
ATOM   2550 C CG  . GLU A 1 334 ? 20.244  14.291  6.796   1.00   32.97  ? 334  GLU A CG  1 
ATOM   2551 C CD  . GLU A 1 334 ? 20.615  14.226  8.273   1.00   38.06  ? 334  GLU A CD  1 
ATOM   2552 O OE1 . GLU A 1 334 ? 21.637  14.826  8.648   1.00   35.96  ? 334  GLU A OE1 1 
ATOM   2553 O OE2 . GLU A 1 334 ? 19.902  13.566  9.056   1.00   39.63  ? 334  GLU A OE2 1 
ATOM   2554 N N   . GLY A 1 335 ? 21.709  18.030  4.469   1.00   34.61  ? 335  GLY A N   1 
ATOM   2555 C CA  . GLY A 1 335 ? 22.761  18.763  3.788   1.00   32.57  ? 335  GLY A CA  1 
ATOM   2556 C C   . GLY A 1 335 ? 22.847  20.279  3.918   1.00   37.53  ? 335  GLY A C   1 
ATOM   2557 O O   . GLY A 1 335 ? 23.924  20.843  3.712   1.00   43.09  ? 335  GLY A O   1 
ATOM   2558 N N   . SER A 1 336 ? 21.746  20.953  4.243   1.00   33.22  ? 336  SER A N   1 
ATOM   2559 C CA  . SER A 1 336 ? 21.711  22.422  4.165   1.00   35.13  ? 336  SER A CA  1 
ATOM   2560 C C   . SER A 1 336 ? 22.783  23.154  4.985   1.00   41.90  ? 336  SER A C   1 
ATOM   2561 O O   . SER A 1 336 ? 23.397  24.105  4.510   1.00   42.56  ? 336  SER A O   1 
ATOM   2562 C CB  . SER A 1 336 ? 20.318  22.964  4.510   1.00   42.56  ? 336  SER A CB  1 
ATOM   2563 O OG  . SER A 1 336 ? 19.930  22.680  5.846   1.00   36.42  ? 336  SER A OG  1 
ATOM   2564 N N   A TYR A 1 337 ? 22.981  22.687  6.214   0.71   41.70  ? 337  TYR A N   1 
ATOM   2565 N N   B TYR A 1 337 ? 23.014  22.709  6.214   0.29   41.86  ? 337  TYR A N   1 
ATOM   2566 C CA  A TYR A 1 337 ? 23.934  23.248  7.171   0.71   44.99  ? 337  TYR A CA  1 
ATOM   2567 C CA  B TYR A 1 337 ? 23.927  23.421  7.109   0.29   44.73  ? 337  TYR A CA  1 
ATOM   2568 C C   A TYR A 1 337 ? 25.320  23.415  6.554   0.71   44.36  ? 337  TYR A C   1 
ATOM   2569 C C   B TYR A 1 337 ? 25.405  23.363  6.694   0.29   44.22  ? 337  TYR A C   1 
ATOM   2570 O O   A TYR A 1 337 ? 25.941  24.477  6.634   0.71   43.92  ? 337  TYR A O   1 
ATOM   2571 O O   B TYR A 1 337 ? 26.186  24.240  7.061   0.29   43.86  ? 337  TYR A O   1 
ATOM   2572 C CB  A TYR A 1 337 ? 24.014  22.297  8.372   0.71   46.21  ? 337  TYR A CB  1 
ATOM   2573 C CB  B TYR A 1 337 ? 23.725  22.969  8.561   0.29   44.50  ? 337  TYR A CB  1 
ATOM   2574 C CG  A TYR A 1 337 ? 24.758  22.801  9.579   0.71   44.35  ? 337  TYR A CG  1 
ATOM   2575 C CG  B TYR A 1 337 ? 25.000  22.689  9.316   0.29   44.51  ? 337  TYR A CG  1 
ATOM   2576 C CD1 A TYR A 1 337 ? 26.137  22.678  9.670   0.71   46.16  ? 337  TYR A CD1 1 
ATOM   2577 C CD1 B TYR A 1 337 ? 25.750  23.718  9.866   0.29   46.05  ? 337  TYR A CD1 1 
ATOM   2578 C CD2 A TYR A 1 337 ? 24.078  23.362  10.649  0.71   44.34  ? 337  TYR A CD2 1 
ATOM   2579 C CD2 B TYR A 1 337 ? 25.446  21.389  9.489   0.29   43.94  ? 337  TYR A CD2 1 
ATOM   2580 C CE1 A TYR A 1 337 ? 26.823  23.132  10.786  0.71   49.00  ? 337  TYR A CE1 1 
ATOM   2581 C CE1 B TYR A 1 337 ? 26.917  23.456  10.560  0.29   48.04  ? 337  TYR A CE1 1 
ATOM   2582 C CE2 A TYR A 1 337 ? 24.754  23.821  11.774  0.71   43.51  ? 337  TYR A CE2 1 
ATOM   2583 C CE2 B TYR A 1 337 ? 26.604  21.119  10.179  0.29   45.61  ? 337  TYR A CE2 1 
ATOM   2584 C CZ  A TYR A 1 337 ? 26.126  23.704  11.837  0.71   45.41  ? 337  TYR A CZ  1 
ATOM   2585 C CZ  B TYR A 1 337 ? 27.338  22.152  10.712  0.29   47.84  ? 337  TYR A CZ  1 
ATOM   2586 O OH  A TYR A 1 337 ? 26.802  24.152  12.953  0.71   43.34  ? 337  TYR A OH  1 
ATOM   2587 O OH  B TYR A 1 337 ? 28.494  21.877  11.405  0.29   50.83  ? 337  TYR A OH  1 
ATOM   2588 N N   . PHE A 1 338 ? 25.787  22.350  5.921   1.00   40.64  ? 338  PHE A N   1 
ATOM   2589 C CA  . PHE A 1 338 ? 27.160  22.270  5.434   1.00   40.85  ? 338  PHE A CA  1 
ATOM   2590 C C   . PHE A 1 338 ? 27.510  23.206  4.267   1.00   44.19  ? 338  PHE A C   1 
ATOM   2591 O O   . PHE A 1 338 ? 28.678  23.553  4.084   1.00   45.86  ? 338  PHE A O   1 
ATOM   2592 C CB  . PHE A 1 338 ? 27.512  20.822  5.125   1.00   40.93  ? 338  PHE A CB  1 
ATOM   2593 C CG  . PHE A 1 338 ? 27.350  19.917  6.307   1.00   41.39  ? 338  PHE A CG  1 
ATOM   2594 C CD1 . PHE A 1 338 ? 26.131  19.309  6.570   1.00   39.78  ? 338  PHE A CD1 1 
ATOM   2595 C CD2 . PHE A 1 338 ? 28.400  19.717  7.185   1.00   37.48  ? 338  PHE A CD2 1 
ATOM   2596 C CE1 . PHE A 1 338 ? 25.974  18.498  7.678   1.00   43.36  ? 338  PHE A CE1 1 
ATOM   2597 C CE2 . PHE A 1 338 ? 28.258  18.896  8.285   1.00   38.54  ? 338  PHE A CE2 1 
ATOM   2598 C CZ  . PHE A 1 338 ? 27.044  18.285  8.537   1.00   42.31  ? 338  PHE A CZ  1 
ATOM   2599 N N   . LEU A 1 339 ? 26.501  23.643  3.518   1.00   38.01  ? 339  LEU A N   1 
ATOM   2600 C CA  . LEU A 1 339 ? 26.708  24.459  2.325   1.00   37.78  ? 339  LEU A CA  1 
ATOM   2601 C C   . LEU A 1 339 ? 27.322  25.843  2.591   1.00   42.23  ? 339  LEU A C   1 
ATOM   2602 O O   . LEU A 1 339 ? 28.088  26.352  1.771   1.00   41.18  ? 339  LEU A O   1 
ATOM   2603 C CB  . LEU A 1 339 ? 25.394  24.603  1.552   1.00   41.16  ? 339  LEU A CB  1 
ATOM   2604 C CG  . LEU A 1 339 ? 24.643  23.304  1.250   1.00   43.86  ? 339  LEU A CG  1 
ATOM   2605 C CD1 . LEU A 1 339 ? 23.442  23.555  0.353   1.00   41.03  ? 339  LEU A CD1 1 
ATOM   2606 C CD2 . LEU A 1 339 ? 25.573  22.268  0.624   1.00   33.69  ? 339  LEU A CD2 1 
ATOM   2607 N N   . VAL A 1 340 ? 26.986  26.453  3.724   1.00   42.51  ? 340  VAL A N   1 
ATOM   2608 C CA  . VAL A 1 340 ? 27.540  27.762  4.073   1.00   42.06  ? 340  VAL A CA  1 
ATOM   2609 C C   . VAL A 1 340 ? 28.989  27.661  4.550   1.00   45.24  ? 340  VAL A C   1 
ATOM   2610 O O   . VAL A 1 340 ? 29.651  28.669  4.776   1.00   50.27  ? 340  VAL A O   1 
ATOM   2611 C CB  . VAL A 1 340 ? 26.710  28.469  5.161   1.00   45.39  ? 340  VAL A CB  1 
ATOM   2612 C CG1 . VAL A 1 340 ? 25.286  28.683  4.683   1.00   40.31  ? 340  VAL A CG1 1 
ATOM   2613 C CG2 . VAL A 1 340 ? 26.737  27.664  6.467   1.00   47.93  ? 340  VAL A CG2 1 
ATOM   2614 N N   . TYR A 1 341 ? 29.482  26.441  4.701   1.00   43.75  ? 341  TYR A N   1 
ATOM   2615 C CA  . TYR A 1 341 ? 30.846  26.238  5.153   1.00   45.52  ? 341  TYR A CA  1 
ATOM   2616 C C   . TYR A 1 341 ? 31.805  25.948  4.007   1.00   51.08  ? 341  TYR A C   1 
ATOM   2617 O O   . TYR A 1 341 ? 32.838  25.300  4.210   1.00   48.06  ? 341  TYR A O   1 
ATOM   2618 C CB  . TYR A 1 341 ? 30.917  25.115  6.199   1.00   51.08  ? 341  TYR A CB  1 
ATOM   2619 C CG  . TYR A 1 341 ? 30.514  25.580  7.569   1.00   50.83  ? 341  TYR A CG  1 
ATOM   2620 C CD1 . TYR A 1 341 ? 31.427  26.222  8.396   1.00   52.50  ? 341  TYR A CD1 1 
ATOM   2621 C CD2 . TYR A 1 341 ? 29.216  25.412  8.025   1.00   45.94  ? 341  TYR A CD2 1 
ATOM   2622 C CE1 . TYR A 1 341 ? 31.066  26.670  9.641   1.00   51.27  ? 341  TYR A CE1 1 
ATOM   2623 C CE2 . TYR A 1 341 ? 28.842  25.861  9.275   1.00   49.46  ? 341  TYR A CE2 1 
ATOM   2624 C CZ  . TYR A 1 341 ? 29.772  26.488  10.079  1.00   51.50  ? 341  TYR A CZ  1 
ATOM   2625 O OH  . TYR A 1 341 ? 29.409  26.935  11.328  1.00   58.22  ? 341  TYR A OH  1 
ATOM   2626 N N   . GLY A 1 342 ? 31.479  26.423  2.809   1.00   41.46  ? 342  GLY A N   1 
ATOM   2627 C CA  . GLY A 1 342 ? 32.405  26.255  1.707   1.00   41.78  ? 342  GLY A CA  1 
ATOM   2628 C C   . GLY A 1 342 ? 31.864  26.144  0.291   1.00   47.89  ? 342  GLY A C   1 
ATOM   2629 O O   . GLY A 1 342 ? 32.649  25.986  -0.642  1.00   49.34  ? 342  GLY A O   1 
ATOM   2630 N N   . VAL A 1 343 ? 30.549  26.221  0.101   1.00   43.33  ? 343  VAL A N   1 
ATOM   2631 C CA  . VAL A 1 343 ? 30.026  26.251  -1.267  1.00   44.65  ? 343  VAL A CA  1 
ATOM   2632 C C   . VAL A 1 343 ? 29.661  27.676  -1.668  1.00   43.69  ? 343  VAL A C   1 
ATOM   2633 O O   . VAL A 1 343 ? 28.802  28.302  -1.053  1.00   47.72  ? 343  VAL A O   1 
ATOM   2634 C CB  . VAL A 1 343 ? 28.830  25.318  -1.459  1.00   45.38  ? 343  VAL A CB  1 
ATOM   2635 C CG1 . VAL A 1 343 ? 28.439  25.249  -2.939  1.00   42.93  ? 343  VAL A CG1 1 
ATOM   2636 C CG2 . VAL A 1 343 ? 29.170  23.942  -0.927  1.00   41.35  ? 343  VAL A CG2 1 
ATOM   2637 N N   . PRO A 1 344 ? 30.335  28.206  -2.696  1.00   43.25  ? 344  PRO A N   1 
ATOM   2638 C CA  . PRO A 1 344 ? 30.102  29.610  -3.055  1.00   51.55  ? 344  PRO A CA  1 
ATOM   2639 C C   . PRO A 1 344 ? 28.652  29.839  -3.501  1.00   49.18  ? 344  PRO A C   1 
ATOM   2640 O O   . PRO A 1 344 ? 28.121  29.035  -4.265  1.00   44.45  ? 344  PRO A O   1 
ATOM   2641 C CB  . PRO A 1 344 ? 31.088  29.849  -4.213  1.00   44.90  ? 344  PRO A CB  1 
ATOM   2642 C CG  . PRO A 1 344 ? 32.113  28.748  -4.087  1.00   42.03  ? 344  PRO A CG  1 
ATOM   2643 C CD  . PRO A 1 344 ? 31.352  27.572  -3.550  1.00   40.79  ? 344  PRO A CD  1 
ATOM   2644 N N   . GLY A 1 345 ? 28.028  30.911  -3.018  1.00   47.22  ? 345  GLY A N   1 
ATOM   2645 C CA  . GLY A 1 345 ? 26.641  31.201  -3.338  1.00   43.43  ? 345  GLY A CA  1 
ATOM   2646 C C   . GLY A 1 345 ? 25.753  30.948  -2.137  1.00   43.75  ? 345  GLY A C   1 
ATOM   2647 O O   . GLY A 1 345 ? 24.640  31.444  -2.060  1.00   52.55  ? 345  GLY A O   1 
ATOM   2648 N N   . PHE A 1 346 ? 26.256  30.184  -1.177  1.00   48.84  ? 346  PHE A N   1 
ATOM   2649 C CA  . PHE A 1 346 ? 25.473  29.870  0.013   1.00   47.53  ? 346  PHE A CA  1 
ATOM   2650 C C   . PHE A 1 346 ? 25.818  30.738  1.215   1.00   47.87  ? 346  PHE A C   1 
ATOM   2651 O O   . PHE A 1 346 ? 26.990  30.992  1.499   1.00   52.29  ? 346  PHE A O   1 
ATOM   2652 C CB  . PHE A 1 346 ? 25.562  28.380  0.338   1.00   38.91  ? 346  PHE A CB  1 
ATOM   2653 C CG  . PHE A 1 346 ? 24.889  27.527  -0.683  1.00   40.39  ? 346  PHE A CG  1 
ATOM   2654 C CD1 . PHE A 1 346 ? 25.546  27.182  -1.854  1.00   37.18  ? 346  PHE A CD1 1 
ATOM   2655 C CD2 . PHE A 1 346 ? 23.574  27.112  -0.500  1.00   43.41  ? 346  PHE A CD2 1 
ATOM   2656 C CE1 . PHE A 1 346 ? 24.916  26.415  -2.821  1.00   40.82  ? 346  PHE A CE1 1 
ATOM   2657 C CE2 . PHE A 1 346 ? 22.935  26.341  -1.451  1.00   36.26  ? 346  PHE A CE2 1 
ATOM   2658 C CZ  . PHE A 1 346 ? 23.603  25.992  -2.618  1.00   43.38  ? 346  PHE A CZ  1 
ATOM   2659 N N   . SER A 1 347 ? 24.770  31.205  1.889   1.00   47.51  ? 347  SER A N   1 
ATOM   2660 C CA  . SER A 1 347 ? 24.886  32.026  3.088   1.00   46.13  ? 347  SER A CA  1 
ATOM   2661 C C   . SER A 1 347 ? 23.698  31.826  4.018   1.00   44.67  ? 347  SER A C   1 
ATOM   2662 O O   . SER A 1 347 ? 22.606  31.473  3.579   1.00   46.95  ? 347  SER A O   1 
ATOM   2663 C CB  . SER A 1 347 ? 24.965  33.503  2.719   1.00   49.21  ? 347  SER A CB  1 
ATOM   2664 O OG  . SER A 1 347 ? 24.858  34.292  3.889   1.00   51.37  ? 347  SER A OG  1 
ATOM   2665 N N   . LYS A 1 348 ? 23.902  32.062  5.306   1.00   42.87  ? 348  LYS A N   1 
ATOM   2666 C CA  . LYS A 1 348 ? 22.782  32.045  6.232   1.00   46.88  ? 348  LYS A CA  1 
ATOM   2667 C C   . LYS A 1 348 ? 21.995  33.345  6.116   1.00   46.42  ? 348  LYS A C   1 
ATOM   2668 O O   . LYS A 1 348 ? 20.839  33.410  6.521   1.00   48.33  ? 348  LYS A O   1 
ATOM   2669 C CB  . LYS A 1 348 ? 23.255  31.850  7.676   1.00   47.07  ? 348  LYS A CB  1 
ATOM   2670 C CG  . LYS A 1 348 ? 23.599  33.134  8.418   1.00   47.28  ? 348  LYS A CG  1 
ATOM   2671 C CD  . LYS A 1 348 ? 24.175  32.835  9.803   1.00   52.27  ? 348  LYS A CD  1 
ATOM   2672 C CE  . LYS A 1 348 ? 24.271  34.092  10.661  1.00   49.02  ? 348  LYS A CE  1 
ATOM   2673 N NZ  . LYS A 1 348 ? 22.936  34.754  10.807  1.00   57.53  ? 348  LYS A NZ  1 
ATOM   2674 N N   . ASP A 1 349 ? 22.628  34.377  5.563   1.00   46.94  ? 349  ASP A N   1 
ATOM   2675 C CA  . ASP A 1 349 ? 22.039  35.722  5.554   1.00   49.29  ? 349  ASP A CA  1 
ATOM   2676 C C   . ASP A 1 349 ? 21.181  36.081  4.332   1.00   51.09  ? 349  ASP A C   1 
ATOM   2677 O O   . ASP A 1 349 ? 20.606  37.159  4.285   1.00   49.64  ? 349  ASP A O   1 
ATOM   2678 C CB  . ASP A 1 349 ? 23.121  36.776  5.764   1.00   40.43  ? 349  ASP A CB  1 
ATOM   2679 C CG  . ASP A 1 349 ? 23.777  36.659  7.122   1.00   49.62  ? 349  ASP A CG  1 
ATOM   2680 O OD1 . ASP A 1 349 ? 23.041  36.577  8.135   1.00   45.91  ? 349  ASP A OD1 1 
ATOM   2681 O OD2 . ASP A 1 349 ? 25.028  36.628  7.172   1.00   48.05  ? 349  ASP A OD2 1 
ATOM   2682 N N   . ASN A 1 350 ? 21.098  35.188  3.352   1.00   49.08  ? 350  ASN A N   1 
ATOM   2683 C CA  . ASN A 1 350 ? 20.198  35.398  2.232   1.00   52.05  ? 350  ASN A CA  1 
ATOM   2684 C C   . ASN A 1 350 ? 19.626  34.083  1.748   1.00   54.71  ? 350  ASN A C   1 
ATOM   2685 O O   . ASN A 1 350 ? 19.931  33.027  2.297   1.00   51.95  ? 350  ASN A O   1 
ATOM   2686 C CB  . ASN A 1 350 ? 20.872  36.168  1.085   1.00   48.58  ? 350  ASN A CB  1 
ATOM   2687 C CG  . ASN A 1 350 ? 22.035  35.417  0.472   1.00   56.87  ? 350  ASN A CG  1 
ATOM   2688 O OD1 . ASN A 1 350 ? 21.948  34.209  0.213   1.00   58.65  ? 350  ASN A OD1 1 
ATOM   2689 N ND2 . ASN A 1 350 ? 23.141  36.136  0.227   1.00   59.92  ? 350  ASN A ND2 1 
ATOM   2690 N N   . GLU A 1 351 ? 18.795  34.158  0.716   1.00   52.91  ? 351  GLU A N   1 
ATOM   2691 C CA  . GLU A 1 351 ? 18.084  32.997  0.204   1.00   52.27  ? 351  GLU A CA  1 
ATOM   2692 C C   . GLU A 1 351 ? 18.986  31.941  -0.445  1.00   46.38  ? 351  GLU A C   1 
ATOM   2693 O O   . GLU A 1 351 ? 18.567  30.807  -0.666  1.00   43.23  ? 351  GLU A O   1 
ATOM   2694 C CB  . GLU A 1 351 ? 17.004  33.457  -0.778  1.00   55.47  ? 351  GLU A CB  1 
ATOM   2695 C CG  . GLU A 1 351 ? 15.770  33.976  -0.084  1.00   54.46  ? 351  GLU A CG  1 
ATOM   2696 C CD  . GLU A 1 351 ? 15.136  32.904  0.781   1.00   74.29  ? 351  GLU A CD  1 
ATOM   2697 O OE1 . GLU A 1 351 ? 14.456  31.997  0.225   1.00   73.83  ? 351  GLU A OE1 1 
ATOM   2698 O OE2 . GLU A 1 351 ? 15.330  32.960  2.017   1.00   69.11  ? 351  GLU A OE2 1 
ATOM   2699 N N   . SER A 1 352 ? 20.214  32.320  -0.770  1.00   44.37  ? 352  SER A N   1 
ATOM   2700 C CA  . SER A 1 352 ? 21.152  31.380  -1.370  1.00   48.80  ? 352  SER A CA  1 
ATOM   2701 C C   . SER A 1 352 ? 20.606  30.736  -2.638  1.00   44.98  ? 352  SER A C   1 
ATOM   2702 O O   . SER A 1 352 ? 20.884  29.570  -2.914  1.00   40.40  ? 352  SER A O   1 
ATOM   2703 C CB  . SER A 1 352 ? 21.535  30.288  -0.365  1.00   44.37  ? 352  SER A CB  1 
ATOM   2704 O OG  . SER A 1 352 ? 22.122  30.858  0.782   1.00   43.43  ? 352  SER A OG  1 
ATOM   2705 N N   . LEU A 1 353 ? 19.824  31.487  -3.405  1.00   47.29  ? 353  LEU A N   1 
ATOM   2706 C CA  . LEU A 1 353 ? 19.464  31.040  -4.744  1.00   48.20  ? 353  LEU A CA  1 
ATOM   2707 C C   . LEU A 1 353 ? 20.748  31.049  -5.562  1.00   49.22  ? 353  LEU A C   1 
ATOM   2708 O O   . LEU A 1 353 ? 21.527  31.997  -5.493  1.00   49.17  ? 353  LEU A O   1 
ATOM   2709 C CB  . LEU A 1 353 ? 18.423  31.960  -5.372  1.00   48.48  ? 353  LEU A CB  1 
ATOM   2710 C CG  . LEU A 1 353 ? 17.135  32.084  -4.568  1.00   52.09  ? 353  LEU A CG  1 
ATOM   2711 C CD1 . LEU A 1 353 ? 16.224  33.140  -5.161  1.00   46.55  ? 353  LEU A CD1 1 
ATOM   2712 C CD2 . LEU A 1 353 ? 16.447  30.740  -4.503  1.00   46.02  ? 353  LEU A CD2 1 
ATOM   2713 N N   . ILE A 1 354 ? 20.991  29.986  -6.313  1.00   41.16  ? 354  ILE A N   1 
ATOM   2714 C CA  . ILE A 1 354 ? 22.255  29.873  -7.028  1.00   46.29  ? 354  ILE A CA  1 
ATOM   2715 C C   . ILE A 1 354 ? 22.034  29.540  -8.485  1.00   44.01  ? 354  ILE A C   1 
ATOM   2716 O O   . ILE A 1 354 ? 20.939  29.152  -8.890  1.00   40.97  ? 354  ILE A O   1 
ATOM   2717 C CB  . ILE A 1 354 ? 23.180  28.798  -6.410  1.00   37.34  ? 354  ILE A CB  1 
ATOM   2718 C CG1 . ILE A 1 354 ? 22.461  27.446  -6.363  1.00   33.84  ? 354  ILE A CG1 1 
ATOM   2719 C CG2 . ILE A 1 354 ? 23.605  29.226  -5.015  1.00   41.39  ? 354  ILE A CG2 1 
ATOM   2720 C CD1 . ILE A 1 354 ? 23.353  26.254  -6.518  1.00   34.37  ? 354  ILE A CD1 1 
ATOM   2721 N N   . SER A 1 355 ? 23.095  29.684  -9.263  1.00   38.89  ? 355  SER A N   1 
ATOM   2722 C CA  . SER A 1 355 ? 23.032  29.436  -10.687 1.00   39.39  ? 355  SER A CA  1 
ATOM   2723 C C   . SER A 1 355 ? 23.405  27.998  -10.989 1.00   41.40  ? 355  SER A C   1 
ATOM   2724 O O   . SER A 1 355 ? 23.906  27.274  -10.138 1.00   43.94  ? 355  SER A O   1 
ATOM   2725 C CB  . SER A 1 355 ? 24.000  30.360  -11.417 1.00   42.83  ? 355  SER A CB  1 
ATOM   2726 O OG  . SER A 1 355 ? 25.342  30.102  -11.010 1.00   43.63  ? 355  SER A OG  1 
ATOM   2727 N N   . ARG A 1 356 ? 23.181  27.595  -12.226 1.00   43.02  ? 356  ARG A N   1 
ATOM   2728 C CA  . ARG A 1 356 ? 23.536  26.263  -12.636 1.00   46.15  ? 356  ARG A CA  1 
ATOM   2729 C C   . ARG A 1 356 ? 25.042  26.082  -12.548 1.00   48.78  ? 356  ARG A C   1 
ATOM   2730 O O   . ARG A 1 356 ? 25.524  24.979  -12.281 1.00   49.89  ? 356  ARG A O   1 
ATOM   2731 C CB  . ARG A 1 356 ? 23.045  26.009  -14.055 1.00   49.31  ? 356  ARG A CB  1 
ATOM   2732 C CG  . ARG A 1 356 ? 23.448  24.670  -14.584 1.00   51.81  ? 356  ARG A CG  1 
ATOM   2733 C CD  . ARG A 1 356 ? 22.367  24.062  -15.439 1.00   51.23  ? 356  ARG A CD  1 
ATOM   2734 N NE  . ARG A 1 356 ? 22.681  22.664  -15.696 1.00   53.29  ? 356  ARG A NE  1 
ATOM   2735 C CZ  . ARG A 1 356 ? 22.229  21.657  -14.960 1.00   47.70  ? 356  ARG A CZ  1 
ATOM   2736 N NH1 . ARG A 1 356 ? 21.418  21.895  -13.934 1.00   46.78  ? 356  ARG A NH1 1 
ATOM   2737 N NH2 . ARG A 1 356 ? 22.568  20.415  -15.268 1.00   48.01  ? 356  ARG A NH2 1 
ATOM   2738 N N   . ALA A 1 357 ? 25.781  27.167  -12.767 1.00   43.39  ? 357  ALA A N   1 
ATOM   2739 C CA  . ALA A 1 357 ? 27.234  27.106  -12.705 1.00   48.50  ? 357  ALA A CA  1 
ATOM   2740 C C   . ALA A 1 357 ? 27.672  26.844  -11.277 1.00   43.01  ? 357  ALA A C   1 
ATOM   2741 O O   . ALA A 1 357 ? 28.540  26.010  -11.025 1.00   50.15  ? 357  ALA A O   1 
ATOM   2742 C CB  . ALA A 1 357 ? 27.868  28.402  -13.226 1.00   44.35  ? 357  ALA A CB  1 
ATOM   2743 N N   . GLN A 1 358 ? 27.079  27.575  -10.344 1.00   40.00  ? 358  GLN A N   1 
ATOM   2744 C CA  . GLN A 1 358 ? 27.417  27.411  -8.943  1.00   41.66  ? 358  GLN A CA  1 
ATOM   2745 C C   . GLN A 1 358 ? 27.063  25.996  -8.475  1.00   47.51  ? 358  GLN A C   1 
ATOM   2746 O O   . GLN A 1 358 ? 27.761  25.416  -7.644  1.00   41.94  ? 358  GLN A O   1 
ATOM   2747 C CB  . GLN A 1 358 ? 26.713  28.466  -8.099  1.00   44.62  ? 358  GLN A CB  1 
ATOM   2748 C CG  . GLN A 1 358 ? 27.270  29.872  -8.280  1.00   42.64  ? 358  GLN A CG  1 
ATOM   2749 C CD  . GLN A 1 358 ? 26.377  30.929  -7.672  1.00   43.14  ? 358  GLN A CD  1 
ATOM   2750 O OE1 . GLN A 1 358 ? 25.166  30.912  -7.860  1.00   51.39  ? 358  GLN A OE1 1 
ATOM   2751 N NE2 . GLN A 1 358 ? 26.969  31.855  -6.938  1.00   44.67  ? 358  GLN A NE2 1 
ATOM   2752 N N   . PHE A 1 359 ? 25.999  25.432  -9.040  1.00   40.68  ? 359  PHE A N   1 
ATOM   2753 C CA  . PHE A 1 359 ? 25.596  24.069  -8.706  1.00   40.57  ? 359  PHE A CA  1 
ATOM   2754 C C   . PHE A 1 359 ? 26.637  23.033  -9.151  1.00   39.65  ? 359  PHE A C   1 
ATOM   2755 O O   . PHE A 1 359 ? 27.072  22.195  -8.353  1.00   40.04  ? 359  PHE A O   1 
ATOM   2756 C CB  . PHE A 1 359 ? 24.211  23.771  -9.282  1.00   36.47  ? 359  PHE A CB  1 
ATOM   2757 C CG  . PHE A 1 359 ? 23.756  22.359  -9.087  1.00   35.17  ? 359  PHE A CG  1 
ATOM   2758 C CD1 . PHE A 1 359 ? 23.525  21.853  -7.821  1.00   41.10  ? 359  PHE A CD1 1 
ATOM   2759 C CD2 . PHE A 1 359 ? 23.539  21.537  -10.172 1.00   39.52  ? 359  PHE A CD2 1 
ATOM   2760 C CE1 . PHE A 1 359 ? 23.100  20.549  -7.651  1.00   37.22  ? 359  PHE A CE1 1 
ATOM   2761 C CE2 . PHE A 1 359 ? 23.105  20.234  -10.005 1.00   38.98  ? 359  PHE A CE2 1 
ATOM   2762 C CZ  . PHE A 1 359 ? 22.885  19.742  -8.754  1.00   32.90  ? 359  PHE A CZ  1 
ATOM   2763 N N   . LEU A 1 360 ? 27.050  23.096  -10.412 1.00   39.98  ? 360  LEU A N   1 
ATOM   2764 C CA  . LEU A 1 360 ? 28.137  22.246  -10.881 1.00   40.40  ? 360  LEU A CA  1 
ATOM   2765 C C   . LEU A 1 360 ? 29.379  22.406  -9.997  1.00   42.34  ? 360  LEU A C   1 
ATOM   2766 O O   . LEU A 1 360 ? 29.981  21.419  -9.591  1.00   43.78  ? 360  LEU A O   1 
ATOM   2767 C CB  . LEU A 1 360 ? 28.483  22.548  -12.338 1.00   44.85  ? 360  LEU A CB  1 
ATOM   2768 C CG  . LEU A 1 360 ? 27.335  22.496  -13.357 1.00   56.78  ? 360  LEU A CG  1 
ATOM   2769 C CD1 . LEU A 1 360 ? 27.832  22.748  -14.785 1.00   60.05  ? 360  LEU A CD1 1 
ATOM   2770 C CD2 . LEU A 1 360 ? 26.602  21.188  -13.311 1.00   42.80  ? 360  LEU A CD2 1 
ATOM   2771 N N   . ALA A 1 361 ? 29.766  23.641  -9.688  1.00   39.24  ? 361  ALA A N   1 
ATOM   2772 C CA  . ALA A 1 361 ? 30.921  23.848  -8.810  1.00   41.21  ? 361  ALA A CA  1 
ATOM   2773 C C   . ALA A 1 361 ? 30.673  23.275  -7.412  1.00   42.70  ? 361  ALA A C   1 
ATOM   2774 O O   . ALA A 1 361 ? 31.565  22.658  -6.826  1.00   43.60  ? 361  ALA A O   1 
ATOM   2775 C CB  . ALA A 1 361 ? 31.314  25.325  -8.736  1.00   35.22  ? 361  ALA A CB  1 
ATOM   2776 N N   . GLY A 1 362 ? 29.459  23.468  -6.894  1.00   38.49  ? 362  GLY A N   1 
ATOM   2777 C CA  . GLY A 1 362 ? 29.080  22.945  -5.592  1.00   37.57  ? 362  GLY A CA  1 
ATOM   2778 C C   . GLY A 1 362 ? 29.190  21.431  -5.530  1.00   41.31  ? 362  GLY A C   1 
ATOM   2779 O O   . GLY A 1 362 ? 29.612  20.859  -4.526  1.00   40.83  ? 362  GLY A O   1 
ATOM   2780 N N   . VAL A 1 363 ? 28.829  20.773  -6.621  1.00   38.55  ? 363  VAL A N   1 
ATOM   2781 C CA  . VAL A 1 363 ? 28.917  19.328  -6.672  1.00   34.05  ? 363  VAL A CA  1 
ATOM   2782 C C   . VAL A 1 363 ? 30.343  18.806  -6.521  1.00   43.53  ? 363  VAL A C   1 
ATOM   2783 O O   . VAL A 1 363 ? 30.557  17.817  -5.820  1.00   48.38  ? 363  VAL A O   1 
ATOM   2784 C CB  . VAL A 1 363 ? 28.256  18.763  -7.946  1.00   38.09  ? 363  VAL A CB  1 
ATOM   2785 C CG1 . VAL A 1 363 ? 28.651  17.302  -8.160  1.00   33.90  ? 363  VAL A CG1 1 
ATOM   2786 C CG2 . VAL A 1 363 ? 26.746  18.904  -7.846  1.00   31.59  ? 363  VAL A CG2 1 
ATOM   2787 N N   . ARG A 1 364 ? 31.316  19.454  -7.165  1.00   43.40  ? 364  ARG A N   1 
ATOM   2788 C CA  . ARG A 1 364 ? 32.716  19.029  -7.044  1.00   42.41  ? 364  ARG A CA  1 
ATOM   2789 C C   . ARG A 1 364 ? 33.224  19.153  -5.603  1.00   44.61  ? 364  ARG A C   1 
ATOM   2790 O O   . ARG A 1 364 ? 34.045  18.361  -5.150  1.00   42.39  ? 364  ARG A O   1 
ATOM   2791 C CB  . ARG A 1 364 ? 33.629  19.850  -7.955  1.00   45.64  ? 364  ARG A CB  1 
ATOM   2792 C CG  . ARG A 1 364 ? 33.295  19.779  -9.430  1.00   45.58  ? 364  ARG A CG  1 
ATOM   2793 C CD  . ARG A 1 364 ? 32.866  18.380  -9.835  1.00   47.26  ? 364  ARG A CD  1 
ATOM   2794 N NE  . ARG A 1 364 ? 33.933  17.386  -9.714  1.00   53.37  ? 364  ARG A NE  1 
ATOM   2795 C CZ  . ARG A 1 364 ? 34.776  17.075  -10.695 1.00   56.66  ? 364  ARG A CZ  1 
ATOM   2796 N NH1 . ARG A 1 364 ? 34.684  17.694  -11.870 1.00   58.50  ? 364  ARG A NH1 1 
ATOM   2797 N NH2 . ARG A 1 364 ? 35.715  16.159  -10.504 1.00   49.79  ? 364  ARG A NH2 1 
ATOM   2798 N N   . ILE A 1 365 ? 32.739  20.162  -4.893  1.00   39.27  ? 365  ILE A N   1 
ATOM   2799 C CA  . ILE A 1 365 ? 33.152  20.399  -3.520  1.00   40.24  ? 365  ILE A CA  1 
ATOM   2800 C C   . ILE A 1 365 ? 32.387  19.476  -2.576  1.00   38.97  ? 365  ILE A C   1 
ATOM   2801 O O   . ILE A 1 365 ? 32.919  19.013  -1.576  1.00   38.37  ? 365  ILE A O   1 
ATOM   2802 C CB  . ILE A 1 365 ? 32.930  21.878  -3.130  1.00   38.14  ? 365  ILE A CB  1 
ATOM   2803 C CG1 . ILE A 1 365 ? 33.703  22.791  -4.080  1.00   38.30  ? 365  ILE A CG1 1 
ATOM   2804 C CG2 . ILE A 1 365 ? 33.334  22.134  -1.672  1.00   39.13  ? 365  ILE A CG2 1 
ATOM   2805 C CD1 . ILE A 1 365 ? 33.463  24.269  -3.834  1.00   39.68  ? 365  ILE A CD1 1 
ATOM   2806 N N   . GLY A 1 366 ? 31.134  19.201  -2.921  1.00   45.55  ? 366  GLY A N   1 
ATOM   2807 C CA  . GLY A 1 366 ? 30.275  18.351  -2.117  1.00   38.92  ? 366  GLY A CA  1 
ATOM   2808 C C   . GLY A 1 366 ? 30.601  16.880  -2.261  1.00   45.67  ? 366  GLY A C   1 
ATOM   2809 O O   . GLY A 1 366 ? 30.447  16.112  -1.309  1.00   47.44  ? 366  GLY A O   1 
ATOM   2810 N N   . VAL A 1 367 ? 31.030  16.482  -3.456  1.00   43.80  ? 367  VAL A N   1 
ATOM   2811 C CA  . VAL A 1 367 ? 31.481  15.115  -3.699  1.00   42.00  ? 367  VAL A CA  1 
ATOM   2812 C C   . VAL A 1 367 ? 32.932  15.197  -4.118  1.00   42.44  ? 367  VAL A C   1 
ATOM   2813 O O   . VAL A 1 367 ? 33.248  14.976  -5.281  1.00   45.22  ? 367  VAL A O   1 
ATOM   2814 C CB  . VAL A 1 367 ? 30.717  14.439  -4.860  1.00   47.17  ? 367  VAL A CB  1 
ATOM   2815 C CG1 . VAL A 1 367 ? 31.018  12.946  -4.888  1.00   42.68  ? 367  VAL A CG1 1 
ATOM   2816 C CG2 . VAL A 1 367 ? 29.223  14.691  -4.768  1.00   35.12  ? 367  VAL A CG2 1 
ATOM   2817 N N   . PRO A 1 368 ? 33.821  15.507  -3.168  1.00   44.36  ? 368  PRO A N   1 
ATOM   2818 C CA  . PRO A 1 368 ? 35.203  15.892  -3.486  1.00   42.98  ? 368  PRO A CA  1 
ATOM   2819 C C   . PRO A 1 368 ? 36.007  14.757  -4.105  1.00   46.71  ? 368  PRO A C   1 
ATOM   2820 O O   . PRO A 1 368 ? 37.014  15.002  -4.765  1.00   50.23  ? 368  PRO A O   1 
ATOM   2821 C CB  . PRO A 1 368 ? 35.800  16.255  -2.129  1.00   39.87  ? 368  PRO A CB  1 
ATOM   2822 C CG  . PRO A 1 368 ? 34.704  16.079  -1.115  1.00   41.46  ? 368  PRO A CG  1 
ATOM   2823 C CD  . PRO A 1 368 ? 33.603  15.307  -1.728  1.00   40.23  ? 368  PRO A CD  1 
ATOM   2824 N N   . GLN A 1 369 ? 35.559  13.527  -3.909  1.00   46.98  ? 369  GLN A N   1 
ATOM   2825 C CA  . GLN A 1 369 ? 36.314  12.373  -4.382  1.00   49.37  ? 369  GLN A CA  1 
ATOM   2826 C C   . GLN A 1 369 ? 35.871  11.890  -5.767  1.00   49.72  ? 369  GLN A C   1 
ATOM   2827 O O   . GLN A 1 369 ? 36.468  10.977  -6.325  1.00   57.75  ? 369  GLN A O   1 
ATOM   2828 C CB  . GLN A 1 369 ? 36.230  11.228  -3.369  1.00   45.82  ? 369  GLN A CB  1 
ATOM   2829 C CG  . GLN A 1 369 ? 34.997  10.340  -3.535  1.00   61.90  ? 369  GLN A CG  1 
ATOM   2830 C CD  . GLN A 1 369 ? 33.719  10.896  -2.894  1.00   56.88  ? 369  GLN A CD  1 
ATOM   2831 O OE1 . GLN A 1 369 ? 33.679  12.027  -2.395  1.00   46.87  ? 369  GLN A OE1 1 
ATOM   2832 N NE2 . GLN A 1 369 ? 32.664  10.083  -2.910  1.00   54.43  ? 369  GLN A NE2 1 
ATOM   2833 N N   . ALA A 1 370 ? 34.839  12.510  -6.327  1.00   50.50  ? 370  ALA A N   1 
ATOM   2834 C CA  . ALA A 1 370 ? 34.295  12.080  -7.621  1.00   49.66  ? 370  ALA A CA  1 
ATOM   2835 C C   . ALA A 1 370 ? 35.152  12.467  -8.821  1.00   52.67  ? 370  ALA A C   1 
ATOM   2836 O O   . ALA A 1 370 ? 35.655  13.593  -8.911  1.00   42.87  ? 370  ALA A O   1 
ATOM   2837 C CB  . ALA A 1 370 ? 32.876  12.613  -7.819  1.00   42.19  ? 370  ALA A CB  1 
ATOM   2838 N N   . SER A 1 371 ? 35.289  11.522  -9.748  1.00   51.18  ? 371  SER A N   1 
ATOM   2839 C CA  . SER A 1 371 ? 35.864  11.801  -11.056 1.00   49.72  ? 371  SER A CA  1 
ATOM   2840 C C   . SER A 1 371 ? 34.958  12.773  -11.806 1.00   51.55  ? 371  SER A C   1 
ATOM   2841 O O   . SER A 1 371 ? 33.867  13.107  -11.340 1.00   51.08  ? 371  SER A O   1 
ATOM   2842 C CB  . SER A 1 371 ? 36.001  10.510  -11.861 1.00   50.25  ? 371  SER A CB  1 
ATOM   2843 O OG  . SER A 1 371 ? 34.736  9.966   -12.212 1.00   52.41  ? 371  SER A OG  1 
ATOM   2844 N N   . ASP A 1 372 ? 35.403  13.213  -12.975 1.00   49.55  ? 372  ASP A N   1 
ATOM   2845 C CA  . ASP A 1 372 ? 34.596  14.098  -13.804 1.00   53.41  ? 372  ASP A CA  1 
ATOM   2846 C C   . ASP A 1 372 ? 33.291  13.434  -14.245 1.00   49.54  ? 372  ASP A C   1 
ATOM   2847 O O   . ASP A 1 372 ? 32.228  14.055  -14.243 1.00   51.95  ? 372  ASP A O   1 
ATOM   2848 C CB  . ASP A 1 372 ? 35.391  14.551  -15.026 1.00   58.03  ? 372  ASP A CB  1 
ATOM   2849 C CG  . ASP A 1 372 ? 36.420  15.614  -14.692 1.00   58.61  ? 372  ASP A CG  1 
ATOM   2850 O OD1 . ASP A 1 372 ? 36.619  15.900  -13.494 1.00   61.46  ? 372  ASP A OD1 1 
ATOM   2851 O OD2 . ASP A 1 372 ? 37.026  16.167  -15.633 1.00   64.44  ? 372  ASP A OD2 1 
ATOM   2852 N N   . LEU A 1 373 ? 33.378  12.169  -14.630 1.00   49.93  ? 373  LEU A N   1 
ATOM   2853 C CA  . LEU A 1 373 ? 32.207  11.439  -15.078 1.00   52.76  ? 373  LEU A CA  1 
ATOM   2854 C C   . LEU A 1 373 ? 31.226  11.256  -13.915 1.00   50.40  ? 373  LEU A C   1 
ATOM   2855 O O   . LEU A 1 373 ? 30.034  11.538  -14.049 1.00   51.56  ? 373  LEU A O   1 
ATOM   2856 C CB  . LEU A 1 373 ? 32.617  10.091  -15.682 1.00   47.22  ? 373  LEU A CB  1 
ATOM   2857 C CG  . LEU A 1 373 ? 31.509  9.219   -16.276 1.00   54.65  ? 373  LEU A CG  1 
ATOM   2858 C CD1 . LEU A 1 373 ? 30.741  9.964   -17.356 1.00   46.29  ? 373  LEU A CD1 1 
ATOM   2859 C CD2 . LEU A 1 373 ? 32.073  7.921   -16.815 1.00   52.82  ? 373  LEU A CD2 1 
ATOM   2860 N N   . ALA A 1 374 ? 31.730  10.796  -12.773 1.00   49.41  ? 374  ALA A N   1 
ATOM   2861 C CA  . ALA A 1 374 ? 30.878  10.571  -11.604 1.00   49.02  ? 374  ALA A CA  1 
ATOM   2862 C C   . ALA A 1 374 ? 30.129  11.845  -11.199 1.00   47.46  ? 374  ALA A C   1 
ATOM   2863 O O   . ALA A 1 374 ? 28.946  11.807  -10.862 1.00   46.94  ? 374  ALA A O   1 
ATOM   2864 C CB  . ALA A 1 374 ? 31.701  10.038  -10.438 1.00   49.98  ? 374  ALA A CB  1 
ATOM   2865 N N   . ALA A 1 375 ? 30.820  12.975  -11.244 1.00   42.62  ? 375  ALA A N   1 
ATOM   2866 C CA  . ALA A 1 375 ? 30.199  14.240  -10.913 1.00   42.39  ? 375  ALA A CA  1 
ATOM   2867 C C   . ALA A 1 375 ? 29.097  14.606  -11.913 1.00   49.94  ? 375  ALA A C   1 
ATOM   2868 O O   . ALA A 1 375 ? 28.041  15.098  -11.520 1.00   53.69  ? 375  ALA A O   1 
ATOM   2869 C CB  . ALA A 1 375 ? 31.239  15.334  -10.824 1.00   39.43  ? 375  ALA A CB  1 
ATOM   2870 N N   . GLU A 1 376 ? 29.334  14.384  -13.203 1.00   50.42  ? 376  GLU A N   1 
ATOM   2871 C CA  A GLU A 1 376 ? 28.293  14.613  -14.203 0.57   49.58  ? 376  GLU A CA  1 
ATOM   2872 C CA  B GLU A 1 376 ? 28.300  14.623  -14.199 0.43   49.59  ? 376  GLU A CA  1 
ATOM   2873 C C   . GLU A 1 376 ? 27.095  13.719  -13.938 1.00   47.92  ? 376  GLU A C   1 
ATOM   2874 O O   . GLU A 1 376 ? 25.945  14.149  -14.077 1.00   48.49  ? 376  GLU A O   1 
ATOM   2875 C CB  A GLU A 1 376 ? 28.808  14.393  -15.632 0.57   55.19  ? 376  GLU A CB  1 
ATOM   2876 C CB  B GLU A 1 376 ? 28.854  14.436  -15.619 0.43   55.20  ? 376  GLU A CB  1 
ATOM   2877 C CG  A GLU A 1 376 ? 29.075  15.685  -16.398 0.57   59.84  ? 376  GLU A CG  1 
ATOM   2878 C CG  B GLU A 1 376 ? 29.920  15.472  -15.992 0.43   59.26  ? 376  GLU A CG  1 
ATOM   2879 C CD  A GLU A 1 376 ? 27.851  16.581  -16.473 0.57   60.08  ? 376  GLU A CD  1 
ATOM   2880 C CD  B GLU A 1 376 ? 30.503  15.263  -17.381 0.43   62.65  ? 376  GLU A CD  1 
ATOM   2881 O OE1 A GLU A 1 376 ? 26.796  16.105  -16.945 0.57   57.19  ? 376  GLU A OE1 1 
ATOM   2882 O OE1 B GLU A 1 376 ? 30.249  14.195  -17.980 0.43   64.57  ? 376  GLU A OE1 1 
ATOM   2883 O OE2 A GLU A 1 376 ? 27.938  17.756  -16.046 0.57   56.90  ? 376  GLU A OE2 1 
ATOM   2884 O OE2 B GLU A 1 376 ? 31.219  16.166  -17.868 0.43   57.47  ? 376  GLU A OE2 1 
ATOM   2885 N N   . ALA A 1 377 ? 27.353  12.472  -13.552 1.00   40.94  ? 377  ALA A N   1 
ATOM   2886 C CA  . ALA A 1 377 ? 26.248  11.586  -13.184 1.00   42.95  ? 377  ALA A CA  1 
ATOM   2887 C C   . ALA A 1 377 ? 25.427  12.218  -12.060 1.00   46.76  ? 377  ALA A C   1 
ATOM   2888 O O   . ALA A 1 377 ? 24.196  12.202  -12.094 1.00   45.06  ? 377  ALA A O   1 
ATOM   2889 C CB  . ALA A 1 377 ? 26.749  10.217  -12.771 1.00   35.61  ? 377  ALA A CB  1 
ATOM   2890 N N   . VAL A 1 378 ? 26.110  12.791  -11.071 1.00   41.31  ? 378  VAL A N   1 
ATOM   2891 C CA  . VAL A 1 378 ? 25.408  13.397  -9.949  1.00   42.85  ? 378  VAL A CA  1 
ATOM   2892 C C   . VAL A 1 378 ? 24.541  14.561  -10.430 1.00   44.67  ? 378  VAL A C   1 
ATOM   2893 O O   . VAL A 1 378 ? 23.363  14.662  -10.084 1.00   42.87  ? 378  VAL A O   1 
ATOM   2894 C CB  . VAL A 1 378 ? 26.379  13.862  -8.829  1.00   42.53  ? 378  VAL A CB  1 
ATOM   2895 C CG1 . VAL A 1 378 ? 25.629  14.667  -7.775  1.00   33.80  ? 378  VAL A CG1 1 
ATOM   2896 C CG2 . VAL A 1 378 ? 27.066  12.658  -8.187  1.00   37.15  ? 378  VAL A CG2 1 
ATOM   2897 N N   . VAL A 1 379 ? 25.130  15.428  -11.245 1.00   44.65  ? 379  VAL A N   1 
ATOM   2898 C CA  . VAL A 1 379 ? 24.438  16.604  -11.753 1.00   43.06  ? 379  VAL A CA  1 
ATOM   2899 C C   . VAL A 1 379 ? 23.250  16.215  -12.632 1.00   46.96  ? 379  VAL A C   1 
ATOM   2900 O O   . VAL A 1 379 ? 22.202  16.858  -12.610 1.00   45.99  ? 379  VAL A O   1 
ATOM   2901 C CB  . VAL A 1 379 ? 25.405  17.494  -12.534 1.00   44.47  ? 379  VAL A CB  1 
ATOM   2902 C CG1 . VAL A 1 379 ? 24.648  18.533  -13.317 1.00   41.77  ? 379  VAL A CG1 1 
ATOM   2903 C CG2 . VAL A 1 379 ? 26.409  18.139  -11.570 1.00   37.86  ? 379  VAL A CG2 1 
ATOM   2904 N N   . LEU A 1 380 ? 23.420  15.137  -13.385 1.00   47.81  ? 380  LEU A N   1 
ATOM   2905 C CA  . LEU A 1 380 ? 22.361  14.596  -14.219 1.00   45.21  ? 380  LEU A CA  1 
ATOM   2906 C C   . LEU A 1 380 ? 21.191  14.097  -13.377 1.00   47.43  ? 380  LEU A C   1 
ATOM   2907 O O   . LEU A 1 380 ? 20.032  14.379  -13.678 1.00   43.36  ? 380  LEU A O   1 
ATOM   2908 C CB  . LEU A 1 380 ? 22.910  13.444  -15.062 1.00   47.35  ? 380  LEU A CB  1 
ATOM   2909 C CG  . LEU A 1 380 ? 23.428  13.774  -16.457 1.00   58.09  ? 380  LEU A CG  1 
ATOM   2910 C CD1 . LEU A 1 380 ? 22.254  13.769  -17.421 1.00   60.23  ? 380  LEU A CD1 1 
ATOM   2911 C CD2 . LEU A 1 380 ? 24.175  15.108  -16.497 1.00   52.69  ? 380  LEU A CD2 1 
ATOM   2912 N N   . HIS A 1 381 ? 21.500  13.335  -12.334 1.00   46.78  ? 381  HIS A N   1 
ATOM   2913 C CA  . HIS A 1 381 ? 20.465  12.776  -11.474 1.00   46.16  ? 381  HIS A CA  1 
ATOM   2914 C C   . HIS A 1 381 ? 19.665  13.838  -10.730 1.00   44.33  ? 381  HIS A C   1 
ATOM   2915 O O   . HIS A 1 381 ? 18.452  13.722  -10.595 1.00   42.19  ? 381  HIS A O   1 
ATOM   2916 C CB  . HIS A 1 381 ? 21.067  11.806  -10.458 1.00   45.45  ? 381  HIS A CB  1 
ATOM   2917 C CG  . HIS A 1 381 ? 20.038  11.072  -9.662  1.00   47.44  ? 381  HIS A CG  1 
ATOM   2918 N ND1 . HIS A 1 381 ? 19.598  9.812   -10.001 1.00   50.74  ? 381  HIS A ND1 1 
ATOM   2919 C CD2 . HIS A 1 381 ? 19.336  11.434  -8.564  1.00   49.14  ? 381  HIS A CD2 1 
ATOM   2920 C CE1 . HIS A 1 381 ? 18.682  9.421   -9.133  1.00   52.42  ? 381  HIS A CE1 1 
ATOM   2921 N NE2 . HIS A 1 381 ? 18.501  10.390  -8.253  1.00   51.04  ? 381  HIS A NE2 1 
ATOM   2922 N N   . TYR A 1 382 ? 20.347  14.875  -10.252 1.00   42.64  ? 382  TYR A N   1 
ATOM   2923 C CA  . TYR A 1 382 ? 19.711  15.853  -9.371  1.00   41.41  ? 382  TYR A CA  1 
ATOM   2924 C C   . TYR A 1 382 ? 19.090  17.015  -10.123 1.00   42.31  ? 382  TYR A C   1 
ATOM   2925 O O   . TYR A 1 382 ? 18.212  17.703  -9.594  1.00   41.80  ? 382  TYR A O   1 
ATOM   2926 C CB  . TYR A 1 382 ? 20.684  16.341  -8.282  1.00   38.93  ? 382  TYR A CB  1 
ATOM   2927 C CG  . TYR A 1 382 ? 20.797  15.358  -7.143  1.00   41.20  ? 382  TYR A CG  1 
ATOM   2928 C CD1 . TYR A 1 382 ? 21.660  14.270  -7.219  1.00   36.19  ? 382  TYR A CD1 1 
ATOM   2929 C CD2 . TYR A 1 382 ? 20.008  15.496  -6.001  1.00   43.23  ? 382  TYR A CD2 1 
ATOM   2930 C CE1 . TYR A 1 382 ? 21.747  13.358  -6.184  1.00   40.01  ? 382  TYR A CE1 1 
ATOM   2931 C CE2 . TYR A 1 382 ? 20.090  14.592  -4.957  1.00   36.81  ? 382  TYR A CE2 1 
ATOM   2932 C CZ  . TYR A 1 382 ? 20.956  13.525  -5.059  1.00   36.44  ? 382  TYR A CZ  1 
ATOM   2933 O OH  . TYR A 1 382 ? 21.042  12.628  -4.036  1.00   37.92  ? 382  TYR A OH  1 
ATOM   2934 N N   . THR A 1 383 ? 19.525  17.228  -11.362 1.00   43.82  ? 383  THR A N   1 
ATOM   2935 C CA  . THR A 1 383 ? 18.947  18.300  -12.159 1.00   40.84  ? 383  THR A CA  1 
ATOM   2936 C C   . THR A 1 383 ? 17.483  18.016  -12.371 1.00   44.41  ? 383  THR A C   1 
ATOM   2937 O O   . THR A 1 383 ? 17.095  16.870  -12.576 1.00   48.86  ? 383  THR A O   1 
ATOM   2938 C CB  . THR A 1 383 ? 19.608  18.433  -13.529 1.00   44.58  ? 383  THR A CB  1 
ATOM   2939 O OG1 . THR A 1 383 ? 20.878  19.067  -13.377 1.00   44.16  ? 383  THR A OG1 1 
ATOM   2940 C CG2 . THR A 1 383 ? 18.728  19.274  -14.472 1.00   37.08  ? 383  THR A CG2 1 
ATOM   2941 N N   . ASP A 1 384 ? 16.675  19.066  -12.306 1.00   45.99  ? 384  ASP A N   1 
ATOM   2942 C CA  . ASP A 1 384 ? 15.276  18.987  -12.687 1.00   43.64  ? 384  ASP A CA  1 
ATOM   2943 C C   . ASP A 1 384 ? 15.154  19.404  -14.158 1.00   48.71  ? 384  ASP A C   1 
ATOM   2944 O O   . ASP A 1 384 ? 15.246  20.592  -14.489 1.00   48.10  ? 384  ASP A O   1 
ATOM   2945 C CB  . ASP A 1 384 ? 14.466  19.914  -11.789 1.00   48.13  ? 384  ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 384 ? 13.040  20.084  -12.254 1.00   56.89  ? 384  ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 384 ? 12.608  19.315  -13.143 1.00   49.99  ? 384  ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 384 ? 12.359  20.999  -11.723 1.00   59.73  ? 384  ASP A OD2 1 
ATOM   2949 N N   . TRP A 1 385 ? 14.968  18.434  -15.049 1.00   45.02  ? 385  TRP A N   1 
ATOM   2950 C CA  . TRP A 1 385 ? 15.086  18.732  -16.476 1.00   46.60  ? 385  TRP A CA  1 
ATOM   2951 C C   . TRP A 1 385 ? 13.897  19.492  -17.055 1.00   48.26  ? 385  TRP A C   1 
ATOM   2952 O O   . TRP A 1 385 ? 13.934  19.930  -18.195 1.00   51.50  ? 385  TRP A O   1 
ATOM   2953 C CB  . TRP A 1 385 ? 15.465  17.485  -17.282 1.00   42.77  ? 385  TRP A CB  1 
ATOM   2954 C CG  . TRP A 1 385 ? 16.817  17.004  -16.887 1.00   46.52  ? 385  TRP A CG  1 
ATOM   2955 C CD1 . TRP A 1 385 ? 17.111  16.002  -16.006 1.00   45.48  ? 385  TRP A CD1 1 
ATOM   2956 C CD2 . TRP A 1 385 ? 18.070  17.531  -17.324 1.00   38.31  ? 385  TRP A CD2 1 
ATOM   2957 N NE1 . TRP A 1 385 ? 18.468  15.871  -15.877 1.00   41.26  ? 385  TRP A NE1 1 
ATOM   2958 C CE2 . TRP A 1 385 ? 19.080  16.800  -16.672 1.00   38.16  ? 385  TRP A CE2 1 
ATOM   2959 C CE3 . TRP A 1 385 ? 18.434  18.555  -18.197 1.00   41.75  ? 385  TRP A CE3 1 
ATOM   2960 C CZ2 . TRP A 1 385 ? 20.429  17.055  -16.870 1.00   42.19  ? 385  TRP A CZ2 1 
ATOM   2961 C CZ3 . TRP A 1 385 ? 19.780  18.816  -18.384 1.00   45.11  ? 385  TRP A CZ3 1 
ATOM   2962 C CH2 . TRP A 1 385 ? 20.759  18.069  -17.726 1.00   44.39  ? 385  TRP A CH2 1 
ATOM   2963 N N   . LEU A 1 386 ? 12.858  19.672  -16.252 1.00   50.44  ? 386  LEU A N   1 
ATOM   2964 C CA  . LEU A 1 386 ? 11.812  20.623  -16.590 1.00   50.17  ? 386  LEU A CA  1 
ATOM   2965 C C   . LEU A 1 386 ? 12.211  22.062  -16.256 1.00   55.55  ? 386  LEU A C   1 
ATOM   2966 O O   . LEU A 1 386 ? 11.672  23.011  -16.829 1.00   59.01  ? 386  LEU A O   1 
ATOM   2967 C CB  . LEU A 1 386 ? 10.515  20.274  -15.870 1.00   51.09  ? 386  LEU A CB  1 
ATOM   2968 C CG  . LEU A 1 386 ? 9.547   19.478  -16.733 1.00   64.31  ? 386  LEU A CG  1 
ATOM   2969 C CD1 . LEU A 1 386 ? 8.186   19.437  -16.073 1.00   66.70  ? 386  LEU A CD1 1 
ATOM   2970 C CD2 . LEU A 1 386 ? 9.461   20.126  -18.121 1.00   62.28  ? 386  LEU A CD2 1 
ATOM   2971 N N   . HIS A 1 387 ? 13.146  22.223  -15.323 1.00   54.39  ? 387  HIS A N   1 
ATOM   2972 C CA  . HIS A 1 387 ? 13.554  23.557  -14.881 1.00   55.20  ? 387  HIS A CA  1 
ATOM   2973 C C   . HIS A 1 387 ? 15.045  23.628  -14.553 1.00   48.67  ? 387  HIS A C   1 
ATOM   2974 O O   . HIS A 1 387 ? 15.424  24.068  -13.473 1.00   52.23  ? 387  HIS A O   1 
ATOM   2975 C CB  . HIS A 1 387 ? 12.739  23.979  -13.653 1.00   53.60  ? 387  HIS A CB  1 
ATOM   2976 C CG  . HIS A 1 387 ? 11.269  24.097  -13.909 1.00   57.67  ? 387  HIS A CG  1 
ATOM   2977 N ND1 . HIS A 1 387 ? 10.381  23.082  -13.624 1.00   59.49  ? 387  HIS A ND1 1 
ATOM   2978 C CD2 . HIS A 1 387 ? 10.530  25.116  -14.410 1.00   62.30  ? 387  HIS A CD2 1 
ATOM   2979 C CE1 . HIS A 1 387 ? 9.158   23.468  -13.944 1.00   62.27  ? 387  HIS A CE1 1 
ATOM   2980 N NE2 . HIS A 1 387 ? 9.220   24.699  -14.422 1.00   60.78  ? 387  HIS A NE2 1 
ATOM   2981 N N   . PRO A 1 388 ? 15.892  23.213  -15.500 1.00   50.93  ? 388  PRO A N   1 
ATOM   2982 C CA  . PRO A 1 388 ? 17.337  23.017  -15.323 1.00   38.65  ? 388  PRO A CA  1 
ATOM   2983 C C   . PRO A 1 388 ? 18.067  24.208  -14.713 1.00   46.23  ? 388  PRO A C   1 
ATOM   2984 O O   . PRO A 1 388 ? 19.169  24.018  -14.191 1.00   46.76  ? 388  PRO A O   1 
ATOM   2985 C CB  . PRO A 1 388 ? 17.843  22.825  -16.760 1.00   42.48  ? 388  PRO A CB  1 
ATOM   2986 C CG  . PRO A 1 388 ? 16.665  22.395  -17.538 1.00   51.83  ? 388  PRO A CG  1 
ATOM   2987 C CD  . PRO A 1 388 ? 15.480  23.056  -16.907 1.00   54.95  ? 388  PRO A CD  1 
ATOM   2988 N N   . GLU A 1 389 ? 17.484  25.402  -14.800 1.00   38.57  ? 389  GLU A N   1 
ATOM   2989 C CA  . GLU A 1 389 ? 18.185  26.635  -14.456 1.00   44.52  ? 389  GLU A CA  1 
ATOM   2990 C C   . GLU A 1 389 ? 17.547  27.352  -13.276 1.00   41.59  ? 389  GLU A C   1 
ATOM   2991 O O   . GLU A 1 389 ? 18.021  28.409  -12.853 1.00   42.87  ? 389  GLU A O   1 
ATOM   2992 C CB  . GLU A 1 389 ? 18.218  27.598  -15.651 1.00   53.26  ? 389  GLU A CB  1 
ATOM   2993 C CG  . GLU A 1 389 ? 18.995  27.111  -16.883 1.00   58.74  ? 389  GLU A CG  1 
ATOM   2994 C CD  . GLU A 1 389 ? 20.500  27.326  -16.767 1.00   68.65  ? 389  GLU A CD  1 
ATOM   2995 O OE1 . GLU A 1 389 ? 20.979  27.628  -15.653 1.00   72.99  ? 389  GLU A OE1 1 
ATOM   2996 O OE2 . GLU A 1 389 ? 21.211  27.196  -17.789 1.00   71.48  ? 389  GLU A OE2 1 
ATOM   2997 N N   . ASP A 1 390 ? 16.460  26.791  -12.765 1.00   37.66  ? 390  ASP A N   1 
ATOM   2998 C CA  . ASP A 1 390 ? 15.764  27.375  -11.627 1.00   43.82  ? 390  ASP A CA  1 
ATOM   2999 C C   . ASP A 1 390 ? 16.645  27.448  -10.359 1.00   43.90  ? 390  ASP A C   1 
ATOM   3000 O O   . ASP A 1 390 ? 17.071  26.431  -9.828  1.00   34.71  ? 390  ASP A O   1 
ATOM   3001 C CB  . ASP A 1 390 ? 14.503  26.582  -11.330 1.00   39.37  ? 390  ASP A CB  1 
ATOM   3002 C CG  . ASP A 1 390 ? 13.683  27.220  -10.262 1.00   41.63  ? 390  ASP A CG  1 
ATOM   3003 O OD1 . ASP A 1 390 ? 13.121  28.286  -10.520 1.00   49.18  ? 390  ASP A OD1 1 
ATOM   3004 O OD2 . ASP A 1 390 ? 13.605  26.674  -9.154  1.00   52.66  ? 390  ASP A OD2 1 
ATOM   3005 N N   . PRO A 1 391 ? 16.904  28.664  -9.872  1.00   44.72  ? 391  PRO A N   1 
ATOM   3006 C CA  . PRO A 1 391 ? 17.826  28.873  -8.751  1.00   41.90  ? 391  PRO A CA  1 
ATOM   3007 C C   . PRO A 1 391 ? 17.326  28.243  -7.450  1.00   44.11  ? 391  PRO A C   1 
ATOM   3008 O O   . PRO A 1 391 ? 18.157  27.845  -6.637  1.00   41.21  ? 391  PRO A O   1 
ATOM   3009 C CB  . PRO A 1 391 ? 17.883  30.403  -8.610  1.00   43.09  ? 391  PRO A CB  1 
ATOM   3010 C CG  . PRO A 1 391 ? 17.313  30.944  -9.889  1.00   48.37  ? 391  PRO A CG  1 
ATOM   3011 C CD  . PRO A 1 391 ? 16.315  29.926  -10.346 1.00   47.24  ? 391  PRO A CD  1 
ATOM   3012 N N   . THR A 1 392 ? 16.011  28.148  -7.257  1.00   39.76  ? 392  THR A N   1 
ATOM   3013 C CA  . THR A 1 392 ? 15.485  27.535  -6.043  1.00   39.69  ? 392  THR A CA  1 
ATOM   3014 C C   . THR A 1 392 ? 15.687  26.028  -6.079  1.00   41.68  ? 392  THR A C   1 
ATOM   3015 O O   . THR A 1 392 ? 16.155  25.436  -5.102  1.00   39.91  ? 392  THR A O   1 
ATOM   3016 C CB  . THR A 1 392 ? 13.994  27.865  -5.781  1.00   42.24  ? 392  THR A CB  1 
ATOM   3017 O OG1 . THR A 1 392 ? 13.845  29.271  -5.564  1.00   43.31  ? 392  THR A OG1 1 
ATOM   3018 C CG2 . THR A 1 392 ? 13.500  27.140  -4.539  1.00   36.15  ? 392  THR A CG2 1 
ATOM   3019 N N   A HIS A 1 393 ? 15.332  25.400  -7.194  0.66   42.25  ? 393  HIS A N   1 
ATOM   3020 N N   B HIS A 1 393 ? 15.327  25.420  -7.209  0.34   42.18  ? 393  HIS A N   1 
ATOM   3021 C CA  A HIS A 1 393 ? 15.537  23.970  -7.299  0.66   41.13  ? 393  HIS A CA  1 
ATOM   3022 C CA  B HIS A 1 393 ? 15.512  23.990  -7.433  0.34   41.22  ? 393  HIS A CA  1 
ATOM   3023 C C   A HIS A 1 393 ? 17.011  23.664  -7.108  0.66   41.52  ? 393  HIS A C   1 
ATOM   3024 C C   B HIS A 1 393 ? 16.973  23.600  -7.243  0.34   41.47  ? 393  HIS A C   1 
ATOM   3025 O O   A HIS A 1 393 ? 17.366  22.767  -6.352  0.66   42.74  ? 393  HIS A O   1 
ATOM   3026 O O   B HIS A 1 393 ? 17.281  22.588  -6.618  0.34   42.39  ? 393  HIS A O   1 
ATOM   3027 C CB  A HIS A 1 393 ? 15.090  23.400  -8.642  0.66   42.88  ? 393  HIS A CB  1 
ATOM   3028 C CB  B HIS A 1 393 ? 15.074  23.606  -8.852  0.34   42.84  ? 393  HIS A CB  1 
ATOM   3029 C CG  A HIS A 1 393 ? 15.612  22.018  -8.883  0.66   41.10  ? 393  HIS A CG  1 
ATOM   3030 C CG  B HIS A 1 393 ? 13.621  23.259  -8.974  0.34   46.08  ? 393  HIS A CG  1 
ATOM   3031 N ND1 A HIS A 1 393 ? 15.051  20.902  -8.302  0.66   48.71  ? 393  HIS A ND1 1 
ATOM   3032 N ND1 B HIS A 1 393 ? 13.098  22.071  -8.507  0.34   44.81  ? 393  HIS A ND1 1 
ATOM   3033 C CD2 A HIS A 1 393 ? 16.682  21.579  -9.583  0.66   41.36  ? 393  HIS A CD2 1 
ATOM   3034 C CD2 B HIS A 1 393 ? 12.587  23.930  -9.536  0.34   47.51  ? 393  HIS A CD2 1 
ATOM   3035 C CE1 A HIS A 1 393 ? 15.735  19.830  -8.661  0.66   46.31  ? 393  HIS A CE1 1 
ATOM   3036 C CE1 B HIS A 1 393 ? 11.802  22.034  -8.763  0.34   47.36  ? 393  HIS A CE1 1 
ATOM   3037 N NE2 A HIS A 1 393 ? 16.734  20.216  -9.434  0.66   41.94  ? 393  HIS A NE2 1 
ATOM   3038 N NE2 B HIS A 1 393 ? 11.467  23.149  -9.386  0.34   46.35  ? 393  HIS A NE2 1 
ATOM   3039 N N   . LEU A 1 394 ? 17.864  24.412  -7.803  1.00   39.35  ? 394  LEU A N   1 
ATOM   3040 C CA  . LEU A 1 394 ? 19.305  24.186  -7.725  1.00   41.19  ? 394  LEU A CA  1 
ATOM   3041 C C   . LEU A 1 394 ? 19.847  24.335  -6.295  1.00   39.33  ? 394  LEU A C   1 
ATOM   3042 O O   . LEU A 1 394 ? 20.601  23.496  -5.834  1.00   37.99  ? 394  LEU A O   1 
ATOM   3043 C CB  . LEU A 1 394 ? 20.039  25.114  -8.691  1.00   35.46  ? 394  LEU A CB  1 
ATOM   3044 C CG  . LEU A 1 394 ? 19.717  24.817  -10.159 1.00   38.85  ? 394  LEU A CG  1 
ATOM   3045 C CD1 . LEU A 1 394 ? 20.230  25.905  -11.097 1.00   36.78  ? 394  LEU A CD1 1 
ATOM   3046 C CD2 . LEU A 1 394 ? 20.257  23.460  -10.555 1.00   34.46  ? 394  LEU A CD2 1 
ATOM   3047 N N   . ARG A 1 395 ? 19.449  25.395  -5.598  1.00   38.26  ? 395  ARG A N   1 
ATOM   3048 C CA  . ARG A 1 395 ? 19.792  25.539  -4.194  1.00   35.87  ? 395  ARG A CA  1 
ATOM   3049 C C   . ARG A 1 395 ? 19.440  24.255  -3.420  1.00   40.97  ? 395  ARG A C   1 
ATOM   3050 O O   . ARG A 1 395 ? 20.298  23.644  -2.783  1.00   38.31  ? 395  ARG A O   1 
ATOM   3051 C CB  . ARG A 1 395 ? 19.092  26.752  -3.603  1.00   36.62  ? 395  ARG A CB  1 
ATOM   3052 C CG  . ARG A 1 395 ? 19.289  26.934  -2.110  1.00   40.79  ? 395  ARG A CG  1 
ATOM   3053 C CD  . ARG A 1 395 ? 17.967  26.748  -1.406  1.00   43.37  ? 395  ARG A CD  1 
ATOM   3054 N NE  . ARG A 1 395 ? 17.278  28.015  -1.249  1.00   42.67  ? 395  ARG A NE  1 
ATOM   3055 C CZ  . ARG A 1 395 ? 15.965  28.147  -1.089  1.00   44.06  ? 395  ARG A CZ  1 
ATOM   3056 N NH1 . ARG A 1 395 ? 15.173  27.086  -1.084  1.00   36.69  ? 395  ARG A NH1 1 
ATOM   3057 N NH2 . ARG A 1 395 ? 15.443  29.355  -0.950  1.00   50.46  ? 395  ARG A NH2 1 
ATOM   3058 N N   . ASP A 1 396 ? 18.189  23.824  -3.525  1.00   40.71  ? 396  ASP A N   1 
ATOM   3059 C CA  . ASP A 1 396 ? 17.710  22.667  -2.783  1.00   36.59  ? 396  ASP A CA  1 
ATOM   3060 C C   . ASP A 1 396 ? 18.337  21.372  -3.258  1.00   36.57  ? 396  ASP A C   1 
ATOM   3061 O O   . ASP A 1 396 ? 18.503  20.444  -2.482  1.00   35.21  ? 396  ASP A O   1 
ATOM   3062 C CB  . ASP A 1 396 ? 16.189  22.569  -2.866  1.00   36.60  ? 396  ASP A CB  1 
ATOM   3063 C CG  . ASP A 1 396 ? 15.503  23.737  -2.188  1.00   46.62  ? 396  ASP A CG  1 
ATOM   3064 O OD1 . ASP A 1 396 ? 16.177  24.481  -1.428  1.00   47.73  ? 396  ASP A OD1 1 
ATOM   3065 O OD2 . ASP A 1 396 ? 14.296  23.917  -2.418  1.00   42.48  ? 396  ASP A OD2 1 
ATOM   3066 N N   . ALA A 1 397 ? 18.691  21.306  -4.531  1.00   34.10  ? 397  ALA A N   1 
ATOM   3067 C CA  . ALA A 1 397 ? 19.293  20.087  -5.052  1.00   41.09  ? 397  ALA A CA  1 
ATOM   3068 C C   . ALA A 1 397 ? 20.724  19.952  -4.538  1.00   42.52  ? 397  ALA A C   1 
ATOM   3069 O O   . ALA A 1 397 ? 21.184  18.843  -4.255  1.00   41.56  ? 397  ALA A O   1 
ATOM   3070 C CB  . ALA A 1 397 ? 19.258  20.056  -6.570  1.00   35.46  ? 397  ALA A CB  1 
ATOM   3071 N N   . MET A 1 398 ? 21.414  21.083  -4.415  1.00   34.75  ? 398  MET A N   1 
ATOM   3072 C CA  . MET A 1 398 ? 22.748  21.100  -3.848  1.00   34.46  ? 398  MET A CA  1 
ATOM   3073 C C   . MET A 1 398 ? 22.690  20.559  -2.412  1.00   40.64  ? 398  MET A C   1 
ATOM   3074 O O   . MET A 1 398 ? 23.525  19.744  -2.008  1.00   38.23  ? 398  MET A O   1 
ATOM   3075 C CB  . MET A 1 398 ? 23.325  22.517  -3.867  1.00   36.50  ? 398  MET A CB  1 
ATOM   3076 C CG  . MET A 1 398 ? 24.784  22.603  -3.450  1.00   34.90  ? 398  MET A CG  1 
ATOM   3077 S SD  . MET A 1 398 ? 25.907  21.779  -4.612  1.00   41.52  ? 398  MET A SD  1 
ATOM   3078 C CE  . MET A 1 398 ? 26.270  20.245  -3.768  1.00   37.00  ? 398  MET A CE  1 
ATOM   3079 N N   . SER A 1 399 ? 21.703  21.013  -1.648  1.00   31.48  ? 399  SER A N   1 
ATOM   3080 C CA  . SER A 1 399 ? 21.496  20.491  -0.302  1.00   40.43  ? 399  SER A CA  1 
ATOM   3081 C C   . SER A 1 399 ? 21.315  18.973  -0.304  1.00   37.18  ? 399  SER A C   1 
ATOM   3082 O O   . SER A 1 399 ? 21.978  18.257  0.445   1.00   35.80  ? 399  SER A O   1 
ATOM   3083 C CB  . SER A 1 399 ? 20.283  21.154  0.352   1.00   34.47  ? 399  SER A CB  1 
ATOM   3084 O OG  . SER A 1 399 ? 20.013  20.555  1.599   1.00   34.49  ? 399  SER A OG  1 
ATOM   3085 N N   . ALA A 1 400 ? 20.405  18.503  -1.151  1.00   37.69  ? 400  ALA A N   1 
ATOM   3086 C CA  . ALA A 1 400 ? 20.071  17.089  -1.252  1.00   36.70  ? 400  ALA A CA  1 
ATOM   3087 C C   . ALA A 1 400 ? 21.280  16.231  -1.623  1.00   36.30  ? 400  ALA A C   1 
ATOM   3088 O O   . ALA A 1 400 ? 21.442  15.127  -1.107  1.00   36.49  ? 400  ALA A O   1 
ATOM   3089 C CB  . ALA A 1 400 ? 18.940  16.883  -2.256  1.00   37.24  ? 400  ALA A CB  1 
ATOM   3090 N N   . VAL A 1 401 ? 22.124  16.740  -2.517  1.00   32.38  ? 401  VAL A N   1 
ATOM   3091 C CA  . VAL A 1 401 ? 23.339  16.029  -2.904  1.00   39.82  ? 401  VAL A CA  1 
ATOM   3092 C C   . VAL A 1 401 ? 24.191  15.742  -1.664  1.00   37.30  ? 401  VAL A C   1 
ATOM   3093 O O   . VAL A 1 401 ? 24.597  14.615  -1.410  1.00   39.96  ? 401  VAL A O   1 
ATOM   3094 C CB  . VAL A 1 401 ? 24.189  16.849  -3.900  1.00   39.34  ? 401  VAL A CB  1 
ATOM   3095 C CG1 . VAL A 1 401 ? 25.611  16.256  -4.014  1.00   30.41  ? 401  VAL A CG1 1 
ATOM   3096 C CG2 . VAL A 1 401 ? 23.504  16.937  -5.249  1.00   31.11  ? 401  VAL A CG2 1 
ATOM   3097 N N   . VAL A 1 402 ? 24.441  16.781  -0.890  1.00   34.16  ? 402  VAL A N   1 
ATOM   3098 C CA  . VAL A 1 402 ? 25.262  16.673  0.288   1.00   36.03  ? 402  VAL A CA  1 
ATOM   3099 C C   . VAL A 1 402 ? 24.599  15.806  1.358   1.00   36.08  ? 402  VAL A C   1 
ATOM   3100 O O   . VAL A 1 402 ? 25.242  14.931  1.934   1.00   37.87  ? 402  VAL A O   1 
ATOM   3101 C CB  . VAL A 1 402 ? 25.624  18.066  0.807   1.00   40.94  ? 402  VAL A CB  1 
ATOM   3102 C CG1 . VAL A 1 402 ? 26.269  17.994  2.201   1.00   37.90  ? 402  VAL A CG1 1 
ATOM   3103 C CG2 . VAL A 1 402 ? 26.537  18.745  -0.207  1.00   34.99  ? 402  VAL A CG2 1 
ATOM   3104 N N   . GLY A 1 403 ? 23.306  16.015  1.585   1.00   36.03  ? 403  GLY A N   1 
ATOM   3105 C CA  . GLY A 1 403 ? 22.569  15.227  2.562   1.00   32.95  ? 403  GLY A CA  1 
ATOM   3106 C C   . GLY A 1 403 ? 22.509  13.751  2.204   1.00   40.34  ? 403  GLY A C   1 
ATOM   3107 O O   . GLY A 1 403 ? 22.709  12.891  3.064   1.00   41.04  ? 403  GLY A O   1 
ATOM   3108 N N   . ASP A 1 404 ? 22.261  13.459  0.927   1.00   37.60  ? 404  ASP A N   1 
ATOM   3109 C CA  . ASP A 1 404 ? 22.094  12.088  0.474   1.00   35.76  ? 404  ASP A CA  1 
ATOM   3110 C C   . ASP A 1 404 ? 23.417  11.344  0.501   1.00   41.46  ? 404  ASP A C   1 
ATOM   3111 O O   . ASP A 1 404 ? 23.498  10.213  0.970   1.00   46.80  ? 404  ASP A O   1 
ATOM   3112 C CB  . ASP A 1 404 ? 21.490  12.054  -0.936  1.00   37.30  ? 404  ASP A CB  1 
ATOM   3113 C CG  . ASP A 1 404 ? 20.048  12.570  -0.975  1.00   43.60  ? 404  ASP A CG  1 
ATOM   3114 O OD1 . ASP A 1 404 ? 19.403  12.717  0.094   1.00   37.23  ? 404  ASP A OD1 1 
ATOM   3115 O OD2 . ASP A 1 404 ? 19.553  12.826  -2.089  1.00   44.64  ? 404  ASP A OD2 1 
ATOM   3116 N N   . HIS A 1 405 ? 24.459  11.992  0.002   1.00   38.58  ? 405  HIS A N   1 
ATOM   3117 C CA  . HIS A 1 405 ? 25.760  11.356  -0.137  1.00   41.41  ? 405  HIS A CA  1 
ATOM   3118 C C   . HIS A 1 405 ? 26.371  11.068  1.242   1.00   43.28  ? 405  HIS A C   1 
ATOM   3119 O O   . HIS A 1 405 ? 27.012  10.030  1.451   1.00   40.40  ? 405  HIS A O   1 
ATOM   3120 C CB  . HIS A 1 405 ? 26.664  12.273  -0.970  1.00   39.41  ? 405  HIS A CB  1 
ATOM   3121 C CG  . HIS A 1 405 ? 28.097  11.845  -1.050  1.00   36.47  ? 405  HIS A CG  1 
ATOM   3122 N ND1 . HIS A 1 405 ? 28.479  10.570  -1.407  1.00   36.46  ? 405  HIS A ND1 1 
ATOM   3123 C CD2 . HIS A 1 405 ? 29.244  12.545  -0.877  1.00   39.16  ? 405  HIS A CD2 1 
ATOM   3124 C CE1 . HIS A 1 405 ? 29.798  10.500  -1.435  1.00   37.66  ? 405  HIS A CE1 1 
ATOM   3125 N NE2 . HIS A 1 405 ? 30.287  11.689  -1.128  1.00   37.92  ? 405  HIS A NE2 1 
ATOM   3126 N N   . ASN A 1 406 ? 26.156  11.980  2.185   1.00   36.47  ? 406  ASN A N   1 
ATOM   3127 C CA  . ASN A 1 406 ? 26.841  11.892  3.474   1.00   37.84  ? 406  ASN A CA  1 
ATOM   3128 C C   . ASN A 1 406 ? 26.050  11.208  4.578   1.00   36.79  ? 406  ASN A C   1 
ATOM   3129 O O   . ASN A 1 406 ? 26.632  10.625  5.477   1.00   34.17  ? 406  ASN A O   1 
ATOM   3130 C CB  . ASN A 1 406 ? 27.298  13.277  3.939   1.00   34.66  ? 406  ASN A CB  1 
ATOM   3131 C CG  . ASN A 1 406 ? 28.438  13.803  3.119   1.00   36.38  ? 406  ASN A CG  1 
ATOM   3132 O OD1 . ASN A 1 406 ? 29.502  13.193  3.066   1.00   38.89  ? 406  ASN A OD1 1 
ATOM   3133 N ND2 . ASN A 1 406 ? 28.224  14.934  2.459   1.00   37.46  ? 406  ASN A ND2 1 
ATOM   3134 N N   . VAL A 1 407 ? 24.725  11.283  4.508   1.00   37.20  ? 407  VAL A N   1 
ATOM   3135 C CA  . VAL A 1 407 ? 23.902  10.817  5.615   1.00   40.97  ? 407  VAL A CA  1 
ATOM   3136 C C   . VAL A 1 407 ? 22.780  9.878   5.196   1.00   38.72  ? 407  VAL A C   1 
ATOM   3137 O O   . VAL A 1 407 ? 22.779  8.725   5.589   1.00   35.77  ? 407  VAL A O   1 
ATOM   3138 C CB  . VAL A 1 407 ? 23.319  12.002  6.438   1.00   32.59  ? 407  VAL A CB  1 
ATOM   3139 C CG1 . VAL A 1 407 ? 22.403  11.491  7.527   1.00   30.15  ? 407  VAL A CG1 1 
ATOM   3140 C CG2 . VAL A 1 407 ? 24.447  12.813  7.042   1.00   33.69  ? 407  VAL A CG2 1 
ATOM   3141 N N   . VAL A 1 408 ? 21.832  10.381  4.405   1.00   40.96  ? 408  VAL A N   1 
ATOM   3142 C CA  . VAL A 1 408 ? 20.618  9.634   4.109   1.00   37.16  ? 408  VAL A CA  1 
ATOM   3143 C C   . VAL A 1 408 ? 20.886  8.291   3.431   1.00   46.24  ? 408  VAL A C   1 
ATOM   3144 O O   . VAL A 1 408 ? 20.253  7.289   3.763   1.00   42.37  ? 408  VAL A O   1 
ATOM   3145 C CB  . VAL A 1 408 ? 19.618  10.438  3.253   1.00   38.44  ? 408  VAL A CB  1 
ATOM   3146 C CG1 . VAL A 1 408 ? 18.408  9.574   2.933   1.00   37.42  ? 408  VAL A CG1 1 
ATOM   3147 C CG2 . VAL A 1 408 ? 19.181  11.700  3.978   1.00   34.43  ? 408  VAL A CG2 1 
ATOM   3148 N N   . CYS A 1 409 ? 21.817  8.261   2.482   1.00   38.16  ? 409  CYS A N   1 
ATOM   3149 C CA  . CYS A 1 409 ? 22.079  7.012   1.789   1.00   42.17  ? 409  CYS A CA  1 
ATOM   3150 C C   . CYS A 1 409 ? 23.014  6.080   2.581   1.00   44.34  ? 409  CYS A C   1 
ATOM   3151 O O   . CYS A 1 409 ? 22.815  4.863   2.591   1.00   45.09  ? 409  CYS A O   1 
ATOM   3152 C CB  . CYS A 1 409 ? 22.528  7.258   0.334   1.00   44.10  ? 409  CYS A CB  1 
ATOM   3153 S SG  . CYS A 1 409 ? 21.181  7.978   -0.713  1.00   38.76  ? 409  CYS A SG  1 
ATOM   3154 N N   . PRO A 1 410 ? 24.033  6.635   3.252   1.00   39.70  ? 410  PRO A N   1 
ATOM   3155 C CA  . PRO A 1 410 ? 24.758  5.732   4.153   1.00   39.72  ? 410  PRO A CA  1 
ATOM   3156 C C   . PRO A 1 410 ? 23.852  5.129   5.224   1.00   38.11  ? 410  PRO A C   1 
ATOM   3157 O O   . PRO A 1 410 ? 24.010  3.965   5.587   1.00   36.10  ? 410  PRO A O   1 
ATOM   3158 C CB  . PRO A 1 410 ? 25.809  6.641   4.780   1.00   37.64  ? 410  PRO A CB  1 
ATOM   3159 C CG  . PRO A 1 410 ? 26.107  7.632   3.687   1.00   36.22  ? 410  PRO A CG  1 
ATOM   3160 C CD  . PRO A 1 410 ? 24.780  7.881   2.997   1.00   41.00  ? 410  PRO A CD  1 
ATOM   3161 N N   . VAL A 1 411 ? 22.903  5.907   5.725   1.00   37.77  ? 411  VAL A N   1 
ATOM   3162 C CA  . VAL A 1 411 ? 21.941  5.355   6.659   1.00   35.22  ? 411  VAL A CA  1 
ATOM   3163 C C   . VAL A 1 411 ? 21.102  4.261   5.984   1.00   41.12  ? 411  VAL A C   1 
ATOM   3164 O O   . VAL A 1 411 ? 20.947  3.170   6.528   1.00   43.59  ? 411  VAL A O   1 
ATOM   3165 C CB  . VAL A 1 411 ? 21.056  6.438   7.289   1.00   38.53  ? 411  VAL A CB  1 
ATOM   3166 C CG1 . VAL A 1 411 ? 19.791  5.816   7.877   1.00   38.59  ? 411  VAL A CG1 1 
ATOM   3167 C CG2 . VAL A 1 411 ? 21.825  7.169   8.360   1.00   30.14  ? 411  VAL A CG2 1 
ATOM   3168 N N   . ALA A 1 412 ? 20.589  4.542   4.789   1.00   38.82  ? 412  ALA A N   1 
ATOM   3169 C CA  . ALA A 1 412 ? 19.845  3.544   4.023   1.00   40.58  ? 412  ALA A CA  1 
ATOM   3170 C C   . ALA A 1 412 ? 20.614  2.218   3.855   1.00   42.53  ? 412  ALA A C   1 
ATOM   3171 O O   . ALA A 1 412 ? 20.064  1.149   4.113   1.00   41.89  ? 412  ALA A O   1 
ATOM   3172 C CB  . ALA A 1 412 ? 19.411  4.113   2.666   1.00   42.46  ? 412  ALA A CB  1 
ATOM   3173 N N   A GLN A 1 413 ? 21.875  2.297   3.438   0.56   41.04  ? 413  GLN A N   1 
ATOM   3174 N N   B GLN A 1 413 ? 21.875  2.294   3.429   0.44   41.23  ? 413  GLN A N   1 
ATOM   3175 C CA  A GLN A 1 413 ? 22.696  1.100   3.319   0.56   42.41  ? 413  GLN A CA  1 
ATOM   3176 C CA  B GLN A 1 413 ? 22.716  1.103   3.319   0.44   42.43  ? 413  GLN A CA  1 
ATOM   3177 C C   A GLN A 1 413 ? 22.813  0.348   4.649   0.56   44.02  ? 413  GLN A C   1 
ATOM   3178 C C   B GLN A 1 413 ? 22.832  0.348   4.646   0.44   44.01  ? 413  GLN A C   1 
ATOM   3179 O O   A GLN A 1 413 ? 22.717  -0.878  4.682   0.56   41.71  ? 413  GLN A O   1 
ATOM   3180 O O   B GLN A 1 413 ? 22.751  -0.879  4.676   0.44   41.70  ? 413  GLN A O   1 
ATOM   3181 C CB  A GLN A 1 413 ? 24.097  1.423   2.797   0.56   42.00  ? 413  GLN A CB  1 
ATOM   3182 C CB  B GLN A 1 413 ? 24.119  1.454   2.807   0.44   42.03  ? 413  GLN A CB  1 
ATOM   3183 C CG  A GLN A 1 413 ? 25.010  0.206   2.837   0.56   42.56  ? 413  GLN A CG  1 
ATOM   3184 C CG  B GLN A 1 413 ? 24.328  1.227   1.314   0.44   45.80  ? 413  GLN A CG  1 
ATOM   3185 C CD  A GLN A 1 413 ? 26.360  0.443   2.223   0.56   47.59  ? 413  GLN A CD  1 
ATOM   3186 C CD  B GLN A 1 413 ? 24.201  -0.228  0.902   0.44   46.10  ? 413  GLN A CD  1 
ATOM   3187 O OE1 A GLN A 1 413 ? 26.730  1.575   1.928   0.56   52.14  ? 413  GLN A OE1 1 
ATOM   3188 O OE1 B GLN A 1 413 ? 24.885  -1.100  1.435   0.44   49.16  ? 413  GLN A OE1 1 
ATOM   3189 N NE2 A GLN A 1 413 ? 27.115  -0.633  2.028   0.56   55.35  ? 413  GLN A NE2 1 
ATOM   3190 N NE2 B GLN A 1 413 ? 23.329  -0.494  -0.063  0.44   44.68  ? 413  GLN A NE2 1 
ATOM   3191 N N   . LEU A 1 414 ? 23.037  1.085   5.736   1.00   41.50  ? 414  LEU A N   1 
ATOM   3192 C CA  . LEU A 1 414 ? 23.195  0.476   7.053   1.00   39.88  ? 414  LEU A CA  1 
ATOM   3193 C C   . LEU A 1 414 ? 21.929  -0.258  7.495   1.00   46.13  ? 414  LEU A C   1 
ATOM   3194 O O   . LEU A 1 414 ? 21.988  -1.417  7.890   1.00   44.07  ? 414  LEU A O   1 
ATOM   3195 C CB  . LEU A 1 414 ? 23.570  1.520   8.100   1.00   39.44  ? 414  LEU A CB  1 
ATOM   3196 C CG  . LEU A 1 414 ? 23.830  1.049   9.533   1.00   38.60  ? 414  LEU A CG  1 
ATOM   3197 C CD1 . LEU A 1 414 ? 25.117  0.245   9.632   1.00   40.35  ? 414  LEU A CD1 1 
ATOM   3198 C CD2 . LEU A 1 414 ? 23.916  2.250   10.444  1.00   46.83  ? 414  LEU A CD2 1 
ATOM   3199 N N   . ALA A 1 415 ? 20.790  0.421   7.434   1.00   39.37  ? 415  ALA A N   1 
ATOM   3200 C CA  . ALA A 1 415 ? 19.538  -0.194  7.839   1.00   42.29  ? 415  ALA A CA  1 
ATOM   3201 C C   . ALA A 1 415 ? 19.299  -1.493  7.055   1.00   51.37  ? 415  ALA A C   1 
ATOM   3202 O O   . ALA A 1 415 ? 18.976  -2.535  7.632   1.00   43.25  ? 415  ALA A O   1 
ATOM   3203 C CB  . ALA A 1 415 ? 18.392  0.775   7.627   1.00   39.81  ? 415  ALA A CB  1 
ATOM   3204 N N   . GLY A 1 416 ? 19.475  -1.421  5.738   1.00   46.80  ? 416  GLY A N   1 
ATOM   3205 C CA  . GLY A 1 416 ? 19.262  -2.563  4.870   1.00   50.08  ? 416  GLY A CA  1 
ATOM   3206 C C   . GLY A 1 416 ? 20.152  -3.750  5.181   1.00   49.99  ? 416  GLY A C   1 
ATOM   3207 O O   . GLY A 1 416 ? 19.672  -4.874  5.318   1.00   53.85  ? 416  GLY A O   1 
ATOM   3208 N N   . ARG A 1 417 ? 21.453  -3.509  5.287   1.00   47.39  ? 417  ARG A N   1 
ATOM   3209 C CA  . ARG A 1 417 ? 22.385  -4.577  5.620   1.00   49.13  ? 417  ARG A CA  1 
ATOM   3210 C C   . ARG A 1 417 ? 22.129  -5.139  7.023   1.00   51.43  ? 417  ARG A C   1 
ATOM   3211 O O   . ARG A 1 417 ? 22.176  -6.343  7.224   1.00   56.61  ? 417  ARG A O   1 
ATOM   3212 C CB  . ARG A 1 417 ? 23.832  -4.097  5.492   1.00   47.55  ? 417  ARG A CB  1 
ATOM   3213 C CG  . ARG A 1 417 ? 24.172  -3.475  4.149   1.00   52.71  ? 417  ARG A CG  1 
ATOM   3214 C CD  . ARG A 1 417 ? 23.840  -4.393  2.979   1.00   57.28  ? 417  ARG A CD  1 
ATOM   3215 N NE  . ARG A 1 417 ? 24.400  -5.724  3.179   1.00   70.84  ? 417  ARG A NE  1 
ATOM   3216 C CZ  . ARG A 1 417 ? 24.861  -6.507  2.208   1.00   79.24  ? 417  ARG A CZ  1 
ATOM   3217 N NH1 . ARG A 1 417 ? 24.845  -6.093  0.940   1.00   69.15  ? 417  ARG A NH1 1 
ATOM   3218 N NH2 . ARG A 1 417 ? 25.355  -7.704  2.513   1.00   73.12  ? 417  ARG A NH2 1 
ATOM   3219 N N   . LEU A 1 418 ? 21.869  -4.267  7.992   1.00   46.22  ? 418  LEU A N   1 
ATOM   3220 C CA  . LEU A 1 418 ? 21.626  -4.712  9.361   1.00   53.42  ? 418  LEU A CA  1 
ATOM   3221 C C   . LEU A 1 418 ? 20.395  -5.603  9.446   1.00   49.37  ? 418  LEU A C   1 
ATOM   3222 O O   . LEU A 1 418 ? 20.396  -6.603  10.158  1.00   47.88  ? 418  LEU A O   1 
ATOM   3223 C CB  . LEU A 1 418 ? 21.476  -3.520  10.324  1.00   44.47  ? 418  LEU A CB  1 
ATOM   3224 C CG  . LEU A 1 418 ? 22.685  -3.147  11.187  1.00   45.84  ? 418  LEU A CG  1 
ATOM   3225 C CD1 . LEU A 1 418 ? 23.978  -3.353  10.429  1.00   50.82  ? 418  LEU A CD1 1 
ATOM   3226 C CD2 . LEU A 1 418 ? 22.565  -1.714  11.671  1.00   48.98  ? 418  LEU A CD2 1 
ATOM   3227 N N   . ALA A 1 419 ? 19.348  -5.221  8.725   1.00   42.75  ? 419  ALA A N   1 
ATOM   3228 C CA  . ALA A 1 419 ? 18.098  -5.963  8.732   1.00   52.68  ? 419  ALA A CA  1 
ATOM   3229 C C   . ALA A 1 419 ? 18.268  -7.304  8.016   1.00   60.34  ? 419  ALA A C   1 
ATOM   3230 O O   . ALA A 1 419 ? 17.827  -8.344  8.504   1.00   61.01  ? 419  ALA A O   1 
ATOM   3231 C CB  . ALA A 1 419 ? 16.974  -5.137  8.082   1.00   45.07  ? 419  ALA A CB  1 
ATOM   3232 N N   . ALA A 1 420 ? 18.920  -7.280  6.860   1.00   59.38  ? 420  ALA A N   1 
ATOM   3233 C CA  . ALA A 1 420 ? 19.113  -8.498  6.089   1.00   60.62  ? 420  ALA A CA  1 
ATOM   3234 C C   . ALA A 1 420 ? 19.856  -9.528  6.923   1.00   59.89  ? 420  ALA A C   1 
ATOM   3235 O O   . ALA A 1 420 ? 19.836  -10.720 6.619   1.00   60.97  ? 420  ALA A O   1 
ATOM   3236 C CB  . ALA A 1 420 ? 19.873  -8.203  4.809   1.00   53.24  ? 420  ALA A CB  1 
ATOM   3237 N N   . GLN A 1 421 ? 20.488  -9.071  7.996   1.00   56.31  ? 421  GLN A N   1 
ATOM   3238 C CA  . GLN A 1 421 ? 21.432  -9.914  8.713   1.00   54.44  ? 421  GLN A CA  1 
ATOM   3239 C C   . GLN A 1 421 ? 21.106  -10.129 10.177  1.00   55.27  ? 421  GLN A C   1 
ATOM   3240 O O   . GLN A 1 421 ? 21.997  -10.372 10.999  1.00   57.72  ? 421  GLN A O   1 
ATOM   3241 C CB  . GLN A 1 421 ? 22.842  -9.373  8.520   1.00   54.86  ? 421  GLN A CB  1 
ATOM   3242 C CG  . GLN A 1 421 ? 23.186  -9.327  7.044   1.00   60.32  ? 421  GLN A CG  1 
ATOM   3243 C CD  . GLN A 1 421 ? 24.510  -8.671  6.770   1.00   70.98  ? 421  GLN A CD  1 
ATOM   3244 O OE1 . GLN A 1 421 ? 24.825  -8.343  5.620   1.00   73.59  ? 421  GLN A OE1 1 
ATOM   3245 N NE2 . GLN A 1 421 ? 25.300  -8.468  7.821   1.00   65.84  ? 421  GLN A NE2 1 
ATOM   3246 N N   . GLY A 1 422 ? 19.818  -10.047 10.493  1.00   53.23  ? 422  GLY A N   1 
ATOM   3247 C CA  . GLY A 1 422 ? 19.329  -10.482 11.786  1.00   57.05  ? 422  GLY A CA  1 
ATOM   3248 C C   . GLY A 1 422 ? 18.947  -9.412  12.781  1.00   58.74  ? 422  GLY A C   1 
ATOM   3249 O O   . GLY A 1 422 ? 18.298  -9.701  13.788  1.00   69.46  ? 422  GLY A O   1 
ATOM   3250 N N   . ALA A 1 423 ? 19.342  -8.174  12.525  1.00   55.70  ? 423  ALA A N   1 
ATOM   3251 C CA  . ALA A 1 423 ? 19.107  -7.134  13.511  1.00   53.52  ? 423  ALA A CA  1 
ATOM   3252 C C   . ALA A 1 423 ? 17.657  -6.704  13.481  1.00   48.62  ? 423  ALA A C   1 
ATOM   3253 O O   . ALA A 1 423 ? 16.996  -6.810  12.454  1.00   51.80  ? 423  ALA A O   1 
ATOM   3254 C CB  . ALA A 1 423 ? 20.022  -5.954  13.270  1.00   53.83  ? 423  ALA A CB  1 
ATOM   3255 N N   . ARG A 1 424 ? 17.153  -6.248  14.619  1.00   45.73  ? 424  ARG A N   1 
ATOM   3256 C CA  . ARG A 1 424 ? 15.865  -5.581  14.643  1.00   52.98  ? 424  ARG A CA  1 
ATOM   3257 C C   . ARG A 1 424 ? 16.123  -4.084  14.511  1.00   46.26  ? 424  ARG A C   1 
ATOM   3258 O O   . ARG A 1 424 ? 16.800  -3.492  15.352  1.00   44.19  ? 424  ARG A O   1 
ATOM   3259 C CB  . ARG A 1 424 ? 15.090  -5.899  15.931  1.00   55.29  ? 424  ARG A CB  1 
ATOM   3260 C CG  . ARG A 1 424 ? 13.774  -5.138  16.039  1.00   54.24  ? 424  ARG A CG  1 
ATOM   3261 C CD  . ARG A 1 424 ? 12.670  -5.963  16.693  1.00   73.97  ? 424  ARG A CD  1 
ATOM   3262 N NE  . ARG A 1 424 ? 12.675  -5.860  18.152  1.00   80.93  ? 424  ARG A NE  1 
ATOM   3263 C CZ  . ARG A 1 424 ? 13.151  -6.798  18.969  1.00   86.79  ? 424  ARG A CZ  1 
ATOM   3264 N NH1 . ARG A 1 424 ? 13.667  -7.921  18.471  1.00   81.52  ? 424  ARG A NH1 1 
ATOM   3265 N NH2 . ARG A 1 424 ? 13.108  -6.614  20.285  1.00   76.25  ? 424  ARG A NH2 1 
ATOM   3266 N N   . VAL A 1 425 ? 15.581  -3.488  13.452  1.00   41.46  ? 425  VAL A N   1 
ATOM   3267 C CA  . VAL A 1 425 ? 15.880  -2.109  13.089  1.00   41.13  ? 425  VAL A CA  1 
ATOM   3268 C C   . VAL A 1 425 ? 14.628  -1.268  13.077  1.00   41.76  ? 425  VAL A C   1 
ATOM   3269 O O   . VAL A 1 425 ? 13.632  -1.676  12.505  1.00   44.40  ? 425  VAL A O   1 
ATOM   3270 C CB  . VAL A 1 425 ? 16.462  -2.031  11.662  1.00   42.98  ? 425  VAL A CB  1 
ATOM   3271 C CG1 . VAL A 1 425 ? 16.784  -0.570  11.288  1.00   36.85  ? 425  VAL A CG1 1 
ATOM   3272 C CG2 . VAL A 1 425 ? 17.687  -2.934  11.520  1.00   38.46  ? 425  VAL A CG2 1 
ATOM   3273 N N   . TYR A 1 426 ? 14.682  -0.092  13.692  1.00   39.50  ? 426  TYR A N   1 
ATOM   3274 C CA  . TYR A 1 426 ? 13.612  0.890   13.555  1.00   40.08  ? 426  TYR A CA  1 
ATOM   3275 C C   . TYR A 1 426 ? 14.185  2.141   12.905  1.00   45.21  ? 426  TYR A C   1 
ATOM   3276 O O   . TYR A 1 426 ? 15.298  2.558   13.228  1.00   43.43  ? 426  TYR A O   1 
ATOM   3277 C CB  . TYR A 1 426 ? 12.988  1.232   14.911  1.00   39.68  ? 426  TYR A CB  1 
ATOM   3278 C CG  . TYR A 1 426 ? 12.261  0.072   15.545  1.00   47.44  ? 426  TYR A CG  1 
ATOM   3279 C CD1 . TYR A 1 426 ? 10.908  -0.159  15.283  1.00   47.81  ? 426  TYR A CD1 1 
ATOM   3280 C CD2 . TYR A 1 426 ? 12.930  -0.808  16.393  1.00   41.55  ? 426  TYR A CD2 1 
ATOM   3281 C CE1 . TYR A 1 426 ? 10.242  -1.242  15.854  1.00   47.88  ? 426  TYR A CE1 1 
ATOM   3282 C CE2 . TYR A 1 426 ? 12.282  -1.879  16.968  1.00   49.70  ? 426  TYR A CE2 1 
ATOM   3283 C CZ  . TYR A 1 426 ? 10.940  -2.099  16.697  1.00   53.67  ? 426  TYR A CZ  1 
ATOM   3284 O OH  . TYR A 1 426 ? 10.308  -3.173  17.276  1.00   51.42  ? 426  TYR A OH  1 
ATOM   3285 N N   . ALA A 1 427 ? 13.429  2.743   11.995  1.00   40.39  ? 427  ALA A N   1 
ATOM   3286 C CA  . ALA A 1 427 ? 13.953  3.845   11.208  1.00   36.52  ? 427  ALA A CA  1 
ATOM   3287 C C   . ALA A 1 427 ? 12.992  5.018   11.195  1.00   42.87  ? 427  ALA A C   1 
ATOM   3288 O O   . ALA A 1 427 ? 11.775  4.837   11.177  1.00   46.16  ? 427  ALA A O   1 
ATOM   3289 C CB  . ALA A 1 427 ? 14.265  3.387   9.790   1.00   37.01  ? 427  ALA A CB  1 
ATOM   3290 N N   . TYR A 1 428 ? 13.536  6.231   11.206  1.00   42.58  ? 428  TYR A N   1 
ATOM   3291 C CA  . TYR A 1 428 ? 12.688  7.415   11.213  1.00   42.37  ? 428  TYR A CA  1 
ATOM   3292 C C   . TYR A 1 428 ? 13.247  8.526   10.343  1.00   44.37  ? 428  TYR A C   1 
ATOM   3293 O O   . TYR A 1 428 ? 14.420  8.529   9.956   1.00   43.70  ? 428  TYR A O   1 
ATOM   3294 C CB  . TYR A 1 428 ? 12.542  7.955   12.632  1.00   42.15  ? 428  TYR A CB  1 
ATOM   3295 C CG  . TYR A 1 428 ? 13.832  8.540   13.148  1.00   46.48  ? 428  TYR A CG  1 
ATOM   3296 C CD1 . TYR A 1 428 ? 14.195  9.845   12.835  1.00   37.90  ? 428  TYR A CD1 1 
ATOM   3297 C CD2 . TYR A 1 428 ? 14.699  7.786   13.938  1.00   40.68  ? 428  TYR A CD2 1 
ATOM   3298 C CE1 . TYR A 1 428 ? 15.384  10.386  13.291  1.00   37.40  ? 428  TYR A CE1 1 
ATOM   3299 C CE2 . TYR A 1 428 ? 15.891  8.326   14.402  1.00   38.87  ? 428  TYR A CE2 1 
ATOM   3300 C CZ  . TYR A 1 428 ? 16.220  9.629   14.075  1.00   38.76  ? 428  TYR A CZ  1 
ATOM   3301 O OH  . TYR A 1 428 ? 17.397  10.183  14.521  1.00   45.61  ? 428  TYR A OH  1 
ATOM   3302 N N   . ILE A 1 429 ? 12.390  9.488   10.052  1.00   38.81  ? 429  ILE A N   1 
ATOM   3303 C CA  . ILE A 1 429 ? 12.845  10.737  9.493   1.00   37.78  ? 429  ILE A CA  1 
ATOM   3304 C C   . ILE A 1 429 ? 12.229  11.828  10.359  1.00   43.88  ? 429  ILE A C   1 
ATOM   3305 O O   . ILE A 1 429 ? 11.021  11.828  10.620  1.00   43.24  ? 429  ILE A O   1 
ATOM   3306 C CB  . ILE A 1 429 ? 12.451  10.884  8.009   1.00   40.69  ? 429  ILE A CB  1 
ATOM   3307 C CG1 . ILE A 1 429 ? 13.025  12.177  7.436   1.00   39.83  ? 429  ILE A CG1 1 
ATOM   3308 C CG2 . ILE A 1 429 ? 10.928  10.833  7.847   1.00   45.31  ? 429  ILE A CG2 1 
ATOM   3309 C CD1 . ILE A 1 429 ? 12.699  12.386  5.974   1.00   49.44  ? 429  ILE A CD1 1 
ATOM   3310 N N   . PHE A 1 430 ? 13.073  12.735  10.834  1.00   38.04  ? 430  PHE A N   1 
ATOM   3311 C CA  . PHE A 1 430 ? 12.638  13.811  11.707  1.00   40.35  ? 430  PHE A CA  1 
ATOM   3312 C C   . PHE A 1 430 ? 12.321  15.051  10.873  1.00   37.17  ? 430  PHE A C   1 
ATOM   3313 O O   . PHE A 1 430 ? 13.189  15.552  10.182  1.00   39.06  ? 430  PHE A O   1 
ATOM   3314 C CB  . PHE A 1 430 ? 13.759  14.111  12.690  1.00   35.03  ? 430  PHE A CB  1 
ATOM   3315 C CG  . PHE A 1 430 ? 13.409  15.133  13.704  1.00   36.16  ? 430  PHE A CG  1 
ATOM   3316 C CD1 . PHE A 1 430 ? 12.829  14.761  14.909  1.00   37.40  ? 430  PHE A CD1 1 
ATOM   3317 C CD2 . PHE A 1 430 ? 13.674  16.465  13.472  1.00   33.49  ? 430  PHE A CD2 1 
ATOM   3318 C CE1 . PHE A 1 430 ? 12.514  15.709  15.856  1.00   42.78  ? 430  PHE A CE1 1 
ATOM   3319 C CE2 . PHE A 1 430 ? 13.353  17.423  14.414  1.00   38.42  ? 430  PHE A CE2 1 
ATOM   3320 C CZ  . PHE A 1 430 ? 12.777  17.050  15.608  1.00   38.18  ? 430  PHE A CZ  1 
ATOM   3321 N N   . GLU A 1 431 ? 11.093  15.562  10.944  1.00   44.17  ? 431  GLU A N   1 
ATOM   3322 C CA  . GLU A 1 431 ? 10.660  16.589  9.990   1.00   42.51  ? 431  GLU A CA  1 
ATOM   3323 C C   . GLU A 1 431 ? 10.139  17.868  10.615  1.00   44.25  ? 431  GLU A C   1 
ATOM   3324 O O   . GLU A 1 431 ? 9.584   18.720  9.922   1.00   43.92  ? 431  GLU A O   1 
ATOM   3325 C CB  . GLU A 1 431 ? 9.550   16.051  9.090   1.00   43.39  ? 431  GLU A CB  1 
ATOM   3326 C CG  . GLU A 1 431 ? 9.933   14.936  8.154   1.00   49.15  ? 431  GLU A CG  1 
ATOM   3327 C CD  . GLU A 1 431 ? 8.747   14.492  7.300   1.00   54.99  ? 431  GLU A CD  1 
ATOM   3328 O OE1 . GLU A 1 431 ? 7.602   14.510  7.808   1.00   52.38  ? 431  GLU A OE1 1 
ATOM   3329 O OE2 . GLU A 1 431 ? 8.959   14.138  6.119   1.00   55.62  ? 431  GLU A OE2 1 
ATOM   3330 N N   . HIS A 1 432 ? 10.276  18.009  11.918  1.00   40.94  ? 432  HIS A N   1 
ATOM   3331 C CA  . HIS A 1 432 ? 9.779   19.220  12.547  1.00   42.50  ? 432  HIS A CA  1 
ATOM   3332 C C   . HIS A 1 432 ? 10.895  20.245  12.756  1.00   44.76  ? 432  HIS A C   1 
ATOM   3333 O O   . HIS A 1 432 ? 11.952  19.933  13.304  1.00   44.42  ? 432  HIS A O   1 
ATOM   3334 C CB  . HIS A 1 432 ? 9.098   18.906  13.871  1.00   40.82  ? 432  HIS A CB  1 
ATOM   3335 C CG  . HIS A 1 432 ? 8.834   20.118  14.696  1.00   44.85  ? 432  HIS A CG  1 
ATOM   3336 N ND1 . HIS A 1 432 ? 7.826   21.008  14.401  1.00   41.00  ? 432  HIS A ND1 1 
ATOM   3337 C CD2 . HIS A 1 432 ? 9.468   20.611  15.786  1.00   44.03  ? 432  HIS A CD2 1 
ATOM   3338 C CE1 . HIS A 1 432 ? 7.832   21.984  15.290  1.00   45.79  ? 432  HIS A CE1 1 
ATOM   3339 N NE2 . HIS A 1 432 ? 8.820   21.769  16.140  1.00   49.43  ? 432  HIS A NE2 1 
ATOM   3340 N N   . ARG A 1 433 ? 10.654  21.470  12.309  1.00   41.56  ? 433  ARG A N   1 
ATOM   3341 C CA  . ARG A 1 433 ? 11.626  22.542  12.455  1.00   41.23  ? 433  ARG A CA  1 
ATOM   3342 C C   . ARG A 1 433 ? 11.371  23.344  13.734  1.00   49.63  ? 433  ARG A C   1 
ATOM   3343 O O   . ARG A 1 433 ? 10.282  23.910  13.908  1.00   50.33  ? 433  ARG A O   1 
ATOM   3344 C CB  . ARG A 1 433 ? 11.558  23.471  11.246  1.00   34.39  ? 433  ARG A CB  1 
ATOM   3345 C CG  . ARG A 1 433 ? 12.516  24.640  11.337  1.00   47.40  ? 433  ARG A CG  1 
ATOM   3346 C CD  . ARG A 1 433 ? 12.154  25.740  10.362  1.00   44.59  ? 433  ARG A CD  1 
ATOM   3347 N NE  . ARG A 1 433 ? 13.343  26.300  9.727   1.00   45.25  ? 433  ARG A NE  1 
ATOM   3348 C CZ  . ARG A 1 433 ? 13.863  27.479  10.028  1.00   43.95  ? 433  ARG A CZ  1 
ATOM   3349 N NH1 . ARG A 1 433 ? 13.310  28.235  10.958  1.00   56.35  ? 433  ARG A NH1 1 
ATOM   3350 N NH2 . ARG A 1 433 ? 14.939  27.899  9.400   1.00   51.91  ? 433  ARG A NH2 1 
ATOM   3351 N N   . ALA A 1 434 ? 12.364  23.405  14.622  1.00   41.17  ? 434  ALA A N   1 
ATOM   3352 C CA  . ALA A 1 434 ? 12.183  24.111  15.887  1.00   38.74  ? 434  ALA A CA  1 
ATOM   3353 C C   . ALA A 1 434 ? 11.615  25.495  15.603  1.00   47.98  ? 434  ALA A C   1 
ATOM   3354 O O   . ALA A 1 434 ? 12.093  26.201  14.710  1.00   44.22  ? 434  ALA A O   1 
ATOM   3355 C CB  . ALA A 1 434 ? 13.494  24.222  16.647  1.00   46.36  ? 434  ALA A CB  1 
ATOM   3356 N N   . SER A 1 435 ? 10.583  25.873  16.350  1.00   43.04  ? 435  SER A N   1 
ATOM   3357 C CA  . SER A 1 435 ? 10.030  27.216  16.235  1.00   47.04  ? 435  SER A CA  1 
ATOM   3358 C C   . SER A 1 435 ? 11.068  28.249  16.657  1.00   47.38  ? 435  SER A C   1 
ATOM   3359 O O   . SER A 1 435 ? 10.944  29.423  16.333  1.00   45.61  ? 435  SER A O   1 
ATOM   3360 C CB  . SER A 1 435 ? 8.742   27.366  17.058  1.00   42.81  ? 435  SER A CB  1 
ATOM   3361 O OG  . SER A 1 435 ? 8.980   27.196  18.439  1.00   47.23  ? 435  SER A OG  1 
ATOM   3362 N N   . THR A 1 436 ? 12.106  27.785  17.351  1.00   47.54  ? 436  THR A N   1 
ATOM   3363 C CA  . THR A 1 436 ? 13.183  28.642  17.847  1.00   45.08  ? 436  THR A CA  1 
ATOM   3364 C C   . THR A 1 436 ? 14.452  28.633  16.992  1.00   43.69  ? 436  THR A C   1 
ATOM   3365 O O   . THR A 1 436 ? 15.455  29.239  17.368  1.00   46.42  ? 436  THR A O   1 
ATOM   3366 C CB  . THR A 1 436 ? 13.616  28.214  19.266  1.00   47.63  ? 436  THR A CB  1 
ATOM   3367 O OG1 . THR A 1 436 ? 14.217  26.913  19.214  1.00   51.31  ? 436  THR A OG1 1 
ATOM   3368 C CG2 . THR A 1 436 ? 12.416  28.174  20.202  1.00   54.20  ? 436  THR A CG2 1 
ATOM   3369 N N   . LEU A 1 437 ? 14.431  27.932  15.866  1.00   41.64  ? 437  LEU A N   1 
ATOM   3370 C CA  . LEU A 1 437 ? 15.633  27.801  15.045  1.00   42.77  ? 437  LEU A CA  1 
ATOM   3371 C C   . LEU A 1 437 ? 16.129  29.179  14.612  1.00   43.14  ? 437  LEU A C   1 
ATOM   3372 O O   . LEU A 1 437 ? 15.327  30.047  14.288  1.00   41.59  ? 437  LEU A O   1 
ATOM   3373 C CB  . LEU A 1 437 ? 15.333  26.944  13.818  1.00   40.60  ? 437  LEU A CB  1 
ATOM   3374 C CG  . LEU A 1 437 ? 16.519  26.290  13.126  1.00   46.20  ? 437  LEU A CG  1 
ATOM   3375 C CD1 . LEU A 1 437 ? 17.154  25.261  14.029  1.00   44.43  ? 437  LEU A CD1 1 
ATOM   3376 C CD2 . LEU A 1 437 ? 16.069  25.635  11.838  1.00   53.16  ? 437  LEU A CD2 1 
ATOM   3377 N N   . THR A 1 438 ? 17.443  29.391  14.598  1.00   47.53  ? 438  THR A N   1 
ATOM   3378 C CA  . THR A 1 438 ? 17.974  30.692  14.184  1.00   38.56  ? 438  THR A CA  1 
ATOM   3379 C C   . THR A 1 438 ? 18.641  30.656  12.809  1.00   45.74  ? 438  THR A C   1 
ATOM   3380 O O   . THR A 1 438 ? 19.060  31.690  12.292  1.00   49.39  ? 438  THR A O   1 
ATOM   3381 C CB  . THR A 1 438 ? 18.945  31.297  15.228  1.00   46.49  ? 438  THR A CB  1 
ATOM   3382 O OG1 . THR A 1 438 ? 20.152  30.525  15.287  1.00   50.11  ? 438  THR A OG1 1 
ATOM   3383 C CG2 . THR A 1 438 ? 18.301  31.313  16.605  1.00   43.62  ? 438  THR A CG2 1 
ATOM   3384 N N   . TRP A 1 439 ? 18.750  29.472  12.218  1.00   42.47  ? 439  TRP A N   1 
ATOM   3385 C CA  . TRP A 1 439 ? 19.150  29.375  10.817  1.00   43.02  ? 439  TRP A CA  1 
ATOM   3386 C C   . TRP A 1 439 ? 17.964  29.785  9.943   1.00   44.17  ? 439  TRP A C   1 
ATOM   3387 O O   . TRP A 1 439 ? 16.818  29.725  10.381  1.00   38.14  ? 439  TRP A O   1 
ATOM   3388 C CB  . TRP A 1 439 ? 19.598  27.953  10.466  1.00   38.20  ? 439  TRP A CB  1 
ATOM   3389 C CG  . TRP A 1 439 ? 20.773  27.510  11.225  1.00   39.06  ? 439  TRP A CG  1 
ATOM   3390 C CD1 . TRP A 1 439 ? 20.778  26.762  12.374  1.00   39.19  ? 439  TRP A CD1 1 
ATOM   3391 C CD2 . TRP A 1 439 ? 22.139  27.789  10.919  1.00   40.86  ? 439  TRP A CD2 1 
ATOM   3392 N NE1 . TRP A 1 439 ? 22.062  26.561  12.799  1.00   36.09  ? 439  TRP A NE1 1 
ATOM   3393 C CE2 . TRP A 1 439 ? 22.922  27.180  11.926  1.00   41.93  ? 439  TRP A CE2 1 
ATOM   3394 C CE3 . TRP A 1 439 ? 22.781  28.491  9.892   1.00   37.92  ? 439  TRP A CE3 1 
ATOM   3395 C CZ2 . TRP A 1 439 ? 24.313  27.250  11.934  1.00   36.75  ? 439  TRP A CZ2 1 
ATOM   3396 C CZ3 . TRP A 1 439 ? 24.165  28.558  9.900   1.00   45.42  ? 439  TRP A CZ3 1 
ATOM   3397 C CH2 . TRP A 1 439 ? 24.917  27.937  10.916  1.00   43.08  ? 439  TRP A CH2 1 
ATOM   3398 N N   . PRO A 1 440 ? 18.240  30.207  8.706   1.00   41.74  ? 440  PRO A N   1 
ATOM   3399 C CA  . PRO A 1 440 ? 17.209  30.656  7.763   1.00   39.39  ? 440  PRO A CA  1 
ATOM   3400 C C   . PRO A 1 440 ? 16.246  29.539  7.406   1.00   38.20  ? 440  PRO A C   1 
ATOM   3401 O O   . PRO A 1 440 ? 16.576  28.360  7.580   1.00   40.36  ? 440  PRO A O   1 
ATOM   3402 C CB  . PRO A 1 440 ? 18.029  31.037  6.518   1.00   40.28  ? 440  PRO A CB  1 
ATOM   3403 C CG  . PRO A 1 440 ? 19.279  30.228  6.641   1.00   42.28  ? 440  PRO A CG  1 
ATOM   3404 C CD  . PRO A 1 440 ? 19.580  30.310  8.113   1.00   42.35  ? 440  PRO A CD  1 
ATOM   3405 N N   . LEU A 1 441 ? 15.078  29.917  6.902   1.00   37.50  ? 441  LEU A N   1 
ATOM   3406 C CA  . LEU A 1 441 ? 14.051  28.975  6.464   1.00   42.54  ? 441  LEU A CA  1 
ATOM   3407 C C   . LEU A 1 441 ? 14.493  28.059  5.343   1.00   42.98  ? 441  LEU A C   1 
ATOM   3408 O O   . LEU A 1 441 ? 14.044  26.917  5.273   1.00   45.45  ? 441  LEU A O   1 
ATOM   3409 C CB  . LEU A 1 441 ? 12.825  29.729  5.968   1.00   46.40  ? 441  LEU A CB  1 
ATOM   3410 C CG  . LEU A 1 441 ? 12.065  30.503  7.023   1.00   57.85  ? 441  LEU A CG  1 
ATOM   3411 C CD1 . LEU A 1 441 ? 10.988  31.342  6.344   1.00   60.45  ? 441  LEU A CD1 1 
ATOM   3412 C CD2 . LEU A 1 441 ? 11.477  29.525  8.018   1.00   46.25  ? 441  LEU A CD2 1 
ATOM   3413 N N   . TRP A 1 442 ? 15.327  28.561  4.437   1.00   40.31  ? 442  TRP A N   1 
ATOM   3414 C CA  . TRP A 1 442 ? 15.723  27.745  3.295   1.00   46.88  ? 442  TRP A CA  1 
ATOM   3415 C C   . TRP A 1 442 ? 16.436  26.468  3.746   1.00   41.51  ? 442  TRP A C   1 
ATOM   3416 O O   . TRP A 1 442 ? 16.424  25.466  3.036   1.00   40.68  ? 442  TRP A O   1 
ATOM   3417 C CB  . TRP A 1 442 ? 16.535  28.527  2.240   1.00   41.68  ? 442  TRP A CB  1 
ATOM   3418 C CG  . TRP A 1 442 ? 17.949  28.883  2.615   1.00   44.87  ? 442  TRP A CG  1 
ATOM   3419 C CD1 . TRP A 1 442 ? 18.397  30.098  3.067   1.00   42.03  ? 442  TRP A CD1 1 
ATOM   3420 C CD2 . TRP A 1 442 ? 19.108  28.034  2.541   1.00   40.88  ? 442  TRP A CD2 1 
ATOM   3421 N NE1 . TRP A 1 442 ? 19.750  30.054  3.284   1.00   41.70  ? 442  TRP A NE1 1 
ATOM   3422 C CE2 . TRP A 1 442 ? 20.216  28.803  2.967   1.00   37.84  ? 442  TRP A CE2 1 
ATOM   3423 C CE3 . TRP A 1 442 ? 19.314  26.702  2.156   1.00   36.35  ? 442  TRP A CE3 1 
ATOM   3424 C CZ2 . TRP A 1 442 ? 21.515  28.280  3.038   1.00   34.74  ? 442  TRP A CZ2 1 
ATOM   3425 C CZ3 . TRP A 1 442 ? 20.607  26.186  2.210   1.00   36.45  ? 442  TRP A CZ3 1 
ATOM   3426 C CH2 . TRP A 1 442 ? 21.690  26.976  2.657   1.00   42.28  ? 442  TRP A CH2 1 
ATOM   3427 N N   . MET A 1 443 ? 17.017  26.495  4.941   1.00   41.61  ? 443  MET A N   1 
ATOM   3428 C CA  . MET A 1 443 ? 17.738  25.330  5.453   1.00   39.74  ? 443  MET A CA  1 
ATOM   3429 C C   . MET A 1 443 ? 16.812  24.240  5.973   1.00   40.31  ? 443  MET A C   1 
ATOM   3430 O O   . MET A 1 443 ? 17.265  23.133  6.265   1.00   44.85  ? 443  MET A O   1 
ATOM   3431 C CB  . MET A 1 443 ? 18.753  25.737  6.519   1.00   40.32  ? 443  MET A CB  1 
ATOM   3432 C CG  . MET A 1 443 ? 19.940  26.486  5.954   1.00   39.12  ? 443  MET A CG  1 
ATOM   3433 S SD  . MET A 1 443 ? 21.137  26.844  7.241   1.00   46.95  ? 443  MET A SD  1 
ATOM   3434 C CE  . MET A 1 443 ? 22.563  27.369  6.307   1.00   47.00  ? 443  MET A CE  1 
ATOM   3435 N N   . GLY A 1 444 ? 15.520  24.545  6.076   1.00   39.89  ? 444  GLY A N   1 
ATOM   3436 C CA  . GLY A 1 444 ? 14.522  23.564  6.481   1.00   42.09  ? 444  GLY A CA  1 
ATOM   3437 C C   . GLY A 1 444 ? 14.711  23.017  7.893   1.00   43.67  ? 444  GLY A C   1 
ATOM   3438 O O   . GLY A 1 444 ? 14.775  23.781  8.858   1.00   41.48  ? 444  GLY A O   1 
ATOM   3439 N N   . VAL A 1 445 ? 14.784  21.693  8.007   1.00   37.47  ? 445  VAL A N   1 
ATOM   3440 C CA  . VAL A 1 445 ? 15.068  21.024  9.276   1.00   42.46  ? 445  VAL A CA  1 
ATOM   3441 C C   . VAL A 1 445 ? 16.512  20.563  9.233   1.00   39.38  ? 445  VAL A C   1 
ATOM   3442 O O   . VAL A 1 445 ? 16.817  19.469  8.728   1.00   37.00  ? 445  VAL A O   1 
ATOM   3443 C CB  . VAL A 1 445 ? 14.145  19.789  9.518   1.00   42.81  ? 445  VAL A CB  1 
ATOM   3444 C CG1 . VAL A 1 445 ? 14.441  19.156  10.872  1.00   33.67  ? 445  VAL A CG1 1 
ATOM   3445 C CG2 . VAL A 1 445 ? 12.677  20.183  9.424   1.00   39.80  ? 445  VAL A CG2 1 
ATOM   3446 N N   . PRO A 1 446 ? 17.424  21.401  9.739   1.00   37.42  ? 446  PRO A N   1 
ATOM   3447 C CA  . PRO A 1 446 ? 18.817  21.077  9.437   1.00   38.24  ? 446  PRO A CA  1 
ATOM   3448 C C   . PRO A 1 446 ? 19.388  20.014  10.374  1.00   42.50  ? 446  PRO A C   1 
ATOM   3449 O O   . PRO A 1 446 ? 18.832  19.700  11.435  1.00   37.93  ? 446  PRO A O   1 
ATOM   3450 C CB  . PRO A 1 446 ? 19.547  22.415  9.626   1.00   34.74  ? 446  PRO A CB  1 
ATOM   3451 C CG  . PRO A 1 446 ? 18.479  23.426  9.953   1.00   36.22  ? 446  PRO A CG  1 
ATOM   3452 C CD  . PRO A 1 446 ? 17.309  22.663  10.477  1.00   33.38  ? 446  PRO A CD  1 
ATOM   3453 N N   . HIS A 1 447 ? 20.500  19.454  9.922   1.00   37.30  ? 447  HIS A N   1 
ATOM   3454 C CA  . HIS A 1 447 ? 21.277  18.464  10.631  1.00   38.32  ? 447  HIS A CA  1 
ATOM   3455 C C   . HIS A 1 447 ? 21.588  18.948  12.044  1.00   39.65  ? 447  HIS A C   1 
ATOM   3456 O O   . HIS A 1 447 ? 22.010  20.078  12.237  1.00   38.20  ? 447  HIS A O   1 
ATOM   3457 C CB  . HIS A 1 447 ? 22.560  18.243  9.829   1.00   38.45  ? 447  HIS A CB  1 
ATOM   3458 C CG  . HIS A 1 447 ? 23.497  17.247  10.421  1.00   41.81  ? 447  HIS A CG  1 
ATOM   3459 N ND1 . HIS A 1 447 ? 23.366  15.891  10.216  1.00   41.25  ? 447  HIS A ND1 1 
ATOM   3460 C CD2 . HIS A 1 447 ? 24.612  17.409  11.173  1.00   45.27  ? 447  HIS A CD2 1 
ATOM   3461 C CE1 . HIS A 1 447 ? 24.351  15.258  10.831  1.00   41.30  ? 447  HIS A CE1 1 
ATOM   3462 N NE2 . HIS A 1 447 ? 25.122  16.156  11.419  1.00   37.87  ? 447  HIS A NE2 1 
ATOM   3463 N N   . GLY A 1 448 ? 21.347  18.088  13.027  1.00   37.16  ? 448  GLY A N   1 
ATOM   3464 C CA  . GLY A 1 448 ? 21.608  18.412  14.414  1.00   37.83  ? 448  GLY A CA  1 
ATOM   3465 C C   . GLY A 1 448 ? 20.411  18.919  15.200  1.00   36.34  ? 448  GLY A C   1 
ATOM   3466 O O   . GLY A 1 448 ? 20.488  19.007  16.420  1.00   31.57  ? 448  GLY A O   1 
ATOM   3467 N N   . TYR A 1 449 ? 19.303  19.228  14.525  1.00   32.70  ? 449  TYR A N   1 
ATOM   3468 C CA  . TYR A 1 449 ? 18.211  19.953  15.199  1.00   36.61  ? 449  TYR A CA  1 
ATOM   3469 C C   . TYR A 1 449 ? 17.027  19.115  15.712  1.00   39.46  ? 449  TYR A C   1 
ATOM   3470 O O   . TYR A 1 449 ? 15.988  19.649  16.094  1.00   38.30  ? 449  TYR A O   1 
ATOM   3471 C CB  . TYR A 1 449 ? 17.799  21.205  14.403  1.00   30.67  ? 449  TYR A CB  1 
ATOM   3472 C CG  . TYR A 1 449 ? 18.889  22.244  14.544  1.00   39.53  ? 449  TYR A CG  1 
ATOM   3473 C CD1 . TYR A 1 449 ? 18.967  23.042  15.684  1.00   38.70  ? 449  TYR A CD1 1 
ATOM   3474 C CD2 . TYR A 1 449 ? 19.911  22.351  13.597  1.00   37.88  ? 449  TYR A CD2 1 
ATOM   3475 C CE1 . TYR A 1 449 ? 20.001  23.963  15.851  1.00   35.63  ? 449  TYR A CE1 1 
ATOM   3476 C CE2 . TYR A 1 449 ? 20.950  23.270  13.758  1.00   38.13  ? 449  TYR A CE2 1 
ATOM   3477 C CZ  . TYR A 1 449 ? 20.984  24.073  14.888  1.00   38.95  ? 449  TYR A CZ  1 
ATOM   3478 O OH  . TYR A 1 449 ? 22.004  24.981  15.056  1.00   40.28  ? 449  TYR A OH  1 
ATOM   3479 N N   . GLU A 1 450 ? 17.213  17.799  15.742  1.00   34.20  ? 450  GLU A N   1 
ATOM   3480 C CA  . GLU A 1 450 ? 16.309  16.912  16.451  1.00   35.46  ? 450  GLU A CA  1 
ATOM   3481 C C   . GLU A 1 450 ? 16.789  16.724  17.895  1.00   38.90  ? 450  GLU A C   1 
ATOM   3482 O O   . GLU A 1 450 ? 15.995  16.440  18.791  1.00   41.42  ? 450  GLU A O   1 
ATOM   3483 C CB  . GLU A 1 450 ? 16.238  15.562  15.748  1.00   33.84  ? 450  GLU A CB  1 
ATOM   3484 C CG  . GLU A 1 450 ? 17.344  14.598  16.128  1.00   32.24  ? 450  GLU A CG  1 
ATOM   3485 C CD  . GLU A 1 450 ? 18.679  14.885  15.459  1.00   35.25  ? 450  GLU A CD  1 
ATOM   3486 O OE1 . GLU A 1 450 ? 18.972  16.040  15.076  1.00   37.62  ? 450  GLU A OE1 1 
ATOM   3487 O OE2 . GLU A 1 450 ? 19.458  13.928  15.326  1.00   39.05  ? 450  GLU A OE2 1 
ATOM   3488 N N   . ILE A 1 451 ? 18.087  16.912  18.113  1.00   34.33  ? 451  ILE A N   1 
ATOM   3489 C CA  . ILE A 1 451 ? 18.715  16.578  19.391  1.00   37.39  ? 451  ILE A CA  1 
ATOM   3490 C C   . ILE A 1 451 ? 18.038  17.239  20.586  1.00   38.89  ? 451  ILE A C   1 
ATOM   3491 O O   . ILE A 1 451 ? 17.780  16.577  21.593  1.00   39.01  ? 451  ILE A O   1 
ATOM   3492 C CB  . ILE A 1 451 ? 20.215  16.954  19.424  1.00   34.34  ? 451  ILE A CB  1 
ATOM   3493 C CG1 . ILE A 1 451 ? 21.008  16.168  18.366  1.00   35.57  ? 451  ILE A CG1 1 
ATOM   3494 C CG2 . ILE A 1 451 ? 20.763  16.719  20.813  1.00   30.90  ? 451  ILE A CG2 1 
ATOM   3495 C CD1 . ILE A 1 451 ? 22.488  16.556  18.283  1.00   30.45  ? 451  ILE A CD1 1 
ATOM   3496 N N   . GLU A 1 452 ? 17.769  18.540  20.474  1.00   34.30  ? 452  GLU A N   1 
ATOM   3497 C CA  . GLU A 1 452 ? 17.117  19.298  21.539  1.00   36.67  ? 452  GLU A CA  1 
ATOM   3498 C C   . GLU A 1 452 ? 15.741  18.735  21.897  1.00   37.85  ? 452  GLU A C   1 
ATOM   3499 O O   . GLU A 1 452 ? 15.312  18.842  23.047  1.00   41.47  ? 452  GLU A O   1 
ATOM   3500 C CB  . GLU A 1 452 ? 17.017  20.797  21.194  1.00   36.28  ? 452  GLU A CB  1 
ATOM   3501 C CG  . GLU A 1 452 ? 16.234  21.095  19.922  1.00   39.36  ? 452  GLU A CG  1 
ATOM   3502 C CD  . GLU A 1 452 ? 16.560  22.448  19.316  1.00   44.01  ? 452  GLU A CD  1 
ATOM   3503 O OE1 . GLU A 1 452 ? 17.681  22.627  18.804  1.00   47.01  ? 452  GLU A OE1 1 
ATOM   3504 O OE2 . GLU A 1 452 ? 15.693  23.340  19.346  1.00   48.32  ? 452  GLU A OE2 1 
ATOM   3505 N N   . PHE A 1 453 ? 15.058  18.133  20.923  1.00   33.34  ? 453  PHE A N   1 
ATOM   3506 C CA  . PHE A 1 453 ? 13.771  17.482  21.188  1.00   33.65  ? 453  PHE A CA  1 
ATOM   3507 C C   . PHE A 1 453 ? 13.909  16.125  21.895  1.00   39.54  ? 453  PHE A C   1 
ATOM   3508 O O   . PHE A 1 453 ? 13.167  15.841  22.841  1.00   39.10  ? 453  PHE A O   1 
ATOM   3509 C CB  . PHE A 1 453 ? 12.943  17.364  19.902  1.00   37.59  ? 453  PHE A CB  1 
ATOM   3510 C CG  . PHE A 1 453 ? 12.433  18.699  19.393  1.00   37.70  ? 453  PHE A CG  1 
ATOM   3511 C CD1 . PHE A 1 453 ? 11.217  19.206  19.833  1.00   36.91  ? 453  PHE A CD1 1 
ATOM   3512 C CD2 . PHE A 1 453 ? 13.186  19.453  18.503  1.00   34.42  ? 453  PHE A CD2 1 
ATOM   3513 C CE1 . PHE A 1 453 ? 10.759  20.436  19.382  1.00   40.92  ? 453  PHE A CE1 1 
ATOM   3514 C CE2 . PHE A 1 453 ? 12.742  20.685  18.048  1.00   36.09  ? 453  PHE A CE2 1 
ATOM   3515 C CZ  . PHE A 1 453 ? 11.523  21.180  18.488  1.00   43.31  ? 453  PHE A CZ  1 
ATOM   3516 N N   . ILE A 1 454 ? 14.867  15.306  21.456  1.00   31.81  ? 454  ILE A N   1 
ATOM   3517 C CA  . ILE A 1 454 ? 15.145  14.023  22.092  1.00   28.20  ? 454  ILE A CA  1 
ATOM   3518 C C   . ILE A 1 454 ? 15.523  14.179  23.572  1.00   37.42  ? 454  ILE A C   1 
ATOM   3519 O O   . ILE A 1 454 ? 15.228  13.311  24.389  1.00   38.44  ? 454  ILE A O   1 
ATOM   3520 C CB  . ILE A 1 454 ? 16.278  13.265  21.368  1.00   35.94  ? 454  ILE A CB  1 
ATOM   3521 C CG1 . ILE A 1 454 ? 16.011  13.178  19.860  1.00   35.17  ? 454  ILE A CG1 1 
ATOM   3522 C CG2 . ILE A 1 454 ? 16.472  11.889  21.963  1.00   34.60  ? 454  ILE A CG2 1 
ATOM   3523 C CD1 . ILE A 1 454 ? 14.885  12.279  19.509  1.00   43.46  ? 454  ILE A CD1 1 
ATOM   3524 N N   . PHE A 1 455 ? 16.166  15.290  23.919  1.00   39.10  ? 455  PHE A N   1 
ATOM   3525 C CA  . PHE A 1 455 ? 16.605  15.523  25.295  1.00   39.11  ? 455  PHE A CA  1 
ATOM   3526 C C   . PHE A 1 455 ? 15.584  16.288  26.121  1.00   39.97  ? 455  PHE A C   1 
ATOM   3527 O O   . PHE A 1 455 ? 15.823  16.568  27.300  1.00   42.85  ? 455  PHE A O   1 
ATOM   3528 C CB  . PHE A 1 455 ? 17.931  16.286  25.322  1.00   35.28  ? 455  PHE A CB  1 
ATOM   3529 C CG  . PHE A 1 455 ? 19.134  15.408  25.205  1.00   33.78  ? 455  PHE A CG  1 
ATOM   3530 C CD1 . PHE A 1 455 ? 19.563  14.964  23.963  1.00   30.52  ? 455  PHE A CD1 1 
ATOM   3531 C CD2 . PHE A 1 455 ? 19.847  15.037  26.339  1.00   31.97  ? 455  PHE A CD2 1 
ATOM   3532 C CE1 . PHE A 1 455 ? 20.690  14.142  23.850  1.00   33.94  ? 455  PHE A CE1 1 
ATOM   3533 C CE2 . PHE A 1 455 ? 20.965  14.227  26.246  1.00   33.87  ? 455  PHE A CE2 1 
ATOM   3534 C CZ  . PHE A 1 455 ? 21.389  13.774  24.990  1.00   37.77  ? 455  PHE A CZ  1 
ATOM   3535 N N   . GLY A 1 456 ? 14.468  16.651  25.494  1.00   38.85  ? 456  GLY A N   1 
ATOM   3536 C CA  . GLY A 1 456 ? 13.387  17.337  26.174  1.00   34.46  ? 456  GLY A CA  1 
ATOM   3537 C C   . GLY A 1 456 ? 13.642  18.773  26.606  1.00   40.13  ? 456  GLY A C   1 
ATOM   3538 O O   . GLY A 1 456 ? 13.074  19.230  27.594  1.00   43.74  ? 456  GLY A O   1 
ATOM   3539 N N   . LEU A 1 457 ? 14.474  19.510  25.880  1.00   40.22  ? 457  LEU A N   1 
ATOM   3540 C CA  . LEU A 1 457 ? 14.624  20.939  26.180  1.00   44.40  ? 457  LEU A CA  1 
ATOM   3541 C C   . LEU A 1 457 ? 13.317  21.749  26.129  1.00   46.38  ? 457  LEU A C   1 
ATOM   3542 O O   . LEU A 1 457 ? 13.158  22.712  26.876  1.00   47.90  ? 457  LEU A O   1 
ATOM   3543 C CB  . LEU A 1 457 ? 15.681  21.599  25.297  1.00   41.24  ? 457  LEU A CB  1 
ATOM   3544 C CG  . LEU A 1 457 ? 17.099  21.495  25.864  1.00   43.54  ? 457  LEU A CG  1 
ATOM   3545 C CD1 . LEU A 1 457 ? 17.583  20.042  25.875  1.00   32.07  ? 457  LEU A CD1 1 
ATOM   3546 C CD2 . LEU A 1 457 ? 18.052  22.382  25.080  1.00   39.52  ? 457  LEU A CD2 1 
ATOM   3547 N N   . PRO A 1 458 ? 12.381  21.378  25.243  1.00   44.00  ? 458  PRO A N   1 
ATOM   3548 C CA  . PRO A 1 458 ? 11.161  22.195  25.222  1.00   50.33  ? 458  PRO A CA  1 
ATOM   3549 C C   . PRO A 1 458 ? 10.359  22.147  26.533  1.00   50.47  ? 458  PRO A C   1 
ATOM   3550 O O   . PRO A 1 458 ? 9.501   23.006  26.734  1.00   54.48  ? 458  PRO A O   1 
ATOM   3551 C CB  . PRO A 1 458 ? 10.361  21.598  24.059  1.00   44.31  ? 458  PRO A CB  1 
ATOM   3552 C CG  . PRO A 1 458 ? 11.414  21.022  23.160  1.00   44.61  ? 458  PRO A CG  1 
ATOM   3553 C CD  . PRO A 1 458 ? 12.449  20.462  24.095  1.00   37.56  ? 458  PRO A CD  1 
ATOM   3554 N N   . LEU A 1 459 ? 10.634  21.180  27.405  1.00   45.41  ? 459  LEU A N   1 
ATOM   3555 C CA  . LEU A 1 459 ? 9.966   21.114  28.710  1.00   45.43  ? 459  LEU A CA  1 
ATOM   3556 C C   . LEU A 1 459 ? 10.409  22.254  29.628  1.00   51.69  ? 459  LEU A C   1 
ATOM   3557 O O   . LEU A 1 459 ? 9.743   22.560  30.623  1.00   53.16  ? 459  LEU A O   1 
ATOM   3558 C CB  . LEU A 1 459 ? 10.248  19.783  29.399  1.00   42.27  ? 459  LEU A CB  1 
ATOM   3559 C CG  . LEU A 1 459 ? 9.361   18.572  29.118  1.00   48.85  ? 459  LEU A CG  1 
ATOM   3560 C CD1 . LEU A 1 459 ? 9.153   18.319  27.629  1.00   51.86  ? 459  LEU A CD1 1 
ATOM   3561 C CD2 . LEU A 1 459 ? 9.986   17.362  29.775  1.00   38.85  ? 459  LEU A CD2 1 
ATOM   3562 N N   . ASP A 1 460 ? 11.542  22.870  29.305  1.00   44.22  ? 460  ASP A N   1 
ATOM   3563 C CA  . ASP A 1 460 ? 12.038  23.989  30.093  1.00   51.06  ? 460  ASP A CA  1 
ATOM   3564 C C   . ASP A 1 460 ? 11.303  25.242  29.646  1.00   51.48  ? 460  ASP A C   1 
ATOM   3565 O O   . ASP A 1 460 ? 11.509  25.723  28.537  1.00   52.28  ? 460  ASP A O   1 
ATOM   3566 C CB  . ASP A 1 460 ? 13.552  24.145  29.915  1.00   46.71  ? 460  ASP A CB  1 
ATOM   3567 C CG  . ASP A 1 460 ? 14.134  25.233  30.792  1.00   51.24  ? 460  ASP A CG  1 
ATOM   3568 O OD1 . ASP A 1 460 ? 13.401  26.174  31.162  1.00   58.12  ? 460  ASP A OD1 1 
ATOM   3569 O OD2 . ASP A 1 460 ? 15.336  25.151  31.111  1.00   60.60  ? 460  ASP A OD2 1 
ATOM   3570 N N   . PRO A 1 461 ? 10.447  25.788  30.515  1.00   60.13  ? 461  PRO A N   1 
ATOM   3571 C CA  . PRO A 1 461 ? 9.503   26.814  30.051  1.00   61.28  ? 461  PRO A CA  1 
ATOM   3572 C C   . PRO A 1 461 ? 10.217  28.081  29.587  1.00   58.86  ? 461  PRO A C   1 
ATOM   3573 O O   . PRO A 1 461 ? 9.735   28.766  28.682  1.00   60.58  ? 461  PRO A O   1 
ATOM   3574 C CB  . PRO A 1 461 ? 8.646   27.100  31.288  1.00   57.97  ? 461  PRO A CB  1 
ATOM   3575 C CG  . PRO A 1 461 ? 9.042   26.057  32.318  1.00   65.17  ? 461  PRO A CG  1 
ATOM   3576 C CD  . PRO A 1 461 ? 10.428  25.631  31.976  1.00   55.85  ? 461  PRO A CD  1 
ATOM   3577 N N   . SER A 1 462 ? 11.367  28.373  30.180  1.00   50.29  ? 462  SER A N   1 
ATOM   3578 C CA  . SER A 1 462 ? 12.140  29.554  29.787  1.00   60.06  ? 462  SER A CA  1 
ATOM   3579 C C   . SER A 1 462 ? 12.725  29.509  28.364  1.00   58.16  ? 462  SER A C   1 
ATOM   3580 O O   . SER A 1 462 ? 13.306  30.491  27.906  1.00   57.26  ? 462  SER A O   1 
ATOM   3581 C CB  . SER A 1 462 ? 13.269  29.818  30.788  1.00   48.41  ? 462  SER A CB  1 
ATOM   3582 O OG  . SER A 1 462 ? 14.295  28.855  30.657  1.00   60.01  ? 462  SER A OG  1 
ATOM   3583 N N   . LEU A 1 463 ? 12.584  28.386  27.663  1.00   56.83  ? 463  LEU A N   1 
ATOM   3584 C CA  . LEU A 1 463 ? 13.194  28.276  26.341  1.00   54.75  ? 463  LEU A CA  1 
ATOM   3585 C C   . LEU A 1 463 ? 12.253  28.695  25.215  1.00   55.78  ? 463  LEU A C   1 
ATOM   3586 O O   . LEU A 1 463 ? 12.651  28.760  24.047  1.00   54.82  ? 463  LEU A O   1 
ATOM   3587 C CB  . LEU A 1 463 ? 13.768  26.878  26.099  1.00   48.19  ? 463  LEU A CB  1 
ATOM   3588 C CG  . LEU A 1 463 ? 14.931  26.504  27.023  1.00   55.70  ? 463  LEU A CG  1 
ATOM   3589 C CD1 . LEU A 1 463 ? 15.531  25.166  26.624  1.00   42.71  ? 463  LEU A CD1 1 
ATOM   3590 C CD2 . LEU A 1 463 ? 15.999  27.593  27.030  1.00   47.52  ? 463  LEU A CD2 1 
ATOM   3591 N N   . ASN A 1 464 ? 11.010  28.986  25.574  1.00   54.07  ? 464  ASN A N   1 
ATOM   3592 C CA  . ASN A 1 464 ? 10.063  29.598  24.639  1.00   61.88  ? 464  ASN A CA  1 
ATOM   3593 C C   . ASN A 1 464 ? 9.603   28.693  23.490  1.00   57.36  ? 464  ASN A C   1 
ATOM   3594 O O   . ASN A 1 464 ? 9.185   29.191  22.446  1.00   54.95  ? 464  ASN A O   1 
ATOM   3595 C CB  . ASN A 1 464 ? 10.618  30.920  24.066  1.00   58.47  ? 464  ASN A CB  1 
ATOM   3596 C CG  . ASN A 1 464 ? 10.759  32.026  25.125  1.00   73.68  ? 464  ASN A CG  1 
ATOM   3597 O OD1 . ASN A 1 464 ? 10.211  31.924  26.231  1.00   69.88  ? 464  ASN A OD1 1 
ATOM   3598 N ND2 . ASN A 1 464 ? 11.496  33.097  24.772  1.00   81.57  ? 464  ASN A ND2 1 
ATOM   3599 N N   . TYR A 1 465 ? 9.677   27.377  23.671  1.00   52.05  ? 465  TYR A N   1 
ATOM   3600 C CA  . TYR A 1 465 ? 9.109   26.463  22.683  1.00   50.52  ? 465  TYR A CA  1 
ATOM   3601 C C   . TYR A 1 465 ? 7.605   26.540  22.783  1.00   50.36  ? 465  TYR A C   1 
ATOM   3602 O O   . TYR A 1 465 ? 7.088   27.067  23.759  1.00   57.10  ? 465  TYR A O   1 
ATOM   3603 C CB  . TYR A 1 465 ? 9.559   25.025  22.927  1.00   47.26  ? 465  TYR A CB  1 
ATOM   3604 C CG  . TYR A 1 465 ? 11.006  24.760  22.590  1.00   48.05  ? 465  TYR A CG  1 
ATOM   3605 C CD1 . TYR A 1 465 ? 12.013  24.993  23.527  1.00   47.90  ? 465  TYR A CD1 1 
ATOM   3606 C CD2 . TYR A 1 465 ? 11.370  24.270  21.339  1.00   45.00  ? 465  TYR A CD2 1 
ATOM   3607 C CE1 . TYR A 1 465 ? 13.336  24.758  23.226  1.00   44.40  ? 465  TYR A CE1 1 
ATOM   3608 C CE2 . TYR A 1 465 ? 12.699  24.023  21.027  1.00   48.23  ? 465  TYR A CE2 1 
ATOM   3609 C CZ  . TYR A 1 465 ? 13.679  24.273  21.977  1.00   49.01  ? 465  TYR A CZ  1 
ATOM   3610 O OH  . TYR A 1 465 ? 15.006  24.029  21.685  1.00   48.10  ? 465  TYR A OH  1 
ATOM   3611 N N   . THR A 1 466 ? 6.900   26.010  21.786  1.00   54.47  ? 466  THR A N   1 
ATOM   3612 C CA  . THR A 1 466 ? 5.436   25.958  21.824  1.00   44.10  ? 466  THR A CA  1 
ATOM   3613 C C   . THR A 1 466 ? 4.951   24.791  22.670  1.00   52.28  ? 466  THR A C   1 
ATOM   3614 O O   . THR A 1 466 ? 5.685   23.815  22.895  1.00   52.02  ? 466  THR A O   1 
ATOM   3615 C CB  . THR A 1 466 ? 4.821   25.784  20.422  1.00   46.62  ? 466  THR A CB  1 
ATOM   3616 O OG1 . THR A 1 466 ? 5.212   24.514  19.873  1.00   50.98  ? 466  THR A OG1 1 
ATOM   3617 C CG2 . THR A 1 466 ? 5.249   26.907  19.492  1.00   37.43  ? 466  THR A CG2 1 
ATOM   3618 N N   . THR A 1 467 ? 3.700   24.880  23.112  1.00   51.38  ? 467  THR A N   1 
ATOM   3619 C CA  . THR A 1 467 ? 3.080   23.819  23.896  1.00   51.64  ? 467  THR A CA  1 
ATOM   3620 C C   . THR A 1 467 ? 3.064   22.516  23.105  1.00   50.20  ? 467  THR A C   1 
ATOM   3621 O O   . THR A 1 467 ? 3.218   21.427  23.660  1.00   53.83  ? 467  THR A O   1 
ATOM   3622 C CB  . THR A 1 467 ? 1.642   24.202  24.325  1.00   56.44  ? 467  THR A CB  1 
ATOM   3623 O OG1 . THR A 1 467 ? 1.696   25.225  25.330  1.00   56.93  ? 467  THR A OG1 1 
ATOM   3624 C CG2 . THR A 1 467 ? 0.919   23.003  24.894  1.00   52.50  ? 467  THR A CG2 1 
ATOM   3625 N N   . GLU A 1 468 ? 2.886   22.639  21.800  1.00   46.62  ? 468  GLU A N   1 
ATOM   3626 C CA  . GLU A 1 468 ? 2.862   21.481  20.926  1.00   55.10  ? 468  GLU A CA  1 
ATOM   3627 C C   . GLU A 1 468 ? 4.252   20.861  20.824  1.00   51.24  ? 468  GLU A C   1 
ATOM   3628 O O   . GLU A 1 468 ? 4.389   19.634  20.788  1.00   45.79  ? 468  GLU A O   1 
ATOM   3629 C CB  . GLU A 1 468 ? 2.332   21.867  19.542  1.00   56.86  ? 468  GLU A CB  1 
ATOM   3630 C CG  . GLU A 1 468 ? 0.975   22.575  19.581  1.00   66.82  ? 468  GLU A CG  1 
ATOM   3631 C CD  . GLU A 1 468 ? 1.090   24.093  19.710  1.00   75.10  ? 468  GLU A CD  1 
ATOM   3632 O OE1 . GLU A 1 468 ? 1.400   24.601  20.815  1.00   68.68  ? 468  GLU A OE1 1 
ATOM   3633 O OE2 . GLU A 1 468 ? 0.853   24.788  18.696  1.00   86.27  ? 468  GLU A OE2 1 
ATOM   3634 N N   . GLU A 1 469 ? 5.279   21.712  20.775  1.00   48.90  ? 469  GLU A N   1 
ATOM   3635 C CA  . GLU A 1 469 ? 6.656   21.232  20.792  1.00   49.14  ? 469  GLU A CA  1 
ATOM   3636 C C   . GLU A 1 469 ? 6.956   20.508  22.097  1.00   47.94  ? 469  GLU A C   1 
ATOM   3637 O O   . GLU A 1 469 ? 7.681   19.516  22.109  1.00   45.04  ? 469  GLU A O   1 
ATOM   3638 C CB  . GLU A 1 469 ? 7.652   22.369  20.531  1.00   45.24  ? 469  GLU A CB  1 
ATOM   3639 C CG  . GLU A 1 469 ? 7.796   22.670  19.031  1.00   49.20  ? 469  GLU A CG  1 
ATOM   3640 C CD  . GLU A 1 469 ? 8.600   23.916  18.743  1.00   47.15  ? 469  GLU A CD  1 
ATOM   3641 O OE1 . GLU A 1 469 ? 8.598   24.828  19.593  1.00   46.53  ? 469  GLU A OE1 1 
ATOM   3642 O OE2 . GLU A 1 469 ? 9.225   23.986  17.664  1.00   45.58  ? 469  GLU A OE2 1 
ATOM   3643 N N   . ARG A 1 470 ? 6.370   20.989  23.190  1.00   45.81  ? 470  ARG A N   1 
ATOM   3644 C CA  . ARG A 1 470 ? 6.557   20.351  24.482  1.00   50.28  ? 470  ARG A CA  1 
ATOM   3645 C C   . ARG A 1 470 ? 5.977   18.941  24.470  1.00   51.16  ? 470  ARG A C   1 
ATOM   3646 O O   . ARG A 1 470 ? 6.615   17.994  24.924  1.00   49.72  ? 470  ARG A O   1 
ATOM   3647 C CB  . ARG A 1 470 ? 5.935   21.194  25.589  1.00   53.17  ? 470  ARG A CB  1 
ATOM   3648 C CG  . ARG A 1 470 ? 6.552   20.966  26.946  1.00   59.43  ? 470  ARG A CG  1 
ATOM   3649 C CD  . ARG A 1 470 ? 5.583   20.288  27.924  1.00   76.49  ? 470  ARG A CD  1 
ATOM   3650 N NE  . ARG A 1 470 ? 4.338   21.041  28.089  1.00   76.91  ? 470  ARG A NE  1 
ATOM   3651 C CZ  . ARG A 1 470 ? 3.124   20.519  27.933  1.00   76.98  ? 470  ARG A CZ  1 
ATOM   3652 N NH1 . ARG A 1 470 ? 2.985   19.231  27.632  1.00   73.58  ? 470  ARG A NH1 1 
ATOM   3653 N NH2 . ARG A 1 470 ? 2.048   21.281  28.090  1.00   73.62  ? 470  ARG A NH2 1 
ATOM   3654 N N   . ILE A 1 471 ? 4.778   18.799  23.917  1.00   50.89  ? 471  ILE A N   1 
ATOM   3655 C CA  . ILE A 1 471 ? 4.140   17.495  23.813  1.00   46.49  ? 471  ILE A CA  1 
ATOM   3656 C C   . ILE A 1 471 ? 4.925   16.588  22.873  1.00   48.38  ? 471  ILE A C   1 
ATOM   3657 O O   . ILE A 1 471 ? 5.162   15.402  23.165  1.00   46.40  ? 471  ILE A O   1 
ATOM   3658 C CB  . ILE A 1 471 ? 2.687   17.645  23.352  1.00   53.15  ? 471  ILE A CB  1 
ATOM   3659 C CG1 . ILE A 1 471 ? 1.863   18.258  24.490  1.00   53.82  ? 471  ILE A CG1 1 
ATOM   3660 C CG2 . ILE A 1 471 ? 2.119   16.303  22.912  1.00   51.89  ? 471  ILE A CG2 1 
ATOM   3661 C CD1 . ILE A 1 471 ? 0.677   19.075  24.041  1.00   58.16  ? 471  ILE A CD1 1 
ATOM   3662 N N   . PHE A 1 472 ? 5.345   17.162  21.750  1.00   46.94  ? 472  PHE A N   1 
ATOM   3663 C CA  . PHE A 1 472 ? 6.181   16.457  20.786  1.00   45.86  ? 472  PHE A CA  1 
ATOM   3664 C C   . PHE A 1 472 ? 7.428   15.889  21.455  1.00   41.84  ? 472  PHE A C   1 
ATOM   3665 O O   . PHE A 1 472 ? 7.708   14.698  21.339  1.00   43.83  ? 472  PHE A O   1 
ATOM   3666 C CB  . PHE A 1 472 ? 6.559   17.396  19.649  1.00   45.52  ? 472  PHE A CB  1 
ATOM   3667 C CG  . PHE A 1 472 ? 7.392   16.760  18.584  1.00   43.05  ? 472  PHE A CG  1 
ATOM   3668 C CD1 . PHE A 1 472 ? 7.063   15.511  18.079  1.00   43.42  ? 472  PHE A CD1 1 
ATOM   3669 C CD2 . PHE A 1 472 ? 8.497   17.429  18.064  1.00   41.41  ? 472  PHE A CD2 1 
ATOM   3670 C CE1 . PHE A 1 472 ? 7.831   14.922  17.081  1.00   44.09  ? 472  PHE A CE1 1 
ATOM   3671 C CE2 . PHE A 1 472 ? 9.269   16.858  17.076  1.00   41.25  ? 472  PHE A CE2 1 
ATOM   3672 C CZ  . PHE A 1 472 ? 8.932   15.596  16.575  1.00   46.11  ? 472  PHE A CZ  1 
ATOM   3673 N N   . ALA A 1 473 ? 8.151   16.729  22.191  1.00   38.00  ? 473  ALA A N   1 
ATOM   3674 C CA  . ALA A 1 473 ? 9.387   16.287  22.845  1.00   41.94  ? 473  ALA A CA  1 
ATOM   3675 C C   . ALA A 1 473 ? 9.146   15.103  23.784  1.00   47.50  ? 473  ALA A C   1 
ATOM   3676 O O   . ALA A 1 473 ? 9.881   14.108  23.760  1.00   45.03  ? 473  ALA A O   1 
ATOM   3677 C CB  . ALA A 1 473 ? 10.048  17.431  23.576  1.00   38.84  ? 473  ALA A CB  1 
ATOM   3678 N N   . GLN A 1 474 ? 8.097   15.209  24.590  1.00   45.97  ? 474  GLN A N   1 
ATOM   3679 C CA  . GLN A 1 474 ? 7.687   14.118  25.463  1.00   44.49  ? 474  GLN A CA  1 
ATOM   3680 C C   . GLN A 1 474 ? 7.458   12.813  24.703  1.00   43.92  ? 474  GLN A C   1 
ATOM   3681 O O   . GLN A 1 474 ? 7.878   11.755  25.156  1.00   46.98  ? 474  GLN A O   1 
ATOM   3682 C CB  . GLN A 1 474 ? 6.439   14.520  26.250  1.00   45.18  ? 474  GLN A CB  1 
ATOM   3683 C CG  . GLN A 1 474 ? 6.727   15.507  27.361  1.00   50.00  ? 474  GLN A CG  1 
ATOM   3684 C CD  . GLN A 1 474 ? 5.477   16.153  27.912  1.00   58.91  ? 474  GLN A CD  1 
ATOM   3685 O OE1 . GLN A 1 474 ? 4.593   16.574  27.164  1.00   63.45  ? 474  GLN A OE1 1 
ATOM   3686 N NE2 . GLN A 1 474 ? 5.400   16.247  29.228  1.00   61.99  ? 474  GLN A NE2 1 
ATOM   3687 N N   . ARG A 1 475 ? 6.792   12.884  23.551  1.00   44.50  ? 475  ARG A N   1 
ATOM   3688 C CA  . ARG A 1 475 ? 6.604   11.693  22.723  1.00   48.92  ? 475  ARG A CA  1 
ATOM   3689 C C   . ARG A 1 475 ? 7.938   11.058  22.355  1.00   49.04  ? 475  ARG A C   1 
ATOM   3690 O O   . ARG A 1 475 ? 8.125   9.838   22.506  1.00   46.42  ? 475  ARG A O   1 
ATOM   3691 C CB  . ARG A 1 475 ? 5.855   12.016  21.425  1.00   51.88  ? 475  ARG A CB  1 
ATOM   3692 C CG  . ARG A 1 475 ? 4.370   12.185  21.562  1.00   52.73  ? 475  ARG A CG  1 
ATOM   3693 C CD  . ARG A 1 475 ? 3.747   12.545  20.216  1.00   50.97  ? 475  ARG A CD  1 
ATOM   3694 N NE  . ARG A 1 475 ? 4.162   11.599  19.190  1.00   47.78  ? 475  ARG A NE  1 
ATOM   3695 C CZ  . ARG A 1 475 ? 4.294   11.897  17.902  1.00   43.24  ? 475  ARG A CZ  1 
ATOM   3696 N NH1 . ARG A 1 475 ? 4.037   13.125  17.468  1.00   41.52  ? 475  ARG A NH1 1 
ATOM   3697 N NH2 . ARG A 1 475 ? 4.697   10.962  17.049  1.00   41.85  ? 475  ARG A NH2 1 
ATOM   3698 N N   . LEU A 1 476 ? 8.855   11.878  21.840  1.00   46.56  ? 476  LEU A N   1 
ATOM   3699 C CA  . LEU A 1 476 ? 10.146  11.360  21.385  1.00   39.31  ? 476  LEU A CA  1 
ATOM   3700 C C   . LEU A 1 476 ? 10.914  10.801  22.563  1.00   40.77  ? 476  LEU A C   1 
ATOM   3701 O O   . LEU A 1 476 ? 11.538  9.745   22.449  1.00   46.15  ? 476  LEU A O   1 
ATOM   3702 C CB  . LEU A 1 476 ? 10.964  12.427  20.654  1.00   46.69  ? 476  LEU A CB  1 
ATOM   3703 C CG  . LEU A 1 476 ? 10.288  13.051  19.429  1.00   43.50  ? 476  LEU A CG  1 
ATOM   3704 C CD1 . LEU A 1 476 ? 11.104  14.210  18.901  1.00   44.26  ? 476  LEU A CD1 1 
ATOM   3705 C CD2 . LEU A 1 476 ? 10.093  12.004  18.362  1.00   39.77  ? 476  LEU A CD2 1 
ATOM   3706 N N   . MET A 1 477 ? 10.862  11.492  23.702  1.00   38.64  ? 477  MET A N   1 
ATOM   3707 C CA  . MET A 1 477 ? 11.506  10.963  24.905  1.00   44.84  ? 477  MET A CA  1 
ATOM   3708 C C   . MET A 1 477 ? 10.956  9.562   25.211  1.00   48.09  ? 477  MET A C   1 
ATOM   3709 O O   . MET A 1 477 ? 11.718  8.644   25.523  1.00   40.46  ? 477  MET A O   1 
ATOM   3710 C CB  . MET A 1 477 ? 11.326  11.896  26.105  1.00   46.09  ? 477  MET A CB  1 
ATOM   3711 C CG  . MET A 1 477 ? 12.123  13.178  26.014  1.00   41.99  ? 477  MET A CG  1 
ATOM   3712 S SD  . MET A 1 477 ? 11.695  14.381  27.292  1.00   47.72  ? 477  MET A SD  1 
ATOM   3713 C CE  . MET A 1 477 ? 12.483  13.686  28.720  1.00   40.88  ? 477  MET A CE  1 
ATOM   3714 N N   . LYS A 1 478 ? 9.638   9.401   25.098  1.00   46.22  ? 478  LYS A N   1 
ATOM   3715 C CA  . LYS A 1 478 ? 9.013   8.090   25.276  1.00   48.77  ? 478  LYS A CA  1 
ATOM   3716 C C   . LYS A 1 478 ? 9.556   7.045   24.295  1.00   43.83  ? 478  LYS A C   1 
ATOM   3717 O O   . LYS A 1 478 ? 9.879   5.921   24.706  1.00   44.51  ? 478  LYS A O   1 
ATOM   3718 C CB  . LYS A 1 478 ? 7.486   8.179   25.156  1.00   48.61  ? 478  LYS A CB  1 
ATOM   3719 C CG  . LYS A 1 478 ? 6.773   8.655   26.401  1.00   57.15  ? 478  LYS A CG  1 
ATOM   3720 C CD  . LYS A 1 478 ? 6.839   7.606   27.502  1.00   66.70  ? 478  LYS A CD  1 
ATOM   3721 C CE  . LYS A 1 478 ? 5.918   7.961   28.663  1.00   72.79  ? 478  LYS A CE  1 
ATOM   3722 N NZ  . LYS A 1 478 ? 6.344   9.175   29.434  1.00   68.33  ? 478  LYS A NZ  1 
ATOM   3723 N N   . TYR A 1 479 ? 9.659   7.397   23.010  1.00   39.82  ? 479  TYR A N   1 
ATOM   3724 C CA  . TYR A 1 479 ? 10.147  6.424   22.013  1.00   43.08  ? 479  TYR A CA  1 
ATOM   3725 C C   . TYR A 1 479 ? 11.547  5.945   22.350  1.00   42.13  ? 479  TYR A C   1 
ATOM   3726 O O   . TYR A 1 479 ? 11.825  4.748   22.336  1.00   39.68  ? 479  TYR A O   1 
ATOM   3727 C CB  . TYR A 1 479 ? 10.182  7.001   20.595  1.00   38.94  ? 479  TYR A CB  1 
ATOM   3728 C CG  . TYR A 1 479 ? 8.839   7.315   19.992  1.00   43.33  ? 479  TYR A CG  1 
ATOM   3729 C CD1 . TYR A 1 479 ? 7.780   6.414   20.077  1.00   37.77  ? 479  TYR A CD1 1 
ATOM   3730 C CD2 . TYR A 1 479 ? 8.639   8.501   19.304  1.00   43.77  ? 479  TYR A CD2 1 
ATOM   3731 C CE1 . TYR A 1 479 ? 6.547   6.709   19.505  1.00   42.35  ? 479  TYR A CE1 1 
ATOM   3732 C CE2 . TYR A 1 479 ? 7.416   8.805   18.727  1.00   46.66  ? 479  TYR A CE2 1 
ATOM   3733 C CZ  . TYR A 1 479 ? 6.372   7.913   18.830  1.00   51.03  ? 479  TYR A CZ  1 
ATOM   3734 O OH  . TYR A 1 479 ? 5.155   8.237   18.256  1.00   46.80  ? 479  TYR A OH  1 
ATOM   3735 N N   . TRP A 1 480 ? 12.428  6.903   22.624  1.00   38.95  ? 480  TRP A N   1 
ATOM   3736 C CA  . TRP A 1 480 ? 13.823  6.611   22.869  1.00   41.41  ? 480  TRP A CA  1 
ATOM   3737 C C   . TRP A 1 480 ? 13.974  5.758   24.130  1.00   46.14  ? 480  TRP A C   1 
ATOM   3738 O O   . TRP A 1 480 ? 14.657  4.721   24.114  1.00   42.85  ? 480  TRP A O   1 
ATOM   3739 C CB  . TRP A 1 480 ? 14.637  7.911   22.961  1.00   39.15  ? 480  TRP A CB  1 
ATOM   3740 C CG  . TRP A 1 480 ? 15.390  8.297   21.692  1.00   42.31  ? 480  TRP A CG  1 
ATOM   3741 C CD1 . TRP A 1 480 ? 16.749  8.454   21.553  1.00   40.17  ? 480  TRP A CD1 1 
ATOM   3742 C CD2 . TRP A 1 480 ? 14.827  8.573   20.398  1.00   44.26  ? 480  TRP A CD2 1 
ATOM   3743 N NE1 . TRP A 1 480 ? 17.058  8.807   20.260  1.00   37.91  ? 480  TRP A NE1 1 
ATOM   3744 C CE2 . TRP A 1 480 ? 15.898  8.883   19.532  1.00   35.40  ? 480  TRP A CE2 1 
ATOM   3745 C CE3 . TRP A 1 480 ? 13.522  8.575   19.886  1.00   43.77  ? 480  TRP A CE3 1 
ATOM   3746 C CZ2 . TRP A 1 480 ? 15.701  9.202   18.194  1.00   34.20  ? 480  TRP A CZ2 1 
ATOM   3747 C CZ3 . TRP A 1 480 ? 13.334  8.890   18.564  1.00   38.27  ? 480  TRP A CZ3 1 
ATOM   3748 C CH2 . TRP A 1 480 ? 14.417  9.200   17.729  1.00   37.99  ? 480  TRP A CH2 1 
ATOM   3749 N N   . THR A 1 481 ? 13.327  6.175   25.216  1.00   39.45  ? 481  THR A N   1 
ATOM   3750 C CA  . THR A 1 481 ? 13.439  5.428   26.463  1.00   42.45  ? 481  THR A CA  1 
ATOM   3751 C C   . THR A 1 481 ? 12.723  4.075   26.425  1.00   44.33  ? 481  THR A C   1 
ATOM   3752 O O   . THR A 1 481 ? 13.181  3.125   27.057  1.00   48.12  ? 481  THR A O   1 
ATOM   3753 C CB  . THR A 1 481 ? 13.020  6.245   27.691  1.00   44.24  ? 481  THR A CB  1 
ATOM   3754 O OG1 . THR A 1 481 ? 11.692  6.750   27.515  1.00   48.22  ? 481  THR A OG1 1 
ATOM   3755 C CG2 . THR A 1 481 ? 13.974  7.405   27.883  1.00   47.92  ? 481  THR A CG2 1 
ATOM   3756 N N   . ASN A 1 482 ? 11.627  3.971   25.677  1.00   41.20  ? 482  ASN A N   1 
ATOM   3757 C CA  . ASN A 1 482 ? 11.015  2.656   25.451  1.00   42.33  ? 482  ASN A CA  1 
ATOM   3758 C C   . ASN A 1 482 ? 11.961  1.734   24.716  1.00   43.87  ? 482  ASN A C   1 
ATOM   3759 O O   . ASN A 1 482 ? 12.126  0.565   25.085  1.00   44.36  ? 482  ASN A O   1 
ATOM   3760 C CB  . ASN A 1 482 ? 9.704   2.761   24.678  1.00   45.73  ? 482  ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 482 ? 8.561   3.185   25.550  1.00   46.27  ? 482  ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 482 ? 8.653   3.144   26.780  1.00   48.46  ? 482  ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 482 ? 7.477   3.605   24.930  1.00   49.01  ? 482  ASN A ND2 1 
ATOM   3764 N N   . PHE A 1 483 ? 12.590  2.262   23.671  1.00   42.51  ? 483  PHE A N   1 
ATOM   3765 C CA  . PHE A 1 483 ? 13.540  1.469   22.910  1.00   43.79  ? 483  PHE A CA  1 
ATOM   3766 C C   . PHE A 1 483 ? 14.754  1.053   23.761  1.00   46.13  ? 483  PHE A C   1 
ATOM   3767 O O   . PHE A 1 483 ? 15.260  -0.072  23.630  1.00   50.86  ? 483  PHE A O   1 
ATOM   3768 C CB  . PHE A 1 483 ? 13.984  2.195   21.639  1.00   42.70  ? 483  PHE A CB  1 
ATOM   3769 C CG  . PHE A 1 483 ? 15.132  1.529   20.957  1.00   41.65  ? 483  PHE A CG  1 
ATOM   3770 C CD1 . PHE A 1 483 ? 14.918  0.439   20.117  1.00   41.92  ? 483  PHE A CD1 1 
ATOM   3771 C CD2 . PHE A 1 483 ? 16.428  1.952   21.189  1.00   32.74  ? 483  PHE A CD2 1 
ATOM   3772 C CE1 . PHE A 1 483 ? 15.971  -0.198  19.497  1.00   38.24  ? 483  PHE A CE1 1 
ATOM   3773 C CE2 . PHE A 1 483 ? 17.496  1.310   20.578  1.00   40.48  ? 483  PHE A CE2 1 
ATOM   3774 C CZ  . PHE A 1 483 ? 17.263  0.240   19.719  1.00   43.11  ? 483  PHE A CZ  1 
ATOM   3775 N N   . ALA A 1 484 ? 15.226  1.948   24.625  1.00   43.17  ? 484  ALA A N   1 
ATOM   3776 C CA  . ALA A 1 484 ? 16.332  1.611   25.519  1.00   45.28  ? 484  ALA A CA  1 
ATOM   3777 C C   . ALA A 1 484 ? 15.881  0.536   26.493  1.00   49.04  ? 484  ALA A C   1 
ATOM   3778 O O   . ALA A 1 484 ? 16.613  -0.431  26.744  1.00   43.81  ? 484  ALA A O   1 
ATOM   3779 C CB  . ALA A 1 484 ? 16.826  2.836   26.282  1.00   33.52  ? 484  ALA A CB  1 
ATOM   3780 N N   . ARG A 1 485 ? 14.677  0.720   27.039  1.00   42.65  ? 485  ARG A N   1 
ATOM   3781 C CA  . ARG A 1 485 ? 14.109  -0.215  28.017  1.00   51.90  ? 485  ARG A CA  1 
ATOM   3782 C C   . ARG A 1 485 ? 13.880  -1.616  27.425  1.00   48.77  ? 485  ARG A C   1 
ATOM   3783 O O   . ARG A 1 485 ? 14.230  -2.613  28.047  1.00   48.57  ? 485  ARG A O   1 
ATOM   3784 C CB  . ARG A 1 485 ? 12.813  0.339   28.674  1.00   41.80  ? 485  ARG A CB  1 
ATOM   3785 C CG  . ARG A 1 485 ? 13.050  1.312   29.865  1.00   57.31  ? 485  ARG A CG  1 
ATOM   3786 C CD  . ARG A 1 485 ? 11.742  1.889   30.504  1.00   55.77  ? 485  ARG A CD  1 
ATOM   3787 N NE  . ARG A 1 485 ? 10.983  2.720   29.567  1.00   60.67  ? 485  ARG A NE  1 
ATOM   3788 C CZ  . ARG A 1 485 ? 10.791  4.037   29.677  1.00   62.80  ? 485  ARG A CZ  1 
ATOM   3789 N NH1 . ARG A 1 485 ? 11.266  4.721   30.717  1.00   53.20  ? 485  ARG A NH1 1 
ATOM   3790 N NH2 . ARG A 1 485 ? 10.094  4.676   28.737  1.00   60.00  ? 485  ARG A NH2 1 
ATOM   3791 N N   . THR A 1 486 ? 13.334  -1.687  26.214  1.00   46.45  ? 486  THR A N   1 
ATOM   3792 C CA  . THR A 1 486 ? 12.813  -2.951  25.689  1.00   44.20  ? 486  THR A CA  1 
ATOM   3793 C C   . THR A 1 486 ? 13.314  -3.330  24.306  1.00   49.01  ? 486  THR A C   1 
ATOM   3794 O O   . THR A 1 486 ? 13.108  -4.457  23.861  1.00   54.20  ? 486  THR A O   1 
ATOM   3795 C CB  . THR A 1 486 ? 11.281  -2.889  25.564  1.00   47.56  ? 486  THR A CB  1 
ATOM   3796 O OG1 . THR A 1 486 ? 10.937  -2.005  24.494  1.00   43.02  ? 486  THR A OG1 1 
ATOM   3797 C CG2 . THR A 1 486 ? 10.648  -2.376  26.850  1.00   36.88  ? 486  THR A CG2 1 
ATOM   3798 N N   . GLY A 1 487 ? 13.944  -2.390  23.609  1.00   49.93  ? 487  GLY A N   1 
ATOM   3799 C CA  . GLY A 1 487 ? 14.355  -2.624  22.234  1.00   50.09  ? 487  GLY A CA  1 
ATOM   3800 C C   . GLY A 1 487 ? 13.212  -2.420  21.259  1.00   48.25  ? 487  GLY A C   1 
ATOM   3801 O O   . GLY A 1 487 ? 13.277  -2.866  20.114  1.00   51.65  ? 487  GLY A O   1 
ATOM   3802 N N   . ASP A 1 488 ? 12.168  -1.736  21.725  1.00   48.34  ? 488  ASP A N   1 
ATOM   3803 C CA  . ASP A 1 488 ? 10.982  -1.444  20.930  1.00   47.07  ? 488  ASP A CA  1 
ATOM   3804 C C   . ASP A 1 488 ? 10.522  -0.033  21.277  1.00   46.38  ? 488  ASP A C   1 
ATOM   3805 O O   . ASP A 1 488 ? 10.188  0.227   22.419  1.00   47.97  ? 488  ASP A O   1 
ATOM   3806 C CB  . ASP A 1 488 ? 9.878   -2.442  21.281  1.00   49.72  ? 488  ASP A CB  1 
ATOM   3807 C CG  . ASP A 1 488 ? 8.668   -2.359  20.345  1.00   56.22  ? 488  ASP A CG  1 
ATOM   3808 O OD1 . ASP A 1 488 ? 8.425   -1.294  19.731  1.00   53.28  ? 488  ASP A OD1 1 
ATOM   3809 O OD2 . ASP A 1 488 ? 7.942   -3.374  20.234  1.00   56.54  ? 488  ASP A OD2 1 
ATOM   3810 N N   . PRO A 1 489 ? 10.492  0.881   20.290  1.00   49.33  ? 489  PRO A N   1 
ATOM   3811 C CA  . PRO A 1 489 ? 10.090  2.260   20.599  1.00   45.39  ? 489  PRO A CA  1 
ATOM   3812 C C   . PRO A 1 489 ? 8.643   2.331   21.057  1.00   47.26  ? 489  PRO A C   1 
ATOM   3813 O O   . PRO A 1 489 ? 8.269   3.263   21.769  1.00   46.45  ? 489  PRO A O   1 
ATOM   3814 C CB  . PRO A 1 489 ? 10.207  2.988   19.253  1.00   44.49  ? 489  PRO A CB  1 
ATOM   3815 C CG  . PRO A 1 489 ? 10.746  1.982   18.269  1.00   48.75  ? 489  PRO A CG  1 
ATOM   3816 C CD  . PRO A 1 489 ? 10.572  0.629   18.841  1.00   46.57  ? 489  PRO A CD  1 
ATOM   3817 N N   . ASN A 1 490 ? 7.836   1.360   20.637  1.00   48.40  ? 490  ASN A N   1 
ATOM   3818 C CA  . ASN A 1 490 ? 6.392   1.402   20.858  1.00   51.95  ? 490  ASN A CA  1 
ATOM   3819 C C   . ASN A 1 490 ? 6.004   1.257   22.330  1.00   54.56  ? 490  ASN A C   1 
ATOM   3820 O O   . ASN A 1 490 ? 6.680   0.578   23.103  1.00   52.95  ? 490  ASN A O   1 
ATOM   3821 C CB  . ASN A 1 490 ? 5.691   0.320   20.021  1.00   49.77  ? 490  ASN A CB  1 
ATOM   3822 C CG  . ASN A 1 490 ? 5.864   0.525   18.523  1.00   46.67  ? 490  ASN A CG  1 
ATOM   3823 O OD1 . ASN A 1 490 ? 5.254   1.413   17.930  1.00   50.57  ? 490  ASN A OD1 1 
ATOM   3824 N ND2 . ASN A 1 490 ? 6.688   -0.307  17.903  1.00   45.63  ? 490  ASN A ND2 1 
ATOM   3825 N N   . ASP A 1 491 ? 4.913   1.908   22.715  1.00   62.73  ? 491  ASP A N   1 
ATOM   3826 C CA  . ASP A 1 491 ? 4.366   1.754   24.060  1.00   68.43  ? 491  ASP A CA  1 
ATOM   3827 C C   . ASP A 1 491 ? 3.290   0.666   24.062  1.00   73.98  ? 491  ASP A C   1 
ATOM   3828 O O   . ASP A 1 491 ? 2.357   0.712   23.261  1.00   78.41  ? 491  ASP A O   1 
ATOM   3829 C CB  . ASP A 1 491 ? 3.784   3.083   24.547  1.00   78.39  ? 491  ASP A CB  1 
ATOM   3830 C CG  . ASP A 1 491 ? 3.378   3.048   26.014  1.00   86.38  ? 491  ASP A CG  1 
ATOM   3831 O OD1 . ASP A 1 491 ? 3.069   1.948   26.532  1.00   84.72  ? 491  ASP A OD1 1 
ATOM   3832 O OD2 . ASP A 1 491 ? 3.372   4.128   26.648  1.00   80.20  ? 491  ASP A OD2 1 
ATOM   3833 N N   . PRO A 1 492 ? 3.432   -0.333  24.946  1.00   80.15  ? 492  PRO A N   1 
ATOM   3834 C CA  . PRO A 1 492 ? 2.440   -1.415  25.080  1.00   87.72  ? 492  PRO A CA  1 
ATOM   3835 C C   . PRO A 1 492 ? 1.034   -0.917  25.443  1.00   81.87  ? 492  PRO A C   1 
ATOM   3836 O O   . PRO A 1 492 ? 0.849   -0.282  26.483  1.00   79.46  ? 492  PRO A O   1 
ATOM   3837 C CB  . PRO A 1 492 ? 3.009   -2.273  26.213  1.00   78.46  ? 492  PRO A CB  1 
ATOM   3838 C CG  . PRO A 1 492 ? 4.491   -2.031  26.151  1.00   80.00  ? 492  PRO A CG  1 
ATOM   3839 C CD  . PRO A 1 492 ? 4.646   -0.589  25.743  1.00   79.22  ? 492  PRO A CD  1 
ATOM   3840 N N   . SER A 1 497 ? -2.734  4.699   19.667  1.00   83.87  ? 497  SER A N   1 
ATOM   3841 C CA  . SER A 1 497 ? -1.468  5.219   19.153  1.00   80.80  ? 497  SER A CA  1 
ATOM   3842 C C   . SER A 1 497 ? -0.984  4.379   17.973  1.00   77.26  ? 497  SER A C   1 
ATOM   3843 O O   . SER A 1 497 ? -0.867  3.155   18.083  1.00   78.07  ? 497  SER A O   1 
ATOM   3844 C CB  . SER A 1 497 ? -0.395  5.230   20.250  1.00   84.86  ? 497  SER A CB  1 
ATOM   3845 O OG  . SER A 1 497 ? -0.902  5.716   21.484  1.00   96.59  ? 497  SER A OG  1 
ATOM   3846 N N   . PRO A 1 498 ? -0.699  5.033   16.836  1.00   71.26  ? 498  PRO A N   1 
ATOM   3847 C CA  . PRO A 1 498 ? -0.202  4.299   15.663  1.00   68.68  ? 498  PRO A CA  1 
ATOM   3848 C C   . PRO A 1 498 ? 1.125   3.610   15.984  1.00   62.72  ? 498  PRO A C   1 
ATOM   3849 O O   . PRO A 1 498 ? 1.875   4.103   16.828  1.00   66.11  ? 498  PRO A O   1 
ATOM   3850 C CB  . PRO A 1 498 ? -0.008  5.396   14.607  1.00   62.99  ? 498  PRO A CB  1 
ATOM   3851 C CG  . PRO A 1 498 ? -0.834  6.569   15.096  1.00   64.79  ? 498  PRO A CG  1 
ATOM   3852 C CD  . PRO A 1 498 ? -0.811  6.482   16.592  1.00   64.69  ? 498  PRO A CD  1 
ATOM   3853 N N   . GLN A 1 499 ? 1.403   2.487   15.329  1.00   60.33  ? 499  GLN A N   1 
ATOM   3854 C CA  . GLN A 1 499 ? 2.585   1.683   15.642  1.00   61.02  ? 499  GLN A CA  1 
ATOM   3855 C C   . GLN A 1 499 ? 3.792   2.000   14.770  1.00   58.28  ? 499  GLN A C   1 
ATOM   3856 O O   . GLN A 1 499 ? 3.663   2.436   13.631  1.00   56.54  ? 499  GLN A O   1 
ATOM   3857 C CB  . GLN A 1 499 ? 2.267   0.194   15.519  1.00   57.17  ? 499  GLN A CB  1 
ATOM   3858 C CG  . GLN A 1 499 ? 1.289   -0.298  16.552  1.00   67.96  ? 499  GLN A CG  1 
ATOM   3859 C CD  . GLN A 1 499 ? 1.881   -0.299  17.945  1.00   66.33  ? 499  GLN A CD  1 
ATOM   3860 O OE1 . GLN A 1 499 ? 1.516   0.528   18.788  1.00   64.49  ? 499  GLN A OE1 1 
ATOM   3861 N NE2 . GLN A 1 499 ? 2.809   -1.226  18.194  1.00   56.35  ? 499  GLN A NE2 1 
ATOM   3862 N N   . TRP A 1 500 ? 4.970   1.757   15.321  1.00   56.00  ? 500  TRP A N   1 
ATOM   3863 C CA  . TRP A 1 500 ? 6.218   1.943   14.606  1.00   49.29  ? 500  TRP A CA  1 
ATOM   3864 C C   . TRP A 1 500 ? 6.695   0.540   14.235  1.00   49.69  ? 500  TRP A C   1 
ATOM   3865 O O   . TRP A 1 500 ? 7.159   -0.213  15.091  1.00   51.20  ? 500  TRP A O   1 
ATOM   3866 C CB  . TRP A 1 500 ? 7.209   2.664   15.531  1.00   50.28  ? 500  TRP A CB  1 
ATOM   3867 C CG  . TRP A 1 500 ? 8.532   3.124   14.944  1.00   51.49  ? 500  TRP A CG  1 
ATOM   3868 C CD1 . TRP A 1 500 ? 9.210   2.585   13.882  1.00   46.65  ? 500  TRP A CD1 1 
ATOM   3869 C CD2 . TRP A 1 500 ? 9.362   4.183   15.454  1.00   46.75  ? 500  TRP A CD2 1 
ATOM   3870 N NE1 . TRP A 1 500 ? 10.394  3.266   13.683  1.00   49.96  ? 500  TRP A NE1 1 
ATOM   3871 C CE2 . TRP A 1 500 ? 10.509  4.249   14.634  1.00   44.45  ? 500  TRP A CE2 1 
ATOM   3872 C CE3 . TRP A 1 500 ? 9.236   5.090   16.516  1.00   38.82  ? 500  TRP A CE3 1 
ATOM   3873 C CZ2 . TRP A 1 500 ? 11.526  5.183   14.845  1.00   43.44  ? 500  TRP A CZ2 1 
ATOM   3874 C CZ3 . TRP A 1 500 ? 10.249  6.031   16.717  1.00   42.11  ? 500  TRP A CZ3 1 
ATOM   3875 C CH2 . TRP A 1 500 ? 11.376  6.065   15.889  1.00   43.58  ? 500  TRP A CH2 1 
ATOM   3876 N N   . PRO A 1 501 ? 6.552   0.171   12.955  1.00   49.91  ? 501  PRO A N   1 
ATOM   3877 C CA  . PRO A 1 501 ? 6.970   -1.147  12.478  1.00   47.60  ? 501  PRO A CA  1 
ATOM   3878 C C   . PRO A 1 501 ? 8.464   -1.174  12.331  1.00   46.92  ? 501  PRO A C   1 
ATOM   3879 O O   . PRO A 1 501 ? 9.043   -0.137  12.044  1.00   49.30  ? 501  PRO A O   1 
ATOM   3880 C CB  . PRO A 1 501 ? 6.372   -1.223  11.070  1.00   47.53  ? 501  PRO A CB  1 
ATOM   3881 C CG  . PRO A 1 501 ? 5.597   0.036   10.868  1.00   49.89  ? 501  PRO A CG  1 
ATOM   3882 C CD  . PRO A 1 501 ? 6.062   1.021   11.862  1.00   51.96  ? 501  PRO A CD  1 
ATOM   3883 N N   . PRO A 1 502 ? 9.082   -2.343  12.504  1.00   45.95  ? 502  PRO A N   1 
ATOM   3884 C CA  . PRO A 1 502 ? 10.495  -2.498  12.162  1.00   47.83  ? 502  PRO A CA  1 
ATOM   3885 C C   . PRO A 1 502 ? 10.742  -2.196  10.691  1.00   52.44  ? 502  PRO A C   1 
ATOM   3886 O O   . PRO A 1 502 ? 9.828   -2.315  9.877   1.00   50.13  ? 502  PRO A O   1 
ATOM   3887 C CB  . PRO A 1 502 ? 10.748  -3.979  12.424  1.00   43.02  ? 502  PRO A CB  1 
ATOM   3888 C CG  . PRO A 1 502 ? 9.794   -4.315  13.526  1.00   46.47  ? 502  PRO A CG  1 
ATOM   3889 C CD  . PRO A 1 502 ? 8.558   -3.512  13.227  1.00   51.50  ? 502  PRO A CD  1 
ATOM   3890 N N   . TYR A 1 503 ? 11.967  -1.798  10.367  1.00   46.77  ? 503  TYR A N   1 
ATOM   3891 C CA  . TYR A 1 503 ? 12.379  -1.642  8.990   1.00   46.58  ? 503  TYR A CA  1 
ATOM   3892 C C   . TYR A 1 503 ? 12.798  -3.012  8.463   1.00   48.40  ? 503  TYR A C   1 
ATOM   3893 O O   . TYR A 1 503 ? 13.503  -3.750  9.142   1.00   47.70  ? 503  TYR A O   1 
ATOM   3894 C CB  . TYR A 1 503 ? 13.544  -0.654  8.908   1.00   43.60  ? 503  TYR A CB  1 
ATOM   3895 C CG  . TYR A 1 503 ? 14.101  -0.475  7.511   1.00   44.04  ? 503  TYR A CG  1 
ATOM   3896 C CD1 . TYR A 1 503 ? 13.577  0.481   6.654   1.00   42.57  ? 503  TYR A CD1 1 
ATOM   3897 C CD2 . TYR A 1 503 ? 15.152  -1.260  7.054   1.00   44.68  ? 503  TYR A CD2 1 
ATOM   3898 C CE1 . TYR A 1 503 ? 14.081  0.650   5.385   1.00   48.85  ? 503  TYR A CE1 1 
ATOM   3899 C CE2 . TYR A 1 503 ? 15.662  -1.095  5.785   1.00   46.12  ? 503  TYR A CE2 1 
ATOM   3900 C CZ  . TYR A 1 503 ? 15.120  -0.140  4.953   1.00   47.32  ? 503  TYR A CZ  1 
ATOM   3901 O OH  . TYR A 1 503 ? 15.616  0.033   3.681   1.00   53.28  ? 503  TYR A OH  1 
ATOM   3902 N N   . THR A 1 504 ? 12.350  -3.363  7.262   1.00   49.02  ? 504  THR A N   1 
ATOM   3903 C CA  . THR A 1 504 ? 12.729  -4.644  6.660   1.00   55.05  ? 504  THR A CA  1 
ATOM   3904 C C   . THR A 1 504 ? 13.118  -4.483  5.197   1.00   48.67  ? 504  THR A C   1 
ATOM   3905 O O   . THR A 1 504 ? 12.696  -3.544  4.531   1.00   49.95  ? 504  THR A O   1 
ATOM   3906 C CB  . THR A 1 504 ? 11.593  -5.698  6.754   1.00   50.37  ? 504  THR A CB  1 
ATOM   3907 O OG1 . THR A 1 504 ? 10.509  -5.317  5.900   1.00   51.66  ? 504  THR A OG1 1 
ATOM   3908 C CG2 . THR A 1 504 ? 11.086  -5.832  8.189   1.00   41.59  ? 504  THR A CG2 1 
ATOM   3909 N N   . THR A 1 505 ? 13.932  -5.402  4.704   1.00   47.71  ? 505  THR A N   1 
ATOM   3910 C CA  . THR A 1 505 ? 14.330  -5.375  3.309   1.00   57.39  ? 505  THR A CA  1 
ATOM   3911 C C   . THR A 1 505 ? 13.106  -5.437  2.393   1.00   57.32  ? 505  THR A C   1 
ATOM   3912 O O   . THR A 1 505 ? 13.032  -4.714  1.399   1.00   54.41  ? 505  THR A O   1 
ATOM   3913 C CB  . THR A 1 505 ? 15.302  -6.517  2.994   1.00   62.95  ? 505  THR A CB  1 
ATOM   3914 O OG1 . THR A 1 505 ? 14.741  -7.755  3.440   1.00   65.44  ? 505  THR A OG1 1 
ATOM   3915 C CG2 . THR A 1 505 ? 16.622  -6.288  3.724   1.00   61.39  ? 505  THR A CG2 1 
ATOM   3916 N N   . ALA A 1 506 ? 12.132  -6.265  2.764   1.00   56.26  ? 506  ALA A N   1 
ATOM   3917 C CA  . ALA A 1 506 ? 10.936  -6.488  1.950   1.00   53.51  ? 506  ALA A CA  1 
ATOM   3918 C C   . ALA A 1 506 ? 9.938   -5.341  1.940   1.00   53.68  ? 506  ALA A C   1 
ATOM   3919 O O   . ALA A 1 506 ? 9.231   -5.154  0.954   1.00   64.52  ? 506  ALA A O   1 
ATOM   3920 C CB  . ALA A 1 506 ? 10.229  -7.762  2.389   1.00   54.94  ? 506  ALA A CB  1 
ATOM   3921 N N   . ALA A 1 507 ? 9.842   -4.594  3.034   1.00   48.94  ? 507  ALA A N   1 
ATOM   3922 C CA  . ALA A 1 507 ? 8.844   -3.527  3.106   1.00   56.25  ? 507  ALA A CA  1 
ATOM   3923 C C   . ALA A 1 507 ? 9.452   -2.141  3.289   1.00   54.39  ? 507  ALA A C   1 
ATOM   3924 O O   . ALA A 1 507 ? 8.795   -1.132  3.026   1.00   53.09  ? 507  ALA A O   1 
ATOM   3925 C CB  . ALA A 1 507 ? 7.826   -3.815  4.205   1.00   54.62  ? 507  ALA A CB  1 
ATOM   3926 N N   . GLN A 1 508 ? 10.694  -2.094  3.757   1.00   50.08  ? 508  GLN A N   1 
ATOM   3927 C CA  . GLN A 1 508 ? 11.414  -0.824  3.894   1.00   52.32  ? 508  GLN A CA  1 
ATOM   3928 C C   . GLN A 1 508 ? 10.595  0.259   4.595   1.00   46.74  ? 508  GLN A C   1 
ATOM   3929 O O   . GLN A 1 508 ? 10.542  1.406   4.148   1.00   49.49  ? 508  GLN A O   1 
ATOM   3930 C CB  . GLN A 1 508 ? 11.855  -0.317  2.522   1.00   45.95  ? 508  GLN A CB  1 
ATOM   3931 C CG  . GLN A 1 508 ? 12.589  -1.343  1.692   1.00   51.60  ? 508  GLN A CG  1 
ATOM   3932 C CD  . GLN A 1 508 ? 12.887  -0.843  0.287   1.00   60.87  ? 508  GLN A CD  1 
ATOM   3933 O OE1 . GLN A 1 508 ? 13.244  0.322   0.092   1.00   61.65  ? 508  GLN A OE1 1 
ATOM   3934 N NE2 . GLN A 1 508 ? 12.737  -1.721  -0.699  1.00   59.20  ? 508  GLN A NE2 1 
ATOM   3935 N N   . GLN A 1 509 ? 9.966   -0.104  5.702   1.00   47.15  ? 509  GLN A N   1 
ATOM   3936 C CA  . GLN A 1 509 ? 9.125   0.827   6.441   1.00   54.44  ? 509  GLN A CA  1 
ATOM   3937 C C   . GLN A 1 509 ? 9.873   1.702   7.448   1.00   46.74  ? 509  GLN A C   1 
ATOM   3938 O O   . GLN A 1 509 ? 10.752  1.223   8.157   1.00   45.28  ? 509  GLN A O   1 
ATOM   3939 C CB  . GLN A 1 509 ? 8.037   0.055   7.178   1.00   51.45  ? 509  GLN A CB  1 
ATOM   3940 C CG  . GLN A 1 509 ? 6.838   -0.274  6.327   1.00   58.32  ? 509  GLN A CG  1 
ATOM   3941 C CD  . GLN A 1 509 ? 5.954   -1.271  7.006   1.00   47.05  ? 509  GLN A CD  1 
ATOM   3942 O OE1 . GLN A 1 509 ? 6.370   -2.398  7.284   1.00   46.95  ? 509  GLN A OE1 1 
ATOM   3943 N NE2 . GLN A 1 509 ? 4.736   -0.861  7.311   1.00   51.02  ? 509  GLN A NE2 1 
ATOM   3944 N N   . TYR A 1 510 ? 9.483   2.973   7.521   1.00   40.69  ? 510  TYR A N   1 
ATOM   3945 C CA  . TYR A 1 510 ? 10.015  3.913   8.505   1.00   40.91  ? 510  TYR A CA  1 
ATOM   3946 C C   . TYR A 1 510 ? 8.915   4.904   8.862   1.00   44.29  ? 510  TYR A C   1 
ATOM   3947 O O   . TYR A 1 510 ? 7.912   4.996   8.163   1.00   49.90  ? 510  TYR A O   1 
ATOM   3948 C CB  . TYR A 1 510 ? 11.231  4.663   7.943   1.00   40.10  ? 510  TYR A CB  1 
ATOM   3949 C CG  . TYR A 1 510 ? 10.892  5.586   6.791   1.00   46.71  ? 510  TYR A CG  1 
ATOM   3950 C CD1 . TYR A 1 510 ? 10.670  5.080   5.510   1.00   43.41  ? 510  TYR A CD1 1 
ATOM   3951 C CD2 . TYR A 1 510 ? 10.766  6.960   6.987   1.00   46.50  ? 510  TYR A CD2 1 
ATOM   3952 C CE1 . TYR A 1 510 ? 10.340  5.914   4.462   1.00   45.55  ? 510  TYR A CE1 1 
ATOM   3953 C CE2 . TYR A 1 510 ? 10.434  7.804   5.938   1.00   45.57  ? 510  TYR A CE2 1 
ATOM   3954 C CZ  . TYR A 1 510 ? 10.229  7.275   4.678   1.00   50.50  ? 510  TYR A CZ  1 
ATOM   3955 O OH  . TYR A 1 510 ? 9.914   8.105   3.625   1.00   52.77  ? 510  TYR A OH  1 
ATOM   3956 N N   . VAL A 1 511 ? 9.084   5.653   9.942   1.00   45.29  ? 511  VAL A N   1 
ATOM   3957 C CA  . VAL A 1 511 ? 8.037   6.586   10.339  1.00   41.04  ? 511  VAL A CA  1 
ATOM   3958 C C   . VAL A 1 511 ? 8.473   8.042   10.232  1.00   41.88  ? 511  VAL A C   1 
ATOM   3959 O O   . VAL A 1 511 ? 9.658   8.349   10.252  1.00   42.47  ? 511  VAL A O   1 
ATOM   3960 C CB  . VAL A 1 511 ? 7.510   6.292   11.764  1.00   44.89  ? 511  VAL A CB  1 
ATOM   3961 C CG1 . VAL A 1 511 ? 6.870   4.918   11.808  1.00   43.77  ? 511  VAL A CG1 1 
ATOM   3962 C CG2 . VAL A 1 511 ? 8.626   6.406   12.813  1.00   43.27  ? 511  VAL A CG2 1 
ATOM   3963 N N   . SER A 1 512 ? 7.508   8.939   10.094  1.00   42.50  ? 512  SER A N   1 
ATOM   3964 C CA  . SER A 1 512 ? 7.802   10.357  10.170  1.00   45.63  ? 512  SER A CA  1 
ATOM   3965 C C   . SER A 1 512 ? 7.631   10.813  11.623  1.00   50.26  ? 512  SER A C   1 
ATOM   3966 O O   . SER A 1 512 ? 6.688   10.412  12.308  1.00   51.75  ? 512  SER A O   1 
ATOM   3967 C CB  . SER A 1 512 ? 6.894   11.164  9.230   1.00   47.35  ? 512  SER A CB  1 
ATOM   3968 O OG  . SER A 1 512 ? 5.519   10.932  9.511   1.00   51.13  ? 512  SER A OG  1 
ATOM   3969 N N   . LEU A 1 513 ? 8.564   11.629  12.093  1.00   46.49  ? 513  LEU A N   1 
ATOM   3970 C CA  . LEU A 1 513 ? 8.474   12.216  13.418  1.00   42.94  ? 513  LEU A CA  1 
ATOM   3971 C C   . LEU A 1 513 ? 8.184   13.706  13.282  1.00   44.17  ? 513  LEU A C   1 
ATOM   3972 O O   . LEU A 1 513 ? 9.050   14.485  12.867  1.00   46.32  ? 513  LEU A O   1 
ATOM   3973 C CB  . LEU A 1 513 ? 9.771   11.985  14.212  1.00   42.58  ? 513  LEU A CB  1 
ATOM   3974 C CG  . LEU A 1 513 ? 10.132  10.533  14.571  1.00   42.37  ? 513  LEU A CG  1 
ATOM   3975 C CD1 . LEU A 1 513 ? 11.415  10.454  15.387  1.00   31.55  ? 513  LEU A CD1 1 
ATOM   3976 C CD2 . LEU A 1 513 ? 9.001   9.884   15.334  1.00   40.13  ? 513  LEU A CD2 1 
ATOM   3977 N N   . ASN A 1 514 ? 6.955   14.096  13.605  1.00   41.60  ? 514  ASN A N   1 
ATOM   3978 C CA  . ASN A 1 514 ? 6.595   15.506  13.659  1.00   44.96  ? 514  ASN A CA  1 
ATOM   3979 C C   . ASN A 1 514 ? 5.431   15.734  14.616  1.00   42.83  ? 514  ASN A C   1 
ATOM   3980 O O   . ASN A 1 514 ? 5.091   14.854  15.398  1.00   49.92  ? 514  ASN A O   1 
ATOM   3981 C CB  . ASN A 1 514 ? 6.302   16.060  12.261  1.00   44.31  ? 514  ASN A CB  1 
ATOM   3982 C CG  . ASN A 1 514 ? 5.375   15.160  11.461  1.00   47.47  ? 514  ASN A CG  1 
ATOM   3983 O OD1 . ASN A 1 514 ? 4.309   14.771  11.940  1.00   45.55  ? 514  ASN A OD1 1 
ATOM   3984 N ND2 . ASN A 1 514 ? 5.780   14.822  10.240  1.00   43.82  ? 514  ASN A ND2 1 
ATOM   3985 N N   . LEU A 1 515 ? 4.835   16.919  14.568  1.00   49.63  ? 515  LEU A N   1 
ATOM   3986 C CA  . LEU A 1 515 ? 3.728   17.251  15.462  1.00   49.28  ? 515  LEU A CA  1 
ATOM   3987 C C   . LEU A 1 515 ? 2.505   16.362  15.215  1.00   45.16  ? 515  LEU A C   1 
ATOM   3988 O O   . LEU A 1 515 ? 1.660   16.205  16.088  1.00   49.60  ? 515  LEU A O   1 
ATOM   3989 C CB  . LEU A 1 515 ? 3.355   18.720  15.297  1.00   46.61  ? 515  LEU A CB  1 
ATOM   3990 C CG  . LEU A 1 515 ? 4.561   19.645  15.421  1.00   50.26  ? 515  LEU A CG  1 
ATOM   3991 C CD1 . LEU A 1 515 ? 4.162   21.097  15.231  1.00   39.69  ? 515  LEU A CD1 1 
ATOM   3992 C CD2 . LEU A 1 515 ? 5.221   19.435  16.779  1.00   41.27  ? 515  LEU A CD2 1 
ATOM   3993 N N   . LYS A 1 516 ? 2.420   15.793  14.017  1.00   51.23  ? 516  LYS A N   1 
ATOM   3994 C CA  . LYS A 1 516 ? 1.348   14.866  13.659  1.00   52.54  ? 516  LYS A CA  1 
ATOM   3995 C C   . LYS A 1 516 ? 1.661   13.463  14.176  1.00   50.66  ? 516  LYS A C   1 
ATOM   3996 O O   . LYS A 1 516 ? 2.820   13.113  14.378  1.00   48.62  ? 516  LYS A O   1 
ATOM   3997 C CB  . LYS A 1 516 ? 1.152   14.846  12.137  1.00   49.29  ? 516  LYS A CB  1 
ATOM   3998 C CG  . LYS A 1 516 ? 0.537   16.131  11.576  1.00   59.30  ? 516  LYS A CG  1 
ATOM   3999 C CD  . LYS A 1 516 ? 1.115   16.527  10.214  1.00   67.83  ? 516  LYS A CD  1 
ATOM   4000 C CE  . LYS A 1 516 ? 0.637   15.629  9.073   1.00   81.95  ? 516  LYS A CE  1 
ATOM   4001 N NZ  . LYS A 1 516 ? 0.910   16.237  7.716   1.00   78.16  ? 516  LYS A NZ  1 
ATOM   4002 N N   . PRO A 1 517 ? 0.624   12.653  14.401  1.00   53.26  ? 517  PRO A N   1 
ATOM   4003 C CA  . PRO A 1 517 ? 0.864   11.295  14.900  1.00   53.16  ? 517  PRO A CA  1 
ATOM   4004 C C   . PRO A 1 517 ? 1.719   10.493  13.929  1.00   51.78  ? 517  PRO A C   1 
ATOM   4005 O O   . PRO A 1 517 ? 1.715   10.792  12.736  1.00   55.94  ? 517  PRO A O   1 
ATOM   4006 C CB  . PRO A 1 517 ? -0.548  10.699  14.980  1.00   52.83  ? 517  PRO A CB  1 
ATOM   4007 C CG  . PRO A 1 517 ? -1.450  11.873  15.124  1.00   40.05  ? 517  PRO A CG  1 
ATOM   4008 C CD  . PRO A 1 517 ? -0.811  12.976  14.326  1.00   51.03  ? 517  PRO A CD  1 
ATOM   4009 N N   . LEU A 1 518 ? 2.431   9.489   14.432  1.00   50.60  ? 518  LEU A N   1 
ATOM   4010 C CA  . LEU A 1 518 ? 3.257   8.643   13.583  1.00   49.08  ? 518  LEU A CA  1 
ATOM   4011 C C   . LEU A 1 518 ? 2.578   8.280   12.270  1.00   53.75  ? 518  LEU A C   1 
ATOM   4012 O O   . LEU A 1 518 ? 1.484   7.722   12.255  1.00   56.15  ? 518  LEU A O   1 
ATOM   4013 C CB  . LEU A 1 518 ? 3.639   7.349   14.299  1.00   47.44  ? 518  LEU A CB  1 
ATOM   4014 C CG  . LEU A 1 518 ? 4.870   7.383   15.193  1.00   50.46  ? 518  LEU A CG  1 
ATOM   4015 C CD1 . LEU A 1 518 ? 5.512   6.014   15.216  1.00   51.38  ? 518  LEU A CD1 1 
ATOM   4016 C CD2 . LEU A 1 518 ? 5.844   8.409   14.691  1.00   48.18  ? 518  LEU A CD2 1 
ATOM   4017 N N   . GLU A 1 519 ? 3.244   8.578   11.166  1.00   52.33  ? 519  GLU A N   1 
ATOM   4018 C CA  . GLU A 1 519 ? 2.790   8.105   9.874   1.00   50.09  ? 519  GLU A CA  1 
ATOM   4019 C C   . GLU A 1 519 ? 3.857   7.185   9.273   1.00   49.28  ? 519  GLU A C   1 
ATOM   4020 O O   . GLU A 1 519 ? 5.050   7.470   9.360   1.00   51.61  ? 519  GLU A O   1 
ATOM   4021 C CB  . GLU A 1 519 ? 2.489   9.296   8.973   1.00   49.33  ? 519  GLU A CB  1 
ATOM   4022 C CG  . GLU A 1 519 ? 2.422   8.982   7.493   1.00   58.53  ? 519  GLU A CG  1 
ATOM   4023 C CD  . GLU A 1 519 ? 2.338   10.249  6.672   1.00   67.02  ? 519  GLU A CD  1 
ATOM   4024 O OE1 . GLU A 1 519 ? 1.737   11.232  7.171   1.00   75.48  ? 519  GLU A OE1 1 
ATOM   4025 O OE2 . GLU A 1 519 ? 2.880   10.269  5.545   1.00   64.69  ? 519  GLU A OE2 1 
ATOM   4026 N N   . VAL A 1 520 ? 3.430   6.074   8.683   1.00   45.04  ? 520  VAL A N   1 
ATOM   4027 C CA  . VAL A 1 520 ? 4.363   5.068   8.184   1.00   45.32  ? 520  VAL A CA  1 
ATOM   4028 C C   . VAL A 1 520 ? 4.626   5.238   6.692   1.00   52.36  ? 520  VAL A C   1 
ATOM   4029 O O   . VAL A 1 520 ? 3.694   5.454   5.912   1.00   49.54  ? 520  VAL A O   1 
ATOM   4030 C CB  . VAL A 1 520 ? 3.844   3.646   8.454   1.00   48.65  ? 520  VAL A CB  1 
ATOM   4031 C CG1 . VAL A 1 520 ? 4.692   2.605   7.720   1.00   46.53  ? 520  VAL A CG1 1 
ATOM   4032 C CG2 . VAL A 1 520 ? 3.812   3.372   9.950   1.00   40.87  ? 520  VAL A CG2 1 
ATOM   4033 N N   . ARG A 1 521 ? 5.898   5.151   6.303   1.00   43.92  ? 521  ARG A N   1 
ATOM   4034 C CA  . ARG A 1 521 ? 6.287   5.302   4.905   1.00   42.33  ? 521  ARG A CA  1 
ATOM   4035 C C   . ARG A 1 521 ? 7.214   4.183   4.456   1.00   43.74  ? 521  ARG A C   1 
ATOM   4036 O O   . ARG A 1 521 ? 7.760   3.433   5.273   1.00   44.51  ? 521  ARG A O   1 
ATOM   4037 C CB  . ARG A 1 521 ? 6.942   6.663   4.663   1.00   45.40  ? 521  ARG A CB  1 
ATOM   4038 C CG  . ARG A 1 521 ? 6.059   7.835   5.048   1.00   49.05  ? 521  ARG A CG  1 
ATOM   4039 C CD  . ARG A 1 521 ? 6.767   9.168   4.879   1.00   44.92  ? 521  ARG A CD  1 
ATOM   4040 N NE  . ARG A 1 521 ? 6.045   10.245  5.554   1.00   51.54  ? 521  ARG A NE  1 
ATOM   4041 C CZ  . ARG A 1 521 ? 6.540   11.461  5.776   1.00   48.49  ? 521  ARG A CZ  1 
ATOM   4042 N NH1 . ARG A 1 521 ? 7.762   11.767  5.373   1.00   44.86  ? 521  ARG A NH1 1 
ATOM   4043 N NH2 . ARG A 1 521 ? 5.813   12.373  6.405   1.00   45.56  ? 521  ARG A NH2 1 
ATOM   4044 N N   . ARG A 1 522 ? 7.401   4.082   3.147   1.00   40.80  ? 522  ARG A N   1 
ATOM   4045 C CA  . ARG A 1 522 ? 8.153   2.971   2.587   1.00   50.27  ? 522  ARG A CA  1 
ATOM   4046 C C   . ARG A 1 522 ? 9.245   3.470   1.663   1.00   48.68  ? 522  ARG A C   1 
ATOM   4047 O O   . ARG A 1 522 ? 9.027   4.363   0.843   1.00   51.55  ? 522  ARG A O   1 
ATOM   4048 C CB  . ARG A 1 522 ? 7.222   2.010   1.824   1.00   55.40  ? 522  ARG A CB  1 
ATOM   4049 C CG  . ARG A 1 522 ? 6.268   1.188   2.700   1.00   59.36  ? 522  ARG A CG  1 
ATOM   4050 C CD  . ARG A 1 522 ? 5.671   0.027   1.905   1.00   69.99  ? 522  ARG A CD  1 
ATOM   4051 N NE  . ARG A 1 522 ? 6.684   -0.601  1.052   1.00   85.46  ? 522  ARG A NE  1 
ATOM   4052 C CZ  . ARG A 1 522 ? 6.438   -1.513  0.110   1.00   84.12  ? 522  ARG A CZ  1 
ATOM   4053 N NH1 . ARG A 1 522 ? 5.197   -1.926  -0.116  1.00   88.23  ? 522  ARG A NH1 1 
ATOM   4054 N NH2 . ARG A 1 522 ? 7.441   -2.016  -0.608  1.00   71.01  ? 522  ARG A NH2 1 
ATOM   4055 N N   . GLY A 1 523 ? 10.422  2.876   1.789   1.00   47.30  ? 523  GLY A N   1 
ATOM   4056 C CA  . GLY A 1 523 ? 11.541  3.242   0.949   1.00   51.41  ? 523  GLY A CA  1 
ATOM   4057 C C   . GLY A 1 523 ? 12.216  4.509   1.426   1.00   52.30  ? 523  GLY A C   1 
ATOM   4058 O O   . GLY A 1 523 ? 11.652  5.601   1.347   1.00   52.34  ? 523  GLY A O   1 
ATOM   4059 N N   . LEU A 1 524 ? 13.434  4.347   1.930   1.00   52.55  ? 524  LEU A N   1 
ATOM   4060 C CA  . LEU A 1 524 ? 14.257  5.457   2.376   1.00   49.88  ? 524  LEU A CA  1 
ATOM   4061 C C   . LEU A 1 524 ? 15.029  6.003   1.180   1.00   47.94  ? 524  LEU A C   1 
ATOM   4062 O O   . LEU A 1 524 ? 16.139  5.547   0.900   1.00   47.69  ? 524  LEU A O   1 
ATOM   4063 C CB  . LEU A 1 524 ? 15.254  4.953   3.417   1.00   51.08  ? 524  LEU A CB  1 
ATOM   4064 C CG  . LEU A 1 524 ? 15.451  5.832   4.648   1.00   63.80  ? 524  LEU A CG  1 
ATOM   4065 C CD1 . LEU A 1 524 ? 14.946  7.252   4.377   1.00   58.61  ? 524  LEU A CD1 1 
ATOM   4066 C CD2 . LEU A 1 524 ? 14.726  5.218   5.836   1.00   50.38  ? 524  LEU A CD2 1 
ATOM   4067 N N   . ARG A 1 525 ? 14.452  6.965   0.470   1.00   39.25  ? 525  ARG A N   1 
ATOM   4068 C CA  . ARG A 1 525 ? 15.056  7.436   -0.778  1.00   46.15  ? 525  ARG A CA  1 
ATOM   4069 C C   . ARG A 1 525 ? 15.495  6.289   -1.664  1.00   45.69  ? 525  ARG A C   1 
ATOM   4070 O O   . ARG A 1 525 ? 16.590  6.335   -2.217  1.00   47.00  ? 525  ARG A O   1 
ATOM   4071 C CB  . ARG A 1 525 ? 16.302  8.246   -0.483  1.00   48.49  ? 525  ARG A CB  1 
ATOM   4072 C CG  . ARG A 1 525 ? 16.022  9.600   0.041   1.00   54.16  ? 525  ARG A CG  1 
ATOM   4073 C CD  . ARG A 1 525 ? 16.192  10.635  -1.018  1.00   47.11  ? 525  ARG A CD  1 
ATOM   4074 N NE  . ARG A 1 525 ? 16.666  11.848  -0.372  1.00   63.70  ? 525  ARG A NE  1 
ATOM   4075 C CZ  . ARG A 1 525 ? 15.934  12.569  0.468   1.00   59.52  ? 525  ARG A CZ  1 
ATOM   4076 N NH1 . ARG A 1 525 ? 14.689  12.198  0.736   1.00   57.60  ? 525  ARG A NH1 1 
ATOM   4077 N NH2 . ARG A 1 525 ? 16.446  13.660  1.029   1.00   61.44  ? 525  ARG A NH2 1 
ATOM   4078 N N   . ALA A 1 526 ? 14.658  5.266   -1.795  1.00   45.12  ? 526  ALA A N   1 
ATOM   4079 C CA  . ALA A 1 526 ? 15.078  4.026   -2.424  1.00   42.30  ? 526  ALA A CA  1 
ATOM   4080 C C   . ALA A 1 526 ? 15.728  4.259   -3.788  1.00   44.50  ? 526  ALA A C   1 
ATOM   4081 O O   . ALA A 1 526 ? 16.777  3.705   -4.082  1.00   42.19  ? 526  ALA A O   1 
ATOM   4082 C CB  . ALA A 1 526 ? 13.904  3.077   -2.546  1.00   49.31  ? 526  ALA A CB  1 
ATOM   4083 N N   . GLN A 1 527 ? 15.114  5.100   -4.608  1.00   41.38  ? 527  GLN A N   1 
ATOM   4084 C CA  . GLN A 1 527 ? 15.560  5.266   -5.979  1.00   45.08  ? 527  GLN A CA  1 
ATOM   4085 C C   . GLN A 1 527 ? 16.902  5.982   -6.036  1.00   45.83  ? 527  GLN A C   1 
ATOM   4086 O O   . GLN A 1 527 ? 17.865  5.477   -6.621  1.00   48.28  ? 527  GLN A O   1 
ATOM   4087 C CB  . GLN A 1 527 ? 14.485  6.000   -6.804  1.00   49.74  ? 527  GLN A CB  1 
ATOM   4088 C CG  . GLN A 1 527 ? 14.345  5.527   -8.255  1.00   54.54  ? 527  GLN A CG  1 
ATOM   4089 C CD  . GLN A 1 527 ? 14.136  4.016   -8.406  1.00   50.63  ? 527  GLN A CD  1 
ATOM   4090 O OE1 . GLN A 1 527 ? 13.591  3.347   -7.523  1.00   52.97  ? 527  GLN A OE1 1 
ATOM   4091 N NE2 . GLN A 1 527 ? 14.565  3.483   -9.538  1.00   49.76  ? 527  GLN A NE2 1 
ATOM   4092 N N   . THR A 1 528 ? 16.966  7.158   -5.423  1.00   44.59  ? 528  THR A N   1 
ATOM   4093 C CA  . THR A 1 528 ? 18.200  7.934   -5.396  1.00   40.70  ? 528  THR A CA  1 
ATOM   4094 C C   . THR A 1 528 ? 19.330  7.179   -4.686  1.00   44.15  ? 528  THR A C   1 
ATOM   4095 O O   . THR A 1 528 ? 20.480  7.221   -5.126  1.00   47.98  ? 528  THR A O   1 
ATOM   4096 C CB  . THR A 1 528 ? 17.980  9.307   -4.727  1.00   46.21  ? 528  THR A CB  1 
ATOM   4097 O OG1 . THR A 1 528 ? 17.240  10.161  -5.613  1.00   45.70  ? 528  THR A OG1 1 
ATOM   4098 C CG2 . THR A 1 528 ? 19.310  9.966   -4.393  1.00   44.49  ? 528  THR A CG2 1 
ATOM   4099 N N   . CYS A 1 529 ? 19.015  6.475   -3.601  1.00   36.62  ? 529  CYS A N   1 
ATOM   4100 C CA  . CYS A 1 529 ? 20.059  5.749   -2.877  1.00   46.64  ? 529  CYS A CA  1 
ATOM   4101 C C   . CYS A 1 529 ? 20.629  4.565   -3.671  1.00   45.74  ? 529  CYS A C   1 
ATOM   4102 O O   . CYS A 1 529 ? 21.782  4.167   -3.467  1.00   40.49  ? 529  CYS A O   1 
ATOM   4103 C CB  . CYS A 1 529 ? 19.604  5.347   -1.461  1.00   45.43  ? 529  CYS A CB  1 
ATOM   4104 S SG  . CYS A 1 529 ? 19.598  6.777   -0.288  1.00   46.32  ? 529  CYS A SG  1 
ATOM   4105 N N   . ALA A 1 530 ? 19.838  4.021   -4.591  1.00   35.29  ? 530  ALA A N   1 
ATOM   4106 C CA  . ALA A 1 530 ? 20.367  3.008   -5.497  1.00   45.29  ? 530  ALA A CA  1 
ATOM   4107 C C   . ALA A 1 530 ? 21.497  3.614   -6.317  1.00   46.37  ? 530  ALA A C   1 
ATOM   4108 O O   . ALA A 1 530 ? 22.492  2.954   -6.615  1.00   43.46  ? 530  ALA A O   1 
ATOM   4109 C CB  . ALA A 1 530 ? 19.274  2.465   -6.414  1.00   46.25  ? 530  ALA A CB  1 
ATOM   4110 N N   . PHE A 1 531 ? 21.329  4.879   -6.685  1.00   40.93  ? 531  PHE A N   1 
ATOM   4111 C CA  . PHE A 1 531 ? 22.347  5.567   -7.444  1.00   42.44  ? 531  PHE A CA  1 
ATOM   4112 C C   . PHE A 1 531 ? 23.637  5.681   -6.640  1.00   41.59  ? 531  PHE A C   1 
ATOM   4113 O O   . PHE A 1 531 ? 24.698  5.298   -7.119  1.00   44.21  ? 531  PHE A O   1 
ATOM   4114 C CB  . PHE A 1 531 ? 21.847  6.943   -7.894  1.00   41.52  ? 531  PHE A CB  1 
ATOM   4115 C CG  . PHE A 1 531 ? 22.945  7.882   -8.303  1.00   48.86  ? 531  PHE A CG  1 
ATOM   4116 C CD1 . PHE A 1 531 ? 23.594  7.726   -9.528  1.00   46.08  ? 531  PHE A CD1 1 
ATOM   4117 C CD2 . PHE A 1 531 ? 23.332  8.924   -7.466  1.00   38.58  ? 531  PHE A CD2 1 
ATOM   4118 C CE1 . PHE A 1 531 ? 24.603  8.588   -9.916  1.00   43.65  ? 531  PHE A CE1 1 
ATOM   4119 C CE2 . PHE A 1 531 ? 24.348  9.790   -7.846  1.00   44.68  ? 531  PHE A CE2 1 
ATOM   4120 C CZ  . PHE A 1 531 ? 24.990  9.621   -9.075  1.00   43.65  ? 531  PHE A CZ  1 
ATOM   4121 N N   . TRP A 1 532 ? 23.541  6.193   -5.417  1.00   42.53  ? 532  TRP A N   1 
ATOM   4122 C CA  . TRP A 1 532 ? 24.721  6.382   -4.564  1.00   45.87  ? 532  TRP A CA  1 
ATOM   4123 C C   . TRP A 1 532 ? 25.342  5.068   -4.111  1.00   46.07  ? 532  TRP A C   1 
ATOM   4124 O O   . TRP A 1 532 ? 26.572  4.913   -4.126  1.00   43.80  ? 532  TRP A O   1 
ATOM   4125 C CB  . TRP A 1 532 ? 24.381  7.218   -3.326  1.00   36.17  ? 532  TRP A CB  1 
ATOM   4126 C CG  . TRP A 1 532 ? 24.119  8.652   -3.630  1.00   36.43  ? 532  TRP A CG  1 
ATOM   4127 C CD1 . TRP A 1 532 ? 22.909  9.267   -3.686  1.00   38.35  ? 532  TRP A CD1 1 
ATOM   4128 C CD2 . TRP A 1 532 ? 25.096  9.654   -3.942  1.00   35.50  ? 532  TRP A CD2 1 
ATOM   4129 N NE1 . TRP A 1 532 ? 23.069  10.597  -4.003  1.00   35.99  ? 532  TRP A NE1 1 
ATOM   4130 C CE2 . TRP A 1 532 ? 24.403  10.857  -4.166  1.00   37.39  ? 532  TRP A CE2 1 
ATOM   4131 C CE3 . TRP A 1 532 ? 26.491  9.652   -4.046  1.00   37.74  ? 532  TRP A CE3 1 
ATOM   4132 C CZ2 . TRP A 1 532 ? 25.057  12.048  -4.494  1.00   38.96  ? 532  TRP A CZ2 1 
ATOM   4133 C CZ3 . TRP A 1 532 ? 27.138  10.837  -4.363  1.00   33.05  ? 532  TRP A CZ3 1 
ATOM   4134 C CH2 . TRP A 1 532 ? 26.419  12.015  -4.582  1.00   32.90  ? 532  TRP A CH2 1 
ATOM   4135 N N   . ASN A 1 533 ? 24.486  4.131   -3.711  1.00   42.38  ? 533  ASN A N   1 
ATOM   4136 C CA  . ASN A 1 533 ? 24.936  2.908   -3.047  1.00   47.39  ? 533  ASN A CA  1 
ATOM   4137 C C   . ASN A 1 533 ? 25.285  1.756   -3.991  1.00   46.44  ? 533  ASN A C   1 
ATOM   4138 O O   . ASN A 1 533 ? 26.128  0.930   -3.674  1.00   51.01  ? 533  ASN A O   1 
ATOM   4139 C CB  . ASN A 1 533 ? 23.897  2.442   -2.025  1.00   41.19  ? 533  ASN A CB  1 
ATOM   4140 C CG  . ASN A 1 533 ? 23.686  3.440   -0.907  1.00   40.22  ? 533  ASN A CG  1 
ATOM   4141 O OD1 . ASN A 1 533 ? 24.470  4.361   -0.728  1.00   43.50  ? 533  ASN A OD1 1 
ATOM   4142 N ND2 . ASN A 1 533 ? 22.609  3.266   -0.155  1.00   42.96  ? 533  ASN A ND2 1 
ATOM   4143 N N   . ARG A 1 534 ? 24.635  1.703   -5.146  1.00   43.55  ? 534  ARG A N   1 
ATOM   4144 C CA  . ARG A 1 534 ? 24.846  0.606   -6.077  1.00   45.63  ? 534  ARG A CA  1 
ATOM   4145 C C   . ARG A 1 534 ? 25.608  1.033   -7.321  1.00   49.08  ? 534  ARG A C   1 
ATOM   4146 O O   . ARG A 1 534 ? 26.551  0.368   -7.733  1.00   53.27  ? 534  ARG A O   1 
ATOM   4147 C CB  . ARG A 1 534 ? 23.516  -0.016  -6.474  1.00   44.69  ? 534  ARG A CB  1 
ATOM   4148 C CG  . ARG A 1 534 ? 22.749  -0.618  -5.313  1.00   47.46  ? 534  ARG A CG  1 
ATOM   4149 C CD  . ARG A 1 534 ? 21.353  -1.029  -5.731  1.00   44.12  ? 534  ARG A CD  1 
ATOM   4150 N NE  . ARG A 1 534 ? 20.569  -1.505  -4.600  1.00   50.37  ? 534  ARG A NE  1 
ATOM   4151 C CZ  . ARG A 1 534 ? 20.511  -2.775  -4.201  1.00   53.41  ? 534  ARG A CZ  1 
ATOM   4152 N NH1 . ARG A 1 534 ? 21.195  -3.716  -4.844  1.00   50.60  ? 534  ARG A NH1 1 
ATOM   4153 N NH2 . ARG A 1 534 ? 19.763  -3.106  -3.157  1.00   46.82  ? 534  ARG A NH2 1 
ATOM   4154 N N   . PHE A 1 535 ? 25.207  2.142   -7.923  1.00   46.43  ? 535  PHE A N   1 
ATOM   4155 C CA  . PHE A 1 535 ? 25.839  2.543   -9.169  1.00   47.05  ? 535  PHE A CA  1 
ATOM   4156 C C   . PHE A 1 535 ? 27.144  3.306   -8.976  1.00   49.48  ? 535  PHE A C   1 
ATOM   4157 O O   . PHE A 1 535 ? 28.164  2.933   -9.541  1.00   48.46  ? 535  PHE A O   1 
ATOM   4158 C CB  . PHE A 1 535 ? 24.897  3.356   -10.051 1.00   43.84  ? 535  PHE A CB  1 
ATOM   4159 C CG  . PHE A 1 535 ? 25.528  3.787   -11.328 1.00   49.34  ? 535  PHE A CG  1 
ATOM   4160 C CD1 . PHE A 1 535 ? 25.775  2.861   -12.335 1.00   50.31  ? 535  PHE A CD1 1 
ATOM   4161 C CD2 . PHE A 1 535 ? 25.925  5.101   -11.512 1.00   43.32  ? 535  PHE A CD2 1 
ATOM   4162 C CE1 . PHE A 1 535 ? 26.388  3.241   -13.510 1.00   45.45  ? 535  PHE A CE1 1 
ATOM   4163 C CE2 . PHE A 1 535 ? 26.530  5.489   -12.687 1.00   49.14  ? 535  PHE A CE2 1 
ATOM   4164 C CZ  . PHE A 1 535 ? 26.763  4.557   -13.688 1.00   50.44  ? 535  PHE A CZ  1 
ATOM   4165 N N   . LEU A 1 536 ? 27.112  4.373   -8.186  1.00   45.24  ? 536  LEU A N   1 
ATOM   4166 C CA  . LEU A 1 536 ? 28.289  5.223   -8.041  1.00   46.34  ? 536  LEU A CA  1 
ATOM   4167 C C   . LEU A 1 536 ? 29.579  4.445   -7.758  1.00   56.45  ? 536  LEU A C   1 
ATOM   4168 O O   . LEU A 1 536 ? 30.615  4.746   -8.348  1.00   59.83  ? 536  LEU A O   1 
ATOM   4169 C CB  . LEU A 1 536 ? 28.075  6.278   -6.962  1.00   50.68  ? 536  LEU A CB  1 
ATOM   4170 C CG  . LEU A 1 536 ? 28.757  7.641   -7.137  1.00   55.12  ? 536  LEU A CG  1 
ATOM   4171 C CD1 . LEU A 1 536 ? 29.100  8.214   -5.771  1.00   56.10  ? 536  LEU A CD1 1 
ATOM   4172 C CD2 . LEU A 1 536 ? 30.016  7.547   -7.987  1.00   65.63  ? 536  LEU A CD2 1 
ATOM   4173 N N   . PRO A 1 537 ? 29.533  3.449   -6.850  1.00   56.59  ? 537  PRO A N   1 
ATOM   4174 C CA  . PRO A 1 537 ? 30.774  2.720   -6.559  1.00   53.53  ? 537  PRO A CA  1 
ATOM   4175 C C   . PRO A 1 537 ? 31.371  2.142   -7.836  1.00   57.21  ? 537  PRO A C   1 
ATOM   4176 O O   . PRO A 1 537 ? 32.527  2.421   -8.150  1.00   67.85  ? 537  PRO A O   1 
ATOM   4177 C CB  . PRO A 1 537 ? 30.312  1.597   -5.634  1.00   46.09  ? 537  PRO A CB  1 
ATOM   4178 C CG  . PRO A 1 537 ? 29.071  2.115   -5.014  1.00   55.97  ? 537  PRO A CG  1 
ATOM   4179 C CD  . PRO A 1 537 ? 28.397  2.926   -6.074  1.00   53.28  ? 537  PRO A CD  1 
ATOM   4180 N N   . LYS A 1 538 ? 30.574  1.363   -8.563  1.00   62.28  ? 538  LYS A N   1 
ATOM   4181 C CA  . LYS A 1 538 ? 30.962  0.799   -9.864  1.00   60.90  ? 538  LYS A CA  1 
ATOM   4182 C C   . LYS A 1 538 ? 31.486  1.824   -10.870 1.00   62.54  ? 538  LYS A C   1 
ATOM   4183 O O   . LYS A 1 538 ? 32.418  1.548   -11.615 1.00   64.72  ? 538  LYS A O   1 
ATOM   4184 C CB  . LYS A 1 538 ? 29.789  0.023   -10.468 1.00   56.08  ? 538  LYS A CB  1 
ATOM   4185 C CG  . LYS A 1 538 ? 29.632  -1.363  -9.859  1.00   62.53  ? 538  LYS A CG  1 
ATOM   4186 C CD  . LYS A 1 538 ? 28.233  -1.903  -10.016 1.00   68.88  ? 538  LYS A CD  1 
ATOM   4187 C CE  . LYS A 1 538 ? 28.053  -3.157  -9.171  1.00   80.40  ? 538  LYS A CE  1 
ATOM   4188 N NZ  . LYS A 1 538 ? 29.006  -4.242  -9.568  1.00   82.72  ? 538  LYS A NZ  1 
ATOM   4189 N N   . LEU A 1 539 ? 30.897  3.013   -10.878 1.00   60.14  ? 539  LEU A N   1 
ATOM   4190 C CA  . LEU A 1 539 ? 31.305  4.047   -11.818 1.00   64.00  ? 539  LEU A CA  1 
ATOM   4191 C C   . LEU A 1 539 ? 32.699  4.586   -11.530 1.00   74.60  ? 539  LEU A C   1 
ATOM   4192 O O   . LEU A 1 539 ? 33.487  4.811   -12.448 1.00   81.07  ? 539  LEU A O   1 
ATOM   4193 C CB  . LEU A 1 539 ? 30.312  5.206   -11.813 1.00   60.98  ? 539  LEU A CB  1 
ATOM   4194 C CG  . LEU A 1 539 ? 30.749  6.369   -12.696 1.00   65.02  ? 539  LEU A CG  1 
ATOM   4195 C CD1 . LEU A 1 539 ? 31.076  5.825   -14.084 1.00   61.01  ? 539  LEU A CD1 1 
ATOM   4196 C CD2 . LEU A 1 539 ? 29.680  7.461   -12.758 1.00   53.80  ? 539  LEU A CD2 1 
ATOM   4197 N N   . LEU A 1 540 ? 32.998  4.802   -10.254 1.00   76.24  ? 540  LEU A N   1 
ATOM   4198 C CA  . LEU A 1 540 ? 34.262  5.423   -9.858  1.00   81.70  ? 540  LEU A CA  1 
ATOM   4199 C C   . LEU A 1 540 ? 35.519  4.640   -10.279 1.00   91.25  ? 540  LEU A C   1 
ATOM   4200 O O   . LEU A 1 540 ? 36.622  5.205   -10.329 1.00   88.05  ? 540  LEU A O   1 
ATOM   4201 C CB  . LEU A 1 540 ? 34.270  5.714   -8.356  1.00   78.94  ? 540  LEU A CB  1 
ATOM   4202 C CG  . LEU A 1 540 ? 33.584  7.036   -8.002  1.00   74.32  ? 540  LEU A CG  1 
ATOM   4203 C CD1 . LEU A 1 540 ? 33.325  7.134   -6.501  1.00   52.68  ? 540  LEU A CD1 1 
ATOM   4204 C CD2 . LEU A 1 540 ? 34.415  8.222   -8.513  1.00   58.24  ? 540  LEU A CD2 1 
ATOM   4205 N N   . SER A 1 541 ? 35.349  3.355   -10.592 1.00   87.85  ? 541  SER A N   1 
ATOM   4206 C CA  . SER A 1 541 ? 36.437  2.550   -11.155 1.00   85.57  ? 541  SER A CA  1 
ATOM   4207 C C   . SER A 1 541 ? 36.207  2.153   -12.631 1.00   88.17  ? 541  SER A C   1 
ATOM   4208 O O   . SER A 1 541 ? 35.762  1.036   -12.916 1.00   88.65  ? 541  SER A O   1 
ATOM   4209 C CB  . SER A 1 541 ? 36.676  1.308   -10.290 1.00   76.76  ? 541  SER A CB  1 
ATOM   4210 O OG  . SER A 1 541 ? 35.486  0.895   -9.644  1.00   73.59  ? 541  SER A OG  1 
ATOM   4211 N N   . ALA A 1 542 ? 36.512  3.059   -13.564 1.00   80.27  ? 542  ALA A N   1 
ATOM   4212 C CA  . ALA A 1 542 ? 37.028  4.389   -13.239 1.00   87.25  ? 542  ALA A CA  1 
ATOM   4213 C C   . ALA A 1 542 ? 36.431  5.464   -14.152 1.00   86.44  ? 542  ALA A C   1 
ATOM   4214 O O   . ALA A 1 542 ? 35.897  6.480   -13.685 1.00   83.62  ? 542  ALA A O   1 
ATOM   4215 C CB  . ALA A 1 542 ? 38.562  4.409   -13.304 1.00   74.04  ? 542  ALA A CB  1 
ATOM   4216 N N   . GLU B 1 4   ? -16.771 5.139   -69.539 1.00   87.66  ? 4    GLU B N   1 
ATOM   4217 C CA  . GLU B 1 4   ? -15.589 5.993   -69.428 1.00   87.70  ? 4    GLU B CA  1 
ATOM   4218 C C   . GLU B 1 4   ? -15.826 7.233   -68.551 1.00   85.38  ? 4    GLU B C   1 
ATOM   4219 O O   . GLU B 1 4   ? -15.983 8.347   -69.063 1.00   82.21  ? 4    GLU B O   1 
ATOM   4220 C CB  . GLU B 1 4   ? -15.103 6.416   -70.819 1.00   83.74  ? 4    GLU B CB  1 
ATOM   4221 N N   . ASP B 1 5   ? -15.842 7.032   -67.233 1.00   78.30  ? 5    ASP B N   1 
ATOM   4222 C CA  . ASP B 1 5   ? -16.004 8.127   -66.270 1.00   71.20  ? 5    ASP B CA  1 
ATOM   4223 C C   . ASP B 1 5   ? -14.864 9.146   -66.362 1.00   72.00  ? 5    ASP B C   1 
ATOM   4224 O O   . ASP B 1 5   ? -13.709 8.811   -66.119 1.00   72.75  ? 5    ASP B O   1 
ATOM   4225 C CB  . ASP B 1 5   ? -16.068 7.558   -64.852 1.00   65.83  ? 5    ASP B CB  1 
ATOM   4226 C CG  . ASP B 1 5   ? -16.513 8.583   -63.825 1.00   70.21  ? 5    ASP B CG  1 
ATOM   4227 O OD1 . ASP B 1 5   ? -16.285 9.799   -64.038 1.00   69.69  ? 5    ASP B OD1 1 
ATOM   4228 O OD2 . ASP B 1 5   ? -17.097 8.157   -62.802 1.00   58.89  ? 5    ASP B OD2 1 
ATOM   4229 N N   . PRO B 1 6   ? -15.188 10.399  -66.706 1.00   72.73  ? 6    PRO B N   1 
ATOM   4230 C CA  . PRO B 1 6   ? -14.179 11.448  -66.912 1.00   69.76  ? 6    PRO B CA  1 
ATOM   4231 C C   . PRO B 1 6   ? -13.428 11.794  -65.631 1.00   70.15  ? 6    PRO B C   1 
ATOM   4232 O O   . PRO B 1 6   ? -12.308 12.296  -65.703 1.00   68.77  ? 6    PRO B O   1 
ATOM   4233 C CB  . PRO B 1 6   ? -15.010 12.660  -67.354 1.00   73.86  ? 6    PRO B CB  1 
ATOM   4234 C CG  . PRO B 1 6   ? -16.342 12.101  -67.764 1.00   73.97  ? 6    PRO B CG  1 
ATOM   4235 C CD  . PRO B 1 6   ? -16.557 10.895  -66.915 1.00   72.86  ? 6    PRO B CD  1 
ATOM   4236 N N   . GLN B 1 7   ? -14.051 11.552  -64.481 1.00   69.48  ? 7    GLN B N   1 
ATOM   4237 C CA  . GLN B 1 7   ? -13.404 11.792  -63.196 1.00   71.14  ? 7    GLN B CA  1 
ATOM   4238 C C   . GLN B 1 7   ? -12.231 10.853  -63.016 1.00   65.68  ? 7    GLN B C   1 
ATOM   4239 O O   . GLN B 1 7   ? -11.251 11.195  -62.363 1.00   66.21  ? 7    GLN B O   1 
ATOM   4240 C CB  . GLN B 1 7   ? -14.386 11.596  -62.036 1.00   71.20  ? 7    GLN B CB  1 
ATOM   4241 C CG  . GLN B 1 7   ? -15.311 12.771  -61.822 1.00   67.09  ? 7    GLN B CG  1 
ATOM   4242 C CD  . GLN B 1 7   ? -14.548 14.065  -61.688 1.00   67.78  ? 7    GLN B CD  1 
ATOM   4243 O OE1 . GLN B 1 7   ? -13.948 14.331  -60.655 1.00   74.60  ? 7    GLN B OE1 1 
ATOM   4244 N NE2 . GLN B 1 7   ? -14.555 14.875  -62.739 1.00   72.25  ? 7    GLN B NE2 1 
ATOM   4245 N N   . LEU B 1 8   ? -12.341 9.668   -63.603 1.00   63.51  ? 8    LEU B N   1 
ATOM   4246 C CA  . LEU B 1 8   ? -11.361 8.614   -63.396 1.00   59.67  ? 8    LEU B CA  1 
ATOM   4247 C C   . LEU B 1 8   ? -10.275 8.603   -64.456 1.00   57.77  ? 8    LEU B C   1 
ATOM   4248 O O   . LEU B 1 8   ? -9.456  7.692   -64.506 1.00   60.35  ? 8    LEU B O   1 
ATOM   4249 C CB  . LEU B 1 8   ? -12.049 7.258   -63.341 1.00   57.19  ? 8    LEU B CB  1 
ATOM   4250 C CG  . LEU B 1 8   ? -13.095 7.158   -62.236 1.00   58.42  ? 8    LEU B CG  1 
ATOM   4251 C CD1 . LEU B 1 8   ? -13.695 5.769   -62.219 1.00   58.83  ? 8    LEU B CD1 1 
ATOM   4252 C CD2 . LEU B 1 8   ? -12.466 7.500   -60.895 1.00   54.78  ? 8    LEU B CD2 1 
ATOM   4253 N N   . LEU B 1 9   ? -10.254 9.623   -65.298 1.00   57.08  ? 9    LEU B N   1 
ATOM   4254 C CA  . LEU B 1 9   ? -9.219  9.707   -66.313 1.00   58.53  ? 9    LEU B CA  1 
ATOM   4255 C C   . LEU B 1 9   ? -8.312  10.894  -66.067 1.00   56.54  ? 9    LEU B C   1 
ATOM   4256 O O   . LEU B 1 9   ? -8.777  12.022  -65.906 1.00   59.51  ? 9    LEU B O   1 
ATOM   4257 C CB  . LEU B 1 9   ? -9.830  9.763   -67.712 1.00   65.24  ? 9    LEU B CB  1 
ATOM   4258 C CG  . LEU B 1 9   ? -9.802  8.428   -68.450 1.00   68.60  ? 9    LEU B CG  1 
ATOM   4259 C CD1 . LEU B 1 9   ? -10.811 8.421   -69.589 1.00   76.88  ? 9    LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 1 9   ? -8.386  8.167   -68.963 1.00   60.99  ? 9    LEU B CD2 1 
ATOM   4261 N N   . VAL B 1 10  ? -7.012  10.622  -66.034 1.00   52.55  ? 10   VAL B N   1 
ATOM   4262 C CA  . VAL B 1 10  ? -6.017  11.625  -65.702 1.00   49.00  ? 10   VAL B CA  1 
ATOM   4263 C C   . VAL B 1 10  ? -4.852  11.504  -66.664 1.00   52.52  ? 10   VAL B C   1 
ATOM   4264 O O   . VAL B 1 10  ? -4.490  10.401  -67.063 1.00   55.62  ? 10   VAL B O   1 
ATOM   4265 C CB  . VAL B 1 10  ? -5.494  11.428  -64.261 1.00   52.96  ? 10   VAL B CB  1 
ATOM   4266 C CG1 . VAL B 1 10  ? -4.492  12.519  -63.884 1.00   51.31  ? 10   VAL B CG1 1 
ATOM   4267 C CG2 . VAL B 1 10  ? -6.642  11.410  -63.291 1.00   52.47  ? 10   VAL B CG2 1 
ATOM   4268 N N   . ARG B 1 11  ? -4.273  12.639  -67.040 1.00   50.48  ? 11   ARG B N   1 
ATOM   4269 C CA  . ARG B 1 11  ? -3.065  12.643  -67.842 1.00   56.77  ? 11   ARG B CA  1 
ATOM   4270 C C   . ARG B 1 11  ? -1.901  13.197  -67.038 1.00   56.31  ? 11   ARG B C   1 
ATOM   4271 O O   . ARG B 1 11  ? -1.885  14.366  -66.652 1.00   52.47  ? 11   ARG B O   1 
ATOM   4272 C CB  . ARG B 1 11  ? -3.234  13.443  -69.140 1.00   58.07  ? 11   ARG B CB  1 
ATOM   4273 C CG  . ARG B 1 11  ? -1.904  13.917  -69.719 1.00   63.95  ? 11   ARG B CG  1 
ATOM   4274 C CD  . ARG B 1 11  ? -2.015  14.432  -71.147 1.00   73.96  ? 11   ARG B CD  1 
ATOM   4275 N NE  . ARG B 1 11  ? -1.451  13.480  -72.100 1.00   90.81  ? 11   ARG B NE  1 
ATOM   4276 C CZ  . ARG B 1 11  ? -2.150  12.539  -72.729 1.00   86.17  ? 11   ARG B CZ  1 
ATOM   4277 N NH1 . ARG B 1 11  ? -3.454  12.419  -72.513 1.00   88.30  ? 11   ARG B NH1 1 
ATOM   4278 N NH2 . ARG B 1 11  ? -1.543  11.717  -73.577 1.00   80.80  ? 11   ARG B NH2 1 
ATOM   4279 N N   . VAL B 1 12  ? -0.923  12.338  -66.797 1.00   52.62  ? 12   VAL B N   1 
ATOM   4280 C CA  . VAL B 1 12  ? 0.283   12.732  -66.107 1.00   56.58  ? 12   VAL B CA  1 
ATOM   4281 C C   . VAL B 1 12  ? 1.379   12.828  -67.155 1.00   55.13  ? 12   VAL B C   1 
ATOM   4282 O O   . VAL B 1 12  ? 1.147   12.506  -68.320 1.00   59.91  ? 12   VAL B O   1 
ATOM   4283 C CB  . VAL B 1 12  ? 0.640   11.715  -65.021 1.00   50.46  ? 12   VAL B CB  1 
ATOM   4284 C CG1 . VAL B 1 12  ? -0.548  11.524  -64.090 1.00   52.59  ? 12   VAL B CG1 1 
ATOM   4285 C CG2 . VAL B 1 12  ? 1.017   10.398  -65.647 1.00   47.92  ? 12   VAL B CG2 1 
ATOM   4286 N N   . ARG B 1 13  ? 2.563   13.270  -66.748 1.00   53.71  ? 13   ARG B N   1 
ATOM   4287 C CA  . ARG B 1 13  ? 3.657   13.498  -67.686 1.00   52.75  ? 13   ARG B CA  1 
ATOM   4288 C C   . ARG B 1 13  ? 4.013   12.278  -68.524 1.00   51.74  ? 13   ARG B C   1 
ATOM   4289 O O   . ARG B 1 13  ? 4.571   12.416  -69.603 1.00   52.25  ? 13   ARG B O   1 
ATOM   4290 C CB  . ARG B 1 13  ? 4.909   13.982  -66.956 1.00   50.87  ? 13   ARG B CB  1 
ATOM   4291 C CG  . ARG B 1 13  ? 4.963   15.477  -66.697 1.00   61.60  ? 13   ARG B CG  1 
ATOM   4292 C CD  . ARG B 1 13  ? 6.412   15.898  -66.471 1.00   77.92  ? 13   ARG B CD  1 
ATOM   4293 N NE  . ARG B 1 13  ? 6.538   17.214  -65.845 1.00   88.99  ? 13   ARG B NE  1 
ATOM   4294 C CZ  . ARG B 1 13  ? 7.679   17.706  -65.363 1.00   92.49  ? 13   ARG B CZ  1 
ATOM   4295 N NH1 . ARG B 1 13  ? 8.797   16.989  -65.432 1.00   92.51  ? 13   ARG B NH1 1 
ATOM   4296 N NH2 . ARG B 1 13  ? 7.707   18.913  -64.806 1.00   84.50  ? 13   ARG B NH2 1 
ATOM   4297 N N   . GLY B 1 14  ? 3.706   11.086  -68.029 1.00   51.94  ? 14   GLY B N   1 
ATOM   4298 C CA  . GLY B 1 14  ? 4.110   9.869   -68.706 1.00   46.04  ? 14   GLY B CA  1 
ATOM   4299 C C   . GLY B 1 14  ? 3.036   9.258   -69.579 1.00   48.98  ? 14   GLY B C   1 
ATOM   4300 O O   . GLY B 1 14  ? 3.306   8.334   -70.338 1.00   48.57  ? 14   GLY B O   1 
ATOM   4301 N N   . GLY B 1 15  ? 1.812   9.764   -69.466 1.00   54.25  ? 15   GLY B N   1 
ATOM   4302 C CA  . GLY B 1 15  ? 0.700   9.233   -70.237 1.00   52.57  ? 15   GLY B CA  1 
ATOM   4303 C C   . GLY B 1 15  ? -0.629  9.277   -69.505 1.00   53.17  ? 15   GLY B C   1 
ATOM   4304 O O   . GLY B 1 15  ? -0.795  10.004  -68.526 1.00   55.29  ? 15   GLY B O   1 
ATOM   4305 N N   . GLN B 1 16  ? -1.579  8.478   -69.969 1.00   48.28  ? 16   GLN B N   1 
ATOM   4306 C CA  . GLN B 1 16  ? -2.915  8.497   -69.400 1.00   49.45  ? 16   GLN B CA  1 
ATOM   4307 C C   . GLN B 1 16  ? -3.122  7.389   -68.402 1.00   47.40  ? 16   GLN B C   1 
ATOM   4308 O O   . GLN B 1 16  ? -2.617  6.285   -68.573 1.00   49.87  ? 16   GLN B O   1 
ATOM   4309 C CB  . GLN B 1 16  ? -3.972  8.382   -70.493 1.00   51.72  ? 16   GLN B CB  1 
ATOM   4310 C CG  . GLN B 1 16  ? -3.965  9.531   -71.459 1.00   62.58  ? 16   GLN B CG  1 
ATOM   4311 C CD  . GLN B 1 16  ? -5.369  9.910   -71.881 1.00   82.87  ? 16   GLN B CD  1 
ATOM   4312 O OE1 . GLN B 1 16  ? -6.025  9.189   -72.649 1.00   71.71  ? 16   GLN B OE1 1 
ATOM   4313 N NE2 . GLN B 1 16  ? -5.851  11.046  -71.368 1.00   78.48  ? 16   GLN B NE2 1 
ATOM   4314 N N   . LEU B 1 17  ? -3.897  7.693   -67.369 1.00   46.31  ? 17   LEU B N   1 
ATOM   4315 C CA  . LEU B 1 17  ? -4.173  6.756   -66.301 1.00   47.85  ? 17   LEU B CA  1 
ATOM   4316 C C   . LEU B 1 17  ? -5.666  6.606   -66.228 1.00   48.41  ? 17   LEU B C   1 
ATOM   4317 O O   . LEU B 1 17  ? -6.395  7.549   -66.515 1.00   54.11  ? 17   LEU B O   1 
ATOM   4318 C CB  . LEU B 1 17  ? -3.683  7.320   -64.955 1.00   45.09  ? 17   LEU B CB  1 
ATOM   4319 C CG  . LEU B 1 17  ? -2.180  7.513   -64.796 1.00   50.53  ? 17   LEU B CG  1 
ATOM   4320 C CD1 . LEU B 1 17  ? -1.871  8.341   -63.578 1.00   50.35  ? 17   LEU B CD1 1 
ATOM   4321 C CD2 . LEU B 1 17  ? -1.496  6.166   -64.716 1.00   54.36  ? 17   LEU B CD2 1 
ATOM   4322 N N   . ARG B 1 18  ? -6.131  5.436   -65.820 1.00   48.34  ? 18   ARG B N   1 
ATOM   4323 C CA  . ARG B 1 18  ? -7.534  5.283   -65.478 1.00   49.76  ? 18   ARG B CA  1 
ATOM   4324 C C   . ARG B 1 18  ? -7.631  4.778   -64.050 1.00   48.46  ? 18   ARG B C   1 
ATOM   4325 O O   . ARG B 1 18  ? -7.121  3.705   -63.716 1.00   50.42  ? 18   ARG B O   1 
ATOM   4326 C CB  . ARG B 1 18  ? -8.255  4.343   -66.449 1.00   52.55  ? 18   ARG B CB  1 
ATOM   4327 C CG  . ARG B 1 18  ? -9.418  3.598   -65.813 1.00   58.05  ? 18   ARG B CG  1 
ATOM   4328 C CD  . ARG B 1 18  ? -10.357 2.975   -66.827 1.00   68.52  ? 18   ARG B CD  1 
ATOM   4329 N NE  . ARG B 1 18  ? -9.675  2.466   -68.015 1.00   79.39  ? 18   ARG B NE  1 
ATOM   4330 C CZ  . ARG B 1 18  ? -9.671  3.092   -69.190 1.00   80.58  ? 18   ARG B CZ  1 
ATOM   4331 N NH1 . ARG B 1 18  ? -10.309 4.252   -69.327 1.00   81.34  ? 18   ARG B NH1 1 
ATOM   4332 N NH2 . ARG B 1 18  ? -9.030  2.565   -70.225 1.00   76.56  ? 18   ARG B NH2 1 
ATOM   4333 N N   . GLY B 1 19  ? -8.277  5.568   -63.203 1.00   47.13  ? 19   GLY B N   1 
ATOM   4334 C CA  . GLY B 1 19  ? -8.436  5.211   -61.811 1.00   47.77  ? 19   GLY B CA  1 
ATOM   4335 C C   . GLY B 1 19  ? -9.693  4.400   -61.612 1.00   53.51  ? 19   GLY B C   1 
ATOM   4336 O O   . GLY B 1 19  ? -10.221 3.803   -62.545 1.00   53.79  ? 19   GLY B O   1 
ATOM   4337 N N   . ILE B 1 20  ? -10.180 4.382   -60.383 1.00   49.51  ? 20   ILE B N   1 
ATOM   4338 C CA  . ILE B 1 20  ? -11.374 3.631   -60.065 1.00   49.18  ? 20   ILE B CA  1 
ATOM   4339 C C   . ILE B 1 20  ? -12.136 4.375   -58.982 1.00   58.73  ? 20   ILE B C   1 
ATOM   4340 O O   . ILE B 1 20  ? -11.531 5.008   -58.113 1.00   60.93  ? 20   ILE B O   1 
ATOM   4341 C CB  . ILE B 1 20  ? -11.029 2.195   -59.612 1.00   48.30  ? 20   ILE B CB  1 
ATOM   4342 C CG1 . ILE B 1 20  ? -12.283 1.466   -59.138 1.00   56.15  ? 20   ILE B CG1 1 
ATOM   4343 C CG2 . ILE B 1 20  ? -9.991  2.202   -58.502 1.00   45.46  ? 20   ILE B CG2 1 
ATOM   4344 C CD1 . ILE B 1 20  ? -12.146 -0.053  -59.147 1.00   46.04  ? 20   ILE B CD1 1 
ATOM   4345 N N   . ARG B 1 21  ? -13.460 4.321   -59.049 1.00   55.79  ? 21   ARG B N   1 
ATOM   4346 C CA  . ARG B 1 21  ? -14.306 4.993   -58.079 1.00   54.06  ? 21   ARG B CA  1 
ATOM   4347 C C   . ARG B 1 21  ? -14.515 4.043   -56.920 1.00   54.29  ? 21   ARG B C   1 
ATOM   4348 O O   . ARG B 1 21  ? -15.044 2.951   -57.104 1.00   58.03  ? 21   ARG B O   1 
ATOM   4349 C CB  . ARG B 1 21  ? -15.651 5.356   -58.712 1.00   62.03  ? 21   ARG B CB  1 
ATOM   4350 C CG  . ARG B 1 21  ? -16.464 6.400   -57.956 1.00   68.03  ? 21   ARG B CG  1 
ATOM   4351 C CD  . ARG B 1 21  ? -17.884 6.506   -58.518 1.00   70.04  ? 21   ARG B CD  1 
ATOM   4352 N NE  . ARG B 1 21  ? -18.708 5.389   -58.063 1.00   77.88  ? 21   ARG B NE  1 
ATOM   4353 C CZ  . ARG B 1 21  ? -19.795 5.511   -57.303 1.00   92.61  ? 21   ARG B CZ  1 
ATOM   4354 N NH1 . ARG B 1 21  ? -20.223 6.712   -56.921 1.00   89.56  ? 21   ARG B NH1 1 
ATOM   4355 N NH2 . ARG B 1 21  ? -20.467 4.426   -56.934 1.00   95.76  ? 21   ARG B NH2 1 
ATOM   4356 N N   . LEU B 1 22  ? -14.082 4.446   -55.729 1.00   49.43  ? 22   LEU B N   1 
ATOM   4357 C CA  . LEU B 1 22  ? -14.200 3.589   -54.554 1.00   57.23  ? 22   LEU B CA  1 
ATOM   4358 C C   . LEU B 1 22  ? -15.238 4.137   -53.599 1.00   56.18  ? 22   LEU B C   1 
ATOM   4359 O O   . LEU B 1 22  ? -15.513 5.337   -53.587 1.00   64.99  ? 22   LEU B O   1 
ATOM   4360 C CB  . LEU B 1 22  ? -12.855 3.448   -53.833 1.00   59.79  ? 22   LEU B CB  1 
ATOM   4361 C CG  . LEU B 1 22  ? -11.733 2.754   -54.605 1.00   56.18  ? 22   LEU B CG  1 
ATOM   4362 C CD1 . LEU B 1 22  ? -10.476 2.664   -53.750 1.00   63.59  ? 22   LEU B CD1 1 
ATOM   4363 C CD2 . LEU B 1 22  ? -12.167 1.377   -55.059 1.00   50.46  ? 22   LEU B CD2 1 
ATOM   4364 N N   . LYS B 1 23  ? -15.808 3.255   -52.792 1.00   62.69  ? 23   LYS B N   1 
ATOM   4365 C CA  . LYS B 1 23  ? -16.846 3.654   -51.855 1.00   63.68  ? 23   LYS B CA  1 
ATOM   4366 C C   . LYS B 1 23  ? -16.270 3.872   -50.462 1.00   63.20  ? 23   LYS B C   1 
ATOM   4367 O O   . LYS B 1 23  ? -15.758 2.944   -49.844 1.00   57.68  ? 23   LYS B O   1 
ATOM   4368 C CB  . LYS B 1 23  ? -17.958 2.601   -51.812 1.00   65.18  ? 23   LYS B CB  1 
ATOM   4369 C CG  . LYS B 1 23  ? -18.955 2.775   -50.677 1.00   73.42  ? 23   LYS B CG  1 
ATOM   4370 C CD  . LYS B 1 23  ? -19.741 1.486   -50.427 1.00   86.26  ? 23   LYS B CD  1 
ATOM   4371 C CE  . LYS B 1 23  ? -20.169 1.357   -48.962 1.00   92.80  ? 23   LYS B CE  1 
ATOM   4372 N NZ  . LYS B 1 23  ? -20.899 2.563   -48.461 1.00   85.40  ? 23   LYS B NZ  1 
ATOM   4373 N N   . ALA B 1 24  ? -16.339 5.113   -49.989 1.00   66.12  ? 24   ALA B N   1 
ATOM   4374 C CA  . ALA B 1 24  ? -16.094 5.432   -48.587 1.00   64.73  ? 24   ALA B CA  1 
ATOM   4375 C C   . ALA B 1 24  ? -17.443 5.526   -47.873 1.00   64.22  ? 24   ALA B C   1 
ATOM   4376 O O   . ALA B 1 24  ? -18.449 5.870   -48.494 1.00   65.87  ? 24   ALA B O   1 
ATOM   4377 C CB  . ALA B 1 24  ? -15.331 6.744   -48.470 1.00   53.86  ? 24   ALA B CB  1 
ATOM   4378 N N   . PRO B 1 25  ? -17.472 5.232   -46.564 1.00   67.15  ? 25   PRO B N   1 
ATOM   4379 C CA  . PRO B 1 25  ? -18.742 5.183   -45.823 1.00   66.12  ? 25   PRO B CA  1 
ATOM   4380 C C   . PRO B 1 25  ? -19.657 6.369   -46.092 1.00   63.25  ? 25   PRO B C   1 
ATOM   4381 O O   . PRO B 1 25  ? -20.874 6.214   -46.042 1.00   69.72  ? 25   PRO B O   1 
ATOM   4382 C CB  . PRO B 1 25  ? -18.298 5.181   -44.360 1.00   55.12  ? 25   PRO B CB  1 
ATOM   4383 C CG  . PRO B 1 25  ? -16.968 4.506   -44.395 1.00   66.65  ? 25   PRO B CG  1 
ATOM   4384 C CD  . PRO B 1 25  ? -16.319 4.941   -45.696 1.00   61.41  ? 25   PRO B CD  1 
ATOM   4385 N N   . GLY B 1 26  ? -19.091 7.529   -46.390 1.00   57.65  ? 26   GLY B N   1 
ATOM   4386 C CA  . GLY B 1 26  ? -19.911 8.703   -46.616 1.00   59.77  ? 26   GLY B CA  1 
ATOM   4387 C C   . GLY B 1 26  ? -19.912 9.246   -48.032 1.00   60.30  ? 26   GLY B C   1 
ATOM   4388 O O   . GLY B 1 26  ? -20.321 10.386  -48.252 1.00   60.60  ? 26   GLY B O   1 
ATOM   4389 N N   . GLY B 1 27  ? -19.463 8.448   -48.996 1.00   56.89  ? 27   GLY B N   1 
ATOM   4390 C CA  . GLY B 1 27  ? -19.407 8.914   -50.371 1.00   58.00  ? 27   GLY B CA  1 
ATOM   4391 C C   . GLY B 1 27  ? -18.317 8.247   -51.179 1.00   62.05  ? 27   GLY B C   1 
ATOM   4392 O O   . GLY B 1 27  ? -17.576 7.425   -50.647 1.00   67.54  ? 27   GLY B O   1 
ATOM   4393 N N   . PRO B 1 28  ? -18.214 8.594   -52.472 1.00   60.58  ? 28   PRO B N   1 
ATOM   4394 C CA  . PRO B 1 28  ? -17.215 7.993   -53.352 1.00   62.46  ? 28   PRO B CA  1 
ATOM   4395 C C   . PRO B 1 28  ? -15.904 8.755   -53.293 1.00   61.52  ? 28   PRO B C   1 
ATOM   4396 O O   . PRO B 1 28  ? -15.894 9.955   -52.995 1.00   55.16  ? 28   PRO B O   1 
ATOM   4397 C CB  . PRO B 1 28  ? -17.815 8.188   -54.753 1.00   64.13  ? 28   PRO B CB  1 
ATOM   4398 C CG  . PRO B 1 28  ? -19.078 8.990   -54.566 1.00   58.91  ? 28   PRO B CG  1 
ATOM   4399 C CD  . PRO B 1 28  ? -19.035 9.570   -53.199 1.00   62.17  ? 28   PRO B CD  1 
ATOM   4400 N N   . VAL B 1 29  ? -14.814 8.057   -53.595 1.00   58.22  ? 29   VAL B N   1 
ATOM   4401 C CA  . VAL B 1 29  ? -13.532 8.701   -53.812 1.00   54.65  ? 29   VAL B CA  1 
ATOM   4402 C C   . VAL B 1 29  ? -12.927 8.153   -55.099 1.00   55.64  ? 29   VAL B C   1 
ATOM   4403 O O   . VAL B 1 29  ? -13.212 7.028   -55.497 1.00   57.24  ? 29   VAL B O   1 
ATOM   4404 C CB  . VAL B 1 29  ? -12.559 8.439   -52.647 1.00   57.46  ? 29   VAL B CB  1 
ATOM   4405 C CG1 . VAL B 1 29  ? -13.143 8.956   -51.331 1.00   56.95  ? 29   VAL B CG1 1 
ATOM   4406 C CG2 . VAL B 1 29  ? -12.246 6.957   -52.552 1.00   49.88  ? 29   VAL B CG2 1 
ATOM   4407 N N   . SER B 1 30  ? -12.098 8.958   -55.747 1.00   49.00  ? 30   SER B N   1 
ATOM   4408 C CA  . SER B 1 30  ? -11.332 8.511   -56.888 1.00   50.28  ? 30   SER B CA  1 
ATOM   4409 C C   . SER B 1 30  ? -10.018 7.919   -56.396 1.00   55.23  ? 30   SER B C   1 
ATOM   4410 O O   . SER B 1 30  ? -9.277  8.569   -55.659 1.00   59.28  ? 30   SER B O   1 
ATOM   4411 C CB  . SER B 1 30  ? -11.046 9.689   -57.811 1.00   52.81  ? 30   SER B CB  1 
ATOM   4412 O OG  . SER B 1 30  ? -12.216 10.458  -58.022 1.00   64.06  ? 30   SER B OG  1 
ATOM   4413 N N   . ALA B 1 31  ? -9.721  6.688   -56.789 1.00   48.19  ? 31   ALA B N   1 
ATOM   4414 C CA  . ALA B 1 31  ? -8.443  6.087   -56.428 1.00   45.12  ? 31   ALA B CA  1 
ATOM   4415 C C   . ALA B 1 31  ? -7.612  5.684   -57.655 1.00   48.13  ? 31   ALA B C   1 
ATOM   4416 O O   . ALA B 1 31  ? -8.089  4.986   -58.551 1.00   46.77  ? 31   ALA B O   1 
ATOM   4417 C CB  . ALA B 1 31  ? -8.659  4.898   -55.499 1.00   42.44  ? 31   ALA B CB  1 
ATOM   4418 N N   . PHE B 1 32  ? -6.369  6.145   -57.697 1.00   50.17  ? 32   PHE B N   1 
ATOM   4419 C CA  . PHE B 1 32  ? -5.429  5.721   -58.730 1.00   42.44  ? 32   PHE B CA  1 
ATOM   4420 C C   . PHE B 1 32  ? -4.305  4.893   -58.098 1.00   46.26  ? 32   PHE B C   1 
ATOM   4421 O O   . PHE B 1 32  ? -3.386  5.438   -57.490 1.00   47.45  ? 32   PHE B O   1 
ATOM   4422 C CB  . PHE B 1 32  ? -4.872  6.931   -59.472 1.00   43.38  ? 32   PHE B CB  1 
ATOM   4423 C CG  . PHE B 1 32  ? -5.931  7.876   -59.949 1.00   47.80  ? 32   PHE B CG  1 
ATOM   4424 C CD1 . PHE B 1 32  ? -6.487  8.807   -59.087 1.00   50.83  ? 32   PHE B CD1 1 
ATOM   4425 C CD2 . PHE B 1 32  ? -6.385  7.827   -61.253 1.00   49.23  ? 32   PHE B CD2 1 
ATOM   4426 C CE1 . PHE B 1 32  ? -7.467  9.667   -59.521 1.00   50.12  ? 32   PHE B CE1 1 
ATOM   4427 C CE2 . PHE B 1 32  ? -7.368  8.686   -61.691 1.00   51.20  ? 32   PHE B CE2 1 
ATOM   4428 C CZ  . PHE B 1 32  ? -7.911  9.603   -60.825 1.00   53.30  ? 32   PHE B CZ  1 
ATOM   4429 N N   . LEU B 1 33  ? -4.404  3.574   -58.231 1.00   40.78  ? 33   LEU B N   1 
ATOM   4430 C CA  . LEU B 1 33  ? -3.473  2.661   -57.593 1.00   42.25  ? 33   LEU B CA  1 
ATOM   4431 C C   . LEU B 1 33  ? -2.498  2.034   -58.581 1.00   47.49  ? 33   LEU B C   1 
ATOM   4432 O O   . LEU B 1 33  ? -2.868  1.723   -59.711 1.00   55.03  ? 33   LEU B O   1 
ATOM   4433 C CB  . LEU B 1 33  ? -4.242  1.561   -56.872 1.00   42.11  ? 33   LEU B CB  1 
ATOM   4434 C CG  . LEU B 1 33  ? -5.464  2.045   -56.086 1.00   45.64  ? 33   LEU B CG  1 
ATOM   4435 C CD1 . LEU B 1 33  ? -6.239  0.866   -55.563 1.00   37.75  ? 33   LEU B CD1 1 
ATOM   4436 C CD2 . LEU B 1 33  ? -5.055  2.954   -54.946 1.00   39.67  ? 33   LEU B CD2 1 
ATOM   4437 N N   . GLY B 1 34  ? -1.253  1.850   -58.147 1.00   43.29  ? 34   GLY B N   1 
ATOM   4438 C CA  . GLY B 1 34  ? -0.249  1.169   -58.948 1.00   43.06  ? 34   GLY B CA  1 
ATOM   4439 C C   . GLY B 1 34  ? 0.421   1.989   -60.040 1.00   43.62  ? 34   GLY B C   1 
ATOM   4440 O O   . GLY B 1 34  ? 0.877   1.437   -61.029 1.00   54.45  ? 34   GLY B O   1 
ATOM   4441 N N   . ILE B 1 35  ? 0.491   3.302   -59.873 1.00   44.20  ? 35   ILE B N   1 
ATOM   4442 C CA  . ILE B 1 35  ? 1.128   4.155   -60.871 1.00   41.81  ? 35   ILE B CA  1 
ATOM   4443 C C   . ILE B 1 35  ? 2.646   4.008   -60.820 1.00   39.02  ? 35   ILE B C   1 
ATOM   4444 O O   . ILE B 1 35  ? 3.253   4.165   -59.768 1.00   46.61  ? 35   ILE B O   1 
ATOM   4445 C CB  . ILE B 1 35  ? 0.758   5.640   -60.660 1.00   39.95  ? 35   ILE B CB  1 
ATOM   4446 C CG1 . ILE B 1 35  ? -0.755  5.827   -60.667 1.00   42.20  ? 35   ILE B CG1 1 
ATOM   4447 C CG2 . ILE B 1 35  ? 1.416   6.506   -61.709 1.00   37.01  ? 35   ILE B CG2 1 
ATOM   4448 C CD1 . ILE B 1 35  ? -1.240  7.068   -59.914 1.00   41.31  ? 35   ILE B CD1 1 
ATOM   4449 N N   . PRO B 1 36  ? 3.276   3.716   -61.960 1.00   43.98  ? 36   PRO B N   1 
ATOM   4450 C CA  . PRO B 1 36  ? 4.732   3.545   -61.921 1.00   40.45  ? 36   PRO B CA  1 
ATOM   4451 C C   . PRO B 1 36  ? 5.430   4.892   -61.812 1.00   41.74  ? 36   PRO B C   1 
ATOM   4452 O O   . PRO B 1 36  ? 5.122   5.795   -62.596 1.00   36.29  ? 36   PRO B O   1 
ATOM   4453 C CB  . PRO B 1 36  ? 5.062   2.933   -63.297 1.00   46.95  ? 36   PRO B CB  1 
ATOM   4454 C CG  . PRO B 1 36  ? 3.754   2.852   -64.062 1.00   44.32  ? 36   PRO B CG  1 
ATOM   4455 C CD  . PRO B 1 36  ? 2.746   3.685   -63.333 1.00   46.22  ? 36   PRO B CD  1 
ATOM   4456 N N   . PHE B 1 37  ? 6.366   5.038   -60.879 1.00   40.26  ? 37   PHE B N   1 
ATOM   4457 C CA  . PHE B 1 37  ? 7.124   6.290   -60.826 1.00   43.57  ? 37   PHE B CA  1 
ATOM   4458 C C   . PHE B 1 37  ? 8.582   6.091   -61.222 1.00   42.36  ? 37   PHE B C   1 
ATOM   4459 O O   . PHE B 1 37  ? 9.319   7.056   -61.427 1.00   39.26  ? 37   PHE B O   1 
ATOM   4460 C CB  . PHE B 1 37  ? 6.983   6.996   -59.467 1.00   42.06  ? 37   PHE B CB  1 
ATOM   4461 C CG  . PHE B 1 37  ? 7.492   6.201   -58.305 1.00   41.78  ? 37   PHE B CG  1 
ATOM   4462 C CD1 . PHE B 1 37  ? 8.811   6.312   -57.895 1.00   37.15  ? 37   PHE B CD1 1 
ATOM   4463 C CD2 . PHE B 1 37  ? 6.649   5.352   -57.603 1.00   41.63  ? 37   PHE B CD2 1 
ATOM   4464 C CE1 . PHE B 1 37  ? 9.277   5.580   -56.803 1.00   37.90  ? 37   PHE B CE1 1 
ATOM   4465 C CE2 . PHE B 1 37  ? 7.116   4.616   -56.510 1.00   35.75  ? 37   PHE B CE2 1 
ATOM   4466 C CZ  . PHE B 1 37  ? 8.430   4.730   -56.118 1.00   34.59  ? 37   PHE B CZ  1 
ATOM   4467 N N   . ALA B 1 38  ? 8.985   4.830   -61.353 1.00   44.20  ? 38   ALA B N   1 
ATOM   4468 C CA  . ALA B 1 38  ? 10.339  4.517   -61.792 1.00   43.24  ? 38   ALA B CA  1 
ATOM   4469 C C   . ALA B 1 38  ? 10.411  3.308   -62.738 1.00   41.47  ? 38   ALA B C   1 
ATOM   4470 O O   . ALA B 1 38  ? 9.523   2.448   -62.745 1.00   36.11  ? 38   ALA B O   1 
ATOM   4471 C CB  . ALA B 1 38  ? 11.231  4.292   -60.583 1.00   42.07  ? 38   ALA B CB  1 
ATOM   4472 N N   . GLU B 1 39  ? 11.480  3.260   -63.528 1.00   38.29  ? 39   GLU B N   1 
ATOM   4473 C CA  . GLU B 1 39  ? 11.879  2.044   -64.229 1.00   39.91  ? 39   GLU B CA  1 
ATOM   4474 C C   . GLU B 1 39  ? 12.084  0.937   -63.211 1.00   41.33  ? 39   GLU B C   1 
ATOM   4475 O O   . GLU B 1 39  ? 12.765  1.140   -62.210 1.00   46.21  ? 39   GLU B O   1 
ATOM   4476 C CB  . GLU B 1 39  ? 13.190  2.272   -64.980 1.00   39.86  ? 39   GLU B CB  1 
ATOM   4477 C CG  . GLU B 1 39  ? 13.056  3.214   -66.146 1.00   43.27  ? 39   GLU B CG  1 
ATOM   4478 C CD  . GLU B 1 39  ? 12.141  2.645   -67.206 1.00   45.64  ? 39   GLU B CD  1 
ATOM   4479 O OE1 . GLU B 1 39  ? 12.597  1.776   -67.981 1.00   48.51  ? 39   GLU B OE1 1 
ATOM   4480 O OE2 . GLU B 1 39  ? 10.963  3.052   -67.253 1.00   46.22  ? 39   GLU B OE2 1 
ATOM   4481 N N   . PRO B 1 40  ? 11.502  -0.242  -63.458 1.00   38.38  ? 40   PRO B N   1 
ATOM   4482 C CA  . PRO B 1 40  ? 11.680  -1.357  -62.520 1.00   41.97  ? 40   PRO B CA  1 
ATOM   4483 C C   . PRO B 1 40  ? 13.161  -1.600  -62.220 1.00   43.59  ? 40   PRO B C   1 
ATOM   4484 O O   . PRO B 1 40  ? 13.943  -1.781  -63.148 1.00   46.23  ? 40   PRO B O   1 
ATOM   4485 C CB  . PRO B 1 40  ? 11.085  -2.541  -63.280 1.00   40.60  ? 40   PRO B CB  1 
ATOM   4486 C CG  . PRO B 1 40  ? 10.028  -1.905  -64.170 1.00   38.00  ? 40   PRO B CG  1 
ATOM   4487 C CD  . PRO B 1 40  ? 10.663  -0.607  -64.611 1.00   37.97  ? 40   PRO B CD  1 
ATOM   4488 N N   . PRO B 1 41  ? 13.540  -1.600  -60.929 1.00   45.96  ? 41   PRO B N   1 
ATOM   4489 C CA  . PRO B 1 41  ? 14.937  -1.715  -60.495 1.00   47.17  ? 41   PRO B CA  1 
ATOM   4490 C C   . PRO B 1 41  ? 15.425  -3.160  -60.495 1.00   51.74  ? 41   PRO B C   1 
ATOM   4491 O O   . PRO B 1 41  ? 15.869  -3.666  -59.458 1.00   49.16  ? 41   PRO B O   1 
ATOM   4492 C CB  . PRO B 1 41  ? 14.860  -1.194  -59.065 1.00   41.03  ? 41   PRO B CB  1 
ATOM   4493 C CG  . PRO B 1 41  ? 13.564  -1.761  -58.614 1.00   46.82  ? 41   PRO B CG  1 
ATOM   4494 C CD  . PRO B 1 41  ? 12.652  -1.410  -59.768 1.00   38.24  ? 41   PRO B CD  1 
ATOM   4495 N N   . VAL B 1 42  ? 15.353  -3.810  -61.651 1.00   48.13  ? 42   VAL B N   1 
ATOM   4496 C CA  . VAL B 1 42  ? 15.659  -5.232  -61.746 1.00   45.03  ? 42   VAL B CA  1 
ATOM   4497 C C   . VAL B 1 42  ? 16.958  -5.525  -62.503 1.00   49.97  ? 42   VAL B C   1 
ATOM   4498 O O   . VAL B 1 42  ? 17.528  -4.661  -63.170 1.00   42.77  ? 42   VAL B O   1 
ATOM   4499 C CB  . VAL B 1 42  ? 14.506  -5.985  -62.410 1.00   47.68  ? 42   VAL B CB  1 
ATOM   4500 C CG1 . VAL B 1 42  ? 13.199  -5.695  -61.661 1.00   41.22  ? 42   VAL B CG1 1 
ATOM   4501 C CG2 . VAL B 1 42  ? 14.394  -5.580  -63.872 1.00   36.62  ? 42   VAL B CG2 1 
ATOM   4502 N N   . GLY B 1 43  ? 17.426  -6.759  -62.386 1.00   48.69  ? 43   GLY B N   1 
ATOM   4503 C CA  . GLY B 1 43  ? 18.631  -7.156  -63.074 1.00   39.55  ? 43   GLY B CA  1 
ATOM   4504 C C   . GLY B 1 43  ? 19.812  -6.293  -62.691 1.00   46.63  ? 43   GLY B C   1 
ATOM   4505 O O   . GLY B 1 43  ? 20.211  -6.252  -61.528 1.00   50.62  ? 43   GLY B O   1 
ATOM   4506 N N   . SER B 1 44  ? 20.388  -5.614  -63.674 1.00   44.48  ? 44   SER B N   1 
ATOM   4507 C CA  . SER B 1 44  ? 21.584  -4.823  -63.437 1.00   48.97  ? 44   SER B CA  1 
ATOM   4508 C C   . SER B 1 44  ? 21.273  -3.565  -62.626 1.00   48.58  ? 44   SER B C   1 
ATOM   4509 O O   . SER B 1 44  ? 22.180  -2.882  -62.162 1.00   50.53  ? 44   SER B O   1 
ATOM   4510 C CB  . SER B 1 44  ? 22.258  -4.453  -64.764 1.00   45.81  ? 44   SER B CB  1 
ATOM   4511 O OG  . SER B 1 44  ? 21.747  -3.229  -65.277 1.00   60.57  ? 44   SER B OG  1 
ATOM   4512 N N   . ARG B 1 45  ? 19.986  -3.257  -62.474 1.00   49.59  ? 45   ARG B N   1 
ATOM   4513 C CA  . ARG B 1 45  ? 19.555  -2.083  -61.723 1.00   50.29  ? 45   ARG B CA  1 
ATOM   4514 C C   . ARG B 1 45  ? 19.395  -2.366  -60.226 1.00   51.46  ? 45   ARG B C   1 
ATOM   4515 O O   . ARG B 1 45  ? 19.102  -1.455  -59.455 1.00   49.16  ? 45   ARG B O   1 
ATOM   4516 C CB  . ARG B 1 45  ? 18.228  -1.565  -62.258 1.00   47.40  ? 45   ARG B CB  1 
ATOM   4517 C CG  . ARG B 1 45  ? 18.282  -0.892  -63.608 1.00   50.96  ? 45   ARG B CG  1 
ATOM   4518 C CD  . ARG B 1 45  ? 16.928  -0.196  -63.854 1.00   66.34  ? 45   ARG B CD  1 
ATOM   4519 N NE  . ARG B 1 45  ? 16.743  0.328   -65.210 1.00   74.72  ? 45   ARG B NE  1 
ATOM   4520 C CZ  . ARG B 1 45  ? 15.866  -0.150  -66.093 1.00   70.24  ? 45   ARG B CZ  1 
ATOM   4521 N NH1 . ARG B 1 45  ? 15.070  -1.182  -65.776 1.00   52.88  ? 45   ARG B NH1 1 
ATOM   4522 N NH2 . ARG B 1 45  ? 15.779  0.415   -67.297 1.00   65.90  ? 45   ARG B NH2 1 
ATOM   4523 N N   . ARG B 1 46  ? 19.560  -3.626  -59.823 1.00   46.47  ? 46   ARG B N   1 
ATOM   4524 C CA  . ARG B 1 46  ? 19.506  -3.984  -58.410 1.00   45.48  ? 46   ARG B CA  1 
ATOM   4525 C C   . ARG B 1 46  ? 20.599  -3.265  -57.633 1.00   45.03  ? 46   ARG B C   1 
ATOM   4526 O O   . ARG B 1 46  ? 21.746  -3.237  -58.071 1.00   48.92  ? 46   ARG B O   1 
ATOM   4527 C CB  . ARG B 1 46  ? 19.648  -5.491  -58.220 1.00   44.89  ? 46   ARG B CB  1 
ATOM   4528 C CG  . ARG B 1 46  ? 19.684  -5.912  -56.762 1.00   44.51  ? 46   ARG B CG  1 
ATOM   4529 C CD  . ARG B 1 46  ? 19.969  -7.396  -56.631 1.00   46.64  ? 46   ARG B CD  1 
ATOM   4530 N NE  . ARG B 1 46  ? 18.766  -8.220  -56.697 1.00   44.33  ? 46   ARG B NE  1 
ATOM   4531 C CZ  . ARG B 1 46  ? 18.786  -9.548  -56.772 1.00   48.34  ? 46   ARG B CZ  1 
ATOM   4532 N NH1 . ARG B 1 46  ? 19.948  -10.188 -56.803 1.00   50.74  ? 46   ARG B NH1 1 
ATOM   4533 N NH2 . ARG B 1 46  ? 17.653  -10.237 -56.814 1.00   41.68  ? 46   ARG B NH2 1 
ATOM   4534 N N   . PHE B 1 47  ? 20.229  -2.676  -56.492 1.00   43.22  ? 47   PHE B N   1 
ATOM   4535 C CA  . PHE B 1 47  ? 21.132  -1.874  -55.649 1.00   40.14  ? 47   PHE B CA  1 
ATOM   4536 C C   . PHE B 1 47  ? 21.439  -0.485  -56.208 1.00   42.69  ? 47   PHE B C   1 
ATOM   4537 O O   . PHE B 1 47  ? 22.151  0.284   -55.577 1.00   44.77  ? 47   PHE B O   1 
ATOM   4538 C CB  . PHE B 1 47  ? 22.465  -2.588  -55.348 1.00   40.50  ? 47   PHE B CB  1 
ATOM   4539 C CG  . PHE B 1 47  ? 22.315  -4.024  -54.925 1.00   44.41  ? 47   PHE B CG  1 
ATOM   4540 C CD1 . PHE B 1 47  ? 21.529  -4.366  -53.832 1.00   41.91  ? 47   PHE B CD1 1 
ATOM   4541 C CD2 . PHE B 1 47  ? 22.970  -5.036  -55.624 1.00   40.84  ? 47   PHE B CD2 1 
ATOM   4542 C CE1 . PHE B 1 47  ? 21.382  -5.693  -53.446 1.00   42.74  ? 47   PHE B CE1 1 
ATOM   4543 C CE2 . PHE B 1 47  ? 22.836  -6.359  -55.244 1.00   40.25  ? 47   PHE B CE2 1 
ATOM   4544 C CZ  . PHE B 1 47  ? 22.033  -6.690  -54.153 1.00   45.11  ? 47   PHE B CZ  1 
ATOM   4545 N N   . MET B 1 48  ? 20.921  -0.157  -57.386 1.00   43.17  ? 48   MET B N   1 
ATOM   4546 C CA  . MET B 1 48  ? 21.210  1.150   -57.971 1.00   42.78  ? 48   MET B CA  1 
ATOM   4547 C C   . MET B 1 48  ? 20.094  2.168   -57.755 1.00   42.89  ? 48   MET B C   1 
ATOM   4548 O O   . MET B 1 48  ? 18.951  1.806   -57.484 1.00   38.89  ? 48   MET B O   1 
ATOM   4549 C CB  . MET B 1 48  ? 21.521  1.003   -59.454 1.00   47.08  ? 48   MET B CB  1 
ATOM   4550 C CG  . MET B 1 48  ? 22.600  -0.032  -59.709 1.00   57.95  ? 48   MET B CG  1 
ATOM   4551 S SD  . MET B 1 48  ? 23.834  0.524   -60.891 1.00   82.95  ? 48   MET B SD  1 
ATOM   4552 C CE  . MET B 1 48  ? 24.413  2.023   -60.091 1.00   55.19  ? 48   MET B CE  1 
ATOM   4553 N N   . PRO B 1 49  ? 20.434  3.455   -57.852 1.00   42.25  ? 49   PRO B N   1 
ATOM   4554 C CA  . PRO B 1 49  ? 19.421  4.515   -57.778 1.00   43.75  ? 49   PRO B CA  1 
ATOM   4555 C C   . PRO B 1 49  ? 18.282  4.268   -58.768 1.00   45.12  ? 49   PRO B C   1 
ATOM   4556 O O   . PRO B 1 49  ? 18.505  3.638   -59.796 1.00   45.47  ? 49   PRO B O   1 
ATOM   4557 C CB  . PRO B 1 49  ? 20.199  5.772   -58.174 1.00   41.12  ? 49   PRO B CB  1 
ATOM   4558 C CG  . PRO B 1 49  ? 21.621  5.475   -57.769 1.00   46.13  ? 49   PRO B CG  1 
ATOM   4559 C CD  . PRO B 1 49  ? 21.805  3.983   -57.948 1.00   44.59  ? 49   PRO B CD  1 
ATOM   4560 N N   . PRO B 1 50  ? 17.067  4.750   -58.452 1.00   47.51  ? 50   PRO B N   1 
ATOM   4561 C CA  . PRO B 1 50  ? 15.944  4.608   -59.383 1.00   41.43  ? 50   PRO B CA  1 
ATOM   4562 C C   . PRO B 1 50  ? 16.102  5.552   -60.558 1.00   41.12  ? 50   PRO B C   1 
ATOM   4563 O O   . PRO B 1 50  ? 16.773  6.566   -60.433 1.00   39.93  ? 50   PRO B O   1 
ATOM   4564 C CB  . PRO B 1 50  ? 14.747  5.056   -58.547 1.00   37.44  ? 50   PRO B CB  1 
ATOM   4565 C CG  . PRO B 1 50  ? 15.347  5.986   -57.536 1.00   40.28  ? 50   PRO B CG  1 
ATOM   4566 C CD  . PRO B 1 50  ? 16.635  5.334   -57.169 1.00   40.66  ? 50   PRO B CD  1 
ATOM   4567 N N   . GLU B 1 51  ? 15.499  5.212   -61.690 1.00   43.47  ? 51   GLU B N   1 
ATOM   4568 C CA  . GLU B 1 51  ? 15.429  6.123   -62.818 1.00   40.85  ? 51   GLU B CA  1 
ATOM   4569 C C   . GLU B 1 51  ? 13.964  6.371   -63.116 1.00   42.25  ? 51   GLU B C   1 
ATOM   4570 O O   . GLU B 1 51  ? 13.131  5.487   -62.906 1.00   44.64  ? 51   GLU B O   1 
ATOM   4571 C CB  . GLU B 1 51  ? 16.119  5.524   -64.038 1.00   46.20  ? 51   GLU B CB  1 
ATOM   4572 C CG  . GLU B 1 51  ? 17.599  5.262   -63.854 1.00   52.49  ? 51   GLU B CG  1 
ATOM   4573 C CD  . GLU B 1 51  ? 18.133  4.255   -64.861 1.00   80.22  ? 51   GLU B CD  1 
ATOM   4574 O OE1 . GLU B 1 51  ? 17.365  3.352   -65.275 1.00   78.99  ? 51   GLU B OE1 1 
ATOM   4575 O OE2 . GLU B 1 51  ? 19.322  4.364   -65.234 1.00   88.85  ? 51   GLU B OE2 1 
ATOM   4576 N N   . PRO B 1 52  ? 13.645  7.575   -63.602 1.00   38.79  ? 52   PRO B N   1 
ATOM   4577 C CA  . PRO B 1 52  ? 12.281  7.981   -63.962 1.00   38.83  ? 52   PRO B CA  1 
ATOM   4578 C C   . PRO B 1 52  ? 11.636  6.984   -64.928 1.00   43.43  ? 52   PRO B C   1 
ATOM   4579 O O   . PRO B 1 52  ? 12.285  6.538   -65.873 1.00   41.90  ? 52   PRO B O   1 
ATOM   4580 C CB  . PRO B 1 52  ? 12.489  9.324   -64.670 1.00   40.15  ? 52   PRO B CB  1 
ATOM   4581 C CG  . PRO B 1 52  ? 13.807  9.823   -64.191 1.00   44.61  ? 52   PRO B CG  1 
ATOM   4582 C CD  . PRO B 1 52  ? 14.645  8.608   -63.921 1.00   39.30  ? 52   PRO B CD  1 
ATOM   4583 N N   . LYS B 1 53  ? 10.373  6.645   -64.689 1.00   40.09  ? 53   LYS B N   1 
ATOM   4584 C CA  . LYS B 1 53  ? 9.652   5.716   -65.548 1.00   45.06  ? 53   LYS B CA  1 
ATOM   4585 C C   . LYS B 1 53  ? 9.519   6.290   -66.955 1.00   44.99  ? 53   LYS B C   1 
ATOM   4586 O O   . LYS B 1 53  ? 9.286   7.485   -67.133 1.00   42.77  ? 53   LYS B O   1 
ATOM   4587 C CB  . LYS B 1 53  ? 8.266   5.415   -64.968 1.00   43.42  ? 53   LYS B CB  1 
ATOM   4588 C CG  . LYS B 1 53  ? 7.331   4.660   -65.906 1.00   44.63  ? 53   LYS B CG  1 
ATOM   4589 C CD  . LYS B 1 53  ? 7.655   3.167   -65.930 1.00   48.78  ? 53   LYS B CD  1 
ATOM   4590 C CE  . LYS B 1 53  ? 6.694   2.393   -66.836 1.00   46.24  ? 53   LYS B CE  1 
ATOM   4591 N NZ  . LYS B 1 53  ? 6.738   2.913   -68.240 1.00   46.69  ? 53   LYS B NZ  1 
ATOM   4592 N N   . ARG B 1 54  ? 9.682   5.441   -67.962 1.00   45.79  ? 54   ARG B N   1 
ATOM   4593 C CA  . ARG B 1 54  ? 9.507   5.899   -69.331 1.00   45.41  ? 54   ARG B CA  1 
ATOM   4594 C C   . ARG B 1 54  ? 8.020   6.052   -69.638 1.00   44.11  ? 54   ARG B C   1 
ATOM   4595 O O   . ARG B 1 54  ? 7.183   5.313   -69.102 1.00   42.74  ? 54   ARG B O   1 
ATOM   4596 C CB  . ARG B 1 54  ? 10.166  4.939   -70.320 1.00   38.68  ? 54   ARG B CB  1 
ATOM   4597 C CG  . ARG B 1 54  ? 11.666  4.852   -70.188 1.00   40.95  ? 54   ARG B CG  1 
ATOM   4598 C CD  . ARG B 1 54  ? 12.208  3.680   -71.005 1.00   42.54  ? 54   ARG B CD  1 
ATOM   4599 N NE  . ARG B 1 54  ? 11.545  2.438   -70.622 1.00   44.11  ? 54   ARG B NE  1 
ATOM   4600 C CZ  . ARG B 1 54  ? 10.788  1.699   -71.427 1.00   51.50  ? 54   ARG B CZ  1 
ATOM   4601 N NH1 . ARG B 1 54  ? 10.615  2.047   -72.706 1.00   45.30  ? 54   ARG B NH1 1 
ATOM   4602 N NH2 . ARG B 1 54  ? 10.226  0.590   -70.953 1.00   41.36  ? 54   ARG B NH2 1 
ATOM   4603 N N   . PRO B 1 55  ? 7.690   7.030   -70.489 1.00   45.50  ? 55   PRO B N   1 
ATOM   4604 C CA  . PRO B 1 55  ? 6.342   7.288   -71.015 1.00   48.74  ? 55   PRO B CA  1 
ATOM   4605 C C   . PRO B 1 55  ? 5.694   6.018   -71.529 1.00   42.35  ? 55   PRO B C   1 
ATOM   4606 O O   . PRO B 1 55  ? 6.394   5.102   -71.944 1.00   49.60  ? 55   PRO B O   1 
ATOM   4607 C CB  . PRO B 1 55  ? 6.603   8.235   -72.183 1.00   51.82  ? 55   PRO B CB  1 
ATOM   4608 C CG  . PRO B 1 55  ? 7.831   8.984   -71.778 1.00   53.28  ? 55   PRO B CG  1 
ATOM   4609 C CD  . PRO B 1 55  ? 8.665   8.043   -70.929 1.00   43.99  ? 55   PRO B CD  1 
ATOM   4610 N N   . TRP B 1 56  ? 4.371   5.951   -71.487 1.00   45.33  ? 56   TRP B N   1 
ATOM   4611 C CA  . TRP B 1 56  ? 3.668   4.770   -71.973 1.00   46.86  ? 56   TRP B CA  1 
ATOM   4612 C C   . TRP B 1 56  ? 2.574   5.150   -72.958 1.00   52.01  ? 56   TRP B C   1 
ATOM   4613 O O   . TRP B 1 56  ? 2.128   6.299   -72.991 1.00   50.97  ? 56   TRP B O   1 
ATOM   4614 C CB  . TRP B 1 56  ? 3.061   3.988   -70.820 1.00   38.91  ? 56   TRP B CB  1 
ATOM   4615 C CG  . TRP B 1 56  ? 2.152   4.809   -69.998 1.00   51.66  ? 56   TRP B CG  1 
ATOM   4616 C CD1 . TRP B 1 56  ? 0.831   5.047   -70.227 1.00   52.80  ? 56   TRP B CD1 1 
ATOM   4617 C CD2 . TRP B 1 56  ? 2.490   5.523   -68.804 1.00   51.81  ? 56   TRP B CD2 1 
ATOM   4618 N NE1 . TRP B 1 56  ? 0.321   5.865   -69.247 1.00   53.82  ? 56   TRP B NE1 1 
ATOM   4619 C CE2 . TRP B 1 56  ? 1.320   6.170   -68.360 1.00   56.83  ? 56   TRP B CE2 1 
ATOM   4620 C CE3 . TRP B 1 56  ? 3.668   5.678   -68.069 1.00   48.54  ? 56   TRP B CE3 1 
ATOM   4621 C CZ2 . TRP B 1 56  ? 1.294   6.957   -67.208 1.00   49.78  ? 56   TRP B CZ2 1 
ATOM   4622 C CZ3 . TRP B 1 56  ? 3.639   6.462   -66.932 1.00   50.83  ? 56   TRP B CZ3 1 
ATOM   4623 C CH2 . TRP B 1 56  ? 2.461   7.090   -66.514 1.00   46.82  ? 56   TRP B CH2 1 
ATOM   4624 N N   . SER B 1 57  ? 2.149   4.176   -73.757 1.00   44.83  ? 57   SER B N   1 
ATOM   4625 C CA  . SER B 1 57  ? 1.147   4.411   -74.783 1.00   47.63  ? 57   SER B CA  1 
ATOM   4626 C C   . SER B 1 57  ? -0.231  4.049   -74.245 1.00   55.42  ? 57   SER B C   1 
ATOM   4627 O O   . SER B 1 57  ? -0.356  3.204   -73.359 1.00   49.27  ? 57   SER B O   1 
ATOM   4628 C CB  . SER B 1 57  ? 1.460   3.574   -76.029 1.00   48.67  ? 57   SER B CB  1 
ATOM   4629 O OG  . SER B 1 57  ? 1.210   2.188   -75.801 1.00   42.30  ? 57   SER B OG  1 
ATOM   4630 N N   . GLY B 1 58  ? -1.267  4.685   -74.781 1.00   48.67  ? 58   GLY B N   1 
ATOM   4631 C CA  . GLY B 1 58  ? -2.625  4.356   -74.390 1.00   45.62  ? 58   GLY B CA  1 
ATOM   4632 C C   . GLY B 1 58  ? -2.987  4.733   -72.965 1.00   52.86  ? 58   GLY B C   1 
ATOM   4633 O O   . GLY B 1 58  ? -2.454  5.701   -72.401 1.00   49.08  ? 58   GLY B O   1 
ATOM   4634 N N   . VAL B 1 59  ? -3.912  3.973   -72.387 1.00   44.01  ? 59   VAL B N   1 
ATOM   4635 C CA  . VAL B 1 59  ? -4.374  4.236   -71.029 1.00   49.76  ? 59   VAL B CA  1 
ATOM   4636 C C   . VAL B 1 59  ? -3.880  3.169   -70.066 1.00   54.44  ? 59   VAL B C   1 
ATOM   4637 O O   . VAL B 1 59  ? -4.343  2.021   -70.110 1.00   48.88  ? 59   VAL B O   1 
ATOM   4638 C CB  . VAL B 1 59  ? -5.925  4.296   -70.940 1.00   56.31  ? 59   VAL B CB  1 
ATOM   4639 C CG1 . VAL B 1 59  ? -6.366  4.546   -69.497 1.00   52.62  ? 59   VAL B CG1 1 
ATOM   4640 C CG2 . VAL B 1 59  ? -6.482  5.381   -71.865 1.00   47.54  ? 59   VAL B CG2 1 
ATOM   4641 N N   . LEU B 1 60  ? -2.944  3.550   -69.195 1.00   53.28  ? 60   LEU B N   1 
ATOM   4642 C CA  . LEU B 1 60  ? -2.458  2.652   -68.147 1.00   43.83  ? 60   LEU B CA  1 
ATOM   4643 C C   . LEU B 1 60  ? -3.545  2.407   -67.105 1.00   44.98  ? 60   LEU B C   1 
ATOM   4644 O O   . LEU B 1 60  ? -4.181  3.341   -66.618 1.00   52.37  ? 60   LEU B O   1 
ATOM   4645 C CB  . LEU B 1 60  ? -1.198  3.213   -67.491 1.00   50.03  ? 60   LEU B CB  1 
ATOM   4646 C CG  . LEU B 1 60  ? -0.383  2.210   -66.663 1.00   56.36  ? 60   LEU B CG  1 
ATOM   4647 C CD1 . LEU B 1 60  ? 1.088   2.604   -66.558 1.00   45.58  ? 60   LEU B CD1 1 
ATOM   4648 C CD2 . LEU B 1 60  ? -0.986  2.043   -65.270 1.00   62.87  ? 60   LEU B CD2 1 
ATOM   4649 N N   . ASP B 1 61  ? -3.763  1.141   -66.780 1.00   42.06  ? 61   ASP B N   1 
ATOM   4650 C CA  . ASP B 1 61  ? -4.763  0.761   -65.802 1.00   45.52  ? 61   ASP B CA  1 
ATOM   4651 C C   . ASP B 1 61  ? -4.254  0.956   -64.366 1.00   55.13  ? 61   ASP B C   1 
ATOM   4652 O O   . ASP B 1 61  ? -3.410  0.194   -63.892 1.00   57.20  ? 61   ASP B O   1 
ATOM   4653 C CB  . ASP B 1 61  ? -5.164  -0.699  -66.019 1.00   45.44  ? 61   ASP B CB  1 
ATOM   4654 C CG  . ASP B 1 61  ? -5.913  -1.272  -64.834 1.00   61.43  ? 61   ASP B CG  1 
ATOM   4655 O OD1 . ASP B 1 61  ? -6.781  -0.558  -64.291 1.00   59.78  ? 61   ASP B OD1 1 
ATOM   4656 O OD2 . ASP B 1 61  ? -5.621  -2.420  -64.427 1.00   60.74  ? 61   ASP B OD2 1 
ATOM   4657 N N   . ALA B 1 62  ? -4.769  1.973   -63.677 1.00   56.17  ? 62   ALA B N   1 
ATOM   4658 C CA  . ALA B 1 62  ? -4.384  2.247   -62.287 1.00   51.31  ? 62   ALA B CA  1 
ATOM   4659 C C   . ALA B 1 62  ? -5.561  2.049   -61.348 1.00   47.15  ? 62   ALA B C   1 
ATOM   4660 O O   . ALA B 1 62  ? -5.970  2.972   -60.646 1.00   44.72  ? 62   ALA B O   1 
ATOM   4661 C CB  . ALA B 1 62  ? -3.840  3.660   -62.147 1.00   43.21  ? 62   ALA B CB  1 
ATOM   4662 N N   . THR B 1 63  ? -6.113  0.846   -61.353 1.00   44.32  ? 63   THR B N   1 
ATOM   4663 C CA  . THR B 1 63  ? -7.291  0.553   -60.551 1.00   48.24  ? 63   THR B CA  1 
ATOM   4664 C C   . THR B 1 63  ? -6.958  -0.472  -59.477 1.00   48.23  ? 63   THR B C   1 
ATOM   4665 O O   . THR B 1 63  ? -7.823  -0.865  -58.698 1.00   49.21  ? 63   THR B O   1 
ATOM   4666 C CB  . THR B 1 63  ? -8.465  0.023   -61.427 1.00   50.03  ? 63   THR B CB  1 
ATOM   4667 O OG1 . THR B 1 63  ? -8.176  -1.303  -61.902 1.00   49.93  ? 63   THR B OG1 1 
ATOM   4668 C CG2 . THR B 1 63  ? -8.703  0.945   -62.614 1.00   43.19  ? 63   THR B CG2 1 
ATOM   4669 N N   . THR B 1 64  ? -5.695  -0.883  -59.426 1.00   46.88  ? 64   THR B N   1 
ATOM   4670 C CA  . THR B 1 64  ? -5.295  -2.004  -58.585 1.00   48.01  ? 64   THR B CA  1 
ATOM   4671 C C   . THR B 1 64  ? -3.895  -1.801  -57.964 1.00   45.00  ? 64   THR B C   1 
ATOM   4672 O O   . THR B 1 64  ? -3.000  -1.243  -58.595 1.00   46.26  ? 64   THR B O   1 
ATOM   4673 C CB  . THR B 1 64  ? -5.365  -3.310  -59.411 1.00   50.82  ? 64   THR B CB  1 
ATOM   4674 O OG1 . THR B 1 64  ? -5.679  -4.410  -58.560 1.00   59.71  ? 64   THR B OG1 1 
ATOM   4675 C CG2 . THR B 1 64  ? -4.053  -3.581  -60.136 1.00   53.94  ? 64   THR B CG2 1 
ATOM   4676 N N   . PHE B 1 65  ? -3.722  -2.223  -56.714 1.00   43.14  ? 65   PHE B N   1 
ATOM   4677 C CA  . PHE B 1 65  ? -2.420  -2.131  -56.049 1.00   42.70  ? 65   PHE B CA  1 
ATOM   4678 C C   . PHE B 1 65  ? -1.395  -2.989  -56.765 1.00   48.13  ? 65   PHE B C   1 
ATOM   4679 O O   . PHE B 1 65  ? -1.683  -4.123  -57.161 1.00   46.44  ? 65   PHE B O   1 
ATOM   4680 C CB  . PHE B 1 65  ? -2.496  -2.613  -54.594 1.00   46.57  ? 65   PHE B CB  1 
ATOM   4681 C CG  . PHE B 1 65  ? -3.092  -1.619  -53.646 1.00   42.57  ? 65   PHE B CG  1 
ATOM   4682 C CD1 . PHE B 1 65  ? -2.587  -0.328  -53.557 1.00   43.50  ? 65   PHE B CD1 1 
ATOM   4683 C CD2 . PHE B 1 65  ? -4.138  -1.983  -52.819 1.00   42.18  ? 65   PHE B CD2 1 
ATOM   4684 C CE1 . PHE B 1 65  ? -3.133  0.585   -52.679 1.00   40.07  ? 65   PHE B CE1 1 
ATOM   4685 C CE2 . PHE B 1 65  ? -4.685  -1.079  -51.935 1.00   42.86  ? 65   PHE B CE2 1 
ATOM   4686 C CZ  . PHE B 1 65  ? -4.186  0.210   -51.868 1.00   44.90  ? 65   PHE B CZ  1 
ATOM   4687 N N   . GLN B 1 66  ? -0.184  -2.470  -56.894 1.00   46.95  ? 66   GLN B N   1 
ATOM   4688 C CA  . GLN B 1 66  ? 0.882   -3.225  -57.535 1.00   42.35  ? 66   GLN B CA  1 
ATOM   4689 C C   . GLN B 1 66  ? 1.576   -4.181  -56.567 1.00   47.06  ? 66   GLN B C   1 
ATOM   4690 O O   . GLN B 1 66  ? 1.192   -4.311  -55.402 1.00   42.98  ? 66   GLN B O   1 
ATOM   4691 C CB  . GLN B 1 66  ? 1.898   -2.279  -58.161 1.00   45.49  ? 66   GLN B CB  1 
ATOM   4692 C CG  . GLN B 1 66  ? 1.592   -1.929  -59.589 1.00   44.53  ? 66   GLN B CG  1 
ATOM   4693 C CD  . GLN B 1 66  ? 2.016   -3.029  -60.537 1.00   57.37  ? 66   GLN B CD  1 
ATOM   4694 O OE1 . GLN B 1 66  ? 2.433   -4.112  -60.105 1.00   55.03  ? 66   GLN B OE1 1 
ATOM   4695 N NE2 . GLN B 1 66  ? 1.925   -2.760  -61.838 1.00   50.83  ? 66   GLN B NE2 1 
ATOM   4696 N N   . ASN B 1 67  ? 2.603   -4.856  -57.062 1.00   45.63  ? 67   ASN B N   1 
ATOM   4697 C CA  . ASN B 1 67  ? 3.373   -5.764  -56.233 1.00   45.52  ? 67   ASN B CA  1 
ATOM   4698 C C   . ASN B 1 67  ? 4.111   -5.083  -55.085 1.00   45.12  ? 67   ASN B C   1 
ATOM   4699 O O   . ASN B 1 67  ? 4.453   -3.906  -55.143 1.00   45.13  ? 67   ASN B O   1 
ATOM   4700 C CB  . ASN B 1 67  ? 4.352   -6.555  -57.091 1.00   48.52  ? 67   ASN B CB  1 
ATOM   4701 C CG  . ASN B 1 67  ? 3.646   -7.495  -58.048 1.00   49.92  ? 67   ASN B CG  1 
ATOM   4702 O OD1 . ASN B 1 67  ? 2.739   -8.224  -57.652 1.00   49.23  ? 67   ASN B OD1 1 
ATOM   4703 N ND2 . ASN B 1 67  ? 4.052   -7.478  -59.308 1.00   44.68  ? 67   ASN B ND2 1 
ATOM   4704 N N   . VAL B 1 68  ? 4.348   -5.866  -54.046 1.00   41.81  ? 68   VAL B N   1 
ATOM   4705 C CA  . VAL B 1 68  ? 5.052   -5.445  -52.864 1.00   38.93  ? 68   VAL B CA  1 
ATOM   4706 C C   . VAL B 1 68  ? 6.544   -5.663  -53.065 1.00   44.05  ? 68   VAL B C   1 
ATOM   4707 O O   . VAL B 1 68  ? 6.960   -6.734  -53.529 1.00   42.74  ? 68   VAL B O   1 
ATOM   4708 C CB  . VAL B 1 68  ? 4.537   -6.269  -51.662 1.00   41.01  ? 68   VAL B CB  1 
ATOM   4709 C CG1 . VAL B 1 68  ? 5.493   -6.205  -50.475 1.00   39.43  ? 68   VAL B CG1 1 
ATOM   4710 C CG2 . VAL B 1 68  ? 3.132   -5.795  -51.277 1.00   37.37  ? 68   VAL B CG2 1 
ATOM   4711 N N   . CYS B 1 69  ? 7.347   -4.651  -52.735 1.00   37.64  ? 69   CYS B N   1 
ATOM   4712 C CA  . CYS B 1 69  ? 8.806   -4.779  -52.833 1.00   39.39  ? 69   CYS B CA  1 
ATOM   4713 C C   . CYS B 1 69  ? 9.304   -6.029  -52.111 1.00   42.98  ? 69   CYS B C   1 
ATOM   4714 O O   . CYS B 1 69  ? 8.820   -6.364  -51.021 1.00   41.38  ? 69   CYS B O   1 
ATOM   4715 C CB  . CYS B 1 69  ? 9.506   -3.541  -52.283 1.00   33.16  ? 69   CYS B CB  1 
ATOM   4716 S SG  . CYS B 1 69  ? 9.356   -2.080  -53.311 1.00   45.20  ? 69   CYS B SG  1 
ATOM   4717 N N   . TYR B 1 70  ? 10.267  -6.717  -52.718 1.00   40.41  ? 70   TYR B N   1 
ATOM   4718 C CA  . TYR B 1 70  ? 10.722  -7.994  -52.178 1.00   36.98  ? 70   TYR B CA  1 
ATOM   4719 C C   . TYR B 1 70  ? 11.267  -7.875  -50.754 1.00   40.86  ? 70   TYR B C   1 
ATOM   4720 O O   . TYR B 1 70  ? 12.175  -7.087  -50.493 1.00   45.02  ? 70   TYR B O   1 
ATOM   4721 C CB  . TYR B 1 70  ? 11.760  -8.679  -53.093 1.00   44.86  ? 70   TYR B CB  1 
ATOM   4722 C CG  . TYR B 1 70  ? 11.637  -10.172 -52.951 1.00   45.90  ? 70   TYR B CG  1 
ATOM   4723 C CD1 . TYR B 1 70  ? 12.238  -10.837 -51.893 1.00   39.28  ? 70   TYR B CD1 1 
ATOM   4724 C CD2 . TYR B 1 70  ? 10.830  -10.903 -53.815 1.00   43.67  ? 70   TYR B CD2 1 
ATOM   4725 C CE1 . TYR B 1 70  ? 12.077  -12.192 -51.724 1.00   49.94  ? 70   TYR B CE1 1 
ATOM   4726 C CE2 . TYR B 1 70  ? 10.662  -12.268 -53.649 1.00   49.19  ? 70   TYR B CE2 1 
ATOM   4727 C CZ  . TYR B 1 70  ? 11.287  -12.905 -52.601 1.00   48.85  ? 70   TYR B CZ  1 
ATOM   4728 O OH  . TYR B 1 70  ? 11.129  -14.254 -52.425 1.00   42.90  ? 70   TYR B OH  1 
ATOM   4729 N N   . GLN B 1 71  ? 10.740  -8.691  -49.846 1.00   40.50  ? 71   GLN B N   1 
ATOM   4730 C CA  . GLN B 1 71  ? 11.048  -8.536  -48.431 1.00   39.81  ? 71   GLN B CA  1 
ATOM   4731 C C   . GLN B 1 71  ? 10.793  -9.803  -47.619 1.00   43.78  ? 71   GLN B C   1 
ATOM   4732 O O   . GLN B 1 71  ? 9.998   -10.662 -48.007 1.00   40.92  ? 71   GLN B O   1 
ATOM   4733 C CB  . GLN B 1 71  ? 10.179  -7.421  -47.849 1.00   37.23  ? 71   GLN B CB  1 
ATOM   4734 C CG  . GLN B 1 71  ? 8.722   -7.824  -47.731 1.00   33.63  ? 71   GLN B CG  1 
ATOM   4735 C CD  . GLN B 1 71  ? 7.801   -6.666  -47.384 1.00   43.39  ? 71   GLN B CD  1 
ATOM   4736 O OE1 . GLN B 1 71  ? 7.039   -6.735  -46.418 1.00   41.89  ? 71   GLN B OE1 1 
ATOM   4737 N NE2 . GLN B 1 71  ? 7.858   -5.601  -48.175 1.00   38.28  ? 71   GLN B NE2 1 
ATOM   4738 N N   . TYR B 1 72  ? 11.458  -9.887  -46.472 1.00   41.46  ? 72   TYR B N   1 
ATOM   4739 C CA  . TYR B 1 72  ? 11.158  -10.883 -45.450 1.00   39.17  ? 72   TYR B CA  1 
ATOM   4740 C C   . TYR B 1 72  ? 9.678   -10.886 -45.075 1.00   44.23  ? 72   TYR B C   1 
ATOM   4741 O O   . TYR B 1 72  ? 9.015   -9.842  -45.060 1.00   42.14  ? 72   TYR B O   1 
ATOM   4742 C CB  . TYR B 1 72  ? 11.987  -10.572 -44.208 1.00   41.68  ? 72   TYR B CB  1 
ATOM   4743 C CG  . TYR B 1 72  ? 11.809  -11.535 -43.070 1.00   49.12  ? 72   TYR B CG  1 
ATOM   4744 C CD1 . TYR B 1 72  ? 12.404  -12.797 -43.102 1.00   50.49  ? 72   TYR B CD1 1 
ATOM   4745 C CD2 . TYR B 1 72  ? 11.064  -11.185 -41.952 1.00   47.49  ? 72   TYR B CD2 1 
ATOM   4746 C CE1 . TYR B 1 72  ? 12.253  -13.683 -42.049 1.00   51.21  ? 72   TYR B CE1 1 
ATOM   4747 C CE2 . TYR B 1 72  ? 10.898  -12.070 -40.894 1.00   48.86  ? 72   TYR B CE2 1 
ATOM   4748 C CZ  . TYR B 1 72  ? 11.500  -13.311 -40.944 1.00   54.35  ? 72   TYR B CZ  1 
ATOM   4749 O OH  . TYR B 1 72  ? 11.342  -14.189 -39.897 1.00   55.31  ? 72   TYR B OH  1 
ATOM   4750 N N   . VAL B 1 73  ? 9.165   -12.065 -44.748 1.00   46.27  ? 73   VAL B N   1 
ATOM   4751 C CA  . VAL B 1 73  ? 7.765   -12.216 -44.377 1.00   43.42  ? 73   VAL B CA  1 
ATOM   4752 C C   . VAL B 1 73  ? 7.705   -12.836 -42.990 1.00   52.17  ? 73   VAL B C   1 
ATOM   4753 O O   . VAL B 1 73  ? 8.359   -13.842 -42.732 1.00   51.08  ? 73   VAL B O   1 
ATOM   4754 C CB  . VAL B 1 73  ? 7.021   -13.110 -45.382 1.00   44.34  ? 73   VAL B CB  1 
ATOM   4755 C CG1 . VAL B 1 73  ? 5.626   -13.448 -44.884 1.00   43.09  ? 73   VAL B CG1 1 
ATOM   4756 C CG2 . VAL B 1 73  ? 6.977   -12.441 -46.759 1.00   48.64  ? 73   VAL B CG2 1 
ATOM   4757 N N   . ASP B 1 74  ? 6.928   -12.232 -42.093 1.00   56.55  ? 74   ASP B N   1 
ATOM   4758 C CA  . ASP B 1 74  ? 6.927   -12.669 -40.701 1.00   50.42  ? 74   ASP B CA  1 
ATOM   4759 C C   . ASP B 1 74  ? 6.334   -14.056 -40.504 1.00   51.10  ? 74   ASP B C   1 
ATOM   4760 O O   . ASP B 1 74  ? 5.370   -14.427 -41.164 1.00   61.07  ? 74   ASP B O   1 
ATOM   4761 C CB  . ASP B 1 74  ? 6.206   -11.672 -39.800 1.00   52.28  ? 74   ASP B CB  1 
ATOM   4762 C CG  . ASP B 1 74  ? 6.673   -11.769 -38.365 1.00   55.31  ? 74   ASP B CG  1 
ATOM   4763 O OD1 . ASP B 1 74  ? 7.797   -11.301 -38.079 1.00   51.60  ? 74   ASP B OD1 1 
ATOM   4764 O OD2 . ASP B 1 74  ? 5.945   -12.359 -37.542 1.00   54.36  ? 74   ASP B OD2 1 
ATOM   4765 N N   . THR B 1 75  ? 6.902   -14.804 -39.564 1.00   56.22  ? 75   THR B N   1 
ATOM   4766 C CA  . THR B 1 75  ? 6.511   -16.190 -39.330 1.00   57.97  ? 75   THR B CA  1 
ATOM   4767 C C   . THR B 1 75  ? 6.352   -16.513 -37.841 1.00   59.94  ? 75   THR B C   1 
ATOM   4768 O O   . THR B 1 75  ? 5.978   -17.627 -37.475 1.00   61.51  ? 75   THR B O   1 
ATOM   4769 C CB  . THR B 1 75  ? 7.554   -17.145 -39.931 1.00   60.68  ? 75   THR B CB  1 
ATOM   4770 O OG1 . THR B 1 75  ? 8.857   -16.787 -39.449 1.00   60.75  ? 75   THR B OG1 1 
ATOM   4771 C CG2 . THR B 1 75  ? 7.541   -17.056 -41.456 1.00   57.29  ? 75   THR B CG2 1 
ATOM   4772 N N   . LEU B 1 76  ? 6.631   -15.533 -36.989 1.00   58.71  ? 76   LEU B N   1 
ATOM   4773 C CA  . LEU B 1 76  ? 6.600   -15.728 -35.543 1.00   57.12  ? 76   LEU B CA  1 
ATOM   4774 C C   . LEU B 1 76  ? 5.276   -16.316 -35.047 1.00   61.68  ? 76   LEU B C   1 
ATOM   4775 O O   . LEU B 1 76  ? 5.269   -17.245 -34.236 1.00   63.40  ? 76   LEU B O   1 
ATOM   4776 C CB  . LEU B 1 76  ? 6.899   -14.406 -34.824 1.00   61.62  ? 76   LEU B CB  1 
ATOM   4777 C CG  . LEU B 1 76  ? 6.909   -14.386 -33.289 1.00   63.42  ? 76   LEU B CG  1 
ATOM   4778 C CD1 . LEU B 1 76  ? 7.949   -15.343 -32.741 1.00   57.25  ? 76   LEU B CD1 1 
ATOM   4779 C CD2 . LEU B 1 76  ? 7.169   -12.976 -32.777 1.00   62.54  ? 76   LEU B CD2 1 
ATOM   4780 N N   . TYR B 1 77  ? 4.161   -15.770 -35.522 1.00   57.56  ? 77   TYR B N   1 
ATOM   4781 C CA  . TYR B 1 77  ? 2.846   -16.244 -35.111 1.00   54.23  ? 77   TYR B CA  1 
ATOM   4782 C C   . TYR B 1 77  ? 1.982   -16.489 -36.338 1.00   60.10  ? 77   TYR B C   1 
ATOM   4783 O O   . TYR B 1 77  ? 1.122   -15.672 -36.673 1.00   55.66  ? 77   TYR B O   1 
ATOM   4784 C CB  . TYR B 1 77  ? 2.167   -15.229 -34.189 1.00   59.39  ? 77   TYR B CB  1 
ATOM   4785 C CG  . TYR B 1 77  ? 2.852   -15.059 -32.853 1.00   63.50  ? 77   TYR B CG  1 
ATOM   4786 C CD1 . TYR B 1 77  ? 2.766   -16.046 -31.882 1.00   64.85  ? 77   TYR B CD1 1 
ATOM   4787 C CD2 . TYR B 1 77  ? 3.581   -13.909 -32.557 1.00   61.82  ? 77   TYR B CD2 1 
ATOM   4788 C CE1 . TYR B 1 77  ? 3.391   -15.903 -30.652 1.00   65.70  ? 77   TYR B CE1 1 
ATOM   4789 C CE2 . TYR B 1 77  ? 4.211   -13.754 -31.325 1.00   62.23  ? 77   TYR B CE2 1 
ATOM   4790 C CZ  . TYR B 1 77  ? 4.111   -14.758 -30.377 1.00   66.14  ? 77   TYR B CZ  1 
ATOM   4791 O OH  . TYR B 1 77  ? 4.726   -14.631 -29.151 1.00   62.80  ? 77   TYR B OH  1 
ATOM   4792 N N   . PRO B 1 78  ? 2.213   -17.622 -37.018 1.00   65.93  ? 78   PRO B N   1 
ATOM   4793 C CA  . PRO B 1 78  ? 1.517   -17.907 -38.279 1.00   59.85  ? 78   PRO B CA  1 
ATOM   4794 C C   . PRO B 1 78  ? 0.008   -17.818 -38.121 1.00   51.47  ? 78   PRO B C   1 
ATOM   4795 O O   . PRO B 1 78  ? -0.536  -18.410 -37.201 1.00   59.32  ? 78   PRO B O   1 
ATOM   4796 C CB  . PRO B 1 78  ? 1.953   -19.340 -38.599 1.00   55.56  ? 78   PRO B CB  1 
ATOM   4797 C CG  . PRO B 1 78  ? 3.295   -19.477 -37.936 1.00   57.66  ? 78   PRO B CG  1 
ATOM   4798 C CD  . PRO B 1 78  ? 3.181   -18.678 -36.663 1.00   59.51  ? 78   PRO B CD  1 
ATOM   4799 N N   . GLY B 1 79  ? -0.646  -17.053 -38.989 1.00   55.08  ? 79   GLY B N   1 
ATOM   4800 C CA  . GLY B 1 79  ? -2.089  -16.909 -38.955 1.00   58.36  ? 79   GLY B CA  1 
ATOM   4801 C C   . GLY B 1 79  ? -2.636  -15.918 -37.943 1.00   61.79  ? 79   GLY B C   1 
ATOM   4802 O O   . GLY B 1 79  ? -3.853  -15.684 -37.895 1.00   51.00  ? 79   GLY B O   1 
ATOM   4803 N N   . PHE B 1 80  ? -1.752  -15.342 -37.126 1.00   57.24  ? 80   PHE B N   1 
ATOM   4804 C CA  . PHE B 1 80  ? -2.161  -14.369 -36.115 1.00   57.97  ? 80   PHE B CA  1 
ATOM   4805 C C   . PHE B 1 80  ? -2.332  -12.987 -36.743 1.00   55.32  ? 80   PHE B C   1 
ATOM   4806 O O   . PHE B 1 80  ? -1.398  -12.457 -37.335 1.00   57.87  ? 80   PHE B O   1 
ATOM   4807 C CB  . PHE B 1 80  ? -1.142  -14.323 -34.971 1.00   59.82  ? 80   PHE B CB  1 
ATOM   4808 C CG  . PHE B 1 80  ? -1.409  -13.241 -33.955 1.00   58.56  ? 80   PHE B CG  1 
ATOM   4809 C CD1 . PHE B 1 80  ? -2.686  -13.042 -33.446 1.00   60.43  ? 80   PHE B CD1 1 
ATOM   4810 C CD2 . PHE B 1 80  ? -0.379  -12.433 -33.500 1.00   60.32  ? 80   PHE B CD2 1 
ATOM   4811 C CE1 . PHE B 1 80  ? -2.937  -12.048 -32.510 1.00   58.33  ? 80   PHE B CE1 1 
ATOM   4812 C CE2 . PHE B 1 80  ? -0.617  -11.442 -32.558 1.00   60.81  ? 80   PHE B CE2 1 
ATOM   4813 C CZ  . PHE B 1 80  ? -1.902  -11.249 -32.061 1.00   60.01  ? 80   PHE B CZ  1 
ATOM   4814 N N   . GLU B 1 81  ? -3.524  -12.412 -36.608 1.00   48.31  ? 81   GLU B N   1 
ATOM   4815 C CA  . GLU B 1 81  ? -3.838  -11.115 -37.211 1.00   58.15  ? 81   GLU B CA  1 
ATOM   4816 C C   . GLU B 1 81  ? -2.931  -9.974  -36.737 1.00   57.42  ? 81   GLU B C   1 
ATOM   4817 O O   . GLU B 1 81  ? -2.598  -9.080  -37.509 1.00   57.20  ? 81   GLU B O   1 
ATOM   4818 C CB  . GLU B 1 81  ? -5.312  -10.752 -36.992 1.00   56.25  ? 81   GLU B CB  1 
ATOM   4819 C CG  . GLU B 1 81  ? -5.771  -9.474  -37.705 1.00   74.09  ? 81   GLU B CG  1 
ATOM   4820 C CD  . GLU B 1 81  ? -5.724  -9.571  -39.241 1.00   92.01  ? 81   GLU B CD  1 
ATOM   4821 O OE1 . GLU B 1 81  ? -5.077  -10.503 -39.782 1.00   84.19  ? 81   GLU B OE1 1 
ATOM   4822 O OE2 . GLU B 1 81  ? -6.335  -8.703  -39.914 1.00   89.05  ? 81   GLU B OE2 1 
ATOM   4823 N N   . GLY B 1 82  ? -2.533  -10.017 -35.472 1.00   59.16  ? 82   GLY B N   1 
ATOM   4824 C CA  . GLY B 1 82  ? -1.643  -9.019  -34.915 1.00   55.25  ? 82   GLY B CA  1 
ATOM   4825 C C   . GLY B 1 82  ? -0.378  -8.833  -35.725 1.00   53.69  ? 82   GLY B C   1 
ATOM   4826 O O   . GLY B 1 82  ? 0.056   -7.704  -35.946 1.00   50.60  ? 82   GLY B O   1 
ATOM   4827 N N   . THR B 1 83  ? 0.214   -9.939  -36.171 1.00   52.20  ? 83   THR B N   1 
ATOM   4828 C CA  . THR B 1 83  ? 1.410   -9.877  -37.005 1.00   51.04  ? 83   THR B CA  1 
ATOM   4829 C C   . THR B 1 83  ? 1.092   -9.862  -38.500 1.00   50.83  ? 83   THR B C   1 
ATOM   4830 O O   . THR B 1 83  ? 1.801   -9.238  -39.289 1.00   51.66  ? 83   THR B O   1 
ATOM   4831 C CB  . THR B 1 83  ? 2.368   -11.056 -36.730 1.00   54.41  ? 83   THR B CB  1 
ATOM   4832 O OG1 . THR B 1 83  ? 1.642   -12.290 -36.787 1.00   62.50  ? 83   THR B OG1 1 
ATOM   4833 C CG2 . THR B 1 83  ? 3.020   -10.922 -35.370 1.00   52.45  ? 83   THR B CG2 1 
ATOM   4834 N N   . GLU B 1 84  ? 0.034   -10.557 -38.895 1.00   54.75  ? 84   GLU B N   1 
ATOM   4835 C CA  . GLU B 1 84  ? -0.230  -10.750 -40.319 1.00   54.51  ? 84   GLU B CA  1 
ATOM   4836 C C   . GLU B 1 84  ? -0.623  -9.444  -40.986 1.00   49.53  ? 84   GLU B C   1 
ATOM   4837 O O   . GLU B 1 84  ? -0.440  -9.282  -42.191 1.00   49.74  ? 84   GLU B O   1 
ATOM   4838 C CB  . GLU B 1 84  ? -1.318  -11.805 -40.551 1.00   56.23  ? 84   GLU B CB  1 
ATOM   4839 C CG  . GLU B 1 84  ? -0.973  -13.227 -40.100 1.00   61.12  ? 84   GLU B CG  1 
ATOM   4840 C CD  . GLU B 1 84  ? -0.006  -13.934 -41.033 1.00   68.84  ? 84   GLU B CD  1 
ATOM   4841 O OE1 . GLU B 1 84  ? 0.256   -13.391 -42.132 1.00   75.15  ? 84   GLU B OE1 1 
ATOM   4842 O OE2 . GLU B 1 84  ? 0.495   -15.027 -40.663 1.00   65.81  ? 84   GLU B OE2 1 
ATOM   4843 N N   . MET B 1 85  ? -1.161  -8.510  -40.205 1.00   49.41  ? 85   MET B N   1 
ATOM   4844 C CA  . MET B 1 85  ? -1.627  -7.230  -40.760 1.00   47.96  ? 85   MET B CA  1 
ATOM   4845 C C   . MET B 1 85  ? -0.490  -6.394  -41.353 1.00   45.46  ? 85   MET B C   1 
ATOM   4846 O O   . MET B 1 85  ? -0.721  -5.504  -42.176 1.00   46.64  ? 85   MET B O   1 
ATOM   4847 C CB  . MET B 1 85  ? -2.382  -6.417  -39.709 1.00   52.09  ? 85   MET B CB  1 
ATOM   4848 C CG  . MET B 1 85  ? -1.600  -6.158  -38.424 1.00   45.37  ? 85   MET B CG  1 
ATOM   4849 S SD  . MET B 1 85  ? -2.523  -5.079  -37.321 1.00   54.32  ? 85   MET B SD  1 
ATOM   4850 C CE  . MET B 1 85  ? -2.530  -3.553  -38.258 1.00   45.84  ? 85   MET B CE  1 
ATOM   4851 N N   . TRP B 1 86  ? 0.733   -6.693  -40.933 1.00   42.22  ? 86   TRP B N   1 
ATOM   4852 C CA  . TRP B 1 86  ? 1.913   -6.021  -41.460 1.00   47.81  ? 86   TRP B CA  1 
ATOM   4853 C C   . TRP B 1 86  ? 2.559   -6.765  -42.638 1.00   45.29  ? 86   TRP B C   1 
ATOM   4854 O O   . TRP B 1 86  ? 3.385   -6.197  -43.341 1.00   42.20  ? 86   TRP B O   1 
ATOM   4855 C CB  . TRP B 1 86  ? 2.927   -5.778  -40.328 1.00   45.39  ? 86   TRP B CB  1 
ATOM   4856 C CG  . TRP B 1 86  ? 2.277   -5.152  -39.131 1.00   47.45  ? 86   TRP B CG  1 
ATOM   4857 C CD1 . TRP B 1 86  ? 1.960   -5.763  -37.953 1.00   48.13  ? 86   TRP B CD1 1 
ATOM   4858 C CD2 . TRP B 1 86  ? 1.827   -3.795  -39.011 1.00   44.10  ? 86   TRP B CD2 1 
ATOM   4859 N NE1 . TRP B 1 86  ? 1.346   -4.870  -37.107 1.00   46.55  ? 86   TRP B NE1 1 
ATOM   4860 C CE2 . TRP B 1 86  ? 1.257   -3.654  -37.731 1.00   46.26  ? 86   TRP B CE2 1 
ATOM   4861 C CE3 . TRP B 1 86  ? 1.863   -2.683  -39.860 1.00   43.92  ? 86   TRP B CE3 1 
ATOM   4862 C CZ2 . TRP B 1 86  ? 0.730   -2.443  -37.276 1.00   48.92  ? 86   TRP B CZ2 1 
ATOM   4863 C CZ3 . TRP B 1 86  ? 1.332   -1.480  -39.409 1.00   44.86  ? 86   TRP B CZ3 1 
ATOM   4864 C CH2 . TRP B 1 86  ? 0.776   -1.370  -38.128 1.00   45.53  ? 86   TRP B CH2 1 
ATOM   4865 N N   . ASN B 1 87  ? 2.180   -8.026  -42.854 1.00   46.97  ? 87   ASN B N   1 
ATOM   4866 C CA  . ASN B 1 87  ? 2.771   -8.839  -43.926 1.00   45.13  ? 87   ASN B CA  1 
ATOM   4867 C C   . ASN B 1 87  ? 2.289   -8.412  -45.324 1.00   43.30  ? 87   ASN B C   1 
ATOM   4868 O O   . ASN B 1 87  ? 1.217   -7.817  -45.464 1.00   37.08  ? 87   ASN B O   1 
ATOM   4869 C CB  . ASN B 1 87  ? 2.502   -10.332 -43.690 1.00   44.59  ? 87   ASN B CB  1 
ATOM   4870 C CG  . ASN B 1 87  ? 3.566   -11.001 -42.815 1.00   48.94  ? 87   ASN B CG  1 
ATOM   4871 O OD1 . ASN B 1 87  ? 4.710   -10.548 -42.731 1.00   51.65  ? 87   ASN B OD1 1 
ATOM   4872 N ND2 . ASN B 1 87  ? 3.191   -12.101 -42.179 1.00   52.00  ? 87   ASN B ND2 1 
ATOM   4873 N N   . PRO B 1 88  ? 3.087   -8.697  -46.365 1.00   42.17  ? 88   PRO B N   1 
ATOM   4874 C CA  . PRO B 1 88  ? 2.668   -8.287  -47.719 1.00   45.22  ? 88   PRO B CA  1 
ATOM   4875 C C   . PRO B 1 88  ? 1.282   -8.832  -48.098 1.00   48.52  ? 88   PRO B C   1 
ATOM   4876 O O   . PRO B 1 88  ? 1.001   -10.013 -47.896 1.00   45.09  ? 88   PRO B O   1 
ATOM   4877 C CB  . PRO B 1 88  ? 3.743   -8.890  -48.627 1.00   37.49  ? 88   PRO B CB  1 
ATOM   4878 C CG  . PRO B 1 88  ? 4.919   -9.140  -47.731 1.00   41.66  ? 88   PRO B CG  1 
ATOM   4879 C CD  . PRO B 1 88  ? 4.346   -9.461  -46.373 1.00   43.07  ? 88   PRO B CD  1 
ATOM   4880 N N   . ASN B 1 89  ? 0.423   -7.963  -48.621 1.00   47.05  ? 89   ASN B N   1 
ATOM   4881 C CA  . ASN B 1 89  ? -0.915  -8.356  -49.043 1.00   46.09  ? 89   ASN B CA  1 
ATOM   4882 C C   . ASN B 1 89  ? -1.050  -8.362  -50.576 1.00   50.79  ? 89   ASN B C   1 
ATOM   4883 O O   . ASN B 1 89  ? -2.151  -8.232  -51.115 1.00   50.88  ? 89   ASN B O   1 
ATOM   4884 C CB  . ASN B 1 89  ? -1.985  -7.471  -48.379 1.00   42.02  ? 89   ASN B CB  1 
ATOM   4885 C CG  . ASN B 1 89  ? -1.961  -6.025  -48.877 1.00   47.62  ? 89   ASN B CG  1 
ATOM   4886 O OD1 . ASN B 1 89  ? -2.970  -5.319  -48.805 1.00   49.41  ? 89   ASN B OD1 1 
ATOM   4887 N ND2 . ASN B 1 89  ? -0.815  -5.582  -49.383 1.00   41.21  ? 89   ASN B ND2 1 
ATOM   4888 N N   . ARG B 1 90  ? 0.090   -8.500  -51.255 1.00   43.28  ? 90   ARG B N   1 
ATOM   4889 C CA  . ARG B 1 90  ? 0.160   -8.681  -52.704 1.00   44.87  ? 90   ARG B CA  1 
ATOM   4890 C C   . ARG B 1 90  ? 1.425   -9.482  -53.023 1.00   51.05  ? 90   ARG B C   1 
ATOM   4891 O O   . ARG B 1 90  ? 2.265   -9.698  -52.152 1.00   49.41  ? 90   ARG B O   1 
ATOM   4892 C CB  . ARG B 1 90  ? 0.191   -7.338  -53.441 1.00   43.52  ? 90   ARG B CB  1 
ATOM   4893 C CG  . ARG B 1 90  ? -1.080  -6.507  -53.338 1.00   47.78  ? 90   ARG B CG  1 
ATOM   4894 C CD  . ARG B 1 90  ? -2.278  -7.223  -53.965 1.00   47.02  ? 90   ARG B CD  1 
ATOM   4895 N NE  . ARG B 1 90  ? -3.414  -6.331  -54.146 1.00   52.77  ? 90   ARG B NE  1 
ATOM   4896 C CZ  . ARG B 1 90  ? -4.307  -6.062  -53.197 1.00   56.58  ? 90   ARG B CZ  1 
ATOM   4897 N NH1 . ARG B 1 90  ? -4.189  -6.620  -51.997 1.00   47.08  ? 90   ARG B NH1 1 
ATOM   4898 N NH2 . ARG B 1 90  ? -5.318  -5.232  -53.443 1.00   45.47  ? 90   ARG B NH2 1 
ATOM   4899 N N   . GLU B 1 91  ? 1.555   -9.931  -54.265 1.00   54.35  ? 91   GLU B N   1 
ATOM   4900 C CA  . GLU B 1 91  ? 2.734   -10.689 -54.684 1.00   55.33  ? 91   GLU B CA  1 
ATOM   4901 C C   . GLU B 1 91  ? 4.024   -9.905  -54.461 1.00   44.39  ? 91   GLU B C   1 
ATOM   4902 O O   . GLU B 1 91  ? 4.089   -8.714  -54.748 1.00   45.27  ? 91   GLU B O   1 
ATOM   4903 C CB  . GLU B 1 91  ? 2.630   -11.086 -56.170 1.00   54.79  ? 91   GLU B CB  1 
ATOM   4904 C CG  . GLU B 1 91  ? 1.659   -12.233 -56.465 1.00   56.73  ? 91   GLU B CG  1 
ATOM   4905 C CD  . GLU B 1 91  ? 1.958   -13.471 -55.643 1.00   65.37  ? 91   GLU B CD  1 
ATOM   4906 O OE1 . GLU B 1 91  ? 3.051   -14.059 -55.808 1.00   73.21  ? 91   GLU B OE1 1 
ATOM   4907 O OE2 . GLU B 1 91  ? 1.101   -13.858 -54.822 1.00   75.95  ? 91   GLU B OE2 1 
ATOM   4908 N N   . LEU B 1 92  ? 5.051   -10.577 -53.952 1.00   44.29  ? 92   LEU B N   1 
ATOM   4909 C CA  . LEU B 1 92  ? 6.362   -9.959  -53.824 1.00   37.94  ? 92   LEU B CA  1 
ATOM   4910 C C   . LEU B 1 92  ? 6.990   -9.811  -55.200 1.00   46.22  ? 92   LEU B C   1 
ATOM   4911 O O   . LEU B 1 92  ? 6.698   -10.585 -56.096 1.00   47.34  ? 92   LEU B O   1 
ATOM   4912 C CB  . LEU B 1 92  ? 7.276   -10.807 -52.947 1.00   40.27  ? 92   LEU B CB  1 
ATOM   4913 C CG  . LEU B 1 92  ? 6.789   -11.132 -51.533 1.00   44.43  ? 92   LEU B CG  1 
ATOM   4914 C CD1 . LEU B 1 92  ? 7.858   -11.882 -50.764 1.00   33.29  ? 92   LEU B CD1 1 
ATOM   4915 C CD2 . LEU B 1 92  ? 6.390   -9.878  -50.804 1.00   35.19  ? 92   LEU B CD2 1 
ATOM   4916 N N   . SER B 1 93  ? 7.868   -8.829  -55.362 1.00   43.60  ? 93   SER B N   1 
ATOM   4917 C CA  . SER B 1 93  ? 8.594   -8.663  -56.609 1.00   39.84  ? 93   SER B CA  1 
ATOM   4918 C C   . SER B 1 93  ? 9.570   -7.500  -56.473 1.00   41.68  ? 93   SER B C   1 
ATOM   4919 O O   . SER B 1 93  ? 9.252   -6.503  -55.834 1.00   47.31  ? 93   SER B O   1 
ATOM   4920 C CB  . SER B 1 93  ? 7.616   -8.397  -57.763 1.00   38.40  ? 93   SER B CB  1 
ATOM   4921 O OG  . SER B 1 93  ? 8.299   -7.967  -58.932 1.00   37.52  ? 93   SER B OG  1 
ATOM   4922 N N   . GLU B 1 94  ? 10.746  -7.614  -57.078 1.00   34.79  ? 94   GLU B N   1 
ATOM   4923 C CA  . GLU B 1 94  ? 11.647  -6.467  -57.177 1.00   35.55  ? 94   GLU B CA  1 
ATOM   4924 C C   . GLU B 1 94  ? 11.079  -5.381  -58.083 1.00   40.85  ? 94   GLU B C   1 
ATOM   4925 O O   . GLU B 1 94  ? 11.514  -4.228  -58.041 1.00   40.69  ? 94   GLU B O   1 
ATOM   4926 C CB  . GLU B 1 94  ? 13.034  -6.890  -57.644 1.00   33.90  ? 94   GLU B CB  1 
ATOM   4927 C CG  . GLU B 1 94  ? 13.760  -7.773  -56.635 1.00   41.57  ? 94   GLU B CG  1 
ATOM   4928 C CD  . GLU B 1 94  ? 15.132  -8.201  -57.107 1.00   47.97  ? 94   GLU B CD  1 
ATOM   4929 O OE1 . GLU B 1 94  ? 16.042  -7.347  -57.185 1.00   44.83  ? 94   GLU B OE1 1 
ATOM   4930 O OE2 . GLU B 1 94  ? 15.297  -9.402  -57.399 1.00   46.13  ? 94   GLU B OE2 1 
ATOM   4931 N N   . ASP B 1 95  ? 10.100  -5.751  -58.902 1.00   40.33  ? 95   ASP B N   1 
ATOM   4932 C CA  . ASP B 1 95  ? 9.405   -4.773  -59.712 1.00   40.96  ? 95   ASP B CA  1 
ATOM   4933 C C   . ASP B 1 95  ? 8.278   -4.202  -58.865 1.00   39.07  ? 95   ASP B C   1 
ATOM   4934 O O   . ASP B 1 95  ? 7.158   -4.702  -58.898 1.00   40.34  ? 95   ASP B O   1 
ATOM   4935 C CB  . ASP B 1 95  ? 8.877   -5.424  -60.990 1.00   38.23  ? 95   ASP B CB  1 
ATOM   4936 C CG  . ASP B 1 95  ? 8.176   -4.445  -61.905 1.00   40.40  ? 95   ASP B CG  1 
ATOM   4937 O OD1 . ASP B 1 95  ? 7.966   -3.275  -61.510 1.00   42.50  ? 95   ASP B OD1 1 
ATOM   4938 O OD2 . ASP B 1 95  ? 7.818   -4.855  -63.026 1.00   43.11  ? 95   ASP B OD2 1 
ATOM   4939 N N   . CYS B 1 96  ? 8.580   -3.154  -58.099 1.00   38.71  ? 96   CYS B N   1 
ATOM   4940 C CA  . CYS B 1 96  ? 7.646   -2.678  -57.065 1.00   37.74  ? 96   CYS B CA  1 
ATOM   4941 C C   . CYS B 1 96  ? 7.543   -1.174  -56.955 1.00   38.37  ? 96   CYS B C   1 
ATOM   4942 O O   . CYS B 1 96  ? 6.824   -0.673  -56.104 1.00   40.37  ? 96   CYS B O   1 
ATOM   4943 C CB  . CYS B 1 96  ? 8.036   -3.224  -55.693 1.00   36.88  ? 96   CYS B CB  1 
ATOM   4944 S SG  . CYS B 1 96  ? 9.732   -2.799  -55.209 1.00   39.23  ? 96   CYS B SG  1 
ATOM   4945 N N   . LEU B 1 97  ? 8.258   -0.455  -57.807 1.00   37.68  ? 97   LEU B N   1 
ATOM   4946 C CA  . LEU B 1 97  ? 8.308   0.991   -57.687 1.00   37.96  ? 97   LEU B CA  1 
ATOM   4947 C C   . LEU B 1 97  ? 7.054   1.677   -58.237 1.00   36.45  ? 97   LEU B C   1 
ATOM   4948 O O   . LEU B 1 97  ? 7.047   2.264   -59.322 1.00   35.18  ? 97   LEU B O   1 
ATOM   4949 C CB  . LEU B 1 97  ? 9.608   1.539   -58.281 1.00   31.85  ? 97   LEU B CB  1 
ATOM   4950 C CG  . LEU B 1 97  ? 10.808  1.149   -57.418 1.00   38.78  ? 97   LEU B CG  1 
ATOM   4951 C CD1 . LEU B 1 97  ? 12.056  1.914   -57.833 1.00   37.79  ? 97   LEU B CD1 1 
ATOM   4952 C CD2 . LEU B 1 97  ? 10.484  1.383   -55.917 1.00   35.75  ? 97   LEU B CD2 1 
ATOM   4953 N N   . TYR B 1 98  ? 5.992   1.611   -57.446 1.00   39.93  ? 98   TYR B N   1 
ATOM   4954 C CA  . TYR B 1 98  ? 4.723   2.214   -57.818 1.00   37.05  ? 98   TYR B CA  1 
ATOM   4955 C C   . TYR B 1 98  ? 4.201   3.075   -56.684 1.00   40.66  ? 98   TYR B C   1 
ATOM   4956 O O   . TYR B 1 98  ? 4.535   2.850   -55.521 1.00   44.87  ? 98   TYR B O   1 
ATOM   4957 C CB  . TYR B 1 98  ? 3.715   1.113   -58.160 1.00   38.97  ? 98   TYR B CB  1 
ATOM   4958 C CG  . TYR B 1 98  ? 4.194   0.224   -59.280 1.00   48.66  ? 98   TYR B CG  1 
ATOM   4959 C CD1 . TYR B 1 98  ? 3.969   0.573   -60.612 1.00   48.46  ? 98   TYR B CD1 1 
ATOM   4960 C CD2 . TYR B 1 98  ? 4.905   -0.948  -59.013 1.00   41.77  ? 98   TYR B CD2 1 
ATOM   4961 C CE1 . TYR B 1 98  ? 4.416   -0.228  -61.647 1.00   50.76  ? 98   TYR B CE1 1 
ATOM   4962 C CE2 . TYR B 1 98  ? 5.365   -1.747  -60.037 1.00   46.92  ? 98   TYR B CE2 1 
ATOM   4963 C CZ  . TYR B 1 98  ? 5.113   -1.386  -61.357 1.00   50.60  ? 98   TYR B CZ  1 
ATOM   4964 O OH  . TYR B 1 98  ? 5.565   -2.178  -62.385 1.00   46.86  ? 98   TYR B OH  1 
ATOM   4965 N N   . LEU B 1 99  ? 3.365   4.049   -57.022 1.00   42.88  ? 99   LEU B N   1 
ATOM   4966 C CA  . LEU B 1 99  ? 2.702   4.862   -56.012 1.00   40.37  ? 99   LEU B CA  1 
ATOM   4967 C C   . LEU B 1 99  ? 1.175   4.900   -56.189 1.00   44.46  ? 99   LEU B C   1 
ATOM   4968 O O   . LEU B 1 99  ? 0.654   4.519   -57.234 1.00   44.05  ? 99   LEU B O   1 
ATOM   4969 C CB  . LEU B 1 99  ? 3.300   6.271   -55.974 1.00   36.17  ? 99   LEU B CB  1 
ATOM   4970 C CG  . LEU B 1 99  ? 3.295   7.141   -57.227 1.00   41.24  ? 99   LEU B CG  1 
ATOM   4971 C CD1 . LEU B 1 99  ? 1.898   7.688   -57.522 1.00   40.39  ? 99   LEU B CD1 1 
ATOM   4972 C CD2 . LEU B 1 99  ? 4.301   8.285   -57.083 1.00   37.21  ? 99   LEU B CD2 1 
ATOM   4973 N N   . ASN B 1 100 ? 0.475   5.362   -55.152 1.00   43.52  ? 100  ASN B N   1 
ATOM   4974 C CA  . ASN B 1 100 ? -0.982  5.413   -55.125 1.00   41.41  ? 100  ASN B CA  1 
ATOM   4975 C C   . ASN B 1 100 ? -1.493  6.811   -54.785 1.00   46.63  ? 100  ASN B C   1 
ATOM   4976 O O   . ASN B 1 100 ? -0.846  7.558   -54.059 1.00   43.32  ? 100  ASN B O   1 
ATOM   4977 C CB  . ASN B 1 100 ? -1.518  4.427   -54.097 1.00   35.20  ? 100  ASN B CB  1 
ATOM   4978 C CG  . ASN B 1 100 ? -0.836  3.084   -54.181 1.00   40.38  ? 100  ASN B CG  1 
ATOM   4979 O OD1 . ASN B 1 100 ? -0.831  2.446   -55.232 1.00   48.10  ? 100  ASN B OD1 1 
ATOM   4980 N ND2 . ASN B 1 100 ? -0.257  2.639   -53.072 1.00   37.13  ? 100  ASN B ND2 1 
ATOM   4981 N N   . VAL B 1 101 ? -2.660  7.162   -55.317 1.00   50.43  ? 101  VAL B N   1 
ATOM   4982 C CA  . VAL B 1 101 ? -3.258  8.464   -55.068 1.00   41.42  ? 101  VAL B CA  1 
ATOM   4983 C C   . VAL B 1 101 ? -4.755  8.305   -54.839 1.00   47.75  ? 101  VAL B C   1 
ATOM   4984 O O   . VAL B 1 101 ? -5.446  7.691   -55.648 1.00   49.17  ? 101  VAL B O   1 
ATOM   4985 C CB  . VAL B 1 101 ? -3.068  9.405   -56.264 1.00   44.02  ? 101  VAL B CB  1 
ATOM   4986 C CG1 . VAL B 1 101 ? -3.685  10.755  -55.971 1.00   40.84  ? 101  VAL B CG1 1 
ATOM   4987 C CG2 . VAL B 1 101 ? -1.588  9.552   -56.615 1.00   46.36  ? 101  VAL B CG2 1 
ATOM   4988 N N   . TRP B 1 102 ? -5.246  8.843   -53.727 1.00   45.83  ? 102  TRP B N   1 
ATOM   4989 C CA  . TRP B 1 102 ? -6.675  8.938   -53.472 1.00   43.58  ? 102  TRP B CA  1 
ATOM   4990 C C   . TRP B 1 102 ? -7.067  10.406  -53.520 1.00   49.65  ? 102  TRP B C   1 
ATOM   4991 O O   . TRP B 1 102 ? -6.352  11.261  -52.988 1.00   51.83  ? 102  TRP B O   1 
ATOM   4992 C CB  . TRP B 1 102 ? -7.010  8.410   -52.084 1.00   42.15  ? 102  TRP B CB  1 
ATOM   4993 C CG  . TRP B 1 102 ? -7.003  6.929   -51.918 1.00   43.76  ? 102  TRP B CG  1 
ATOM   4994 C CD1 . TRP B 1 102 ? -8.073  6.078   -52.038 1.00   43.13  ? 102  TRP B CD1 1 
ATOM   4995 C CD2 . TRP B 1 102 ? -5.886  6.117   -51.544 1.00   43.35  ? 102  TRP B CD2 1 
ATOM   4996 N NE1 . TRP B 1 102 ? -7.682  4.785   -51.771 1.00   45.88  ? 102  TRP B NE1 1 
ATOM   4997 C CE2 . TRP B 1 102 ? -6.343  4.782   -51.472 1.00   47.28  ? 102  TRP B CE2 1 
ATOM   4998 C CE3 . TRP B 1 102 ? -4.545  6.383   -51.268 1.00   42.90  ? 102  TRP B CE3 1 
ATOM   4999 C CZ2 . TRP B 1 102 ? -5.502  3.727   -51.131 1.00   42.23  ? 102  TRP B CZ2 1 
ATOM   5000 C CZ3 . TRP B 1 102 ? -3.715  5.333   -50.934 1.00   41.96  ? 102  TRP B CZ3 1 
ATOM   5001 C CH2 . TRP B 1 102 ? -4.195  4.023   -50.866 1.00   40.06  ? 102  TRP B CH2 1 
ATOM   5002 N N   . THR B 1 103 ? -8.197  10.709  -54.147 1.00   45.96  ? 103  THR B N   1 
ATOM   5003 C CA  . THR B 1 103 ? -8.711  12.077  -54.141 1.00   49.79  ? 103  THR B CA  1 
ATOM   5004 C C   . THR B 1 103 ? -10.208 12.041  -53.912 1.00   53.18  ? 103  THR B C   1 
ATOM   5005 O O   . THR B 1 103 ? -10.832 10.990  -54.073 1.00   53.81  ? 103  THR B O   1 
ATOM   5006 C CB  . THR B 1 103 ? -8.409  12.854  -55.457 1.00   50.99  ? 103  THR B CB  1 
ATOM   5007 O OG1 . THR B 1 103 ? -9.216  12.337  -56.521 1.00   57.59  ? 103  THR B OG1 1 
ATOM   5008 C CG2 . THR B 1 103 ? -6.938  12.735  -55.840 1.00   52.17  ? 103  THR B CG2 1 
ATOM   5009 N N   . PRO B 1 104 ? -10.787 13.187  -53.513 1.00   55.34  ? 104  PRO B N   1 
ATOM   5010 C CA  . PRO B 1 104 ? -12.241 13.352  -53.449 1.00   53.66  ? 104  PRO B CA  1 
ATOM   5011 C C   . PRO B 1 104 ? -12.855 13.055  -54.814 1.00   57.85  ? 104  PRO B C   1 
ATOM   5012 O O   . PRO B 1 104 ? -12.205 13.271  -55.841 1.00   57.00  ? 104  PRO B O   1 
ATOM   5013 C CB  . PRO B 1 104 ? -12.409 14.841  -53.141 1.00   50.82  ? 104  PRO B CB  1 
ATOM   5014 C CG  . PRO B 1 104 ? -11.146 15.246  -52.508 1.00   56.63  ? 104  PRO B CG  1 
ATOM   5015 C CD  . PRO B 1 104 ? -10.077 14.422  -53.141 1.00   55.35  ? 104  PRO B CD  1 
ATOM   5016 N N   . TYR B 1 105 ? -14.084 12.550  -54.811 1.00   58.11  ? 105  TYR B N   1 
ATOM   5017 C CA  . TYR B 1 105 ? -14.850 12.328  -56.030 1.00   58.19  ? 105  TYR B CA  1 
ATOM   5018 C C   . TYR B 1 105 ? -16.078 13.235  -55.983 1.00   60.15  ? 105  TYR B C   1 
ATOM   5019 O O   . TYR B 1 105 ? -16.962 13.039  -55.145 1.00   54.12  ? 105  TYR B O   1 
ATOM   5020 C CB  . TYR B 1 105 ? -15.288 10.869  -56.103 1.00   58.47  ? 105  TYR B CB  1 
ATOM   5021 C CG  . TYR B 1 105 ? -15.977 10.494  -57.389 1.00   62.83  ? 105  TYR B CG  1 
ATOM   5022 C CD1 . TYR B 1 105 ? -17.183 11.068  -57.745 1.00   64.62  ? 105  TYR B CD1 1 
ATOM   5023 C CD2 . TYR B 1 105 ? -15.412 9.571   -58.255 1.00   70.59  ? 105  TYR B CD2 1 
ATOM   5024 C CE1 . TYR B 1 105 ? -17.810 10.733  -58.922 1.00   69.74  ? 105  TYR B CE1 1 
ATOM   5025 C CE2 . TYR B 1 105 ? -16.032 9.228   -59.434 1.00   70.69  ? 105  TYR B CE2 1 
ATOM   5026 C CZ  . TYR B 1 105 ? -17.232 9.811   -59.761 1.00   75.54  ? 105  TYR B CZ  1 
ATOM   5027 O OH  . TYR B 1 105 ? -17.858 9.472   -60.935 1.00   78.72  ? 105  TYR B OH  1 
ATOM   5028 N N   . PRO B 1 106 ? -16.149 14.226  -56.886 1.00   59.19  ? 106  PRO B N   1 
ATOM   5029 C CA  . PRO B 1 106 ? -15.225 14.471  -58.000 1.00   67.22  ? 106  PRO B CA  1 
ATOM   5030 C C   . PRO B 1 106 ? -13.917 15.123  -57.553 1.00   62.29  ? 106  PRO B C   1 
ATOM   5031 O O   . PRO B 1 106 ? -13.798 15.561  -56.415 1.00   58.69  ? 106  PRO B O   1 
ATOM   5032 C CB  . PRO B 1 106 ? -16.008 15.444  -58.887 1.00   65.03  ? 106  PRO B CB  1 
ATOM   5033 C CG  . PRO B 1 106 ? -16.882 16.197  -57.935 1.00   63.42  ? 106  PRO B CG  1 
ATOM   5034 C CD  . PRO B 1 106 ? -17.166 15.288  -56.765 1.00   60.40  ? 106  PRO B CD  1 
ATOM   5035 N N   . ARG B 1 107 ? -12.948 15.197  -58.455 1.00   64.24  ? 107  ARG B N   1 
ATOM   5036 C CA  . ARG B 1 107 ? -11.639 15.702  -58.082 1.00   69.08  ? 107  ARG B CA  1 
ATOM   5037 C C   . ARG B 1 107 ? -11.721 17.176  -57.717 1.00   72.93  ? 107  ARG B C   1 
ATOM   5038 O O   . ARG B 1 107 ? -12.450 17.937  -58.350 1.00   76.45  ? 107  ARG B O   1 
ATOM   5039 C CB  . ARG B 1 107 ? -10.603 15.437  -59.177 1.00   63.22  ? 107  ARG B CB  1 
ATOM   5040 C CG  . ARG B 1 107 ? -10.269 16.600  -60.097 1.00   70.34  ? 107  ARG B CG  1 
ATOM   5041 C CD  . ARG B 1 107 ? -9.069  16.203  -60.963 1.00   70.30  ? 107  ARG B CD  1 
ATOM   5042 N NE  . ARG B 1 107 ? -9.216  14.831  -61.454 1.00   69.85  ? 107  ARG B NE  1 
ATOM   5043 C CZ  . ARG B 1 107 ? -9.217  14.486  -62.740 1.00   78.39  ? 107  ARG B CZ  1 
ATOM   5044 N NH1 . ARG B 1 107 ? -9.050  15.408  -63.679 1.00   78.61  ? 107  ARG B NH1 1 
ATOM   5045 N NH2 . ARG B 1 107 ? -9.373  13.214  -63.088 1.00   69.47  ? 107  ARG B NH2 1 
ATOM   5046 N N   . PRO B 1 108 ? -10.977 17.573  -56.677 1.00   64.52  ? 108  PRO B N   1 
ATOM   5047 C CA  . PRO B 1 108 ? -11.003 18.927  -56.123 1.00   68.86  ? 108  PRO B CA  1 
ATOM   5048 C C   . PRO B 1 108 ? -11.055 19.991  -57.210 1.00   70.36  ? 108  PRO B C   1 
ATOM   5049 O O   . PRO B 1 108 ? -10.300 19.927  -58.179 1.00   67.09  ? 108  PRO B O   1 
ATOM   5050 C CB  . PRO B 1 108 ? -9.677  19.012  -55.372 1.00   65.04  ? 108  PRO B CB  1 
ATOM   5051 C CG  . PRO B 1 108 ? -9.423  17.614  -54.938 1.00   62.85  ? 108  PRO B CG  1 
ATOM   5052 C CD  . PRO B 1 108 ? -9.982  16.720  -56.008 1.00   55.06  ? 108  PRO B CD  1 
ATOM   5053 N N   . ALA B 1 109 ? -11.950 20.959  -57.033 1.00   73.76  ? 109  ALA B N   1 
ATOM   5054 C CA  . ALA B 1 109 ? -12.087 22.081  -57.953 1.00   75.43  ? 109  ALA B CA  1 
ATOM   5055 C C   . ALA B 1 109 ? -10.986 23.115  -57.729 1.00   70.80  ? 109  ALA B C   1 
ATOM   5056 O O   . ALA B 1 109 ? -10.597 23.833  -58.650 1.00   64.97  ? 109  ALA B O   1 
ATOM   5057 C CB  . ALA B 1 109 ? -13.456 22.722  -57.797 1.00   77.92  ? 109  ALA B CB  1 
ATOM   5058 N N   . SER B 1 110 ? -10.498 23.199  -56.495 1.00   67.61  ? 110  SER B N   1 
ATOM   5059 C CA  . SER B 1 110 ? -9.337  24.025  -56.187 1.00   65.39  ? 110  SER B CA  1 
ATOM   5060 C C   . SER B 1 110 ? -8.191  23.126  -55.718 1.00   63.00  ? 110  SER B C   1 
ATOM   5061 O O   . SER B 1 110 ? -8.421  21.993  -55.293 1.00   64.98  ? 110  SER B O   1 
ATOM   5062 C CB  . SER B 1 110 ? -9.689  25.060  -55.121 1.00   62.68  ? 110  SER B CB  1 
ATOM   5063 O OG  . SER B 1 110 ? -10.478 24.475  -54.099 1.00   71.05  ? 110  SER B OG  1 
ATOM   5064 N N   . PRO B 1 111 ? -6.953  23.624  -55.809 1.00   53.43  ? 111  PRO B N   1 
ATOM   5065 C CA  . PRO B 1 111 ? -5.736  22.922  -55.380 1.00   56.75  ? 111  PRO B CA  1 
ATOM   5066 C C   . PRO B 1 111 ? -5.754  22.527  -53.902 1.00   53.42  ? 111  PRO B C   1 
ATOM   5067 O O   . PRO B 1 111 ? -5.832  23.383  -53.026 1.00   54.90  ? 111  PRO B O   1 
ATOM   5068 C CB  . PRO B 1 111 ? -4.641  23.961  -55.621 1.00   53.98  ? 111  PRO B CB  1 
ATOM   5069 C CG  . PRO B 1 111 ? -5.173  24.809  -56.712 1.00   48.52  ? 111  PRO B CG  1 
ATOM   5070 C CD  . PRO B 1 111 ? -6.642  24.921  -56.424 1.00   60.07  ? 111  PRO B CD  1 
ATOM   5071 N N   . THR B 1 112 ? -5.659  21.232  -53.637 1.00   52.62  ? 112  THR B N   1 
ATOM   5072 C CA  . THR B 1 112 ? -5.771  20.719  -52.282 1.00   53.13  ? 112  THR B CA  1 
ATOM   5073 C C   . THR B 1 112 ? -4.426  20.316  -51.685 1.00   50.55  ? 112  THR B C   1 
ATOM   5074 O O   . THR B 1 112 ? -3.581  19.752  -52.374 1.00   52.96  ? 112  THR B O   1 
ATOM   5075 C CB  . THR B 1 112 ? -6.681  19.492  -52.258 1.00   52.16  ? 112  THR B CB  1 
ATOM   5076 O OG1 . THR B 1 112 ? -7.745  19.684  -53.191 1.00   58.32  ? 112  THR B OG1 1 
ATOM   5077 C CG2 . THR B 1 112 ? -7.253  19.282  -50.871 1.00   52.15  ? 112  THR B CG2 1 
ATOM   5078 N N   . PRO B 1 113 ? -4.225  20.613  -50.395 1.00   49.33  ? 113  PRO B N   1 
ATOM   5079 C CA  . PRO B 1 113 ? -3.099  20.094  -49.620 1.00   45.83  ? 113  PRO B CA  1 
ATOM   5080 C C   . PRO B 1 113 ? -2.884  18.609  -49.851 1.00   47.17  ? 113  PRO B C   1 
ATOM   5081 O O   . PRO B 1 113 ? -3.843  17.845  -49.822 1.00   47.18  ? 113  PRO B O   1 
ATOM   5082 C CB  . PRO B 1 113 ? -3.554  20.333  -48.188 1.00   46.04  ? 113  PRO B CB  1 
ATOM   5083 C CG  . PRO B 1 113 ? -4.325  21.599  -48.279 1.00   50.63  ? 113  PRO B CG  1 
ATOM   5084 C CD  . PRO B 1 113 ? -4.942  21.663  -49.657 1.00   47.83  ? 113  PRO B CD  1 
ATOM   5085 N N   . VAL B 1 114 ? -1.634  18.215  -50.076 1.00   43.92  ? 114  VAL B N   1 
ATOM   5086 C CA  . VAL B 1 114 ? -1.295  16.815  -50.289 1.00   41.82  ? 114  VAL B CA  1 
ATOM   5087 C C   . VAL B 1 114 ? -0.620  16.198  -49.063 1.00   41.48  ? 114  VAL B C   1 
ATOM   5088 O O   . VAL B 1 114 ? 0.281   16.785  -48.481 1.00   41.05  ? 114  VAL B O   1 
ATOM   5089 C CB  . VAL B 1 114 ? -0.321  16.656  -51.469 1.00   41.62  ? 114  VAL B CB  1 
ATOM   5090 C CG1 . VAL B 1 114 ? -0.084  15.181  -51.761 1.00   38.44  ? 114  VAL B CG1 1 
ATOM   5091 C CG2 . VAL B 1 114 ? -0.836  17.394  -52.696 1.00   42.97  ? 114  VAL B CG2 1 
ATOM   5092 N N   . LEU B 1 115 ? -1.052  15.005  -48.684 1.00   43.32  ? 115  LEU B N   1 
ATOM   5093 C CA  . LEU B 1 115 ? -0.386  14.243  -47.641 1.00   38.68  ? 115  LEU B CA  1 
ATOM   5094 C C   . LEU B 1 115 ? 0.327   13.059  -48.294 1.00   48.10  ? 115  LEU B C   1 
ATOM   5095 O O   . LEU B 1 115 ? -0.299  12.276  -49.024 1.00   45.04  ? 115  LEU B O   1 
ATOM   5096 C CB  . LEU B 1 115 ? -1.412  13.701  -46.648 1.00   41.02  ? 115  LEU B CB  1 
ATOM   5097 C CG  . LEU B 1 115 ? -1.959  14.542  -45.495 1.00   45.89  ? 115  LEU B CG  1 
ATOM   5098 C CD1 . LEU B 1 115 ? -3.063  13.770  -44.779 1.00   42.89  ? 115  LEU B CD1 1 
ATOM   5099 C CD2 . LEU B 1 115 ? -0.864  14.867  -44.515 1.00   42.90  ? 115  LEU B CD2 1 
ATOM   5100 N N   . ILE B 1 116 ? 1.625   12.924  -48.043 1.00   41.19  ? 116  ILE B N   1 
ATOM   5101 C CA  . ILE B 1 116 ? 2.362   11.782  -48.555 1.00   34.71  ? 116  ILE B CA  1 
ATOM   5102 C C   . ILE B 1 116 ? 2.775   10.833  -47.435 1.00   38.32  ? 116  ILE B C   1 
ATOM   5103 O O   . ILE B 1 116 ? 3.546   11.209  -46.559 1.00   39.86  ? 116  ILE B O   1 
ATOM   5104 C CB  . ILE B 1 116 ? 3.599   12.218  -49.345 1.00   34.77  ? 116  ILE B CB  1 
ATOM   5105 C CG1 . ILE B 1 116 ? 3.199   13.147  -50.485 1.00   34.60  ? 116  ILE B CG1 1 
ATOM   5106 C CG2 . ILE B 1 116 ? 4.294   11.009  -49.916 1.00   35.63  ? 116  ILE B CG2 1 
ATOM   5107 C CD1 . ILE B 1 116 ? 4.372   13.690  -51.275 1.00   34.31  ? 116  ILE B CD1 1 
ATOM   5108 N N   . TRP B 1 117 ? 2.250   9.608   -47.471 1.00   33.57  ? 117  TRP B N   1 
ATOM   5109 C CA  . TRP B 1 117 ? 2.548   8.577   -46.480 1.00   34.30  ? 117  TRP B CA  1 
ATOM   5110 C C   . TRP B 1 117 ? 3.779   7.747   -46.837 1.00   42.06  ? 117  TRP B C   1 
ATOM   5111 O O   . TRP B 1 117 ? 3.922   7.300   -47.981 1.00   38.10  ? 117  TRP B O   1 
ATOM   5112 C CB  . TRP B 1 117 ? 1.356   7.623   -46.323 1.00   32.36  ? 117  TRP B CB  1 
ATOM   5113 C CG  . TRP B 1 117 ? 1.633   6.473   -45.406 1.00   36.00  ? 117  TRP B CG  1 
ATOM   5114 C CD1 . TRP B 1 117 ? 1.890   5.175   -45.761 1.00   37.29  ? 117  TRP B CD1 1 
ATOM   5115 C CD2 . TRP B 1 117 ? 1.701   6.516   -43.971 1.00   37.96  ? 117  TRP B CD2 1 
ATOM   5116 N NE1 . TRP B 1 117 ? 2.100   4.409   -44.632 1.00   37.32  ? 117  TRP B NE1 1 
ATOM   5117 C CE2 . TRP B 1 117 ? 2.000   5.211   -43.524 1.00   34.75  ? 117  TRP B CE2 1 
ATOM   5118 C CE3 . TRP B 1 117 ? 1.554   7.535   -43.023 1.00   36.26  ? 117  TRP B CE3 1 
ATOM   5119 C CZ2 . TRP B 1 117 ? 2.139   4.898   -42.172 1.00   39.12  ? 117  TRP B CZ2 1 
ATOM   5120 C CZ3 . TRP B 1 117 ? 1.691   7.218   -41.680 1.00   36.14  ? 117  TRP B CZ3 1 
ATOM   5121 C CH2 . TRP B 1 117 ? 1.978   5.916   -41.269 1.00   38.35  ? 117  TRP B CH2 1 
ATOM   5122 N N   . ILE B 1 118 ? 4.646   7.525   -45.846 1.00   38.33  ? 118  ILE B N   1 
ATOM   5123 C CA  . ILE B 1 118 ? 5.807   6.655   -45.998 1.00   38.66  ? 118  ILE B CA  1 
ATOM   5124 C C   . ILE B 1 118 ? 5.747   5.540   -44.937 1.00   43.06  ? 118  ILE B C   1 
ATOM   5125 O O   . ILE B 1 118 ? 6.006   5.775   -43.746 1.00   41.39  ? 118  ILE B O   1 
ATOM   5126 C CB  . ILE B 1 118 ? 7.133   7.448   -45.868 1.00   37.86  ? 118  ILE B CB  1 
ATOM   5127 C CG1 . ILE B 1 118 ? 7.120   8.687   -46.770 1.00   39.12  ? 118  ILE B CG1 1 
ATOM   5128 C CG2 . ILE B 1 118 ? 8.324   6.579   -46.212 1.00   33.13  ? 118  ILE B CG2 1 
ATOM   5129 C CD1 . ILE B 1 118 ? 8.426   9.516   -46.712 1.00   31.11  ? 118  ILE B CD1 1 
ATOM   5130 N N   . TYR B 1 119 ? 5.406   4.328   -45.366 1.00   34.58  ? 119  TYR B N   1 
ATOM   5131 C CA  . TYR B 1 119 ? 5.202   3.225   -44.423 1.00   36.65  ? 119  TYR B CA  1 
ATOM   5132 C C   . TYR B 1 119 ? 6.453   2.857   -43.635 1.00   37.36  ? 119  TYR B C   1 
ATOM   5133 O O   . TYR B 1 119 ? 7.573   3.132   -44.064 1.00   38.17  ? 119  TYR B O   1 
ATOM   5134 C CB  . TYR B 1 119 ? 4.639   1.973   -45.126 1.00   40.12  ? 119  TYR B CB  1 
ATOM   5135 C CG  . TYR B 1 119 ? 5.483   1.442   -46.272 1.00   36.31  ? 119  TYR B CG  1 
ATOM   5136 C CD1 . TYR B 1 119 ? 6.677   0.764   -46.031 1.00   39.40  ? 119  TYR B CD1 1 
ATOM   5137 C CD2 . TYR B 1 119 ? 5.076   1.600   -47.592 1.00   35.21  ? 119  TYR B CD2 1 
ATOM   5138 C CE1 . TYR B 1 119 ? 7.454   0.265   -47.078 1.00   38.49  ? 119  TYR B CE1 1 
ATOM   5139 C CE2 . TYR B 1 119 ? 5.844   1.106   -48.649 1.00   38.39  ? 119  TYR B CE2 1 
ATOM   5140 C CZ  . TYR B 1 119 ? 7.033   0.437   -48.385 1.00   41.42  ? 119  TYR B CZ  1 
ATOM   5141 O OH  . TYR B 1 119 ? 7.805   -0.054  -49.425 1.00   36.47  ? 119  TYR B OH  1 
ATOM   5142 N N   . GLY B 1 120 ? 6.234   2.217   -42.488 1.00   41.51  ? 120  GLY B N   1 
ATOM   5143 C CA  . GLY B 1 120 ? 7.298   1.690   -41.651 1.00   40.23  ? 120  GLY B CA  1 
ATOM   5144 C C   . GLY B 1 120 ? 7.554   0.227   -41.954 1.00   40.73  ? 120  GLY B C   1 
ATOM   5145 O O   . GLY B 1 120 ? 7.103   -0.276  -42.984 1.00   42.83  ? 120  GLY B O   1 
ATOM   5146 N N   . GLY B 1 121 ? 8.273   -0.458  -41.066 1.00   43.17  ? 121  GLY B N   1 
ATOM   5147 C CA  . GLY B 1 121 ? 8.702   -1.825  -41.327 1.00   43.71  ? 121  GLY B CA  1 
ATOM   5148 C C   . GLY B 1 121 ? 10.203  -2.070  -41.176 1.00   39.06  ? 121  GLY B C   1 
ATOM   5149 O O   . GLY B 1 121 ? 10.758  -2.988  -41.785 1.00   42.18  ? 121  GLY B O   1 
ATOM   5150 N N   . GLY B 1 122 ? 10.863  -1.245  -40.373 1.00   42.58  ? 122  GLY B N   1 
ATOM   5151 C CA  . GLY B 1 122 ? 12.279  -1.413  -40.074 1.00   40.77  ? 122  GLY B CA  1 
ATOM   5152 C C   . GLY B 1 122 ? 13.244  -1.222  -41.239 1.00   41.45  ? 122  GLY B C   1 
ATOM   5153 O O   . GLY B 1 122 ? 14.423  -1.570  -41.141 1.00   41.16  ? 122  GLY B O   1 
ATOM   5154 N N   . PHE B 1 123 ? 12.759  -0.658  -42.341 1.00   39.08  ? 123  PHE B N   1 
ATOM   5155 C CA  . PHE B 1 123 ? 13.562  -0.579  -43.562 1.00   43.85  ? 123  PHE B CA  1 
ATOM   5156 C C   . PHE B 1 123 ? 13.777  -1.954  -44.187 1.00   38.77  ? 123  PHE B C   1 
ATOM   5157 O O   . PHE B 1 123 ? 14.507  -2.064  -45.165 1.00   43.67  ? 123  PHE B O   1 
ATOM   5158 C CB  . PHE B 1 123 ? 14.927  0.085   -43.315 1.00   35.39  ? 123  PHE B CB  1 
ATOM   5159 C CG  . PHE B 1 123 ? 14.847  1.569   -43.012 1.00   42.78  ? 123  PHE B CG  1 
ATOM   5160 C CD1 . PHE B 1 123 ? 14.358  2.466   -43.964 1.00   36.66  ? 123  PHE B CD1 1 
ATOM   5161 C CD2 . PHE B 1 123 ? 15.281  2.066   -41.779 1.00   37.70  ? 123  PHE B CD2 1 
ATOM   5162 C CE1 . PHE B 1 123 ? 14.281  3.830   -43.687 1.00   39.00  ? 123  PHE B CE1 1 
ATOM   5163 C CE2 . PHE B 1 123 ? 15.225  3.414   -41.491 1.00   34.86  ? 123  PHE B CE2 1 
ATOM   5164 C CZ  . PHE B 1 123 ? 14.724  4.309   -42.449 1.00   42.09  ? 123  PHE B CZ  1 
ATOM   5165 N N   . TYR B 1 124 ? 13.144  -2.990  -43.633 1.00   33.47  ? 124  TYR B N   1 
ATOM   5166 C CA  . TYR B 1 124 ? 13.268  -4.348  -44.179 1.00   43.42  ? 124  TYR B CA  1 
ATOM   5167 C C   . TYR B 1 124 ? 11.937  -4.928  -44.685 1.00   42.80  ? 124  TYR B C   1 
ATOM   5168 O O   . TYR B 1 124 ? 11.907  -6.016  -45.249 1.00   40.82  ? 124  TYR B O   1 
ATOM   5169 C CB  . TYR B 1 124 ? 13.895  -5.316  -43.162 1.00   42.97  ? 124  TYR B CB  1 
ATOM   5170 C CG  . TYR B 1 124 ? 12.943  -5.731  -42.063 1.00   45.37  ? 124  TYR B CG  1 
ATOM   5171 C CD1 . TYR B 1 124 ? 11.983  -6.710  -42.278 1.00   42.04  ? 124  TYR B CD1 1 
ATOM   5172 C CD2 . TYR B 1 124 ? 12.997  -5.131  -40.810 1.00   43.42  ? 124  TYR B CD2 1 
ATOM   5173 C CE1 . TYR B 1 124 ? 11.109  -7.079  -41.278 1.00   40.38  ? 124  TYR B CE1 1 
ATOM   5174 C CE2 . TYR B 1 124 ? 12.122  -5.493  -39.802 1.00   40.14  ? 124  TYR B CE2 1 
ATOM   5175 C CZ  . TYR B 1 124 ? 11.183  -6.464  -40.039 1.00   43.91  ? 124  TYR B CZ  1 
ATOM   5176 O OH  . TYR B 1 124 ? 10.320  -6.825  -39.030 1.00   40.56  ? 124  TYR B OH  1 
ATOM   5177 N N   . SER B 1 125 ? 10.842  -4.206  -44.491 1.00   43.01  ? 125  SER B N   1 
ATOM   5178 C CA  . SER B 1 125 ? 9.541   -4.711  -44.903 1.00   39.51  ? 125  SER B CA  1 
ATOM   5179 C C   . SER B 1 125 ? 8.533   -3.581  -45.025 1.00   41.69  ? 125  SER B C   1 
ATOM   5180 O O   . SER B 1 125 ? 8.875   -2.419  -44.827 1.00   37.52  ? 125  SER B O   1 
ATOM   5181 C CB  . SER B 1 125 ? 9.034   -5.736  -43.891 1.00   46.14  ? 125  SER B CB  1 
ATOM   5182 O OG  . SER B 1 125 ? 8.889   -5.155  -42.603 1.00   45.72  ? 125  SER B OG  1 
ATOM   5183 N N   . GLY B 1 126 ? 7.288   -3.939  -45.336 1.00   46.12  ? 126  GLY B N   1 
ATOM   5184 C CA  . GLY B 1 126 ? 6.201   -2.978  -45.451 1.00   35.45  ? 126  GLY B CA  1 
ATOM   5185 C C   . GLY B 1 126 ? 5.728   -2.774  -46.875 1.00   39.26  ? 126  GLY B C   1 
ATOM   5186 O O   . GLY B 1 126 ? 6.393   -3.182  -47.825 1.00   41.29  ? 126  GLY B O   1 
ATOM   5187 N N   . ALA B 1 127 ? 4.570   -2.138  -47.021 1.00   40.59  ? 127  ALA B N   1 
ATOM   5188 C CA  . ALA B 1 127 ? 3.990   -1.887  -48.329 1.00   41.88  ? 127  ALA B CA  1 
ATOM   5189 C C   . ALA B 1 127 ? 2.922   -0.817  -48.209 1.00   39.61  ? 127  ALA B C   1 
ATOM   5190 O O   . ALA B 1 127 ? 2.317   -0.664  -47.155 1.00   44.23  ? 127  ALA B O   1 
ATOM   5191 C CB  . ALA B 1 127 ? 3.391   -3.166  -48.900 1.00   39.61  ? 127  ALA B CB  1 
ATOM   5192 N N   . ALA B 1 128 ? 2.685   -0.088  -49.291 1.00   35.54  ? 128  ALA B N   1 
ATOM   5193 C CA  . ALA B 1 128 ? 1.710   0.989   -49.274 1.00   39.32  ? 128  ALA B CA  1 
ATOM   5194 C C   . ALA B 1 128 ? 0.303   0.465   -49.508 1.00   39.91  ? 128  ALA B C   1 
ATOM   5195 O O   . ALA B 1 128 ? -0.637  1.236   -49.573 1.00   42.46  ? 128  ALA B O   1 
ATOM   5196 C CB  . ALA B 1 128 ? 2.060   2.055   -50.305 1.00   36.32  ? 128  ALA B CB  1 
ATOM   5197 N N   . SER B 1 129 ? 0.160   -0.850  -49.620 1.00   42.54  ? 129  SER B N   1 
ATOM   5198 C CA  . SER B 1 129 ? -1.143  -1.443  -49.921 1.00   44.51  ? 129  SER B CA  1 
ATOM   5199 C C   . SER B 1 129 ? -1.841  -2.053  -48.707 1.00   40.39  ? 129  SER B C   1 
ATOM   5200 O O   . SER B 1 129 ? -2.938  -2.578  -48.834 1.00   44.57  ? 129  SER B O   1 
ATOM   5201 C CB  . SER B 1 129 ? -1.010  -2.496  -51.029 1.00   41.69  ? 129  SER B CB  1 
ATOM   5202 O OG  . SER B 1 129 ? 0.041   -3.407  -50.750 1.00   41.49  ? 129  SER B OG  1 
ATOM   5203 N N   . LEU B 1 130 ? -1.211  -2.000  -47.536 1.00   41.00  ? 130  LEU B N   1 
ATOM   5204 C CA  . LEU B 1 130 ? -1.835  -2.576  -46.342 1.00   44.82  ? 130  LEU B CA  1 
ATOM   5205 C C   . LEU B 1 130 ? -3.132  -1.841  -46.066 1.00   46.07  ? 130  LEU B C   1 
ATOM   5206 O O   . LEU B 1 130 ? -3.267  -0.665  -46.410 1.00   45.05  ? 130  LEU B O   1 
ATOM   5207 C CB  . LEU B 1 130 ? -0.914  -2.480  -45.128 1.00   44.25  ? 130  LEU B CB  1 
ATOM   5208 C CG  . LEU B 1 130 ? 0.475   -3.090  -45.303 1.00   46.92  ? 130  LEU B CG  1 
ATOM   5209 C CD1 . LEU B 1 130 ? 1.295   -2.906  -44.041 1.00   39.33  ? 130  LEU B CD1 1 
ATOM   5210 C CD2 . LEU B 1 130 ? 0.366   -4.566  -45.666 1.00   45.24  ? 130  LEU B CD2 1 
ATOM   5211 N N   . ASP B 1 131 ? -4.089  -2.528  -45.456 1.00   44.02  ? 131  ASP B N   1 
ATOM   5212 C CA  . ASP B 1 131 ? -5.376  -1.910  -45.150 1.00   47.46  ? 131  ASP B CA  1 
ATOM   5213 C C   . ASP B 1 131 ? -5.251  -0.735  -44.166 1.00   53.63  ? 131  ASP B C   1 
ATOM   5214 O O   . ASP B 1 131 ? -6.036  0.216   -44.244 1.00   45.89  ? 131  ASP B O   1 
ATOM   5215 C CB  . ASP B 1 131 ? -6.368  -2.935  -44.597 1.00   51.50  ? 131  ASP B CB  1 
ATOM   5216 C CG  . ASP B 1 131 ? -6.666  -4.064  -45.573 1.00   59.57  ? 131  ASP B CG  1 
ATOM   5217 O OD1 . ASP B 1 131 ? -6.434  -3.903  -46.797 1.00   54.78  ? 131  ASP B OD1 1 
ATOM   5218 O OD2 . ASP B 1 131 ? -7.144  -5.123  -45.102 1.00   61.15  ? 131  ASP B OD2 1 
ATOM   5219 N N   . VAL B 1 132 ? -4.280  -0.789  -43.246 1.00   44.91  ? 132  VAL B N   1 
ATOM   5220 C CA  . VAL B 1 132 ? -4.142  0.303   -42.278 1.00   50.06  ? 132  VAL B CA  1 
ATOM   5221 C C   . VAL B 1 132 ? -3.685  1.610   -42.912 1.00   47.14  ? 132  VAL B C   1 
ATOM   5222 O O   . VAL B 1 132 ? -3.738  2.659   -42.261 1.00   47.80  ? 132  VAL B O   1 
ATOM   5223 C CB  . VAL B 1 132 ? -3.225  -0.038  -41.083 1.00   43.25  ? 132  VAL B CB  1 
ATOM   5224 C CG1 . VAL B 1 132 ? -3.957  -0.901  -40.091 1.00   45.94  ? 132  VAL B CG1 1 
ATOM   5225 C CG2 . VAL B 1 132 ? -1.948  -0.706  -41.550 1.00   49.07  ? 132  VAL B CG2 1 
ATOM   5226 N N   . TYR B 1 133 ? -3.245  1.548   -44.171 1.00   42.37  ? 133  TYR B N   1 
ATOM   5227 C CA  . TYR B 1 133 ? -2.823  2.752   -44.900 1.00   40.42  ? 133  TYR B CA  1 
ATOM   5228 C C   . TYR B 1 133 ? -3.829  3.179   -45.946 1.00   40.05  ? 133  TYR B C   1 
ATOM   5229 O O   . TYR B 1 133 ? -3.512  3.983   -46.800 1.00   41.10  ? 133  TYR B O   1 
ATOM   5230 C CB  . TYR B 1 133 ? -1.464  2.564   -45.589 1.00   40.26  ? 133  TYR B CB  1 
ATOM   5231 C CG  . TYR B 1 133 ? -0.399  1.980   -44.702 1.00   38.44  ? 133  TYR B CG  1 
ATOM   5232 C CD1 . TYR B 1 133 ? -0.291  2.369   -43.372 1.00   34.25  ? 133  TYR B CD1 1 
ATOM   5233 C CD2 . TYR B 1 133 ? 0.510   1.044   -45.201 1.00   36.34  ? 133  TYR B CD2 1 
ATOM   5234 C CE1 . TYR B 1 133 ? 0.666   1.827   -42.550 1.00   38.26  ? 133  TYR B CE1 1 
ATOM   5235 C CE2 . TYR B 1 133 ? 1.492   0.501   -44.395 1.00   34.65  ? 133  TYR B CE2 1 
ATOM   5236 C CZ  . TYR B 1 133 ? 1.567   0.898   -43.066 1.00   40.86  ? 133  TYR B CZ  1 
ATOM   5237 O OH  . TYR B 1 133 ? 2.528   0.367   -42.245 1.00   32.28  ? 133  TYR B OH  1 
ATOM   5238 N N   . ASP B 1 134 ? -5.037  2.636   -45.881 1.00   45.85  ? 134  ASP B N   1 
ATOM   5239 C CA  . ASP B 1 134 ? -6.099  2.975   -46.829 1.00   38.09  ? 134  ASP B CA  1 
ATOM   5240 C C   . ASP B 1 134 ? -6.451  4.470   -46.792 1.00   43.26  ? 134  ASP B C   1 
ATOM   5241 O O   . ASP B 1 134 ? -6.954  4.977   -45.790 1.00   39.85  ? 134  ASP B O   1 
ATOM   5242 C CB  . ASP B 1 134 ? -7.330  2.130   -46.499 1.00   48.22  ? 134  ASP B CB  1 
ATOM   5243 C CG  . ASP B 1 134 ? -8.444  2.277   -47.512 1.00   48.88  ? 134  ASP B CG  1 
ATOM   5244 O OD1 . ASP B 1 134 ? -8.492  3.293   -48.229 1.00   47.13  ? 134  ASP B OD1 1 
ATOM   5245 O OD2 . ASP B 1 134 ? -9.286  1.362   -47.581 1.00   54.03  ? 134  ASP B OD2 1 
ATOM   5246 N N   . GLY B 1 135 ? -6.207  5.165   -47.898 1.00   43.59  ? 135  GLY B N   1 
ATOM   5247 C CA  . GLY B 1 135 ? -6.454  6.597   -47.979 1.00   43.19  ? 135  GLY B CA  1 
ATOM   5248 C C   . GLY B 1 135 ? -7.868  7.094   -48.285 1.00   43.36  ? 135  GLY B C   1 
ATOM   5249 O O   . GLY B 1 135 ? -8.092  8.300   -48.374 1.00   41.87  ? 135  GLY B O   1 
ATOM   5250 N N   . ARG B 1 136 ? -8.831  6.197   -48.454 1.00   42.49  ? 136  ARG B N   1 
ATOM   5251 C CA  . ARG B 1 136 ? -10.173 6.643   -48.852 1.00   49.78  ? 136  ARG B CA  1 
ATOM   5252 C C   . ARG B 1 136 ? -10.836 7.547   -47.793 1.00   53.50  ? 136  ARG B C   1 
ATOM   5253 O O   . ARG B 1 136 ? -11.496 8.540   -48.137 1.00   47.15  ? 136  ARG B O   1 
ATOM   5254 C CB  . ARG B 1 136 ? -11.074 5.457   -49.197 1.00   45.86  ? 136  ARG B CB  1 
ATOM   5255 C CG  . ARG B 1 136 ? -11.601 4.718   -47.995 1.00   48.99  ? 136  ARG B CG  1 
ATOM   5256 C CD  . ARG B 1 136 ? -11.510 3.227   -48.202 1.00   53.57  ? 136  ARG B CD  1 
ATOM   5257 N NE  . ARG B 1 136 ? -12.516 2.717   -49.121 1.00   61.77  ? 136  ARG B NE  1 
ATOM   5258 C CZ  . ARG B 1 136 ? -12.306 1.723   -49.986 1.00   64.75  ? 136  ARG B CZ  1 
ATOM   5259 N NH1 . ARG B 1 136 ? -11.114 1.147   -50.081 1.00   61.41  ? 136  ARG B NH1 1 
ATOM   5260 N NH2 . ARG B 1 136 ? -13.289 1.315   -50.774 1.00   66.54  ? 136  ARG B NH2 1 
ATOM   5261 N N   . PHE B 1 137 ? -10.643 7.219   -46.516 1.00   40.33  ? 137  PHE B N   1 
ATOM   5262 C CA  . PHE B 1 137 ? -11.276 7.973   -45.436 1.00   44.97  ? 137  PHE B CA  1 
ATOM   5263 C C   . PHE B 1 137 ? -10.824 9.426   -45.382 1.00   49.49  ? 137  PHE B C   1 
ATOM   5264 O O   . PHE B 1 137 ? -11.652 10.338  -45.390 1.00   51.54  ? 137  PHE B O   1 
ATOM   5265 C CB  . PHE B 1 137 ? -11.061 7.278   -44.094 1.00   42.39  ? 137  PHE B CB  1 
ATOM   5266 C CG  . PHE B 1 137 ? -11.533 5.870   -44.086 1.00   43.47  ? 137  PHE B CG  1 
ATOM   5267 C CD1 . PHE B 1 137 ? -12.889 5.587   -44.094 1.00   47.56  ? 137  PHE B CD1 1 
ATOM   5268 C CD2 . PHE B 1 137 ? -10.631 4.822   -44.104 1.00   47.58  ? 137  PHE B CD2 1 
ATOM   5269 C CE1 . PHE B 1 137 ? -13.336 4.276   -44.106 1.00   55.77  ? 137  PHE B CE1 1 
ATOM   5270 C CE2 . PHE B 1 137 ? -11.068 3.503   -44.118 1.00   51.03  ? 137  PHE B CE2 1 
ATOM   5271 C CZ  . PHE B 1 137 ? -12.422 3.229   -44.116 1.00   55.56  ? 137  PHE B CZ  1 
ATOM   5272 N N   . LEU B 1 138 ? -9.513  9.636   -45.330 1.00   47.93  ? 138  LEU B N   1 
ATOM   5273 C CA  . LEU B 1 138 ? -8.949  10.979  -45.291 1.00   49.98  ? 138  LEU B CA  1 
ATOM   5274 C C   . LEU B 1 138 ? -9.365  11.795  -46.517 1.00   48.05  ? 138  LEU B C   1 
ATOM   5275 O O   . LEU B 1 138 ? -9.572  13.007  -46.427 1.00   50.37  ? 138  LEU B O   1 
ATOM   5276 C CB  . LEU B 1 138 ? -7.413  10.922  -45.171 1.00   49.18  ? 138  LEU B CB  1 
ATOM   5277 C CG  . LEU B 1 138 ? -6.823  10.604  -43.789 1.00   46.16  ? 138  LEU B CG  1 
ATOM   5278 C CD1 . LEU B 1 138 ? -5.349  10.214  -43.869 1.00   36.83  ? 138  LEU B CD1 1 
ATOM   5279 C CD2 . LEU B 1 138 ? -7.010  11.782  -42.846 1.00   46.99  ? 138  LEU B CD2 1 
ATOM   5280 N N   . ALA B 1 139 ? -9.481  11.131  -47.664 1.00   46.08  ? 139  ALA B N   1 
ATOM   5281 C CA  . ALA B 1 139 ? -9.814  11.827  -48.911 1.00   50.03  ? 139  ALA B CA  1 
ATOM   5282 C C   . ALA B 1 139 ? -11.285 12.209  -48.946 1.00   48.46  ? 139  ALA B C   1 
ATOM   5283 O O   . ALA B 1 139 ? -11.651 13.277  -49.433 1.00   48.78  ? 139  ALA B O   1 
ATOM   5284 C CB  . ALA B 1 139 ? -9.459  10.968  -50.134 1.00   47.31  ? 139  ALA B CB  1 
ATOM   5285 N N   . GLN B 1 140 ? -12.125 11.322  -48.430 1.00   48.29  ? 140  GLN B N   1 
ATOM   5286 C CA  . GLN B 1 140 ? -13.555 11.548  -48.448 1.00   51.21  ? 140  GLN B CA  1 
ATOM   5287 C C   . GLN B 1 140 ? -13.943 12.552  -47.376 1.00   57.23  ? 140  GLN B C   1 
ATOM   5288 O O   . GLN B 1 140 ? -14.563 13.572  -47.665 1.00   56.33  ? 140  GLN B O   1 
ATOM   5289 C CB  . GLN B 1 140 ? -14.302 10.237  -48.231 1.00   54.91  ? 140  GLN B CB  1 
ATOM   5290 C CG  . GLN B 1 140 ? -15.682 10.219  -48.864 1.00   54.17  ? 140  GLN B CG  1 
ATOM   5291 C CD  . GLN B 1 140 ? -16.707 10.956  -48.030 1.00   57.96  ? 140  GLN B CD  1 
ATOM   5292 O OE1 . GLN B 1 140 ? -16.915 10.639  -46.854 1.00   57.83  ? 140  GLN B OE1 1 
ATOM   5293 N NE2 . GLN B 1 140 ? -17.358 11.943  -48.634 1.00   47.47  ? 140  GLN B NE2 1 
ATOM   5294 N N   . VAL B 1 141 ? -13.566 12.265  -46.136 1.00   53.74  ? 141  VAL B N   1 
ATOM   5295 C CA  . VAL B 1 141 ? -13.987 13.092  -45.013 1.00   52.53  ? 141  VAL B CA  1 
ATOM   5296 C C   . VAL B 1 141 ? -13.331 14.470  -44.973 1.00   53.77  ? 141  VAL B C   1 
ATOM   5297 O O   . VAL B 1 141 ? -13.969 15.455  -44.604 1.00   53.68  ? 141  VAL B O   1 
ATOM   5298 C CB  . VAL B 1 141 ? -13.760 12.375  -43.686 1.00   51.12  ? 141  VAL B CB  1 
ATOM   5299 C CG1 . VAL B 1 141 ? -14.163 13.273  -42.528 1.00   46.33  ? 141  VAL B CG1 1 
ATOM   5300 C CG2 . VAL B 1 141 ? -14.547 11.070  -43.671 1.00   48.76  ? 141  VAL B CG2 1 
ATOM   5301 N N   . GLU B 1 142 ? -12.068 14.545  -45.373 1.00   50.82  ? 142  GLU B N   1 
ATOM   5302 C CA  . GLU B 1 142 ? -11.304 15.769  -45.218 1.00   40.08  ? 142  GLU B CA  1 
ATOM   5303 C C   . GLU B 1 142 ? -10.941 16.421  -46.543 1.00   47.58  ? 142  GLU B C   1 
ATOM   5304 O O   . GLU B 1 142 ? -10.291 17.470  -46.574 1.00   46.93  ? 142  GLU B O   1 
ATOM   5305 C CB  . GLU B 1 142 ? -10.045 15.467  -44.415 1.00   50.92  ? 142  GLU B CB  1 
ATOM   5306 C CG  . GLU B 1 142 ? -10.342 15.094  -42.975 1.00   46.28  ? 142  GLU B CG  1 
ATOM   5307 C CD  . GLU B 1 142 ? -10.865 16.284  -42.185 1.00   53.01  ? 142  GLU B CD  1 
ATOM   5308 O OE1 . GLU B 1 142 ? -10.783 17.425  -42.703 1.00   53.67  ? 142  GLU B OE1 1 
ATOM   5309 O OE2 . GLU B 1 142 ? -11.346 16.080  -41.050 1.00   52.31  ? 142  GLU B OE2 1 
ATOM   5310 N N   . GLY B 1 143 ? -11.361 15.796  -47.638 1.00   50.05  ? 143  GLY B N   1 
ATOM   5311 C CA  . GLY B 1 143 ? -11.040 16.283  -48.969 1.00   47.41  ? 143  GLY B CA  1 
ATOM   5312 C C   . GLY B 1 143 ? -9.547  16.382  -49.236 1.00   53.03  ? 143  GLY B C   1 
ATOM   5313 O O   . GLY B 1 143 ? -9.099  17.266  -49.970 1.00   50.80  ? 143  GLY B O   1 
ATOM   5314 N N   . ALA B 1 144 ? -8.771  15.484  -48.630 1.00   50.75  ? 144  ALA B N   1 
ATOM   5315 C CA  . ALA B 1 144 ? -7.325  15.471  -48.829 1.00   52.12  ? 144  ALA B CA  1 
ATOM   5316 C C   . ALA B 1 144 ? -6.947  14.694  -50.090 1.00   48.26  ? 144  ALA B C   1 
ATOM   5317 O O   . ALA B 1 144 ? -7.604  13.714  -50.436 1.00   45.66  ? 144  ALA B O   1 
ATOM   5318 C CB  . ALA B 1 144 ? -6.636  14.869  -47.621 1.00   44.03  ? 144  ALA B CB  1 
ATOM   5319 N N   . VAL B 1 145 ? -5.909  15.153  -50.784 1.00   41.42  ? 145  VAL B N   1 
ATOM   5320 C CA  . VAL B 1 145 ? -5.247  14.322  -51.773 1.00   41.88  ? 145  VAL B CA  1 
ATOM   5321 C C   . VAL B 1 145 ? -4.154  13.569  -51.027 1.00   43.17  ? 145  VAL B C   1 
ATOM   5322 O O   . VAL B 1 145 ? -3.246  14.171  -50.447 1.00   44.79  ? 145  VAL B O   1 
ATOM   5323 C CB  . VAL B 1 145 ? -4.644  15.129  -52.938 1.00   46.05  ? 145  VAL B CB  1 
ATOM   5324 C CG1 . VAL B 1 145 ? -3.833  14.215  -53.854 1.00   37.52  ? 145  VAL B CG1 1 
ATOM   5325 C CG2 . VAL B 1 145 ? -5.739  15.828  -53.732 1.00   43.08  ? 145  VAL B CG2 1 
ATOM   5326 N N   . LEU B 1 146 ? -4.269  12.249  -51.012 1.00   40.96  ? 146  LEU B N   1 
ATOM   5327 C CA  . LEU B 1 146 ? -3.336  11.417  -50.274 1.00   45.20  ? 146  LEU B CA  1 
ATOM   5328 C C   . LEU B 1 146 ? -2.506  10.551  -51.214 1.00   47.43  ? 146  LEU B C   1 
ATOM   5329 O O   . LEU B 1 146 ? -3.050  9.829   -52.049 1.00   54.74  ? 146  LEU B O   1 
ATOM   5330 C CB  . LEU B 1 146 ? -4.084  10.546  -49.263 1.00   39.43  ? 146  LEU B CB  1 
ATOM   5331 C CG  . LEU B 1 146 ? -3.142  9.909   -48.248 1.00   48.09  ? 146  LEU B CG  1 
ATOM   5332 C CD1 . LEU B 1 146 ? -3.768  9.884   -46.885 1.00   43.67  ? 146  LEU B CD1 1 
ATOM   5333 C CD2 . LEU B 1 146 ? -2.709  8.507   -48.690 1.00   51.18  ? 146  LEU B CD2 1 
ATOM   5334 N N   . VAL B 1 147 ? -1.189  10.626  -51.075 1.00   41.05  ? 147  VAL B N   1 
ATOM   5335 C CA  . VAL B 1 147 ? -0.283  9.821   -51.887 1.00   38.31  ? 147  VAL B CA  1 
ATOM   5336 C C   . VAL B 1 147 ? 0.496   8.838   -51.014 1.00   40.04  ? 147  VAL B C   1 
ATOM   5337 O O   . VAL B 1 147 ? 0.890   9.180   -49.903 1.00   38.89  ? 147  VAL B O   1 
ATOM   5338 C CB  . VAL B 1 147 ? 0.724   10.721  -52.634 1.00   39.15  ? 147  VAL B CB  1 
ATOM   5339 C CG1 . VAL B 1 147 ? 1.698   9.886   -53.438 1.00   34.13  ? 147  VAL B CG1 1 
ATOM   5340 C CG2 . VAL B 1 147 ? -0.010  11.712  -53.528 1.00   46.58  ? 147  VAL B CG2 1 
ATOM   5341 N N   . SER B 1 148 ? 0.716   7.619   -51.508 1.00   42.23  ? 148  SER B N   1 
ATOM   5342 C CA  . SER B 1 148 ? 1.684   6.714   -50.880 1.00   38.61  ? 148  SER B CA  1 
ATOM   5343 C C   . SER B 1 148 ? 2.501   5.939   -51.922 1.00   40.15  ? 148  SER B C   1 
ATOM   5344 O O   . SER B 1 148 ? 1.968   5.546   -52.950 1.00   38.82  ? 148  SER B O   1 
ATOM   5345 C CB  . SER B 1 148 ? 0.996   5.745   -49.924 1.00   35.07  ? 148  SER B CB  1 
ATOM   5346 O OG  . SER B 1 148 ? 0.208   4.827   -50.644 1.00   40.86  ? 148  SER B OG  1 
ATOM   5347 N N   . MET B 1 149 ? 3.788   5.714   -51.644 1.00   37.47  ? 149  MET B N   1 
ATOM   5348 C CA  . MET B 1 149 ? 4.668   5.000   -52.575 1.00   35.90  ? 149  MET B CA  1 
ATOM   5349 C C   . MET B 1 149 ? 5.235   3.712   -51.982 1.00   40.96  ? 149  MET B C   1 
ATOM   5350 O O   . MET B 1 149 ? 5.395   3.575   -50.767 1.00   42.97  ? 149  MET B O   1 
ATOM   5351 C CB  . MET B 1 149 ? 5.842   5.887   -53.018 1.00   34.83  ? 149  MET B CB  1 
ATOM   5352 C CG  . MET B 1 149 ? 7.041   5.888   -52.037 1.00   36.19  ? 149  MET B CG  1 
ATOM   5353 S SD  . MET B 1 149 ? 6.701   6.692   -50.440 1.00   35.71  ? 149  MET B SD  1 
ATOM   5354 C CE  . MET B 1 149 ? 6.398   8.372   -51.006 1.00   31.63  ? 149  MET B CE  1 
ATOM   5355 N N   . ASN B 1 150 ? 5.550   2.766   -52.854 1.00   37.75  ? 150  ASN B N   1 
ATOM   5356 C CA  . ASN B 1 150 ? 6.396   1.660   -52.458 1.00   39.92  ? 150  ASN B CA  1 
ATOM   5357 C C   . ASN B 1 150 ? 7.850   2.103   -52.569 1.00   35.13  ? 150  ASN B C   1 
ATOM   5358 O O   . ASN B 1 150 ? 8.200   2.889   -53.448 1.00   33.26  ? 150  ASN B O   1 
ATOM   5359 C CB  . ASN B 1 150 ? 6.149   0.453   -53.351 1.00   39.73  ? 150  ASN B CB  1 
ATOM   5360 C CG  . ASN B 1 150 ? 4.924   -0.321  -52.951 1.00   43.95  ? 150  ASN B CG  1 
ATOM   5361 O OD1 . ASN B 1 150 ? 4.239   0.021   -51.981 1.00   42.82  ? 150  ASN B OD1 1 
ATOM   5362 N ND2 . ASN B 1 150 ? 4.641   -1.385  -53.689 1.00   45.29  ? 150  ASN B ND2 1 
ATOM   5363 N N   . TYR B 1 151 ? 8.691   1.629   -51.664 1.00   32.99  ? 151  TYR B N   1 
ATOM   5364 C CA  . TYR B 1 151 ? 10.122  1.842   -51.815 1.00   34.95  ? 151  TYR B CA  1 
ATOM   5365 C C   . TYR B 1 151 ? 10.866  0.560   -51.429 1.00   33.77  ? 151  TYR B C   1 
ATOM   5366 O O   . TYR B 1 151 ? 10.406  -0.199  -50.583 1.00   33.46  ? 151  TYR B O   1 
ATOM   5367 C CB  . TYR B 1 151 ? 10.587  3.052   -50.998 1.00   36.03  ? 151  TYR B CB  1 
ATOM   5368 C CG  . TYR B 1 151 ? 10.413  2.870   -49.514 1.00   37.23  ? 151  TYR B CG  1 
ATOM   5369 C CD1 . TYR B 1 151 ? 11.414  2.282   -48.754 1.00   36.97  ? 151  TYR B CD1 1 
ATOM   5370 C CD2 . TYR B 1 151 ? 9.247   3.272   -48.868 1.00   35.60  ? 151  TYR B CD2 1 
ATOM   5371 C CE1 . TYR B 1 151 ? 11.269  2.101   -47.397 1.00   35.96  ? 151  TYR B CE1 1 
ATOM   5372 C CE2 . TYR B 1 151 ? 9.091   3.088   -47.499 1.00   36.09  ? 151  TYR B CE2 1 
ATOM   5373 C CZ  . TYR B 1 151 ? 10.113  2.496   -46.774 1.00   39.19  ? 151  TYR B CZ  1 
ATOM   5374 O OH  . TYR B 1 151 ? 10.002  2.293   -45.417 1.00   41.05  ? 151  TYR B OH  1 
ATOM   5375 N N   . ARG B 1 152 ? 12.011  0.321   -52.061 1.00   37.85  ? 152  ARG B N   1 
ATOM   5376 C CA  . ARG B 1 152 ? 12.781  -0.889  -51.811 1.00   35.95  ? 152  ARG B CA  1 
ATOM   5377 C C   . ARG B 1 152 ? 13.236  -1.008  -50.350 1.00   37.34  ? 152  ARG B C   1 
ATOM   5378 O O   . ARG B 1 152 ? 13.690  -0.044  -49.748 1.00   37.11  ? 152  ARG B O   1 
ATOM   5379 C CB  . ARG B 1 152 ? 13.968  -0.958  -52.769 1.00   39.60  ? 152  ARG B CB  1 
ATOM   5380 C CG  . ARG B 1 152 ? 13.580  -1.335  -54.191 1.00   38.23  ? 152  ARG B CG  1 
ATOM   5381 C CD  . ARG B 1 152 ? 14.748  -1.198  -55.147 1.00   34.65  ? 152  ARG B CD  1 
ATOM   5382 N NE  . ARG B 1 152 ? 15.028  0.198   -55.432 1.00   32.43  ? 152  ARG B NE  1 
ATOM   5383 C CZ  . ARG B 1 152 ? 16.103  0.623   -56.085 1.00   33.07  ? 152  ARG B CZ  1 
ATOM   5384 N NH1 . ARG B 1 152 ? 16.995  -0.247  -56.532 1.00   33.77  ? 152  ARG B NH1 1 
ATOM   5385 N NH2 . ARG B 1 152 ? 16.282  1.917   -56.293 1.00   31.65  ? 152  ARG B NH2 1 
ATOM   5386 N N   . VAL B 1 153 ? 13.088  -2.201  -49.792 1.00   34.59  ? 153  VAL B N   1 
ATOM   5387 C CA  . VAL B 1 153 ? 13.506  -2.490  -48.428 1.00   33.36  ? 153  VAL B CA  1 
ATOM   5388 C C   . VAL B 1 153 ? 14.579  -3.585  -48.423 1.00   43.01  ? 153  VAL B C   1 
ATOM   5389 O O   . VAL B 1 153 ? 14.959  -4.106  -49.481 1.00   37.29  ? 153  VAL B O   1 
ATOM   5390 C CB  . VAL B 1 153 ? 12.315  -2.966  -47.565 1.00   40.87  ? 153  VAL B CB  1 
ATOM   5391 C CG1 . VAL B 1 153 ? 11.350  -1.802  -47.272 1.00   37.71  ? 153  VAL B CG1 1 
ATOM   5392 C CG2 . VAL B 1 153 ? 11.580  -4.140  -48.245 1.00   33.37  ? 153  VAL B CG2 1 
ATOM   5393 N N   . GLY B 1 154 ? 15.060  -3.929  -47.229 1.00   40.76  ? 154  GLY B N   1 
ATOM   5394 C CA  . GLY B 1 154 ? 16.102  -4.926  -47.066 1.00   35.38  ? 154  GLY B CA  1 
ATOM   5395 C C   . GLY B 1 154 ? 17.340  -4.652  -47.899 1.00   39.65  ? 154  GLY B C   1 
ATOM   5396 O O   . GLY B 1 154 ? 17.729  -3.496  -48.108 1.00   39.72  ? 154  GLY B O   1 
ATOM   5397 N N   . THR B 1 155 ? 17.962  -5.726  -48.379 1.00   43.45  ? 155  THR B N   1 
ATOM   5398 C CA  . THR B 1 155 ? 19.176  -5.629  -49.187 1.00   45.90  ? 155  THR B CA  1 
ATOM   5399 C C   . THR B 1 155 ? 18.933  -4.828  -50.470 1.00   44.31  ? 155  THR B C   1 
ATOM   5400 O O   . THR B 1 155 ? 19.766  -4.011  -50.877 1.00   44.07  ? 155  THR B O   1 
ATOM   5401 C CB  . THR B 1 155 ? 19.724  -7.024  -49.550 1.00   43.49  ? 155  THR B CB  1 
ATOM   5402 O OG1 . THR B 1 155 ? 18.730  -7.740  -50.278 1.00   42.57  ? 155  THR B OG1 1 
ATOM   5403 C CG2 . THR B 1 155 ? 20.058  -7.816  -48.296 1.00   45.87  ? 155  THR B CG2 1 
ATOM   5404 N N   . PHE B 1 156 ? 17.780  -5.046  -51.091 1.00   36.85  ? 156  PHE B N   1 
ATOM   5405 C CA  . PHE B 1 156 ? 17.454  -4.356  -52.339 1.00   44.08  ? 156  PHE B CA  1 
ATOM   5406 C C   . PHE B 1 156 ? 17.468  -2.840  -52.187 1.00   41.92  ? 156  PHE B C   1 
ATOM   5407 O O   . PHE B 1 156 ? 17.947  -2.122  -53.066 1.00   40.67  ? 156  PHE B O   1 
ATOM   5408 C CB  . PHE B 1 156 ? 16.121  -4.878  -52.886 1.00   41.36  ? 156  PHE B CB  1 
ATOM   5409 C CG  . PHE B 1 156 ? 16.028  -6.365  -52.816 1.00   43.61  ? 156  PHE B CG  1 
ATOM   5410 C CD1 . PHE B 1 156 ? 16.568  -7.155  -53.829 1.00   44.87  ? 156  PHE B CD1 1 
ATOM   5411 C CD2 . PHE B 1 156 ? 15.500  -6.985  -51.694 1.00   36.61  ? 156  PHE B CD2 1 
ATOM   5412 C CE1 . PHE B 1 156 ? 16.531  -8.536  -53.742 1.00   40.30  ? 156  PHE B CE1 1 
ATOM   5413 C CE2 . PHE B 1 156 ? 15.466  -8.363  -51.600 1.00   40.71  ? 156  PHE B CE2 1 
ATOM   5414 C CZ  . PHE B 1 156 ? 15.979  -9.140  -52.624 1.00   42.95  ? 156  PHE B CZ  1 
ATOM   5415 N N   . GLY B 1 157 ? 16.966  -2.354  -51.059 1.00   40.41  ? 157  GLY B N   1 
ATOM   5416 C CA  . GLY B 1 157 ? 16.886  -0.922  -50.844 1.00   40.07  ? 157  GLY B CA  1 
ATOM   5417 C C   . GLY B 1 157 ? 18.079  -0.308  -50.125 1.00   34.64  ? 157  GLY B C   1 
ATOM   5418 O O   . GLY B 1 157 ? 18.380  0.863   -50.324 1.00   35.73  ? 157  GLY B O   1 
ATOM   5419 N N   . PHE B 1 158 ? 18.763  -1.086  -49.293 1.00   33.88  ? 158  PHE B N   1 
ATOM   5420 C CA  . PHE B 1 158 ? 19.778  -0.489  -48.426 1.00   43.06  ? 158  PHE B CA  1 
ATOM   5421 C C   . PHE B 1 158 ? 21.127  -1.205  -48.302 1.00   41.85  ? 158  PHE B C   1 
ATOM   5422 O O   . PHE B 1 158 ? 21.979  -0.766  -47.537 1.00   42.93  ? 158  PHE B O   1 
ATOM   5423 C CB  . PHE B 1 158 ? 19.181  -0.180  -47.044 1.00   37.44  ? 158  PHE B CB  1 
ATOM   5424 C CG  . PHE B 1 158 ? 17.999  0.748   -47.107 1.00   36.30  ? 158  PHE B CG  1 
ATOM   5425 C CD1 . PHE B 1 158 ? 18.182  2.112   -47.159 1.00   33.94  ? 158  PHE B CD1 1 
ATOM   5426 C CD2 . PHE B 1 158 ? 16.703  0.248   -47.155 1.00   39.05  ? 158  PHE B CD2 1 
ATOM   5427 C CE1 . PHE B 1 158 ? 17.099  2.973   -47.243 1.00   37.25  ? 158  PHE B CE1 1 
ATOM   5428 C CE2 . PHE B 1 158 ? 15.610  1.103   -47.243 1.00   36.10  ? 158  PHE B CE2 1 
ATOM   5429 C CZ  . PHE B 1 158 ? 15.807  2.463   -47.288 1.00   37.70  ? 158  PHE B CZ  1 
ATOM   5430 N N   . LEU B 1 159 ? 21.336  -2.291  -49.043 1.00   41.27  ? 159  LEU B N   1 
ATOM   5431 C CA  . LEU B 1 159 ? 22.658  -2.905  -49.063 1.00   37.78  ? 159  LEU B CA  1 
ATOM   5432 C C   . LEU B 1 159 ? 23.637  -1.965  -49.751 1.00   43.67  ? 159  LEU B C   1 
ATOM   5433 O O   . LEU B 1 159 ? 23.417  -1.570  -50.892 1.00   45.28  ? 159  LEU B O   1 
ATOM   5434 C CB  . LEU B 1 159 ? 22.635  -4.246  -49.783 1.00   46.97  ? 159  LEU B CB  1 
ATOM   5435 C CG  . LEU B 1 159 ? 23.983  -4.971  -49.846 1.00   42.16  ? 159  LEU B CG  1 
ATOM   5436 C CD1 . LEU B 1 159 ? 23.783  -6.477  -49.755 1.00   45.03  ? 159  LEU B CD1 1 
ATOM   5437 C CD2 . LEU B 1 159 ? 24.743  -4.587  -51.101 1.00   42.26  ? 159  LEU B CD2 1 
ATOM   5438 N N   . ALA B 1 160 ? 24.718  -1.610  -49.061 1.00   48.17  ? 160  ALA B N   1 
ATOM   5439 C CA  . ALA B 1 160 ? 25.656  -0.613  -49.575 1.00   48.01  ? 160  ALA B CA  1 
ATOM   5440 C C   . ALA B 1 160 ? 27.113  -1.024  -49.428 1.00   46.69  ? 160  ALA B C   1 
ATOM   5441 O O   . ALA B 1 160 ? 27.523  -1.591  -48.416 1.00   50.11  ? 160  ALA B O   1 
ATOM   5442 C CB  . ALA B 1 160 ? 25.433  0.737   -48.895 1.00   46.21  ? 160  ALA B CB  1 
ATOM   5443 N N   . LEU B 1 161 ? 27.884  -0.737  -50.466 1.00   47.15  ? 161  LEU B N   1 
ATOM   5444 C CA  . LEU B 1 161 ? 29.324  -0.791  -50.387 1.00   49.10  ? 161  LEU B CA  1 
ATOM   5445 C C   . LEU B 1 161 ? 29.788  0.632   -50.570 1.00   47.78  ? 161  LEU B C   1 
ATOM   5446 O O   . LEU B 1 161 ? 30.085  1.057   -51.684 1.00   49.41  ? 161  LEU B O   1 
ATOM   5447 C CB  . LEU B 1 161 ? 29.888  -1.739  -51.441 1.00   48.96  ? 161  LEU B CB  1 
ATOM   5448 C CG  . LEU B 1 161 ? 29.651  -3.142  -50.871 1.00   53.82  ? 161  LEU B CG  1 
ATOM   5449 C CD1 . LEU B 1 161 ? 28.821  -4.018  -51.772 1.00   48.39  ? 161  LEU B CD1 1 
ATOM   5450 C CD2 . LEU B 1 161 ? 30.942  -3.824  -50.458 1.00   52.37  ? 161  LEU B CD2 1 
ATOM   5451 N N   . PRO B 1 162 ? 29.821  1.386   -49.459 1.00   44.30  ? 162  PRO B N   1 
ATOM   5452 C CA  . PRO B 1 162 ? 30.003  2.836   -49.521 1.00   50.15  ? 162  PRO B CA  1 
ATOM   5453 C C   . PRO B 1 162 ? 31.160  3.218   -50.416 1.00   52.66  ? 162  PRO B C   1 
ATOM   5454 O O   . PRO B 1 162 ? 32.237  2.625   -50.331 1.00   52.30  ? 162  PRO B O   1 
ATOM   5455 C CB  . PRO B 1 162 ? 30.271  3.211   -48.066 1.00   48.43  ? 162  PRO B CB  1 
ATOM   5456 C CG  . PRO B 1 162 ? 29.487  2.187   -47.298 1.00   48.50  ? 162  PRO B CG  1 
ATOM   5457 C CD  . PRO B 1 162 ? 29.643  0.912   -48.077 1.00   39.40  ? 162  PRO B CD  1 
ATOM   5458 N N   . GLY B 1 163 ? 30.915  4.192   -51.283 1.00   53.43  ? 163  GLY B N   1 
ATOM   5459 C CA  . GLY B 1 163 ? 31.922  4.667   -52.211 1.00   52.04  ? 163  GLY B CA  1 
ATOM   5460 C C   . GLY B 1 163 ? 31.825  4.013   -53.576 1.00   55.21  ? 163  GLY B C   1 
ATOM   5461 O O   . GLY B 1 163 ? 32.190  4.623   -54.580 1.00   60.44  ? 163  GLY B O   1 
ATOM   5462 N N   . SER B 1 164 ? 31.339  2.774   -53.621 1.00   51.32  ? 164  SER B N   1 
ATOM   5463 C CA  . SER B 1 164 ? 31.215  2.051   -54.888 1.00   51.06  ? 164  SER B CA  1 
ATOM   5464 C C   . SER B 1 164 ? 30.225  2.726   -55.833 1.00   50.48  ? 164  SER B C   1 
ATOM   5465 O O   . SER B 1 164 ? 29.449  3.593   -55.431 1.00   54.77  ? 164  SER B O   1 
ATOM   5466 C CB  . SER B 1 164 ? 30.767  0.618   -54.645 1.00   51.64  ? 164  SER B CB  1 
ATOM   5467 O OG  . SER B 1 164 ? 29.370  0.579   -54.425 1.00   49.52  ? 164  SER B OG  1 
ATOM   5468 N N   . ARG B 1 165 ? 30.244  2.325   -57.095 1.00   54.25  ? 165  ARG B N   1 
ATOM   5469 C CA  . ARG B 1 165 ? 29.329  2.918   -58.057 1.00   60.31  ? 165  ARG B CA  1 
ATOM   5470 C C   . ARG B 1 165 ? 28.028  2.128   -58.153 1.00   56.63  ? 165  ARG B C   1 
ATOM   5471 O O   . ARG B 1 165 ? 26.980  2.679   -58.491 1.00   56.37  ? 165  ARG B O   1 
ATOM   5472 C CB  . ARG B 1 165 ? 29.967  3.025   -59.441 1.00   61.83  ? 165  ARG B CB  1 
ATOM   5473 C CG  . ARG B 1 165 ? 29.240  3.997   -60.342 1.00   77.14  ? 165  ARG B CG  1 
ATOM   5474 C CD  . ARG B 1 165 ? 29.292  3.583   -61.803 1.00   88.71  ? 165  ARG B CD  1 
ATOM   5475 N NE  . ARG B 1 165 ? 28.758  4.638   -62.666 1.00   107.23 ? 165  ARG B NE  1 
ATOM   5476 C CZ  . ARG B 1 165 ? 27.514  4.670   -63.141 1.00   108.56 ? 165  ARG B CZ  1 
ATOM   5477 N NH1 . ARG B 1 165 ? 26.659  3.696   -62.849 1.00   97.41  ? 165  ARG B NH1 1 
ATOM   5478 N NH2 . ARG B 1 165 ? 27.127  5.677   -63.916 1.00   110.24 ? 165  ARG B NH2 1 
ATOM   5479 N N   . GLU B 1 166 ? 28.095  0.842   -57.841 1.00   47.69  ? 166  GLU B N   1 
ATOM   5480 C CA  . GLU B 1 166 ? 26.986  -0.051  -58.144 1.00   57.24  ? 166  GLU B CA  1 
ATOM   5481 C C   . GLU B 1 166 ? 26.183  -0.467  -56.922 1.00   55.17  ? 166  GLU B C   1 
ATOM   5482 O O   . GLU B 1 166 ? 25.169  -1.158  -57.052 1.00   56.24  ? 166  GLU B O   1 
ATOM   5483 C CB  . GLU B 1 166 ? 27.476  -1.281  -58.928 1.00   67.42  ? 166  GLU B CB  1 
ATOM   5484 C CG  . GLU B 1 166 ? 28.820  -1.837  -58.467 1.00   70.35  ? 166  GLU B CG  1 
ATOM   5485 C CD  . GLU B 1 166 ? 30.013  -1.063  -59.019 1.00   72.35  ? 166  GLU B CD  1 
ATOM   5486 O OE1 . GLU B 1 166 ? 30.119  -0.936  -60.261 1.00   71.07  ? 166  GLU B OE1 1 
ATOM   5487 O OE2 . GLU B 1 166 ? 30.846  -0.597  -58.205 1.00   66.68  ? 166  GLU B OE2 1 
ATOM   5488 N N   . ALA B 1 167 ? 26.643  -0.059  -55.742 1.00   50.75  ? 167  ALA B N   1 
ATOM   5489 C CA  . ALA B 1 167 ? 25.846  -0.174  -54.518 1.00   49.32  ? 167  ALA B CA  1 
ATOM   5490 C C   . ALA B 1 167 ? 26.143  0.991   -53.588 1.00   49.09  ? 167  ALA B C   1 
ATOM   5491 O O   . ALA B 1 167 ? 26.737  0.807   -52.532 1.00   48.41  ? 167  ALA B O   1 
ATOM   5492 C CB  . ALA B 1 167 ? 26.106  -1.479  -53.820 1.00   44.80  ? 167  ALA B CB  1 
ATOM   5493 N N   . PRO B 1 168 ? 25.726  2.200   -53.988 1.00   50.61  ? 168  PRO B N   1 
ATOM   5494 C CA  . PRO B 1 168 ? 26.033  3.424   -53.234 1.00   41.56  ? 168  PRO B CA  1 
ATOM   5495 C C   . PRO B 1 168 ? 25.319  3.514   -51.875 1.00   43.45  ? 168  PRO B C   1 
ATOM   5496 O O   . PRO B 1 168 ? 25.723  4.320   -51.049 1.00   44.09  ? 168  PRO B O   1 
ATOM   5497 C CB  . PRO B 1 168 ? 25.536  4.534   -54.167 1.00   39.33  ? 168  PRO B CB  1 
ATOM   5498 C CG  . PRO B 1 168 ? 24.481  3.860   -55.018 1.00   39.35  ? 168  PRO B CG  1 
ATOM   5499 C CD  . PRO B 1 168 ? 25.030  2.492   -55.256 1.00   42.03  ? 168  PRO B CD  1 
ATOM   5500 N N   . GLY B 1 169 ? 24.286  2.707   -51.650 1.00   45.61  ? 169  GLY B N   1 
ATOM   5501 C CA  . GLY B 1 169 ? 23.484  2.811   -50.442 1.00   39.91  ? 169  GLY B CA  1 
ATOM   5502 C C   . GLY B 1 169 ? 22.366  3.841   -50.526 1.00   39.36  ? 169  GLY B C   1 
ATOM   5503 O O   . GLY B 1 169 ? 22.392  4.746   -51.370 1.00   38.38  ? 169  GLY B O   1 
ATOM   5504 N N   . ASN B 1 170 ? 21.371  3.693   -49.655 1.00   38.06  ? 170  ASN B N   1 
ATOM   5505 C CA  . ASN B 1 170 ? 20.263  4.641   -49.565 1.00   39.35  ? 170  ASN B CA  1 
ATOM   5506 C C   . ASN B 1 170 ? 19.327  4.690   -50.791 1.00   42.91  ? 170  ASN B C   1 
ATOM   5507 O O   . ASN B 1 170 ? 18.595  5.673   -50.979 1.00   42.65  ? 170  ASN B O   1 
ATOM   5508 C CB  . ASN B 1 170 ? 20.800  6.052   -49.271 1.00   33.81  ? 170  ASN B CB  1 
ATOM   5509 C CG  . ASN B 1 170 ? 21.536  6.139   -47.934 1.00   44.51  ? 170  ASN B CG  1 
ATOM   5510 O OD1 . ASN B 1 170 ? 21.260  5.378   -47.003 1.00   42.07  ? 170  ASN B OD1 1 
ATOM   5511 N ND2 . ASN B 1 170 ? 22.471  7.082   -47.831 1.00   40.89  ? 170  ASN B ND2 1 
ATOM   5512 N N   . VAL B 1 171 ? 19.333  3.660   -51.632 1.00   37.58  ? 171  VAL B N   1 
ATOM   5513 C CA  . VAL B 1 171 ? 18.543  3.761   -52.861 1.00   41.87  ? 171  VAL B CA  1 
ATOM   5514 C C   . VAL B 1 171 ? 17.044  3.757   -52.543 1.00   42.06  ? 171  VAL B C   1 
ATOM   5515 O O   . VAL B 1 171 ? 16.249  4.408   -53.228 1.00   38.28  ? 171  VAL B O   1 
ATOM   5516 C CB  . VAL B 1 171 ? 18.908  2.694   -53.927 1.00   42.75  ? 171  VAL B CB  1 
ATOM   5517 C CG1 . VAL B 1 171 ? 20.386  2.800   -54.294 1.00   38.85  ? 171  VAL B CG1 1 
ATOM   5518 C CG2 . VAL B 1 171 ? 18.525  1.283   -53.463 1.00   36.83  ? 171  VAL B CG2 1 
ATOM   5519 N N   . GLY B 1 172 ? 16.672  3.055   -51.480 1.00   37.21  ? 172  GLY B N   1 
ATOM   5520 C CA  . GLY B 1 172 ? 15.305  3.102   -50.991 1.00   37.82  ? 172  GLY B CA  1 
ATOM   5521 C C   . GLY B 1 172 ? 14.842  4.497   -50.601 1.00   37.22  ? 172  GLY B C   1 
ATOM   5522 O O   . GLY B 1 172 ? 13.695  4.855   -50.843 1.00   41.17  ? 172  GLY B O   1 
ATOM   5523 N N   . LEU B 1 173 ? 15.714  5.292   -49.987 1.00   36.83  ? 173  LEU B N   1 
ATOM   5524 C CA  . LEU B 1 173 ? 15.372  6.684   -49.729 1.00   35.52  ? 173  LEU B CA  1 
ATOM   5525 C C   . LEU B 1 173 ? 15.287  7.452   -51.050 1.00   40.83  ? 173  LEU B C   1 
ATOM   5526 O O   . LEU B 1 173 ? 14.429  8.331   -51.215 1.00   43.67  ? 173  LEU B O   1 
ATOM   5527 C CB  . LEU B 1 173 ? 16.356  7.360   -48.754 1.00   35.32  ? 173  LEU B CB  1 
ATOM   5528 C CG  . LEU B 1 173 ? 16.399  6.820   -47.311 1.00   34.76  ? 173  LEU B CG  1 
ATOM   5529 C CD1 . LEU B 1 173 ? 17.511  7.472   -46.518 1.00   34.47  ? 173  LEU B CD1 1 
ATOM   5530 C CD2 . LEU B 1 173 ? 15.066  6.991   -46.597 1.00   37.03  ? 173  LEU B CD2 1 
ATOM   5531 N N   . LEU B 1 174 ? 16.166  7.119   -51.992 1.00   35.45  ? 174  LEU B N   1 
ATOM   5532 C CA  . LEU B 1 174 ? 16.102  7.747   -53.311 1.00   40.60  ? 174  LEU B CA  1 
ATOM   5533 C C   . LEU B 1 174 ? 14.804  7.385   -54.032 1.00   38.46  ? 174  LEU B C   1 
ATOM   5534 O O   . LEU B 1 174 ? 14.334  8.148   -54.871 1.00   34.25  ? 174  LEU B O   1 
ATOM   5535 C CB  . LEU B 1 174 ? 17.325  7.405   -54.176 1.00   36.89  ? 174  LEU B CB  1 
ATOM   5536 C CG  . LEU B 1 174 ? 18.648  8.032   -53.714 1.00   45.69  ? 174  LEU B CG  1 
ATOM   5537 C CD1 . LEU B 1 174 ? 19.843  7.497   -54.514 1.00   40.00  ? 174  LEU B CD1 1 
ATOM   5538 C CD2 . LEU B 1 174 ? 18.599  9.550   -53.783 1.00   36.58  ? 174  LEU B CD2 1 
ATOM   5539 N N   . ASP B 1 175 ? 14.228  6.229   -53.696 1.00   36.04  ? 175  ASP B N   1 
ATOM   5540 C CA  . ASP B 1 175 ? 12.966  5.822   -54.288 1.00   33.25  ? 175  ASP B CA  1 
ATOM   5541 C C   . ASP B 1 175 ? 11.890  6.782   -53.783 1.00   43.09  ? 175  ASP B C   1 
ATOM   5542 O O   . ASP B 1 175 ? 11.073  7.291   -54.559 1.00   42.53  ? 175  ASP B O   1 
ATOM   5543 C CB  . ASP B 1 175 ? 12.600  4.385   -53.896 1.00   34.36  ? 175  ASP B CB  1 
ATOM   5544 C CG  . ASP B 1 175 ? 13.504  3.339   -54.538 1.00   36.90  ? 175  ASP B CG  1 
ATOM   5545 O OD1 . ASP B 1 175 ? 14.233  3.685   -55.495 1.00   34.75  ? 175  ASP B OD1 1 
ATOM   5546 O OD2 . ASP B 1 175 ? 13.474  2.165   -54.080 1.00   36.24  ? 175  ASP B OD2 1 
ATOM   5547 N N   . GLN B 1 176 ? 11.897  7.018   -52.473 1.00   35.12  ? 176  GLN B N   1 
ATOM   5548 C CA  . GLN B 1 176 ? 10.988  7.968   -51.859 1.00   33.60  ? 176  GLN B CA  1 
ATOM   5549 C C   . GLN B 1 176 ? 11.144  9.342   -52.482 1.00   38.43  ? 176  GLN B C   1 
ATOM   5550 O O   . GLN B 1 176 ? 10.153  10.007  -52.799 1.00   39.07  ? 176  GLN B O   1 
ATOM   5551 C CB  . GLN B 1 176 ? 11.218  8.044   -50.344 1.00   37.19  ? 176  GLN B CB  1 
ATOM   5552 C CG  . GLN B 1 176 ? 10.817  6.766   -49.590 1.00   33.00  ? 176  GLN B CG  1 
ATOM   5553 C CD  . GLN B 1 176 ? 11.372  6.732   -48.175 1.00   39.74  ? 176  GLN B CD  1 
ATOM   5554 O OE1 . GLN B 1 176 ? 11.788  7.761   -47.641 1.00   38.14  ? 176  GLN B OE1 1 
ATOM   5555 N NE2 . GLN B 1 176 ? 11.389  5.544   -47.563 1.00   37.43  ? 176  GLN B NE2 1 
ATOM   5556 N N   . ARG B 1 177 ? 12.385  9.782   -52.652 1.00   38.54  ? 177  ARG B N   1 
ATOM   5557 C CA  . ARG B 1 177 ? 12.610  11.107  -53.215 1.00   38.46  ? 177  ARG B CA  1 
ATOM   5558 C C   . ARG B 1 177 ? 12.072  11.199  -54.649 1.00   44.62  ? 177  ARG B C   1 
ATOM   5559 O O   . ARG B 1 177 ? 11.422  12.189  -55.007 1.00   40.53  ? 177  ARG B O   1 
ATOM   5560 C CB  . ARG B 1 177 ? 14.084  11.483  -53.173 1.00   35.53  ? 177  ARG B CB  1 
ATOM   5561 C CG  . ARG B 1 177 ? 14.394  12.787  -53.861 1.00   42.06  ? 177  ARG B CG  1 
ATOM   5562 C CD  . ARG B 1 177 ? 15.872  13.078  -53.802 1.00   39.61  ? 177  ARG B CD  1 
ATOM   5563 N NE  . ARG B 1 177 ? 16.261  13.450  -52.449 1.00   49.74  ? 177  ARG B NE  1 
ATOM   5564 C CZ  . ARG B 1 177 ? 17.510  13.408  -51.984 1.00   54.70  ? 177  ARG B CZ  1 
ATOM   5565 N NH1 . ARG B 1 177 ? 18.507  12.992  -52.768 1.00   43.12  ? 177  ARG B NH1 1 
ATOM   5566 N NH2 . ARG B 1 177 ? 17.760  13.786  -50.734 1.00   42.66  ? 177  ARG B NH2 1 
ATOM   5567 N N   . LEU B 1 178 ? 12.328  10.171  -55.462 1.00   42.79  ? 178  LEU B N   1 
ATOM   5568 C CA  . LEU B 1 178 ? 11.817  10.162  -56.834 1.00   44.52  ? 178  LEU B CA  1 
ATOM   5569 C C   . LEU B 1 178 ? 10.292  10.284  -56.846 1.00   39.31  ? 178  LEU B C   1 
ATOM   5570 O O   . LEU B 1 178 ? 9.733   11.008  -57.663 1.00   42.70  ? 178  LEU B O   1 
ATOM   5571 C CB  . LEU B 1 178 ? 12.266  8.923   -57.614 1.00   35.07  ? 178  LEU B CB  1 
ATOM   5572 C CG  . LEU B 1 178 ? 11.774  8.846   -59.069 1.00   43.25  ? 178  LEU B CG  1 
ATOM   5573 C CD1 . LEU B 1 178 ? 12.313  9.995   -59.917 1.00   32.90  ? 178  LEU B CD1 1 
ATOM   5574 C CD2 . LEU B 1 178 ? 12.148  7.505   -59.699 1.00   43.76  ? 178  LEU B CD2 1 
ATOM   5575 N N   . ALA B 1 179 ? 9.634   9.596   -55.921 1.00   35.71  ? 179  ALA B N   1 
ATOM   5576 C CA  . ALA B 1 179 ? 8.173   9.664   -55.795 1.00   38.30  ? 179  ALA B CA  1 
ATOM   5577 C C   . ALA B 1 179 ? 7.688   11.049  -55.325 1.00   40.44  ? 179  ALA B C   1 
ATOM   5578 O O   . ALA B 1 179 ? 6.657   11.540  -55.779 1.00   45.08  ? 179  ALA B O   1 
ATOM   5579 C CB  . ALA B 1 179 ? 7.667   8.560   -54.870 1.00   31.28  ? 179  ALA B CB  1 
ATOM   5580 N N   . LEU B 1 180 ? 8.438   11.680  -54.428 1.00   39.90  ? 180  LEU B N   1 
ATOM   5581 C CA  . LEU B 1 180 ? 8.189   13.074  -54.060 1.00   40.63  ? 180  LEU B CA  1 
ATOM   5582 C C   . LEU B 1 180 ? 8.320   13.998  -55.275 1.00   42.08  ? 180  LEU B C   1 
ATOM   5583 O O   . LEU B 1 180 ? 7.542   14.944  -55.424 1.00   45.72  ? 180  LEU B O   1 
ATOM   5584 C CB  . LEU B 1 180 ? 9.134   13.527  -52.936 1.00   33.34  ? 180  LEU B CB  1 
ATOM   5585 C CG  . LEU B 1 180 ? 8.727   13.293  -51.471 1.00   37.95  ? 180  LEU B CG  1 
ATOM   5586 C CD1 . LEU B 1 180 ? 8.046   11.965  -51.250 1.00   31.90  ? 180  LEU B CD1 1 
ATOM   5587 C CD2 . LEU B 1 180 ? 9.927   13.449  -50.516 1.00   32.29  ? 180  LEU B CD2 1 
ATOM   5588 N N   . GLN B 1 181 ? 9.306   13.732  -56.134 1.00   46.06  ? 181  GLN B N   1 
ATOM   5589 C CA  . GLN B 1 181 ? 9.498   14.529  -57.352 1.00   47.39  ? 181  GLN B CA  1 
ATOM   5590 C C   . GLN B 1 181 ? 8.301   14.362  -58.276 1.00   49.49  ? 181  GLN B C   1 
ATOM   5591 O O   . GLN B 1 181 ? 7.840   15.317  -58.915 1.00   41.03  ? 181  GLN B O   1 
ATOM   5592 C CB  . GLN B 1 181 ? 10.770  14.118  -58.087 1.00   43.08  ? 181  GLN B CB  1 
ATOM   5593 C CG  . GLN B 1 181 ? 11.997  14.951  -57.721 1.00   64.35  ? 181  GLN B CG  1 
ATOM   5594 C CD  . GLN B 1 181 ? 13.319  14.166  -57.812 1.00   69.12  ? 181  GLN B CD  1 
ATOM   5595 O OE1 . GLN B 1 181 ? 13.376  13.075  -58.396 1.00   67.97  ? 181  GLN B OE1 1 
ATOM   5596 N NE2 . GLN B 1 181 ? 14.382  14.724  -57.224 1.00   56.12  ? 181  GLN B NE2 1 
ATOM   5597 N N   . TRP B 1 182 ? 7.794   13.135  -58.324 1.00   43.04  ? 182  TRP B N   1 
ATOM   5598 C CA  . TRP B 1 182 ? 6.664   12.815  -59.166 1.00   41.28  ? 182  TRP B CA  1 
ATOM   5599 C C   . TRP B 1 182 ? 5.448   13.611  -58.724 1.00   44.94  ? 182  TRP B C   1 
ATOM   5600 O O   . TRP B 1 182 ? 4.723   14.152  -59.559 1.00   44.03  ? 182  TRP B O   1 
ATOM   5601 C CB  . TRP B 1 182 ? 6.373   11.321  -59.100 1.00   41.96  ? 182  TRP B CB  1 
ATOM   5602 C CG  . TRP B 1 182 ? 5.293   10.869  -60.032 1.00   49.72  ? 182  TRP B CG  1 
ATOM   5603 C CD1 . TRP B 1 182 ? 5.452   10.344  -61.288 1.00   48.72  ? 182  TRP B CD1 1 
ATOM   5604 C CD2 . TRP B 1 182 ? 3.884   10.892  -59.785 1.00   47.34  ? 182  TRP B CD2 1 
ATOM   5605 N NE1 . TRP B 1 182 ? 4.229   10.034  -61.829 1.00   47.04  ? 182  TRP B NE1 1 
ATOM   5606 C CE2 . TRP B 1 182 ? 3.250   10.360  -60.928 1.00   46.64  ? 182  TRP B CE2 1 
ATOM   5607 C CE3 . TRP B 1 182 ? 3.097   11.308  -58.708 1.00   44.95  ? 182  TRP B CE3 1 
ATOM   5608 C CZ2 . TRP B 1 182 ? 1.868   10.237  -61.025 1.00   49.20  ? 182  TRP B CZ2 1 
ATOM   5609 C CZ3 . TRP B 1 182 ? 1.725   11.178  -58.803 1.00   42.70  ? 182  TRP B CZ3 1 
ATOM   5610 C CH2 . TRP B 1 182 ? 1.124   10.648  -59.953 1.00   47.33  ? 182  TRP B CH2 1 
ATOM   5611 N N   . VAL B 1 183 ? 5.234   13.687  -57.411 1.00   40.52  ? 183  VAL B N   1 
ATOM   5612 C CA  . VAL B 1 183 ? 4.127   14.466  -56.870 1.00   40.15  ? 183  VAL B CA  1 
ATOM   5613 C C   . VAL B 1 183 ? 4.212   15.935  -57.309 1.00   46.73  ? 183  VAL B C   1 
ATOM   5614 O O   . VAL B 1 183 ? 3.223   16.503  -57.769 1.00   43.49  ? 183  VAL B O   1 
ATOM   5615 C CB  . VAL B 1 183 ? 4.041   14.335  -55.339 1.00   43.13  ? 183  VAL B CB  1 
ATOM   5616 C CG1 . VAL B 1 183 ? 3.059   15.355  -54.741 1.00   34.59  ? 183  VAL B CG1 1 
ATOM   5617 C CG2 . VAL B 1 183 ? 3.647   12.915  -54.971 1.00   41.33  ? 183  VAL B CG2 1 
ATOM   5618 N N   . GLN B 1 184 ? 5.393   16.537  -57.188 1.00   40.93  ? 184  GLN B N   1 
ATOM   5619 C CA  . GLN B 1 184 ? 5.606   17.905  -57.658 1.00   42.26  ? 184  GLN B CA  1 
ATOM   5620 C C   . GLN B 1 184 ? 5.190   18.088  -59.107 1.00   49.53  ? 184  GLN B C   1 
ATOM   5621 O O   . GLN B 1 184 ? 4.548   19.086  -59.463 1.00   41.96  ? 184  GLN B O   1 
ATOM   5622 C CB  . GLN B 1 184 ? 7.080   18.296  -57.533 1.00   34.30  ? 184  GLN B CB  1 
ATOM   5623 C CG  . GLN B 1 184 ? 7.507   18.523  -56.118 1.00   45.70  ? 184  GLN B CG  1 
ATOM   5624 C CD  . GLN B 1 184 ? 6.805   19.719  -55.540 1.00   50.65  ? 184  GLN B CD  1 
ATOM   5625 O OE1 . GLN B 1 184 ? 7.029   20.854  -55.979 1.00   52.56  ? 184  GLN B OE1 1 
ATOM   5626 N NE2 . GLN B 1 184 ? 5.929   19.480  -54.571 1.00   43.65  ? 184  GLN B NE2 1 
ATOM   5627 N N   . GLU B 1 185 ? 5.587   17.129  -59.941 1.00   47.19  ? 185  GLU B N   1 
ATOM   5628 C CA  . GLU B 1 185 ? 5.407   17.238  -61.382 1.00   52.50  ? 185  GLU B CA  1 
ATOM   5629 C C   . GLU B 1 185 ? 3.997   16.890  -61.860 1.00   48.68  ? 185  GLU B C   1 
ATOM   5630 O O   . GLU B 1 185 ? 3.601   17.283  -62.959 1.00   57.30  ? 185  GLU B O   1 
ATOM   5631 C CB  . GLU B 1 185 ? 6.398   16.326  -62.106 1.00   55.07  ? 185  GLU B CB  1 
ATOM   5632 C CG  . GLU B 1 185 ? 7.826   16.801  -62.117 1.00   56.78  ? 185  GLU B CG  1 
ATOM   5633 C CD  . GLU B 1 185 ? 8.773   15.706  -62.586 1.00   73.79  ? 185  GLU B CD  1 
ATOM   5634 O OE1 . GLU B 1 185 ? 8.273   14.620  -62.960 1.00   74.29  ? 185  GLU B OE1 1 
ATOM   5635 O OE2 . GLU B 1 185 ? 10.007  15.922  -62.566 1.00   76.38  ? 185  GLU B OE2 1 
ATOM   5636 N N   . ASN B 1 186 ? 3.245   16.156  -61.045 1.00   47.14  ? 186  ASN B N   1 
ATOM   5637 C CA  . ASN B 1 186 ? 2.022   15.524  -61.532 1.00   44.69  ? 186  ASN B CA  1 
ATOM   5638 C C   . ASN B 1 186 ? 0.770   15.722  -60.674 1.00   47.72  ? 186  ASN B C   1 
ATOM   5639 O O   . ASN B 1 186 ? -0.351  15.545  -61.155 1.00   47.56  ? 186  ASN B O   1 
ATOM   5640 C CB  . ASN B 1 186 ? 2.275   14.025  -61.743 1.00   43.44  ? 186  ASN B CB  1 
ATOM   5641 C CG  . ASN B 1 186 ? 3.261   13.754  -62.869 1.00   49.59  ? 186  ASN B CG  1 
ATOM   5642 O OD1 . ASN B 1 186 ? 2.999   14.086  -64.020 1.00   51.62  ? 186  ASN B OD1 1 
ATOM   5643 N ND2 . ASN B 1 186 ? 4.399   13.155  -62.540 1.00   46.91  ? 186  ASN B ND2 1 
ATOM   5644 N N   . ILE B 1 187 ? 0.948   16.082  -59.407 1.00   48.69  ? 187  ILE B N   1 
ATOM   5645 C CA  . ILE B 1 187 ? -0.164  16.021  -58.465 1.00   44.85  ? 187  ILE B CA  1 
ATOM   5646 C C   . ILE B 1 187 ? -1.266  17.016  -58.810 1.00   47.76  ? 187  ILE B C   1 
ATOM   5647 O O   . ILE B 1 187 ? -2.443  16.781  -58.509 1.00   44.31  ? 187  ILE B O   1 
ATOM   5648 C CB  . ILE B 1 187 ? 0.287   16.220  -57.006 1.00   44.49  ? 187  ILE B CB  1 
ATOM   5649 C CG1 . ILE B 1 187 ? -0.672  15.491  -56.062 1.00   40.29  ? 187  ILE B CG1 1 
ATOM   5650 C CG2 . ILE B 1 187 ? 0.401   17.706  -56.668 1.00   40.62  ? 187  ILE B CG2 1 
ATOM   5651 C CD1 . ILE B 1 187 ? -0.848  14.040  -56.402 1.00   38.04  ? 187  ILE B CD1 1 
ATOM   5652 N N   . ALA B 1 188 ? -0.878  18.118  -59.445 1.00   39.43  ? 188  ALA B N   1 
ATOM   5653 C CA  . ALA B 1 188 ? -1.833  19.123  -59.879 1.00   45.44  ? 188  ALA B CA  1 
ATOM   5654 C C   . ALA B 1 188 ? -2.900  18.511  -60.806 1.00   50.35  ? 188  ALA B C   1 
ATOM   5655 O O   . ALA B 1 188 ? -4.082  18.811  -60.691 1.00   53.60  ? 188  ALA B O   1 
ATOM   5656 C CB  . ALA B 1 188 ? -1.107  20.272  -60.556 1.00   37.72  ? 188  ALA B CB  1 
ATOM   5657 N N   . ALA B 1 189 ? -2.479  17.632  -61.706 1.00   46.32  ? 189  ALA B N   1 
ATOM   5658 C CA  . ALA B 1 189 ? -3.408  16.955  -62.602 1.00   49.02  ? 189  ALA B CA  1 
ATOM   5659 C C   . ALA B 1 189 ? -4.519  16.231  -61.848 1.00   48.23  ? 189  ALA B C   1 
ATOM   5660 O O   . ALA B 1 189 ? -5.568  15.945  -62.413 1.00   54.12  ? 189  ALA B O   1 
ATOM   5661 C CB  . ALA B 1 189 ? -2.650  15.981  -63.517 1.00   47.91  ? 189  ALA B CB  1 
ATOM   5662 N N   . PHE B 1 190 ? -4.280  15.934  -60.573 1.00   52.27  ? 190  PHE B N   1 
ATOM   5663 C CA  . PHE B 1 190 ? -5.264  15.251  -59.736 1.00   48.38  ? 190  PHE B CA  1 
ATOM   5664 C C   . PHE B 1 190 ? -6.016  16.259  -58.870 1.00   50.14  ? 190  PHE B C   1 
ATOM   5665 O O   . PHE B 1 190 ? -6.915  15.890  -58.114 1.00   50.45  ? 190  PHE B O   1 
ATOM   5666 C CB  . PHE B 1 190 ? -4.583  14.221  -58.828 1.00   45.62  ? 190  PHE B CB  1 
ATOM   5667 C CG  . PHE B 1 190 ? -3.907  13.096  -59.570 1.00   46.53  ? 190  PHE B CG  1 
ATOM   5668 C CD1 . PHE B 1 190 ? -2.626  13.252  -60.080 1.00   45.74  ? 190  PHE B CD1 1 
ATOM   5669 C CD2 . PHE B 1 190 ? -4.545  11.877  -59.740 1.00   44.82  ? 190  PHE B CD2 1 
ATOM   5670 C CE1 . PHE B 1 190 ? -2.006  12.221  -60.759 1.00   43.45  ? 190  PHE B CE1 1 
ATOM   5671 C CE2 . PHE B 1 190 ? -3.930  10.845  -60.422 1.00   47.90  ? 190  PHE B CE2 1 
ATOM   5672 C CZ  . PHE B 1 190 ? -2.660  11.016  -60.930 1.00   45.67  ? 190  PHE B CZ  1 
ATOM   5673 N N   . GLY B 1 191 ? -5.634  17.529  -58.983 1.00   46.83  ? 191  GLY B N   1 
ATOM   5674 C CA  . GLY B 1 191 ? -6.165  18.578  -58.125 1.00   52.46  ? 191  GLY B CA  1 
ATOM   5675 C C   . GLY B 1 191 ? -5.358  18.812  -56.852 1.00   53.12  ? 191  GLY B C   1 
ATOM   5676 O O   . GLY B 1 191 ? -5.813  19.489  -55.934 1.00   54.13  ? 191  GLY B O   1 
ATOM   5677 N N   . GLY B 1 192 ? -4.157  18.241  -56.792 1.00   55.32  ? 192  GLY B N   1 
ATOM   5678 C CA  . GLY B 1 192 ? -3.283  18.403  -55.646 1.00   37.40  ? 192  GLY B CA  1 
ATOM   5679 C C   . GLY B 1 192 ? -2.563  19.722  -55.727 1.00   46.00  ? 192  GLY B C   1 
ATOM   5680 O O   . GLY B 1 192 ? -2.386  20.267  -56.812 1.00   56.47  ? 192  GLY B O   1 
ATOM   5681 N N   . ASP B 1 193 ? -2.161  20.253  -54.580 1.00   47.42  ? 193  ASP B N   1 
ATOM   5682 C CA  . ASP B 1 193 ? -1.390  21.487  -54.546 1.00   47.73  ? 193  ASP B CA  1 
ATOM   5683 C C   . ASP B 1 193 ? 0.082   21.173  -54.251 1.00   49.45  ? 193  ASP B C   1 
ATOM   5684 O O   . ASP B 1 193 ? 0.448   20.894  -53.111 1.00   51.09  ? 193  ASP B O   1 
ATOM   5685 C CB  . ASP B 1 193 ? -1.974  22.428  -53.489 1.00   48.76  ? 193  ASP B CB  1 
ATOM   5686 C CG  . ASP B 1 193 ? -1.254  23.777  -53.423 1.00   49.44  ? 193  ASP B CG  1 
ATOM   5687 O OD1 . ASP B 1 193 ? -0.185  23.927  -54.045 1.00   45.41  ? 193  ASP B OD1 1 
ATOM   5688 O OD2 . ASP B 1 193 ? -1.767  24.695  -52.738 1.00   53.68  ? 193  ASP B OD2 1 
ATOM   5689 N N   . PRO B 1 194 ? 0.936   21.227  -55.282 1.00   53.05  ? 194  PRO B N   1 
ATOM   5690 C CA  . PRO B 1 194 ? 2.351   20.881  -55.105 1.00   46.55  ? 194  PRO B CA  1 
ATOM   5691 C C   . PRO B 1 194 ? 3.029   21.830  -54.118 1.00   47.31  ? 194  PRO B C   1 
ATOM   5692 O O   . PRO B 1 194 ? 4.076   21.515  -53.534 1.00   47.13  ? 194  PRO B O   1 
ATOM   5693 C CB  . PRO B 1 194 ? 2.953   21.091  -56.506 1.00   43.61  ? 194  PRO B CB  1 
ATOM   5694 C CG  . PRO B 1 194 ? 1.793   21.311  -57.430 1.00   47.92  ? 194  PRO B CG  1 
ATOM   5695 C CD  . PRO B 1 194 ? 0.671   21.830  -56.599 1.00   52.11  ? 194  PRO B CD  1 
ATOM   5696 N N   . MET B 1 195 ? 2.437   23.004  -53.956 1.00   42.87  ? 195  MET B N   1 
ATOM   5697 C CA  . MET B 1 195 ? 2.988   24.024  -53.077 1.00   47.82  ? 195  MET B CA  1 
ATOM   5698 C C   . MET B 1 195 ? 2.597   23.793  -51.622 1.00   45.00  ? 195  MET B C   1 
ATOM   5699 O O   . MET B 1 195 ? 3.016   24.550  -50.740 1.00   44.04  ? 195  MET B O   1 
ATOM   5700 C CB  . MET B 1 195 ? 2.576   25.426  -53.538 1.00   44.69  ? 195  MET B CB  1 
ATOM   5701 C CG  . MET B 1 195 ? 3.215   25.834  -54.845 1.00   41.65  ? 195  MET B CG  1 
ATOM   5702 S SD  . MET B 1 195 ? 3.345   27.618  -55.058 1.00   72.31  ? 195  MET B SD  1 
ATOM   5703 C CE  . MET B 1 195 ? 1.643   28.125  -54.844 1.00   60.75  ? 195  MET B CE  1 
ATOM   5704 N N   . SER B 1 196 ? 1.798   22.751  -51.380 1.00   40.22  ? 196  SER B N   1 
ATOM   5705 C CA  . SER B 1 196 ? 1.480   22.328  -50.015 1.00   44.78  ? 196  SER B CA  1 
ATOM   5706 C C   . SER B 1 196 ? 1.556   20.806  -49.836 1.00   44.21  ? 196  SER B C   1 
ATOM   5707 O O   . SER B 1 196 ? 0.567   20.082  -50.011 1.00   40.44  ? 196  SER B O   1 
ATOM   5708 C CB  . SER B 1 196 ? 0.116   22.853  -49.574 1.00   42.29  ? 196  SER B CB  1 
ATOM   5709 O OG  . SER B 1 196 ? -0.193  22.381  -48.274 1.00   45.03  ? 196  SER B OG  1 
ATOM   5710 N N   . VAL B 1 197 ? 2.742   20.331  -49.478 1.00   40.18  ? 197  VAL B N   1 
ATOM   5711 C CA  . VAL B 1 197 ? 2.986   18.904  -49.378 1.00   41.55  ? 197  VAL B CA  1 
ATOM   5712 C C   . VAL B 1 197 ? 3.492   18.518  -47.999 1.00   38.59  ? 197  VAL B C   1 
ATOM   5713 O O   . VAL B 1 197 ? 4.523   18.998  -47.542 1.00   40.30  ? 197  VAL B O   1 
ATOM   5714 C CB  . VAL B 1 197 ? 3.986   18.431  -50.453 1.00   40.38  ? 197  VAL B CB  1 
ATOM   5715 C CG1 . VAL B 1 197 ? 4.326   16.964  -50.241 1.00   36.82  ? 197  VAL B CG1 1 
ATOM   5716 C CG2 . VAL B 1 197 ? 3.411   18.682  -51.846 1.00   35.96  ? 197  VAL B CG2 1 
ATOM   5717 N N   . THR B 1 198 ? 2.758   17.640  -47.342 1.00   36.24  ? 198  THR B N   1 
ATOM   5718 C CA  . THR B 1 198 ? 3.111   17.215  -46.004 1.00   39.00  ? 198  THR B CA  1 
ATOM   5719 C C   . THR B 1 198 ? 3.483   15.746  -46.015 1.00   38.55  ? 198  THR B C   1 
ATOM   5720 O O   . THR B 1 198 ? 2.666   14.903  -46.386 1.00   41.21  ? 198  THR B O   1 
ATOM   5721 C CB  . THR B 1 198 ? 1.918   17.387  -45.050 1.00   40.93  ? 198  THR B CB  1 
ATOM   5722 O OG1 . THR B 1 198 ? 1.368   18.696  -45.212 1.00   48.84  ? 198  THR B OG1 1 
ATOM   5723 C CG2 . THR B 1 198 ? 2.351   17.192  -43.608 1.00   35.19  ? 198  THR B CG2 1 
ATOM   5724 N N   . LEU B 1 199 ? 4.707   15.432  -45.606 1.00   33.67  ? 199  LEU B N   1 
ATOM   5725 C CA  . LEU B 1 199 ? 5.086   14.036  -45.421 1.00   34.45  ? 199  LEU B CA  1 
ATOM   5726 C C   . LEU B 1 199 ? 4.588   13.535  -44.078 1.00   33.85  ? 199  LEU B C   1 
ATOM   5727 O O   . LEU B 1 199 ? 4.709   14.230  -43.081 1.00   39.94  ? 199  LEU B O   1 
ATOM   5728 C CB  . LEU B 1 199 ? 6.604   13.881  -45.472 1.00   33.16  ? 199  LEU B CB  1 
ATOM   5729 C CG  . LEU B 1 199 ? 7.303   14.537  -46.653 1.00   37.30  ? 199  LEU B CG  1 
ATOM   5730 C CD1 . LEU B 1 199 ? 8.767   14.130  -46.650 1.00   31.30  ? 199  LEU B CD1 1 
ATOM   5731 C CD2 . LEU B 1 199 ? 6.609   14.150  -47.958 1.00   32.12  ? 199  LEU B CD2 1 
ATOM   5732 N N   . PHE B 1 200 ? 4.019   12.340  -44.037 1.00   33.20  ? 200  PHE B N   1 
ATOM   5733 C CA  . PHE B 1 200 ? 3.844   11.680  -42.750 1.00   30.57  ? 200  PHE B CA  1 
ATOM   5734 C C   . PHE B 1 200 ? 4.213   10.197  -42.832 1.00   36.49  ? 200  PHE B C   1 
ATOM   5735 O O   . PHE B 1 200 ? 4.070   9.568   -43.883 1.00   37.43  ? 200  PHE B O   1 
ATOM   5736 C CB  . PHE B 1 200 ? 2.464   11.964  -42.126 1.00   34.14  ? 200  PHE B CB  1 
ATOM   5737 C CG  . PHE B 1 200 ? 1.293   11.263  -42.796 1.00   38.12  ? 200  PHE B CG  1 
ATOM   5738 C CD1 . PHE B 1 200 ? 1.115   11.302  -44.174 1.00   35.78  ? 200  PHE B CD1 1 
ATOM   5739 C CD2 . PHE B 1 200 ? 0.332   10.613  -42.018 1.00   35.93  ? 200  PHE B CD2 1 
ATOM   5740 C CE1 . PHE B 1 200 ? 0.028   10.667  -44.764 1.00   38.33  ? 200  PHE B CE1 1 
ATOM   5741 C CE2 . PHE B 1 200 ? -0.763  9.992   -42.596 1.00   35.92  ? 200  PHE B CE2 1 
ATOM   5742 C CZ  . PHE B 1 200 ? -0.917  10.010  -43.971 1.00   36.58  ? 200  PHE B CZ  1 
ATOM   5743 N N   . GLY B 1 201 ? 4.744   9.662   -41.739 1.00   34.19  ? 201  GLY B N   1 
ATOM   5744 C CA  . GLY B 1 201 ? 5.238   8.297   -41.716 1.00   34.21  ? 201  GLY B CA  1 
ATOM   5745 C C   . GLY B 1 201 ? 5.421   7.777   -40.303 1.00   39.31  ? 201  GLY B C   1 
ATOM   5746 O O   . GLY B 1 201 ? 5.559   8.553   -39.357 1.00   44.10  ? 201  GLY B O   1 
ATOM   5747 N N   . GLU B 1 202 ? 5.419   6.460   -40.155 1.00   38.64  ? 202  GLU B N   1 
ATOM   5748 C CA  . GLU B 1 202 ? 5.551   5.831   -38.845 1.00   40.75  ? 202  GLU B CA  1 
ATOM   5749 C C   . GLU B 1 202 ? 6.781   4.904   -38.749 1.00   39.92  ? 202  GLU B C   1 
ATOM   5750 O O   . GLU B 1 202 ? 7.161   4.265   -39.726 1.00   38.35  ? 202  GLU B O   1 
ATOM   5751 C CB  . GLU B 1 202 ? 4.265   5.077   -38.503 1.00   31.81  ? 202  GLU B CB  1 
ATOM   5752 C CG  . GLU B 1 202 ? 4.202   4.572   -37.069 1.00   39.04  ? 202  GLU B CG  1 
ATOM   5753 C CD  . GLU B 1 202 ? 4.629   3.134   -36.961 1.00   49.38  ? 202  GLU B CD  1 
ATOM   5754 O OE1 . GLU B 1 202 ? 4.845   2.511   -38.025 1.00   43.40  ? 202  GLU B OE1 1 
ATOM   5755 O OE2 . GLU B 1 202 ? 4.733   2.619   -35.825 1.00   48.03  ? 202  GLU B OE2 1 
HETATM 5756 N N   . SGB B 1 203 ? 7.403   4.854   -37.567 1.00   43.04  ? 203  SGB B N   1 
HETATM 5757 C CA  . SGB B 1 203 ? 8.601   4.039   -37.322 1.00   40.94  ? 203  SGB B CA  1 
HETATM 5758 C C   . SGB B 1 203 ? 9.692   4.348   -38.352 1.00   39.86  ? 203  SGB B C   1 
HETATM 5759 O O   . SGB B 1 203 ? 10.150  5.479   -38.423 1.00   39.38  ? 203  SGB B O   1 
HETATM 5760 C CB  . SGB B 1 203 ? 8.175   2.572   -37.292 1.00   44.47  ? 203  SGB B CB  1 
HETATM 5761 O OG  . SGB B 1 203 ? 9.180   1.784   -36.661 1.00   51.02  ? 203  SGB B OG  1 
HETATM 5762 O O1  . SGB B 1 203 ? 9.803   0.461   -38.803 1.00   45.37  ? 203  SGB B O1  1 
HETATM 5763 P P1  . SGB B 1 203 ? 9.646   0.361   -37.297 1.00   64.78  ? 203  SGB B P1  1 
HETATM 5764 C C1  . SGB B 1 203 ? 11.178  0.129   -36.421 1.00   56.57  ? 203  SGB B C1  1 
HETATM 5765 O O2  . SGB B 1 203 ? 8.655   -0.807  -36.772 1.00   52.44  ? 203  SGB B O2  1 
HETATM 5766 C C2  . SGB B 1 203 ? 8.953   -2.184  -37.032 1.00   54.10  ? 203  SGB B C2  1 
HETATM 5767 C C4  . SGB B 1 203 ? 8.238   -2.600  -38.308 1.00   58.75  ? 203  SGB B C4  1 
HETATM 5768 C C3  . SGB B 1 203 ? 8.448   -3.085  -35.913 1.00   62.16  ? 203  SGB B C3  1 
ATOM   5769 N N   . ALA B 1 204 ? 10.092  3.371   -39.166 1.00   38.01  ? 204  ALA B N   1 
ATOM   5770 C CA  . ALA B 1 204 ? 11.086  3.635   -40.216 1.00   43.64  ? 204  ALA B CA  1 
ATOM   5771 C C   . ALA B 1 204 ? 10.582  4.677   -41.216 1.00   38.23  ? 204  ALA B C   1 
ATOM   5772 O O   . ALA B 1 204 ? 11.369  5.429   -41.785 1.00   38.32  ? 204  ALA B O   1 
ATOM   5773 C CB  . ALA B 1 204 ? 11.502  2.348   -40.941 1.00   39.94  ? 204  ALA B CB  1 
ATOM   5774 N N   . GLY B 1 205 ? 9.270   4.718   -41.432 1.00   36.80  ? 205  GLY B N   1 
ATOM   5775 C CA  . GLY B 1 205 ? 8.683   5.776   -42.237 1.00   38.61  ? 205  GLY B CA  1 
ATOM   5776 C C   . GLY B 1 205 ? 8.956   7.152   -41.633 1.00   39.13  ? 205  GLY B C   1 
ATOM   5777 O O   . GLY B 1 205 ? 9.320   8.092   -42.339 1.00   36.94  ? 205  GLY B O   1 
ATOM   5778 N N   . ALA B 1 206 ? 8.780   7.265   -40.319 1.00   36.32  ? 206  ALA B N   1 
ATOM   5779 C CA  . ALA B 1 206 ? 9.078   8.501   -39.601 1.00   39.80  ? 206  ALA B CA  1 
ATOM   5780 C C   . ALA B 1 206 ? 10.556  8.866   -39.745 1.00   35.84  ? 206  ALA B C   1 
ATOM   5781 O O   . ALA B 1 206 ? 10.900  10.004  -40.040 1.00   39.87  ? 206  ALA B O   1 
ATOM   5782 C CB  . ALA B 1 206 ? 8.689   8.370   -38.120 1.00   36.64  ? 206  ALA B CB  1 
ATOM   5783 N N   . ALA B 1 207 ? 11.423  7.886   -39.537 1.00   37.23  ? 207  ALA B N   1 
ATOM   5784 C CA  . ALA B 1 207 ? 12.851  8.062   -39.742 1.00   33.99  ? 207  ALA B CA  1 
ATOM   5785 C C   . ALA B 1 207 ? 13.161  8.540   -41.168 1.00   38.26  ? 207  ALA B C   1 
ATOM   5786 O O   . ALA B 1 207 ? 13.988  9.448   -41.358 1.00   35.93  ? 207  ALA B O   1 
ATOM   5787 C CB  . ALA B 1 207 ? 13.566  6.761   -39.455 1.00   36.75  ? 207  ALA B CB  1 
ATOM   5788 N N   . SER B 1 208 ? 12.506  7.934   -42.166 1.00   34.81  ? 208  SER B N   1 
ATOM   5789 C CA  . SER B 1 208 ? 12.648  8.377   -43.571 1.00   37.10  ? 208  SER B CA  1 
ATOM   5790 C C   . SER B 1 208 ? 12.262  9.837   -43.737 1.00   33.34  ? 208  SER B C   1 
ATOM   5791 O O   . SER B 1 208 ? 12.988  10.615  -44.347 1.00   36.89  ? 208  SER B O   1 
ATOM   5792 C CB  . SER B 1 208 ? 11.801  7.531   -44.528 1.00   34.74  ? 208  SER B CB  1 
ATOM   5793 O OG  . SER B 1 208 ? 12.139  6.163   -44.457 1.00   34.96  ? 208  SER B OG  1 
ATOM   5794 N N   . VAL B 1 209 ? 11.106  10.206  -43.196 1.00   37.40  ? 209  VAL B N   1 
ATOM   5795 C CA  . VAL B 1 209 ? 10.673  11.608  -43.197 1.00   38.30  ? 209  VAL B CA  1 
ATOM   5796 C C   . VAL B 1 209 ? 11.759  12.510  -42.604 1.00   39.33  ? 209  VAL B C   1 
ATOM   5797 O O   . VAL B 1 209 ? 12.113  13.536  -43.183 1.00   39.90  ? 209  VAL B O   1 
ATOM   5798 C CB  . VAL B 1 209 ? 9.405   11.809  -42.364 1.00   37.68  ? 209  VAL B CB  1 
ATOM   5799 C CG1 . VAL B 1 209 ? 9.097   13.303  -42.231 1.00   32.18  ? 209  VAL B CG1 1 
ATOM   5800 C CG2 . VAL B 1 209 ? 8.233   11.053  -42.976 1.00   38.28  ? 209  VAL B CG2 1 
ATOM   5801 N N   . GLY B 1 210 ? 12.280  12.123  -41.442 1.00   33.99  ? 210  GLY B N   1 
ATOM   5802 C CA  . GLY B 1 210 ? 13.355  12.866  -40.806 1.00   39.11  ? 210  GLY B CA  1 
ATOM   5803 C C   . GLY B 1 210 ? 14.595  12.984  -41.677 1.00   40.44  ? 210  GLY B C   1 
ATOM   5804 O O   . GLY B 1 210 ? 15.269  14.008  -41.692 1.00   42.02  ? 210  GLY B O   1 
ATOM   5805 N N   . MET B 1 211 ? 14.895  11.936  -42.430 1.00   39.13  ? 211  MET B N   1 
ATOM   5806 C CA  . MET B 1 211 ? 16.015  12.007  -43.344 1.00   37.15  ? 211  MET B CA  1 
ATOM   5807 C C   . MET B 1 211 ? 15.762  12.907  -44.549 1.00   41.85  ? 211  MET B C   1 
ATOM   5808 O O   . MET B 1 211 ? 16.700  13.529  -45.054 1.00   39.94  ? 211  MET B O   1 
ATOM   5809 C CB  . MET B 1 211 ? 16.475  10.619  -43.756 1.00   38.63  ? 211  MET B CB  1 
ATOM   5810 C CG  . MET B 1 211 ? 17.332  9.990   -42.681 1.00   37.26  ? 211  MET B CG  1 
ATOM   5811 S SD  . MET B 1 211 ? 17.365  8.224   -42.824 1.00   50.74  ? 211  MET B SD  1 
ATOM   5812 C CE  . MET B 1 211 ? 17.616  7.752   -41.123 1.00   45.06  ? 211  MET B CE  1 
ATOM   5813 N N   . HIS B 1 212 ? 14.514  13.001  -45.003 1.00   33.09  ? 212  HIS B N   1 
ATOM   5814 C CA  . HIS B 1 212 ? 14.214  13.992  -46.035 1.00   38.68  ? 212  HIS B CA  1 
ATOM   5815 C C   . HIS B 1 212 ? 14.329  15.413  -45.487 1.00   42.29  ? 212  HIS B C   1 
ATOM   5816 O O   . HIS B 1 212 ? 14.630  16.336  -46.237 1.00   44.11  ? 212  HIS B O   1 
ATOM   5817 C CB  . HIS B 1 212 ? 12.852  13.765  -46.711 1.00   36.15  ? 212  HIS B CB  1 
ATOM   5818 C CG  . HIS B 1 212 ? 12.768  12.483  -47.477 1.00   39.20  ? 212  HIS B CG  1 
ATOM   5819 N ND1 . HIS B 1 212 ? 13.483  12.261  -48.635 1.00   39.44  ? 212  HIS B ND1 1 
ATOM   5820 C CD2 . HIS B 1 212 ? 12.069  11.348  -47.240 1.00   34.68  ? 212  HIS B CD2 1 
ATOM   5821 C CE1 . HIS B 1 212 ? 13.227  11.043  -49.079 1.00   40.41  ? 212  HIS B CE1 1 
ATOM   5822 N NE2 . HIS B 1 212 ? 12.368  10.470  -48.253 1.00   39.58  ? 212  HIS B NE2 1 
ATOM   5823 N N   . ILE B 1 213 ? 14.101  15.593  -44.187 1.00   38.53  ? 213  ILE B N   1 
ATOM   5824 C CA  . ILE B 1 213 ? 14.333  16.901  -43.574 1.00   42.13  ? 213  ILE B CA  1 
ATOM   5825 C C   . ILE B 1 213 ? 15.829  17.246  -43.557 1.00   43.37  ? 213  ILE B C   1 
ATOM   5826 O O   . ILE B 1 213 ? 16.210  18.398  -43.750 1.00   43.26  ? 213  ILE B O   1 
ATOM   5827 C CB  . ILE B 1 213 ? 13.774  16.982  -42.138 1.00   42.51  ? 213  ILE B CB  1 
ATOM   5828 C CG1 . ILE B 1 213 ? 12.244  17.042  -42.163 1.00   39.24  ? 213  ILE B CG1 1 
ATOM   5829 C CG2 . ILE B 1 213 ? 14.337  18.207  -41.412 1.00   36.02  ? 213  ILE B CG2 1 
ATOM   5830 C CD1 . ILE B 1 213 ? 11.584  16.557  -40.890 1.00   35.07  ? 213  ILE B CD1 1 
ATOM   5831 N N   . LEU B 1 214 ? 16.664  16.233  -43.338 1.00   42.88  ? 214  LEU B N   1 
ATOM   5832 C CA  . LEU B 1 214 ? 18.109  16.412  -43.208 1.00   39.40  ? 214  LEU B CA  1 
ATOM   5833 C C   . LEU B 1 214 ? 18.896  16.238  -44.514 1.00   45.13  ? 214  LEU B C   1 
ATOM   5834 O O   . LEU B 1 214 ? 20.128  16.213  -44.500 1.00   50.58  ? 214  LEU B O   1 
ATOM   5835 C CB  . LEU B 1 214 ? 18.666  15.457  -42.147 1.00   33.07  ? 214  LEU B CB  1 
ATOM   5836 C CG  . LEU B 1 214 ? 18.086  15.564  -40.733 1.00   37.87  ? 214  LEU B CG  1 
ATOM   5837 C CD1 . LEU B 1 214 ? 18.574  14.408  -39.869 1.00   39.27  ? 214  LEU B CD1 1 
ATOM   5838 C CD2 . LEU B 1 214 ? 18.453  16.887  -40.091 1.00   40.66  ? 214  LEU B CD2 1 
ATOM   5839 N N   . SER B 1 215 ? 18.201  16.108  -45.638 1.00   45.04  ? 215  SER B N   1 
ATOM   5840 C CA  . SER B 1 215 ? 18.890  16.003  -46.926 1.00   42.40  ? 215  SER B CA  1 
ATOM   5841 C C   . SER B 1 215 ? 18.404  17.076  -47.888 1.00   45.51  ? 215  SER B C   1 
ATOM   5842 O O   . SER B 1 215 ? 17.228  17.107  -48.262 1.00   46.36  ? 215  SER B O   1 
ATOM   5843 C CB  . SER B 1 215 ? 18.724  14.612  -47.539 1.00   46.82  ? 215  SER B CB  1 
ATOM   5844 O OG  . SER B 1 215 ? 19.582  14.454  -48.655 1.00   50.06  ? 215  SER B OG  1 
ATOM   5845 N N   . LEU B 1 216 ? 19.314  17.960  -48.288 1.00   48.48  ? 216  LEU B N   1 
ATOM   5846 C CA  . LEU B 1 216 ? 18.910  19.173  -48.989 1.00   47.35  ? 216  LEU B CA  1 
ATOM   5847 C C   . LEU B 1 216 ? 18.114  18.968  -50.279 1.00   49.07  ? 216  LEU B C   1 
ATOM   5848 O O   . LEU B 1 216 ? 17.144  19.675  -50.519 1.00   52.97  ? 216  LEU B O   1 
ATOM   5849 C CB  . LEU B 1 216 ? 20.098  20.083  -49.253 1.00   55.39  ? 216  LEU B CB  1 
ATOM   5850 C CG  . LEU B 1 216 ? 19.653  21.530  -49.082 1.00   59.90  ? 216  LEU B CG  1 
ATOM   5851 C CD1 . LEU B 1 216 ? 19.757  21.894  -47.603 1.00   60.71  ? 216  LEU B CD1 1 
ATOM   5852 C CD2 . LEU B 1 216 ? 20.468  22.474  -49.953 1.00   59.14  ? 216  LEU B CD2 1 
ATOM   5853 N N   . PRO B 1 217 ? 18.522  18.013  -51.122 1.00   48.91  ? 217  PRO B N   1 
ATOM   5854 C CA  . PRO B 1 217 ? 17.722  17.823  -52.341 1.00   50.20  ? 217  PRO B CA  1 
ATOM   5855 C C   . PRO B 1 217 ? 16.249  17.494  -52.064 1.00   50.13  ? 217  PRO B C   1 
ATOM   5856 O O   . PRO B 1 217 ? 15.403  17.814  -52.891 1.00   54.50  ? 217  PRO B O   1 
ATOM   5857 C CB  . PRO B 1 217 ? 18.424  16.655  -53.045 1.00   49.40  ? 217  PRO B CB  1 
ATOM   5858 C CG  . PRO B 1 217 ? 19.850  16.737  -52.562 1.00   46.13  ? 217  PRO B CG  1 
ATOM   5859 C CD  . PRO B 1 217 ? 19.749  17.196  -51.125 1.00   45.74  ? 217  PRO B CD  1 
ATOM   5860 N N   . SER B 1 218 ? 15.939  16.888  -50.921 1.00   51.40  ? 218  SER B N   1 
ATOM   5861 C CA  . SER B 1 218 ? 14.544  16.578  -50.603 1.00   44.89  ? 218  SER B CA  1 
ATOM   5862 C C   . SER B 1 218 ? 13.749  17.803  -50.191 1.00   47.31  ? 218  SER B C   1 
ATOM   5863 O O   . SER B 1 218 ? 12.530  17.817  -50.316 1.00   49.81  ? 218  SER B O   1 
ATOM   5864 C CB  . SER B 1 218 ? 14.447  15.537  -49.484 1.00   46.31  ? 218  SER B CB  1 
ATOM   5865 O OG  . SER B 1 218 ? 14.830  14.249  -49.922 1.00   44.05  ? 218  SER B OG  1 
ATOM   5866 N N   . ARG B 1 219 ? 14.436  18.828  -49.691 1.00   48.85  ? 219  ARG B N   1 
ATOM   5867 C CA  . ARG B 1 219 ? 13.759  19.925  -48.997 1.00   49.07  ? 219  ARG B CA  1 
ATOM   5868 C C   . ARG B 1 219 ? 12.837  20.759  -49.878 1.00   44.71  ? 219  ARG B C   1 
ATOM   5869 O O   . ARG B 1 219 ? 11.870  21.347  -49.400 1.00   56.80  ? 219  ARG B O   1 
ATOM   5870 C CB  . ARG B 1 219 ? 14.768  20.804  -48.251 1.00   51.19  ? 219  ARG B CB  1 
ATOM   5871 C CG  . ARG B 1 219 ? 15.405  20.091  -47.058 1.00   51.40  ? 219  ARG B CG  1 
ATOM   5872 C CD  . ARG B 1 219 ? 14.377  19.866  -45.965 1.00   48.09  ? 219  ARG B CD  1 
ATOM   5873 N NE  . ARG B 1 219 ? 13.898  21.139  -45.439 1.00   56.89  ? 219  ARG B NE  1 
ATOM   5874 C CZ  . ARG B 1 219 ? 14.506  21.821  -44.469 1.00   64.90  ? 219  ARG B CZ  1 
ATOM   5875 N NH1 . ARG B 1 219 ? 15.611  21.333  -43.904 1.00   56.91  ? 219  ARG B NH1 1 
ATOM   5876 N NH2 . ARG B 1 219 ? 14.008  22.985  -44.055 1.00   60.95  ? 219  ARG B NH2 1 
ATOM   5877 N N   . SER B 1 220 ? 13.118  20.798  -51.167 1.00   46.13  ? 220  SER B N   1 
ATOM   5878 C CA  . SER B 1 220 ? 12.287  21.555  -52.084 1.00   44.73  ? 220  SER B CA  1 
ATOM   5879 C C   . SER B 1 220 ? 11.048  20.759  -52.489 1.00   47.75  ? 220  SER B C   1 
ATOM   5880 O O   . SER B 1 220 ? 10.234  21.226  -53.289 1.00   46.61  ? 220  SER B O   1 
ATOM   5881 C CB  . SER B 1 220 ? 13.093  21.926  -53.326 1.00   46.83  ? 220  SER B CB  1 
ATOM   5882 O OG  . SER B 1 220 ? 13.584  20.761  -53.977 1.00   51.55  ? 220  SER B OG  1 
ATOM   5883 N N   . LEU B 1 221 ? 10.896  19.564  -51.931 1.00   43.22  ? 221  LEU B N   1 
ATOM   5884 C CA  . LEU B 1 221 ? 9.815   18.677  -52.355 1.00   41.63  ? 221  LEU B CA  1 
ATOM   5885 C C   . LEU B 1 221 ? 8.679   18.590  -51.355 1.00   40.46  ? 221  LEU B C   1 
ATOM   5886 O O   . LEU B 1 221 ? 7.680   17.914  -51.608 1.00   46.84  ? 221  LEU B O   1 
ATOM   5887 C CB  . LEU B 1 221 ? 10.347  17.264  -52.645 1.00   40.31  ? 221  LEU B CB  1 
ATOM   5888 C CG  . LEU B 1 221 ? 11.549  17.153  -53.586 1.00   42.52  ? 221  LEU B CG  1 
ATOM   5889 C CD1 . LEU B 1 221 ? 11.922  15.691  -53.790 1.00   43.18  ? 221  LEU B CD1 1 
ATOM   5890 C CD2 . LEU B 1 221 ? 11.276  17.839  -54.924 1.00   40.56  ? 221  LEU B CD2 1 
ATOM   5891 N N   . PHE B 1 222 ? 8.824   19.241  -50.209 1.00   40.67  ? 222  PHE B N   1 
ATOM   5892 C CA  . PHE B 1 222 ? 7.736   19.242  -49.230 1.00   43.63  ? 222  PHE B CA  1 
ATOM   5893 C C   . PHE B 1 222 ? 7.819   20.466  -48.345 1.00   41.36  ? 222  PHE B C   1 
ATOM   5894 O O   . PHE B 1 222 ? 8.809   21.182  -48.372 1.00   43.77  ? 222  PHE B O   1 
ATOM   5895 C CB  . PHE B 1 222 ? 7.734   17.955  -48.390 1.00   42.11  ? 222  PHE B CB  1 
ATOM   5896 C CG  . PHE B 1 222 ? 8.954   17.786  -47.533 1.00   41.56  ? 222  PHE B CG  1 
ATOM   5897 C CD1 . PHE B 1 222 ? 10.150  17.361  -48.087 1.00   40.81  ? 222  PHE B CD1 1 
ATOM   5898 C CD2 . PHE B 1 222 ? 8.905   18.061  -46.174 1.00   38.92  ? 222  PHE B CD2 1 
ATOM   5899 C CE1 . PHE B 1 222 ? 11.272  17.206  -47.307 1.00   42.10  ? 222  PHE B CE1 1 
ATOM   5900 C CE2 . PHE B 1 222 ? 10.022  17.913  -45.383 1.00   37.65  ? 222  PHE B CE2 1 
ATOM   5901 C CZ  . PHE B 1 222 ? 11.210  17.480  -45.946 1.00   43.73  ? 222  PHE B CZ  1 
ATOM   5902 N N   . HIS B 1 223 ? 6.779   20.697  -47.556 1.00   41.86  ? 223  HIS B N   1 
ATOM   5903 C CA  . HIS B 1 223 ? 6.695   21.911  -46.756 1.00   44.62  ? 223  HIS B CA  1 
ATOM   5904 C C   . HIS B 1 223 ? 6.526   21.642  -45.273 1.00   46.38  ? 223  HIS B C   1 
ATOM   5905 O O   . HIS B 1 223 ? 6.859   22.495  -44.461 1.00   49.43  ? 223  HIS B O   1 
ATOM   5906 C CB  . HIS B 1 223 ? 5.555   22.779  -47.267 1.00   43.03  ? 223  HIS B CB  1 
ATOM   5907 C CG  . HIS B 1 223 ? 5.502   22.850  -48.756 1.00   47.26  ? 223  HIS B CG  1 
ATOM   5908 N ND1 . HIS B 1 223 ? 6.216   23.778  -49.480 1.00   44.38  ? 223  HIS B ND1 1 
ATOM   5909 C CD2 . HIS B 1 223 ? 4.857   22.079  -49.662 1.00   45.00  ? 223  HIS B CD2 1 
ATOM   5910 C CE1 . HIS B 1 223 ? 5.999   23.589  -50.769 1.00   41.26  ? 223  HIS B CE1 1 
ATOM   5911 N NE2 . HIS B 1 223 ? 5.179   22.562  -50.905 1.00   44.91  ? 223  HIS B NE2 1 
ATOM   5912 N N   . ARG B 1 224 ? 6.025   20.456  -44.928 1.00   45.27  ? 224  ARG B N   1 
ATOM   5913 C CA  . ARG B 1 224 ? 5.773   20.089  -43.536 1.00   44.16  ? 224  ARG B CA  1 
ATOM   5914 C C   . ARG B 1 224 ? 5.983   18.594  -43.337 1.00   45.39  ? 224  ARG B C   1 
ATOM   5915 O O   . ARG B 1 224 ? 5.920   17.826  -44.299 1.00   42.28  ? 224  ARG B O   1 
ATOM   5916 C CB  . ARG B 1 224 ? 4.344   20.462  -43.141 1.00   45.49  ? 224  ARG B CB  1 
ATOM   5917 C CG  . ARG B 1 224 ? 4.114   21.952  -43.044 1.00   52.08  ? 224  ARG B CG  1 
ATOM   5918 C CD  . ARG B 1 224 ? 2.650   22.297  -42.788 1.00   48.30  ? 224  ARG B CD  1 
ATOM   5919 N NE  . ARG B 1 224 ? 1.891   22.465  -44.020 1.00   48.99  ? 224  ARG B NE  1 
ATOM   5920 C CZ  . ARG B 1 224 ? 2.149   23.398  -44.934 1.00   55.53  ? 224  ARG B CZ  1 
ATOM   5921 N NH1 . ARG B 1 224 ? 3.164   24.234  -44.765 1.00   53.63  ? 224  ARG B NH1 1 
ATOM   5922 N NH2 . ARG B 1 224 ? 1.405   23.482  -46.029 1.00   59.67  ? 224  ARG B NH2 1 
ATOM   5923 N N   . ALA B 1 225 ? 6.202   18.179  -42.090 1.00   39.03  ? 225  ALA B N   1 
ATOM   5924 C CA  . ALA B 1 225 ? 6.514   16.787  -41.805 1.00   33.08  ? 225  ALA B CA  1 
ATOM   5925 C C   . ALA B 1 225 ? 5.866   16.289  -40.525 1.00   38.85  ? 225  ALA B C   1 
ATOM   5926 O O   . ALA B 1 225 ? 5.711   17.042  -39.565 1.00   39.70  ? 225  ALA B O   1 
ATOM   5927 C CB  . ALA B 1 225 ? 8.012   16.605  -41.724 1.00   35.55  ? 225  ALA B CB  1 
ATOM   5928 N N   . VAL B 1 226 ? 5.508   15.006  -40.524 1.00   36.37  ? 226  VAL B N   1 
ATOM   5929 C CA  . VAL B 1 226 ? 4.973   14.329  -39.356 1.00   34.56  ? 226  VAL B CA  1 
ATOM   5930 C C   . VAL B 1 226 ? 5.793   13.074  -39.110 1.00   34.18  ? 226  VAL B C   1 
ATOM   5931 O O   . VAL B 1 226 ? 5.943   12.259  -40.000 1.00   40.30  ? 226  VAL B O   1 
ATOM   5932 C CB  . VAL B 1 226 ? 3.492   13.919  -39.556 1.00   37.63  ? 226  VAL B CB  1 
ATOM   5933 C CG1 . VAL B 1 226 ? 2.919   13.295  -38.275 1.00   31.01  ? 226  VAL B CG1 1 
ATOM   5934 C CG2 . VAL B 1 226 ? 2.659   15.121  -40.005 1.00   36.46  ? 226  VAL B CG2 1 
ATOM   5935 N N   . LEU B 1 227 ? 6.331   12.927  -37.906 1.00   34.70  ? 227  LEU B N   1 
ATOM   5936 C CA  . LEU B 1 227 ? 7.099   11.748  -37.568 1.00   33.46  ? 227  LEU B CA  1 
ATOM   5937 C C   . LEU B 1 227 ? 6.403   11.052  -36.438 1.00   37.78  ? 227  LEU B C   1 
ATOM   5938 O O   . LEU B 1 227 ? 6.406   11.546  -35.308 1.00   40.95  ? 227  LEU B O   1 
ATOM   5939 C CB  . LEU B 1 227 ? 8.534   12.095  -37.153 1.00   32.54  ? 227  LEU B CB  1 
ATOM   5940 C CG  . LEU B 1 227 ? 9.437   12.635  -38.266 1.00   38.99  ? 227  LEU B CG  1 
ATOM   5941 C CD1 . LEU B 1 227 ? 9.071   14.086  -38.563 1.00   35.58  ? 227  LEU B CD1 1 
ATOM   5942 C CD2 . LEU B 1 227 ? 10.935  12.512  -37.923 1.00   29.67  ? 227  LEU B CD2 1 
ATOM   5943 N N   . GLN B 1 228 ? 5.815   9.899   -36.750 1.00   35.51  ? 228  GLN B N   1 
ATOM   5944 C CA  . GLN B 1 228 ? 5.088   9.093   -35.780 1.00   35.26  ? 228  GLN B CA  1 
ATOM   5945 C C   . GLN B 1 228 ? 5.949   7.910   -35.321 1.00   41.33  ? 228  GLN B C   1 
ATOM   5946 O O   . GLN B 1 228 ? 6.182   6.970   -36.087 1.00   38.42  ? 228  GLN B O   1 
ATOM   5947 C CB  . GLN B 1 228 ? 3.787   8.572   -36.401 1.00   34.61  ? 228  GLN B CB  1 
ATOM   5948 C CG  . GLN B 1 228 ? 2.846   9.666   -36.909 1.00   37.47  ? 228  GLN B CG  1 
ATOM   5949 C CD  . GLN B 1 228 ? 1.677   9.109   -37.733 1.00   36.43  ? 228  GLN B CD  1 
ATOM   5950 O OE1 . GLN B 1 228 ? 1.221   7.994   -37.497 1.00   39.63  ? 228  GLN B OE1 1 
ATOM   5951 N NE2 . GLN B 1 228 ? 1.200   9.886   -38.702 1.00   28.90  ? 228  GLN B NE2 1 
ATOM   5952 N N   . SER B 1 229 ? 6.428   7.971   -34.081 1.00   32.25  ? 229  SER B N   1 
ATOM   5953 C CA  . SER B 1 229 ? 7.141   6.859   -33.455 1.00   36.97  ? 229  SER B CA  1 
ATOM   5954 C C   . SER B 1 229 ? 8.429   6.458   -34.174 1.00   35.14  ? 229  SER B C   1 
ATOM   5955 O O   . SER B 1 229 ? 8.713   5.281   -34.319 1.00   34.90  ? 229  SER B O   1 
ATOM   5956 C CB  . SER B 1 229 ? 6.233   5.629   -33.322 1.00   37.28  ? 229  SER B CB  1 
ATOM   5957 O OG  . SER B 1 229 ? 5.152   5.877   -32.448 1.00   39.33  ? 229  SER B OG  1 
ATOM   5958 N N   . GLY B 1 230 ? 9.207   7.439   -34.605 1.00   38.36  ? 230  GLY B N   1 
ATOM   5959 C CA  . GLY B 1 230 ? 10.441  7.169   -35.313 1.00   36.21  ? 230  GLY B CA  1 
ATOM   5960 C C   . GLY B 1 230 ? 11.175  8.453   -35.653 1.00   37.96  ? 230  GLY B C   1 
ATOM   5961 O O   . GLY B 1 230 ? 10.563  9.503   -35.879 1.00   37.72  ? 230  GLY B O   1 
ATOM   5962 N N   . THR B 1 231 ? 12.497  8.365   -35.688 1.00   31.13  ? 231  THR B N   1 
ATOM   5963 C CA  . THR B 1 231 ? 13.334  9.529   -35.916 1.00   35.76  ? 231  THR B CA  1 
ATOM   5964 C C   . THR B 1 231 ? 14.549  9.138   -36.748 1.00   32.42  ? 231  THR B C   1 
ATOM   5965 O O   . THR B 1 231 ? 14.952  7.979   -36.748 1.00   32.52  ? 231  THR B O   1 
ATOM   5966 C CB  . THR B 1 231 ? 13.848  10.085  -34.567 1.00   42.55  ? 231  THR B CB  1 
ATOM   5967 O OG1 . THR B 1 231 ? 14.688  9.106   -33.940 1.00   34.92  ? 231  THR B OG1 1 
ATOM   5968 C CG2 . THR B 1 231 ? 12.687  10.409  -33.640 1.00   34.72  ? 231  THR B CG2 1 
ATOM   5969 N N   . PRO B 1 232 ? 15.169  10.110  -37.426 1.00   37.02  ? 232  PRO B N   1 
ATOM   5970 C CA  . PRO B 1 232 ? 16.393  9.758   -38.155 1.00   33.37  ? 232  PRO B CA  1 
ATOM   5971 C C   . PRO B 1 232 ? 17.501  9.468   -37.171 1.00   35.30  ? 232  PRO B C   1 
ATOM   5972 O O   . PRO B 1 232 ? 18.321  8.599   -37.414 1.00   45.44  ? 232  PRO B O   1 
ATOM   5973 C CB  . PRO B 1 232 ? 16.730  11.030  -38.944 1.00   37.31  ? 232  PRO B CB  1 
ATOM   5974 C CG  . PRO B 1 232 ? 15.619  12.022  -38.653 1.00   38.91  ? 232  PRO B CG  1 
ATOM   5975 C CD  . PRO B 1 232 ? 14.886  11.556  -37.453 1.00   34.72  ? 232  PRO B CD  1 
ATOM   5976 N N   . ASN B 1 233 ? 17.525  10.201  -36.066 1.00   38.09  ? 233  ASN B N   1 
ATOM   5977 C CA  . ASN B 1 233 ? 18.549  10.013  -35.053 1.00   38.27  ? 233  ASN B CA  1 
ATOM   5978 C C   . ASN B 1 233 ? 18.258  8.754   -34.261 1.00   41.13  ? 233  ASN B C   1 
ATOM   5979 O O   . ASN B 1 233 ? 17.228  8.109   -34.477 1.00   40.11  ? 233  ASN B O   1 
ATOM   5980 C CB  . ASN B 1 233 ? 18.648  11.246  -34.140 1.00   35.53  ? 233  ASN B CB  1 
ATOM   5981 C CG  . ASN B 1 233 ? 17.301  11.658  -33.551 1.00   36.87  ? 233  ASN B CG  1 
ATOM   5982 O OD1 . ASN B 1 233 ? 16.407  12.115  -34.258 1.00   35.87  ? 233  ASN B OD1 1 
ATOM   5983 N ND2 . ASN B 1 233 ? 17.164  11.510  -32.244 1.00   39.85  ? 233  ASN B ND2 1 
ATOM   5984 N N   . GLY B 1 234 ? 19.161  8.377   -33.360 1.00   42.37  ? 234  GLY B N   1 
ATOM   5985 C CA  . GLY B 1 234 ? 18.900  7.212   -32.530 1.00   35.03  ? 234  GLY B CA  1 
ATOM   5986 C C   . GLY B 1 234 ? 19.609  5.957   -32.996 1.00   39.45  ? 234  GLY B C   1 
ATOM   5987 O O   . GLY B 1 234 ? 20.300  5.974   -34.011 1.00   43.08  ? 234  GLY B O   1 
ATOM   5988 N N   . PRO B 1 235 ? 19.420  4.853   -32.262 1.00   39.65  ? 235  PRO B N   1 
ATOM   5989 C CA  . PRO B 1 235 ? 20.302  3.686   -32.340 1.00   41.65  ? 235  PRO B CA  1 
ATOM   5990 C C   . PRO B 1 235 ? 20.069  2.772   -33.540 1.00   48.04  ? 235  PRO B C   1 
ATOM   5991 O O   . PRO B 1 235 ? 20.993  2.033   -33.881 1.00   49.11  ? 235  PRO B O   1 
ATOM   5992 C CB  . PRO B 1 235 ? 19.973  2.905   -31.054 1.00   48.16  ? 235  PRO B CB  1 
ATOM   5993 C CG  . PRO B 1 235 ? 18.778  3.571   -30.435 1.00   40.12  ? 235  PRO B CG  1 
ATOM   5994 C CD  . PRO B 1 235 ? 18.267  4.612   -31.380 1.00   40.94  ? 235  PRO B CD  1 
ATOM   5995 N N   . TRP B 1 236 ? 18.884  2.803   -34.155 1.00   43.39  ? 236  TRP B N   1 
ATOM   5996 C CA  . TRP B 1 236 ? 18.543  1.823   -35.192 1.00   36.39  ? 236  TRP B CA  1 
ATOM   5997 C C   . TRP B 1 236 ? 18.403  2.346   -36.627 1.00   42.12  ? 236  TRP B C   1 
ATOM   5998 O O   . TRP B 1 236 ? 18.469  1.564   -37.569 1.00   44.31  ? 236  TRP B O   1 
ATOM   5999 C CB  . TRP B 1 236 ? 17.252  1.102   -34.823 1.00   38.06  ? 236  TRP B CB  1 
ATOM   6000 C CG  . TRP B 1 236 ? 16.083  2.033   -34.603 1.00   42.05  ? 236  TRP B CG  1 
ATOM   6001 C CD1 . TRP B 1 236 ? 15.685  2.576   -33.413 1.00   38.28  ? 236  TRP B CD1 1 
ATOM   6002 C CD2 . TRP B 1 236 ? 15.163  2.523   -35.593 1.00   41.42  ? 236  TRP B CD2 1 
ATOM   6003 N NE1 . TRP B 1 236 ? 14.580  3.376   -33.600 1.00   41.17  ? 236  TRP B NE1 1 
ATOM   6004 C CE2 . TRP B 1 236 ? 14.234  3.359   -34.924 1.00   44.33  ? 236  TRP B CE2 1 
ATOM   6005 C CE3 . TRP B 1 236 ? 15.027  2.334   -36.974 1.00   43.65  ? 236  TRP B CE3 1 
ATOM   6006 C CZ2 . TRP B 1 236 ? 13.178  4.008   -35.592 1.00   42.04  ? 236  TRP B CZ2 1 
ATOM   6007 C CZ3 . TRP B 1 236 ? 13.974  2.987   -37.643 1.00   43.55  ? 236  TRP B CZ3 1 
ATOM   6008 C CH2 . TRP B 1 236 ? 13.065  3.812   -36.944 1.00   41.58  ? 236  TRP B CH2 1 
ATOM   6009 N N   . ALA B 1 237 ? 18.187  3.644   -36.804 1.00   43.89  ? 237  ALA B N   1 
ATOM   6010 C CA  . ALA B 1 237 ? 17.779  4.157   -38.118 1.00   40.69  ? 237  ALA B CA  1 
ATOM   6011 C C   . ALA B 1 237 ? 18.906  4.288   -39.137 1.00   43.43  ? 237  ALA B C   1 
ATOM   6012 O O   . ALA B 1 237 ? 18.648  4.257   -40.342 1.00   45.85  ? 237  ALA B O   1 
ATOM   6013 C CB  . ALA B 1 237 ? 17.018  5.490   -37.985 1.00   33.07  ? 237  ALA B CB  1 
ATOM   6014 N N   . THR B 1 238 ? 20.141  4.457   -38.664 1.00   40.21  ? 238  THR B N   1 
ATOM   6015 C CA  . THR B 1 238 ? 21.287  4.599   -39.560 1.00   38.90  ? 238  THR B CA  1 
ATOM   6016 C C   . THR B 1 238 ? 22.426  3.653   -39.180 1.00   42.36  ? 238  THR B C   1 
ATOM   6017 O O   . THR B 1 238 ? 22.424  3.073   -38.104 1.00   38.65  ? 238  THR B O   1 
ATOM   6018 C CB  . THR B 1 238 ? 21.859  6.034   -39.567 1.00   37.71  ? 238  THR B CB  1 
ATOM   6019 O OG1 . THR B 1 238 ? 22.399  6.343   -38.279 1.00   40.77  ? 238  THR B OG1 1 
ATOM   6020 C CG2 . THR B 1 238 ? 20.803  7.051   -39.934 1.00   40.93  ? 238  THR B CG2 1 
ATOM   6021 N N   . VAL B 1 239 ? 23.391  3.498   -40.082 1.00   40.31  ? 239  VAL B N   1 
ATOM   6022 C CA  . VAL B 1 239 ? 24.647  2.827   -39.769 1.00   40.16  ? 239  VAL B CA  1 
ATOM   6023 C C   . VAL B 1 239 ? 25.790  3.565   -40.439 1.00   41.09  ? 239  VAL B C   1 
ATOM   6024 O O   . VAL B 1 239 ? 25.593  4.297   -41.411 1.00   47.01  ? 239  VAL B O   1 
ATOM   6025 C CB  . VAL B 1 239 ? 24.670  1.364   -40.237 1.00   39.23  ? 239  VAL B CB  1 
ATOM   6026 C CG1 . VAL B 1 239 ? 23.810  0.504   -39.334 1.00   38.58  ? 239  VAL B CG1 1 
ATOM   6027 C CG2 . VAL B 1 239 ? 24.233  1.269   -41.704 1.00   42.85  ? 239  VAL B CG2 1 
ATOM   6028 N N   . SER B 1 240 ? 26.990  3.376   -39.915 1.00   37.70  ? 240  SER B N   1 
ATOM   6029 C CA  . SER B 1 240 ? 28.160  4.013   -40.493 1.00   48.29  ? 240  SER B CA  1 
ATOM   6030 C C   . SER B 1 240 ? 28.530  3.273   -41.772 1.00   46.87  ? 240  SER B C   1 
ATOM   6031 O O   . SER B 1 240 ? 28.094  2.135   -41.993 1.00   38.78  ? 240  SER B O   1 
ATOM   6032 C CB  . SER B 1 240 ? 29.324  3.923   -39.519 1.00   43.06  ? 240  SER B CB  1 
ATOM   6033 O OG  . SER B 1 240 ? 29.708  2.565   -39.382 1.00   51.08  ? 240  SER B OG  1 
ATOM   6034 N N   . ALA B 1 241 ? 29.346  3.912   -42.602 1.00   46.68  ? 241  ALA B N   1 
ATOM   6035 C CA  . ALA B 1 241 ? 29.830  3.279   -43.826 1.00   47.73  ? 241  ALA B CA  1 
ATOM   6036 C C   . ALA B 1 241 ? 30.508  1.966   -43.491 1.00   52.72  ? 241  ALA B C   1 
ATOM   6037 O O   . ALA B 1 241 ? 30.211  0.933   -44.099 1.00   53.85  ? 241  ALA B O   1 
ATOM   6038 C CB  . ALA B 1 241 ? 30.774  4.187   -44.554 1.00   39.41  ? 241  ALA B CB  1 
ATOM   6039 N N   . GLY B 1 242 ? 31.399  2.005   -42.500 1.00   50.11  ? 242  GLY B N   1 
ATOM   6040 C CA  . GLY B 1 242 ? 32.156  0.831   -42.113 1.00   39.08  ? 242  GLY B CA  1 
ATOM   6041 C C   . GLY B 1 242 ? 31.278  -0.361  -41.794 1.00   48.02  ? 242  GLY B C   1 
ATOM   6042 O O   . GLY B 1 242 ? 31.537  -1.490  -42.237 1.00   49.30  ? 242  GLY B O   1 
ATOM   6043 N N   . GLU B 1 243 ? 30.234  -0.112  -41.016 1.00   43.83  ? 243  GLU B N   1 
ATOM   6044 C CA  . GLU B 1 243 ? 29.344  -1.177  -40.577 1.00   49.53  ? 243  GLU B CA  1 
ATOM   6045 C C   . GLU B 1 243 ? 28.483  -1.696  -41.733 1.00   47.98  ? 243  GLU B C   1 
ATOM   6046 O O   . GLU B 1 243 ? 28.183  -2.882  -41.798 1.00   50.54  ? 243  GLU B O   1 
ATOM   6047 C CB  . GLU B 1 243 ? 28.480  -0.710  -39.394 1.00   45.74  ? 243  GLU B CB  1 
ATOM   6048 C CG  . GLU B 1 243 ? 27.479  -1.744  -38.895 1.00   39.47  ? 243  GLU B CG  1 
ATOM   6049 C CD  . GLU B 1 243 ? 28.134  -3.002  -38.343 1.00   48.50  ? 243  GLU B CD  1 
ATOM   6050 O OE1 . GLU B 1 243 ? 29.380  -3.120  -38.393 1.00   54.22  ? 243  GLU B OE1 1 
ATOM   6051 O OE2 . GLU B 1 243 ? 27.394  -3.884  -37.857 1.00   42.36  ? 243  GLU B OE2 1 
ATOM   6052 N N   . ALA B 1 244 ? 28.096  -0.807  -42.645 1.00   48.28  ? 244  ALA B N   1 
ATOM   6053 C CA  . ALA B 1 244 ? 27.331  -1.206  -43.823 1.00   44.69  ? 244  ALA B CA  1 
ATOM   6054 C C   . ALA B 1 244 ? 28.210  -2.031  -44.763 1.00   46.42  ? 244  ALA B C   1 
ATOM   6055 O O   . ALA B 1 244 ? 27.828  -3.110  -45.211 1.00   41.77  ? 244  ALA B O   1 
ATOM   6056 C CB  . ALA B 1 244 ? 26.776  0.015   -44.542 1.00   40.76  ? 244  ALA B CB  1 
ATOM   6057 N N   . ARG B 1 245 ? 29.397  -1.519  -45.058 1.00   43.19  ? 245  ARG B N   1 
ATOM   6058 C CA  . ARG B 1 245 ? 30.341  -2.276  -45.859 1.00   49.12  ? 245  ARG B CA  1 
ATOM   6059 C C   . ARG B 1 245 ? 30.571  -3.663  -45.264 1.00   49.78  ? 245  ARG B C   1 
ATOM   6060 O O   . ARG B 1 245 ? 30.748  -4.648  -45.981 1.00   52.76  ? 245  ARG B O   1 
ATOM   6061 C CB  . ARG B 1 245 ? 31.660  -1.531  -45.965 1.00   51.28  ? 245  ARG B CB  1 
ATOM   6062 C CG  . ARG B 1 245 ? 32.798  -2.400  -46.441 1.00   49.15  ? 245  ARG B CG  1 
ATOM   6063 C CD  . ARG B 1 245 ? 33.951  -1.531  -46.838 1.00   47.16  ? 245  ARG B CD  1 
ATOM   6064 N NE  . ARG B 1 245 ? 33.599  -0.681  -47.969 1.00   57.68  ? 245  ARG B NE  1 
ATOM   6065 C CZ  . ARG B 1 245 ? 33.578  -1.105  -49.229 1.00   58.58  ? 245  ARG B CZ  1 
ATOM   6066 N NH1 . ARG B 1 245 ? 33.882  -2.372  -49.508 1.00   51.69  ? 245  ARG B NH1 1 
ATOM   6067 N NH2 . ARG B 1 245 ? 33.253  -0.267  -50.203 1.00   50.36  ? 245  ARG B NH2 1 
ATOM   6068 N N   . ARG B 1 246 ? 30.544  -3.733  -43.943 1.00   47.63  ? 246  ARG B N   1 
ATOM   6069 C CA  . ARG B 1 246 ? 30.827  -4.967  -43.244 1.00   51.41  ? 246  ARG B CA  1 
ATOM   6070 C C   . ARG B 1 246 ? 29.672  -5.947  -43.384 1.00   49.62  ? 246  ARG B C   1 
ATOM   6071 O O   . ARG B 1 246 ? 29.877  -7.134  -43.635 1.00   49.13  ? 246  ARG B O   1 
ATOM   6072 C CB  . ARG B 1 246 ? 31.100  -4.667  -41.766 1.00   55.46  ? 246  ARG B CB  1 
ATOM   6073 C CG  . ARG B 1 246 ? 31.395  -5.896  -40.939 1.00   48.29  ? 246  ARG B CG  1 
ATOM   6074 C CD  . ARG B 1 246 ? 30.861  -5.756  -39.527 1.00   52.46  ? 246  ARG B CD  1 
ATOM   6075 N NE  . ARG B 1 246 ? 30.280  -7.027  -39.147 1.00   49.31  ? 246  ARG B NE  1 
ATOM   6076 C CZ  . ARG B 1 246 ? 29.038  -7.206  -38.725 1.00   50.24  ? 246  ARG B CZ  1 
ATOM   6077 N NH1 . ARG B 1 246 ? 28.216  -6.176  -38.572 1.00   48.04  ? 246  ARG B NH1 1 
ATOM   6078 N NH2 . ARG B 1 246 ? 28.631  -8.432  -38.432 1.00   51.89  ? 246  ARG B NH2 1 
ATOM   6079 N N   . ARG B 1 247 ? 28.454  -5.443  -43.217 1.00   50.99  ? 247  ARG B N   1 
ATOM   6080 C CA  . ARG B 1 247 ? 27.258  -6.275  -43.354 1.00   51.62  ? 247  ARG B CA  1 
ATOM   6081 C C   . ARG B 1 247 ? 27.059  -6.759  -44.796 1.00   48.07  ? 247  ARG B C   1 
ATOM   6082 O O   . ARG B 1 247 ? 26.604  -7.871  -45.019 1.00   48.35  ? 247  ARG B O   1 
ATOM   6083 C CB  . ARG B 1 247 ? 26.018  -5.521  -42.854 1.00   51.23  ? 247  ARG B CB  1 
ATOM   6084 C CG  . ARG B 1 247 ? 26.090  -5.117  -41.374 1.00   50.02  ? 247  ARG B CG  1 
ATOM   6085 C CD  . ARG B 1 247 ? 24.841  -4.385  -40.928 1.00   47.10  ? 247  ARG B CD  1 
ATOM   6086 N NE  . ARG B 1 247 ? 24.969  -3.871  -39.570 1.00   50.94  ? 247  ARG B NE  1 
ATOM   6087 C CZ  . ARG B 1 247 ? 23.950  -3.457  -38.821 1.00   53.62  ? 247  ARG B CZ  1 
ATOM   6088 N NH1 . ARG B 1 247 ? 22.706  -3.508  -39.296 1.00   49.17  ? 247  ARG B NH1 1 
ATOM   6089 N NH2 . ARG B 1 247 ? 24.178  -3.007  -37.589 1.00   39.49  ? 247  ARG B NH2 1 
ATOM   6090 N N   . ALA B 1 248 ? 27.406  -5.919  -45.768 1.00   49.64  ? 248  ALA B N   1 
ATOM   6091 C CA  . ALA B 1 248 ? 27.272  -6.281  -47.179 1.00   54.36  ? 248  ALA B CA  1 
ATOM   6092 C C   . ALA B 1 248 ? 28.211  -7.432  -47.483 1.00   56.58  ? 248  ALA B C   1 
ATOM   6093 O O   . ALA B 1 248 ? 27.808  -8.459  -48.029 1.00   54.24  ? 248  ALA B O   1 
ATOM   6094 C CB  . ALA B 1 248 ? 27.595  -5.088  -48.079 1.00   41.73  ? 248  ALA B CB  1 
ATOM   6095 N N   . THR B 1 249 ? 29.473  -7.240  -47.115 1.00   58.43  ? 249  THR B N   1 
ATOM   6096 C CA  . THR B 1 249 ? 30.510  -8.240  -47.310 1.00   48.54  ? 249  THR B CA  1 
ATOM   6097 C C   . THR B 1 249 ? 30.182  -9.564  -46.616 1.00   55.76  ? 249  THR B C   1 
ATOM   6098 O O   . THR B 1 249 ? 30.390  -10.633 -47.193 1.00   58.41  ? 249  THR B O   1 
ATOM   6099 C CB  . THR B 1 249 ? 31.853  -7.709  -46.814 1.00   54.04  ? 249  THR B CB  1 
ATOM   6100 O OG1 . THR B 1 249 ? 32.128  -6.462  -47.466 1.00   49.80  ? 249  THR B OG1 1 
ATOM   6101 C CG2 . THR B 1 249 ? 32.965  -8.708  -47.118 1.00   51.23  ? 249  THR B CG2 1 
ATOM   6102 N N   . LEU B 1 250 ? 29.657  -9.499  -45.392 1.00   48.37  ? 250  LEU B N   1 
ATOM   6103 C CA  . LEU B 1 250 ? 29.274  -10.722 -44.695 1.00   54.40  ? 250  LEU B CA  1 
ATOM   6104 C C   . LEU B 1 250 ? 28.118  -11.397 -45.415 1.00   52.95  ? 250  LEU B C   1 
ATOM   6105 O O   . LEU B 1 250 ? 28.053  -12.629 -45.494 1.00   54.17  ? 250  LEU B O   1 
ATOM   6106 C CB  . LEU B 1 250 ? 28.920  -10.473 -43.217 1.00   53.16  ? 250  LEU B CB  1 
ATOM   6107 C CG  . LEU B 1 250 ? 28.344  -11.706 -42.501 1.00   52.40  ? 250  LEU B CG  1 
ATOM   6108 C CD1 . LEU B 1 250 ? 29.223  -12.922 -42.709 1.00   49.18  ? 250  LEU B CD1 1 
ATOM   6109 C CD2 . LEU B 1 250 ? 28.118  -11.475 -41.015 1.00   51.94  ? 250  LEU B CD2 1 
ATOM   6110 N N   . LEU B 1 251 ? 27.203  -10.600 -45.951 1.00   53.30  ? 251  LEU B N   1 
ATOM   6111 C CA  . LEU B 1 251 ? 26.072  -11.191 -46.660 1.00   54.99  ? 251  LEU B CA  1 
ATOM   6112 C C   . LEU B 1 251 ? 26.533  -11.832 -47.973 1.00   53.99  ? 251  LEU B C   1 
ATOM   6113 O O   . LEU B 1 251 ? 26.070  -12.913 -48.337 1.00   53.86  ? 251  LEU B O   1 
ATOM   6114 C CB  . LEU B 1 251 ? 24.949  -10.185 -46.909 1.00   48.35  ? 251  LEU B CB  1 
ATOM   6115 C CG  . LEU B 1 251 ? 23.813  -10.869 -47.675 1.00   54.07  ? 251  LEU B CG  1 
ATOM   6116 C CD1 . LEU B 1 251 ? 22.614  -11.165 -46.779 1.00   47.81  ? 251  LEU B CD1 1 
ATOM   6117 C CD2 . LEU B 1 251 ? 23.413  -10.049 -48.881 1.00   46.49  ? 251  LEU B CD2 1 
ATOM   6118 N N   . ALA B 1 252 ? 27.452  -11.174 -48.672 1.00   52.52  ? 252  ALA B N   1 
ATOM   6119 C CA  . ALA B 1 252 ? 28.004  -11.737 -49.901 1.00   60.27  ? 252  ALA B CA  1 
ATOM   6120 C C   . ALA B 1 252 ? 28.617  -13.102 -49.600 1.00   62.35  ? 252  ALA B C   1 
ATOM   6121 O O   . ALA B 1 252 ? 28.245  -14.111 -50.197 1.00   63.66  ? 252  ALA B O   1 
ATOM   6122 C CB  . ALA B 1 252 ? 29.035  -10.810 -50.499 1.00   52.52  ? 252  ALA B CB  1 
ATOM   6123 N N   . ARG B 1 253 ? 29.545  -13.126 -48.653 1.00   58.84  ? 253  ARG B N   1 
ATOM   6124 C CA  . ARG B 1 253 ? 30.140  -14.375 -48.203 1.00   60.34  ? 253  ARG B CA  1 
ATOM   6125 C C   . ARG B 1 253 ? 29.068  -15.439 -47.926 1.00   61.84  ? 253  ARG B C   1 
ATOM   6126 O O   . ARG B 1 253 ? 29.166  -16.573 -48.400 1.00   57.58  ? 253  ARG B O   1 
ATOM   6127 C CB  . ARG B 1 253 ? 30.989  -14.117 -46.957 1.00   61.29  ? 253  ARG B CB  1 
ATOM   6128 C CG  . ARG B 1 253 ? 31.581  -15.351 -46.311 1.00   69.34  ? 253  ARG B CG  1 
ATOM   6129 C CD  . ARG B 1 253 ? 32.183  -15.012 -44.956 1.00   74.15  ? 253  ARG B CD  1 
ATOM   6130 N NE  . ARG B 1 253 ? 32.905  -16.138 -44.371 1.00   90.46  ? 253  ARG B NE  1 
ATOM   6131 C CZ  . ARG B 1 253 ? 32.353  -17.054 -43.578 1.00   101.90 ? 253  ARG B CZ  1 
ATOM   6132 N NH1 . ARG B 1 253 ? 31.059  -16.983 -43.268 1.00   81.29  ? 253  ARG B NH1 1 
ATOM   6133 N NH2 . ARG B 1 253 ? 33.097  -18.044 -43.094 1.00   106.14 ? 253  ARG B NH2 1 
ATOM   6134 N N   . LEU B 1 254 ? 28.036  -15.073 -47.171 1.00   59.97  ? 254  LEU B N   1 
ATOM   6135 C CA  . LEU B 1 254 ? 27.001  -16.038 -46.801 1.00   59.79  ? 254  LEU B CA  1 
ATOM   6136 C C   . LEU B 1 254 ? 26.289  -16.658 -48.003 1.00   60.38  ? 254  LEU B C   1 
ATOM   6137 O O   . LEU B 1 254 ? 25.708  -17.738 -47.892 1.00   56.23  ? 254  LEU B O   1 
ATOM   6138 C CB  . LEU B 1 254 ? 25.970  -15.409 -45.859 1.00   60.20  ? 254  LEU B CB  1 
ATOM   6139 C CG  . LEU B 1 254 ? 26.449  -15.067 -44.447 1.00   61.70  ? 254  LEU B CG  1 
ATOM   6140 C CD1 . LEU B 1 254 ? 25.271  -14.670 -43.574 1.00   54.02  ? 254  LEU B CD1 1 
ATOM   6141 C CD2 . LEU B 1 254 ? 27.196  -16.251 -43.850 1.00   54.99  ? 254  LEU B CD2 1 
ATOM   6142 N N   . VAL B 1 255 ? 26.323  -15.973 -49.143 1.00   56.48  ? 255  VAL B N   1 
ATOM   6143 C CA  . VAL B 1 255 ? 25.657  -16.478 -50.340 1.00   60.83  ? 255  VAL B CA  1 
ATOM   6144 C C   . VAL B 1 255 ? 26.634  -16.891 -51.447 1.00   65.20  ? 255  VAL B C   1 
ATOM   6145 O O   . VAL B 1 255 ? 26.215  -17.224 -52.550 1.00   67.17  ? 255  VAL B O   1 
ATOM   6146 C CB  . VAL B 1 255 ? 24.624  -15.464 -50.909 1.00   58.03  ? 255  VAL B CB  1 
ATOM   6147 C CG1 . VAL B 1 255 ? 23.504  -15.215 -49.905 1.00   53.21  ? 255  VAL B CG1 1 
ATOM   6148 C CG2 . VAL B 1 255 ? 25.301  -14.154 -51.312 1.00   52.07  ? 255  VAL B CG2 1 
ATOM   6149 N N   . GLY B 1 256 ? 27.931  -16.855 -51.161 1.00   62.84  ? 256  GLY B N   1 
ATOM   6150 C CA  . GLY B 1 256 ? 28.925  -17.335 -52.104 1.00   60.55  ? 256  GLY B CA  1 
ATOM   6151 C C   . GLY B 1 256 ? 29.623  -16.288 -52.958 1.00   62.79  ? 256  GLY B C   1 
ATOM   6152 O O   . GLY B 1 256 ? 30.180  -16.615 -54.000 1.00   69.59  ? 256  GLY B O   1 
ATOM   6153 N N   . CYS B 1 257 ? 29.633  -15.036 -52.522 1.00   58.03  ? 257  CYS B N   1 
ATOM   6154 C CA  . CYS B 1 257 ? 30.255  -13.990 -53.325 1.00   61.32  ? 257  CYS B CA  1 
ATOM   6155 C C   . CYS B 1 257 ? 31.441  -13.323 -52.624 1.00   65.67  ? 257  CYS B C   1 
ATOM   6156 O O   . CYS B 1 257 ? 32.560  -13.308 -53.154 1.00   69.67  ? 257  CYS B O   1 
ATOM   6157 C CB  . CYS B 1 257 ? 29.210  -12.948 -53.747 1.00   61.91  ? 257  CYS B CB  1 
ATOM   6158 S SG  . CYS B 1 257 ? 27.729  -13.639 -54.557 1.00   64.51  ? 257  CYS B SG  1 
ATOM   6159 N N   . ASN B 1 265 ? 37.532  -6.596  -55.119 1.00   71.55  ? 265  ASN B N   1 
ATOM   6160 C CA  . ASN B 1 265 ? 36.905  -5.349  -55.565 1.00   82.31  ? 265  ASN B CA  1 
ATOM   6161 C C   . ASN B 1 265 ? 35.391  -5.347  -55.384 1.00   75.77  ? 265  ASN B C   1 
ATOM   6162 O O   . ASN B 1 265 ? 34.753  -6.405  -55.346 1.00   72.98  ? 265  ASN B O   1 
ATOM   6163 C CB  . ASN B 1 265 ? 37.242  -5.051  -57.030 1.00   80.14  ? 265  ASN B CB  1 
ATOM   6164 C CG  . ASN B 1 265 ? 36.548  -6.003  -57.992 1.00   80.53  ? 265  ASN B CG  1 
ATOM   6165 O OD1 . ASN B 1 265 ? 35.507  -5.677  -58.564 1.00   73.45  ? 265  ASN B OD1 1 
ATOM   6166 N ND2 . ASN B 1 265 ? 37.118  -7.196  -58.163 1.00   84.85  ? 265  ASN B ND2 1 
ATOM   6167 N N   . ASP B 1 266 ? 34.821  -4.149  -55.287 1.00   70.03  ? 266  ASP B N   1 
ATOM   6168 C CA  . ASP B 1 266 ? 33.383  -3.996  -55.091 1.00   66.59  ? 266  ASP B CA  1 
ATOM   6169 C C   . ASP B 1 266 ? 32.590  -4.478  -56.311 1.00   63.64  ? 266  ASP B C   1 
ATOM   6170 O O   . ASP B 1 266 ? 31.589  -5.180  -56.172 1.00   58.01  ? 266  ASP B O   1 
ATOM   6171 C CB  . ASP B 1 266 ? 33.041  -2.538  -54.752 1.00   57.43  ? 266  ASP B CB  1 
ATOM   6172 C CG  . ASP B 1 266 ? 33.505  -2.135  -53.348 1.00   62.70  ? 266  ASP B CG  1 
ATOM   6173 O OD1 . ASP B 1 266 ? 33.728  -3.042  -52.509 1.00   56.92  ? 266  ASP B OD1 1 
ATOM   6174 O OD2 . ASP B 1 266 ? 33.640  -0.915  -53.079 1.00   55.66  ? 266  ASP B OD2 1 
ATOM   6175 N N   . THR B 1 267 ? 33.055  -4.113  -57.501 1.00   65.88  ? 267  THR B N   1 
ATOM   6176 C CA  . THR B 1 267 ? 32.341  -4.416  -58.741 1.00   64.19  ? 267  THR B CA  1 
ATOM   6177 C C   . THR B 1 267 ? 32.048  -5.905  -58.917 1.00   62.04  ? 267  THR B C   1 
ATOM   6178 O O   . THR B 1 267 ? 30.932  -6.299  -59.265 1.00   57.36  ? 267  THR B O   1 
ATOM   6179 C CB  . THR B 1 267 ? 33.108  -3.900  -59.965 1.00   63.76  ? 267  THR B CB  1 
ATOM   6180 O OG1 . THR B 1 267 ? 33.245  -2.476  -59.879 1.00   62.42  ? 267  THR B OG1 1 
ATOM   6181 C CG2 . THR B 1 267 ? 32.369  -4.256  -61.242 1.00   62.80  ? 267  THR B CG2 1 
ATOM   6182 N N   . GLU B 1 268 ? 33.049  -6.736  -58.667 1.00   61.85  ? 268  GLU B N   1 
ATOM   6183 C CA  . GLU B 1 268 ? 32.854  -8.172  -58.787 1.00   59.33  ? 268  GLU B CA  1 
ATOM   6184 C C   . GLU B 1 268 ? 31.897  -8.677  -57.710 1.00   59.43  ? 268  GLU B C   1 
ATOM   6185 O O   . GLU B 1 268 ? 31.065  -9.553  -57.957 1.00   55.40  ? 268  GLU B O   1 
ATOM   6186 C CB  . GLU B 1 268 ? 34.195  -8.911  -58.710 1.00   56.43  ? 268  GLU B CB  1 
ATOM   6187 N N   . LEU B 1 269 ? 32.014  -8.125  -56.507 1.00   60.07  ? 269  LEU B N   1 
ATOM   6188 C CA  . LEU B 1 269 ? 31.201  -8.601  -55.399 1.00   55.00  ? 269  LEU B CA  1 
ATOM   6189 C C   . LEU B 1 269 ? 29.732  -8.301  -55.677 1.00   53.95  ? 269  LEU B C   1 
ATOM   6190 O O   . LEU B 1 269 ? 28.853  -9.132  -55.430 1.00   50.39  ? 269  LEU B O   1 
ATOM   6191 C CB  . LEU B 1 269 ? 31.661  -7.968  -54.082 1.00   57.67  ? 269  LEU B CB  1 
ATOM   6192 C CG  . LEU B 1 269 ? 31.055  -8.523  -52.789 1.00   56.36  ? 269  LEU B CG  1 
ATOM   6193 C CD1 . LEU B 1 269 ? 31.921  -8.202  -51.595 1.00   55.92  ? 269  LEU B CD1 1 
ATOM   6194 C CD2 . LEU B 1 269 ? 29.664  -7.968  -52.582 1.00   58.42  ? 269  LEU B CD2 1 
ATOM   6195 N N   . ILE B 1 270 ? 29.473  -7.118  -56.219 1.00   47.96  ? 270  ILE B N   1 
ATOM   6196 C CA  . ILE B 1 270 ? 28.104  -6.702  -56.486 1.00   55.65  ? 270  ILE B CA  1 
ATOM   6197 C C   . ILE B 1 270 ? 27.508  -7.395  -57.712 1.00   59.57  ? 270  ILE B C   1 
ATOM   6198 O O   . ILE B 1 270 ? 26.317  -7.755  -57.726 1.00   50.09  ? 270  ILE B O   1 
ATOM   6199 C CB  . ILE B 1 270 ? 28.018  -5.185  -56.611 1.00   55.12  ? 270  ILE B CB  1 
ATOM   6200 C CG1 . ILE B 1 270 ? 28.438  -4.559  -55.280 1.00   56.84  ? 270  ILE B CG1 1 
ATOM   6201 C CG2 . ILE B 1 270 ? 26.612  -4.769  -56.960 1.00   51.39  ? 270  ILE B CG2 1 
ATOM   6202 C CD1 . ILE B 1 270 ? 28.888  -3.122  -55.391 1.00   62.62  ? 270  ILE B CD1 1 
ATOM   6203 N N   . ALA B 1 271 ? 28.339  -7.603  -58.730 1.00   53.31  ? 271  ALA B N   1 
ATOM   6204 C CA  . ALA B 1 271 ? 27.896  -8.338  -59.902 1.00   54.09  ? 271  ALA B CA  1 
ATOM   6205 C C   . ALA B 1 271 ? 27.422  -9.733  -59.504 1.00   52.21  ? 271  ALA B C   1 
ATOM   6206 O O   . ALA B 1 271 ? 26.368  -10.191 -59.960 1.00   49.79  ? 271  ALA B O   1 
ATOM   6207 C CB  . ALA B 1 271 ? 28.989  -8.412  -60.928 1.00   54.84  ? 271  ALA B CB  1 
ATOM   6208 N N   . CYS B 1 272 ? 28.177  -10.399 -58.635 1.00   52.37  ? 272  CYS B N   1 
ATOM   6209 C CA  . CYS B 1 272 ? 27.777  -11.737 -58.190 1.00   59.59  ? 272  CYS B CA  1 
ATOM   6210 C C   . CYS B 1 272 ? 26.490  -11.686 -57.379 1.00   54.88  ? 272  CYS B C   1 
ATOM   6211 O O   . CYS B 1 272 ? 25.618  -12.551 -57.536 1.00   59.17  ? 272  CYS B O   1 
ATOM   6212 C CB  . CYS B 1 272 ? 28.879  -12.456 -57.396 1.00   46.38  ? 272  CYS B CB  1 
ATOM   6213 S SG  . CYS B 1 272 ? 28.286  -13.948 -56.526 1.00   68.70  ? 272  CYS B SG  1 
ATOM   6214 N N   . LEU B 1 273 ? 26.375  -10.679 -56.512 1.00   52.06  ? 273  LEU B N   1 
ATOM   6215 C CA  . LEU B 1 273 ? 25.151  -10.498 -55.726 1.00   51.15  ? 273  LEU B CA  1 
ATOM   6216 C C   . LEU B 1 273 ? 23.964  -10.304 -56.652 1.00   50.83  ? 273  LEU B C   1 
ATOM   6217 O O   . LEU B 1 273 ? 22.866  -10.784 -56.370 1.00   53.96  ? 273  LEU B O   1 
ATOM   6218 C CB  . LEU B 1 273 ? 25.255  -9.303  -54.769 1.00   52.56  ? 273  LEU B CB  1 
ATOM   6219 C CG  . LEU B 1 273 ? 25.979  -9.500  -53.436 1.00   41.31  ? 273  LEU B CG  1 
ATOM   6220 C CD1 . LEU B 1 273 ? 26.092  -8.182  -52.732 1.00   47.41  ? 273  LEU B CD1 1 
ATOM   6221 C CD2 . LEU B 1 273 ? 25.251  -10.512 -52.564 1.00   47.22  ? 273  LEU B CD2 1 
ATOM   6222 N N   . ARG B 1 274 ? 24.183  -9.618  -57.769 1.00   49.57  ? 274  ARG B N   1 
ATOM   6223 C CA  . ARG B 1 274 ? 23.086  -9.387  -58.703 1.00   53.32  ? 274  ARG B CA  1 
ATOM   6224 C C   . ARG B 1 274 ? 22.572  -10.667 -59.376 1.00   53.03  ? 274  ARG B C   1 
ATOM   6225 O O   . ARG B 1 274 ? 21.441  -10.694 -59.854 1.00   49.88  ? 274  ARG B O   1 
ATOM   6226 C CB  . ARG B 1 274 ? 23.422  -8.292  -59.718 1.00   46.50  ? 274  ARG B CB  1 
ATOM   6227 C CG  . ARG B 1 274 ? 23.444  -6.890  -59.091 1.00   49.08  ? 274  ARG B CG  1 
ATOM   6228 C CD  . ARG B 1 274 ? 23.459  -5.794  -60.135 1.00   46.04  ? 274  ARG B CD  1 
ATOM   6229 N NE  . ARG B 1 274 ? 24.496  -6.053  -61.117 1.00   52.43  ? 274  ARG B NE  1 
ATOM   6230 C CZ  . ARG B 1 274 ? 25.664  -5.424  -61.149 1.00   61.52  ? 274  ARG B CZ  1 
ATOM   6231 N NH1 . ARG B 1 274 ? 25.934  -4.480  -60.258 1.00   59.31  ? 274  ARG B NH1 1 
ATOM   6232 N NH2 . ARG B 1 274 ? 26.557  -5.735  -62.079 1.00   60.92  ? 274  ARG B NH2 1 
ATOM   6233 N N   . THR B 1 275 ? 23.371  -11.734 -59.364 1.00   50.54  ? 275  THR B N   1 
ATOM   6234 C CA  . THR B 1 275 ? 22.965  -12.990 -60.004 1.00   46.31  ? 275  THR B CA  1 
ATOM   6235 C C   . THR B 1 275 ? 22.060  -13.830 -59.125 1.00   52.75  ? 275  THR B C   1 
ATOM   6236 O O   . THR B 1 275 ? 21.532  -14.842 -59.568 1.00   59.11  ? 275  THR B O   1 
ATOM   6237 C CB  . THR B 1 275 ? 24.168  -13.888 -60.389 1.00   50.04  ? 275  THR B CB  1 
ATOM   6238 O OG1 . THR B 1 275 ? 24.655  -14.573 -59.225 1.00   55.34  ? 275  THR B OG1 1 
ATOM   6239 C CG2 . THR B 1 275 ? 25.290  -13.076 -61.029 1.00   42.90  ? 275  THR B CG2 1 
ATOM   6240 N N   . ARG B 1 276 ? 21.876  -13.429 -57.875 1.00   51.85  ? 276  ARG B N   1 
ATOM   6241 C CA  . ARG B 1 276 ? 21.184  -14.305 -56.943 1.00   47.63  ? 276  ARG B CA  1 
ATOM   6242 C C   . ARG B 1 276 ? 19.676  -14.053 -56.864 1.00   51.70  ? 276  ARG B C   1 
ATOM   6243 O O   . ARG B 1 276 ? 19.233  -12.911 -56.788 1.00   53.60  ? 276  ARG B O   1 
ATOM   6244 C CB  . ARG B 1 276 ? 21.839  -14.212 -55.559 1.00   56.38  ? 276  ARG B CB  1 
ATOM   6245 C CG  . ARG B 1 276 ? 23.316  -14.627 -55.539 1.00   59.72  ? 276  ARG B CG  1 
ATOM   6246 C CD  . ARG B 1 276 ? 23.500  -16.144 -55.430 1.00   53.90  ? 276  ARG B CD  1 
ATOM   6247 N NE  . ARG B 1 276 ? 24.872  -16.487 -55.056 1.00   65.18  ? 276  ARG B NE  1 
ATOM   6248 C CZ  . ARG B 1 276 ? 25.847  -16.745 -55.924 1.00   67.64  ? 276  ARG B CZ  1 
ATOM   6249 N NH1 . ARG B 1 276 ? 25.604  -16.715 -57.229 1.00   66.15  ? 276  ARG B NH1 1 
ATOM   6250 N NH2 . ARG B 1 276 ? 27.068  -17.035 -55.488 1.00   60.29  ? 276  ARG B NH2 1 
ATOM   6251 N N   . PRO B 1 277 ? 18.878  -15.130 -56.881 1.00   53.18  ? 277  PRO B N   1 
ATOM   6252 C CA  . PRO B 1 277 ? 17.436  -14.955 -56.701 1.00   54.47  ? 277  PRO B CA  1 
ATOM   6253 C C   . PRO B 1 277 ? 17.159  -14.153 -55.431 1.00   55.20  ? 277  PRO B C   1 
ATOM   6254 O O   . PRO B 1 277 ? 17.841  -14.340 -54.419 1.00   47.19  ? 277  PRO B O   1 
ATOM   6255 C CB  . PRO B 1 277 ? 16.921  -16.393 -56.552 1.00   51.71  ? 277  PRO B CB  1 
ATOM   6256 C CG  . PRO B 1 277 ? 17.932  -17.229 -57.216 1.00   49.39  ? 277  PRO B CG  1 
ATOM   6257 C CD  . PRO B 1 277 ? 19.253  -16.547 -56.994 1.00   52.09  ? 277  PRO B CD  1 
ATOM   6258 N N   . ALA B 1 278 ? 16.169  -13.270 -55.487 1.00   54.00  ? 278  ALA B N   1 
ATOM   6259 C CA  . ALA B 1 278 ? 15.868  -12.402 -54.355 1.00   52.76  ? 278  ALA B CA  1 
ATOM   6260 C C   . ALA B 1 278 ? 15.866  -13.160 -53.026 1.00   52.23  ? 278  ALA B C   1 
ATOM   6261 O O   . ALA B 1 278 ? 16.511  -12.733 -52.069 1.00   49.53  ? 278  ALA B O   1 
ATOM   6262 C CB  . ALA B 1 278 ? 14.547  -11.682 -54.563 1.00   46.50  ? 278  ALA B CB  1 
ATOM   6263 N N   . GLN B 1 279 ? 15.160  -14.288 -52.973 1.00   51.74  ? 279  GLN B N   1 
ATOM   6264 C CA  . GLN B 1 279 ? 14.978  -15.003 -51.714 1.00   50.74  ? 279  GLN B CA  1 
ATOM   6265 C C   . GLN B 1 279 ? 16.283  -15.508 -51.099 1.00   52.87  ? 279  GLN B C   1 
ATOM   6266 O O   . GLN B 1 279 ? 16.331  -15.803 -49.913 1.00   50.85  ? 279  GLN B O   1 
ATOM   6267 C CB  . GLN B 1 279 ? 14.000  -16.163 -51.869 1.00   52.73  ? 279  GLN B CB  1 
ATOM   6268 C CG  . GLN B 1 279 ? 13.659  -16.836 -50.545 1.00   53.99  ? 279  GLN B CG  1 
ATOM   6269 C CD  . GLN B 1 279 ? 12.925  -15.909 -49.580 1.00   53.26  ? 279  GLN B CD  1 
ATOM   6270 O OE1 . GLN B 1 279 ? 12.168  -15.036 -49.994 1.00   47.19  ? 279  GLN B OE1 1 
ATOM   6271 N NE2 . GLN B 1 279 ? 13.144  -16.107 -48.287 1.00   49.13  ? 279  GLN B NE2 1 
ATOM   6272 N N   . ASP B 1 280 ? 17.331  -15.623 -51.907 1.00   52.88  ? 280  ASP B N   1 
ATOM   6273 C CA  . ASP B 1 280 ? 18.633  -16.048 -51.399 1.00   53.11  ? 280  ASP B CA  1 
ATOM   6274 C C   . ASP B 1 280 ? 19.240  -14.967 -50.499 1.00   53.71  ? 280  ASP B C   1 
ATOM   6275 O O   . ASP B 1 280 ? 19.798  -15.261 -49.438 1.00   54.17  ? 280  ASP B O   1 
ATOM   6276 C CB  . ASP B 1 280 ? 19.584  -16.370 -52.554 1.00   52.33  ? 280  ASP B CB  1 
ATOM   6277 C CG  . ASP B 1 280 ? 19.268  -17.700 -53.221 1.00   59.69  ? 280  ASP B CG  1 
ATOM   6278 O OD1 . ASP B 1 280 ? 18.180  -18.267 -52.957 1.00   58.10  ? 280  ASP B OD1 1 
ATOM   6279 O OD2 . ASP B 1 280 ? 20.117  -18.180 -54.005 1.00   54.53  ? 280  ASP B OD2 1 
ATOM   6280 N N   . LEU B 1 281 ? 19.132  -13.720 -50.940 1.00   46.12  ? 281  LEU B N   1 
ATOM   6281 C CA  . LEU B 1 281 ? 19.540  -12.561 -50.157 1.00   48.52  ? 281  LEU B CA  1 
ATOM   6282 C C   . LEU B 1 281 ? 18.724  -12.471 -48.868 1.00   51.42  ? 281  LEU B C   1 
ATOM   6283 O O   . LEU B 1 281 ? 19.268  -12.309 -47.775 1.00   47.67  ? 281  LEU B O   1 
ATOM   6284 C CB  . LEU B 1 281 ? 19.339  -11.295 -50.986 1.00   49.49  ? 281  LEU B CB  1 
ATOM   6285 C CG  . LEU B 1 281 ? 20.500  -10.900 -51.894 1.00   48.06  ? 281  LEU B CG  1 
ATOM   6286 C CD1 . LEU B 1 281 ? 21.301  -12.103 -52.322 1.00   44.95  ? 281  LEU B CD1 1 
ATOM   6287 C CD2 . LEU B 1 281 ? 20.022  -10.091 -53.086 1.00   51.20  ? 281  LEU B CD2 1 
ATOM   6288 N N   . VAL B 1 282 ? 17.411  -12.596 -49.003 1.00   44.45  ? 282  VAL B N   1 
ATOM   6289 C CA  . VAL B 1 282 ? 16.521  -12.510 -47.859 1.00   47.78  ? 282  VAL B CA  1 
ATOM   6290 C C   . VAL B 1 282 ? 16.745  -13.648 -46.846 1.00   54.22  ? 282  VAL B C   1 
ATOM   6291 O O   . VAL B 1 282 ? 16.549  -13.469 -45.638 1.00   54.07  ? 282  VAL B O   1 
ATOM   6292 C CB  . VAL B 1 282 ? 15.061  -12.447 -48.328 1.00   41.35  ? 282  VAL B CB  1 
ATOM   6293 C CG1 . VAL B 1 282 ? 14.088  -12.663 -47.156 1.00   44.67  ? 282  VAL B CG1 1 
ATOM   6294 C CG2 . VAL B 1 282 ? 14.812  -11.126 -49.012 1.00   39.27  ? 282  VAL B CG2 1 
ATOM   6295 N N   . ASP B 1 283 ? 17.166  -14.809 -47.342 1.00   51.89  ? 283  ASP B N   1 
ATOM   6296 C CA  . ASP B 1 283 ? 17.456  -15.966 -46.494 1.00   50.76  ? 283  ASP B CA  1 
ATOM   6297 C C   . ASP B 1 283 ? 18.527  -15.658 -45.446 1.00   52.49  ? 283  ASP B C   1 
ATOM   6298 O O   . ASP B 1 283 ? 18.537  -16.254 -44.374 1.00   44.51  ? 283  ASP B O   1 
ATOM   6299 C CB  . ASP B 1 283 ? 17.958  -17.136 -47.345 1.00   51.27  ? 283  ASP B CB  1 
ATOM   6300 C CG  . ASP B 1 283 ? 16.835  -17.969 -47.950 1.00   58.98  ? 283  ASP B CG  1 
ATOM   6301 O OD1 . ASP B 1 283 ? 15.658  -17.835 -47.535 1.00   54.66  ? 283  ASP B OD1 1 
ATOM   6302 O OD2 . ASP B 1 283 ? 17.149  -18.780 -48.851 1.00   60.39  ? 283  ASP B OD2 1 
ATOM   6303 N N   . HIS B 1 284 ? 19.443  -14.746 -45.767 1.00   50.92  ? 284  HIS B N   1 
ATOM   6304 C CA  . HIS B 1 284 ? 20.592  -14.498 -44.895 1.00   49.44  ? 284  HIS B CA  1 
ATOM   6305 C C   . HIS B 1 284 ? 20.646  -13.103 -44.297 1.00   53.66  ? 284  HIS B C   1 
ATOM   6306 O O   . HIS B 1 284 ? 21.603  -12.764 -43.596 1.00   54.02  ? 284  HIS B O   1 
ATOM   6307 C CB  . HIS B 1 284 ? 21.899  -14.758 -45.640 1.00   52.69  ? 284  HIS B CB  1 
ATOM   6308 C CG  . HIS B 1 284 ? 22.221  -16.208 -45.787 1.00   59.76  ? 284  HIS B CG  1 
ATOM   6309 N ND1 . HIS B 1 284 ? 22.417  -17.036 -44.703 1.00   59.02  ? 284  HIS B ND1 1 
ATOM   6310 C CD2 . HIS B 1 284 ? 22.364  -16.983 -46.887 1.00   47.98  ? 284  HIS B CD2 1 
ATOM   6311 C CE1 . HIS B 1 284 ? 22.667  -18.260 -45.128 1.00   57.82  ? 284  HIS B CE1 1 
ATOM   6312 N NE2 . HIS B 1 284 ? 22.641  -18.255 -46.449 1.00   57.94  ? 284  HIS B NE2 1 
ATOM   6313 N N   . GLU B 1 285 ? 19.634  -12.288 -44.566 1.00   53.53  ? 285  GLU B N   1 
ATOM   6314 C CA  . GLU B 1 285 ? 19.734  -10.893 -44.176 1.00   53.40  ? 285  GLU B CA  1 
ATOM   6315 C C   . GLU B 1 285 ? 19.759  -10.714 -42.658 1.00   48.95  ? 285  GLU B C   1 
ATOM   6316 O O   . GLU B 1 285 ? 20.398  -9.793  -42.161 1.00   45.82  ? 285  GLU B O   1 
ATOM   6317 C CB  . GLU B 1 285 ? 18.669  -10.027 -44.859 1.00   51.76  ? 285  GLU B CB  1 
ATOM   6318 C CG  . GLU B 1 285 ? 17.327  -9.940  -44.165 1.00   47.92  ? 285  GLU B CG  1 
ATOM   6319 C CD  . GLU B 1 285 ? 16.442  -8.905  -44.829 1.00   50.56  ? 285  GLU B CD  1 
ATOM   6320 O OE1 . GLU B 1 285 ? 16.227  -9.024  -46.049 1.00   55.55  ? 285  GLU B OE1 1 
ATOM   6321 O OE2 . GLU B 1 285 ? 15.985  -7.959  -44.151 1.00   57.55  ? 285  GLU B OE2 1 
ATOM   6322 N N   . TRP B 1 286 ? 19.100  -11.609 -41.927 1.00   48.31  ? 286  TRP B N   1 
ATOM   6323 C CA  . TRP B 1 286 ? 19.117  -11.540 -40.467 1.00   49.74  ? 286  TRP B CA  1 
ATOM   6324 C C   . TRP B 1 286 ? 20.416  -12.055 -39.852 1.00   55.61  ? 286  TRP B C   1 
ATOM   6325 O O   . TRP B 1 286 ? 20.645  -11.899 -38.655 1.00   62.31  ? 286  TRP B O   1 
ATOM   6326 C CB  . TRP B 1 286 ? 17.915  -12.263 -39.861 1.00   45.92  ? 286  TRP B CB  1 
ATOM   6327 C CG  . TRP B 1 286 ? 16.631  -11.538 -40.141 1.00   65.81  ? 286  TRP B CG  1 
ATOM   6328 C CD1 . TRP B 1 286 ? 15.619  -11.940 -40.971 1.00   57.19  ? 286  TRP B CD1 1 
ATOM   6329 C CD2 . TRP B 1 286 ? 16.233  -10.265 -39.611 1.00   65.74  ? 286  TRP B CD2 1 
ATOM   6330 N NE1 . TRP B 1 286 ? 14.615  -11.003 -40.979 1.00   55.99  ? 286  TRP B NE1 1 
ATOM   6331 C CE2 . TRP B 1 286 ? 14.965  -9.967  -40.151 1.00   65.81  ? 286  TRP B CE2 1 
ATOM   6332 C CE3 . TRP B 1 286 ? 16.824  -9.352  -38.726 1.00   61.66  ? 286  TRP B CE3 1 
ATOM   6333 C CZ2 . TRP B 1 286 ? 14.275  -8.792  -39.834 1.00   63.96  ? 286  TRP B CZ2 1 
ATOM   6334 C CZ3 . TRP B 1 286 ? 16.140  -8.186  -38.417 1.00   63.09  ? 286  TRP B CZ3 1 
ATOM   6335 C CH2 . TRP B 1 286 ? 14.881  -7.917  -38.971 1.00   58.77  ? 286  TRP B CH2 1 
ATOM   6336 N N   . HIS B 1 287 ? 21.282  -12.630 -40.674 1.00   50.24  ? 287  HIS B N   1 
ATOM   6337 C CA  . HIS B 1 287 ? 22.492  -13.247 -40.158 1.00   50.87  ? 287  HIS B CA  1 
ATOM   6338 C C   . HIS B 1 287 ? 23.680  -12.308 -40.108 1.00   53.60  ? 287  HIS B C   1 
ATOM   6339 O O   . HIS B 1 287 ? 24.802  -12.762 -39.895 1.00   53.00  ? 287  HIS B O   1 
ATOM   6340 C CB  . HIS B 1 287 ? 22.858  -14.491 -40.973 1.00   50.73  ? 287  HIS B CB  1 
ATOM   6341 C CG  . HIS B 1 287 ? 21.818  -15.561 -40.920 1.00   49.84  ? 287  HIS B CG  1 
ATOM   6342 N ND1 . HIS B 1 287 ? 21.560  -16.404 -41.979 1.00   52.62  ? 287  HIS B ND1 1 
ATOM   6343 C CD2 . HIS B 1 287 ? 20.947  -15.903 -39.943 1.00   51.54  ? 287  HIS B CD2 1 
ATOM   6344 C CE1 . HIS B 1 287 ? 20.593  -17.240 -41.644 1.00   53.00  ? 287  HIS B CE1 1 
ATOM   6345 N NE2 . HIS B 1 287 ? 20.200  -16.956 -40.417 1.00   58.30  ? 287  HIS B NE2 1 
ATOM   6346 N N   . VAL B 1 288 ? 23.453  -11.010 -40.295 1.00   49.09  ? 288  VAL B N   1 
ATOM   6347 C CA  . VAL B 1 288 ? 24.583  -10.077 -40.329 1.00   51.50  ? 288  VAL B CA  1 
ATOM   6348 C C   . VAL B 1 288 ? 24.679  -9.076  -39.166 1.00   51.08  ? 288  VAL B C   1 
ATOM   6349 O O   . VAL B 1 288 ? 25.630  -8.290  -39.107 1.00   52.74  ? 288  VAL B O   1 
ATOM   6350 C CB  . VAL B 1 288 ? 24.662  -9.310  -41.673 1.00   51.33  ? 288  VAL B CB  1 
ATOM   6351 C CG1 . VAL B 1 288 ? 25.013  -10.261 -42.811 1.00   53.33  ? 288  VAL B CG1 1 
ATOM   6352 C CG2 . VAL B 1 288 ? 23.360  -8.584  -41.946 1.00   43.96  ? 288  VAL B CG2 1 
ATOM   6353 N N   . LEU B 1 289 ? 23.714  -9.091  -38.251 1.00   42.76  ? 289  LEU B N   1 
ATOM   6354 C CA  . LEU B 1 289 ? 23.774  -8.187  -37.103 1.00   47.47  ? 289  LEU B CA  1 
ATOM   6355 C C   . LEU B 1 289 ? 24.939  -8.538  -36.167 1.00   50.38  ? 289  LEU B C   1 
ATOM   6356 O O   . LEU B 1 289 ? 25.208  -9.708  -35.912 1.00   49.43  ? 289  LEU B O   1 
ATOM   6357 C CB  . LEU B 1 289 ? 22.444  -8.177  -36.346 1.00   45.52  ? 289  LEU B CB  1 
ATOM   6358 C CG  . LEU B 1 289 ? 21.309  -7.536  -37.148 1.00   45.82  ? 289  LEU B CG  1 
ATOM   6359 C CD1 . LEU B 1 289 ? 19.957  -7.944  -36.625 1.00   41.02  ? 289  LEU B CD1 1 
ATOM   6360 C CD2 . LEU B 1 289 ? 21.462  -6.027  -37.177 1.00   48.39  ? 289  LEU B CD2 1 
ATOM   6361 N N   . PRO B 1 290 ? 25.632  -7.515  -35.645 1.00   55.14  ? 290  PRO B N   1 
ATOM   6362 C CA  . PRO B 1 290 ? 26.798  -7.768  -34.789 1.00   50.37  ? 290  PRO B CA  1 
ATOM   6363 C C   . PRO B 1 290 ? 26.423  -8.439  -33.461 1.00   51.77  ? 290  PRO B C   1 
ATOM   6364 O O   . PRO B 1 290 ? 27.223  -9.190  -32.913 1.00   51.22  ? 290  PRO B O   1 
ATOM   6365 C CB  . PRO B 1 290 ? 27.363  -6.366  -34.526 1.00   49.89  ? 290  PRO B CB  1 
ATOM   6366 C CG  . PRO B 1 290 ? 26.563  -5.418  -35.364 1.00   51.63  ? 290  PRO B CG  1 
ATOM   6367 C CD  . PRO B 1 290 ? 25.273  -6.089  -35.687 1.00   48.28  ? 290  PRO B CD  1 
ATOM   6368 N N   . GLN B 1 291 ? 25.221  -8.180  -32.953 1.00   53.11  ? 291  GLN B N   1 
ATOM   6369 C CA  . GLN B 1 291 ? 24.812  -8.729  -31.659 1.00   57.18  ? 291  GLN B CA  1 
ATOM   6370 C C   . GLN B 1 291 ? 23.410  -9.303  -31.706 1.00   53.43  ? 291  GLN B C   1 
ATOM   6371 O O   . GLN B 1 291 ? 22.597  -8.900  -32.532 1.00   56.95  ? 291  GLN B O   1 
ATOM   6372 C CB  . GLN B 1 291 ? 24.850  -7.651  -30.559 1.00   55.53  ? 291  GLN B CB  1 
ATOM   6373 C CG  . GLN B 1 291 ? 26.221  -7.089  -30.254 1.00   48.93  ? 291  GLN B CG  1 
ATOM   6374 C CD  . GLN B 1 291 ? 26.535  -5.845  -31.050 1.00   61.26  ? 291  GLN B CD  1 
ATOM   6375 O OE1 . GLN B 1 291 ? 27.705  -5.530  -31.306 1.00   60.21  ? 291  GLN B OE1 1 
ATOM   6376 N NE2 . GLN B 1 291 ? 25.489  -5.119  -31.444 1.00   62.67  ? 291  GLN B NE2 1 
ATOM   6377 N N   . GLU B 1 292 ? 23.132  -10.236 -30.800 1.00   56.46  ? 292  GLU B N   1 
ATOM   6378 C CA  . GLU B 1 292 ? 21.771  -10.685 -30.563 1.00   52.09  ? 292  GLU B CA  1 
ATOM   6379 C C   . GLU B 1 292 ? 21.003  -9.451  -30.136 1.00   55.13  ? 292  GLU B C   1 
ATOM   6380 O O   . GLU B 1 292 ? 21.459  -8.708  -29.270 1.00   62.53  ? 292  GLU B O   1 
ATOM   6381 C CB  . GLU B 1 292 ? 21.736  -11.738 -29.449 1.00   56.31  ? 292  GLU B CB  1 
ATOM   6382 C CG  . GLU B 1 292 ? 20.371  -12.403 -29.248 1.00   62.78  ? 292  GLU B CG  1 
ATOM   6383 C CD  . GLU B 1 292 ? 20.309  -13.288 -27.999 1.00   78.81  ? 292  GLU B CD  1 
ATOM   6384 O OE1 . GLU B 1 292 ? 21.362  -13.501 -27.353 1.00   74.83  ? 292  GLU B OE1 1 
ATOM   6385 O OE2 . GLU B 1 292 ? 19.202  -13.767 -27.660 1.00   79.49  ? 292  GLU B OE2 1 
ATOM   6386 N N   . SER B 1 293 ? 19.846  -9.209  -30.738 1.00   59.78  ? 293  SER B N   1 
ATOM   6387 C CA  . SER B 1 293 ? 19.141  -7.973  -30.449 1.00   50.03  ? 293  SER B CA  1 
ATOM   6388 C C   . SER B 1 293 ? 17.671  -7.991  -30.805 1.00   50.58  ? 293  SER B C   1 
ATOM   6389 O O   . SER B 1 293 ? 17.175  -8.931  -31.418 1.00   54.90  ? 293  SER B O   1 
ATOM   6390 C CB  . SER B 1 293 ? 19.838  -6.788  -31.128 1.00   49.55  ? 293  SER B CB  1 
ATOM   6391 O OG  . SER B 1 293 ? 20.369  -7.129  -32.399 1.00   50.15  ? 293  SER B OG  1 
ATOM   6392 N N   . ILE B 1 294 ? 16.978  -6.949  -30.363 1.00   49.22  ? 294  ILE B N   1 
ATOM   6393 C CA  . ILE B 1 294 ? 15.668  -6.599  -30.878 1.00   47.65  ? 294  ILE B CA  1 
ATOM   6394 C C   . ILE B 1 294 ? 15.735  -5.128  -31.294 1.00   46.43  ? 294  ILE B C   1 
ATOM   6395 O O   . ILE B 1 294 ? 16.682  -4.425  -30.935 1.00   44.87  ? 294  ILE B O   1 
ATOM   6396 C CB  . ILE B 1 294 ? 14.552  -6.846  -29.847 1.00   50.94  ? 294  ILE B CB  1 
ATOM   6397 C CG1 . ILE B 1 294 ? 14.902  -6.200  -28.502 1.00   50.03  ? 294  ILE B CG1 1 
ATOM   6398 C CG2 . ILE B 1 294 ? 14.319  -8.342  -29.658 1.00   46.36  ? 294  ILE B CG2 1 
ATOM   6399 C CD1 . ILE B 1 294 ? 13.756  -6.210  -27.513 1.00   37.93  ? 294  ILE B CD1 1 
ATOM   6400 N N   . PHE B 1 295 ? 14.754  -4.679  -32.074 1.00   51.49  ? 295  PHE B N   1 
ATOM   6401 C CA  . PHE B 1 295 ? 14.704  -3.299  -32.566 1.00   41.05  ? 295  PHE B CA  1 
ATOM   6402 C C   . PHE B 1 295 ? 16.028  -2.902  -33.214 1.00   43.88  ? 295  PHE B C   1 
ATOM   6403 O O   . PHE B 1 295 ? 16.530  -1.796  -33.019 1.00   44.01  ? 295  PHE B O   1 
ATOM   6404 C CB  . PHE B 1 295 ? 14.338  -2.323  -31.435 1.00   40.18  ? 295  PHE B CB  1 
ATOM   6405 C CG  . PHE B 1 295 ? 13.431  -1.189  -31.868 1.00   35.76  ? 295  PHE B CG  1 
ATOM   6406 C CD1 . PHE B 1 295 ? 13.726  -0.429  -32.995 1.00   35.05  ? 295  PHE B CD1 1 
ATOM   6407 C CD2 . PHE B 1 295 ? 12.280  -0.887  -31.144 1.00   39.38  ? 295  PHE B CD2 1 
ATOM   6408 C CE1 . PHE B 1 295 ? 12.893  0.600   -33.398 1.00   36.99  ? 295  PHE B CE1 1 
ATOM   6409 C CE2 . PHE B 1 295 ? 11.435  0.145   -31.534 1.00   38.66  ? 295  PHE B CE2 1 
ATOM   6410 C CZ  . PHE B 1 295 ? 11.744  0.893   -32.665 1.00   40.31  ? 295  PHE B CZ  1 
ATOM   6411 N N   . ARG B 1 296 ? 16.595  -3.829  -33.974 1.00   44.50  ? 296  ARG B N   1 
ATOM   6412 C CA  . ARG B 1 296 ? 17.791  -3.568  -34.748 1.00   43.63  ? 296  ARG B CA  1 
ATOM   6413 C C   . ARG B 1 296 ? 17.609  -4.272  -36.103 1.00   49.57  ? 296  ARG B C   1 
ATOM   6414 O O   . ARG B 1 296 ? 16.999  -5.345  -36.178 1.00   46.59  ? 296  ARG B O   1 
ATOM   6415 C CB  . ARG B 1 296 ? 19.034  -4.064  -34.000 1.00   48.97  ? 296  ARG B CB  1 
ATOM   6416 C CG  . ARG B 1 296 ? 20.257  -3.145  -34.113 1.00   55.35  ? 296  ARG B CG  1 
ATOM   6417 C CD  . ARG B 1 296 ? 20.548  -2.337  -32.840 1.00   44.55  ? 296  ARG B CD  1 
ATOM   6418 N NE  . ARG B 1 296 ? 19.350  -1.705  -32.316 1.00   50.72  ? 296  ARG B NE  1 
ATOM   6419 C CZ  . ARG B 1 296 ? 19.290  -0.919  -31.242 1.00   46.24  ? 296  ARG B CZ  1 
ATOM   6420 N NH1 . ARG B 1 296 ? 20.366  -0.617  -30.519 1.00   42.76  ? 296  ARG B NH1 1 
ATOM   6421 N NH2 . ARG B 1 296 ? 18.122  -0.430  -30.889 1.00   47.43  ? 296  ARG B NH2 1 
ATOM   6422 N N   . PHE B 1 297 ? 18.126  -3.665  -37.170 1.00   45.77  ? 297  PHE B N   1 
ATOM   6423 C CA  . PHE B 1 297 ? 17.824  -4.103  -38.539 1.00   41.91  ? 297  PHE B CA  1 
ATOM   6424 C C   . PHE B 1 297 ? 19.069  -4.087  -39.414 1.00   48.86  ? 297  PHE B C   1 
ATOM   6425 O O   . PHE B 1 297 ? 19.906  -3.183  -39.314 1.00   46.04  ? 297  PHE B O   1 
ATOM   6426 C CB  . PHE B 1 297 ? 16.715  -3.232  -39.141 1.00   41.17  ? 297  PHE B CB  1 
ATOM   6427 C CG  . PHE B 1 297 ? 15.548  -3.036  -38.209 1.00   46.90  ? 297  PHE B CG  1 
ATOM   6428 C CD1 . PHE B 1 297 ? 14.671  -4.085  -37.940 1.00   41.39  ? 297  PHE B CD1 1 
ATOM   6429 C CD2 . PHE B 1 297 ? 15.357  -1.828  -37.557 1.00   40.77  ? 297  PHE B CD2 1 
ATOM   6430 C CE1 . PHE B 1 297 ? 13.608  -3.914  -37.062 1.00   43.59  ? 297  PHE B CE1 1 
ATOM   6431 C CE2 . PHE B 1 297 ? 14.294  -1.652  -36.669 1.00   40.33  ? 297  PHE B CE2 1 
ATOM   6432 C CZ  . PHE B 1 297 ? 13.418  -2.695  -36.427 1.00   39.46  ? 297  PHE B CZ  1 
ATOM   6433 N N   . SER B 1 298 ? 19.190  -5.099  -40.267 1.00   45.71  ? 298  SER B N   1 
ATOM   6434 C CA  . SER B 1 298 ? 20.435  -5.347  -40.977 1.00   43.19  ? 298  SER B CA  1 
ATOM   6435 C C   . SER B 1 298 ? 20.784  -4.325  -42.056 1.00   46.78  ? 298  SER B C   1 
ATOM   6436 O O   . SER B 1 298 ? 21.943  -3.912  -42.171 1.00   46.33  ? 298  SER B O   1 
ATOM   6437 C CB  . SER B 1 298 ? 20.430  -6.756  -41.551 1.00   46.54  ? 298  SER B CB  1 
ATOM   6438 O OG  . SER B 1 298 ? 20.414  -7.699  -40.499 1.00   46.85  ? 298  SER B OG  1 
ATOM   6439 N N   . PHE B 1 299 ? 19.796  -3.907  -42.844 1.00   41.15  ? 299  PHE B N   1 
ATOM   6440 C CA  . PHE B 1 299 ? 20.080  -2.984  -43.938 1.00   38.80  ? 299  PHE B CA  1 
ATOM   6441 C C   . PHE B 1 299 ? 19.210  -1.742  -43.867 1.00   43.65  ? 299  PHE B C   1 
ATOM   6442 O O   . PHE B 1 299 ? 18.010  -1.780  -44.137 1.00   44.27  ? 299  PHE B O   1 
ATOM   6443 C CB  . PHE B 1 299 ? 19.976  -3.699  -45.293 1.00   37.84  ? 299  PHE B CB  1 
ATOM   6444 C CG  . PHE B 1 299 ? 20.889  -4.883  -45.395 1.00   42.84  ? 299  PHE B CG  1 
ATOM   6445 C CD1 . PHE B 1 299 ? 22.209  -4.722  -45.788 1.00   41.52  ? 299  PHE B CD1 1 
ATOM   6446 C CD2 . PHE B 1 299 ? 20.450  -6.147  -45.023 1.00   40.80  ? 299  PHE B CD2 1 
ATOM   6447 C CE1 . PHE B 1 299 ? 23.066  -5.812  -45.842 1.00   42.16  ? 299  PHE B CE1 1 
ATOM   6448 C CE2 . PHE B 1 299 ? 21.299  -7.236  -45.073 1.00   41.02  ? 299  PHE B CE2 1 
ATOM   6449 C CZ  . PHE B 1 299 ? 22.608  -7.070  -45.485 1.00   39.10  ? 299  PHE B CZ  1 
ATOM   6450 N N   . VAL B 1 300 ? 19.843  -0.637  -43.499 1.00   39.68  ? 300  VAL B N   1 
ATOM   6451 C CA  . VAL B 1 300 ? 19.144  0.592   -43.194 1.00   35.61  ? 300  VAL B CA  1 
ATOM   6452 C C   . VAL B 1 300 ? 19.919  1.701   -43.868 1.00   36.52  ? 300  VAL B C   1 
ATOM   6453 O O   . VAL B 1 300 ? 20.991  1.455   -44.413 1.00   38.41  ? 300  VAL B O   1 
ATOM   6454 C CB  . VAL B 1 300 ? 19.055  0.820   -41.646 1.00   37.35  ? 300  VAL B CB  1 
ATOM   6455 C CG1 . VAL B 1 300 ? 18.453  -0.390  -40.965 1.00   32.53  ? 300  VAL B CG1 1 
ATOM   6456 C CG2 . VAL B 1 300 ? 20.417  1.110   -41.060 1.00   37.03  ? 300  VAL B CG2 1 
ATOM   6457 N N   . PRO B 1 301 ? 19.374  2.923   -43.868 1.00   36.84  ? 301  PRO B N   1 
ATOM   6458 C CA  . PRO B 1 301 ? 20.112  4.058   -44.429 1.00   38.56  ? 301  PRO B CA  1 
ATOM   6459 C C   . PRO B 1 301 ? 21.527  4.141   -43.853 1.00   44.50  ? 301  PRO B C   1 
ATOM   6460 O O   . PRO B 1 301 ? 21.746  3.758   -42.692 1.00   40.75  ? 301  PRO B O   1 
ATOM   6461 C CB  . PRO B 1 301 ? 19.283  5.260   -43.974 1.00   39.28  ? 301  PRO B CB  1 
ATOM   6462 C CG  . PRO B 1 301 ? 17.897  4.733   -43.916 1.00   38.83  ? 301  PRO B CG  1 
ATOM   6463 C CD  . PRO B 1 301 ? 18.015  3.301   -43.447 1.00   38.27  ? 301  PRO B CD  1 
ATOM   6464 N N   . VAL B 1 302 ? 22.464  4.631   -44.662 1.00   39.88  ? 302  VAL B N   1 
ATOM   6465 C CA  . VAL B 1 302 ? 23.877  4.660   -44.301 1.00   42.34  ? 302  VAL B CA  1 
ATOM   6466 C C   . VAL B 1 302 ? 24.414  6.084   -44.317 1.00   44.18  ? 302  VAL B C   1 
ATOM   6467 O O   . VAL B 1 302 ? 24.052  6.874   -45.184 1.00   43.57  ? 302  VAL B O   1 
ATOM   6468 C CB  . VAL B 1 302 ? 24.721  3.818   -45.280 1.00   39.54  ? 302  VAL B CB  1 
ATOM   6469 C CG1 . VAL B 1 302 ? 24.582  4.352   -46.699 1.00   37.50  ? 302  VAL B CG1 1 
ATOM   6470 C CG2 . VAL B 1 302 ? 26.191  3.805   -44.853 1.00   41.03  ? 302  VAL B CG2 1 
ATOM   6471 N N   . VAL B 1 303 ? 25.272  6.421   -43.360 1.00   39.97  ? 303  VAL B N   1 
ATOM   6472 C CA  . VAL B 1 303 ? 25.878  7.742   -43.385 1.00   43.54  ? 303  VAL B CA  1 
ATOM   6473 C C   . VAL B 1 303 ? 26.942  7.722   -44.473 1.00   46.25  ? 303  VAL B C   1 
ATOM   6474 O O   . VAL B 1 303 ? 28.031  7.185   -44.293 1.00   50.04  ? 303  VAL B O   1 
ATOM   6475 C CB  . VAL B 1 303 ? 26.441  8.162   -42.015 1.00   42.44  ? 303  VAL B CB  1 
ATOM   6476 C CG1 . VAL B 1 303 ? 26.966  9.586   -42.065 1.00   42.89  ? 303  VAL B CG1 1 
ATOM   6477 C CG2 . VAL B 1 303 ? 25.363  8.045   -40.969 1.00   36.61  ? 303  VAL B CG2 1 
ATOM   6478 N N   . ASP B 1 304 ? 26.595  8.293   -45.620 1.00   47.51  ? 304  ASP B N   1 
ATOM   6479 C CA  . ASP B 1 304 ? 27.384  8.146   -46.834 1.00   46.99  ? 304  ASP B CA  1 
ATOM   6480 C C   . ASP B 1 304 ? 28.173  9.414   -47.174 1.00   52.38  ? 304  ASP B C   1 
ATOM   6481 O O   . ASP B 1 304 ? 29.053  9.398   -48.034 1.00   54.71  ? 304  ASP B O   1 
ATOM   6482 C CB  . ASP B 1 304 ? 26.465  7.759   -48.002 1.00   41.86  ? 304  ASP B CB  1 
ATOM   6483 C CG  . ASP B 1 304 ? 25.353  8.783   -48.248 1.00   50.91  ? 304  ASP B CG  1 
ATOM   6484 O OD1 . ASP B 1 304 ? 25.129  9.651   -47.376 1.00   47.08  ? 304  ASP B OD1 1 
ATOM   6485 O OD2 . ASP B 1 304 ? 24.695  8.716   -49.315 1.00   48.65  ? 304  ASP B OD2 1 
ATOM   6486 N N   . GLY B 1 305 ? 27.858  10.507  -46.490 1.00   50.43  ? 305  GLY B N   1 
ATOM   6487 C CA  . GLY B 1 305 ? 28.419  11.797  -46.831 1.00   44.67  ? 305  GLY B CA  1 
ATOM   6488 C C   . GLY B 1 305 ? 27.759  12.353  -48.076 1.00   53.20  ? 305  GLY B C   1 
ATOM   6489 O O   . GLY B 1 305 ? 28.221  13.342  -48.639 1.00   52.93  ? 305  GLY B O   1 
ATOM   6490 N N   . ASP B 1 306 ? 26.668  11.719  -48.503 1.00   52.89  ? 306  ASP B N   1 
ATOM   6491 C CA  . ASP B 1 306 ? 25.950  12.152  -49.697 1.00   48.55  ? 306  ASP B CA  1 
ATOM   6492 C C   . ASP B 1 306 ? 24.489  12.481  -49.388 1.00   51.77  ? 306  ASP B C   1 
ATOM   6493 O O   . ASP B 1 306 ? 24.141  13.643  -49.156 1.00   46.23  ? 306  ASP B O   1 
ATOM   6494 C CB  . ASP B 1 306 ? 26.025  11.076  -50.780 1.00   50.90  ? 306  ASP B CB  1 
ATOM   6495 C CG  . ASP B 1 306 ? 25.539  11.568  -52.120 1.00   53.29  ? 306  ASP B CG  1 
ATOM   6496 O OD1 . ASP B 1 306 ? 25.291  12.786  -52.253 1.00   54.68  ? 306  ASP B OD1 1 
ATOM   6497 O OD2 . ASP B 1 306 ? 25.407  10.737  -53.043 1.00   56.87  ? 306  ASP B OD2 1 
ATOM   6498 N N   . PHE B 1 307 ? 23.628  11.464  -49.405 1.00   49.48  ? 307  PHE B N   1 
ATOM   6499 C CA  . PHE B 1 307 ? 22.262  11.675  -48.957 1.00   48.91  ? 307  PHE B CA  1 
ATOM   6500 C C   . PHE B 1 307 ? 22.306  12.254  -47.541 1.00   44.93  ? 307  PHE B C   1 
ATOM   6501 O O   . PHE B 1 307 ? 21.686  13.272  -47.258 1.00   43.11  ? 307  PHE B O   1 
ATOM   6502 C CB  . PHE B 1 307 ? 21.429  10.389  -48.997 1.00   42.95  ? 307  PHE B CB  1 
ATOM   6503 C CG  . PHE B 1 307 ? 19.944  10.640  -48.918 1.00   44.71  ? 307  PHE B CG  1 
ATOM   6504 C CD1 . PHE B 1 307 ? 19.339  10.935  -47.700 1.00   44.01  ? 307  PHE B CD1 1 
ATOM   6505 C CD2 . PHE B 1 307 ? 19.159  10.618  -50.060 1.00   39.91  ? 307  PHE B CD2 1 
ATOM   6506 C CE1 . PHE B 1 307 ? 17.981  11.184  -47.616 1.00   35.72  ? 307  PHE B CE1 1 
ATOM   6507 C CE2 . PHE B 1 307 ? 17.803  10.865  -49.983 1.00   42.95  ? 307  PHE B CE2 1 
ATOM   6508 C CZ  . PHE B 1 307 ? 17.214  11.147  -48.749 1.00   41.57  ? 307  PHE B CZ  1 
ATOM   6509 N N   . LEU B 1 308 ? 23.053  11.591  -46.666 1.00   40.00  ? 308  LEU B N   1 
ATOM   6510 C CA  . LEU B 1 308 ? 23.322  12.098  -45.328 1.00   44.20  ? 308  LEU B CA  1 
ATOM   6511 C C   . LEU B 1 308 ? 24.764  12.577  -45.256 1.00   49.55  ? 308  LEU B C   1 
ATOM   6512 O O   . LEU B 1 308 ? 25.689  11.760  -45.162 1.00   49.60  ? 308  LEU B O   1 
ATOM   6513 C CB  . LEU B 1 308 ? 23.101  10.998  -44.294 1.00   37.97  ? 308  LEU B CB  1 
ATOM   6514 C CG  . LEU B 1 308 ? 21.705  10.390  -44.300 1.00   40.67  ? 308  LEU B CG  1 
ATOM   6515 C CD1 . LEU B 1 308 ? 21.622  9.173   -43.395 1.00   39.02  ? 308  LEU B CD1 1 
ATOM   6516 C CD2 . LEU B 1 308 ? 20.711  11.456  -43.899 1.00   39.26  ? 308  LEU B CD2 1 
ATOM   6517 N N   . SER B 1 309 ? 24.955  13.893  -45.309 1.00   45.77  ? 309  SER B N   1 
ATOM   6518 C CA  . SER B 1 309 ? 26.299  14.487  -45.292 1.00   48.79  ? 309  SER B CA  1 
ATOM   6519 C C   . SER B 1 309 ? 27.082  14.203  -43.998 1.00   46.64  ? 309  SER B C   1 
ATOM   6520 O O   . SER B 1 309 ? 28.307  14.157  -44.000 1.00   54.92  ? 309  SER B O   1 
ATOM   6521 C CB  . SER B 1 309 ? 26.208  15.993  -45.519 1.00   42.71  ? 309  SER B CB  1 
ATOM   6522 O OG  . SER B 1 309 ? 25.674  16.631  -44.374 1.00   52.80  ? 309  SER B OG  1 
ATOM   6523 N N   . ASP B 1 310 ? 26.358  14.012  -42.902 1.00   50.70  ? 310  ASP B N   1 
ATOM   6524 C CA  . ASP B 1 310 ? 26.936  13.652  -41.608 1.00   50.92  ? 310  ASP B CA  1 
ATOM   6525 C C   . ASP B 1 310 ? 25.913  12.757  -40.906 1.00   53.40  ? 310  ASP B C   1 
ATOM   6526 O O   . ASP B 1 310 ? 24.869  12.436  -41.476 1.00   47.33  ? 310  ASP B O   1 
ATOM   6527 C CB  . ASP B 1 310 ? 27.172  14.916  -40.775 1.00   50.79  ? 310  ASP B CB  1 
ATOM   6528 C CG  . ASP B 1 310 ? 28.366  14.798  -39.830 1.00   58.76  ? 310  ASP B CG  1 
ATOM   6529 O OD1 . ASP B 1 310 ? 28.617  13.707  -39.274 1.00   53.83  ? 310  ASP B OD1 1 
ATOM   6530 O OD2 . ASP B 1 310 ? 29.052  15.822  -39.639 1.00   56.41  ? 310  ASP B OD2 1 
ATOM   6531 N N   . THR B 1 311 ? 26.195  12.366  -39.669 1.00   55.16  ? 311  THR B N   1 
ATOM   6532 C CA  . THR B 1 311 ? 25.232  11.600  -38.894 1.00   49.92  ? 311  THR B CA  1 
ATOM   6533 C C   . THR B 1 311 ? 23.993  12.448  -38.623 1.00   50.26  ? 311  THR B C   1 
ATOM   6534 O O   . THR B 1 311 ? 24.073  13.677  -38.603 1.00   51.18  ? 311  THR B O   1 
ATOM   6535 C CB  . THR B 1 311 ? 25.829  11.168  -37.556 1.00   52.55  ? 311  THR B CB  1 
ATOM   6536 O OG1 . THR B 1 311 ? 26.066  12.326  -36.751 1.00   50.99  ? 311  THR B OG1 1 
ATOM   6537 C CG2 . THR B 1 311 ? 27.135  10.432  -37.780 1.00   50.91  ? 311  THR B CG2 1 
ATOM   6538 N N   . PRO B 1 312 ? 22.836  11.797  -38.423 1.00   47.56  ? 312  PRO B N   1 
ATOM   6539 C CA  . PRO B 1 312 ? 21.633  12.570  -38.104 1.00   45.63  ? 312  PRO B CA  1 
ATOM   6540 C C   . PRO B 1 312 ? 21.824  13.415  -36.856 1.00   47.78  ? 312  PRO B C   1 
ATOM   6541 O O   . PRO B 1 312 ? 21.373  14.560  -36.832 1.00   46.86  ? 312  PRO B O   1 
ATOM   6542 C CB  . PRO B 1 312 ? 20.570  11.494  -37.863 1.00   47.01  ? 312  PRO B CB  1 
ATOM   6543 C CG  . PRO B 1 312 ? 21.032  10.328  -38.680 1.00   49.89  ? 312  PRO B CG  1 
ATOM   6544 C CD  . PRO B 1 312 ? 22.544  10.372  -38.656 1.00   44.43  ? 312  PRO B CD  1 
ATOM   6545 N N   . GLU B 1 313 ? 22.480  12.876  -35.833 1.00   47.83  ? 313  GLU B N   1 
ATOM   6546 C CA  . GLU B 1 313 ? 22.717  13.678  -34.630 1.00   52.55  ? 313  GLU B CA  1 
ATOM   6547 C C   . GLU B 1 313 ? 23.526  14.933  -34.972 1.00   51.39  ? 313  GLU B C   1 
ATOM   6548 O O   . GLU B 1 313 ? 23.122  16.043  -34.636 1.00   52.12  ? 313  GLU B O   1 
ATOM   6549 C CB  . GLU B 1 313 ? 23.357  12.858  -33.508 1.00   50.83  ? 313  GLU B CB  1 
ATOM   6550 C CG  . GLU B 1 313 ? 23.920  11.512  -33.971 1.00   68.13  ? 313  GLU B CG  1 
ATOM   6551 C CD  . GLU B 1 313 ? 22.860  10.403  -34.091 1.00   63.86  ? 313  GLU B CD  1 
ATOM   6552 O OE1 . GLU B 1 313 ? 22.133  10.141  -33.091 1.00   52.35  ? 313  GLU B OE1 1 
ATOM   6553 O OE2 . GLU B 1 313 ? 22.775  9.793   -35.193 1.00   58.64  ? 313  GLU B OE2 1 
ATOM   6554 N N   . ALA B 1 314 ? 24.638  14.768  -35.679 1.00   44.60  ? 314  ALA B N   1 
ATOM   6555 C CA  . ALA B 1 314 ? 25.387  15.928  -36.136 1.00   46.15  ? 314  ALA B CA  1 
ATOM   6556 C C   . ALA B 1 314 ? 24.460  16.911  -36.849 1.00   54.60  ? 314  ALA B C   1 
ATOM   6557 O O   . ALA B 1 314 ? 24.431  18.098  -36.522 1.00   54.22  ? 314  ALA B O   1 
ATOM   6558 C CB  . ALA B 1 314 ? 26.530  15.515  -37.056 1.00   44.29  ? 314  ALA B CB  1 
ATOM   6559 N N   . LEU B 1 315 ? 23.694  16.404  -37.812 1.00   52.84  ? 315  LEU B N   1 
ATOM   6560 C CA  . LEU B 1 315 ? 22.879  17.250  -38.689 1.00   51.21  ? 315  LEU B CA  1 
ATOM   6561 C C   . LEU B 1 315 ? 21.731  17.973  -37.990 1.00   50.16  ? 315  LEU B C   1 
ATOM   6562 O O   . LEU B 1 315 ? 21.398  19.099  -38.358 1.00   49.23  ? 315  LEU B O   1 
ATOM   6563 C CB  . LEU B 1 315 ? 22.325  16.440  -39.864 1.00   47.44  ? 315  LEU B CB  1 
ATOM   6564 C CG  . LEU B 1 315 ? 23.348  15.905  -40.860 1.00   50.65  ? 315  LEU B CG  1 
ATOM   6565 C CD1 . LEU B 1 315 ? 22.647  15.281  -42.056 1.00   44.93  ? 315  LEU B CD1 1 
ATOM   6566 C CD2 . LEU B 1 315 ? 24.281  17.028  -41.293 1.00   46.50  ? 315  LEU B CD2 1 
ATOM   6567 N N   . ILE B 1 316 ? 21.104  17.325  -37.011 1.00   49.07  ? 316  ILE B N   1 
ATOM   6568 C CA  . ILE B 1 316 ? 20.025  17.982  -36.279 1.00   49.95  ? 316  ILE B CA  1 
ATOM   6569 C C   . ILE B 1 316 ? 20.623  18.992  -35.308 1.00   58.89  ? 316  ILE B C   1 
ATOM   6570 O O   . ILE B 1 316 ? 20.039  20.049  -35.078 1.00   57.57  ? 316  ILE B O   1 
ATOM   6571 C CB  . ILE B 1 316 ? 19.092  16.996  -35.522 1.00   47.17  ? 316  ILE B CB  1 
ATOM   6572 C CG1 . ILE B 1 316 ? 19.766  16.441  -34.271 1.00   52.61  ? 316  ILE B CG1 1 
ATOM   6573 C CG2 . ILE B 1 316 ? 18.646  15.857  -36.422 1.00   48.10  ? 316  ILE B CG2 1 
ATOM   6574 C CD1 . ILE B 1 316 ? 18.949  15.386  -33.553 1.00   49.13  ? 316  ILE B CD1 1 
ATOM   6575 N N   . ASN B 1 317 ? 21.794  18.668  -34.754 1.00   58.61  ? 317  ASN B N   1 
ATOM   6576 C CA  . ASN B 1 317 ? 22.495  19.567  -33.834 1.00   57.59  ? 317  ASN B CA  1 
ATOM   6577 C C   . ASN B 1 317 ? 22.867  20.895  -34.481 1.00   60.34  ? 317  ASN B C   1 
ATOM   6578 O O   . ASN B 1 317 ? 22.988  21.908  -33.800 1.00   65.39  ? 317  ASN B O   1 
ATOM   6579 C CB  . ASN B 1 317 ? 23.786  18.931  -33.318 1.00   58.12  ? 317  ASN B CB  1 
ATOM   6580 C CG  . ASN B 1 317 ? 23.556  17.964  -32.182 1.00   59.38  ? 317  ASN B CG  1 
ATOM   6581 O OD1 . ASN B 1 317 ? 22.436  17.812  -31.691 1.00   64.09  ? 317  ASN B OD1 1 
ATOM   6582 N ND2 . ASN B 1 317 ? 24.625  17.291  -31.758 1.00   51.36  ? 317  ASN B ND2 1 
ATOM   6583 N N   . THR B 1 318 ? 23.066  20.892  -35.794 1.00   59.18  ? 318  THR B N   1 
ATOM   6584 C CA  . THR B 1 318 ? 23.657  22.055  -36.443 1.00   59.05  ? 318  THR B CA  1 
ATOM   6585 C C   . THR B 1 318 ? 22.759  22.706  -37.477 1.00   60.50  ? 318  THR B C   1 
ATOM   6586 O O   . THR B 1 318 ? 23.033  23.815  -37.920 1.00   68.67  ? 318  THR B O   1 
ATOM   6587 C CB  . THR B 1 318 ? 24.993  21.693  -37.113 1.00   62.39  ? 318  THR B CB  1 
ATOM   6588 O OG1 . THR B 1 318 ? 24.749  20.862  -38.257 1.00   57.78  ? 318  THR B OG1 1 
ATOM   6589 C CG2 . THR B 1 318 ? 25.894  20.953  -36.127 1.00   63.93  ? 318  THR B CG2 1 
ATOM   6590 N N   . GLY B 1 319 ? 21.686  22.025  -37.862 1.00   58.04  ? 319  GLY B N   1 
ATOM   6591 C CA  . GLY B 1 319 ? 20.844  22.513  -38.937 1.00   59.69  ? 319  GLY B CA  1 
ATOM   6592 C C   . GLY B 1 319 ? 20.088  23.785  -38.608 1.00   57.24  ? 319  GLY B C   1 
ATOM   6593 O O   . GLY B 1 319 ? 20.011  24.186  -37.452 1.00   55.21  ? 319  GLY B O   1 
ATOM   6594 N N   . ASP B 1 320 ? 19.536  24.421  -39.637 1.00   56.65  ? 320  ASP B N   1 
ATOM   6595 C CA  . ASP B 1 320 ? 18.628  25.547  -39.460 1.00   63.99  ? 320  ASP B CA  1 
ATOM   6596 C C   . ASP B 1 320 ? 17.227  25.155  -39.938 1.00   65.95  ? 320  ASP B C   1 
ATOM   6597 O O   . ASP B 1 320 ? 17.015  24.856  -41.123 1.00   62.82  ? 320  ASP B O   1 
ATOM   6598 C CB  . ASP B 1 320 ? 19.128  26.773  -40.228 1.00   73.74  ? 320  ASP B CB  1 
ATOM   6599 C CG  . ASP B 1 320 ? 18.135  27.925  -40.202 1.00   75.10  ? 320  ASP B CG  1 
ATOM   6600 O OD1 . ASP B 1 320 ? 17.183  27.879  -39.394 1.00   71.67  ? 320  ASP B OD1 1 
ATOM   6601 O OD2 . ASP B 1 320 ? 18.306  28.879  -40.992 1.00   78.91  ? 320  ASP B OD2 1 
ATOM   6602 N N   . PHE B 1 321 ? 16.269  25.156  -39.017 1.00   57.94  ? 321  PHE B N   1 
ATOM   6603 C CA  . PHE B 1 321 ? 14.946  24.635  -39.330 1.00   59.52  ? 321  PHE B CA  1 
ATOM   6604 C C   . PHE B 1 321 ? 13.883  25.709  -39.224 1.00   60.30  ? 321  PHE B C   1 
ATOM   6605 O O   . PHE B 1 321 ? 12.726  25.431  -38.911 1.00   62.27  ? 321  PHE B O   1 
ATOM   6606 C CB  . PHE B 1 321 ? 14.632  23.435  -38.439 1.00   51.39  ? 321  PHE B CB  1 
ATOM   6607 C CG  . PHE B 1 321 ? 15.658  22.340  -38.531 1.00   50.73  ? 321  PHE B CG  1 
ATOM   6608 C CD1 . PHE B 1 321 ? 15.773  21.575  -39.686 1.00   54.35  ? 321  PHE B CD1 1 
ATOM   6609 C CD2 . PHE B 1 321 ? 16.518  22.079  -37.476 1.00   50.16  ? 321  PHE B CD2 1 
ATOM   6610 C CE1 . PHE B 1 321 ? 16.721  20.560  -39.782 1.00   48.35  ? 321  PHE B CE1 1 
ATOM   6611 C CE2 . PHE B 1 321 ? 17.461  21.061  -37.565 1.00   49.72  ? 321  PHE B CE2 1 
ATOM   6612 C CZ  . PHE B 1 321 ? 17.561  20.305  -38.726 1.00   44.29  ? 321  PHE B CZ  1 
ATOM   6613 N N   . GLN B 1 322 ? 14.288  26.937  -39.531 1.00   69.54  ? 322  GLN B N   1 
ATOM   6614 C CA  . GLN B 1 322 ? 13.440  28.109  -39.371 1.00   67.25  ? 322  GLN B CA  1 
ATOM   6615 C C   . GLN B 1 322 ? 12.083  28.008  -40.070 1.00   66.15  ? 322  GLN B C   1 
ATOM   6616 O O   . GLN B 1 322 ? 11.048  28.289  -39.458 1.00   66.86  ? 322  GLN B O   1 
ATOM   6617 C CB  . GLN B 1 322 ? 14.185  29.371  -39.821 1.00   77.15  ? 322  GLN B CB  1 
ATOM   6618 C CG  . GLN B 1 322 ? 15.047  30.010  -38.732 1.00   81.57  ? 322  GLN B CG  1 
ATOM   6619 C CD  . GLN B 1 322 ? 14.217  30.708  -37.660 1.00   88.85  ? 322  GLN B CD  1 
ATOM   6620 O OE1 . GLN B 1 322 ? 13.010  30.906  -37.824 1.00   88.61  ? 322  GLN B OE1 1 
ATOM   6621 N NE2 . GLN B 1 322 ? 14.864  31.087  -36.558 1.00   78.57  ? 322  GLN B NE2 1 
ATOM   6622 N N   . ASP B 1 323 ? 12.071  27.614  -41.338 1.00   60.33  ? 323  ASP B N   1 
ATOM   6623 C CA  . ASP B 1 323 ? 10.811  27.641  -42.093 1.00   70.69  ? 323  ASP B CA  1 
ATOM   6624 C C   . ASP B 1 323 ? 10.086  26.296  -42.088 1.00   63.66  ? 323  ASP B C   1 
ATOM   6625 O O   . ASP B 1 323 ? 9.366   25.962  -43.025 1.00   60.05  ? 323  ASP B O   1 
ATOM   6626 C CB  . ASP B 1 323 ? 11.033  28.131  -43.528 1.00   70.65  ? 323  ASP B CB  1 
ATOM   6627 N N   . LEU B 1 324 ? 10.265  25.541  -41.012 1.00   60.24  ? 324  LEU B N   1 
ATOM   6628 C CA  . LEU B 1 324 ? 9.768   24.180  -40.940 1.00   52.94  ? 324  LEU B CA  1 
ATOM   6629 C C   . LEU B 1 324 ? 8.722   24.010  -39.838 1.00   45.38  ? 324  LEU B C   1 
ATOM   6630 O O   . LEU B 1 324 ? 8.881   24.530  -38.742 1.00   45.65  ? 324  LEU B O   1 
ATOM   6631 C CB  . LEU B 1 324 ? 10.948  23.246  -40.677 1.00   51.61  ? 324  LEU B CB  1 
ATOM   6632 C CG  . LEU B 1 324 ? 10.649  21.751  -40.664 1.00   54.50  ? 324  LEU B CG  1 
ATOM   6633 C CD1 . LEU B 1 324 ? 10.002  21.337  -41.989 1.00   52.27  ? 324  LEU B CD1 1 
ATOM   6634 C CD2 . LEU B 1 324 ? 11.925  20.980  -40.416 1.00   52.09  ? 324  LEU B CD2 1 
ATOM   6635 N N   . GLN B 1 325 ? 7.653   23.281  -40.131 1.00   44.16  ? 325  GLN B N   1 
ATOM   6636 C CA  . GLN B 1 325 ? 6.717   22.865  -39.088 1.00   42.26  ? 325  GLN B CA  1 
ATOM   6637 C C   . GLN B 1 325 ? 6.696   21.347  -38.968 1.00   40.70  ? 325  GLN B C   1 
ATOM   6638 O O   . GLN B 1 325 ? 6.606   20.650  -39.967 1.00   39.49  ? 325  GLN B O   1 
ATOM   6639 C CB  . GLN B 1 325 ? 5.309   23.400  -39.343 1.00   40.95  ? 325  GLN B CB  1 
ATOM   6640 C CG  . GLN B 1 325 ? 5.254   24.905  -39.593 1.00   45.97  ? 325  GLN B CG  1 
ATOM   6641 C CD  . GLN B 1 325 ? 5.142   25.247  -41.063 1.00   48.68  ? 325  GLN B CD  1 
ATOM   6642 O OE1 . GLN B 1 325 ? 4.605   24.473  -41.856 1.00   49.95  ? 325  GLN B OE1 1 
ATOM   6643 N NE2 . GLN B 1 325 ? 5.643   26.413  -41.436 1.00   60.10  ? 325  GLN B NE2 1 
ATOM   6644 N N   . VAL B 1 326 ? 6.792   20.840  -37.743 1.00   37.26  ? 326  VAL B N   1 
ATOM   6645 C CA  . VAL B 1 326 ? 6.861   19.410  -37.531 1.00   38.81  ? 326  VAL B CA  1 
ATOM   6646 C C   . VAL B 1 326 ? 5.920   18.943  -36.445 1.00   39.12  ? 326  VAL B C   1 
ATOM   6647 O O   . VAL B 1 326 ? 5.836   19.553  -35.391 1.00   41.83  ? 326  VAL B O   1 
ATOM   6648 C CB  . VAL B 1 326 ? 8.274   18.957  -37.136 1.00   47.12  ? 326  VAL B CB  1 
ATOM   6649 C CG1 . VAL B 1 326 ? 8.283   17.463  -36.922 1.00   45.03  ? 326  VAL B CG1 1 
ATOM   6650 C CG2 . VAL B 1 326 ? 9.285   19.335  -38.203 1.00   46.17  ? 326  VAL B CG2 1 
ATOM   6651 N N   . LEU B 1 327 ? 5.223   17.844  -36.716 1.00   38.26  ? 327  LEU B N   1 
ATOM   6652 C CA  . LEU B 1 327 ? 4.403   17.161  -35.725 1.00   39.03  ? 327  LEU B CA  1 
ATOM   6653 C C   . LEU B 1 327 ? 5.061   15.817  -35.411 1.00   38.99  ? 327  LEU B C   1 
ATOM   6654 O O   . LEU B 1 327 ? 5.399   15.054  -36.317 1.00   40.32  ? 327  LEU B O   1 
ATOM   6655 C CB  . LEU B 1 327 ? 2.969   16.975  -36.243 1.00   35.88  ? 327  LEU B CB  1 
ATOM   6656 C CG  . LEU B 1 327 ? 2.055   16.016  -35.469 1.00   41.53  ? 327  LEU B CG  1 
ATOM   6657 C CD1 . LEU B 1 327 ? 1.766   16.523  -34.069 1.00   39.75  ? 327  LEU B CD1 1 
ATOM   6658 C CD2 . LEU B 1 327 ? 0.752   15.786  -36.237 1.00   36.83  ? 327  LEU B CD2 1 
ATOM   6659 N N   . VAL B 1 328 ? 5.271   15.543  -34.131 1.00   37.36  ? 328  VAL B N   1 
ATOM   6660 C CA  . VAL B 1 328 ? 5.974   14.338  -33.721 1.00   35.61  ? 328  VAL B CA  1 
ATOM   6661 C C   . VAL B 1 328 ? 5.309   13.743  -32.494 1.00   40.15  ? 328  VAL B C   1 
ATOM   6662 O O   . VAL B 1 328 ? 4.749   14.472  -31.673 1.00   41.48  ? 328  VAL B O   1 
ATOM   6663 C CB  . VAL B 1 328 ? 7.436   14.629  -33.377 1.00   36.52  ? 328  VAL B CB  1 
ATOM   6664 C CG1 . VAL B 1 328 ? 8.176   15.079  -34.596 1.00   41.51  ? 328  VAL B CG1 1 
ATOM   6665 C CG2 . VAL B 1 328 ? 7.510   15.693  -32.296 1.00   39.28  ? 328  VAL B CG2 1 
ATOM   6666 N N   . GLY B 1 329 ? 5.385   12.421  -32.359 1.00   35.81  ? 329  GLY B N   1 
ATOM   6667 C CA  . GLY B 1 329 ? 4.744   11.756  -31.248 1.00   33.89  ? 329  GLY B CA  1 
ATOM   6668 C C   . GLY B 1 329 ? 5.120   10.305  -31.066 1.00   35.40  ? 329  GLY B C   1 
ATOM   6669 O O   . GLY B 1 329 ? 5.847   9.730   -31.866 1.00   42.59  ? 329  GLY B O   1 
ATOM   6670 N N   . VAL B 1 330 ? 4.611   9.715   -29.994 1.00   34.08  ? 330  VAL B N   1 
ATOM   6671 C CA  . VAL B 1 330 ? 4.926   8.351   -29.634 1.00   37.41  ? 330  VAL B CA  1 
ATOM   6672 C C   . VAL B 1 330 ? 3.640   7.730   -29.118 1.00   42.94  ? 330  VAL B C   1 
ATOM   6673 O O   . VAL B 1 330 ? 2.680   8.448   -28.842 1.00   43.25  ? 330  VAL B O   1 
ATOM   6674 C CB  . VAL B 1 330 ? 5.971   8.301   -28.497 1.00   39.33  ? 330  VAL B CB  1 
ATOM   6675 C CG1 . VAL B 1 330 ? 7.248   8.977   -28.919 1.00   39.75  ? 330  VAL B CG1 1 
ATOM   6676 C CG2 . VAL B 1 330 ? 5.416   8.955   -27.230 1.00   36.00  ? 330  VAL B CG2 1 
ATOM   6677 N N   . VAL B 1 331 ? 3.615   6.405   -28.999 1.00   37.00  ? 331  VAL B N   1 
ATOM   6678 C CA  . VAL B 1 331 ? 2.498   5.725   -28.370 1.00   38.13  ? 331  VAL B CA  1 
ATOM   6679 C C   . VAL B 1 331 ? 2.908   5.359   -26.952 1.00   42.10  ? 331  VAL B C   1 
ATOM   6680 O O   . VAL B 1 331 ? 4.088   5.414   -26.597 1.00   39.68  ? 331  VAL B O   1 
ATOM   6681 C CB  . VAL B 1 331 ? 2.051   4.456   -29.147 1.00   44.62  ? 331  VAL B CB  1 
ATOM   6682 C CG1 . VAL B 1 331 ? 1.504   4.835   -30.534 1.00   38.56  ? 331  VAL B CG1 1 
ATOM   6683 C CG2 . VAL B 1 331 ? 3.198   3.446   -29.255 1.00   32.03  ? 331  VAL B CG2 1 
ATOM   6684 N N   . LYS B 1 332 ? 1.924   4.988   -26.143 1.00   39.16  ? 332  LYS B N   1 
ATOM   6685 C CA  . LYS B 1 332 ? 2.153   4.783   -24.727 1.00   41.61  ? 332  LYS B CA  1 
ATOM   6686 C C   . LYS B 1 332 ? 3.112   3.625   -24.429 1.00   39.72  ? 332  LYS B C   1 
ATOM   6687 O O   . LYS B 1 332 ? 3.810   3.647   -23.429 1.00   39.44  ? 332  LYS B O   1 
ATOM   6688 C CB  . LYS B 1 332 ? 0.820   4.588   -24.013 1.00   46.93  ? 332  LYS B CB  1 
ATOM   6689 C CG  . LYS B 1 332 ? 0.864   4.716   -22.500 1.00   42.77  ? 332  LYS B CG  1 
ATOM   6690 C CD  . LYS B 1 332 ? -0.571  4.612   -21.981 1.00   55.26  ? 332  LYS B CD  1 
ATOM   6691 C CE  . LYS B 1 332 ? -0.637  4.631   -20.472 1.00   60.27  ? 332  LYS B CE  1 
ATOM   6692 N NZ  . LYS B 1 332 ? -0.178  3.340   -19.901 1.00   66.33  ? 332  LYS B NZ  1 
ATOM   6693 N N   . ASP B 1 333 ? 3.168   2.623   -25.294 1.00   35.72  ? 333  ASP B N   1 
ATOM   6694 C CA  . ASP B 1 333 ? 4.005   1.463   -24.993 1.00   44.75  ? 333  ASP B CA  1 
ATOM   6695 C C   . ASP B 1 333 ? 4.875   1.035   -26.172 1.00   44.15  ? 333  ASP B C   1 
ATOM   6696 O O   . ASP B 1 333 ? 4.733   -0.065  -26.697 1.00   44.72  ? 333  ASP B O   1 
ATOM   6697 C CB  . ASP B 1 333 ? 3.134   0.309   -24.483 1.00   42.22  ? 333  ASP B CB  1 
ATOM   6698 C CG  . ASP B 1 333 ? 2.304   0.708   -23.272 1.00   47.32  ? 333  ASP B CG  1 
ATOM   6699 O OD1 . ASP B 1 333 ? 2.865   0.774   -22.155 1.00   46.40  ? 333  ASP B OD1 1 
ATOM   6700 O OD2 . ASP B 1 333 ? 1.100   0.997   -23.441 1.00   45.51  ? 333  ASP B OD2 1 
ATOM   6701 N N   . GLU B 1 334 ? 5.780   1.919   -26.576 1.00   40.67  ? 334  GLU B N   1 
ATOM   6702 C CA  . GLU B 1 334 ? 6.596   1.712   -27.774 1.00   40.41  ? 334  GLU B CA  1 
ATOM   6703 C C   . GLU B 1 334 ? 7.333   0.370   -27.788 1.00   42.40  ? 334  GLU B C   1 
ATOM   6704 O O   . GLU B 1 334 ? 7.493   -0.243  -28.844 1.00   44.53  ? 334  GLU B O   1 
ATOM   6705 C CB  . GLU B 1 334 ? 7.615   2.851   -27.928 1.00   39.09  ? 334  GLU B CB  1 
ATOM   6706 C CG  . GLU B 1 334 ? 6.996   4.203   -28.250 1.00   37.10  ? 334  GLU B CG  1 
ATOM   6707 C CD  . GLU B 1 334 ? 6.488   4.285   -29.685 1.00   46.16  ? 334  GLU B CD  1 
ATOM   6708 O OE1 . GLU B 1 334 ? 6.799   3.372   -30.487 1.00   38.88  ? 334  GLU B OE1 1 
ATOM   6709 O OE2 . GLU B 1 334 ? 5.781   5.265   -30.007 1.00   42.36  ? 334  GLU B OE2 1 
ATOM   6710 N N   . GLY B 1 335 ? 7.771   -0.092  -26.622 1.00   35.87  ? 335  GLY B N   1 
ATOM   6711 C CA  . GLY B 1 335 ? 8.650   -1.245  -26.562 1.00   39.63  ? 335  GLY B CA  1 
ATOM   6712 C C   . GLY B 1 335 ? 8.022   -2.627  -26.490 1.00   43.15  ? 335  GLY B C   1 
ATOM   6713 O O   . GLY B 1 335 ? 8.687   -3.619  -26.791 1.00   44.65  ? 335  GLY B O   1 
ATOM   6714 N N   . SER B 1 336 ? 6.754   -2.709  -26.098 1.00   42.24  ? 336  SER B N   1 
ATOM   6715 C CA  . SER B 1 336 ? 6.140   -4.004  -25.782 1.00   42.87  ? 336  SER B CA  1 
ATOM   6716 C C   . SER B 1 336 ? 6.206   -5.003  -26.953 1.00   48.98  ? 336  SER B C   1 
ATOM   6717 O O   . SER B 1 336 ? 6.704   -6.123  -26.803 1.00   49.81  ? 336  SER B O   1 
ATOM   6718 C CB  . SER B 1 336 ? 4.706   -3.804  -25.310 1.00   42.19  ? 336  SER B CB  1 
ATOM   6719 O OG  . SER B 1 336 ? 3.969   -3.052  -26.256 1.00   43.45  ? 336  SER B OG  1 
ATOM   6720 N N   . TYR B 1 337 ? 5.724   -4.569  -28.114 1.00   47.83  ? 337  TYR B N   1 
ATOM   6721 C CA  . TYR B 1 337 ? 5.787   -5.322  -29.372 1.00   46.78  ? 337  TYR B CA  1 
ATOM   6722 C C   . TYR B 1 337 ? 7.073   -6.113  -29.586 1.00   51.00  ? 337  TYR B C   1 
ATOM   6723 O O   . TYR B 1 337 ? 7.025   -7.284  -29.944 1.00   53.25  ? 337  TYR B O   1 
ATOM   6724 C CB  . TYR B 1 337 ? 5.617   -4.349  -30.538 1.00   55.05  ? 337  TYR B CB  1 
ATOM   6725 C CG  . TYR B 1 337 ? 5.322   -4.971  -31.877 1.00   53.62  ? 337  TYR B CG  1 
ATOM   6726 C CD1 . TYR B 1 337 ? 6.348   -5.416  -32.710 1.00   57.22  ? 337  TYR B CD1 1 
ATOM   6727 C CD2 . TYR B 1 337 ? 4.016   -5.090  -32.324 1.00   57.74  ? 337  TYR B CD2 1 
ATOM   6728 C CE1 . TYR B 1 337 ? 6.069   -5.980  -33.954 1.00   63.01  ? 337  TYR B CE1 1 
ATOM   6729 C CE2 . TYR B 1 337 ? 3.723   -5.650  -33.565 1.00   64.63  ? 337  TYR B CE2 1 
ATOM   6730 C CZ  . TYR B 1 337 ? 4.747   -6.094  -34.375 1.00   61.80  ? 337  TYR B CZ  1 
ATOM   6731 O OH  . TYR B 1 337 ? 4.433   -6.645  -35.599 1.00   58.81  ? 337  TYR B OH  1 
ATOM   6732 N N   . PHE B 1 338 ? 8.214   -5.467  -29.365 1.00   45.99  ? 338  PHE B N   1 
ATOM   6733 C CA  . PHE B 1 338 ? 9.509   -6.017  -29.757 1.00   47.23  ? 338  PHE B CA  1 
ATOM   6734 C C   . PHE B 1 338 ? 10.043  -7.093  -28.828 1.00   53.77  ? 338  PHE B C   1 
ATOM   6735 O O   . PHE B 1 338 ? 10.929  -7.864  -29.208 1.00   53.48  ? 338  PHE B O   1 
ATOM   6736 C CB  . PHE B 1 338 ? 10.537  -4.891  -29.880 1.00   49.33  ? 338  PHE B CB  1 
ATOM   6737 C CG  . PHE B 1 338 ? 10.158  -3.860  -30.891 1.00   50.97  ? 338  PHE B CG  1 
ATOM   6738 C CD1 . PHE B 1 338 ? 9.294   -2.827  -30.554 1.00   44.13  ? 338  PHE B CD1 1 
ATOM   6739 C CD2 . PHE B 1 338 ? 10.630  -3.945  -32.197 1.00   47.65  ? 338  PHE B CD2 1 
ATOM   6740 C CE1 . PHE B 1 338 ? 8.916   -1.892  -31.499 1.00   46.98  ? 338  PHE B CE1 1 
ATOM   6741 C CE2 . PHE B 1 338 ? 10.265  -3.008  -33.142 1.00   41.30  ? 338  PHE B CE2 1 
ATOM   6742 C CZ  . PHE B 1 338 ? 9.399   -1.983  -32.791 1.00   47.98  ? 338  PHE B CZ  1 
ATOM   6743 N N   . LEU B 1 339 ? 9.516   -7.143  -27.611 1.00   54.77  ? 339  LEU B N   1 
ATOM   6744 C CA  . LEU B 1 339 ? 10.056  -8.055  -26.609 1.00   55.20  ? 339  LEU B CA  1 
ATOM   6745 C C   . LEU B 1 339 ? 9.840   -9.505  -27.039 1.00   52.49  ? 339  LEU B C   1 
ATOM   6746 O O   . LEU B 1 339 ? 10.726  -10.339 -26.881 1.00   51.69  ? 339  LEU B O   1 
ATOM   6747 C CB  . LEU B 1 339 ? 9.444   -7.784  -25.223 1.00   47.21  ? 339  LEU B CB  1 
ATOM   6748 C CG  . LEU B 1 339 ? 9.592   -6.348  -24.703 1.00   47.85  ? 339  LEU B CG  1 
ATOM   6749 C CD1 . LEU B 1 339 ? 8.889   -6.142  -23.360 1.00   47.29  ? 339  LEU B CD1 1 
ATOM   6750 C CD2 . LEU B 1 339 ? 11.047  -5.957  -24.618 1.00   41.57  ? 339  LEU B CD2 1 
ATOM   6751 N N   . VAL B 1 340 ? 8.670   -9.789  -27.607 1.00   49.95  ? 340  VAL B N   1 
ATOM   6752 C CA  . VAL B 1 340 ? 8.341   -11.143 -28.045 1.00   56.73  ? 340  VAL B CA  1 
ATOM   6753 C C   . VAL B 1 340 ? 9.175   -11.615 -29.245 1.00   55.30  ? 340  VAL B C   1 
ATOM   6754 O O   . VAL B 1 340 ? 9.059   -12.763 -29.664 1.00   59.98  ? 340  VAL B O   1 
ATOM   6755 C CB  . VAL B 1 340 ? 6.845   -11.289 -28.383 1.00   49.70  ? 340  VAL B CB  1 
ATOM   6756 C CG1 . VAL B 1 340 ? 5.993   -10.550 -27.362 1.00   56.96  ? 340  VAL B CG1 1 
ATOM   6757 C CG2 . VAL B 1 340 ? 6.562   -10.761 -29.764 1.00   50.58  ? 340  VAL B CG2 1 
ATOM   6758 N N   . TYR B 1 341 ? 10.009  -10.736 -29.793 1.00   50.04  ? 341  TYR B N   1 
ATOM   6759 C CA  . TYR B 1 341 ? 10.866  -11.109 -30.919 1.00   53.75  ? 341  TYR B CA  1 
ATOM   6760 C C   . TYR B 1 341 ? 12.281  -11.481 -30.518 1.00   53.07  ? 341  TYR B C   1 
ATOM   6761 O O   . TYR B 1 341 ? 13.211  -11.310 -31.303 1.00   57.33  ? 341  TYR B O   1 
ATOM   6762 C CB  . TYR B 1 341 ? 10.910  -10.008 -31.984 1.00   47.15  ? 341  TYR B CB  1 
ATOM   6763 C CG  . TYR B 1 341 ? 9.712   -10.035 -32.897 1.00   57.93  ? 341  TYR B CG  1 
ATOM   6764 C CD1 . TYR B 1 341 ? 8.539   -9.367  -32.556 1.00   53.19  ? 341  TYR B CD1 1 
ATOM   6765 C CD2 . TYR B 1 341 ? 9.741   -10.749 -34.089 1.00   53.76  ? 341  TYR B CD2 1 
ATOM   6766 C CE1 . TYR B 1 341 ? 7.437   -9.394  -33.385 1.00   55.58  ? 341  TYR B CE1 1 
ATOM   6767 C CE2 . TYR B 1 341 ? 8.647   -10.789 -34.920 1.00   57.30  ? 341  TYR B CE2 1 
ATOM   6768 C CZ  . TYR B 1 341 ? 7.494   -10.111 -34.567 1.00   61.64  ? 341  TYR B CZ  1 
ATOM   6769 O OH  . TYR B 1 341 ? 6.398   -10.148 -35.401 1.00   61.94  ? 341  TYR B OH  1 
ATOM   6770 N N   . GLY B 1 342 ? 12.458  -11.989 -29.304 1.00   53.66  ? 342  GLY B N   1 
ATOM   6771 C CA  . GLY B 1 342 ? 13.772  -12.473 -28.918 1.00   62.81  ? 342  GLY B CA  1 
ATOM   6772 C C   . GLY B 1 342 ? 14.220  -12.251 -27.488 1.00   64.70  ? 342  GLY B C   1 
ATOM   6773 O O   . GLY B 1 342 ? 15.355  -12.589 -27.137 1.00   68.15  ? 342  GLY B O   1 
ATOM   6774 N N   . VAL B 1 343 ? 13.351  -11.674 -26.664 1.00   55.31  ? 343  VAL B N   1 
ATOM   6775 C CA  . VAL B 1 343 ? 13.650  -11.552 -25.250 1.00   49.90  ? 343  VAL B CA  1 
ATOM   6776 C C   . VAL B 1 343 ? 13.003  -12.706 -24.504 1.00   55.80  ? 343  VAL B C   1 
ATOM   6777 O O   . VAL B 1 343 ? 11.770  -12.789 -24.423 1.00   57.90  ? 343  VAL B O   1 
ATOM   6778 C CB  . VAL B 1 343 ? 13.160  -10.217 -24.654 1.00   56.86  ? 343  VAL B CB  1 
ATOM   6779 C CG1 . VAL B 1 343 ? 13.499  -10.155 -23.163 1.00   46.94  ? 343  VAL B CG1 1 
ATOM   6780 C CG2 . VAL B 1 343 ? 13.773  -9.034  -25.400 1.00   49.83  ? 343  VAL B CG2 1 
ATOM   6781 N N   . PRO B 1 344 ? 13.832  -13.611 -23.962 1.00   45.68  ? 344  PRO B N   1 
ATOM   6782 C CA  . PRO B 1 344 ? 13.326  -14.770 -23.224 1.00   52.37  ? 344  PRO B CA  1 
ATOM   6783 C C   . PRO B 1 344 ? 12.381  -14.359 -22.102 1.00   59.35  ? 344  PRO B C   1 
ATOM   6784 O O   . PRO B 1 344 ? 12.715  -13.465 -21.324 1.00   59.10  ? 344  PRO B O   1 
ATOM   6785 C CB  . PRO B 1 344 ? 14.598  -15.395 -22.654 1.00   52.32  ? 344  PRO B CB  1 
ATOM   6786 C CG  . PRO B 1 344 ? 15.654  -15.028 -23.636 1.00   51.41  ? 344  PRO B CG  1 
ATOM   6787 C CD  . PRO B 1 344 ? 15.299  -13.636 -24.088 1.00   50.69  ? 344  PRO B CD  1 
ATOM   6788 N N   . GLY B 1 345 ? 11.219  -15.008 -22.034 1.00   51.92  ? 345  GLY B N   1 
ATOM   6789 C CA  . GLY B 1 345 ? 10.232  -14.728 -21.011 1.00   50.44  ? 345  GLY B CA  1 
ATOM   6790 C C   . GLY B 1 345 ? 9.009   -14.039 -21.584 1.00   57.96  ? 345  GLY B C   1 
ATOM   6791 O O   . GLY B 1 345 ? 7.971   -13.942 -20.928 1.00   63.29  ? 345  GLY B O   1 
ATOM   6792 N N   . PHE B 1 346 ? 9.118   -13.560 -22.816 1.00   53.09  ? 346  PHE B N   1 
ATOM   6793 C CA  . PHE B 1 346 ? 8.025   -12.791 -23.399 1.00   56.34  ? 346  PHE B CA  1 
ATOM   6794 C C   . PHE B 1 346 ? 7.284   -13.549 -24.484 1.00   59.07  ? 346  PHE B C   1 
ATOM   6795 O O   . PHE B 1 346 ? 7.887   -14.244 -25.302 1.00   59.67  ? 346  PHE B O   1 
ATOM   6796 C CB  . PHE B 1 346 ? 8.508   -11.417 -23.890 1.00   52.48  ? 346  PHE B CB  1 
ATOM   6797 C CG  . PHE B 1 346 ? 8.921   -10.494 -22.769 1.00   53.18  ? 346  PHE B CG  1 
ATOM   6798 C CD1 . PHE B 1 346 ? 10.219  -10.516 -22.273 1.00   51.69  ? 346  PHE B CD1 1 
ATOM   6799 C CD2 . PHE B 1 346 ? 8.005   -9.628  -22.192 1.00   50.61  ? 346  PHE B CD2 1 
ATOM   6800 C CE1 . PHE B 1 346 ? 10.599  -9.685  -21.236 1.00   46.06  ? 346  PHE B CE1 1 
ATOM   6801 C CE2 . PHE B 1 346 ? 8.376   -8.790  -21.158 1.00   47.83  ? 346  PHE B CE2 1 
ATOM   6802 C CZ  . PHE B 1 346 ? 9.677   -8.823  -20.677 1.00   50.49  ? 346  PHE B CZ  1 
ATOM   6803 N N   . SER B 1 347 ? 5.963   -13.411 -24.469 1.00   55.41  ? 347  SER B N   1 
ATOM   6804 C CA  . SER B 1 347 ? 5.102   -14.117 -25.399 1.00   58.79  ? 347  SER B CA  1 
ATOM   6805 C C   . SER B 1 347 ? 3.775   -13.384 -25.470 1.00   56.03  ? 347  SER B C   1 
ATOM   6806 O O   . SER B 1 347 ? 3.311   -12.845 -24.470 1.00   50.56  ? 347  SER B O   1 
ATOM   6807 C CB  . SER B 1 347 ? 4.878   -15.555 -24.916 1.00   63.26  ? 347  SER B CB  1 
ATOM   6808 O OG  . SER B 1 347 ? 3.707   -16.125 -25.483 1.00   59.26  ? 347  SER B OG  1 
ATOM   6809 N N   . LYS B 1 348 ? 3.159   -13.364 -26.646 1.00   54.74  ? 348  LYS B N   1 
ATOM   6810 C CA  . LYS B 1 348 ? 1.837   -12.776 -26.764 1.00   57.11  ? 348  LYS B CA  1 
ATOM   6811 C C   . LYS B 1 348 ? 0.820   -13.652 -26.049 1.00   60.79  ? 348  LYS B C   1 
ATOM   6812 O O   . LYS B 1 348 ? -0.309  -13.231 -25.789 1.00   58.63  ? 348  LYS B O   1 
ATOM   6813 C CB  . LYS B 1 348 ? 1.438   -12.622 -28.227 1.00   54.88  ? 348  LYS B CB  1 
ATOM   6814 C CG  . LYS B 1 348 ? 1.197   -13.922 -28.963 1.00   57.44  ? 348  LYS B CG  1 
ATOM   6815 C CD  . LYS B 1 348 ? -0.015  -13.783 -29.879 1.00   62.78  ? 348  LYS B CD  1 
ATOM   6816 C CE  . LYS B 1 348 ? -0.168  -14.985 -30.794 1.00   64.92  ? 348  LYS B CE  1 
ATOM   6817 N NZ  . LYS B 1 348 ? -1.603  -15.358 -30.953 1.00   70.43  ? 348  LYS B NZ  1 
ATOM   6818 N N   . ASP B 1 349 ? 1.236   -14.872 -25.724 1.00   58.18  ? 349  ASP B N   1 
ATOM   6819 C CA  . ASP B 1 349 ? 0.302   -15.894 -25.269 1.00   64.15  ? 349  ASP B CA  1 
ATOM   6820 C C   . ASP B 1 349 ? 0.174   -16.027 -23.744 1.00   64.44  ? 349  ASP B C   1 
ATOM   6821 O O   . ASP B 1 349 ? -0.791  -16.611 -23.257 1.00   59.96  ? 349  ASP B O   1 
ATOM   6822 C CB  . ASP B 1 349 ? 0.604   -17.234 -25.957 1.00   61.33  ? 349  ASP B CB  1 
ATOM   6823 C CG  . ASP B 1 349 ? 0.192   -17.231 -27.426 1.00   62.11  ? 349  ASP B CG  1 
ATOM   6824 O OD1 . ASP B 1 349 ? -0.809  -16.559 -27.759 1.00   61.06  ? 349  ASP B OD1 1 
ATOM   6825 O OD2 . ASP B 1 349 ? 0.870   -17.882 -28.247 1.00   64.11  ? 349  ASP B OD2 1 
ATOM   6826 N N   . ASN B 1 350 ? 1.136   -15.482 -23.002 1.00   61.41  ? 350  ASN B N   1 
ATOM   6827 C CA  . ASN B 1 350 ? 0.996   -15.338 -21.549 1.00   65.12  ? 350  ASN B CA  1 
ATOM   6828 C C   . ASN B 1 350 ? 1.346   -13.925 -21.070 1.00   65.08  ? 350  ASN B C   1 
ATOM   6829 O O   . ASN B 1 350 ? 1.680   -13.052 -21.876 1.00   63.59  ? 350  ASN B O   1 
ATOM   6830 C CB  . ASN B 1 350 ? 1.788   -16.411 -20.781 1.00   61.75  ? 350  ASN B CB  1 
ATOM   6831 C CG  . ASN B 1 350 ? 3.286   -16.368 -21.056 1.00   69.38  ? 350  ASN B CG  1 
ATOM   6832 O OD1 . ASN B 1 350 ? 3.875   -15.295 -21.213 1.00   70.02  ? 350  ASN B OD1 1 
ATOM   6833 N ND2 . ASN B 1 350 ? 3.917   -17.549 -21.065 1.00   72.80  ? 350  ASN B ND2 1 
ATOM   6834 N N   . GLU B 1 351 ? 1.265   -13.698 -19.763 1.00   61.45  ? 351  GLU B N   1 
ATOM   6835 C CA  . GLU B 1 351 ? 1.487   -12.359 -19.215 1.00   61.83  ? 351  GLU B CA  1 
ATOM   6836 C C   . GLU B 1 351 ? 2.962   -11.977 -19.081 1.00   53.22  ? 351  GLU B C   1 
ATOM   6837 O O   . GLU B 1 351 ? 3.292   -10.887 -18.623 1.00   57.20  ? 351  GLU B O   1 
ATOM   6838 C CB  . GLU B 1 351 ? 0.764   -12.197 -17.885 1.00   56.91  ? 351  GLU B CB  1 
ATOM   6839 C CG  . GLU B 1 351 ? -0.708  -11.921 -18.055 1.00   61.61  ? 351  GLU B CG  1 
ATOM   6840 C CD  . GLU B 1 351 ? -1.455  -11.913 -16.738 1.00   85.74  ? 351  GLU B CD  1 
ATOM   6841 O OE1 . GLU B 1 351 ? -0.867  -12.327 -15.709 1.00   78.44  ? 351  GLU B OE1 1 
ATOM   6842 O OE2 . GLU B 1 351 ? -2.633  -11.489 -16.735 1.00   97.25  ? 351  GLU B OE2 1 
ATOM   6843 N N   . SER B 1 352 ? 3.841   -12.876 -19.493 1.00   51.06  ? 352  SER B N   1 
ATOM   6844 C CA  . SER B 1 352 ? 5.264   -12.582 -19.552 1.00   56.85  ? 352  SER B CA  1 
ATOM   6845 C C   . SER B 1 352 ? 5.765   -11.876 -18.296 1.00   56.88  ? 352  SER B C   1 
ATOM   6846 O O   . SER B 1 352 ? 6.495   -10.887 -18.386 1.00   57.36  ? 352  SER B O   1 
ATOM   6847 C CB  . SER B 1 352 ? 5.574   -11.723 -20.781 1.00   51.93  ? 352  SER B CB  1 
ATOM   6848 O OG  . SER B 1 352 ? 4.586   -11.889 -21.777 1.00   53.22  ? 352  SER B OG  1 
ATOM   6849 N N   . LEU B 1 353 ? 5.359   -12.367 -17.130 1.00   53.01  ? 353  LEU B N   1 
ATOM   6850 C CA  . LEU B 1 353 ? 5.937   -11.900 -15.877 1.00   55.89  ? 353  LEU B CA  1 
ATOM   6851 C C   . LEU B 1 353 ? 7.349   -12.462 -15.788 1.00   56.79  ? 353  LEU B C   1 
ATOM   6852 O O   . LEU B 1 353 ? 7.551   -13.674 -15.801 1.00   56.22  ? 353  LEU B O   1 
ATOM   6853 C CB  . LEU B 1 353 ? 5.087   -12.338 -14.692 1.00   51.45  ? 353  LEU B CB  1 
ATOM   6854 C CG  . LEU B 1 353 ? 3.642   -11.845 -14.817 1.00   60.76  ? 353  LEU B CG  1 
ATOM   6855 C CD1 . LEU B 1 353 ? 2.715   -12.587 -13.873 1.00   58.46  ? 353  LEU B CD1 1 
ATOM   6856 C CD2 . LEU B 1 353 ? 3.556   -10.335 -14.583 1.00   56.79  ? 353  LEU B CD2 1 
ATOM   6857 N N   . ILE B 1 354 ? 8.335   -11.578 -15.744 1.00   53.68  ? 354  ILE B N   1 
ATOM   6858 C CA  . ILE B 1 354 ? 9.715   -12.025 -15.827 1.00   53.96  ? 354  ILE B CA  1 
ATOM   6859 C C   . ILE B 1 354 ? 10.419  -11.946 -14.483 1.00   52.43  ? 354  ILE B C   1 
ATOM   6860 O O   . ILE B 1 354 ? 9.921   -11.332 -13.542 1.00   49.50  ? 354  ILE B O   1 
ATOM   6861 C CB  . ILE B 1 354 ? 10.507  -11.251 -16.901 1.00   51.84  ? 354  ILE B CB  1 
ATOM   6862 C CG1 . ILE B 1 354 ? 10.375  -9.734  -16.684 1.00   56.40  ? 354  ILE B CG1 1 
ATOM   6863 C CG2 . ILE B 1 354 ? 10.020  -11.643 -18.287 1.00   49.64  ? 354  ILE B CG2 1 
ATOM   6864 C CD1 . ILE B 1 354 ? 11.460  -8.906  -17.359 1.00   47.54  ? 354  ILE B CD1 1 
ATOM   6865 N N   . SER B 1 355 ? 11.570  -12.600 -14.403 1.00   54.20  ? 355  SER B N   1 
ATOM   6866 C CA  . SER B 1 355 ? 12.384  -12.578 -13.205 1.00   56.58  ? 355  SER B CA  1 
ATOM   6867 C C   . SER B 1 355 ? 13.428  -11.486 -13.334 1.00   62.89  ? 355  SER B C   1 
ATOM   6868 O O   . SER B 1 355 ? 13.636  -10.924 -14.414 1.00   63.67  ? 355  SER B O   1 
ATOM   6869 C CB  . SER B 1 355 ? 13.108  -13.908 -13.045 1.00   60.30  ? 355  SER B CB  1 
ATOM   6870 O OG  . SER B 1 355 ? 14.238  -13.959 -13.904 1.00   66.16  ? 355  SER B OG  1 
ATOM   6871 N N   . ARG B 1 356 ? 14.110  -11.212 -12.234 1.00   58.57  ? 356  ARG B N   1 
ATOM   6872 C CA  . ARG B 1 356 ? 15.163  -10.221 -12.233 1.00   61.73  ? 356  ARG B CA  1 
ATOM   6873 C C   . ARG B 1 356 ? 16.320  -10.663 -13.133 1.00   62.31  ? 356  ARG B C   1 
ATOM   6874 O O   . ARG B 1 356 ? 16.956  -9.839  -13.804 1.00   61.86  ? 356  ARG B O   1 
ATOM   6875 C CB  . ARG B 1 356 ? 15.631  -9.946  -10.799 1.00   56.87  ? 356  ARG B CB  1 
ATOM   6876 C CG  . ARG B 1 356 ? 16.672  -8.855  -10.714 1.00   56.96  ? 356  ARG B CG  1 
ATOM   6877 C CD  . ARG B 1 356 ? 16.458  -7.895  -9.547  1.00   55.02  ? 356  ARG B CD  1 
ATOM   6878 N NE  . ARG B 1 356 ? 17.452  -6.827  -9.638  1.00   65.12  ? 356  ARG B NE  1 
ATOM   6879 C CZ  . ARG B 1 356 ? 17.234  -5.650  -10.222 1.00   58.82  ? 356  ARG B CZ  1 
ATOM   6880 N NH1 . ARG B 1 356 ? 16.041  -5.375  -10.730 1.00   51.72  ? 356  ARG B NH1 1 
ATOM   6881 N NH2 . ARG B 1 356 ? 18.200  -4.741  -10.282 1.00   49.90  ? 356  ARG B NH2 1 
ATOM   6882 N N   . ALA B 1 357 ? 16.580  -11.967 -13.161 1.00   61.94  ? 357  ALA B N   1 
ATOM   6883 C CA  . ALA B 1 357 ? 17.670  -12.499 -13.972 1.00   56.77  ? 357  ALA B CA  1 
ATOM   6884 C C   . ALA B 1 357 ? 17.340  -12.309 -15.437 1.00   55.49  ? 357  ALA B C   1 
ATOM   6885 O O   . ALA B 1 357 ? 18.191  -11.899 -16.230 1.00   50.04  ? 357  ALA B O   1 
ATOM   6886 C CB  . ALA B 1 357 ? 17.894  -13.961 -13.667 1.00   55.02  ? 357  ALA B CB  1 
ATOM   6887 N N   . GLN B 1 358 ? 16.087  -12.605 -15.774 1.00   54.64  ? 358  GLN B N   1 
ATOM   6888 C CA  . GLN B 1 358 ? 15.562  -12.425 -17.120 1.00   58.63  ? 358  GLN B CA  1 
ATOM   6889 C C   . GLN B 1 358 ? 15.642  -10.966 -17.561 1.00   60.66  ? 358  GLN B C   1 
ATOM   6890 O O   . GLN B 1 358 ? 15.893  -10.673 -18.735 1.00   55.60  ? 358  GLN B O   1 
ATOM   6891 C CB  . GLN B 1 358 ? 14.119  -12.937 -17.194 1.00   55.89  ? 358  GLN B CB  1 
ATOM   6892 C CG  . GLN B 1 358 ? 14.043  -14.447 -17.079 1.00   58.15  ? 358  GLN B CG  1 
ATOM   6893 C CD  . GLN B 1 358 ? 12.646  -14.995 -17.250 1.00   63.37  ? 358  GLN B CD  1 
ATOM   6894 O OE1 . GLN B 1 358 ? 11.694  -14.537 -16.606 1.00   68.42  ? 358  GLN B OE1 1 
ATOM   6895 N NE2 . GLN B 1 358 ? 12.514  -16.000 -18.110 1.00   59.31  ? 358  GLN B NE2 1 
ATOM   6896 N N   . PHE B 1 359 ? 15.441  -10.057 -16.609 1.00   59.19  ? 359  PHE B N   1 
ATOM   6897 C CA  . PHE B 1 359 ? 15.461  -8.627  -16.895 1.00   56.96  ? 359  PHE B CA  1 
ATOM   6898 C C   . PHE B 1 359 ? 16.864  -8.127  -17.263 1.00   50.20  ? 359  PHE B C   1 
ATOM   6899 O O   . PHE B 1 359 ? 17.024  -7.392  -18.231 1.00   51.75  ? 359  PHE B O   1 
ATOM   6900 C CB  . PHE B 1 359 ? 14.844  -7.829  -15.735 1.00   54.81  ? 359  PHE B CB  1 
ATOM   6901 C CG  . PHE B 1 359 ? 15.016  -6.344  -15.858 1.00   50.69  ? 359  PHE B CG  1 
ATOM   6902 C CD1 . PHE B 1 359 ? 14.559  -5.668  -16.976 1.00   56.34  ? 359  PHE B CD1 1 
ATOM   6903 C CD2 . PHE B 1 359 ? 15.651  -5.622  -14.863 1.00   53.29  ? 359  PHE B CD2 1 
ATOM   6904 C CE1 . PHE B 1 359 ? 14.729  -4.294  -17.099 1.00   56.75  ? 359  PHE B CE1 1 
ATOM   6905 C CE2 . PHE B 1 359 ? 15.817  -4.247  -14.976 1.00   54.04  ? 359  PHE B CE2 1 
ATOM   6906 C CZ  . PHE B 1 359 ? 15.353  -3.583  -16.096 1.00   52.11  ? 359  PHE B CZ  1 
ATOM   6907 N N   . LEU B 1 360 ? 17.881  -8.538  -16.516 1.00   51.94  ? 360  LEU B N   1 
ATOM   6908 C CA  . LEU B 1 360 ? 19.253  -8.156  -16.860 1.00   55.89  ? 360  LEU B CA  1 
ATOM   6909 C C   . LEU B 1 360 ? 19.661  -8.801  -18.184 1.00   55.75  ? 360  LEU B C   1 
ATOM   6910 O O   . LEU B 1 360 ? 20.449  -8.243  -18.952 1.00   53.28  ? 360  LEU B O   1 
ATOM   6911 C CB  . LEU B 1 360 ? 20.249  -8.555  -15.763 1.00   51.62  ? 360  LEU B CB  1 
ATOM   6912 C CG  . LEU B 1 360 ? 19.912  -8.366  -14.277 1.00   65.22  ? 360  LEU B CG  1 
ATOM   6913 C CD1 . LEU B 1 360 ? 21.199  -8.317  -13.459 1.00   65.33  ? 360  LEU B CD1 1 
ATOM   6914 C CD2 . LEU B 1 360 ? 19.077  -7.118  -13.993 1.00   59.92  ? 360  LEU B CD2 1 
ATOM   6915 N N   . ALA B 1 361 ? 19.120  -9.984  -18.448 1.00   59.39  ? 361  ALA B N   1 
ATOM   6916 C CA  . ALA B 1 361 ? 19.370  -10.657 -19.716 1.00   61.63  ? 361  ALA B CA  1 
ATOM   6917 C C   . ALA B 1 361 ? 18.679  -9.883  -20.830 1.00   52.52  ? 361  ALA B C   1 
ATOM   6918 O O   . ALA B 1 361 ? 19.301  -9.522  -21.831 1.00   51.35  ? 361  ALA B O   1 
ATOM   6919 C CB  . ALA B 1 361 ? 18.869  -12.102 -19.668 1.00   55.77  ? 361  ALA B CB  1 
ATOM   6920 N N   . GLY B 1 362 ? 17.388  -9.629  -20.641 1.00   52.08  ? 362  GLY B N   1 
ATOM   6921 C CA  . GLY B 1 362 ? 16.614  -8.836  -21.580 1.00   49.02  ? 362  GLY B CA  1 
ATOM   6922 C C   . GLY B 1 362 ? 17.332  -7.558  -21.973 1.00   50.34  ? 362  GLY B C   1 
ATOM   6923 O O   . GLY B 1 362 ? 17.354  -7.180  -23.149 1.00   45.25  ? 362  GLY B O   1 
ATOM   6924 N N   . VAL B 1 363 ? 17.948  -6.906  -20.989 1.00   49.56  ? 363  VAL B N   1 
ATOM   6925 C CA  . VAL B 1 363 ? 18.573  -5.598  -21.200 1.00   50.83  ? 363  VAL B CA  1 
ATOM   6926 C C   . VAL B 1 363 ? 19.764  -5.620  -22.167 1.00   48.36  ? 363  VAL B C   1 
ATOM   6927 O O   . VAL B 1 363 ? 19.893  -4.716  -22.991 1.00   47.27  ? 363  VAL B O   1 
ATOM   6928 C CB  . VAL B 1 363 ? 18.925  -4.895  -19.854 1.00   47.73  ? 363  VAL B CB  1 
ATOM   6929 C CG1 . VAL B 1 363 ? 19.946  -3.789  -20.054 1.00   41.73  ? 363  VAL B CG1 1 
ATOM   6930 C CG2 . VAL B 1 363 ? 17.654  -4.350  -19.204 1.00   45.39  ? 363  VAL B CG2 1 
ATOM   6931 N N   . ARG B 1 364 ? 20.613  -6.648  -22.089 1.00   48.93  ? 364  ARG B N   1 
ATOM   6932 C CA  . ARG B 1 364 ? 21.753  -6.754  -23.007 1.00   47.55  ? 364  ARG B CA  1 
ATOM   6933 C C   . ARG B 1 364 ? 21.260  -6.929  -24.435 1.00   51.06  ? 364  ARG B C   1 
ATOM   6934 O O   . ARG B 1 364 ? 21.964  -6.608  -25.381 1.00   53.77  ? 364  ARG B O   1 
ATOM   6935 C CB  . ARG B 1 364 ? 22.663  -7.931  -22.657 1.00   48.54  ? 364  ARG B CB  1 
ATOM   6936 C CG  . ARG B 1 364 ? 22.982  -8.109  -21.165 1.00   54.78  ? 364  ARG B CG  1 
ATOM   6937 C CD  . ARG B 1 364 ? 23.675  -6.882  -20.567 1.00   54.53  ? 364  ARG B CD  1 
ATOM   6938 N NE  . ARG B 1 364 ? 24.763  -6.374  -21.400 1.00   53.19  ? 364  ARG B NE  1 
ATOM   6939 C CZ  . ARG B 1 364 ? 26.056  -6.519  -21.116 1.00   60.66  ? 364  ARG B CZ  1 
ATOM   6940 N NH1 . ARG B 1 364 ? 26.414  -7.163  -20.008 1.00   60.90  ? 364  ARG B NH1 1 
ATOM   6941 N NH2 . ARG B 1 364 ? 26.989  -6.013  -21.929 1.00   48.04  ? 364  ARG B NH2 1 
ATOM   6942 N N   . ILE B 1 365 ? 20.046  -7.449  -24.584 1.00   52.10  ? 365  ILE B N   1 
ATOM   6943 C CA  . ILE B 1 365 ? 19.475  -7.696  -25.900 1.00   51.98  ? 365  ILE B CA  1 
ATOM   6944 C C   . ILE B 1 365 ? 18.798  -6.445  -26.443 1.00   49.96  ? 365  ILE B C   1 
ATOM   6945 O O   . ILE B 1 365 ? 18.893  -6.142  -27.639 1.00   48.07  ? 365  ILE B O   1 
ATOM   6946 C CB  . ILE B 1 365 ? 18.465  -8.866  -25.869 1.00   50.67  ? 365  ILE B CB  1 
ATOM   6947 C CG1 . ILE B 1 365 ? 19.184  -10.160 -25.499 1.00   48.90  ? 365  ILE B CG1 1 
ATOM   6948 C CG2 . ILE B 1 365 ? 17.757  -9.012  -27.227 1.00   45.03  ? 365  ILE B CG2 1 
ATOM   6949 C CD1 . ILE B 1 365 ? 18.263  -11.353 -25.417 1.00   57.67  ? 365  ILE B CD1 1 
ATOM   6950 N N   . GLY B 1 366 ? 18.124  -5.720  -25.553 1.00   47.20  ? 366  GLY B N   1 
ATOM   6951 C CA  . GLY B 1 366 ? 17.444  -4.487  -25.912 1.00   47.05  ? 366  GLY B CA  1 
ATOM   6952 C C   . GLY B 1 366 ? 18.395  -3.316  -26.078 1.00   49.06  ? 366  GLY B C   1 
ATOM   6953 O O   . GLY B 1 366 ? 18.042  -2.309  -26.681 1.00   50.85  ? 366  GLY B O   1 
ATOM   6954 N N   . VAL B 1 367 ? 19.599  -3.449  -25.528 1.00   45.54  ? 367  VAL B N   1 
ATOM   6955 C CA  . VAL B 1 367 ? 20.621  -2.417  -25.630 1.00   50.54  ? 367  VAL B CA  1 
ATOM   6956 C C   . VAL B 1 367 ? 21.938  -3.074  -26.005 1.00   51.01  ? 367  VAL B C   1 
ATOM   6957 O O   . VAL B 1 367 ? 22.905  -3.022  -25.255 1.00   46.71  ? 367  VAL B O   1 
ATOM   6958 C CB  . VAL B 1 367 ? 20.812  -1.639  -24.304 1.00   49.86  ? 367  VAL B CB  1 
ATOM   6959 C CG1 . VAL B 1 367 ? 21.655  -0.400  -24.544 1.00   43.60  ? 367  VAL B CG1 1 
ATOM   6960 C CG2 . VAL B 1 367 ? 19.470  -1.260  -23.693 1.00   40.76  ? 367  VAL B CG2 1 
ATOM   6961 N N   . PRO B 1 368 ? 21.979  -3.665  -27.200 1.00   55.22  ? 368  PRO B N   1 
ATOM   6962 C CA  . PRO B 1 368 ? 23.029  -4.577  -27.676 1.00   54.14  ? 368  PRO B CA  1 
ATOM   6963 C C   . PRO B 1 368 ? 24.401  -3.915  -27.749 1.00   53.82  ? 368  PRO B C   1 
ATOM   6964 O O   . PRO B 1 368 ? 25.424  -4.594  -27.744 1.00   61.58  ? 368  PRO B O   1 
ATOM   6965 C CB  . PRO B 1 368 ? 22.556  -4.947  -29.089 1.00   57.15  ? 368  PRO B CB  1 
ATOM   6966 C CG  . PRO B 1 368 ? 21.124  -4.478  -29.176 1.00   56.55  ? 368  PRO B CG  1 
ATOM   6967 C CD  . PRO B 1 368 ? 21.021  -3.316  -28.261 1.00   51.28  ? 368  PRO B CD  1 
ATOM   6968 N N   . GLN B 1 369 ? 24.416  -2.594  -27.820 1.00   50.92  ? 369  GLN B N   1 
ATOM   6969 C CA  . GLN B 1 369 ? 25.663  -1.856  -27.938 1.00   57.14  ? 369  GLN B CA  1 
ATOM   6970 C C   . GLN B 1 369 ? 26.251  -1.540  -26.562 1.00   57.62  ? 369  GLN B C   1 
ATOM   6971 O O   . GLN B 1 369 ? 27.381  -1.055  -26.464 1.00   57.57  ? 369  GLN B O   1 
ATOM   6972 C CB  . GLN B 1 369 ? 25.441  -0.561  -28.725 1.00   51.92  ? 369  GLN B CB  1 
ATOM   6973 C CG  . GLN B 1 369 ? 24.679  0.520   -27.953 1.00   59.04  ? 369  GLN B CG  1 
ATOM   6974 C CD  . GLN B 1 369 ? 23.164  0.315   -27.947 1.00   60.00  ? 369  GLN B CD  1 
ATOM   6975 O OE1 . GLN B 1 369 ? 22.402  1.271   -28.086 1.00   69.00  ? 369  GLN B OE1 1 
ATOM   6976 N NE2 . GLN B 1 369 ? 22.725  -0.928  -27.792 1.00   55.15  ? 369  GLN B NE2 1 
ATOM   6977 N N   . ALA B 1 370 ? 25.488  -1.830  -25.510 1.00   47.33  ? 370  ALA B N   1 
ATOM   6978 C CA  . ALA B 1 370 ? 25.861  -1.447  -24.150 1.00   51.32  ? 370  ALA B CA  1 
ATOM   6979 C C   . ALA B 1 370 ? 26.987  -2.283  -23.575 1.00   54.22  ? 370  ALA B C   1 
ATOM   6980 O O   . ALA B 1 370 ? 26.914  -3.515  -23.571 1.00   50.86  ? 370  ALA B O   1 
ATOM   6981 C CB  . ALA B 1 370 ? 24.652  -1.525  -23.220 1.00   49.32  ? 370  ALA B CB  1 
ATOM   6982 N N   . SER B 1 371 ? 28.012  -1.601  -23.068 1.00   52.97  ? 371  SER B N   1 
ATOM   6983 C CA  . SER B 1 371 ? 29.030  -2.234  -22.233 1.00   53.44  ? 371  SER B CA  1 
ATOM   6984 C C   . SER B 1 371 ? 28.396  -2.763  -20.949 1.00   57.21  ? 371  SER B C   1 
ATOM   6985 O O   . SER B 1 371 ? 27.247  -2.444  -20.639 1.00   56.37  ? 371  SER B O   1 
ATOM   6986 C CB  . SER B 1 371 ? 30.125  -1.230  -21.885 1.00   55.90  ? 371  SER B CB  1 
ATOM   6987 O OG  . SER B 1 371 ? 29.598  -0.130  -21.165 1.00   52.21  ? 371  SER B OG  1 
ATOM   6988 N N   . ASP B 1 372 ? 29.140  -3.569  -20.201 1.00   60.54  ? 372  ASP B N   1 
ATOM   6989 C CA  . ASP B 1 372 ? 28.615  -4.155  -18.973 1.00   60.37  ? 372  ASP B CA  1 
ATOM   6990 C C   . ASP B 1 372 ? 28.145  -3.057  -18.027 1.00   61.13  ? 372  ASP B C   1 
ATOM   6991 O O   . ASP B 1 372 ? 27.087  -3.161  -17.398 1.00   57.80  ? 372  ASP B O   1 
ATOM   6992 C CB  . ASP B 1 372 ? 29.687  -5.006  -18.289 1.00   67.89  ? 372  ASP B CB  1 
ATOM   6993 C CG  . ASP B 1 372 ? 30.105  -6.203  -19.127 1.00   76.80  ? 372  ASP B CG  1 
ATOM   6994 O OD1 . ASP B 1 372 ? 29.211  -6.864  -19.702 1.00   72.07  ? 372  ASP B OD1 1 
ATOM   6995 O OD2 . ASP B 1 372 ? 31.324  -6.483  -19.209 1.00   81.20  ? 372  ASP B OD2 1 
ATOM   6996 N N   . LEU B 1 373 ? 28.941  -1.997  -17.946 1.00   53.26  ? 373  LEU B N   1 
ATOM   6997 C CA  . LEU B 1 373 ? 28.676  -0.915  -17.016 1.00   53.85  ? 373  LEU B CA  1 
ATOM   6998 C C   . LEU B 1 373 ? 27.448  -0.110  -17.423 1.00   55.73  ? 373  LEU B C   1 
ATOM   6999 O O   . LEU B 1 373 ? 26.619  0.237   -16.577 1.00   51.76  ? 373  LEU B O   1 
ATOM   7000 C CB  . LEU B 1 373 ? 29.894  -0.006  -16.914 1.00   47.92  ? 373  LEU B CB  1 
ATOM   7001 C CG  . LEU B 1 373 ? 29.737  1.214   -16.007 1.00   55.88  ? 373  LEU B CG  1 
ATOM   7002 C CD1 . LEU B 1 373 ? 29.208  0.816   -14.638 1.00   45.02  ? 373  LEU B CD1 1 
ATOM   7003 C CD2 . LEU B 1 373 ? 31.068  1.933   -15.890 1.00   50.11  ? 373  LEU B CD2 1 
ATOM   7004 N N   . ALA B 1 374 ? 27.349  0.190   -18.717 1.00   51.82  ? 374  ALA B N   1 
ATOM   7005 C CA  . ALA B 1 374 ? 26.189  0.882   -19.274 1.00   52.68  ? 374  ALA B CA  1 
ATOM   7006 C C   . ALA B 1 374 ? 24.905  0.077   -19.077 1.00   51.44  ? 374  ALA B C   1 
ATOM   7007 O O   . ALA B 1 374 ? 23.863  0.635   -18.729 1.00   46.27  ? 374  ALA B O   1 
ATOM   7008 C CB  . ALA B 1 374 ? 26.405  1.174   -20.754 1.00   52.95  ? 374  ALA B CB  1 
ATOM   7009 N N   . ALA B 1 375 ? 24.986  -1.229  -19.309 1.00   44.31  ? 375  ALA B N   1 
ATOM   7010 C CA  . ALA B 1 375 ? 23.836  -2.100  -19.135 1.00   50.76  ? 375  ALA B CA  1 
ATOM   7011 C C   . ALA B 1 375 ? 23.426  -2.064  -17.679 1.00   52.63  ? 375  ALA B C   1 
ATOM   7012 O O   . ALA B 1 375 ? 22.242  -2.027  -17.353 1.00   49.85  ? 375  ALA B O   1 
ATOM   7013 C CB  . ALA B 1 375 ? 24.170  -3.519  -19.559 1.00   49.94  ? 375  ALA B CB  1 
ATOM   7014 N N   . GLU B 1 376 ? 24.419  -2.066  -16.798 1.00   54.17  ? 376  GLU B N   1 
ATOM   7015 C CA  . GLU B 1 376 ? 24.159  -2.005  -15.366 1.00   53.42  ? 376  GLU B CA  1 
ATOM   7016 C C   . GLU B 1 376 ? 23.461  -0.691  -14.994 1.00   50.68  ? 376  GLU B C   1 
ATOM   7017 O O   . GLU B 1 376 ? 22.449  -0.685  -14.285 1.00   44.33  ? 376  GLU B O   1 
ATOM   7018 C CB  . GLU B 1 376 ? 25.464  -2.156  -14.601 1.00   56.69  ? 376  GLU B CB  1 
ATOM   7019 C CG  . GLU B 1 376 ? 25.307  -2.777  -13.242 1.00   67.91  ? 376  GLU B CG  1 
ATOM   7020 C CD  . GLU B 1 376 ? 26.547  -3.545  -12.846 1.00   91.20  ? 376  GLU B CD  1 
ATOM   7021 O OE1 . GLU B 1 376 ? 27.378  -3.817  -13.745 1.00   85.46  ? 376  GLU B OE1 1 
ATOM   7022 O OE2 . GLU B 1 376 ? 26.693  -3.872  -11.648 1.00   93.16  ? 376  GLU B OE2 1 
ATOM   7023 N N   . ALA B 1 377 ? 24.006  0.419   -15.481 1.00   45.54  ? 377  ALA B N   1 
ATOM   7024 C CA  . ALA B 1 377 ? 23.332  1.701   -15.346 1.00   46.72  ? 377  ALA B CA  1 
ATOM   7025 C C   . ALA B 1 377 ? 21.858  1.583   -15.730 1.00   46.60  ? 377  ALA B C   1 
ATOM   7026 O O   . ALA B 1 377 ? 20.990  2.085   -15.014 1.00   49.60  ? 377  ALA B O   1 
ATOM   7027 C CB  . ALA B 1 377 ? 24.018  2.761   -16.179 1.00   44.35  ? 377  ALA B CB  1 
ATOM   7028 N N   . VAL B 1 378 ? 21.568  0.912   -16.845 1.00   41.22  ? 378  VAL B N   1 
ATOM   7029 C CA  . VAL B 1 378 ? 20.188  0.835   -17.309 1.00   39.49  ? 378  VAL B CA  1 
ATOM   7030 C C   . VAL B 1 378 ? 19.339  0.073   -16.311 1.00   40.89  ? 378  VAL B C   1 
ATOM   7031 O O   . VAL B 1 378 ? 18.245  0.506   -15.958 1.00   45.80  ? 378  VAL B O   1 
ATOM   7032 C CB  . VAL B 1 378 ? 20.047  0.158   -18.685 1.00   41.35  ? 378  VAL B CB  1 
ATOM   7033 C CG1 . VAL B 1 378 ? 18.570  0.007   -19.040 1.00   34.97  ? 378  VAL B CG1 1 
ATOM   7034 C CG2 . VAL B 1 378 ? 20.769  0.945   -19.731 1.00   37.50  ? 378  VAL B CG2 1 
ATOM   7035 N N   . VAL B 1 379 ? 19.840  -1.069  -15.861 1.00   43.54  ? 379  VAL B N   1 
ATOM   7036 C CA  . VAL B 1 379 ? 19.111  -1.871  -14.890 1.00   47.32  ? 379  VAL B CA  1 
ATOM   7037 C C   . VAL B 1 379 ? 18.821  -1.113  -13.599 1.00   44.99  ? 379  VAL B C   1 
ATOM   7038 O O   . VAL B 1 379 ? 17.692  -1.111  -13.114 1.00   43.97  ? 379  VAL B O   1 
ATOM   7039 C CB  . VAL B 1 379 ? 19.867  -3.144  -14.538 1.00   46.33  ? 379  VAL B CB  1 
ATOM   7040 C CG1 . VAL B 1 379 ? 19.194  -3.827  -13.360 1.00   40.38  ? 379  VAL B CG1 1 
ATOM   7041 C CG2 . VAL B 1 379 ? 19.933  -4.058  -15.750 1.00   50.60  ? 379  VAL B CG2 1 
ATOM   7042 N N   . LEU B 1 380 ? 19.841  -0.468  -13.047 1.00   43.35  ? 380  LEU B N   1 
ATOM   7043 C CA  . LEU B 1 380 ? 19.672  0.252   -11.790 1.00   48.36  ? 380  LEU B CA  1 
ATOM   7044 C C   . LEU B 1 380 ? 18.686  1.411   -11.937 1.00   51.27  ? 380  LEU B C   1 
ATOM   7045 O O   . LEU B 1 380 ? 17.915  1.699   -11.016 1.00   49.33  ? 380  LEU B O   1 
ATOM   7046 C CB  . LEU B 1 380 ? 21.025  0.733   -11.248 1.00   45.66  ? 380  LEU B CB  1 
ATOM   7047 C CG  . LEU B 1 380 ? 22.111  -0.361  -11.206 1.00   55.22  ? 380  LEU B CG  1 
ATOM   7048 C CD1 . LEU B 1 380 ? 23.433  0.174   -10.689 1.00   48.91  ? 380  LEU B CD1 1 
ATOM   7049 C CD2 . LEU B 1 380 ? 21.679  -1.602  -10.397 1.00   47.93  ? 380  LEU B CD2 1 
ATOM   7050 N N   . HIS B 1 381 ? 18.701  2.061   -13.101 1.00   45.67  ? 381  HIS B N   1 
ATOM   7051 C CA  . HIS B 1 381 ? 17.806  3.189   -13.355 1.00   45.75  ? 381  HIS B CA  1 
ATOM   7052 C C   . HIS B 1 381 ? 16.360  2.749   -13.483 1.00   43.63  ? 381  HIS B C   1 
ATOM   7053 O O   . HIS B 1 381 ? 15.456  3.451   -13.041 1.00   45.70  ? 381  HIS B O   1 
ATOM   7054 C CB  . HIS B 1 381 ? 18.216  3.943   -14.623 1.00   49.48  ? 381  HIS B CB  1 
ATOM   7055 C CG  . HIS B 1 381 ? 17.278  5.052   -14.994 1.00   45.36  ? 381  HIS B CG  1 
ATOM   7056 N ND1 . HIS B 1 381 ? 17.516  6.369   -14.669 1.00   47.14  ? 381  HIS B ND1 1 
ATOM   7057 C CD2 . HIS B 1 381 ? 16.097  5.037   -15.656 1.00   48.43  ? 381  HIS B CD2 1 
ATOM   7058 C CE1 . HIS B 1 381 ? 16.522  7.118   -15.111 1.00   48.92  ? 381  HIS B CE1 1 
ATOM   7059 N NE2 . HIS B 1 381 ? 15.646  6.333   -15.714 1.00   45.83  ? 381  HIS B NE2 1 
ATOM   7060 N N   . TYR B 1 382 ? 16.152  1.577   -14.077 1.00   45.63  ? 382  TYR B N   1 
ATOM   7061 C CA  . TYR B 1 382 ? 14.809  1.080   -14.369 1.00   46.08  ? 382  TYR B CA  1 
ATOM   7062 C C   . TYR B 1 382 ? 14.238  0.161   -13.306 1.00   47.35  ? 382  TYR B C   1 
ATOM   7063 O O   . TYR B 1 382 ? 13.024  -0.069  -13.261 1.00   52.71  ? 382  TYR B O   1 
ATOM   7064 C CB  . TYR B 1 382 ? 14.766  0.382   -15.729 1.00   42.78  ? 382  TYR B CB  1 
ATOM   7065 C CG  . TYR B 1 382 ? 14.575  1.345   -16.863 1.00   42.20  ? 382  TYR B CG  1 
ATOM   7066 C CD1 . TYR B 1 382 ? 15.665  1.971   -17.454 1.00   38.18  ? 382  TYR B CD1 1 
ATOM   7067 C CD2 . TYR B 1 382 ? 13.306  1.654   -17.326 1.00   39.80  ? 382  TYR B CD2 1 
ATOM   7068 C CE1 . TYR B 1 382 ? 15.499  2.862   -18.480 1.00   38.32  ? 382  TYR B CE1 1 
ATOM   7069 C CE2 . TYR B 1 382 ? 13.126  2.546   -18.359 1.00   40.68  ? 382  TYR B CE2 1 
ATOM   7070 C CZ  . TYR B 1 382 ? 14.227  3.149   -18.935 1.00   44.10  ? 382  TYR B CZ  1 
ATOM   7071 O OH  . TYR B 1 382 ? 14.067  4.038   -19.971 1.00   44.06  ? 382  TYR B OH  1 
ATOM   7072 N N   . THR B 1 383 ? 15.098  -0.368  -12.449 1.00   51.28  ? 383  THR B N   1 
ATOM   7073 C CA  . THR B 1 383 ? 14.608  -1.156  -11.333 1.00   48.05  ? 383  THR B CA  1 
ATOM   7074 C C   . THR B 1 383 ? 13.835  -0.248  -10.403 1.00   51.22  ? 383  THR B C   1 
ATOM   7075 O O   . THR B 1 383 ? 14.292  0.852   -10.083 1.00   48.91  ? 383  THR B O   1 
ATOM   7076 C CB  . THR B 1 383 ? 15.747  -1.793  -10.574 1.00   46.98  ? 383  THR B CB  1 
ATOM   7077 O OG1 . THR B 1 383 ? 16.349  -2.780  -11.411 1.00   43.91  ? 383  THR B OG1 1 
ATOM   7078 C CG2 . THR B 1 383 ? 15.248  -2.441  -9.274  1.00   47.58  ? 383  THR B CG2 1 
ATOM   7079 N N   . ASP B 1 384 ? 12.643  -0.688  -10.012 1.00   50.66  ? 384  ASP B N   1 
ATOM   7080 C CA  . ASP B 1 384 ? 11.905  -0.007  -8.958  1.00   55.14  ? 384  ASP B CA  1 
ATOM   7081 C C   . ASP B 1 384 ? 12.365  -0.570  -7.612  1.00   57.71  ? 384  ASP B C   1 
ATOM   7082 O O   . ASP B 1 384 ? 12.058  -1.712  -7.258  1.00   45.78  ? 384  ASP B O   1 
ATOM   7083 C CB  . ASP B 1 384 ? 10.399  -0.168  -9.133  1.00   47.38  ? 384  ASP B CB  1 
ATOM   7084 C CG  . ASP B 1 384 ? 9.606   0.519   -8.029  1.00   60.55  ? 384  ASP B CG  1 
ATOM   7085 O OD1 . ASP B 1 384 ? 10.098  0.560   -6.882  1.00   62.01  ? 384  ASP B OD1 1 
ATOM   7086 O OD2 . ASP B 1 384 ? 8.486   1.010   -8.298  1.00   63.41  ? 384  ASP B OD2 1 
ATOM   7087 N N   . TRP B 1 385 ? 13.102  0.241   -6.860  1.00   55.68  ? 385  TRP B N   1 
ATOM   7088 C CA  . TRP B 1 385 ? 13.780  -0.268  -5.671  1.00   57.50  ? 385  TRP B CA  1 
ATOM   7089 C C   . TRP B 1 385 ? 12.865  -0.517  -4.475  1.00   54.87  ? 385  TRP B C   1 
ATOM   7090 O O   . TRP B 1 385 ? 13.245  -1.206  -3.530  1.00   54.49  ? 385  TRP B O   1 
ATOM   7091 C CB  . TRP B 1 385 ? 15.006  0.586   -5.342  1.00   54.45  ? 385  TRP B CB  1 
ATOM   7092 C CG  . TRP B 1 385 ? 16.016  0.422   -6.426  1.00   51.91  ? 385  TRP B CG  1 
ATOM   7093 C CD1 . TRP B 1 385 ? 16.262  1.280   -7.464  1.00   49.63  ? 385  TRP B CD1 1 
ATOM   7094 C CD2 . TRP B 1 385 ? 16.856  -0.715  -6.637  1.00   46.75  ? 385  TRP B CD2 1 
ATOM   7095 N NE1 . TRP B 1 385 ? 17.229  0.757   -8.285  1.00   47.18  ? 385  TRP B NE1 1 
ATOM   7096 C CE2 . TRP B 1 385 ? 17.609  -0.468  -7.802  1.00   43.10  ? 385  TRP B CE2 1 
ATOM   7097 C CE3 . TRP B 1 385 ? 17.048  -1.916  -5.951  1.00   43.91  ? 385  TRP B CE3 1 
ATOM   7098 C CZ2 . TRP B 1 385 ? 18.552  -1.374  -8.287  1.00   46.57  ? 385  TRP B CZ2 1 
ATOM   7099 C CZ3 . TRP B 1 385 ? 17.985  -2.815  -6.435  1.00   48.56  ? 385  TRP B CZ3 1 
ATOM   7100 C CH2 . TRP B 1 385 ? 18.723  -2.540  -7.591  1.00   48.07  ? 385  TRP B CH2 1 
ATOM   7101 N N   . LEU B 1 386 ? 11.644  -0.001  -4.545  1.00   52.63  ? 386  LEU B N   1 
ATOM   7102 C CA  . LEU B 1 386 ? 10.611  -0.406  -3.597  1.00   64.95  ? 386  LEU B CA  1 
ATOM   7103 C C   . LEU B 1 386 ? 10.152  -1.840  -3.882  1.00   61.73  ? 386  LEU B C   1 
ATOM   7104 O O   . LEU B 1 386 ? 9.836   -2.587  -2.958  1.00   64.19  ? 386  LEU B O   1 
ATOM   7105 C CB  . LEU B 1 386 ? 9.434   0.565   -3.645  1.00   67.53  ? 386  LEU B CB  1 
ATOM   7106 C CG  . LEU B 1 386 ? 9.845   1.937   -3.109  1.00   68.80  ? 386  LEU B CG  1 
ATOM   7107 C CD1 . LEU B 1 386 ? 9.030   3.093   -3.702  1.00   64.58  ? 386  LEU B CD1 1 
ATOM   7108 C CD2 . LEU B 1 386 ? 9.772   1.916   -1.593  1.00   68.93  ? 386  LEU B CD2 1 
ATOM   7109 N N   . HIS B 1 387 ? 10.145  -2.216  -5.163  1.00   58.73  ? 387  HIS B N   1 
ATOM   7110 C CA  . HIS B 1 387 ? 9.740   -3.557  -5.594  1.00   56.34  ? 387  HIS B CA  1 
ATOM   7111 C C   . HIS B 1 387 ? 10.731  -4.168  -6.606  1.00   58.15  ? 387  HIS B C   1 
ATOM   7112 O O   . HIS B 1 387 ? 10.376  -4.453  -7.749  1.00   57.08  ? 387  HIS B O   1 
ATOM   7113 C CB  . HIS B 1 387 ? 8.341   -3.507  -6.209  1.00   57.63  ? 387  HIS B CB  1 
ATOM   7114 C CG  . HIS B 1 387 ? 7.369   -2.668  -5.440  1.00   65.16  ? 387  HIS B CG  1 
ATOM   7115 N ND1 . HIS B 1 387 ? 6.898   -1.457  -5.906  1.00   69.03  ? 387  HIS B ND1 1 
ATOM   7116 C CD2 . HIS B 1 387 ? 6.782   -2.860  -4.234  1.00   68.34  ? 387  HIS B CD2 1 
ATOM   7117 C CE1 . HIS B 1 387 ? 6.065   -0.940  -5.020  1.00   61.96  ? 387  HIS B CE1 1 
ATOM   7118 N NE2 . HIS B 1 387 ? 5.978   -1.771  -3.996  1.00   75.79  ? 387  HIS B NE2 1 
ATOM   7119 N N   . PRO B 1 388 ? 11.981  -4.369  -6.185  1.00   54.24  ? 388  PRO B N   1 
ATOM   7120 C CA  . PRO B 1 388 ? 13.068  -4.794  -7.078  1.00   52.20  ? 388  PRO B CA  1 
ATOM   7121 C C   . PRO B 1 388 ? 12.884  -6.146  -7.783  1.00   54.17  ? 388  PRO B C   1 
ATOM   7122 O O   . PRO B 1 388 ? 13.538  -6.377  -8.805  1.00   56.24  ? 388  PRO B O   1 
ATOM   7123 C CB  . PRO B 1 388 ? 14.279  -4.859  -6.133  1.00   58.50  ? 388  PRO B CB  1 
ATOM   7124 C CG  . PRO B 1 388 ? 13.684  -4.929  -4.760  1.00   53.87  ? 388  PRO B CG  1 
ATOM   7125 C CD  . PRO B 1 388 ? 12.485  -4.060  -4.839  1.00   49.42  ? 388  PRO B CD  1 
ATOM   7126 N N   . GLU B 1 389 ? 12.032  -7.021  -7.257  1.00   58.02  ? 389  GLU B N   1 
ATOM   7127 C CA  . GLU B 1 389 ? 11.910  -8.378  -7.801  1.00   59.66  ? 389  GLU B CA  1 
ATOM   7128 C C   . GLU B 1 389 ? 10.515  -8.657  -8.344  1.00   58.41  ? 389  GLU B C   1 
ATOM   7129 O O   . GLU B 1 389 ? 10.263  -9.729  -8.902  1.00   62.68  ? 389  GLU B O   1 
ATOM   7130 C CB  . GLU B 1 389 ? 12.247  -9.433  -6.740  1.00   58.98  ? 389  GLU B CB  1 
ATOM   7131 C CG  . GLU B 1 389 ? 13.402  -9.076  -5.823  1.00   70.84  ? 389  GLU B CG  1 
ATOM   7132 C CD  . GLU B 1 389 ? 14.713  -9.724  -6.227  1.00   80.40  ? 389  GLU B CD  1 
ATOM   7133 O OE1 . GLU B 1 389 ? 14.682  -10.710 -6.996  1.00   83.03  ? 389  GLU B OE1 1 
ATOM   7134 O OE2 . GLU B 1 389 ? 15.778  -9.253  -5.761  1.00   83.90  ? 389  GLU B OE2 1 
ATOM   7135 N N   . ASP B 1 390 ? 9.603   -7.707  -8.172  1.00   50.36  ? 390  ASP B N   1 
ATOM   7136 C CA  . ASP B 1 390 ? 8.255   -7.891  -8.679  1.00   57.01  ? 390  ASP B CA  1 
ATOM   7137 C C   . ASP B 1 390 ? 8.245   -8.040  -10.209 1.00   60.32  ? 390  ASP B C   1 
ATOM   7138 O O   . ASP B 1 390 ? 8.695   -7.151  -10.933 1.00   57.51  ? 390  ASP B O   1 
ATOM   7139 C CB  . ASP B 1 390 ? 7.358   -6.741  -8.267  1.00   49.46  ? 390  ASP B CB  1 
ATOM   7140 C CG  . ASP B 1 390 ? 6.058   -6.750  -9.019  1.00   62.03  ? 390  ASP B CG  1 
ATOM   7141 O OD1 . ASP B 1 390 ? 5.360   -7.783  -8.974  1.00   72.83  ? 390  ASP B OD1 1 
ATOM   7142 O OD2 . ASP B 1 390 ? 5.737   -5.740  -9.673  1.00   64.82  ? 390  ASP B OD2 1 
ATOM   7143 N N   . PRO B 1 391 ? 7.736   -9.177  -10.699 1.00   62.10  ? 391  PRO B N   1 
ATOM   7144 C CA  . PRO B 1 391 ? 7.748   -9.536  -12.123 1.00   58.64  ? 391  PRO B CA  1 
ATOM   7145 C C   . PRO B 1 391 ? 6.888   -8.635  -13.019 1.00   56.04  ? 391  PRO B C   1 
ATOM   7146 O O   . PRO B 1 391 ? 7.255   -8.451  -14.176 1.00   57.75  ? 391  PRO B O   1 
ATOM   7147 C CB  . PRO B 1 391 ? 7.213   -10.972 -12.126 1.00   55.99  ? 391  PRO B CB  1 
ATOM   7148 C CG  . PRO B 1 391 ? 7.467   -11.468 -10.733 1.00   59.68  ? 391  PRO B CG  1 
ATOM   7149 C CD  . PRO B 1 391 ? 7.227   -10.277 -9.866  1.00   60.47  ? 391  PRO B CD  1 
ATOM   7150 N N   . THR B 1 392 ? 5.777   -8.103  -12.514 1.00   52.14  ? 392  THR B N   1 
ATOM   7151 C CA  . THR B 1 392 ? 4.981   -7.159  -13.293 1.00   53.27  ? 392  THR B CA  1 
ATOM   7152 C C   . THR B 1 392 ? 5.778   -5.876  -13.563 1.00   58.24  ? 392  THR B C   1 
ATOM   7153 O O   . THR B 1 392 ? 5.822   -5.386  -14.691 1.00   58.73  ? 392  THR B O   1 
ATOM   7154 C CB  . THR B 1 392 ? 3.647   -6.788  -12.596 1.00   56.40  ? 392  THR B CB  1 
ATOM   7155 O OG1 . THR B 1 392 ? 2.767   -7.921  -12.577 1.00   59.42  ? 392  THR B OG1 1 
ATOM   7156 C CG2 . THR B 1 392 ? 2.963   -5.650  -13.333 1.00   41.85  ? 392  THR B CG2 1 
ATOM   7157 N N   . HIS B 1 393 ? 6.400   -5.332  -12.521 1.00   56.54  ? 393  HIS B N   1 
ATOM   7158 C CA  . HIS B 1 393 ? 7.219   -4.137  -12.671 1.00   60.46  ? 393  HIS B CA  1 
ATOM   7159 C C   . HIS B 1 393 ? 8.345   -4.431  -13.642 1.00   53.24  ? 393  HIS B C   1 
ATOM   7160 O O   . HIS B 1 393 ? 8.598   -3.662  -14.570 1.00   49.14  ? 393  HIS B O   1 
ATOM   7161 C CB  . HIS B 1 393 ? 7.810   -3.696  -11.326 1.00   59.11  ? 393  HIS B CB  1 
ATOM   7162 C CG  . HIS B 1 393 ? 6.893   -2.836  -10.515 1.00   69.89  ? 393  HIS B CG  1 
ATOM   7163 N ND1 . HIS B 1 393 ? 6.167   -3.319  -9.445  1.00   72.30  ? 393  HIS B ND1 1 
ATOM   7164 C CD2 . HIS B 1 393 ? 6.585   -1.520  -10.613 1.00   80.31  ? 393  HIS B CD2 1 
ATOM   7165 C CE1 . HIS B 1 393 ? 5.451   -2.338  -8.921  1.00   74.87  ? 393  HIS B CE1 1 
ATOM   7166 N NE2 . HIS B 1 393 ? 5.687   -1.236  -9.610  1.00   78.51  ? 393  HIS B NE2 1 
ATOM   7167 N N   . LEU B 1 394 ? 9.019   -5.553  -13.412 1.00   50.14  ? 394  LEU B N   1 
ATOM   7168 C CA  . LEU B 1 394 ? 10.171  -5.932  -14.211 1.00   53.71  ? 394  LEU B CA  1 
ATOM   7169 C C   . LEU B 1 394 ? 9.822   -6.082  -15.685 1.00   54.53  ? 394  LEU B C   1 
ATOM   7170 O O   . LEU B 1 394 ? 10.631  -5.758  -16.554 1.00   48.66  ? 394  LEU B O   1 
ATOM   7171 C CB  . LEU B 1 394 ? 10.767  -7.226  -13.681 1.00   55.33  ? 394  LEU B CB  1 
ATOM   7172 C CG  . LEU B 1 394 ? 11.528  -7.018  -12.377 1.00   60.32  ? 394  LEU B CG  1 
ATOM   7173 C CD1 . LEU B 1 394 ? 11.898  -8.359  -11.760 1.00   59.71  ? 394  LEU B CD1 1 
ATOM   7174 C CD2 . LEU B 1 394 ? 12.759  -6.158  -12.637 1.00   48.77  ? 394  LEU B CD2 1 
ATOM   7175 N N   . ARG B 1 395 ? 8.616   -6.574  -15.956 1.00   51.62  ? 395  ARG B N   1 
ATOM   7176 C CA  . ARG B 1 395 ? 8.162   -6.775  -17.321 1.00   52.82  ? 395  ARG B CA  1 
ATOM   7177 C C   . ARG B 1 395 ? 7.883   -5.422  -17.966 1.00   53.55  ? 395  ARG B C   1 
ATOM   7178 O O   . ARG B 1 395 ? 8.333   -5.145  -19.081 1.00   49.47  ? 395  ARG B O   1 
ATOM   7179 C CB  . ARG B 1 395 ? 6.932   -7.686  -17.349 1.00   53.04  ? 395  ARG B CB  1 
ATOM   7180 C CG  . ARG B 1 395 ? 6.150   -7.658  -18.648 1.00   55.62  ? 395  ARG B CG  1 
ATOM   7181 C CD  . ARG B 1 395 ? 4.838   -6.905  -18.470 1.00   54.50  ? 395  ARG B CD  1 
ATOM   7182 N NE  . ARG B 1 395 ? 3.758   -7.798  -18.087 1.00   53.48  ? 395  ARG B NE  1 
ATOM   7183 C CZ  . ARG B 1 395 ? 2.610   -7.406  -17.543 1.00   56.15  ? 395  ARG B CZ  1 
ATOM   7184 N NH1 . ARG B 1 395 ? 2.379   -6.122  -17.306 1.00   43.49  ? 395  ARG B NH1 1 
ATOM   7185 N NH2 . ARG B 1 395 ? 1.693   -8.313  -17.226 1.00   59.27  ? 395  ARG B NH2 1 
ATOM   7186 N N   . ASP B 1 396 ? 7.171   -4.566  -17.241 1.00   50.37  ? 396  ASP B N   1 
ATOM   7187 C CA  . ASP B 1 396 ? 6.864   -3.235  -17.735 1.00   41.98  ? 396  ASP B CA  1 
ATOM   7188 C C   . ASP B 1 396 ? 8.131   -2.405  -17.931 1.00   44.64  ? 396  ASP B C   1 
ATOM   7189 O O   . ASP B 1 396 ? 8.194   -1.577  -18.831 1.00   48.08  ? 396  ASP B O   1 
ATOM   7190 C CB  . ASP B 1 396 ? 5.880   -2.533  -16.804 1.00   45.60  ? 396  ASP B CB  1 
ATOM   7191 C CG  . ASP B 1 396 ? 4.510   -3.188  -16.806 1.00   54.83  ? 396  ASP B CG  1 
ATOM   7192 O OD1 . ASP B 1 396 ? 4.277   -4.082  -17.650 1.00   51.98  ? 396  ASP B OD1 1 
ATOM   7193 O OD2 . ASP B 1 396 ? 3.663   -2.811  -15.969 1.00   59.38  ? 396  ASP B OD2 1 
ATOM   7194 N N   . ALA B 1 397 ? 9.148   -2.648  -17.111 1.00   42.46  ? 397  ALA B N   1 
ATOM   7195 C CA  . ALA B 1 397 ? 10.403  -1.912  -17.223 1.00   47.90  ? 397  ALA B CA  1 
ATOM   7196 C C   . ALA B 1 397 ? 11.174  -2.327  -18.474 1.00   48.37  ? 397  ALA B C   1 
ATOM   7197 O O   . ALA B 1 397 ? 11.749  -1.484  -19.178 1.00   39.53  ? 397  ALA B O   1 
ATOM   7198 C CB  . ALA B 1 397 ? 11.260  -2.110  -15.981 1.00   42.95  ? 397  ALA B CB  1 
ATOM   7199 N N   . MET B 1 398 ? 11.185  -3.629  -18.744 1.00   47.30  ? 398  MET B N   1 
ATOM   7200 C CA  . MET B 1 398 ? 11.841  -4.146  -19.935 1.00   48.17  ? 398  MET B CA  1 
ATOM   7201 C C   . MET B 1 398 ? 11.230  -3.462  -21.167 1.00   41.21  ? 398  MET B C   1 
ATOM   7202 O O   . MET B 1 398 ? 11.946  -3.023  -22.057 1.00   41.60  ? 398  MET B O   1 
ATOM   7203 C CB  . MET B 1 398 ? 11.699  -5.671  -20.001 1.00   49.27  ? 398  MET B CB  1 
ATOM   7204 C CG  . MET B 1 398 ? 12.509  -6.367  -21.089 1.00   39.87  ? 398  MET B CG  1 
ATOM   7205 S SD  . MET B 1 398 ? 14.278  -6.049  -21.005 1.00   51.39  ? 398  MET B SD  1 
ATOM   7206 C CE  . MET B 1 398 ? 14.491  -4.881  -22.336 1.00   54.65  ? 398  MET B CE  1 
ATOM   7207 N N   . SER B 1 399 ? 9.906   -3.350  -21.186 1.00   39.03  ? 399  SER B N   1 
ATOM   7208 C CA  . SER B 1 399 ? 9.193   -2.684  -22.268 1.00   40.82  ? 399  SER B CA  1 
ATOM   7209 C C   . SER B 1 399 ? 9.600   -1.211  -22.354 1.00   47.17  ? 399  SER B C   1 
ATOM   7210 O O   . SER B 1 399 ? 9.808   -0.680  -23.448 1.00   43.62  ? 399  SER B O   1 
ATOM   7211 C CB  . SER B 1 399 ? 7.678   -2.797  -22.035 1.00   47.14  ? 399  SER B CB  1 
ATOM   7212 O OG  . SER B 1 399 ? 6.945   -1.924  -22.882 1.00   40.63  ? 399  SER B OG  1 
ATOM   7213 N N   . ALA B 1 400 ? 9.716   -0.560  -21.194 1.00   43.89  ? 400  ALA B N   1 
ATOM   7214 C CA  . ALA B 1 400 ? 10.091  0.857   -21.131 1.00   41.65  ? 400  ALA B CA  1 
ATOM   7215 C C   . ALA B 1 400 ? 11.529  1.106   -21.591 1.00   41.90  ? 400  ALA B C   1 
ATOM   7216 O O   . ALA B 1 400 ? 11.795  2.067   -22.315 1.00   40.08  ? 400  ALA B O   1 
ATOM   7217 C CB  . ALA B 1 400 ? 9.875   1.400   -19.741 1.00   38.09  ? 400  ALA B CB  1 
ATOM   7218 N N   . VAL B 1 401 ? 12.455  0.243   -21.178 1.00   39.46  ? 401  VAL B N   1 
ATOM   7219 C CA  . VAL B 1 401 ? 13.827  0.349   -21.654 1.00   40.41  ? 401  VAL B CA  1 
ATOM   7220 C C   . VAL B 1 401 ? 13.854  0.405   -23.183 1.00   45.33  ? 401  VAL B C   1 
ATOM   7221 O O   . VAL B 1 401 ? 14.369  1.360   -23.787 1.00   41.47  ? 401  VAL B O   1 
ATOM   7222 C CB  . VAL B 1 401 ? 14.706  -0.828  -21.171 1.00   43.41  ? 401  VAL B CB  1 
ATOM   7223 C CG1 . VAL B 1 401 ? 16.042  -0.830  -21.902 1.00   36.19  ? 401  VAL B CG1 1 
ATOM   7224 C CG2 . VAL B 1 401 ? 14.924  -0.745  -19.667 1.00   40.26  ? 401  VAL B CG2 1 
ATOM   7225 N N   . VAL B 1 402 ? 13.275  -0.618  -23.798 1.00   42.64  ? 402  VAL B N   1 
ATOM   7226 C CA  . VAL B 1 402 ? 13.322  -0.773  -25.242 1.00   40.91  ? 402  VAL B CA  1 
ATOM   7227 C C   . VAL B 1 402 ? 12.677  0.412   -25.962 1.00   44.03  ? 402  VAL B C   1 
ATOM   7228 O O   . VAL B 1 402 ? 13.266  0.974   -26.897 1.00   42.99  ? 402  VAL B O   1 
ATOM   7229 C CB  . VAL B 1 402 ? 12.669  -2.116  -25.676 1.00   48.62  ? 402  VAL B CB  1 
ATOM   7230 C CG1 . VAL B 1 402 ? 12.347  -2.114  -27.176 1.00   42.17  ? 402  VAL B CG1 1 
ATOM   7231 C CG2 . VAL B 1 402 ? 13.582  -3.285  -25.305 1.00   39.21  ? 402  VAL B CG2 1 
ATOM   7232 N N   . GLY B 1 403 ? 11.483  0.795   -25.513 1.00   35.91  ? 403  GLY B N   1 
ATOM   7233 C CA  . GLY B 1 403 ? 10.762  1.916   -26.090 1.00   38.17  ? 403  GLY B CA  1 
ATOM   7234 C C   . GLY B 1 403 ? 11.395  3.283   -25.866 1.00   40.44  ? 403  GLY B C   1 
ATOM   7235 O O   . GLY B 1 403 ? 11.375  4.143   -26.752 1.00   37.88  ? 403  GLY B O   1 
ATOM   7236 N N   . ASP B 1 404 ? 11.942  3.492   -24.673 1.00   39.54  ? 404  ASP B N   1 
ATOM   7237 C CA  . ASP B 1 404 ? 12.613  4.740   -24.349 1.00   41.86  ? 404  ASP B CA  1 
ATOM   7238 C C   . ASP B 1 404 ? 13.865  4.870   -25.197 1.00   36.54  ? 404  ASP B C   1 
ATOM   7239 O O   . ASP B 1 404 ? 14.085  5.876   -25.865 1.00   40.94  ? 404  ASP B O   1 
ATOM   7240 C CB  . ASP B 1 404 ? 12.997  4.765   -22.867 1.00   37.81  ? 404  ASP B CB  1 
ATOM   7241 C CG  . ASP B 1 404 ? 11.820  5.016   -21.964 1.00   41.22  ? 404  ASP B CG  1 
ATOM   7242 O OD1 . ASP B 1 404 ? 10.713  5.319   -22.473 1.00   47.19  ? 404  ASP B OD1 1 
ATOM   7243 O OD2 . ASP B 1 404 ? 12.002  4.918   -20.735 1.00   43.19  ? 404  ASP B OD2 1 
ATOM   7244 N N   . HIS B 1 405 ? 14.681  3.828   -25.157 1.00   39.75  ? 405  HIS B N   1 
ATOM   7245 C CA  . HIS B 1 405 ? 15.943  3.781   -25.886 1.00   41.89  ? 405  HIS B CA  1 
ATOM   7246 C C   . HIS B 1 405 ? 15.733  3.988   -27.398 1.00   40.95  ? 405  HIS B C   1 
ATOM   7247 O O   . HIS B 1 405 ? 16.474  4.719   -28.041 1.00   37.78  ? 405  HIS B O   1 
ATOM   7248 C CB  . HIS B 1 405 ? 16.621  2.434   -25.596 1.00   35.18  ? 405  HIS B CB  1 
ATOM   7249 C CG  . HIS B 1 405 ? 17.853  2.171   -26.403 1.00   41.57  ? 405  HIS B CG  1 
ATOM   7250 N ND1 . HIS B 1 405 ? 18.848  3.110   -26.581 1.00   42.56  ? 405  HIS B ND1 1 
ATOM   7251 C CD2 . HIS B 1 405 ? 18.266  1.057   -27.057 1.00   46.20  ? 405  HIS B CD2 1 
ATOM   7252 C CE1 . HIS B 1 405 ? 19.815  2.590   -27.318 1.00   41.04  ? 405  HIS B CE1 1 
ATOM   7253 N NE2 . HIS B 1 405 ? 19.489  1.345   -27.617 1.00   48.33  ? 405  HIS B NE2 1 
ATOM   7254 N N   . ASN B 1 406 ? 14.701  3.372   -27.957 1.00   36.59  ? 406  ASN B N   1 
ATOM   7255 C CA  . ASN B 1 406 ? 14.571  3.336   -29.409 1.00   40.20  ? 406  ASN B CA  1 
ATOM   7256 C C   . ASN B 1 406 ? 13.686  4.402   -30.020 1.00   39.34  ? 406  ASN B C   1 
ATOM   7257 O O   . ASN B 1 406 ? 13.926  4.828   -31.144 1.00   37.75  ? 406  ASN B O   1 
ATOM   7258 C CB  . ASN B 1 406 ? 14.150  1.935   -29.875 1.00   38.56  ? 406  ASN B CB  1 
ATOM   7259 C CG  . ASN B 1 406 ? 15.302  0.960   -29.824 1.00   39.54  ? 406  ASN B CG  1 
ATOM   7260 O OD1 . ASN B 1 406 ? 16.339  1.204   -30.427 1.00   36.39  ? 406  ASN B OD1 1 
ATOM   7261 N ND2 . ASN B 1 406 ? 15.150  -0.119  -29.062 1.00   40.68  ? 406  ASN B ND2 1 
ATOM   7262 N N   . VAL B 1 407 ? 12.682  4.848   -29.273 1.00   37.22  ? 407  VAL B N   1 
ATOM   7263 C CA  . VAL B 1 407 ? 11.717  5.802   -29.808 1.00   37.18  ? 407  VAL B CA  1 
ATOM   7264 C C   . VAL B 1 407 ? 11.559  7.073   -28.970 1.00   35.00  ? 407  VAL B C   1 
ATOM   7265 O O   . VAL B 1 407 ? 11.860  8.166   -29.441 1.00   38.83  ? 407  VAL B O   1 
ATOM   7266 C CB  . VAL B 1 407 ? 10.338  5.140   -29.999 1.00   42.24  ? 407  VAL B CB  1 
ATOM   7267 C CG1 . VAL B 1 407 ? 9.344   6.140   -30.567 1.00   41.01  ? 407  VAL B CG1 1 
ATOM   7268 C CG2 . VAL B 1 407 ? 10.467  3.925   -30.901 1.00   37.18  ? 407  VAL B CG2 1 
ATOM   7269 N N   . VAL B 1 408 ? 11.095  6.932   -27.732 1.00   33.48  ? 408  VAL B N   1 
ATOM   7270 C CA  . VAL B 1 408 ? 10.722  8.097   -26.926 1.00   39.70  ? 408  VAL B CA  1 
ATOM   7271 C C   . VAL B 1 408 ? 11.854  9.109   -26.750 1.00   37.42  ? 408  VAL B C   1 
ATOM   7272 O O   . VAL B 1 408 ? 11.695  10.295  -27.010 1.00   41.86  ? 408  VAL B O   1 
ATOM   7273 C CB  . VAL B 1 408 ? 10.195  7.701   -25.533 1.00   42.58  ? 408  VAL B CB  1 
ATOM   7274 C CG1 . VAL B 1 408 ? 9.718   8.940   -24.785 1.00   34.86  ? 408  VAL B CG1 1 
ATOM   7275 C CG2 . VAL B 1 408 ? 9.083   6.672   -25.654 1.00   32.60  ? 408  VAL B CG2 1 
ATOM   7276 N N   . CYS B 1 409 ? 13.004  8.650   -26.310 1.00   36.34  ? 409  CYS B N   1 
ATOM   7277 C CA  . CYS B 1 409 ? 14.080  9.584   -26.046 1.00   34.80  ? 409  CYS B CA  1 
ATOM   7278 C C   . CYS B 1 409 ? 14.701  10.156  -27.344 1.00   40.41  ? 409  CYS B C   1 
ATOM   7279 O O   . CYS B 1 409 ? 14.954  11.368  -27.438 1.00   42.80  ? 409  CYS B O   1 
ATOM   7280 C CB  . CYS B 1 409 ? 15.093  8.961   -25.074 1.00   35.44  ? 409  CYS B CB  1 
ATOM   7281 S SG  . CYS B 1 409 ? 14.364  8.680   -23.386 1.00   41.60  ? 409  CYS B SG  1 
ATOM   7282 N N   . PRO B 1 410 ? 14.925  9.304   -28.356 1.00   35.74  ? 410  PRO B N   1 
ATOM   7283 C CA  . PRO B 1 410 ? 15.310  9.837   -29.673 1.00   39.48  ? 410  PRO B CA  1 
ATOM   7284 C C   . PRO B 1 410 ? 14.318  10.886  -30.198 1.00   39.22  ? 410  PRO B C   1 
ATOM   7285 O O   . PRO B 1 410 ? 14.743  11.843  -30.846 1.00   38.37  ? 410  PRO B O   1 
ATOM   7286 C CB  . PRO B 1 410 ? 15.281  8.605   -30.578 1.00   38.97  ? 410  PRO B CB  1 
ATOM   7287 C CG  . PRO B 1 410 ? 15.505  7.463   -29.666 1.00   39.04  ? 410  PRO B CG  1 
ATOM   7288 C CD  . PRO B 1 410 ? 14.932  7.830   -28.328 1.00   37.44  ? 410  PRO B CD  1 
ATOM   7289 N N   . VAL B 1 411 ? 13.027  10.710  -29.917 1.00   34.60  ? 411  VAL B N   1 
ATOM   7290 C CA  . VAL B 1 411 ? 12.014  11.709  -30.283 1.00   35.92  ? 411  VAL B CA  1 
ATOM   7291 C C   . VAL B 1 411 ? 12.116  12.993  -29.437 1.00   39.03  ? 411  VAL B C   1 
ATOM   7292 O O   . VAL B 1 411 ? 12.016  14.102  -29.976 1.00   34.32  ? 411  VAL B O   1 
ATOM   7293 C CB  . VAL B 1 411 ? 10.560  11.146  -30.183 1.00   33.33  ? 411  VAL B CB  1 
ATOM   7294 C CG1 . VAL B 1 411 ? 9.556   12.273  -30.073 1.00   26.40  ? 411  VAL B CG1 1 
ATOM   7295 C CG2 . VAL B 1 411 ? 10.229  10.272  -31.375 1.00   34.21  ? 411  VAL B CG2 1 
ATOM   7296 N N   . ALA B 1 412 ? 12.287  12.842  -28.121 1.00   34.33  ? 412  ALA B N   1 
ATOM   7297 C CA  . ALA B 1 412 ? 12.406  13.995  -27.219 1.00   40.47  ? 412  ALA B CA  1 
ATOM   7298 C C   . ALA B 1 412 ? 13.580  14.843  -27.660 1.00   37.31  ? 412  ALA B C   1 
ATOM   7299 O O   . ALA B 1 412 ? 13.507  16.073  -27.704 1.00   40.67  ? 412  ALA B O   1 
ATOM   7300 C CB  . ALA B 1 412 ? 12.593  13.544  -25.758 1.00   37.02  ? 412  ALA B CB  1 
ATOM   7301 N N   . GLN B 1 413 ? 14.658  14.167  -28.023 1.00   38.30  ? 413  GLN B N   1 
ATOM   7302 C CA  . GLN B 1 413 ? 15.857  14.849  -28.494 1.00   43.05  ? 413  GLN B CA  1 
ATOM   7303 C C   . GLN B 1 413 ? 15.648  15.584  -29.824 1.00   40.41  ? 413  GLN B C   1 
ATOM   7304 O O   . GLN B 1 413 ? 15.988  16.760  -29.944 1.00   41.42  ? 413  GLN B O   1 
ATOM   7305 C CB  . GLN B 1 413 ? 16.996  13.853  -28.614 1.00   39.48  ? 413  GLN B CB  1 
ATOM   7306 C CG  . GLN B 1 413 ? 18.130  14.338  -29.437 1.00   46.83  ? 413  GLN B CG  1 
ATOM   7307 C CD  . GLN B 1 413 ? 19.341  13.449  -29.279 1.00   63.24  ? 413  GLN B CD  1 
ATOM   7308 O OE1 . GLN B 1 413 ? 20.019  13.475  -28.247 1.00   68.98  ? 413  GLN B OE1 1 
ATOM   7309 N NE2 . GLN B 1 413 ? 19.619  12.646  -30.298 1.00   59.31  ? 413  GLN B NE2 1 
ATOM   7310 N N   . LEU B 1 414 ? 15.088  14.893  -30.816 1.00   35.05  ? 414  LEU B N   1 
ATOM   7311 C CA  . LEU B 1 414 ? 14.746  15.535  -32.080 1.00   36.98  ? 414  LEU B CA  1 
ATOM   7312 C C   . LEU B 1 414 ? 13.851  16.765  -31.861 1.00   38.13  ? 414  LEU B C   1 
ATOM   7313 O O   . LEU B 1 414 ? 14.132  17.846  -32.369 1.00   40.19  ? 414  LEU B O   1 
ATOM   7314 C CB  . LEU B 1 414 ? 14.047  14.552  -33.021 1.00   34.90  ? 414  LEU B CB  1 
ATOM   7315 C CG  . LEU B 1 414 ? 13.566  15.158  -34.344 1.00   34.19  ? 414  LEU B CG  1 
ATOM   7316 C CD1 . LEU B 1 414 ? 14.754  15.586  -35.167 1.00   38.01  ? 414  LEU B CD1 1 
ATOM   7317 C CD2 . LEU B 1 414 ? 12.727  14.184  -35.123 1.00   38.94  ? 414  LEU B CD2 1 
ATOM   7318 N N   . ALA B 1 415 ? 12.772  16.582  -31.110 1.00   34.43  ? 415  ALA B N   1 
ATOM   7319 C CA  . ALA B 1 415 ? 11.835  17.660  -30.802 1.00   38.50  ? 415  ALA B CA  1 
ATOM   7320 C C   . ALA B 1 415 ? 12.573  18.873  -30.252 1.00   45.08  ? 415  ALA B C   1 
ATOM   7321 O O   . ALA B 1 415 ? 12.338  20.005  -30.680 1.00   45.08  ? 415  ALA B O   1 
ATOM   7322 C CB  . ALA B 1 415 ? 10.815  17.186  -29.793 1.00   33.60  ? 415  ALA B CB  1 
ATOM   7323 N N   . GLY B 1 416 ? 13.467  18.625  -29.298 1.00   39.60  ? 416  GLY B N   1 
ATOM   7324 C CA  . GLY B 1 416 ? 14.166  19.699  -28.625 1.00   42.88  ? 416  GLY B CA  1 
ATOM   7325 C C   . GLY B 1 416 ? 15.095  20.445  -29.556 1.00   48.45  ? 416  GLY B C   1 
ATOM   7326 O O   . GLY B 1 416 ? 15.108  21.677  -29.570 1.00   47.03  ? 416  GLY B O   1 
ATOM   7327 N N   . ARG B 1 417 ? 15.876  19.698  -30.332 1.00   44.02  ? 417  ARG B N   1 
ATOM   7328 C CA  . ARG B 1 417 ? 16.807  20.300  -31.271 1.00   45.21  ? 417  ARG B CA  1 
ATOM   7329 C C   . ARG B 1 417 ? 16.057  21.070  -32.355 1.00   45.31  ? 417  ARG B C   1 
ATOM   7330 O O   . ARG B 1 417 ? 16.484  22.144  -32.749 1.00   49.68  ? 417  ARG B O   1 
ATOM   7331 C CB  . ARG B 1 417 ? 17.734  19.246  -31.882 1.00   48.85  ? 417  ARG B CB  1 
ATOM   7332 C CG  . ARG B 1 417 ? 18.546  18.462  -30.863 1.00   46.29  ? 417  ARG B CG  1 
ATOM   7333 C CD  . ARG B 1 417 ? 19.899  19.094  -30.587 1.00   53.13  ? 417  ARG B CD  1 
ATOM   7334 N NE  . ARG B 1 417 ? 19.787  20.445  -30.046 1.00   71.59  ? 417  ARG B NE  1 
ATOM   7335 C CZ  . ARG B 1 417 ? 20.815  21.263  -29.814 1.00   79.39  ? 417  ARG B CZ  1 
ATOM   7336 N NH1 . ARG B 1 417 ? 22.067  20.879  -30.067 1.00   58.30  ? 417  ARG B NH1 1 
ATOM   7337 N NH2 . ARG B 1 417 ? 20.587  22.479  -29.321 1.00   79.84  ? 417  ARG B NH2 1 
ATOM   7338 N N   . LEU B 1 418 ? 14.932  20.533  -32.820 1.00   42.89  ? 418  LEU B N   1 
ATOM   7339 C CA  . LEU B 1 418 ? 14.123  21.219  -33.825 1.00   45.98  ? 418  LEU B CA  1 
ATOM   7340 C C   . LEU B 1 418 ? 13.526  22.527  -33.283 1.00   46.62  ? 418  LEU B C   1 
ATOM   7341 O O   . LEU B 1 418 ? 13.553  23.556  -33.954 1.00   49.75  ? 418  LEU B O   1 
ATOM   7342 C CB  . LEU B 1 418 ? 13.006  20.311  -34.357 1.00   42.85  ? 418  LEU B CB  1 
ATOM   7343 C CG  . LEU B 1 418 ? 13.327  19.138  -35.293 1.00   45.19  ? 418  LEU B CG  1 
ATOM   7344 C CD1 . LEU B 1 418 ? 12.038  18.538  -35.850 1.00   41.44  ? 418  LEU B CD1 1 
ATOM   7345 C CD2 . LEU B 1 418 ? 14.215  19.584  -36.419 1.00   46.58  ? 418  LEU B CD2 1 
ATOM   7346 N N   . ALA B 1 419 ? 12.987  22.490  -32.070 1.00   41.80  ? 419  ALA B N   1 
ATOM   7347 C CA  . ALA B 1 419 ? 12.405  23.688  -31.486 1.00   43.70  ? 419  ALA B CA  1 
ATOM   7348 C C   . ALA B 1 419 ? 13.472  24.759  -31.272 1.00   48.72  ? 419  ALA B C   1 
ATOM   7349 O O   . ALA B 1 419 ? 13.220  25.944  -31.462 1.00   55.40  ? 419  ALA B O   1 
ATOM   7350 C CB  . ALA B 1 419 ? 11.697  23.359  -30.175 1.00   44.06  ? 419  ALA B CB  1 
ATOM   7351 N N   . ALA B 1 420 ? 14.668  24.324  -30.890 1.00   50.36  ? 420  ALA B N   1 
ATOM   7352 C CA  . ALA B 1 420 ? 15.768  25.225  -30.567 1.00   50.02  ? 420  ALA B CA  1 
ATOM   7353 C C   . ALA B 1 420 ? 16.379  25.861  -31.820 1.00   58.23  ? 420  ALA B C   1 
ATOM   7354 O O   . ALA B 1 420 ? 16.737  27.036  -31.806 1.00   59.42  ? 420  ALA B O   1 
ATOM   7355 C CB  . ALA B 1 420 ? 16.834  24.480  -29.770 1.00   44.92  ? 420  ALA B CB  1 
ATOM   7356 N N   . GLN B 1 421 ? 16.496  25.077  -32.891 1.00   52.02  ? 421  GLN B N   1 
ATOM   7357 C CA  . GLN B 1 421 ? 17.000  25.546  -34.176 1.00   44.99  ? 421  GLN B CA  1 
ATOM   7358 C C   . GLN B 1 421 ? 15.916  26.224  -35.015 1.00   53.61  ? 421  GLN B C   1 
ATOM   7359 O O   . GLN B 1 421 ? 16.028  26.280  -36.244 1.00   51.26  ? 421  GLN B O   1 
ATOM   7360 C CB  . GLN B 1 421 ? 17.552  24.367  -34.986 1.00   59.19  ? 421  GLN B CB  1 
ATOM   7361 C CG  . GLN B 1 421 ? 19.057  24.107  -34.890 1.00   56.83  ? 421  GLN B CG  1 
ATOM   7362 C CD  . GLN B 1 421 ? 19.511  23.755  -33.498 1.00   63.42  ? 421  GLN B CD  1 
ATOM   7363 O OE1 . GLN B 1 421 ? 19.532  24.610  -32.621 1.00   71.22  ? 421  GLN B OE1 1 
ATOM   7364 N NE2 . GLN B 1 421 ? 19.894  22.495  -33.285 1.00   59.01  ? 421  GLN B NE2 1 
ATOM   7365 N N   . GLY B 1 422 ? 14.851  26.702  -34.374 1.00   51.50  ? 422  GLY B N   1 
ATOM   7366 C CA  . GLY B 1 422 ? 13.867  27.520  -35.068 1.00   53.10  ? 422  GLY B CA  1 
ATOM   7367 C C   . GLY B 1 422 ? 12.634  26.858  -35.669 1.00   57.61  ? 422  GLY B C   1 
ATOM   7368 O O   . GLY B 1 422 ? 11.755  27.550  -36.182 1.00   55.54  ? 422  GLY B O   1 
ATOM   7369 N N   . ALA B 1 423 ? 12.544  25.533  -35.620 1.00   51.14  ? 423  ALA B N   1 
ATOM   7370 C CA  . ALA B 1 423 ? 11.357  24.869  -36.168 1.00   54.04  ? 423  ALA B CA  1 
ATOM   7371 C C   . ALA B 1 423 ? 10.131  25.083  -35.292 1.00   49.39  ? 423  ALA B C   1 
ATOM   7372 O O   . ALA B 1 423 ? 10.242  25.308  -34.086 1.00   50.51  ? 423  ALA B O   1 
ATOM   7373 C CB  . ALA B 1 423 ? 11.601  23.377  -36.372 1.00   47.69  ? 423  ALA B CB  1 
ATOM   7374 N N   . ARG B 1 424 ? 8.963   25.021  -35.918 1.00   46.00  ? 424  ARG B N   1 
ATOM   7375 C CA  . ARG B 1 424 ? 7.694   24.995  -35.204 1.00   44.92  ? 424  ARG B CA  1 
ATOM   7376 C C   . ARG B 1 424 ? 7.321   23.540  -34.966 1.00   45.23  ? 424  ARG B C   1 
ATOM   7377 O O   . ARG B 1 424 ? 7.109   22.791  -35.911 1.00   43.05  ? 424  ARG B O   1 
ATOM   7378 C CB  . ARG B 1 424 ? 6.630   25.655  -36.061 1.00   52.34  ? 424  ARG B CB  1 
ATOM   7379 C CG  . ARG B 1 424 ? 5.232   25.643  -35.477 1.00   57.75  ? 424  ARG B CG  1 
ATOM   7380 C CD  . ARG B 1 424 ? 4.300   26.494  -36.358 1.00   62.29  ? 424  ARG B CD  1 
ATOM   7381 N NE  . ARG B 1 424 ? 3.381   27.285  -35.551 1.00   69.66  ? 424  ARG B NE  1 
ATOM   7382 C CZ  . ARG B 1 424 ? 3.771   28.137  -34.609 1.00   55.82  ? 424  ARG B CZ  1 
ATOM   7383 N NH1 . ARG B 1 424 ? 5.060   28.314  -34.343 1.00   57.56  ? 424  ARG B NH1 1 
ATOM   7384 N NH2 . ARG B 1 424 ? 2.868   28.806  -33.930 1.00   50.68  ? 424  ARG B NH2 1 
ATOM   7385 N N   . VAL B 1 425 ? 7.239   23.145  -33.705 1.00   45.05  ? 425  VAL B N   1 
ATOM   7386 C CA  . VAL B 1 425 ? 7.116   21.739  -33.346 1.00   39.24  ? 425  VAL B CA  1 
ATOM   7387 C C   . VAL B 1 425 ? 5.858   21.458  -32.528 1.00   38.81  ? 425  VAL B C   1 
ATOM   7388 O O   . VAL B 1 425 ? 5.553   22.187  -31.602 1.00   40.35  ? 425  VAL B O   1 
ATOM   7389 C CB  . VAL B 1 425 ? 8.335   21.306  -32.516 1.00   37.08  ? 425  VAL B CB  1 
ATOM   7390 C CG1 . VAL B 1 425 ? 8.262   19.821  -32.178 1.00   37.26  ? 425  VAL B CG1 1 
ATOM   7391 C CG2 . VAL B 1 425 ? 9.626   21.645  -33.266 1.00   36.89  ? 425  VAL B CG2 1 
ATOM   7392 N N   . TYR B 1 426 ? 5.138   20.394  -32.870 1.00   40.89  ? 426  TYR B N   1 
ATOM   7393 C CA  . TYR B 1 426 ? 4.025   19.919  -32.054 1.00   37.63  ? 426  TYR B CA  1 
ATOM   7394 C C   . TYR B 1 426 ? 4.248   18.469  -31.647 1.00   42.34  ? 426  TYR B C   1 
ATOM   7395 O O   . TYR B 1 426 ? 4.585   17.628  -32.481 1.00   45.88  ? 426  TYR B O   1 
ATOM   7396 C CB  . TYR B 1 426 ? 2.699   20.047  -32.800 1.00   37.84  ? 426  TYR B CB  1 
ATOM   7397 C CG  . TYR B 1 426 ? 2.272   21.470  -33.056 1.00   37.08  ? 426  TYR B CG  1 
ATOM   7398 C CD1 . TYR B 1 426 ? 2.697   22.136  -34.197 1.00   33.83  ? 426  TYR B CD1 1 
ATOM   7399 C CD2 . TYR B 1 426 ? 1.446   22.154  -32.152 1.00   38.24  ? 426  TYR B CD2 1 
ATOM   7400 C CE1 . TYR B 1 426 ? 2.320   23.438  -34.448 1.00   38.80  ? 426  TYR B CE1 1 
ATOM   7401 C CE2 . TYR B 1 426 ? 1.062   23.466  -32.393 1.00   41.13  ? 426  TYR B CE2 1 
ATOM   7402 C CZ  . TYR B 1 426 ? 1.507   24.103  -33.550 1.00   42.38  ? 426  TYR B CZ  1 
ATOM   7403 O OH  . TYR B 1 426 ? 1.142   25.397  -33.829 1.00   42.36  ? 426  TYR B OH  1 
ATOM   7404 N N   . ALA B 1 427 ? 4.052   18.169  -30.370 1.00   39.74  ? 427  ALA B N   1 
ATOM   7405 C CA  . ALA B 1 427 ? 4.314   16.824  -29.879 1.00   39.17  ? 427  ALA B CA  1 
ATOM   7406 C C   . ALA B 1 427 ? 3.098   16.230  -29.202 1.00   40.35  ? 427  ALA B C   1 
ATOM   7407 O O   . ALA B 1 427 ? 2.264   16.947  -28.652 1.00   40.80  ? 427  ALA B O   1 
ATOM   7408 C CB  . ALA B 1 427 ? 5.502   16.820  -28.929 1.00   36.54  ? 427  ALA B CB  1 
ATOM   7409 N N   . TYR B 1 428 ? 3.015   14.906  -29.238 1.00   35.63  ? 428  TYR B N   1 
ATOM   7410 C CA  . TYR B 1 428 ? 1.912   14.197  -28.626 1.00   35.51  ? 428  TYR B CA  1 
ATOM   7411 C C   . TYR B 1 428 ? 2.379   12.860  -28.069 1.00   38.30  ? 428  TYR B C   1 
ATOM   7412 O O   . TYR B 1 428 ? 3.471   12.373  -28.375 1.00   35.91  ? 428  TYR B O   1 
ATOM   7413 C CB  . TYR B 1 428 ? 0.800   13.939  -29.654 1.00   37.39  ? 428  TYR B CB  1 
ATOM   7414 C CG  . TYR B 1 428 ? 1.206   12.940  -30.728 1.00   39.38  ? 428  TYR B CG  1 
ATOM   7415 C CD1 . TYR B 1 428 ? 1.271   11.575  -30.459 1.00   37.04  ? 428  TYR B CD1 1 
ATOM   7416 C CD2 . TYR B 1 428 ? 1.543   13.368  -31.998 1.00   37.69  ? 428  TYR B CD2 1 
ATOM   7417 C CE1 . TYR B 1 428 ? 1.656   10.671  -31.437 1.00   40.66  ? 428  TYR B CE1 1 
ATOM   7418 C CE2 . TYR B 1 428 ? 1.921   12.482  -32.979 1.00   35.06  ? 428  TYR B CE2 1 
ATOM   7419 C CZ  . TYR B 1 428 ? 1.976   11.137  -32.702 1.00   41.92  ? 428  TYR B CZ  1 
ATOM   7420 O OH  . TYR B 1 428 ? 2.366   10.269  -33.701 1.00   43.10  ? 428  TYR B OH  1 
ATOM   7421 N N   . ILE B 1 429 ? 1.524   12.276  -27.247 1.00   37.30  ? 429  ILE B N   1 
ATOM   7422 C CA  . ILE B 1 429 ? 1.627   10.877  -26.897 1.00   37.12  ? 429  ILE B CA  1 
ATOM   7423 C C   . ILE B 1 429 ? 0.238   10.290  -27.111 1.00   39.35  ? 429  ILE B C   1 
ATOM   7424 O O   . ILE B 1 429 ? -0.770  10.860  -26.685 1.00   41.02  ? 429  ILE B O   1 
ATOM   7425 C CB  . ILE B 1 429 ? 2.083   10.681  -25.455 1.00   40.36  ? 429  ILE B CB  1 
ATOM   7426 C CG1 . ILE B 1 429 ? 2.269   9.197   -25.162 1.00   43.06  ? 429  ILE B CG1 1 
ATOM   7427 C CG2 . ILE B 1 429 ? 1.088   11.310  -24.474 1.00   39.23  ? 429  ILE B CG2 1 
ATOM   7428 C CD1 . ILE B 1 429 ? 2.757   8.928   -23.747 1.00   42.06  ? 429  ILE B CD1 1 
ATOM   7429 N N   . PHE B 1 430 ? 0.186   9.173   -27.816 1.00   38.17  ? 430  PHE B N   1 
ATOM   7430 C CA  . PHE B 1 430 ? -1.072  8.549   -28.166 1.00   39.33  ? 430  PHE B CA  1 
ATOM   7431 C C   . PHE B 1 430 ? -1.343  7.435   -27.152 1.00   41.92  ? 430  PHE B C   1 
ATOM   7432 O O   . PHE B 1 430 ? -0.507  6.554   -26.952 1.00   38.52  ? 430  PHE B O   1 
ATOM   7433 C CB  . PHE B 1 430 ? -0.954  8.004   -29.578 1.00   37.68  ? 430  PHE B CB  1 
ATOM   7434 C CG  . PHE B 1 430 ? -2.172  7.301   -30.066 1.00   39.31  ? 430  PHE B CG  1 
ATOM   7435 C CD1 . PHE B 1 430 ? -2.362  5.955   -29.792 1.00   38.93  ? 430  PHE B CD1 1 
ATOM   7436 C CD2 . PHE B 1 430 ? -3.114  7.975   -30.838 1.00   37.18  ? 430  PHE B CD2 1 
ATOM   7437 C CE1 . PHE B 1 430 ? -3.495  5.284   -30.266 1.00   43.92  ? 430  PHE B CE1 1 
ATOM   7438 C CE2 . PHE B 1 430 ? -4.235  7.322   -31.315 1.00   42.34  ? 430  PHE B CE2 1 
ATOM   7439 C CZ  . PHE B 1 430 ? -4.427  5.965   -31.028 1.00   41.13  ? 430  PHE B CZ  1 
ATOM   7440 N N   . GLU B 1 431 ? -2.501  7.477   -26.502 1.00   37.02  ? 431  GLU B N   1 
ATOM   7441 C CA  . GLU B 1 431 ? -2.719  6.621   -25.332 1.00   43.91  ? 431  GLU B CA  1 
ATOM   7442 C C   . GLU B 1 431 ? -3.933  5.707   -25.394 1.00   46.66  ? 431  GLU B C   1 
ATOM   7443 O O   . GLU B 1 431 ? -4.202  4.988   -24.435 1.00   48.72  ? 431  GLU B O   1 
ATOM   7444 C CB  . GLU B 1 431 ? -2.813  7.462   -24.063 1.00   44.25  ? 431  GLU B CB  1 
ATOM   7445 C CG  . GLU B 1 431 ? -1.502  8.060   -23.605 1.00   46.97  ? 431  GLU B CG  1 
ATOM   7446 C CD  . GLU B 1 431 ? -1.647  8.812   -22.298 1.00   47.03  ? 431  GLU B CD  1 
ATOM   7447 O OE1 . GLU B 1 431 ? -2.750  9.327   -22.026 1.00   51.35  ? 431  GLU B OE1 1 
ATOM   7448 O OE2 . GLU B 1 431 ? -0.661  8.887   -21.544 1.00   50.23  ? 431  GLU B OE2 1 
ATOM   7449 N N   . HIS B 1 432 ? -4.665  5.727   -26.504 1.00   46.48  ? 432  HIS B N   1 
ATOM   7450 C CA  . HIS B 1 432 ? -5.835  4.863   -26.630 1.00   47.81  ? 432  HIS B CA  1 
ATOM   7451 C C   . HIS B 1 432 ? -5.504  3.489   -27.218 1.00   46.39  ? 432  HIS B C   1 
ATOM   7452 O O   . HIS B 1 432 ? -4.996  3.400   -28.327 1.00   45.78  ? 432  HIS B O   1 
ATOM   7453 C CB  . HIS B 1 432 ? -6.910  5.527   -27.471 1.00   44.84  ? 432  HIS B CB  1 
ATOM   7454 C CG  . HIS B 1 432 ? -8.103  4.656   -27.695 1.00   58.60  ? 432  HIS B CG  1 
ATOM   7455 N ND1 . HIS B 1 432 ? -8.973  4.317   -26.681 1.00   58.87  ? 432  HIS B ND1 1 
ATOM   7456 C CD2 . HIS B 1 432 ? -8.563  4.040   -28.810 1.00   52.90  ? 432  HIS B CD2 1 
ATOM   7457 C CE1 . HIS B 1 432 ? -9.924  3.537   -27.165 1.00   57.61  ? 432  HIS B CE1 1 
ATOM   7458 N NE2 . HIS B 1 432 ? -9.697  3.353   -28.453 1.00   58.00  ? 432  HIS B NE2 1 
ATOM   7459 N N   . ARG B 1 433 ? -5.791  2.425   -26.468 1.00   49.24  ? 433  ARG B N   1 
ATOM   7460 C CA  . ARG B 1 433 ? -5.639  1.054   -26.967 1.00   51.55  ? 433  ARG B CA  1 
ATOM   7461 C C   . ARG B 1 433 ? -6.903  0.612   -27.710 1.00   50.70  ? 433  ARG B C   1 
ATOM   7462 O O   . ARG B 1 433 ? -7.986  0.573   -27.129 1.00   50.27  ? 433  ARG B O   1 
ATOM   7463 C CB  . ARG B 1 433 ? -5.349  0.083   -25.818 1.00   49.19  ? 433  ARG B CB  1 
ATOM   7464 C CG  . ARG B 1 433 ? -5.331  -1.393  -26.226 1.00   54.14  ? 433  ARG B CG  1 
ATOM   7465 C CD  . ARG B 1 433 ? -5.266  -2.299  -25.000 1.00   53.37  ? 433  ARG B CD  1 
ATOM   7466 N NE  . ARG B 1 433 ? -5.561  -3.703  -25.284 1.00   48.17  ? 433  ARG B NE  1 
ATOM   7467 C CZ  . ARG B 1 433 ? -4.637  -4.640  -25.485 1.00   50.95  ? 433  ARG B CZ  1 
ATOM   7468 N NH1 . ARG B 1 433 ? -3.350  -4.330  -25.449 1.00   51.55  ? 433  ARG B NH1 1 
ATOM   7469 N NH2 . ARG B 1 433 ? -4.999  -5.889  -25.726 1.00   51.42  ? 433  ARG B NH2 1 
ATOM   7470 N N   . ALA B 1 434 ? -6.761  0.296   -28.994 1.00   49.35  ? 434  ALA B N   1 
ATOM   7471 C CA  . ALA B 1 434 ? -7.897  -0.105  -29.826 1.00   55.88  ? 434  ALA B CA  1 
ATOM   7472 C C   . ALA B 1 434 ? -8.702  -1.230  -29.185 1.00   50.70  ? 434  ALA B C   1 
ATOM   7473 O O   . ALA B 1 434 ? -8.140  -2.215  -28.695 1.00   46.95  ? 434  ALA B O   1 
ATOM   7474 C CB  . ALA B 1 434 ? -7.423  -0.523  -31.217 1.00   51.71  ? 434  ALA B CB  1 
ATOM   7475 N N   . SER B 1 435 ? -10.021 -1.070  -29.192 1.00   54.98  ? 435  SER B N   1 
ATOM   7476 C CA  . SER B 1 435 ? -10.931 -2.083  -28.670 1.00   54.22  ? 435  SER B CA  1 
ATOM   7477 C C   . SER B 1 435 ? -10.742 -3.389  -29.434 1.00   53.62  ? 435  SER B C   1 
ATOM   7478 O O   . SER B 1 435 ? -10.812 -4.477  -28.856 1.00   53.17  ? 435  SER B O   1 
ATOM   7479 C CB  . SER B 1 435 ? -12.383 -1.608  -28.775 1.00   48.63  ? 435  SER B CB  1 
ATOM   7480 O OG  . SER B 1 435 ? -12.779 -1.493  -30.131 1.00   60.57  ? 435  SER B OG  1 
ATOM   7481 N N   . THR B 1 436 ? -10.461 -3.267  -30.729 1.00   56.53  ? 436  THR B N   1 
ATOM   7482 C CA  . THR B 1 436 ? -10.295 -4.426  -31.605 1.00   57.12  ? 436  THR B CA  1 
ATOM   7483 C C   . THR B 1 436 ? -8.917  -5.081  -31.576 1.00   54.77  ? 436  THR B C   1 
ATOM   7484 O O   . THR B 1 436 ? -8.655  -5.974  -32.379 1.00   57.44  ? 436  THR B O   1 
ATOM   7485 C CB  . THR B 1 436 ? -10.588 -4.051  -33.062 1.00   56.87  ? 436  THR B CB  1 
ATOM   7486 O OG1 . THR B 1 436 ? -9.679  -3.023  -33.485 1.00   63.11  ? 436  THR B OG1 1 
ATOM   7487 C CG2 . THR B 1 436 ? -12.021 -3.552  -33.204 1.00   62.43  ? 436  THR B CG2 1 
ATOM   7488 N N   . LEU B 1 437 ? -8.041  -4.654  -30.667 1.00   53.07  ? 437  LEU B N   1 
ATOM   7489 C CA  . LEU B 1 437 ? -6.650  -5.134  -30.674 1.00   55.52  ? 437  LEU B CA  1 
ATOM   7490 C C   . LEU B 1 437 ? -6.548  -6.619  -30.349 1.00   58.46  ? 437  LEU B C   1 
ATOM   7491 O O   . LEU B 1 437 ? -7.266  -7.122  -29.490 1.00   62.38  ? 437  LEU B O   1 
ATOM   7492 C CB  . LEU B 1 437 ? -5.771  -4.329  -29.707 1.00   57.82  ? 437  LEU B CB  1 
ATOM   7493 C CG  . LEU B 1 437 ? -4.259  -4.409  -29.969 1.00   60.01  ? 437  LEU B CG  1 
ATOM   7494 C CD1 . LEU B 1 437 ? -3.937  -3.903  -31.364 1.00   54.10  ? 437  LEU B CD1 1 
ATOM   7495 C CD2 . LEU B 1 437 ? -3.452  -3.638  -28.932 1.00   56.40  ? 437  LEU B CD2 1 
ATOM   7496 N N   . THR B 1 438 ? -5.632  -7.310  -31.019 1.00   59.44  ? 438  THR B N   1 
ATOM   7497 C CA  . THR B 1 438 ? -5.504  -8.756  -30.877 1.00   54.64  ? 438  THR B CA  1 
ATOM   7498 C C   . THR B 1 438 ? -4.290  -9.166  -30.045 1.00   55.16  ? 438  THR B C   1 
ATOM   7499 O O   . THR B 1 438 ? -4.151  -10.334 -29.685 1.00   55.44  ? 438  THR B O   1 
ATOM   7500 C CB  . THR B 1 438 ? -5.438  -9.442  -32.263 1.00   61.91  ? 438  THR B CB  1 
ATOM   7501 O OG1 . THR B 1 438 ? -4.177  -9.162  -32.884 1.00   62.04  ? 438  THR B OG1 1 
ATOM   7502 C CG2 . THR B 1 438 ? -6.553  -8.922  -33.166 1.00   56.80  ? 438  THR B CG2 1 
ATOM   7503 N N   . TRP B 1 439 ? -3.401  -8.216  -29.758 1.00   55.32  ? 439  TRP B N   1 
ATOM   7504 C CA  . TRP B 1 439 ? -2.264  -8.472  -28.868 1.00   52.98  ? 439  TRP B CA  1 
ATOM   7505 C C   . TRP B 1 439 ? -2.752  -8.429  -27.419 1.00   48.44  ? 439  TRP B C   1 
ATOM   7506 O O   . TRP B 1 439 ? -3.755  -7.787  -27.127 1.00   54.33  ? 439  TRP B O   1 
ATOM   7507 C CB  . TRP B 1 439 ? -1.162  -7.430  -29.068 1.00   52.66  ? 439  TRP B CB  1 
ATOM   7508 C CG  . TRP B 1 439 ? -0.482  -7.457  -30.417 1.00   53.88  ? 439  TRP B CG  1 
ATOM   7509 C CD1 . TRP B 1 439 ? -0.793  -6.695  -31.512 1.00   48.36  ? 439  TRP B CD1 1 
ATOM   7510 C CD2 . TRP B 1 439 ? 0.639   -8.265  -30.800 1.00   47.97  ? 439  TRP B CD2 1 
ATOM   7511 N NE1 . TRP B 1 439 ? 0.053   -6.993  -32.551 1.00   48.80  ? 439  TRP B NE1 1 
ATOM   7512 C CE2 . TRP B 1 439 ? 0.942   -7.951  -32.141 1.00   48.01  ? 439  TRP B CE2 1 
ATOM   7513 C CE3 . TRP B 1 439 ? 1.404   -9.235  -30.143 1.00   49.31  ? 439  TRP B CE3 1 
ATOM   7514 C CZ2 . TRP B 1 439 ? 1.980   -8.570  -32.837 1.00   45.43  ? 439  TRP B CZ2 1 
ATOM   7515 C CZ3 . TRP B 1 439 ? 2.443   -9.837  -30.829 1.00   49.40  ? 439  TRP B CZ3 1 
ATOM   7516 C CH2 . TRP B 1 439 ? 2.721   -9.500  -32.168 1.00   45.72  ? 439  TRP B CH2 1 
ATOM   7517 N N   . PRO B 1 440 ? -2.050  -9.113  -26.506 1.00   48.13  ? 440  PRO B N   1 
ATOM   7518 C CA  . PRO B 1 440 ? -2.501  -9.179  -25.108 1.00   53.57  ? 440  PRO B CA  1 
ATOM   7519 C C   . PRO B 1 440 ? -2.526  -7.811  -24.403 1.00   55.40  ? 440  PRO B C   1 
ATOM   7520 O O   . PRO B 1 440 ? -1.933  -6.828  -24.871 1.00   53.11  ? 440  PRO B O   1 
ATOM   7521 C CB  . PRO B 1 440 ? -1.460  -10.097 -24.456 1.00   46.04  ? 440  PRO B CB  1 
ATOM   7522 C CG  . PRO B 1 440 ? -0.246  -9.926  -25.317 1.00   53.49  ? 440  PRO B CG  1 
ATOM   7523 C CD  . PRO B 1 440 ? -0.811  -9.879  -26.708 1.00   53.02  ? 440  PRO B CD  1 
ATOM   7524 N N   . LEU B 1 441 ? -3.209  -7.757  -23.268 1.00   47.67  ? 441  LEU B N   1 
ATOM   7525 C CA  . LEU B 1 441 ? -3.338  -6.513  -22.529 1.00   52.41  ? 441  LEU B CA  1 
ATOM   7526 C C   . LEU B 1 441 ? -2.003  -5.965  -22.026 1.00   51.75  ? 441  LEU B C   1 
ATOM   7527 O O   . LEU B 1 441 ? -1.806  -4.750  -21.975 1.00   50.48  ? 441  LEU B O   1 
ATOM   7528 C CB  . LEU B 1 441 ? -4.299  -6.691  -21.356 1.00   56.62  ? 441  LEU B CB  1 
ATOM   7529 C CG  . LEU B 1 441 ? -5.767  -6.849  -21.749 1.00   62.62  ? 441  LEU B CG  1 
ATOM   7530 C CD1 . LEU B 1 441 ? -6.580  -7.324  -20.560 1.00   61.98  ? 441  LEU B CD1 1 
ATOM   7531 C CD2 . LEU B 1 441 ? -6.313  -5.536  -22.291 1.00   56.95  ? 441  LEU B CD2 1 
ATOM   7532 N N   . TRP B 1 442 ? -1.088  -6.851  -21.654 1.00   48.76  ? 442  TRP B N   1 
ATOM   7533 C CA  . TRP B 1 442 ? 0.159   -6.405  -21.046 1.00   48.69  ? 442  TRP B CA  1 
ATOM   7534 C C   . TRP B 1 442 ? 1.019   -5.545  -21.968 1.00   49.01  ? 442  TRP B C   1 
ATOM   7535 O O   . TRP B 1 442 ? 1.884   -4.820  -21.485 1.00   47.31  ? 442  TRP B O   1 
ATOM   7536 C CB  . TRP B 1 442 ? 0.977   -7.574  -20.485 1.00   49.08  ? 442  TRP B CB  1 
ATOM   7537 C CG  . TRP B 1 442 ? 1.656   -8.438  -21.512 1.00   50.32  ? 442  TRP B CG  1 
ATOM   7538 C CD1 . TRP B 1 442 ? 1.234   -9.652  -21.960 1.00   53.82  ? 442  TRP B CD1 1 
ATOM   7539 C CD2 . TRP B 1 442 ? 2.886   -8.162  -22.200 1.00   54.36  ? 442  TRP B CD2 1 
ATOM   7540 N NE1 . TRP B 1 442 ? 2.116   -10.148 -22.886 1.00   51.27  ? 442  TRP B NE1 1 
ATOM   7541 C CE2 . TRP B 1 442 ? 3.138   -9.253  -23.053 1.00   48.96  ? 442  TRP B CE2 1 
ATOM   7542 C CE3 . TRP B 1 442 ? 3.794   -7.095  -22.181 1.00   49.81  ? 442  TRP B CE3 1 
ATOM   7543 C CZ2 . TRP B 1 442 ? 4.262   -9.315  -23.877 1.00   48.50  ? 442  TRP B CZ2 1 
ATOM   7544 C CZ3 . TRP B 1 442 ? 4.908   -7.157  -22.998 1.00   47.42  ? 442  TRP B CZ3 1 
ATOM   7545 C CH2 . TRP B 1 442 ? 5.133   -8.260  -23.837 1.00   47.91  ? 442  TRP B CH2 1 
ATOM   7546 N N   . MET B 1 443 ? 0.790   -5.623  -23.278 1.00   46.14  ? 443  MET B N   1 
ATOM   7547 C CA  . MET B 1 443 ? 1.565   -4.828  -24.232 1.00   41.91  ? 443  MET B CA  1 
ATOM   7548 C C   . MET B 1 443 ? 1.016   -3.409  -24.347 1.00   43.10  ? 443  MET B C   1 
ATOM   7549 O O   . MET B 1 443 ? 1.631   -2.544  -24.968 1.00   44.89  ? 443  MET B O   1 
ATOM   7550 C CB  . MET B 1 443 ? 1.600   -5.493  -25.610 1.00   39.20  ? 443  MET B CB  1 
ATOM   7551 C CG  . MET B 1 443 ? 2.171   -6.899  -25.602 1.00   53.47  ? 443  MET B CG  1 
ATOM   7552 S SD  . MET B 1 443 ? 2.185   -7.628  -27.252 1.00   54.51  ? 443  MET B SD  1 
ATOM   7553 C CE  . MET B 1 443 ? 3.889   -7.436  -27.730 1.00   55.22  ? 443  MET B CE  1 
ATOM   7554 N N   . GLY B 1 444 ? -0.157  -3.192  -23.764 1.00   41.81  ? 444  GLY B N   1 
ATOM   7555 C CA  . GLY B 1 444 ? -0.766  -1.875  -23.687 1.00   47.01  ? 444  GLY B CA  1 
ATOM   7556 C C   . GLY B 1 444 ? -1.211  -1.282  -25.014 1.00   50.33  ? 444  GLY B C   1 
ATOM   7557 O O   . GLY B 1 444 ? -2.071  -1.834  -25.705 1.00   49.08  ? 444  GLY B O   1 
ATOM   7558 N N   . VAL B 1 445 ? -0.648  -0.123  -25.339 1.00   45.87  ? 445  VAL B N   1 
ATOM   7559 C CA  . VAL B 1 445 ? -0.859  0.526   -26.622 1.00   44.27  ? 445  VAL B CA  1 
ATOM   7560 C C   . VAL B 1 445 ? 0.424   0.359   -27.400 1.00   45.58  ? 445  VAL B C   1 
ATOM   7561 O O   . VAL B 1 445 ? 1.355   1.133   -27.219 1.00   46.52  ? 445  VAL B O   1 
ATOM   7562 C CB  . VAL B 1 445 ? -1.115  2.020   -26.450 1.00   44.02  ? 445  VAL B CB  1 
ATOM   7563 C CG1 . VAL B 1 445 ? -1.597  2.634   -27.777 1.00   40.21  ? 445  VAL B CG1 1 
ATOM   7564 C CG2 . VAL B 1 445 ? -2.113  2.253   -25.331 1.00   37.30  ? 445  VAL B CG2 1 
ATOM   7565 N N   . PRO B 1 446 ? 0.495   -0.680  -28.247 1.00   49.25  ? 446  PRO B N   1 
ATOM   7566 C CA  . PRO B 1 446 ? 1.792   -1.035  -28.836 1.00   45.25  ? 446  PRO B CA  1 
ATOM   7567 C C   . PRO B 1 446 ? 2.166   -0.169  -30.018 1.00   40.70  ? 446  PRO B C   1 
ATOM   7568 O O   . PRO B 1 446 ? 1.330   0.523   -30.604 1.00   35.47  ? 446  PRO B O   1 
ATOM   7569 C CB  . PRO B 1 446 ? 1.597   -2.494  -29.292 1.00   47.83  ? 446  PRO B CB  1 
ATOM   7570 C CG  . PRO B 1 446 ? 0.291   -2.952  -28.646 1.00   45.61  ? 446  PRO B CG  1 
ATOM   7571 C CD  . PRO B 1 446 ? -0.529  -1.698  -28.525 1.00   43.19  ? 446  PRO B CD  1 
ATOM   7572 N N   . HIS B 1 447 ? 3.449   -0.220  -30.341 1.00   43.80  ? 447  HIS B N   1 
ATOM   7573 C CA  . HIS B 1 447 ? 4.012   0.450   -31.498 1.00   43.36  ? 447  HIS B CA  1 
ATOM   7574 C C   . HIS B 1 447 ? 3.205   0.141   -32.763 1.00   47.96  ? 447  HIS B C   1 
ATOM   7575 O O   . HIS B 1 447 ? 2.990   -1.018  -33.108 1.00   49.26  ? 447  HIS B O   1 
ATOM   7576 C CB  . HIS B 1 447 ? 5.452   -0.018  -31.647 1.00   38.44  ? 447  HIS B CB  1 
ATOM   7577 C CG  . HIS B 1 447 ? 6.170   0.561   -32.818 1.00   44.94  ? 447  HIS B CG  1 
ATOM   7578 N ND1 . HIS B 1 447 ? 6.651   1.851   -32.831 1.00   44.16  ? 447  HIS B ND1 1 
ATOM   7579 C CD2 . HIS B 1 447 ? 6.530   0.010   -34.003 1.00   46.90  ? 447  HIS B CD2 1 
ATOM   7580 C CE1 . HIS B 1 447 ? 7.261   2.077   -33.981 1.00   45.94  ? 447  HIS B CE1 1 
ATOM   7581 N NE2 . HIS B 1 447 ? 7.200   0.976   -34.710 1.00   45.80  ? 447  HIS B NE2 1 
ATOM   7582 N N   . GLY B 1 448 ? 2.739   1.184   -33.440 1.00   48.85  ? 448  GLY B N   1 
ATOM   7583 C CA  . GLY B 1 448 ? 2.072   1.011   -34.715 1.00   45.37  ? 448  GLY B CA  1 
ATOM   7584 C C   . GLY B 1 448 ? 0.564   1.100   -34.654 1.00   42.87  ? 448  GLY B C   1 
ATOM   7585 O O   . GLY B 1 448 ? -0.085  1.193   -35.694 1.00   47.64  ? 448  GLY B O   1 
ATOM   7586 N N   . TYR B 1 449 ? -0.004  1.100   -33.453 1.00   42.17  ? 449  TYR B N   1 
ATOM   7587 C CA  . TYR B 1 449 ? -1.468  1.033   -33.321 1.00   41.81  ? 449  TYR B CA  1 
ATOM   7588 C C   . TYR B 1 449 ? -2.215  2.367   -33.171 1.00   40.56  ? 449  TYR B C   1 
ATOM   7589 O O   . TYR B 1 449 ? -3.388  2.396   -32.794 1.00   41.30  ? 449  TYR B O   1 
ATOM   7590 C CB  . TYR B 1 449 ? -1.883  -0.031  -32.290 1.00   35.35  ? 449  TYR B CB  1 
ATOM   7591 C CG  . TYR B 1 449 ? -1.535  -1.375  -32.847 1.00   42.76  ? 449  TYR B CG  1 
ATOM   7592 C CD1 . TYR B 1 449 ? -2.426  -2.044  -33.665 1.00   44.64  ? 449  TYR B CD1 1 
ATOM   7593 C CD2 . TYR B 1 449 ? -0.282  -1.934  -32.646 1.00   42.62  ? 449  TYR B CD2 1 
ATOM   7594 C CE1 . TYR B 1 449 ? -2.109  -3.244  -34.223 1.00   46.68  ? 449  TYR B CE1 1 
ATOM   7595 C CE2 . TYR B 1 449 ? 0.048   -3.147  -33.213 1.00   44.65  ? 449  TYR B CE2 1 
ATOM   7596 C CZ  . TYR B 1 449 ? -0.875  -3.797  -34.003 1.00   46.05  ? 449  TYR B CZ  1 
ATOM   7597 O OH  . TYR B 1 449 ? -0.582  -5.008  -34.586 1.00   46.18  ? 449  TYR B OH  1 
ATOM   7598 N N   . GLU B 1 450 ? -1.540  3.457   -33.522 1.00   38.26  ? 450  GLU B N   1 
ATOM   7599 C CA  . GLU B 1 450 ? -2.209  4.733   -33.712 1.00   40.98  ? 450  GLU B CA  1 
ATOM   7600 C C   . GLU B 1 450 ? -2.582  4.903   -35.193 1.00   42.63  ? 450  GLU B C   1 
ATOM   7601 O O   . GLU B 1 450 ? -3.491  5.665   -35.542 1.00   38.93  ? 450  GLU B O   1 
ATOM   7602 C CB  . GLU B 1 450 ? -1.322  5.897   -33.245 1.00   38.38  ? 450  GLU B CB  1 
ATOM   7603 C CG  . GLU B 1 450 ? -0.385  6.462   -34.322 1.00   36.00  ? 450  GLU B CG  1 
ATOM   7604 C CD  . GLU B 1 450 ? 0.888   5.630   -34.513 1.00   40.50  ? 450  GLU B CD  1 
ATOM   7605 O OE1 . GLU B 1 450 ? 0.931   4.474   -34.040 1.00   36.96  ? 450  GLU B OE1 1 
ATOM   7606 O OE2 . GLU B 1 450 ? 1.849   6.136   -35.137 1.00   42.48  ? 450  GLU B OE2 1 
ATOM   7607 N N   . ILE B 1 451 ? -1.893  4.176   -36.066 1.00   39.60  ? 451  ILE B N   1 
ATOM   7608 C CA  . ILE B 1 451 ? -2.082  4.382   -37.502 1.00   41.21  ? 451  ILE B CA  1 
ATOM   7609 C C   . ILE B 1 451 ? -3.525  4.207   -37.986 1.00   42.45  ? 451  ILE B C   1 
ATOM   7610 O O   . ILE B 1 451 ? -4.063  5.057   -38.706 1.00   44.50  ? 451  ILE B O   1 
ATOM   7611 C CB  . ILE B 1 451 ? -1.155  3.496   -38.327 1.00   39.90  ? 451  ILE B CB  1 
ATOM   7612 C CG1 . ILE B 1 451 ? 0.299   3.739   -37.902 1.00   44.55  ? 451  ILE B CG1 1 
ATOM   7613 C CG2 . ILE B 1 451 ? -1.357  3.779   -39.804 1.00   39.07  ? 451  ILE B CG2 1 
ATOM   7614 C CD1 . ILE B 1 451 ? 1.312   2.811   -38.549 1.00   39.87  ? 451  ILE B CD1 1 
ATOM   7615 N N   . GLU B 1 452 ? -4.152  3.108   -37.591 1.00   45.20  ? 452  GLU B N   1 
ATOM   7616 C CA  . GLU B 1 452 ? -5.522  2.829   -38.010 1.00   45.73  ? 452  GLU B CA  1 
ATOM   7617 C C   . GLU B 1 452 ? -6.489  3.947   -37.611 1.00   45.22  ? 452  GLU B C   1 
ATOM   7618 O O   . GLU B 1 452 ? -7.499  4.160   -38.284 1.00   47.67  ? 452  GLU B O   1 
ATOM   7619 C CB  . GLU B 1 452 ? -5.986  1.474   -37.468 1.00   46.18  ? 452  GLU B CB  1 
ATOM   7620 C CG  . GLU B 1 452 ? -6.033  1.377   -35.949 1.00   46.55  ? 452  GLU B CG  1 
ATOM   7621 C CD  . GLU B 1 452 ? -5.914  -0.061  -35.454 1.00   51.89  ? 452  GLU B CD  1 
ATOM   7622 O OE1 . GLU B 1 452 ? -4.917  -0.734  -35.795 1.00   50.34  ? 452  GLU B OE1 1 
ATOM   7623 O OE2 . GLU B 1 452 ? -6.822  -0.526  -34.737 1.00   55.60  ? 452  GLU B OE2 1 
ATOM   7624 N N   . PHE B 1 453 ? -6.176  4.670   -36.535 1.00   43.80  ? 453  PHE B N   1 
ATOM   7625 C CA  . PHE B 1 453 ? -6.994  5.823   -36.127 1.00   43.75  ? 453  PHE B CA  1 
ATOM   7626 C C   . PHE B 1 453 ? -6.750  7.075   -36.965 1.00   42.82  ? 453  PHE B C   1 
ATOM   7627 O O   . PHE B 1 453 ? -7.698  7.724   -37.394 1.00   47.00  ? 453  PHE B O   1 
ATOM   7628 C CB  . PHE B 1 453 ? -6.838  6.127   -34.632 1.00   40.37  ? 453  PHE B CB  1 
ATOM   7629 C CG  . PHE B 1 453 ? -7.441  5.083   -33.753 1.00   38.98  ? 453  PHE B CG  1 
ATOM   7630 C CD1 . PHE B 1 453 ? -8.796  5.106   -33.460 1.00   46.32  ? 453  PHE B CD1 1 
ATOM   7631 C CD2 . PHE B 1 453 ? -6.668  4.059   -33.249 1.00   39.73  ? 453  PHE B CD2 1 
ATOM   7632 C CE1 . PHE B 1 453 ? -9.360  4.136   -32.661 1.00   44.46  ? 453  PHE B CE1 1 
ATOM   7633 C CE2 . PHE B 1 453 ? -7.218  3.083   -32.451 1.00   39.45  ? 453  PHE B CE2 1 
ATOM   7634 C CZ  . PHE B 1 453 ? -8.572  3.120   -32.157 1.00   48.99  ? 453  PHE B CZ  1 
ATOM   7635 N N   . ILE B 1 454 ? -5.482  7.408   -37.202 1.00   44.72  ? 454  ILE B N   1 
ATOM   7636 C CA  . ILE B 1 454 ? -5.129  8.540   -38.057 1.00   36.45  ? 454  ILE B CA  1 
ATOM   7637 C C   . ILE B 1 454 ? -5.713  8.374   -39.464 1.00   45.56  ? 454  ILE B C   1 
ATOM   7638 O O   . ILE B 1 454 ? -6.092  9.357   -40.099 1.00   46.08  ? 454  ILE B O   1 
ATOM   7639 C CB  . ILE B 1 454 ? -3.597  8.699   -38.186 1.00   42.25  ? 454  ILE B CB  1 
ATOM   7640 C CG1 . ILE B 1 454 ? -2.934  8.844   -36.804 1.00   42.37  ? 454  ILE B CG1 1 
ATOM   7641 C CG2 . ILE B 1 454 ? -3.241  9.858   -39.124 1.00   35.81  ? 454  ILE B CG2 1 
ATOM   7642 C CD1 . ILE B 1 454 ? -3.460  10.004  -35.991 1.00   49.51  ? 454  ILE B CD1 1 
ATOM   7643 N N   . PHE B 1 455 ? -5.788  7.133   -39.948 1.00   44.91  ? 455  PHE B N   1 
ATOM   7644 C CA  . PHE B 1 455 ? -6.244  6.880   -41.319 1.00   46.80  ? 455  PHE B CA  1 
ATOM   7645 C C   . PHE B 1 455 ? -7.760  6.782   -41.405 1.00   49.72  ? 455  PHE B C   1 
ATOM   7646 O O   . PHE B 1 455 ? -8.335  6.861   -42.496 1.00   42.31  ? 455  PHE B O   1 
ATOM   7647 C CB  . PHE B 1 455 ? -5.567  5.639   -41.925 1.00   42.55  ? 455  PHE B CB  1 
ATOM   7648 C CG  . PHE B 1 455 ? -4.292  5.951   -42.666 1.00   46.28  ? 455  PHE B CG  1 
ATOM   7649 C CD1 . PHE B 1 455 ? -4.317  6.261   -44.015 1.00   44.54  ? 455  PHE B CD1 1 
ATOM   7650 C CD2 . PHE B 1 455 ? -3.071  5.958   -42.009 1.00   46.74  ? 455  PHE B CD2 1 
ATOM   7651 C CE1 . PHE B 1 455 ? -3.146  6.562   -44.703 1.00   40.26  ? 455  PHE B CE1 1 
ATOM   7652 C CE2 . PHE B 1 455 ? -1.900  6.252   -42.689 1.00   45.59  ? 455  PHE B CE2 1 
ATOM   7653 C CZ  . PHE B 1 455 ? -1.938  6.558   -44.040 1.00   39.92  ? 455  PHE B CZ  1 
ATOM   7654 N N   . GLY B 1 456 ? -8.394  6.613   -40.245 1.00   45.84  ? 456  GLY B N   1 
ATOM   7655 C CA  . GLY B 1 456 ? -9.839  6.667   -40.147 1.00   45.51  ? 456  GLY B CA  1 
ATOM   7656 C C   . GLY B 1 456 ? -10.590 5.357   -40.301 1.00   52.65  ? 456  GLY B C   1 
ATOM   7657 O O   . GLY B 1 456 ? -11.786 5.370   -40.574 1.00   54.68  ? 456  GLY B O   1 
ATOM   7658 N N   . LEU B 1 457 ? -9.913  4.228   -40.112 1.00   46.76  ? 457  LEU B N   1 
ATOM   7659 C CA  . LEU B 1 457 ? -10.568 2.934   -40.284 1.00   46.77  ? 457  LEU B CA  1 
ATOM   7660 C C   . LEU B 1 457 ? -11.806 2.753   -39.398 1.00   59.28  ? 457  LEU B C   1 
ATOM   7661 O O   . LEU B 1 457 ? -12.762 2.089   -39.792 1.00   57.45  ? 457  LEU B O   1 
ATOM   7662 C CB  . LEU B 1 457 ? -9.586  1.785   -40.066 1.00   44.21  ? 457  LEU B CB  1 
ATOM   7663 C CG  . LEU B 1 457 ? -8.866  1.317   -41.326 1.00   46.92  ? 457  LEU B CG  1 
ATOM   7664 C CD1 . LEU B 1 457 ? -8.136  2.475   -42.012 1.00   42.97  ? 457  LEU B CD1 1 
ATOM   7665 C CD2 . LEU B 1 457 ? -7.911  0.175   -40.985 1.00   44.23  ? 457  LEU B CD2 1 
ATOM   7666 N N   . PRO B 1 458 ? -11.793 3.329   -38.187 1.00   56.50  ? 458  PRO B N   1 
ATOM   7667 C CA  . PRO B 1 458 ? -12.996 3.199   -37.359 1.00   56.82  ? 458  PRO B CA  1 
ATOM   7668 C C   . PRO B 1 458 ? -14.258 3.769   -38.021 1.00   55.06  ? 458  PRO B C   1 
ATOM   7669 O O   . PRO B 1 458 ? -15.361 3.386   -37.649 1.00   59.31  ? 458  PRO B O   1 
ATOM   7670 C CB  . PRO B 1 458 ? -12.625 3.968   -36.095 1.00   53.83  ? 458  PRO B CB  1 
ATOM   7671 C CG  . PRO B 1 458 ? -11.137 3.793   -36.006 1.00   53.83  ? 458  PRO B CG  1 
ATOM   7672 C CD  . PRO B 1 458 ? -10.655 3.869   -37.426 1.00   46.00  ? 458  PRO B CD  1 
ATOM   7673 N N   . LEU B 1 459 ? -14.103 4.654   -38.996 1.00   52.99  ? 459  LEU B N   1 
ATOM   7674 C CA  . LEU B 1 459 ? -15.252 5.144   -39.751 1.00   54.18  ? 459  LEU B CA  1 
ATOM   7675 C C   . LEU B 1 459 ? -15.902 4.055   -40.621 1.00   59.65  ? 459  LEU B C   1 
ATOM   7676 O O   . LEU B 1 459 ? -16.934 4.286   -41.249 1.00   63.87  ? 459  LEU B O   1 
ATOM   7677 C CB  . LEU B 1 459 ? -14.858 6.339   -40.621 1.00   55.73  ? 459  LEU B CB  1 
ATOM   7678 C CG  . LEU B 1 459 ? -14.912 7.718   -39.964 1.00   54.91  ? 459  LEU B CG  1 
ATOM   7679 C CD1 . LEU B 1 459 ? -13.941 7.799   -38.806 1.00   55.98  ? 459  LEU B CD1 1 
ATOM   7680 C CD2 . LEU B 1 459 ? -14.614 8.797   -40.984 1.00   52.47  ? 459  LEU B CD2 1 
ATOM   7681 N N   . ASP B 1 460 ? -15.289 2.877   -40.663 1.00   63.05  ? 460  ASP B N   1 
ATOM   7682 C CA  . ASP B 1 460 ? -15.829 1.749   -41.412 1.00   61.25  ? 460  ASP B CA  1 
ATOM   7683 C C   . ASP B 1 460 ? -16.519 0.797   -40.451 1.00   63.53  ? 460  ASP B C   1 
ATOM   7684 O O   . ASP B 1 460 ? -15.862 0.113   -39.666 1.00   64.29  ? 460  ASP B O   1 
ATOM   7685 C CB  . ASP B 1 460 ? -14.714 1.020   -42.159 1.00   60.07  ? 460  ASP B CB  1 
ATOM   7686 C CG  . ASP B 1 460 ? -15.238 -0.097  -43.053 1.00   70.60  ? 460  ASP B CG  1 
ATOM   7687 O OD1 . ASP B 1 460 ? -16.464 -0.360  -43.039 1.00   66.97  ? 460  ASP B OD1 1 
ATOM   7688 O OD2 . ASP B 1 460 ? -14.416 -0.710  -43.771 1.00   68.55  ? 460  ASP B OD2 1 
ATOM   7689 N N   . PRO B 1 461 ? -17.857 0.743   -40.519 1.00   73.94  ? 461  PRO B N   1 
ATOM   7690 C CA  . PRO B 1 461 ? -18.669 0.013   -39.533 1.00   67.15  ? 461  PRO B CA  1 
ATOM   7691 C C   . PRO B 1 461 ? -18.372 -1.489  -39.492 1.00   70.08  ? 461  PRO B C   1 
ATOM   7692 O O   . PRO B 1 461 ? -18.381 -2.088  -38.415 1.00   70.63  ? 461  PRO B O   1 
ATOM   7693 C CB  . PRO B 1 461 ? -20.107 0.280   -39.995 1.00   63.57  ? 461  PRO B CB  1 
ATOM   7694 C CG  . PRO B 1 461 ? -20.014 1.514   -40.868 1.00   66.72  ? 461  PRO B CG  1 
ATOM   7695 C CD  . PRO B 1 461 ? -18.686 1.399   -41.546 1.00   68.23  ? 461  PRO B CD  1 
ATOM   7696 N N   . SER B 1 462 ? -18.097 -2.084  -40.647 1.00   64.15  ? 462  SER B N   1 
ATOM   7697 C CA  . SER B 1 462 ? -17.797 -3.510  -40.708 1.00   64.40  ? 462  SER B CA  1 
ATOM   7698 C C   . SER B 1 462 ? -16.583 -3.880  -39.860 1.00   72.72  ? 462  SER B C   1 
ATOM   7699 O O   . SER B 1 462 ? -16.333 -5.063  -39.597 1.00   74.52  ? 462  SER B O   1 
ATOM   7700 C CB  . SER B 1 462 ? -17.558 -3.934  -42.158 1.00   70.20  ? 462  SER B CB  1 
ATOM   7701 O OG  . SER B 1 462 ? -16.681 -3.032  -42.811 1.00   72.08  ? 462  SER B OG  1 
ATOM   7702 N N   . LEU B 1 463 ? -15.831 -2.869  -39.432 1.00   70.10  ? 463  LEU B N   1 
ATOM   7703 C CA  . LEU B 1 463 ? -14.586 -3.110  -38.711 1.00   68.82  ? 463  LEU B CA  1 
ATOM   7704 C C   . LEU B 1 463 ? -14.798 -3.317  -37.213 1.00   71.36  ? 463  LEU B C   1 
ATOM   7705 O O   . LEU B 1 463 ? -13.920 -3.848  -36.525 1.00   72.47  ? 463  LEU B O   1 
ATOM   7706 C CB  . LEU B 1 463 ? -13.578 -1.994  -38.992 1.00   67.64  ? 463  LEU B CB  1 
ATOM   7707 C CG  . LEU B 1 463 ? -13.073 -2.055  -40.435 1.00   67.60  ? 463  LEU B CG  1 
ATOM   7708 C CD1 . LEU B 1 463 ? -12.200 -0.864  -40.795 1.00   58.91  ? 463  LEU B CD1 1 
ATOM   7709 C CD2 . LEU B 1 463 ? -12.325 -3.352  -40.637 1.00   66.87  ? 463  LEU B CD2 1 
ATOM   7710 N N   . ASN B 1 464 ? -15.962 -2.897  -36.722 1.00   62.65  ? 464  ASN B N   1 
ATOM   7711 C CA  . ASN B 1 464 ? -16.386 -3.196  -35.355 1.00   68.64  ? 464  ASN B CA  1 
ATOM   7712 C C   . ASN B 1 464 ? -15.752 -2.335  -34.261 1.00   72.53  ? 464  ASN B C   1 
ATOM   7713 O O   . ASN B 1 464 ? -15.657 -2.772  -33.113 1.00   76.67  ? 464  ASN B O   1 
ATOM   7714 C CB  . ASN B 1 464 ? -16.180 -4.682  -35.025 1.00   74.84  ? 464  ASN B CB  1 
ATOM   7715 C CG  . ASN B 1 464 ? -17.061 -5.604  -35.863 1.00   83.00  ? 464  ASN B CG  1 
ATOM   7716 O OD1 . ASN B 1 464 ? -18.100 -5.189  -36.389 1.00   79.59  ? 464  ASN B OD1 1 
ATOM   7717 N ND2 . ASN B 1 464 ? -16.647 -6.866  -35.986 1.00   84.29  ? 464  ASN B ND2 1 
ATOM   7718 N N   . TYR B 1 465 ? -15.321 -1.124  -34.611 1.00   66.05  ? 465  TYR B N   1 
ATOM   7719 C CA  . TYR B 1 465 ? -14.857 -0.156  -33.617 1.00   60.19  ? 465  TYR B CA  1 
ATOM   7720 C C   . TYR B 1 465 ? -16.056 0.484   -32.914 1.00   61.91  ? 465  TYR B C   1 
ATOM   7721 O O   . TYR B 1 465 ? -17.149 0.527   -33.469 1.00   68.55  ? 465  TYR B O   1 
ATOM   7722 C CB  . TYR B 1 465 ? -14.048 0.958   -34.282 1.00   61.69  ? 465  TYR B CB  1 
ATOM   7723 C CG  . TYR B 1 465 ? -12.686 0.571   -34.812 1.00   60.53  ? 465  TYR B CG  1 
ATOM   7724 C CD1 . TYR B 1 465 ? -11.581 0.497   -33.967 1.00   54.59  ? 465  TYR B CD1 1 
ATOM   7725 C CD2 . TYR B 1 465 ? -12.495 0.321   -36.165 1.00   56.91  ? 465  TYR B CD2 1 
ATOM   7726 C CE1 . TYR B 1 465 ? -10.330 0.167   -34.456 1.00   55.95  ? 465  TYR B CE1 1 
ATOM   7727 C CE2 . TYR B 1 465 ? -11.257 -0.007  -36.663 1.00   53.92  ? 465  TYR B CE2 1 
ATOM   7728 C CZ  . TYR B 1 465 ? -10.176 -0.083  -35.808 1.00   60.83  ? 465  TYR B CZ  1 
ATOM   7729 O OH  . TYR B 1 465 ? -8.942  -0.410  -36.312 1.00   57.92  ? 465  TYR B OH  1 
ATOM   7730 N N   . THR B 1 466 ? -15.847 1.003   -31.708 1.00   60.29  ? 466  THR B N   1 
ATOM   7731 C CA  . THR B 1 466 ? -16.916 1.656   -30.955 1.00   54.52  ? 466  THR B CA  1 
ATOM   7732 C C   . THR B 1 466 ? -17.193 3.056   -31.491 1.00   62.69  ? 466  THR B C   1 
ATOM   7733 O O   . THR B 1 466 ? -16.370 3.624   -32.207 1.00   63.74  ? 466  THR B O   1 
ATOM   7734 C CB  . THR B 1 466 ? -16.546 1.804   -29.468 1.00   61.59  ? 466  THR B CB  1 
ATOM   7735 O OG1 . THR B 1 466 ? -15.686 2.941   -29.293 1.00   59.92  ? 466  THR B OG1 1 
ATOM   7736 C CG2 . THR B 1 466 ? -15.853 0.553   -28.959 1.00   49.22  ? 466  THR B CG2 1 
ATOM   7737 N N   . THR B 1 467 ? -18.342 3.619   -31.127 1.00   64.59  ? 467  THR B N   1 
ATOM   7738 C CA  . THR B 1 467 ? -18.692 4.978   -31.538 1.00   68.47  ? 467  THR B CA  1 
ATOM   7739 C C   . THR B 1 467 ? -17.736 6.023   -30.971 1.00   67.28  ? 467  THR B C   1 
ATOM   7740 O O   . THR B 1 467 ? -17.452 7.030   -31.624 1.00   65.86  ? 467  THR B O   1 
ATOM   7741 C CB  . THR B 1 467 ? -20.121 5.359   -31.119 1.00   68.95  ? 467  THR B CB  1 
ATOM   7742 O OG1 . THR B 1 467 ? -20.435 4.715   -29.879 1.00   84.73  ? 467  THR B OG1 1 
ATOM   7743 C CG2 . THR B 1 467 ? -21.120 4.926   -32.180 1.00   72.17  ? 467  THR B CG2 1 
ATOM   7744 N N   . GLU B 1 468 ? -17.258 5.792   -29.751 1.00   61.10  ? 468  GLU B N   1 
ATOM   7745 C CA  . GLU B 1 468 ? -16.283 6.685   -29.144 1.00   63.13  ? 468  GLU B CA  1 
ATOM   7746 C C   . GLU B 1 468 ? -15.032 6.704   -30.025 1.00   62.93  ? 468  GLU B C   1 
ATOM   7747 O O   . GLU B 1 468 ? -14.469 7.766   -30.310 1.00   54.16  ? 468  GLU B O   1 
ATOM   7748 C CB  . GLU B 1 468 ? -15.929 6.231   -27.719 1.00   65.02  ? 468  GLU B CB  1 
ATOM   7749 C CG  . GLU B 1 468 ? -17.080 6.275   -26.706 1.00   71.88  ? 468  GLU B CG  1 
ATOM   7750 C CD  . GLU B 1 468 ? -17.967 5.027   -26.740 1.00   86.49  ? 468  GLU B CD  1 
ATOM   7751 O OE1 . GLU B 1 468 ? -17.788 4.179   -27.644 1.00   85.35  ? 468  GLU B OE1 1 
ATOM   7752 O OE2 . GLU B 1 468 ? -18.848 4.892   -25.859 1.00   89.64  ? 468  GLU B OE2 1 
ATOM   7753 N N   . GLU B 1 469 ? -14.617 5.517   -30.464 1.00   56.95  ? 469  GLU B N   1 
ATOM   7754 C CA  . GLU B 1 469 ? -13.444 5.371   -31.314 1.00   53.17  ? 469  GLU B CA  1 
ATOM   7755 C C   . GLU B 1 469 ? -13.629 6.068   -32.653 1.00   53.75  ? 469  GLU B C   1 
ATOM   7756 O O   . GLU B 1 469 ? -12.708 6.696   -33.171 1.00   55.27  ? 469  GLU B O   1 
ATOM   7757 C CB  . GLU B 1 469 ? -13.112 3.895   -31.513 1.00   51.47  ? 469  GLU B CB  1 
ATOM   7758 C CG  . GLU B 1 469 ? -12.206 3.342   -30.432 1.00   46.56  ? 469  GLU B CG  1 
ATOM   7759 C CD  . GLU B 1 469 ? -12.132 1.839   -30.455 1.00   54.03  ? 469  GLU B CD  1 
ATOM   7760 O OE1 . GLU B 1 469 ? -12.987 1.207   -31.109 1.00   62.68  ? 469  GLU B OE1 1 
ATOM   7761 O OE2 . GLU B 1 469 ? -11.230 1.281   -29.808 1.00   49.11  ? 469  GLU B OE2 1 
ATOM   7762 N N   . ARG B 1 470 ? -14.830 5.966   -33.204 1.00   55.91  ? 470  ARG B N   1 
ATOM   7763 C CA  . ARG B 1 470 ? -15.142 6.635   -34.451 1.00   53.82  ? 470  ARG B CA  1 
ATOM   7764 C C   . ARG B 1 470 ? -14.987 8.148   -34.265 1.00   54.98  ? 470  ARG B C   1 
ATOM   7765 O O   . ARG B 1 470 ? -14.335 8.816   -35.062 1.00   56.13  ? 470  ARG B O   1 
ATOM   7766 C CB  . ARG B 1 470 ? -16.550 6.243   -34.911 1.00   59.36  ? 470  ARG B CB  1 
ATOM   7767 C CG  . ARG B 1 470 ? -16.903 6.649   -36.333 1.00   67.08  ? 470  ARG B CG  1 
ATOM   7768 C CD  . ARG B 1 470 ? -17.760 7.906   -36.352 1.00   77.82  ? 470  ARG B CD  1 
ATOM   7769 N NE  . ARG B 1 470 ? -19.061 7.679   -35.722 1.00   90.15  ? 470  ARG B NE  1 
ATOM   7770 C CZ  . ARG B 1 470 ? -19.920 8.641   -35.394 1.00   90.12  ? 470  ARG B CZ  1 
ATOM   7771 N NH1 . ARG B 1 470 ? -19.625 9.915   -35.630 1.00   81.90  ? 470  ARG B NH1 1 
ATOM   7772 N NH2 . ARG B 1 470 ? -21.074 8.328   -34.821 1.00   87.99  ? 470  ARG B NH2 1 
ATOM   7773 N N   . ILE B 1 471 ? -15.555 8.681   -33.188 1.00   59.45  ? 471  ILE B N   1 
ATOM   7774 C CA  . ILE B 1 471 ? -15.390 10.100  -32.843 1.00   60.41  ? 471  ILE B CA  1 
ATOM   7775 C C   . ILE B 1 471 ? -13.912 10.494  -32.621 1.00   51.45  ? 471  ILE B C   1 
ATOM   7776 O O   . ILE B 1 471 ? -13.462 11.539  -33.081 1.00   49.54  ? 471  ILE B O   1 
ATOM   7777 C CB  . ILE B 1 471 ? -16.240 10.460  -31.605 1.00   58.74  ? 471  ILE B CB  1 
ATOM   7778 C CG1 . ILE B 1 471 ? -17.722 10.496  -31.992 1.00   60.73  ? 471  ILE B CG1 1 
ATOM   7779 C CG2 . ILE B 1 471 ? -15.803 11.781  -31.019 1.00   48.12  ? 471  ILE B CG2 1 
ATOM   7780 C CD1 . ILE B 1 471 ? -18.643 10.070  -30.886 1.00   55.21  ? 471  ILE B CD1 1 
ATOM   7781 N N   . PHE B 1 472 ? -13.174 9.636   -31.923 1.00   48.76  ? 472  PHE B N   1 
ATOM   7782 C CA  . PHE B 1 472 ? -11.730 9.773   -31.753 1.00   52.10  ? 472  PHE B CA  1 
ATOM   7783 C C   . PHE B 1 472 ? -11.007 9.879   -33.103 1.00   52.84  ? 472  PHE B C   1 
ATOM   7784 O O   . PHE B 1 472 ? -10.267 10.841  -33.340 1.00   47.21  ? 472  PHE B O   1 
ATOM   7785 C CB  . PHE B 1 472 ? -11.210 8.573   -30.963 1.00   53.66  ? 472  PHE B CB  1 
ATOM   7786 C CG  . PHE B 1 472 ? -9.775  8.680   -30.551 1.00   50.47  ? 472  PHE B CG  1 
ATOM   7787 C CD1 . PHE B 1 472 ? -9.253  9.878   -30.096 1.00   51.84  ? 472  PHE B CD1 1 
ATOM   7788 C CD2 . PHE B 1 472 ? -8.956  7.563   -30.579 1.00   46.56  ? 472  PHE B CD2 1 
ATOM   7789 C CE1 . PHE B 1 472 ? -7.928  9.969   -29.702 1.00   42.10  ? 472  PHE B CE1 1 
ATOM   7790 C CE2 . PHE B 1 472 ? -7.634  7.642   -30.191 1.00   47.66  ? 472  PHE B CE2 1 
ATOM   7791 C CZ  . PHE B 1 472 ? -7.122  8.853   -29.740 1.00   49.66  ? 472  PHE B CZ  1 
ATOM   7792 N N   . ALA B 1 473 ? -11.233 8.905   -33.988 1.00   46.47  ? 473  ALA B N   1 
ATOM   7793 C CA  . ALA B 1 473 ? -10.591 8.918   -35.306 1.00   44.12  ? 473  ALA B CA  1 
ATOM   7794 C C   . ALA B 1 473 ? -10.865 10.224  -36.044 1.00   50.58  ? 473  ALA B C   1 
ATOM   7795 O O   . ALA B 1 473 ? -9.966  10.790  -36.677 1.00   50.64  ? 473  ALA B O   1 
ATOM   7796 C CB  . ALA B 1 473 ? -11.019 7.719   -36.151 1.00   39.68  ? 473  ALA B CB  1 
ATOM   7797 N N   . GLN B 1 474 ? -12.097 10.717  -35.954 1.00   47.32  ? 474  GLN B N   1 
ATOM   7798 C CA  . GLN B 1 474 ? -12.436 11.957  -36.641 1.00   49.60  ? 474  GLN B CA  1 
ATOM   7799 C C   . GLN B 1 474 ? -11.648 13.142  -36.078 1.00   53.37  ? 474  GLN B C   1 
ATOM   7800 O O   . GLN B 1 474 ? -11.228 14.032  -36.828 1.00   51.30  ? 474  GLN B O   1 
ATOM   7801 C CB  . GLN B 1 474 ? -13.946 12.220  -36.597 1.00   56.24  ? 474  GLN B CB  1 
ATOM   7802 C CG  . GLN B 1 474 ? -14.786 11.076  -37.169 1.00   55.38  ? 474  GLN B CG  1 
ATOM   7803 C CD  . GLN B 1 474 ? -16.224 11.481  -37.471 1.00   73.19  ? 474  GLN B CD  1 
ATOM   7804 O OE1 . GLN B 1 474 ? -17.159 11.069  -36.776 1.00   70.71  ? 474  GLN B OE1 1 
ATOM   7805 N NE2 . GLN B 1 474 ? -16.406 12.294  -38.514 1.00   76.33  ? 474  GLN B NE2 1 
ATOM   7806 N N   . ARG B 1 475 ? -11.443 13.147  -34.761 1.00   52.69  ? 475  ARG B N   1 
ATOM   7807 C CA  . ARG B 1 475 ? -10.651 14.194  -34.121 1.00   51.26  ? 475  ARG B CA  1 
ATOM   7808 C C   . ARG B 1 475 ? -9.240  14.170  -34.680 1.00   45.82  ? 475  ARG B C   1 
ATOM   7809 O O   . ARG B 1 475 ? -8.696  15.214  -35.065 1.00   45.13  ? 475  ARG B O   1 
ATOM   7810 C CB  . ARG B 1 475 ? -10.588 13.998  -32.602 1.00   52.86  ? 475  ARG B CB  1 
ATOM   7811 C CG  . ARG B 1 475 ? -11.869 14.334  -31.848 1.00   60.92  ? 475  ARG B CG  1 
ATOM   7812 C CD  . ARG B 1 475 ? -11.660 14.175  -30.336 1.00   58.55  ? 475  ARG B CD  1 
ATOM   7813 N NE  . ARG B 1 475 ? -10.381 14.741  -29.909 1.00   47.39  ? 475  ARG B NE  1 
ATOM   7814 C CZ  . ARG B 1 475 ? -9.664  14.276  -28.890 1.00   49.82  ? 475  ARG B CZ  1 
ATOM   7815 N NH1 . ARG B 1 475 ? -10.094 13.229  -28.194 1.00   41.30  ? 475  ARG B NH1 1 
ATOM   7816 N NH2 . ARG B 1 475 ? -8.505  14.847  -28.577 1.00   44.96  ? 475  ARG B NH2 1 
ATOM   7817 N N   . LEU B 1 476 ? -8.663  12.970  -34.730 1.00   38.58  ? 476  LEU B N   1 
ATOM   7818 C CA  . LEU B 1 476 ? -7.282  12.781  -35.192 1.00   43.55  ? 476  LEU B CA  1 
ATOM   7819 C C   . LEU B 1 476 ? -7.081  13.144  -36.666 1.00   44.08  ? 476  LEU B C   1 
ATOM   7820 O O   . LEU B 1 476 ? -6.111  13.819  -37.017 1.00   44.95  ? 476  LEU B O   1 
ATOM   7821 C CB  . LEU B 1 476 ? -6.803  11.355  -34.908 1.00   42.47  ? 476  LEU B CB  1 
ATOM   7822 C CG  . LEU B 1 476 ? -6.838  10.955  -33.432 1.00   41.89  ? 476  LEU B CG  1 
ATOM   7823 C CD1 . LEU B 1 476 ? -6.194  9.608   -33.229 1.00   52.63  ? 476  LEU B CD1 1 
ATOM   7824 C CD2 . LEU B 1 476 ? -6.135  11.998  -32.590 1.00   41.56  ? 476  LEU B CD2 1 
ATOM   7825 N N   . MET B 1 477 ? -8.010  12.720  -37.518 1.00   42.51  ? 477  MET B N   1 
ATOM   7826 C CA  . MET B 1 477 ? -7.969  13.091  -38.927 1.00   45.67  ? 477  MET B CA  1 
ATOM   7827 C C   . MET B 1 477 ? -7.955  14.606  -39.078 1.00   44.42  ? 477  MET B C   1 
ATOM   7828 O O   . MET B 1 477 ? -7.378  15.142  -40.022 1.00   46.83  ? 477  MET B O   1 
ATOM   7829 C CB  . MET B 1 477 ? -9.166  12.498  -39.693 1.00   48.80  ? 477  MET B CB  1 
ATOM   7830 C CG  . MET B 1 477 ? -9.190  10.963  -39.765 1.00   49.60  ? 477  MET B CG  1 
ATOM   7831 S SD  . MET B 1 477 ? -10.712 10.265  -40.471 1.00   59.09  ? 477  MET B SD  1 
ATOM   7832 C CE  . MET B 1 477 ? -10.552 10.729  -42.184 1.00   39.55  ? 477  MET B CE  1 
ATOM   7833 N N   . LYS B 1 478 ? -8.600  15.296  -38.145 1.00   47.03  ? 478  LYS B N   1 
ATOM   7834 C CA  . LYS B 1 478 ? -8.671  16.757  -38.188 1.00   45.48  ? 478  LYS B CA  1 
ATOM   7835 C C   . LYS B 1 478 ? -7.365  17.413  -37.756 1.00   42.22  ? 478  LYS B C   1 
ATOM   7836 O O   . LYS B 1 478 ? -6.949  18.408  -38.347 1.00   40.59  ? 478  LYS B O   1 
ATOM   7837 C CB  . LYS B 1 478 ? -9.826  17.269  -37.325 1.00   48.96  ? 478  LYS B CB  1 
ATOM   7838 C CG  . LYS B 1 478 ? -11.014 17.800  -38.106 1.00   60.01  ? 478  LYS B CG  1 
ATOM   7839 C CD  . LYS B 1 478 ? -10.883 19.301  -38.342 1.00   60.32  ? 478  LYS B CD  1 
ATOM   7840 C CE  . LYS B 1 478 ? -11.978 19.831  -39.273 1.00   71.81  ? 478  LYS B CE  1 
ATOM   7841 N NZ  . LYS B 1 478 ? -11.915 19.293  -40.677 1.00   60.62  ? 478  LYS B NZ  1 
ATOM   7842 N N   . TYR B 1 479 ? -6.730  16.870  -36.719 1.00   39.17  ? 479  TYR B N   1 
ATOM   7843 C CA  . TYR B 1 479 ? -5.459  17.416  -36.266 1.00   41.22  ? 479  TYR B CA  1 
ATOM   7844 C C   . TYR B 1 479 ? -4.455  17.301  -37.411 1.00   41.78  ? 479  TYR B C   1 
ATOM   7845 O O   . TYR B 1 479 ? -3.837  18.290  -37.826 1.00   38.15  ? 479  TYR B O   1 
ATOM   7846 C CB  . TYR B 1 479 ? -4.925  16.656  -35.058 1.00   42.84  ? 479  TYR B CB  1 
ATOM   7847 C CG  . TYR B 1 479 ? -5.694  16.830  -33.774 1.00   39.57  ? 479  TYR B CG  1 
ATOM   7848 C CD1 . TYR B 1 479 ? -6.125  18.082  -33.354 1.00   45.86  ? 479  TYR B CD1 1 
ATOM   7849 C CD2 . TYR B 1 479 ? -5.952  15.743  -32.952 1.00   44.64  ? 479  TYR B CD2 1 
ATOM   7850 C CE1 . TYR B 1 479 ? -6.824  18.238  -32.160 1.00   40.25  ? 479  TYR B CE1 1 
ATOM   7851 C CE2 . TYR B 1 479 ? -6.644  15.889  -31.758 1.00   41.47  ? 479  TYR B CE2 1 
ATOM   7852 C CZ  . TYR B 1 479 ? -7.074  17.136  -31.369 1.00   45.65  ? 479  TYR B CZ  1 
ATOM   7853 O OH  . TYR B 1 479 ? -7.758  17.279  -30.178 1.00   54.17  ? 479  TYR B OH  1 
ATOM   7854 N N   . TRP B 1 480 ? -4.334  16.087  -37.942 1.00   40.18  ? 480  TRP B N   1 
ATOM   7855 C CA  . TRP B 1 480 ? -3.382  15.805  -39.015 1.00   41.89  ? 480  TRP B CA  1 
ATOM   7856 C C   . TRP B 1 480 ? -3.606  16.654  -40.271 1.00   42.01  ? 480  TRP B C   1 
ATOM   7857 O O   . TRP B 1 480 ? -2.663  17.254  -40.805 1.00   41.84  ? 480  TRP B O   1 
ATOM   7858 C CB  . TRP B 1 480 ? -3.384  14.313  -39.349 1.00   35.40  ? 480  TRP B CB  1 
ATOM   7859 C CG  . TRP B 1 480 ? -2.270  13.528  -38.706 1.00   38.14  ? 480  TRP B CG  1 
ATOM   7860 C CD1 . TRP B 1 480 ? -1.253  12.873  -39.349 1.00   39.59  ? 480  TRP B CD1 1 
ATOM   7861 C CD2 . TRP B 1 480 ? -2.061  13.306  -37.308 1.00   39.63  ? 480  TRP B CD2 1 
ATOM   7862 N NE1 . TRP B 1 480 ? -0.428  12.263  -38.441 1.00   37.85  ? 480  TRP B NE1 1 
ATOM   7863 C CE2 . TRP B 1 480 ? -0.900  12.511  -37.180 1.00   42.18  ? 480  TRP B CE2 1 
ATOM   7864 C CE3 . TRP B 1 480 ? -2.736  13.704  -36.152 1.00   41.60  ? 480  TRP B CE3 1 
ATOM   7865 C CZ2 . TRP B 1 480 ? -0.404  12.106  -35.942 1.00   40.31  ? 480  TRP B CZ2 1 
ATOM   7866 C CZ3 . TRP B 1 480 ? -2.248  13.302  -34.931 1.00   41.83  ? 480  TRP B CZ3 1 
ATOM   7867 C CH2 . TRP B 1 480 ? -1.092  12.507  -34.832 1.00   42.85  ? 480  TRP B CH2 1 
ATOM   7868 N N   . THR B 1 481 ? -4.851  16.734  -40.727 1.00   36.03  ? 481  THR B N   1 
ATOM   7869 C CA  . THR B 1 481 ? -5.139  17.478  -41.947 1.00   39.39  ? 481  THR B CA  1 
ATOM   7870 C C   . THR B 1 481 ? -5.046  18.983  -41.698 1.00   44.32  ? 481  THR B C   1 
ATOM   7871 O O   . THR B 1 481 ? -4.571  19.737  -42.553 1.00   46.17  ? 481  THR B O   1 
ATOM   7872 C CB  . THR B 1 481 ? -6.504  17.086  -42.570 1.00   45.06  ? 481  THR B CB  1 
ATOM   7873 O OG1 . THR B 1 481 ? -7.546  17.247  -41.602 1.00   49.08  ? 481  THR B OG1 1 
ATOM   7874 C CG2 . THR B 1 481 ? -6.485  15.638  -43.022 1.00   40.67  ? 481  THR B CG2 1 
ATOM   7875 N N   . ASN B 1 482 ? -5.484  19.426  -40.525 1.00   43.49  ? 482  ASN B N   1 
ATOM   7876 C CA  . ASN B 1 482 ? -5.281  20.825  -40.166 1.00   47.84  ? 482  ASN B CA  1 
ATOM   7877 C C   . ASN B 1 482 ? -3.808  21.135  -40.149 1.00   38.58  ? 482  ASN B C   1 
ATOM   7878 O O   . ASN B 1 482 ? -3.381  22.169  -40.659 1.00   41.48  ? 482  ASN B O   1 
ATOM   7879 C CB  . ASN B 1 482 ? -5.936  21.192  -38.832 1.00   49.21  ? 482  ASN B CB  1 
ATOM   7880 C CG  . ASN B 1 482 ? -7.409  21.493  -38.984 1.00   50.28  ? 482  ASN B CG  1 
ATOM   7881 O OD1 . ASN B 1 482 ? -7.826  22.103  -39.969 1.00   49.67  ? 482  ASN B OD1 1 
ATOM   7882 N ND2 . ASN B 1 482 ? -8.208  21.054  -38.022 1.00   53.59  ? 482  ASN B ND2 1 
ATOM   7883 N N   . PHE B 1 483 ? -3.021  20.227  -39.585 1.00   40.53  ? 483  PHE B N   1 
ATOM   7884 C CA  . PHE B 1 483 ? -1.579  20.412  -39.644 1.00   45.44  ? 483  PHE B CA  1 
ATOM   7885 C C   . PHE B 1 483 ? -1.095  20.485  -41.109 1.00   46.78  ? 483  PHE B C   1 
ATOM   7886 O O   . PHE B 1 483 ? -0.287  21.343  -41.456 1.00   43.09  ? 483  PHE B O   1 
ATOM   7887 C CB  . PHE B 1 483 ? -0.828  19.336  -38.866 1.00   39.56  ? 483  PHE B CB  1 
ATOM   7888 C CG  . PHE B 1 483 ? 0.672   19.463  -38.968 1.00   43.40  ? 483  PHE B CG  1 
ATOM   7889 C CD1 . PHE B 1 483 ? 1.362   20.385  -38.184 1.00   37.16  ? 483  PHE B CD1 1 
ATOM   7890 C CD2 . PHE B 1 483 ? 1.388   18.679  -39.861 1.00   37.78  ? 483  PHE B CD2 1 
ATOM   7891 C CE1 . PHE B 1 483 ? 2.732   20.511  -38.282 1.00   40.48  ? 483  PHE B CE1 1 
ATOM   7892 C CE2 . PHE B 1 483 ? 2.771   18.796  -39.964 1.00   41.56  ? 483  PHE B CE2 1 
ATOM   7893 C CZ  . PHE B 1 483 ? 3.446   19.711  -39.174 1.00   39.42  ? 483  PHE B CZ  1 
ATOM   7894 N N   . ALA B 1 484 ? -1.605  19.609  -41.970 1.00   42.29  ? 484  ALA B N   1 
ATOM   7895 C CA  . ALA B 1 484 ? -1.197  19.634  -43.379 1.00   43.20  ? 484  ALA B CA  1 
ATOM   7896 C C   . ALA B 1 484 ? -1.520  20.974  -44.029 1.00   44.08  ? 484  ALA B C   1 
ATOM   7897 O O   . ALA B 1 484 ? -0.689  21.554  -44.737 1.00   40.05  ? 484  ALA B O   1 
ATOM   7898 C CB  . ALA B 1 484 ? -1.850  18.486  -44.166 1.00   37.65  ? 484  ALA B CB  1 
ATOM   7899 N N   . ARG B 1 485 ? -2.731  21.462  -43.775 1.00   44.73  ? 485  ARG B N   1 
ATOM   7900 C CA  . ARG B 1 485 ? -3.212  22.708  -44.375 1.00   46.62  ? 485  ARG B CA  1 
ATOM   7901 C C   . ARG B 1 485 ? -2.424  23.933  -43.918 1.00   50.46  ? 485  ARG B C   1 
ATOM   7902 O O   . ARG B 1 485 ? -2.125  24.818  -44.727 1.00   50.76  ? 485  ARG B O   1 
ATOM   7903 C CB  . ARG B 1 485 ? -4.700  22.923  -44.058 1.00   46.98  ? 485  ARG B CB  1 
ATOM   7904 C CG  . ARG B 1 485 ? -5.635  21.916  -44.710 1.00   54.73  ? 485  ARG B CG  1 
ATOM   7905 C CD  . ARG B 1 485 ? -7.098  22.176  -44.355 1.00   53.33  ? 485  ARG B CD  1 
ATOM   7906 N NE  . ARG B 1 485 ? -7.509  21.444  -43.160 1.00   62.96  ? 485  ARG B NE  1 
ATOM   7907 C CZ  . ARG B 1 485 ? -8.304  20.372  -43.161 1.00   63.78  ? 485  ARG B CZ  1 
ATOM   7908 N NH1 . ARG B 1 485 ? -8.794  19.894  -44.304 1.00   52.98  ? 485  ARG B NH1 1 
ATOM   7909 N NH2 . ARG B 1 485 ? -8.614  19.776  -42.007 1.00   54.11  ? 485  ARG B NH2 1 
ATOM   7910 N N   . THR B 1 486 ? -2.080  23.976  -42.629 1.00   46.09  ? 486  THR B N   1 
ATOM   7911 C CA  . THR B 1 486 ? -1.645  25.225  -42.005 1.00   46.10  ? 486  THR B CA  1 
ATOM   7912 C C   . THR B 1 486 ? -0.355  25.138  -41.204 1.00   49.25  ? 486  THR B C   1 
ATOM   7913 O O   . THR B 1 486 ? 0.191   26.160  -40.802 1.00   51.89  ? 486  THR B O   1 
ATOM   7914 C CB  . THR B 1 486 ? -2.719  25.754  -41.033 1.00   50.75  ? 486  THR B CB  1 
ATOM   7915 O OG1 . THR B 1 486 ? -2.909  24.811  -39.969 1.00   47.30  ? 486  THR B OG1 1 
ATOM   7916 C CG2 . THR B 1 486 ? -4.040  25.983  -41.749 1.00   44.01  ? 486  THR B CG2 1 
ATOM   7917 N N   . GLY B 1 487 ? 0.126   23.928  -40.955 1.00   47.00  ? 487  GLY B N   1 
ATOM   7918 C CA  . GLY B 1 487 ? 1.269   23.751  -40.081 1.00   39.99  ? 487  GLY B CA  1 
ATOM   7919 C C   . GLY B 1 487 ? 0.862   23.789  -38.619 1.00   42.98  ? 487  GLY B C   1 
ATOM   7920 O O   . GLY B 1 487 ? 1.713   23.757  -37.732 1.00   43.99  ? 487  GLY B O   1 
ATOM   7921 N N   . ASP B 1 488 ? -0.446  23.843  -38.371 1.00   46.17  ? 488  ASP B N   1 
ATOM   7922 C CA  . ASP B 1 488 ? -0.984  23.963  -37.017 1.00   40.88  ? 488  ASP B CA  1 
ATOM   7923 C C   . ASP B 1 488 ? -2.154  23.003  -36.868 1.00   42.08  ? 488  ASP B C   1 
ATOM   7924 O O   . ASP B 1 488 ? -3.147  23.122  -37.574 1.00   45.87  ? 488  ASP B O   1 
ATOM   7925 C CB  . ASP B 1 488 ? -1.448  25.398  -36.803 1.00   44.93  ? 488  ASP B CB  1 
ATOM   7926 C CG  . ASP B 1 488 ? -1.852  25.692  -35.370 1.00   46.87  ? 488  ASP B CG  1 
ATOM   7927 O OD1 . ASP B 1 488 ? -2.227  24.757  -34.639 1.00   49.60  ? 488  ASP B OD1 1 
ATOM   7928 O OD2 . ASP B 1 488 ? -1.813  26.881  -34.987 1.00   44.76  ? 488  ASP B OD2 1 
ATOM   7929 N N   . PRO B 1 489 ? -2.044  22.041  -35.945 1.00   40.50  ? 489  PRO B N   1 
ATOM   7930 C CA  . PRO B 1 489 ? -3.057  20.982  -35.802 1.00   41.10  ? 489  PRO B CA  1 
ATOM   7931 C C   . PRO B 1 489 ? -4.359  21.479  -35.195 1.00   45.52  ? 489  PRO B C   1 
ATOM   7932 O O   . PRO B 1 489 ? -5.358  20.767  -35.211 1.00   51.85  ? 489  PRO B O   1 
ATOM   7933 C CB  . PRO B 1 489 ? -2.401  20.009  -34.824 1.00   37.68  ? 489  PRO B CB  1 
ATOM   7934 C CG  . PRO B 1 489 ? -1.507  20.904  -33.998 1.00   42.73  ? 489  PRO B CG  1 
ATOM   7935 C CD  . PRO B 1 489 ? -0.919  21.853  -35.014 1.00   39.99  ? 489  PRO B CD  1 
ATOM   7936 N N   . ASN B 1 490 ? -4.349  22.684  -34.647 1.00   49.48  ? 490  ASN B N   1 
ATOM   7937 C CA  . ASN B 1 490 ? -5.527  23.188  -33.951 1.00   54.76  ? 490  ASN B CA  1 
ATOM   7938 C C   . ASN B 1 490 ? -6.678  23.527  -34.888 1.00   55.34  ? 490  ASN B C   1 
ATOM   7939 O O   . ASN B 1 490 ? -6.490  24.182  -35.918 1.00   50.48  ? 490  ASN B O   1 
ATOM   7940 C CB  . ASN B 1 490 ? -5.168  24.401  -33.088 1.00   47.03  ? 490  ASN B CB  1 
ATOM   7941 C CG  . ASN B 1 490 ? -4.325  24.028  -31.898 1.00   48.59  ? 490  ASN B CG  1 
ATOM   7942 O OD1 . ASN B 1 490 ? -4.821  23.458  -30.925 1.00   52.86  ? 490  ASN B OD1 1 
ATOM   7943 N ND2 . ASN B 1 490 ? -3.041  24.345  -31.963 1.00   45.42  ? 490  ASN B ND2 1 
ATOM   7944 N N   . ASP B 1 491 ? -7.872  23.076  -34.521 1.00   61.36  ? 491  ASP B N   1 
ATOM   7945 C CA  . ASP B 1 491 ? -9.074  23.412  -35.271 1.00   67.87  ? 491  ASP B CA  1 
ATOM   7946 C C   . ASP B 1 491 ? -9.331  24.924  -35.190 1.00   69.07  ? 491  ASP B C   1 
ATOM   7947 O O   . ASP B 1 491 ? -9.560  25.463  -34.100 1.00   70.95  ? 491  ASP B O   1 
ATOM   7948 C CB  . ASP B 1 491 ? -10.270 22.623  -34.729 1.00   68.75  ? 491  ASP B CB  1 
ATOM   7949 C CG  . ASP B 1 491 ? -11.332 22.367  -35.786 1.00   74.11  ? 491  ASP B CG  1 
ATOM   7950 O OD1 . ASP B 1 491 ? -11.376 23.104  -36.799 1.00   70.62  ? 491  ASP B OD1 1 
ATOM   7951 O OD2 . ASP B 1 491 ? -12.125 21.417  -35.601 1.00   80.61  ? 491  ASP B OD2 1 
ATOM   7952 N N   . PRO B 1 492 ? -9.292  25.609  -36.349 1.00   68.54  ? 492  PRO B N   1 
ATOM   7953 C CA  . PRO B 1 492 ? -9.497  27.060  -36.455 1.00   72.48  ? 492  PRO B CA  1 
ATOM   7954 C C   . PRO B 1 492 ? -10.970 27.405  -36.268 1.00   77.85  ? 492  PRO B C   1 
ATOM   7955 O O   . PRO B 1 492 ? -11.350 28.578  -36.310 1.00   77.92  ? 492  PRO B O   1 
ATOM   7956 C CB  . PRO B 1 492 ? -9.069  27.382  -37.897 1.00   78.09  ? 492  PRO B CB  1 
ATOM   7957 C CG  . PRO B 1 492 ? -8.544  26.078  -38.485 1.00   75.04  ? 492  PRO B CG  1 
ATOM   7958 C CD  . PRO B 1 492 ? -9.166  24.986  -37.677 1.00   74.15  ? 492  PRO B CD  1 
ATOM   7959 N N   . ARG B 1 493 ? -11.786 26.372  -36.082 1.00   82.02  ? 493  ARG B N   1 
ATOM   7960 C CA  . ARG B 1 493 ? -13.198 26.533  -35.759 1.00   84.66  ? 493  ARG B CA  1 
ATOM   7961 C C   . ARG B 1 493 ? -13.458 25.997  -34.349 1.00   81.27  ? 493  ARG B C   1 
ATOM   7962 O O   . ARG B 1 493 ? -14.513 25.438  -34.065 1.00   83.17  ? 493  ARG B O   1 
ATOM   7963 C CB  . ARG B 1 493 ? -14.078 25.817  -36.794 1.00   75.33  ? 493  ARG B CB  1 
ATOM   7964 N N   . ASP B 1 494 ? -12.475 26.160  -33.471 1.00   82.24  ? 494  ASP B N   1 
ATOM   7965 C CA  . ASP B 1 494 ? -12.643 25.785  -32.075 1.00   82.73  ? 494  ASP B CA  1 
ATOM   7966 C C   . ASP B 1 494 ? -11.909 26.768  -31.172 1.00   78.34  ? 494  ASP B C   1 
ATOM   7967 O O   . ASP B 1 494 ? -12.416 27.854  -30.888 1.00   69.53  ? 494  ASP B O   1 
ATOM   7968 C CB  . ASP B 1 494 ? -12.154 24.359  -31.830 1.00   80.24  ? 494  ASP B CB  1 
ATOM   7969 C CG  . ASP B 1 494 ? -12.662 23.787  -30.517 1.00   92.03  ? 494  ASP B CG  1 
ATOM   7970 O OD1 . ASP B 1 494 ? -12.664 24.515  -29.494 1.00   85.34  ? 494  ASP B OD1 1 
ATOM   7971 O OD2 . ASP B 1 494 ? -13.057 22.600  -30.512 1.00   96.00  ? 494  ASP B OD2 1 
ATOM   7972 N N   . PRO B 1 498 ? -9.176  21.982  -25.115 1.00   64.58  ? 498  PRO B N   1 
ATOM   7973 C CA  . PRO B 1 498 ? -8.365  23.206  -25.117 1.00   59.98  ? 498  PRO B CA  1 
ATOM   7974 C C   . PRO B 1 498 ? -7.494  23.260  -26.362 1.00   63.41  ? 498  PRO B C   1 
ATOM   7975 O O   . PRO B 1 498 ? -7.763  22.538  -27.322 1.00   70.80  ? 498  PRO B O   1 
ATOM   7976 C CB  . PRO B 1 498 ? -7.479  23.056  -23.869 1.00   57.01  ? 498  PRO B CB  1 
ATOM   7977 C CG  . PRO B 1 498 ? -8.068  21.902  -23.081 1.00   58.85  ? 498  PRO B CG  1 
ATOM   7978 C CD  . PRO B 1 498 ? -8.723  21.019  -24.098 1.00   59.38  ? 498  PRO B CD  1 
ATOM   7979 N N   . GLN B 1 499 ? -6.459  24.092  -26.347 1.00   53.94  ? 499  GLN B N   1 
ATOM   7980 C CA  . GLN B 1 499 ? -5.603  24.229  -27.515 1.00   48.62  ? 499  GLN B CA  1 
ATOM   7981 C C   . GLN B 1 499 ? -4.280  23.463  -27.386 1.00   46.61  ? 499  GLN B C   1 
ATOM   7982 O O   . GLN B 1 499 ? -3.726  23.318  -26.298 1.00   42.46  ? 499  GLN B O   1 
ATOM   7983 C CB  . GLN B 1 499 ? -5.365  25.713  -27.847 1.00   54.49  ? 499  GLN B CB  1 
ATOM   7984 N N   . TRP B 1 500 ? -3.799  22.967  -28.520 1.00   41.91  ? 500  TRP B N   1 
ATOM   7985 C CA  . TRP B 1 500 ? -2.539  22.245  -28.606 1.00   42.44  ? 500  TRP B CA  1 
ATOM   7986 C C   . TRP B 1 500 ? -1.374  23.240  -28.744 1.00   38.23  ? 500  TRP B C   1 
ATOM   7987 O O   . TRP B 1 500 ? -1.214  23.859  -29.791 1.00   39.07  ? 500  TRP B O   1 
ATOM   7988 C CB  . TRP B 1 500 ? -2.582  21.339  -29.841 1.00   39.54  ? 500  TRP B CB  1 
ATOM   7989 C CG  . TRP B 1 500 ? -1.493  20.307  -29.915 1.00   36.96  ? 500  TRP B CG  1 
ATOM   7990 C CD1 . TRP B 1 500 ? -0.258  20.358  -29.325 1.00   36.72  ? 500  TRP B CD1 1 
ATOM   7991 C CD2 . TRP B 1 500 ? -1.533  19.083  -30.653 1.00   42.06  ? 500  TRP B CD2 1 
ATOM   7992 N NE1 . TRP B 1 500 ? 0.463   19.235  -29.641 1.00   40.34  ? 500  TRP B NE1 1 
ATOM   7993 C CE2 . TRP B 1 500 ? -0.296  18.434  -30.454 1.00   42.52  ? 500  TRP B CE2 1 
ATOM   7994 C CE3 . TRP B 1 500 ? -2.496  18.470  -31.465 1.00   38.78  ? 500  TRP B CE3 1 
ATOM   7995 C CZ2 . TRP B 1 500 ? -0.001  17.200  -31.031 1.00   42.45  ? 500  TRP B CZ2 1 
ATOM   7996 C CZ3 . TRP B 1 500 ? -2.202  17.248  -32.037 1.00   42.99  ? 500  TRP B CZ3 1 
ATOM   7997 C CH2 . TRP B 1 500 ? -0.964  16.623  -31.815 1.00   43.13  ? 500  TRP B CH2 1 
ATOM   7998 N N   . PRO B 1 501 ? -0.555  23.392  -27.692 1.00   37.71  ? 501  PRO B N   1 
ATOM   7999 C CA  . PRO B 1 501 ? 0.534   24.375  -27.756 1.00   41.12  ? 501  PRO B CA  1 
ATOM   8000 C C   . PRO B 1 501 ? 1.743   23.804  -28.474 1.00   36.90  ? 501  PRO B C   1 
ATOM   8001 O O   . PRO B 1 501 ? 1.950   22.596  -28.437 1.00   39.19  ? 501  PRO B O   1 
ATOM   8002 C CB  . PRO B 1 501 ? 0.908   24.602  -26.280 1.00   33.99  ? 501  PRO B CB  1 
ATOM   8003 C CG  . PRO B 1 501 ? 0.231   23.481  -25.499 1.00   37.98  ? 501  PRO B CG  1 
ATOM   8004 C CD  . PRO B 1 501 ? -0.517  22.598  -26.449 1.00   37.36  ? 501  PRO B CD  1 
ATOM   8005 N N   . PRO B 1 502 ? 2.545   24.667  -29.106 1.00   39.62  ? 502  PRO B N   1 
ATOM   8006 C CA  . PRO B 1 502 ? 3.837   24.256  -29.669 1.00   37.72  ? 502  PRO B CA  1 
ATOM   8007 C C   . PRO B 1 502 ? 4.734   23.665  -28.588 1.00   39.10  ? 502  PRO B C   1 
ATOM   8008 O O   . PRO B 1 502 ? 4.641   24.064  -27.431 1.00   45.26  ? 502  PRO B O   1 
ATOM   8009 C CB  . PRO B 1 502 ? 4.436   25.568  -30.169 1.00   32.05  ? 502  PRO B CB  1 
ATOM   8010 C CG  . PRO B 1 502 ? 3.273   26.474  -30.390 1.00   40.40  ? 502  PRO B CG  1 
ATOM   8011 C CD  . PRO B 1 502 ? 2.226   26.076  -29.389 1.00   39.60  ? 502  PRO B CD  1 
ATOM   8012 N N   . TYR B 1 503 ? 5.574   22.707  -28.954 1.00   37.77  ? 503  TYR B N   1 
ATOM   8013 C CA  . TYR B 1 503 ? 6.571   22.183  -28.041 1.00   37.85  ? 503  TYR B CA  1 
ATOM   8014 C C   . TYR B 1 503 ? 7.769   23.126  -28.090 1.00   40.12  ? 503  TYR B C   1 
ATOM   8015 O O   . TYR B 1 503 ? 8.189   23.543  -29.169 1.00   43.44  ? 503  TYR B O   1 
ATOM   8016 C CB  . TYR B 1 503 ? 6.984   20.766  -28.459 1.00   38.32  ? 503  TYR B CB  1 
ATOM   8017 C CG  . TYR B 1 503 ? 8.118   20.161  -27.642 1.00   38.66  ? 503  TYR B CG  1 
ATOM   8018 C CD1 . TYR B 1 503 ? 9.441   20.430  -27.951 1.00   37.26  ? 503  TYR B CD1 1 
ATOM   8019 C CD2 . TYR B 1 503 ? 7.853   19.315  -26.557 1.00   39.98  ? 503  TYR B CD2 1 
ATOM   8020 C CE1 . TYR B 1 503 ? 10.477  19.879  -27.204 1.00   41.09  ? 503  TYR B CE1 1 
ATOM   8021 C CE2 . TYR B 1 503 ? 8.876   18.757  -25.808 1.00   36.62  ? 503  TYR B CE2 1 
ATOM   8022 C CZ  . TYR B 1 503 ? 10.189  19.046  -26.135 1.00   43.59  ? 503  TYR B CZ  1 
ATOM   8023 O OH  . TYR B 1 503 ? 11.215  18.496  -25.400 1.00   39.56  ? 503  TYR B OH  1 
ATOM   8024 N N   . THR B 1 504 ? 8.313   23.468  -26.925 1.00   42.31  ? 504  THR B N   1 
ATOM   8025 C CA  . THR B 1 504 ? 9.454   24.380  -26.848 1.00   40.52  ? 504  THR B CA  1 
ATOM   8026 C C   . THR B 1 504 ? 10.449  23.794  -25.875 1.00   44.50  ? 504  THR B C   1 
ATOM   8027 O O   . THR B 1 504 ? 10.095  22.939  -25.083 1.00   47.42  ? 504  THR B O   1 
ATOM   8028 C CB  . THR B 1 504 ? 9.043   25.771  -26.346 1.00   41.02  ? 504  THR B CB  1 
ATOM   8029 O OG1 . THR B 1 504 ? 8.556   25.668  -25.002 1.00   41.85  ? 504  THR B OG1 1 
ATOM   8030 C CG2 . THR B 1 504 ? 7.952   26.365  -27.229 1.00   41.88  ? 504  THR B CG2 1 
ATOM   8031 N N   . THR B 1 505 ? 11.695  24.242  -25.931 1.00   48.50  ? 505  THR B N   1 
ATOM   8032 C CA  . THR B 1 505 ? 12.710  23.707  -25.028 1.00   53.24  ? 505  THR B CA  1 
ATOM   8033 C C   . THR B 1 505 ? 12.452  24.202  -23.609 1.00   53.93  ? 505  THR B C   1 
ATOM   8034 O O   . THR B 1 505 ? 12.675  23.479  -22.640 1.00   52.00  ? 505  THR B O   1 
ATOM   8035 C CB  . THR B 1 505 ? 14.139  24.082  -25.478 1.00   49.68  ? 505  THR B CB  1 
ATOM   8036 O OG1 . THR B 1 505 ? 14.179  25.468  -25.842 1.00   59.68  ? 505  THR B OG1 1 
ATOM   8037 C CG2 . THR B 1 505 ? 14.540  23.258  -26.682 1.00   42.56  ? 505  THR B CG2 1 
ATOM   8038 N N   . ALA B 1 506 ? 11.964  25.434  -23.503 1.00   47.65  ? 506  ALA B N   1 
ATOM   8039 C CA  . ALA B 1 506 ? 11.590  26.011  -22.220 1.00   52.28  ? 506  ALA B CA  1 
ATOM   8040 C C   . ALA B 1 506 ? 10.456  25.231  -21.534 1.00   57.83  ? 506  ALA B C   1 
ATOM   8041 O O   . ALA B 1 506 ? 10.688  24.530  -20.543 1.00   56.96  ? 506  ALA B O   1 
ATOM   8042 C CB  . ALA B 1 506 ? 11.197  27.474  -22.401 1.00   49.65  ? 506  ALA B CB  1 
ATOM   8043 N N   . ALA B 1 507 ? 9.238   25.347  -22.067 1.00   45.97  ? 507  ALA B N   1 
ATOM   8044 C CA  . ALA B 1 507 ? 8.061   24.768  -21.420 1.00   44.26  ? 507  ALA B CA  1 
ATOM   8045 C C   . ALA B 1 507 ? 7.872   23.264  -21.687 1.00   46.50  ? 507  ALA B C   1 
ATOM   8046 O O   . ALA B 1 507 ? 7.273   22.560  -20.880 1.00   48.12  ? 507  ALA B O   1 
ATOM   8047 C CB  . ALA B 1 507 ? 6.796   25.556  -21.791 1.00   40.81  ? 507  ALA B CB  1 
ATOM   8048 N N   . GLN B 1 508 ? 8.361   22.783  -22.822 1.00   43.97  ? 508  GLN B N   1 
ATOM   8049 C CA  . GLN B 1 508 ? 8.349   21.351  -23.112 1.00   46.02  ? 508  GLN B CA  1 
ATOM   8050 C C   . GLN B 1 508 ? 6.954   20.719  -23.148 1.00   43.97  ? 508  GLN B C   1 
ATOM   8051 O O   . GLN B 1 508 ? 6.749   19.593  -22.682 1.00   38.88  ? 508  GLN B O   1 
ATOM   8052 C CB  . GLN B 1 508 ? 9.240   20.625  -22.115 1.00   39.03  ? 508  GLN B CB  1 
ATOM   8053 C CG  . GLN B 1 508 ? 10.674  21.089  -22.205 1.00   53.73  ? 508  GLN B CG  1 
ATOM   8054 C CD  . GLN B 1 508 ? 11.599  20.364  -21.249 1.00   53.97  ? 508  GLN B CD  1 
ATOM   8055 O OE1 . GLN B 1 508 ? 11.671  19.131  -21.239 1.00   51.73  ? 508  GLN B OE1 1 
ATOM   8056 N NE2 . GLN B 1 508 ? 12.319  21.131  -20.440 1.00   56.58  ? 508  GLN B NE2 1 
ATOM   8057 N N   . GLN B 1 509 ? 6.000   21.433  -23.723 1.00   38.31  ? 509  GLN B N   1 
ATOM   8058 C CA  . GLN B 1 509 ? 4.617   20.966  -23.710 1.00   42.46  ? 509  GLN B CA  1 
ATOM   8059 C C   . GLN B 1 509 ? 4.228   20.017  -24.844 1.00   40.65  ? 509  GLN B C   1 
ATOM   8060 O O   . GLN B 1 509 ? 4.659   20.168  -25.984 1.00   36.48  ? 509  GLN B O   1 
ATOM   8061 C CB  . GLN B 1 509 ? 3.678   22.155  -23.714 1.00   40.65  ? 509  GLN B CB  1 
ATOM   8062 C CG  . GLN B 1 509 ? 4.022   23.197  -22.685 1.00   46.11  ? 509  GLN B CG  1 
ATOM   8063 C CD  . GLN B 1 509 ? 3.170   24.420  -22.849 1.00   49.07  ? 509  GLN B CD  1 
ATOM   8064 O OE1 . GLN B 1 509 ? 3.471   25.297  -23.663 1.00   50.09  ? 509  GLN B OE1 1 
ATOM   8065 N NE2 . GLN B 1 509 ? 2.087   24.487  -22.090 1.00   43.66  ? 509  GLN B NE2 1 
ATOM   8066 N N   . TYR B 1 510 ? 3.391   19.043  -24.511 1.00   43.19  ? 510  TYR B N   1 
ATOM   8067 C CA  . TYR B 1 510 ? 2.853   18.107  -25.488 1.00   43.26  ? 510  TYR B CA  1 
ATOM   8068 C C   . TYR B 1 510 ? 1.475   17.709  -25.010 1.00   41.38  ? 510  TYR B C   1 
ATOM   8069 O O   . TYR B 1 510 ? 1.114   18.002  -23.874 1.00   43.06  ? 510  TYR B O   1 
ATOM   8070 C CB  . TYR B 1 510 ? 3.746   16.873  -25.605 1.00   37.39  ? 510  TYR B CB  1 
ATOM   8071 C CG  . TYR B 1 510 ? 3.834   16.062  -24.336 1.00   39.90  ? 510  TYR B CG  1 
ATOM   8072 C CD1 . TYR B 1 510 ? 4.710   16.413  -23.316 1.00   47.24  ? 510  TYR B CD1 1 
ATOM   8073 C CD2 . TYR B 1 510 ? 3.042   14.936  -24.158 1.00   44.76  ? 510  TYR B CD2 1 
ATOM   8074 C CE1 . TYR B 1 510 ? 4.791   15.664  -22.152 1.00   45.09  ? 510  TYR B CE1 1 
ATOM   8075 C CE2 . TYR B 1 510 ? 3.119   14.179  -22.999 1.00   45.20  ? 510  TYR B CE2 1 
ATOM   8076 C CZ  . TYR B 1 510 ? 3.993   14.549  -22.006 1.00   43.06  ? 510  TYR B CZ  1 
ATOM   8077 O OH  . TYR B 1 510 ? 4.062   13.789  -20.869 1.00   44.60  ? 510  TYR B OH  1 
ATOM   8078 N N   . VAL B 1 511 ? 0.707   17.037  -25.862 1.00   38.29  ? 511  VAL B N   1 
ATOM   8079 C CA  . VAL B 1 511 ? -0.648  16.655  -25.498 1.00   35.96  ? 511  VAL B CA  1 
ATOM   8080 C C   . VAL B 1 511 ? -0.868  15.139  -25.527 1.00   42.19  ? 511  VAL B C   1 
ATOM   8081 O O   . VAL B 1 511 ? -0.195  14.404  -26.254 1.00   39.43  ? 511  VAL B O   1 
ATOM   8082 C CB  . VAL B 1 511 ? -1.678  17.327  -26.417 1.00   39.53  ? 511  VAL B CB  1 
ATOM   8083 C CG1 . VAL B 1 511 ? -1.456  18.820  -26.457 1.00   31.19  ? 511  VAL B CG1 1 
ATOM   8084 C CG2 . VAL B 1 511 ? -1.599  16.738  -27.814 1.00   43.11  ? 511  VAL B CG2 1 
ATOM   8085 N N   . SER B 1 512 ? -1.800  14.674  -24.704 1.00   38.09  ? 512  SER B N   1 
ATOM   8086 C CA  . SER B 1 512 ? -2.226  13.286  -24.743 1.00   42.38  ? 512  SER B CA  1 
ATOM   8087 C C   . SER B 1 512 ? -3.338  13.161  -25.782 1.00   46.13  ? 512  SER B C   1 
ATOM   8088 O O   . SER B 1 512 ? -4.274  13.970  -25.813 1.00   36.41  ? 512  SER B O   1 
ATOM   8089 C CB  . SER B 1 512 ? -2.749  12.853  -23.376 1.00   42.38  ? 512  SER B CB  1 
ATOM   8090 O OG  . SER B 1 512 ? -3.693  13.802  -22.893 1.00   45.86  ? 512  SER B OG  1 
ATOM   8091 N N   . LEU B 1 513 ? -3.216  12.164  -26.651 1.00   42.70  ? 513  LEU B N   1 
ATOM   8092 C CA  . LEU B 1 513 ? -4.278  11.846  -27.587 1.00   40.44  ? 513  LEU B CA  1 
ATOM   8093 C C   . LEU B 1 513 ? -4.995  10.622  -27.054 1.00   44.95  ? 513  LEU B C   1 
ATOM   8094 O O   . LEU B 1 513 ? -4.401  9.548   -26.943 1.00   43.77  ? 513  LEU B O   1 
ATOM   8095 C CB  . LEU B 1 513 ? -3.700  11.584  -28.969 1.00   42.90  ? 513  LEU B CB  1 
ATOM   8096 C CG  . LEU B 1 513 ? -3.074  12.851  -29.542 1.00   42.70  ? 513  LEU B CG  1 
ATOM   8097 C CD1 . LEU B 1 513 ? -2.540  12.634  -30.959 1.00   36.06  ? 513  LEU B CD1 1 
ATOM   8098 C CD2 . LEU B 1 513 ? -4.134  13.937  -29.517 1.00   39.05  ? 513  LEU B CD2 1 
ATOM   8099 N N   . ASN B 1 514 ? -6.255  10.799  -26.669 1.00   45.45  ? 514  ASN B N   1 
ATOM   8100 C CA  . ASN B 1 514 ? -7.080  9.678   -26.228 1.00   44.36  ? 514  ASN B CA  1 
ATOM   8101 C C   . ASN B 1 514 ? -8.556  10.047  -26.267 1.00   48.33  ? 514  ASN B C   1 
ATOM   8102 O O   . ASN B 1 514 ? -8.927  11.061  -26.862 1.00   46.55  ? 514  ASN B O   1 
ATOM   8103 C CB  . ASN B 1 514 ? -6.654  9.178   -24.846 1.00   42.39  ? 514  ASN B CB  1 
ATOM   8104 C CG  . ASN B 1 514 ? -6.709  10.266  -23.788 1.00   49.11  ? 514  ASN B CG  1 
ATOM   8105 O OD1 . ASN B 1 514 ? -7.705  10.973  -23.664 1.00   50.29  ? 514  ASN B OD1 1 
ATOM   8106 N ND2 . ASN B 1 514 ? -5.636  10.396  -23.009 1.00   48.29  ? 514  ASN B ND2 1 
ATOM   8107 N N   . LEU B 1 515 ? -9.399  9.229   -25.647 1.00   49.19  ? 515  LEU B N   1 
ATOM   8108 C CA  . LEU B 1 515 ? -10.836 9.442   -25.748 1.00   50.22  ? 515  LEU B CA  1 
ATOM   8109 C C   . LEU B 1 515 ? -11.259 10.742  -25.065 1.00   54.44  ? 515  LEU B C   1 
ATOM   8110 O O   . LEU B 1 515 ? -12.116 11.468  -25.580 1.00   53.32  ? 515  LEU B O   1 
ATOM   8111 C CB  . LEU B 1 515 ? -11.596 8.245   -25.190 1.00   56.70  ? 515  LEU B CB  1 
ATOM   8112 C CG  . LEU B 1 515 ? -11.365 6.956   -25.984 1.00   59.33  ? 515  LEU B CG  1 
ATOM   8113 C CD1 . LEU B 1 515 ? -12.046 5.784   -25.302 1.00   56.83  ? 515  LEU B CD1 1 
ATOM   8114 C CD2 . LEU B 1 515 ? -11.845 7.094   -27.433 1.00   52.67  ? 515  LEU B CD2 1 
ATOM   8115 N N   . LYS B 1 516 ? -10.640 11.040  -23.924 1.00   47.62  ? 516  LYS B N   1 
ATOM   8116 C CA  . LYS B 1 516 ? -10.879 12.303  -23.224 1.00   50.20  ? 516  LYS B CA  1 
ATOM   8117 C C   . LYS B 1 516 ? -10.325 13.441  -24.067 1.00   51.52  ? 516  LYS B C   1 
ATOM   8118 O O   . LYS B 1 516 ? -9.475  13.214  -24.926 1.00   49.31  ? 516  LYS B O   1 
ATOM   8119 C CB  . LYS B 1 516 ? -10.205 12.295  -21.850 1.00   50.87  ? 516  LYS B CB  1 
ATOM   8120 C CG  . LYS B 1 516 ? -10.413 11.007  -21.065 1.00   50.94  ? 516  LYS B CG  1 
ATOM   8121 C CD  . LYS B 1 516 ? -10.018 11.191  -19.615 1.00   64.18  ? 516  LYS B CD  1 
ATOM   8122 C CE  . LYS B 1 516 ? -8.607  11.755  -19.502 1.00   81.40  ? 516  LYS B CE  1 
ATOM   8123 N NZ  . LYS B 1 516 ? -8.081  11.686  -18.098 1.00   98.22  ? 516  LYS B NZ  1 
ATOM   8124 N N   . PRO B 1 517 ? -10.794 14.672  -23.822 1.00   48.52  ? 517  PRO B N   1 
ATOM   8125 C CA  . PRO B 1 517 ? -10.316 15.824  -24.598 1.00   52.37  ? 517  PRO B CA  1 
ATOM   8126 C C   . PRO B 1 517 ? -8.831  16.097  -24.359 1.00   48.76  ? 517  PRO B C   1 
ATOM   8127 O O   . PRO B 1 517 ? -8.264  15.625  -23.372 1.00   53.82  ? 517  PRO B O   1 
ATOM   8128 C CB  . PRO B 1 517 ? -11.153 16.995  -24.052 1.00   56.17  ? 517  PRO B CB  1 
ATOM   8129 C CG  . PRO B 1 517 ? -12.239 16.374  -23.221 1.00   49.37  ? 517  PRO B CG  1 
ATOM   8130 C CD  . PRO B 1 517 ? -11.668 15.086  -22.715 1.00   54.26  ? 517  PRO B CD  1 
ATOM   8131 N N   . LEU B 1 518 ? -8.213  16.847  -25.262 1.00   47.28  ? 518  LEU B N   1 
ATOM   8132 C CA  . LEU B 1 518 ? -6.797  17.176  -25.158 1.00   45.17  ? 518  LEU B CA  1 
ATOM   8133 C C   . LEU B 1 518 ? -6.396  17.629  -23.765 1.00   45.31  ? 518  LEU B C   1 
ATOM   8134 O O   . LEU B 1 518 ? -7.038  18.477  -23.159 1.00   48.55  ? 518  LEU B O   1 
ATOM   8135 C CB  . LEU B 1 518 ? -6.427  18.295  -26.138 1.00   44.99  ? 518  LEU B CB  1 
ATOM   8136 C CG  . LEU B 1 518 ? -6.013  17.956  -27.561 1.00   45.32  ? 518  LEU B CG  1 
ATOM   8137 C CD1 . LEU B 1 518 ? -5.185  19.102  -28.127 1.00   44.63  ? 518  LEU B CD1 1 
ATOM   8138 C CD2 . LEU B 1 518 ? -5.221  16.669  -27.590 1.00   42.72  ? 518  LEU B CD2 1 
ATOM   8139 N N   . GLU B 1 519 ? -5.292  17.092  -23.283 1.00   47.82  ? 519  GLU B N   1 
ATOM   8140 C CA  . GLU B 1 519 ? -4.730  17.524  -22.023 1.00   47.65  ? 519  GLU B CA  1 
ATOM   8141 C C   . GLU B 1 519 ? -3.273  17.894  -22.267 1.00   48.64  ? 519  GLU B C   1 
ATOM   8142 O O   . GLU B 1 519 ? -2.559  17.172  -22.953 1.00   53.17  ? 519  GLU B O   1 
ATOM   8143 C CB  . GLU B 1 519 ? -4.854  16.389  -21.007 1.00   52.30  ? 519  GLU B CB  1 
ATOM   8144 C CG  . GLU B 1 519 ? -3.855  16.416  -19.881 1.00   51.74  ? 519  GLU B CG  1 
ATOM   8145 C CD  . GLU B 1 519 ? -4.066  15.256  -18.917 1.00   61.95  ? 519  GLU B CD  1 
ATOM   8146 O OE1 . GLU B 1 519 ? -5.245  14.895  -18.684 1.00   65.85  ? 519  GLU B OE1 1 
ATOM   8147 O OE2 . GLU B 1 519 ? -3.061  14.711  -18.397 1.00   53.42  ? 519  GLU B OE2 1 
ATOM   8148 N N   . VAL B 1 520 ? -2.833  19.026  -21.728 1.00   43.11  ? 520  VAL B N   1 
ATOM   8149 C CA  . VAL B 1 520 ? -1.454  19.455  -21.906 1.00   40.04  ? 520  VAL B CA  1 
ATOM   8150 C C   . VAL B 1 520 ? -0.530  18.947  -20.786 1.00   43.05  ? 520  VAL B C   1 
ATOM   8151 O O   . VAL B 1 520 ? -0.849  19.067  -19.612 1.00   51.39  ? 520  VAL B O   1 
ATOM   8152 C CB  . VAL B 1 520 ? -1.355  20.996  -22.030 1.00   45.15  ? 520  VAL B CB  1 
ATOM   8153 C CG1 . VAL B 1 520 ? 0.081   21.419  -22.286 1.00   40.77  ? 520  VAL B CG1 1 
ATOM   8154 C CG2 . VAL B 1 520 ? -2.269  21.510  -23.140 1.00   38.18  ? 520  VAL B CG2 1 
ATOM   8155 N N   . ARG B 1 521 ? 0.608   18.369  -21.158 1.00   43.01  ? 521  ARG B N   1 
ATOM   8156 C CA  . ARG B 1 521 ? 1.604   17.900  -20.193 1.00   41.64  ? 521  ARG B CA  1 
ATOM   8157 C C   . ARG B 1 521 ? 2.947   18.537  -20.502 1.00   38.50  ? 521  ARG B C   1 
ATOM   8158 O O   . ARG B 1 521 ? 3.143   19.094  -21.574 1.00   41.30  ? 521  ARG B O   1 
ATOM   8159 C CB  . ARG B 1 521 ? 1.748   16.375  -20.232 1.00   42.19  ? 521  ARG B CB  1 
ATOM   8160 C CG  . ARG B 1 521 ? 0.530   15.639  -19.772 1.00   39.75  ? 521  ARG B CG  1 
ATOM   8161 C CD  . ARG B 1 521 ? 0.601   14.141  -19.998 1.00   42.64  ? 521  ARG B CD  1 
ATOM   8162 N NE  . ARG B 1 521 ? -0.752  13.582  -19.948 1.00   50.25  ? 521  ARG B NE  1 
ATOM   8163 C CZ  . ARG B 1 521 ? -1.067  12.317  -20.219 1.00   52.78  ? 521  ARG B CZ  1 
ATOM   8164 N NH1 . ARG B 1 521 ? -0.121  11.450  -20.561 1.00   39.88  ? 521  ARG B NH1 1 
ATOM   8165 N NH2 . ARG B 1 521 ? -2.338  11.923  -20.152 1.00   46.74  ? 521  ARG B NH2 1 
ATOM   8166 N N   . ARG B 1 522 ? 3.872   18.461  -19.557 1.00   42.96  ? 522  ARG B N   1 
ATOM   8167 C CA  . ARG B 1 522 ? 5.174   19.095  -19.725 1.00   44.11  ? 522  ARG B CA  1 
ATOM   8168 C C   . ARG B 1 522 ? 6.248   18.071  -19.467 1.00   40.49  ? 522  ARG B C   1 
ATOM   8169 O O   . ARG B 1 522 ? 6.198   17.355  -18.471 1.00   46.97  ? 522  ARG B O   1 
ATOM   8170 C CB  . ARG B 1 522 ? 5.338   20.296  -18.782 1.00   40.84  ? 522  ARG B CB  1 
ATOM   8171 C CG  . ARG B 1 522 ? 4.444   21.486  -19.146 1.00   53.37  ? 522  ARG B CG  1 
ATOM   8172 C CD  . ARG B 1 522 ? 4.556   22.673  -18.163 1.00   50.22  ? 522  ARG B CD  1 
ATOM   8173 N NE  . ARG B 1 522 ? 5.863   23.326  -18.214 1.00   52.07  ? 522  ARG B NE  1 
ATOM   8174 C CZ  . ARG B 1 522 ? 6.157   24.482  -17.623 1.00   54.22  ? 522  ARG B CZ  1 
ATOM   8175 N NH1 . ARG B 1 522 ? 5.229   25.139  -16.942 1.00   53.67  ? 522  ARG B NH1 1 
ATOM   8176 N NH2 . ARG B 1 522 ? 7.381   24.989  -17.721 1.00   49.09  ? 522  ARG B NH2 1 
ATOM   8177 N N   . GLY B 1 523 ? 7.212   17.996  -20.373 1.00   42.46  ? 523  GLY B N   1 
ATOM   8178 C CA  . GLY B 1 523 ? 8.348   17.117  -20.200 1.00   44.26  ? 523  GLY B CA  1 
ATOM   8179 C C   . GLY B 1 523 ? 8.034   15.727  -20.688 1.00   45.22  ? 523  GLY B C   1 
ATOM   8180 O O   . GLY B 1 523 ? 7.207   15.030  -20.119 1.00   49.96  ? 523  GLY B O   1 
ATOM   8181 N N   . LEU B 1 524 ? 8.701   15.333  -21.763 1.00   50.05  ? 524  LEU B N   1 
ATOM   8182 C CA  . LEU B 1 524 ? 8.504   14.031  -22.377 1.00   46.48  ? 524  LEU B CA  1 
ATOM   8183 C C   . LEU B 1 524 ? 9.546   13.081  -21.802 1.00   45.33  ? 524  LEU B C   1 
ATOM   8184 O O   . LEU B 1 524 ? 10.671  13.029  -22.291 1.00   47.67  ? 524  LEU B O   1 
ATOM   8185 C CB  . LEU B 1 524 ? 8.696   14.187  -23.882 1.00   46.70  ? 524  LEU B CB  1 
ATOM   8186 C CG  . LEU B 1 524 ? 8.127   13.177  -24.867 1.00   59.53  ? 524  LEU B CG  1 
ATOM   8187 C CD1 . LEU B 1 524 ? 6.828   12.574  -24.357 1.00   53.54  ? 524  LEU B CD1 1 
ATOM   8188 C CD2 . LEU B 1 524 ? 7.918   13.882  -26.196 1.00   60.77  ? 524  LEU B CD2 1 
ATOM   8189 N N   . ARG B 1 525 ? 9.181   12.345  -20.754 1.00   42.39  ? 525  ARG B N   1 
ATOM   8190 C CA  . ARG B 1 525 ? 10.152  11.550  -19.996 1.00   45.98  ? 525  ARG B CA  1 
ATOM   8191 C C   . ARG B 1 525 ? 11.423  12.332  -19.712 1.00   43.61  ? 525  ARG B C   1 
ATOM   8192 O O   . ARG B 1 525 ? 12.524  11.833  -19.943 1.00   41.09  ? 525  ARG B O   1 
ATOM   8193 C CB  . ARG B 1 525 ? 10.538  10.291  -20.761 1.00   45.38  ? 525  ARG B CB  1 
ATOM   8194 C CG  . ARG B 1 525 ? 9.390   9.379   -21.038 1.00   56.01  ? 525  ARG B CG  1 
ATOM   8195 C CD  . ARG B 1 525 ? 9.302   8.288   -20.004 1.00   59.13  ? 525  ARG B CD  1 
ATOM   8196 N NE  . ARG B 1 525 ? 8.962   7.032   -20.656 1.00   65.80  ? 525  ARG B NE  1 
ATOM   8197 C CZ  . ARG B 1 525 ? 7.775   6.780   -21.196 1.00   66.23  ? 525  ARG B CZ  1 
ATOM   8198 N NH1 . ARG B 1 525 ? 6.813   7.701   -21.146 1.00   62.18  ? 525  ARG B NH1 1 
ATOM   8199 N NH2 . ARG B 1 525 ? 7.550   5.607   -21.782 1.00   64.08  ? 525  ARG B NH2 1 
ATOM   8200 N N   . ALA B 1 526 ? 11.283  13.552  -19.209 1.00   44.77  ? 526  ALA B N   1 
ATOM   8201 C CA  . ALA B 1 526 ? 12.439  14.434  -19.097 1.00   42.49  ? 526  ALA B CA  1 
ATOM   8202 C C   . ALA B 1 526 ? 13.589  13.821  -18.301 1.00   41.15  ? 526  ALA B C   1 
ATOM   8203 O O   . ALA B 1 526 ? 14.734  13.889  -18.744 1.00   47.22  ? 526  ALA B O   1 
ATOM   8204 C CB  . ALA B 1 526 ? 12.039  15.785  -18.525 1.00   46.34  ? 526  ALA B CB  1 
ATOM   8205 N N   . GLN B 1 527 ? 13.303  13.223  -17.141 1.00   39.49  ? 527  GLN B N   1 
ATOM   8206 C CA  . GLN B 1 527 ? 14.380  12.683  -16.294 1.00   43.47  ? 527  GLN B CA  1 
ATOM   8207 C C   . GLN B 1 527 ? 15.034  11.486  -16.952 1.00   42.60  ? 527  GLN B C   1 
ATOM   8208 O O   . GLN B 1 527 ? 16.260  11.394  -17.017 1.00   39.43  ? 527  GLN B O   1 
ATOM   8209 C CB  . GLN B 1 527 ? 13.892  12.284  -14.885 1.00   40.73  ? 527  GLN B CB  1 
ATOM   8210 C CG  . GLN B 1 527 ? 13.590  13.447  -13.975 1.00   44.27  ? 527  GLN B CG  1 
ATOM   8211 C CD  . GLN B 1 527 ? 14.768  14.401  -13.832 1.00   52.48  ? 527  GLN B CD  1 
ATOM   8212 O OE1 . GLN B 1 527 ? 15.761  14.090  -13.165 1.00   54.86  ? 527  GLN B OE1 1 
ATOM   8213 N NE2 . GLN B 1 527 ? 14.658  15.574  -14.451 1.00   48.47  ? 527  GLN B NE2 1 
ATOM   8214 N N   . THR B 1 528 ? 14.204  10.569  -17.438 1.00   39.76  ? 528  THR B N   1 
ATOM   8215 C CA  . THR B 1 528 ? 14.717  9.338   -18.012 1.00   44.54  ? 528  THR B CA  1 
ATOM   8216 C C   . THR B 1 528 ? 15.407  9.574   -19.360 1.00   44.94  ? 528  THR B C   1 
ATOM   8217 O O   . THR B 1 528 ? 16.401  8.912   -19.675 1.00   46.42  ? 528  THR B O   1 
ATOM   8218 C CB  . THR B 1 528 ? 13.614  8.273   -18.117 1.00   49.55  ? 528  THR B CB  1 
ATOM   8219 O OG1 . THR B 1 528 ? 13.273  7.819   -16.799 1.00   42.97  ? 528  THR B OG1 1 
ATOM   8220 C CG2 . THR B 1 528 ? 14.086  7.085   -18.967 1.00   43.08  ? 528  THR B CG2 1 
ATOM   8221 N N   . CYS B 1 529 ? 14.905  10.525  -20.142 1.00   36.79  ? 529  CYS B N   1 
ATOM   8222 C CA  . CYS B 1 529 ? 15.553  10.853  -21.411 1.00   42.75  ? 529  CYS B CA  1 
ATOM   8223 C C   . CYS B 1 529 ? 16.850  11.648  -21.217 1.00   46.78  ? 529  CYS B C   1 
ATOM   8224 O O   . CYS B 1 529 ? 17.731  11.630  -22.088 1.00   39.89  ? 529  CYS B O   1 
ATOM   8225 C CB  . CYS B 1 529 ? 14.587  11.551  -22.380 1.00   42.82  ? 529  CYS B CB  1 
ATOM   8226 S SG  . CYS B 1 529 ? 13.330  10.410  -23.078 1.00   44.87  ? 529  CYS B SG  1 
ATOM   8227 N N   . ALA B 1 530 ? 16.978  12.322  -20.073 1.00   40.80  ? 530  ALA B N   1 
ATOM   8228 C CA  . ALA B 1 530 ? 18.272  12.898  -19.692 1.00   40.56  ? 530  ALA B CA  1 
ATOM   8229 C C   . ALA B 1 530 ? 19.324  11.796  -19.492 1.00   41.28  ? 530  ALA B C   1 
ATOM   8230 O O   . ALA B 1 530 ? 20.478  11.936  -19.901 1.00   42.29  ? 530  ALA B O   1 
ATOM   8231 C CB  . ALA B 1 530 ? 18.142  13.753  -18.441 1.00   41.22  ? 530  ALA B CB  1 
ATOM   8232 N N   . PHE B 1 531 ? 18.917  10.696  -18.870 1.00   41.47  ? 531  PHE B N   1 
ATOM   8233 C CA  . PHE B 1 531 ? 19.782  9.531   -18.740 1.00   45.26  ? 531  PHE B CA  1 
ATOM   8234 C C   . PHE B 1 531 ? 20.269  9.016   -20.094 1.00   43.64  ? 531  PHE B C   1 
ATOM   8235 O O   . PHE B 1 531 ? 21.470  8.869   -20.317 1.00   46.21  ? 531  PHE B O   1 
ATOM   8236 C CB  . PHE B 1 531 ? 19.067  8.401   -17.997 1.00   39.27  ? 531  PHE B CB  1 
ATOM   8237 C CG  . PHE B 1 531 ? 19.836  7.106   -17.992 1.00   45.09  ? 531  PHE B CG  1 
ATOM   8238 C CD1 . PHE B 1 531 ? 20.962  6.955   -17.195 1.00   46.22  ? 531  PHE B CD1 1 
ATOM   8239 C CD2 . PHE B 1 531 ? 19.443  6.044   -18.792 1.00   43.32  ? 531  PHE B CD2 1 
ATOM   8240 C CE1 . PHE B 1 531 ? 21.672  5.765   -17.186 1.00   47.46  ? 531  PHE B CE1 1 
ATOM   8241 C CE2 . PHE B 1 531 ? 20.155  4.852   -18.795 1.00   43.06  ? 531  PHE B CE2 1 
ATOM   8242 C CZ  . PHE B 1 531 ? 21.265  4.709   -17.988 1.00   45.83  ? 531  PHE B CZ  1 
ATOM   8243 N N   . TRP B 1 532 ? 19.325  8.738   -20.989 1.00   43.38  ? 532  TRP B N   1 
ATOM   8244 C CA  . TRP B 1 532 ? 19.650  8.211   -22.316 1.00   47.68  ? 532  TRP B CA  1 
ATOM   8245 C C   . TRP B 1 532 ? 20.392  9.212   -23.188 1.00   46.49  ? 532  TRP B C   1 
ATOM   8246 O O   . TRP B 1 532 ? 21.410  8.872   -23.805 1.00   42.10  ? 532  TRP B O   1 
ATOM   8247 C CB  . TRP B 1 532 ? 18.385  7.767   -23.052 1.00   42.79  ? 532  TRP B CB  1 
ATOM   8248 C CG  . TRP B 1 532 ? 17.772  6.524   -22.512 1.00   39.22  ? 532  TRP B CG  1 
ATOM   8249 C CD1 . TRP B 1 532 ? 16.648  6.430   -21.759 1.00   41.35  ? 532  TRP B CD1 1 
ATOM   8250 C CD2 . TRP B 1 532 ? 18.251  5.185   -22.688 1.00   37.07  ? 532  TRP B CD2 1 
ATOM   8251 N NE1 . TRP B 1 532 ? 16.385  5.114   -21.460 1.00   45.28  ? 532  TRP B NE1 1 
ATOM   8252 C CE2 . TRP B 1 532 ? 17.355  4.330   -22.025 1.00   36.07  ? 532  TRP B CE2 1 
ATOM   8253 C CE3 . TRP B 1 532 ? 19.350  4.629   -23.349 1.00   39.11  ? 532  TRP B CE3 1 
ATOM   8254 C CZ2 . TRP B 1 532 ? 17.526  2.949   -21.990 1.00   40.10  ? 532  TRP B CZ2 1 
ATOM   8255 C CZ3 . TRP B 1 532 ? 19.510  3.250   -23.326 1.00   38.87  ? 532  TRP B CZ3 1 
ATOM   8256 C CH2 . TRP B 1 532 ? 18.605  2.429   -22.650 1.00   36.52  ? 532  TRP B CH2 1 
ATOM   8257 N N   . ASN B 1 533 ? 19.886  10.444  -23.228 1.00   39.14  ? 533  ASN B N   1 
ATOM   8258 C CA  . ASN B 1 533 ? 20.390  11.430  -24.185 1.00   48.15  ? 533  ASN B CA  1 
ATOM   8259 C C   . ASN B 1 533 ? 21.645  12.156  -23.725 1.00   46.58  ? 533  ASN B C   1 
ATOM   8260 O O   . ASN B 1 533 ? 22.433  12.628  -24.545 1.00   45.10  ? 533  ASN B O   1 
ATOM   8261 C CB  . ASN B 1 533 ? 19.313  12.460  -24.559 1.00   45.36  ? 533  ASN B CB  1 
ATOM   8262 C CG  . ASN B 1 533 ? 18.106  11.834  -25.252 1.00   43.85  ? 533  ASN B CG  1 
ATOM   8263 O OD1 . ASN B 1 533 ? 18.091  10.642  -25.567 1.00   41.67  ? 533  ASN B OD1 1 
ATOM   8264 N ND2 . ASN B 1 533 ? 17.082  12.638  -25.469 1.00   38.73  ? 533  ASN B ND2 1 
ATOM   8265 N N   . ARG B 1 534 ? 21.836  12.241  -22.415 1.00   52.26  ? 534  ARG B N   1 
ATOM   8266 C CA  . ARG B 1 534 ? 22.915  13.062  -21.877 1.00   48.35  ? 534  ARG B CA  1 
ATOM   8267 C C   . ARG B 1 534 ? 24.012  12.266  -21.198 1.00   48.78  ? 534  ARG B C   1 
ATOM   8268 O O   . ARG B 1 534 ? 25.187  12.532  -21.416 1.00   51.47  ? 534  ARG B O   1 
ATOM   8269 C CB  . ARG B 1 534 ? 22.369  14.110  -20.917 1.00   45.57  ? 534  ARG B CB  1 
ATOM   8270 C CG  . ARG B 1 534 ? 21.714  15.292  -21.601 1.00   49.37  ? 534  ARG B CG  1 
ATOM   8271 C CD  . ARG B 1 534 ? 21.134  16.244  -20.568 1.00   45.70  ? 534  ARG B CD  1 
ATOM   8272 N NE  . ARG B 1 534 ? 20.077  17.050  -21.158 1.00   59.32  ? 534  ARG B NE  1 
ATOM   8273 C CZ  . ARG B 1 534 ? 20.243  18.292  -21.602 1.00   58.34  ? 534  ARG B CZ  1 
ATOM   8274 N NH1 . ARG B 1 534 ? 21.433  18.881  -21.505 1.00   54.63  ? 534  ARG B NH1 1 
ATOM   8275 N NH2 . ARG B 1 534 ? 19.213  18.940  -22.133 1.00   49.13  ? 534  ARG B NH2 1 
ATOM   8276 N N   . PHE B 1 535 ? 23.635  11.299  -20.370 1.00   47.41  ? 535  PHE B N   1 
ATOM   8277 C CA  . PHE B 1 535 ? 24.627  10.589  -19.587 1.00   47.61  ? 535  PHE B CA  1 
ATOM   8278 C C   . PHE B 1 535 ? 25.150  9.363   -20.302 1.00   49.59  ? 535  PHE B C   1 
ATOM   8279 O O   . PHE B 1 535 ? 26.357  9.167   -20.419 1.00   52.25  ? 535  PHE B O   1 
ATOM   8280 C CB  . PHE B 1 535 ? 24.087  10.174  -18.222 1.00   43.27  ? 535  PHE B CB  1 
ATOM   8281 C CG  . PHE B 1 535 ? 25.062  9.347   -17.441 1.00   46.77  ? 535  PHE B CG  1 
ATOM   8282 C CD1 . PHE B 1 535 ? 26.208  9.927   -16.908 1.00   40.53  ? 535  PHE B CD1 1 
ATOM   8283 C CD2 . PHE B 1 535 ? 24.863  7.987   -17.277 1.00   44.46  ? 535  PHE B CD2 1 
ATOM   8284 C CE1 . PHE B 1 535 ? 27.117  9.175   -16.211 1.00   40.41  ? 535  PHE B CE1 1 
ATOM   8285 C CE2 . PHE B 1 535 ? 25.774  7.228   -16.581 1.00   44.23  ? 535  PHE B CE2 1 
ATOM   8286 C CZ  . PHE B 1 535 ? 26.902  7.826   -16.043 1.00   43.29  ? 535  PHE B CZ  1 
ATOM   8287 N N   . LEU B 1 536 ? 24.228  8.533   -20.765 1.00   45.90  ? 536  LEU B N   1 
ATOM   8288 C CA  . LEU B 1 536 ? 24.575  7.296   -21.452 1.00   52.04  ? 536  LEU B CA  1 
ATOM   8289 C C   . LEU B 1 536 ? 25.706  7.406   -22.502 1.00   55.93  ? 536  LEU B C   1 
ATOM   8290 O O   . LEU B 1 536 ? 26.566  6.528   -22.572 1.00   59.28  ? 536  LEU B O   1 
ATOM   8291 C CB  . LEU B 1 536 ? 23.317  6.676   -22.054 1.00   53.83  ? 536  LEU B CB  1 
ATOM   8292 C CG  . LEU B 1 536 ? 23.212  5.183   -21.802 1.00   49.99  ? 536  LEU B CG  1 
ATOM   8293 C CD1 . LEU B 1 536 ? 24.126  4.458   -22.757 1.00   65.64  ? 536  LEU B CD1 1 
ATOM   8294 C CD2 . LEU B 1 536 ? 23.583  4.893   -20.363 1.00   51.00  ? 536  LEU B CD2 1 
ATOM   8295 N N   . PRO B 1 537 ? 25.707  8.472   -23.324 1.00   52.04  ? 537  PRO B N   1 
ATOM   8296 C CA  . PRO B 1 537 ? 26.815  8.650   -24.273 1.00   53.91  ? 537  PRO B CA  1 
ATOM   8297 C C   . PRO B 1 537 ? 28.178  8.875   -23.613 1.00   63.95  ? 537  PRO B C   1 
ATOM   8298 O O   . PRO B 1 537 ? 29.136  8.200   -23.998 1.00   68.35  ? 537  PRO B O   1 
ATOM   8299 C CB  . PRO B 1 537 ? 26.401  9.896   -25.067 1.00   53.30  ? 537  PRO B CB  1 
ATOM   8300 C CG  . PRO B 1 537 ? 24.928  9.892   -25.013 1.00   50.12  ? 537  PRO B CG  1 
ATOM   8301 C CD  . PRO B 1 537 ? 24.592  9.388   -23.619 1.00   49.14  ? 537  PRO B CD  1 
ATOM   8302 N N   . LYS B 1 538 ? 28.272  9.809   -22.664 1.00   63.37  ? 538  LYS B N   1 
ATOM   8303 C CA  . LYS B 1 538 ? 29.521  10.045  -21.933 1.00   58.13  ? 538  LYS B CA  1 
ATOM   8304 C C   . LYS B 1 538 ? 30.063  8.732   -21.396 1.00   60.07  ? 538  LYS B C   1 
ATOM   8305 O O   . LYS B 1 538 ? 31.267  8.496   -21.364 1.00   64.89  ? 538  LYS B O   1 
ATOM   8306 C CB  . LYS B 1 538 ? 29.288  10.975  -20.747 1.00   55.92  ? 538  LYS B CB  1 
ATOM   8307 C CG  . LYS B 1 538 ? 28.578  12.271  -21.062 1.00   66.69  ? 538  LYS B CG  1 
ATOM   8308 C CD  . LYS B 1 538 ? 29.539  13.453  -21.080 1.00   80.03  ? 538  LYS B CD  1 
ATOM   8309 C CE  . LYS B 1 538 ? 28.806  14.754  -20.740 1.00   76.67  ? 538  LYS B CE  1 
ATOM   8310 N NZ  . LYS B 1 538 ? 28.031  14.632  -19.457 1.00   73.75  ? 538  LYS B NZ  1 
ATOM   8311 N N   . LEU B 1 539 ? 29.149  7.877   -20.971 1.00   59.25  ? 539  LEU B N   1 
ATOM   8312 C CA  . LEU B 1 539 ? 29.510  6.652   -20.282 1.00   67.10  ? 539  LEU B CA  1 
ATOM   8313 C C   . LEU B 1 539 ? 30.101  5.619   -21.217 1.00   70.80  ? 539  LEU B C   1 
ATOM   8314 O O   . LEU B 1 539 ? 31.150  5.045   -20.932 1.00   79.37  ? 539  LEU B O   1 
ATOM   8315 C CB  . LEU B 1 539 ? 28.283  6.070   -19.595 1.00   62.36  ? 539  LEU B CB  1 
ATOM   8316 C CG  . LEU B 1 539 ? 28.436  4.671   -19.028 1.00   59.35  ? 539  LEU B CG  1 
ATOM   8317 C CD1 . LEU B 1 539 ? 29.270  4.747   -17.774 1.00   64.46  ? 539  LEU B CD1 1 
ATOM   8318 C CD2 . LEU B 1 539 ? 27.063  4.114   -18.724 1.00   60.51  ? 539  LEU B CD2 1 
ATOM   8319 N N   . LEU B 1 540 ? 29.415  5.372   -22.329 1.00   76.25  ? 540  LEU B N   1 
ATOM   8320 C CA  . LEU B 1 540 ? 29.845  4.352   -23.284 1.00   77.30  ? 540  LEU B CA  1 
ATOM   8321 C C   . LEU B 1 540 ? 31.245  4.640   -23.839 1.00   81.91  ? 540  LEU B C   1 
ATOM   8322 O O   . LEU B 1 540 ? 31.992  3.712   -24.173 1.00   85.56  ? 540  LEU B O   1 
ATOM   8323 C CB  . LEU B 1 540 ? 28.821  4.201   -24.411 1.00   76.13  ? 540  LEU B CB  1 
ATOM   8324 C CG  . LEU B 1 540 ? 27.603  3.346   -24.048 1.00   75.70  ? 540  LEU B CG  1 
ATOM   8325 C CD1 . LEU B 1 540 ? 26.480  3.523   -25.069 1.00   69.06  ? 540  LEU B CD1 1 
ATOM   8326 C CD2 . LEU B 1 540 ? 28.000  1.878   -23.915 1.00   66.19  ? 540  LEU B CD2 1 
ATOM   8327 N N   . SER B 1 541 ? 31.595  5.923   -23.926 1.00   73.45  ? 541  SER B N   1 
ATOM   8328 C CA  . SER B 1 541 ? 32.961  6.330   -24.239 1.00   76.83  ? 541  SER B CA  1 
ATOM   8329 C C   . SER B 1 541 ? 33.972  5.677   -23.283 1.00   85.21  ? 541  SER B C   1 
ATOM   8330 O O   . SER B 1 541 ? 34.788  4.842   -23.693 1.00   81.12  ? 541  SER B O   1 
ATOM   8331 C CB  . SER B 1 541 ? 33.088  7.852   -24.167 1.00   75.27  ? 541  SER B CB  1 
ATOM   8332 O OG  . SER B 1 541 ? 31.996  8.473   -24.817 1.00   76.53  ? 541  SER B OG  1 
ATOM   8333 N N   . ALA B 1 542 ? 33.912  6.065   -22.011 1.00   81.83  ? 542  ALA B N   1 
ATOM   8334 C CA  . ALA B 1 542 ? 34.798  5.524   -20.982 1.00   81.46  ? 542  ALA B CA  1 
ATOM   8335 C C   . ALA B 1 542 ? 34.814  3.992   -20.960 1.00   78.79  ? 542  ALA B C   1 
ATOM   8336 O O   . ALA B 1 542 ? 33.765  3.346   -20.901 1.00   77.29  ? 542  ALA B O   1 
ATOM   8337 C CB  . ALA B 1 542 ? 34.401  6.067   -19.618 1.00   89.12  ? 542  ALA B CB  1 
HETATM 8338 C C1  . NAG C 2 .   ? 24.135  35.396  -0.537  1.00   60.39  ? 601  NAG A C1  1 
HETATM 8339 C C2  . NAG C 2 .   ? 24.184  35.881  -1.993  0.77   60.27  ? 601  NAG A C2  1 
HETATM 8340 C C3  . NAG C 2 .   ? 25.396  35.402  -2.783  0.53   62.89  ? 601  NAG A C3  1 
HETATM 8341 C C4  . NAG C 2 .   ? 26.676  35.517  -1.979  1.00   65.02  ? 601  NAG A C4  1 
HETATM 8342 C C5  . NAG C 2 .   ? 26.490  34.884  -0.607  0.60   61.43  ? 601  NAG A C5  1 
HETATM 8343 C C6  . NAG C 2 .   ? 27.750  35.067  0.229   1.00   64.38  ? 601  NAG A C6  1 
HETATM 8344 C C7  . NAG C 2 .   ? 22.249  36.363  -3.357  0.0000 59.76  ? 601  NAG A C7  1 
HETATM 8345 C C8  . NAG C 2 .   ? 21.405  35.850  -4.490  1.00   62.07  ? 601  NAG A C8  1 
HETATM 8346 N N2  . NAG C 2 .   ? 22.988  35.474  -2.703  0.89   59.67  ? 601  NAG A N2  1 
HETATM 8347 O O3  . NAG C 2 .   ? 25.538  36.194  -3.939  0.56   65.04  ? 601  NAG A O3  1 
HETATM 8348 O O4  . NAG C 2 .   ? 27.715  34.883  -2.696  1.00   72.94  ? 601  NAG A O4  1 
HETATM 8349 O O5  . NAG C 2 .   ? 25.405  35.480  0.084   0.65   58.43  ? 601  NAG A O5  1 
HETATM 8350 O O6  . NAG C 2 .   ? 27.827  36.407  0.677   1.00   70.17  ? 601  NAG A O6  1 
HETATM 8351 O O7  . NAG C 2 .   ? 22.249  37.555  -3.059  0.89   59.20  ? 601  NAG A O7  1 
HETATM 8352 C C1  . NAG D 2 .   ? 11.630  34.098  25.817  1.00   90.29  ? 701  NAG A C1  1 
HETATM 8353 C C2  . NAG D 2 .   ? 13.039  34.683  25.671  1.00   85.30  ? 701  NAG A C2  1 
HETATM 8354 C C3  . NAG D 2 .   ? 13.265  35.880  26.594  0.46   91.58  ? 701  NAG A C3  1 
HETATM 8355 C C4  . NAG D 2 .   ? 12.180  36.912  26.316  1.00   95.47  ? 701  NAG A C4  1 
HETATM 8356 C C5  . NAG D 2 .   ? 10.819  36.265  26.552  0.63   96.99  ? 701  NAG A C5  1 
HETATM 8357 C C6  . NAG D 2 .   ? 9.694   37.264  26.285  0.94   104.51 ? 701  NAG A C6  1 
HETATM 8358 C C7  . NAG D 2 .   ? 14.586  32.995  24.890  0.33   82.13  ? 701  NAG A C7  1 
HETATM 8359 C C8  . NAG D 2 .   ? 15.859  32.251  25.175  1.00   75.24  ? 701  NAG A C8  1 
HETATM 8360 N N2  . NAG D 2 .   ? 14.032  33.652  25.907  0.85   84.05  ? 701  NAG A N2  1 
HETATM 8361 O O3  . NAG D 2 .   ? 14.555  36.433  26.403  1.00   91.51  ? 701  NAG A O3  1 
HETATM 8362 O O4  . NAG D 2 .   ? 12.326  38.061  27.132  1.00   93.96  ? 701  NAG A O4  1 
HETATM 8363 O O5  . NAG D 2 .   ? 10.634  35.110  25.744  1.00   95.95  ? 701  NAG A O5  1 
HETATM 8364 O O6  . NAG D 2 .   ? 9.775   37.744  24.958  1.00   104.56 ? 701  NAG A O6  1 
HETATM 8365 O O7  . NAG D 2 .   ? 14.091  32.983  23.762  1.00   82.14  ? 701  NAG A O7  1 
HETATM 8366 C C1  . PEG E 3 .   ? 10.749  2.788   -15.101 1.00   64.13  ? 1543 PEG A C1  1 
HETATM 8367 O O1  . PEG E 3 .   ? 9.526   2.723   -15.857 1.00   67.65  ? 1543 PEG A O1  1 
HETATM 8368 C C2  . PEG E 3 .   ? 11.129  4.234   -14.765 1.00   63.02  ? 1543 PEG A C2  1 
HETATM 8369 O O2  . PEG E 3 .   ? 12.136  4.250   -13.742 1.00   61.72  ? 1543 PEG A O2  1 
HETATM 8370 C C3  . PEG E 3 .   ? 11.608  4.622   -12.473 1.00   55.92  ? 1543 PEG A C3  1 
HETATM 8371 C C4  . PEG E 3 .   ? 11.649  3.430   -11.531 1.00   51.15  ? 1543 PEG A C4  1 
HETATM 8372 O O4  . PEG E 3 .   ? 10.892  3.750   -10.356 1.00   54.44  ? 1543 PEG A O4  1 
HETATM 8373 C C1  . PEG F 3 .   ? 44.743  -2.540  8.356   1.00   56.59  ? 1544 PEG A C1  1 
HETATM 8374 O O1  . PEG F 3 .   ? 46.127  -2.599  7.986   1.00   58.30  ? 1544 PEG A O1  1 
HETATM 8375 C C2  . PEG F 3 .   ? 43.837  -2.825  7.160   1.00   53.44  ? 1544 PEG A C2  1 
HETATM 8376 O O2  . PEG F 3 .   ? 43.324  -4.151  7.271   1.00   64.49  ? 1544 PEG A O2  1 
HETATM 8377 C C3  . PEG F 3 .   ? 42.291  -4.409  6.318   1.00   67.87  ? 1544 PEG A C3  1 
HETATM 8378 C C4  . PEG F 3 .   ? 41.839  -5.867  6.410   1.00   65.76  ? 1544 PEG A C4  1 
HETATM 8379 O O4  . PEG F 3 .   ? 41.990  -6.526  5.143   1.00   80.82  ? 1544 PEG A O4  1 
HETATM 8380 C C7  . ME2 G 4 .   ? 30.409  21.580  9.321   1.00   51.99  ? 1545 ME2 A C7  1 
HETATM 8381 C C6  . ME2 G 4 .   ? 31.660  22.447  9.400   1.00   56.07  ? 1545 ME2 A C6  1 
HETATM 8382 O O3  . ME2 G 4 .   ? 32.803  21.944  8.766   1.00   65.74  ? 1545 ME2 A O3  1 
HETATM 8383 C C5  . ME2 G 4 .   ? 33.867  22.806  8.477   1.00   61.50  ? 1545 ME2 A C5  1 
HETATM 8384 C C4  . ME2 G 4 .   ? 34.484  23.536  9.666   1.00   63.93  ? 1545 ME2 A C4  1 
HETATM 8385 O O2  . ME2 G 4 .   ? 35.269  24.658  9.396   1.00   72.44  ? 1545 ME2 A O2  1 
HETATM 8386 C C3  . ME2 G 4 .   ? 36.132  24.656  8.293   1.00   65.16  ? 1545 ME2 A C3  1 
HETATM 8387 C C2  . ME2 G 4 .   ? 37.479  25.332  8.525   1.00   60.51  ? 1545 ME2 A C2  1 
HETATM 8388 O O1  . ME2 G 4 .   ? 37.891  26.300  7.609   1.00   73.69  ? 1545 ME2 A O1  1 
HETATM 8389 C C1  . ME2 G 4 .   ? 38.742  27.323  8.048   1.00   81.99  ? 1545 ME2 A C1  1 
HETATM 8390 C C13 . P15 H 5 .   ? 16.339  11.799  -11.530 1.00   60.46  ? 1546 P15 A C13 1 
HETATM 8391 O O6  . P15 H 5 .   ? 16.666  10.484  -11.885 1.00   71.12  ? 1546 P15 A O6  1 
HETATM 8392 C C12 . P15 H 5 .   ? 17.864  10.224  -12.572 1.00   60.08  ? 1546 P15 A C12 1 
HETATM 8393 C C11 . P15 H 5 .   ? 18.125  10.933  -13.903 1.00   59.07  ? 1546 P15 A C11 1 
HETATM 8394 O O5  . P15 H 5 .   ? 19.131  10.373  -14.714 1.00   69.48  ? 1546 P15 A O5  1 
HETATM 8395 C C10 . P15 H 5 .   ? 20.280  11.095  -15.089 1.00   55.84  ? 1546 P15 A C10 1 
HETATM 8396 C C9  . P15 H 5 .   ? 21.633  10.360  -15.159 1.00   58.68  ? 1546 P15 A C9  1 
HETATM 8397 O O4  . P15 H 5 .   ? 21.994  9.436   -14.152 1.00   62.02  ? 1546 P15 A O4  1 
HETATM 8398 C C8  . P15 H 5 .   ? 23.241  8.792   -14.191 1.00   44.49  ? 1546 P15 A C8  1 
HETATM 8399 C C7  . P15 H 5 .   ? 23.302  7.263   -14.149 1.00   41.77  ? 1546 P15 A C7  1 
HETATM 8400 O O3  . P15 H 5 .   ? 22.455  6.591   -13.262 1.00   49.35  ? 1546 P15 A O3  1 
HETATM 8401 C C6  . P15 H 5 .   ? 22.708  5.258   -12.934 1.00   47.59  ? 1546 P15 A C6  1 
HETATM 8402 C C5  . P15 H 5 .   ? 21.596  4.447   -12.261 1.00   52.19  ? 1546 P15 A C5  1 
HETATM 8403 O O2  . P15 H 5 .   ? 20.980  4.997   -11.130 1.00   59.01  ? 1546 P15 A O2  1 
HETATM 8404 C C4  . P15 H 5 .   ? 19.845  4.401   -10.550 1.00   53.10  ? 1546 P15 A C4  1 
HETATM 8405 C C3  . P15 H 5 .   ? 18.895  5.272   -9.718  1.00   50.73  ? 1546 P15 A C3  1 
HETATM 8406 O O1  . P15 H 5 .   ? 18.176  6.304   -10.349 1.00   57.81  ? 1546 P15 A O1  1 
HETATM 8407 C C2  . P15 H 5 .   ? 16.821  6.126   -10.684 1.00   58.03  ? 1546 P15 A C2  1 
HETATM 8408 C C1  . P15 H 5 .   ? 16.154  7.121   -11.644 1.00   60.12  ? 1546 P15 A C1  1 
HETATM 8409 O OXT . P15 H 5 .   ? 14.851  6.867   -12.113 1.00   58.32  ? 1546 P15 A OXT 1 
HETATM 8410 C C1  . PEG I 3 .   ? 14.503  15.948  -10.422 1.00   55.30  ? 1547 PEG A C1  1 
HETATM 8411 O O1  . PEG I 3 .   ? 13.365  16.437  -9.699  1.00   68.58  ? 1547 PEG A O1  1 
HETATM 8412 C C2  . PEG I 3 .   ? 15.611  15.507  -9.470  1.00   59.42  ? 1547 PEG A C2  1 
HETATM 8413 O O2  . PEG I 3 .   ? 15.407  14.171  -9.009  1.00   63.82  ? 1547 PEG A O2  1 
HETATM 8414 C C3  . PEG I 3 .   ? 16.331  13.830  -7.972  1.00   54.63  ? 1547 PEG A C3  1 
HETATM 8415 C C4  . PEG I 3 .   ? 15.700  14.062  -6.605  1.00   68.52  ? 1547 PEG A C4  1 
HETATM 8416 O O4  . PEG I 3 .   ? 16.708  13.980  -5.590  1.00   64.67  ? 1547 PEG A O4  1 
HETATM 8417 C C1  . NAG J 2 .   ? 5.053   -17.602 -21.964 1.00   76.31  ? 601  NAG B C1  1 
HETATM 8418 C C2  . NAG J 2 .   ? 6.224   -17.766 -20.995 1.00   72.82  ? 601  NAG B C2  1 
HETATM 8419 C C3  . NAG J 2 .   ? 7.516   -18.213 -21.670 0.98   77.06  ? 601  NAG B C3  1 
HETATM 8420 C C4  . NAG J 2 .   ? 7.269   -19.378 -22.614 0.25   80.16  ? 601  NAG B C4  1 
HETATM 8421 C C5  . NAG J 2 .   ? 6.120   -19.062 -23.562 0.50   78.39  ? 601  NAG B C5  1 
HETATM 8422 C C6  . NAG J 2 .   ? 5.835   -20.270 -24.450 1.00   78.53  ? 601  NAG B C6  1 
HETATM 8423 C C7  . NAG J 2 .   ? 6.335   -16.430 -18.991 0.0000 67.87  ? 601  NAG B C7  1 
HETATM 8424 C C8  . NAG J 2 .   ? 7.296   -15.517 -18.275 1.00   59.21  ? 601  NAG B C8  1 
HETATM 8425 N N2  . NAG J 2 .   ? 6.470   -16.514 -20.309 0.0000 69.80  ? 601  NAG B N2  1 
HETATM 8426 O O3  . NAG J 2 .   ? 8.447   -18.596 -20.677 1.00   79.16  ? 601  NAG B O3  1 
HETATM 8427 O O4  . NAG J 2 .   ? 8.432   -19.643 -23.370 1.00   89.20  ? 601  NAG B O4  1 
HETATM 8428 O O5  . NAG J 2 .   ? 4.947   -18.701 -22.856 0.24   75.12  ? 601  NAG B O5  1 
HETATM 8429 O O6  . NAG J 2 .   ? 4.500   -20.200 -24.894 1.00   79.44  ? 601  NAG B O6  1 
HETATM 8430 O O7  . NAG J 2 .   ? 5.471   -17.070 -18.388 1.00   73.32  ? 601  NAG B O7  1 
HETATM 8431 C C2  . ETX K 6 .   ? 31.237  10.242  -43.984 1.00   65.46  ? 1543 ETX B C2  1 
HETATM 8432 O O2  . ETX K 6 .   ? 30.590  11.448  -43.570 1.00   73.31  ? 1543 ETX B O2  1 
HETATM 8433 C C3  . ETX K 6 .   ? 31.178  12.021  -42.400 1.00   71.69  ? 1543 ETX B C3  1 
HETATM 8434 C C4  . ETX K 6 .   ? 31.565  13.474  -42.670 1.00   70.87  ? 1543 ETX B C4  1 
HETATM 8435 O O1  . ETX K 6 .   ? 31.971  9.033   -45.933 1.00   63.91  ? 1543 ETX B O1  1 
HETATM 8436 C C1  . ETX K 6 .   ? 31.689  10.350  -45.438 1.00   64.61  ? 1543 ETX B C1  1 
HETATM 8437 C C7  . ME2 L 4 .   ? 9.074   -6.676  -35.121 1.00   55.88  ? 1544 ME2 B C7  1 
HETATM 8438 C C6  . ME2 L 4 .   ? 10.250  -7.067  -36.007 1.00   67.35  ? 1544 ME2 B C6  1 
HETATM 8439 O O3  . ME2 L 4 .   ? 11.544  -7.046  -35.472 1.00   62.42  ? 1544 ME2 B O3  1 
HETATM 8440 C C5  . ME2 L 4 .   ? 12.318  -8.208  -35.619 1.00   67.96  ? 1544 ME2 B C5  1 
HETATM 8441 C C4  . ME2 L 4 .   ? 12.477  -8.782  -37.025 1.00   71.06  ? 1544 ME2 B C4  1 
HETATM 8442 O O2  . ME2 L 4 .   ? 12.249  -10.149 -37.248 1.00   78.46  ? 1544 ME2 B O2  1 
HETATM 8443 C C3  . ME2 L 4 .   ? 13.050  -11.114 -36.626 1.00   78.64  ? 1544 ME2 B C3  1 
HETATM 8444 C C2  . ME2 L 4 .   ? 13.520  -12.292 -37.480 1.00   75.80  ? 1544 ME2 B C2  1 
HETATM 8445 O O1  . ME2 L 4 .   ? 14.078  -13.387 -36.802 1.00   90.46  ? 1544 ME2 B O1  1 
HETATM 8446 C C1  . ME2 L 4 .   ? 14.455  -14.535 -37.513 1.00   77.79  ? 1544 ME2 B C1  1 
HETATM 8447 O O   . HOH M 7 .   ? 26.278  11.148  54.901  1.00   46.67  ? 2001 HOH A O   1 
HETATM 8448 O O   . HOH M 7 .   ? 34.686  15.074  53.336  1.00   55.73  ? 2002 HOH A O   1 
HETATM 8449 O O   . HOH M 7 .   ? 19.124  18.506  52.004  1.00   55.32  ? 2003 HOH A O   1 
HETATM 8450 O O   . HOH M 7 .   ? 21.301  19.600  52.679  1.00   57.51  ? 2004 HOH A O   1 
HETATM 8451 O O   . HOH M 7 .   ? 28.819  20.260  50.887  1.00   66.11  ? 2005 HOH A O   1 
HETATM 8452 O O   . HOH M 7 .   ? 21.213  19.466  48.189  1.00   53.48  ? 2006 HOH A O   1 
HETATM 8453 O O   . HOH M 7 .   ? 23.939  19.929  50.508  1.00   50.05  ? 2007 HOH A O   1 
HETATM 8454 O O   . HOH M 7 .   ? 44.543  2.229   37.997  1.00   54.41  ? 2008 HOH A O   1 
HETATM 8455 O O   . HOH M 7 .   ? 25.173  9.623   52.784  1.00   45.64  ? 2009 HOH A O   1 
HETATM 8456 O O   . HOH M 7 .   ? 24.016  8.806   48.357  1.00   40.48  ? 2010 HOH A O   1 
HETATM 8457 O O   . HOH M 7 .   ? 36.409  3.026   45.865  1.00   44.32  ? 2011 HOH A O   1 
HETATM 8458 O O   . HOH M 7 .   ? 28.131  4.629   47.092  1.00   42.79  ? 2012 HOH A O   1 
HETATM 8459 O O   . HOH M 7 .   ? 29.321  2.571   45.929  1.00   33.41  ? 2013 HOH A O   1 
HETATM 8460 O O   . HOH M 7 .   ? 39.560  15.626  39.021  1.00   42.14  ? 2014 HOH A O   1 
HETATM 8461 O O   . HOH M 7 .   ? 33.200  1.346   44.305  1.00   41.90  ? 2015 HOH A O   1 
HETATM 8462 O O   . HOH M 7 .   ? 46.833  1.222   26.970  1.00   64.08  ? 2016 HOH A O   1 
HETATM 8463 O O   . HOH M 7 .   ? 37.595  8.287   50.412  1.00   57.50  ? 2017 HOH A O   1 
HETATM 8464 O O   . HOH M 7 .   ? 41.409  1.326   39.379  1.00   51.03  ? 2018 HOH A O   1 
HETATM 8465 O O   . HOH M 7 .   ? 38.155  3.708   38.094  1.00   46.07  ? 2019 HOH A O   1 
HETATM 8466 O O   . HOH M 7 .   ? 8.036   7.388   -9.636  1.00   60.68  ? 2020 HOH A O   1 
HETATM 8467 O O   . HOH M 7 .   ? 31.091  10.631  48.984  1.00   50.55  ? 2021 HOH A O   1 
HETATM 8468 O O   . HOH M 7 .   ? 46.632  2.760   40.357  1.00   59.18  ? 2022 HOH A O   1 
HETATM 8469 O O   . HOH M 7 .   ? 40.626  14.922  44.558  1.00   54.53  ? 2023 HOH A O   1 
HETATM 8470 O O   . HOH M 7 .   ? 51.956  -1.839  21.098  1.00   70.03  ? 2024 HOH A O   1 
HETATM 8471 O O   . HOH M 7 .   ? 26.093  19.978  46.111  1.00   50.35  ? 2025 HOH A O   1 
HETATM 8472 O O   . HOH M 7 .   ? 23.139  20.176  45.959  1.00   45.89  ? 2026 HOH A O   1 
HETATM 8473 O O   . HOH M 7 .   ? 13.325  21.573  43.133  1.00   67.17  ? 2027 HOH A O   1 
HETATM 8474 O O   . HOH M 7 .   ? 22.555  22.734  44.764  1.00   57.33  ? 2028 HOH A O   1 
HETATM 8475 O O   . HOH M 7 .   ? 32.385  -5.717  31.118  1.00   58.81  ? 2029 HOH A O   1 
HETATM 8476 O O   . HOH M 7 .   ? 33.998  -5.395  37.888  1.00   56.72  ? 2030 HOH A O   1 
HETATM 8477 O O   . HOH M 7 .   ? 19.358  23.901  38.874  1.00   50.64  ? 2031 HOH A O   1 
HETATM 8478 O O   . HOH M 7 .   ? 13.993  23.709  35.302  1.00   59.94  ? 2032 HOH A O   1 
HETATM 8479 O O   . HOH M 7 .   ? 11.215  17.856  34.376  1.00   49.26  ? 2033 HOH A O   1 
HETATM 8480 O O   . HOH M 7 .   ? 23.394  28.852  22.425  1.00   64.27  ? 2034 HOH A O   1 
HETATM 8481 O O   . HOH M 7 .   ? 44.876  8.286   -4.064  1.00   65.03  ? 2035 HOH A O   1 
HETATM 8482 O O   . HOH M 7 .   ? 38.114  28.686  27.184  1.00   46.28  ? 2036 HOH A O   1 
HETATM 8483 O O   . HOH M 7 .   ? 56.271  15.806  28.590  1.00   60.48  ? 2037 HOH A O   1 
HETATM 8484 O O   . HOH M 7 .   ? 36.567  16.790  38.309  1.00   44.61  ? 2038 HOH A O   1 
HETATM 8485 O O   . HOH M 7 .   ? 41.173  25.801  -1.863  1.00   59.98  ? 2039 HOH A O   1 
HETATM 8486 O O   . HOH M 7 .   ? 50.693  17.568  25.850  1.00   52.75  ? 2040 HOH A O   1 
HETATM 8487 O O   . HOH M 7 .   ? 53.898  7.810   28.591  1.00   61.43  ? 2041 HOH A O   1 
HETATM 8488 O O   . HOH M 7 .   ? 50.998  12.124  31.478  1.00   59.19  ? 2042 HOH A O   1 
HETATM 8489 O O   . HOH M 7 .   ? 48.687  11.360  32.779  1.00   56.37  ? 2043 HOH A O   1 
HETATM 8490 O O   . HOH M 7 .   ? 49.882  6.484   28.009  1.00   56.77  ? 2044 HOH A O   1 
HETATM 8491 O O   . HOH M 7 .   ? 28.603  21.053  15.044  1.00   53.31  ? 2045 HOH A O   1 
HETATM 8492 O O   . HOH M 7 .   ? 52.687  9.513   21.605  1.00   44.27  ? 2046 HOH A O   1 
HETATM 8493 O O   . HOH M 7 .   ? 27.097  25.892  -16.455 1.00   55.91  ? 2047 HOH A O   1 
HETATM 8494 O O   . HOH M 7 .   ? 47.081  7.549   17.890  1.00   39.71  ? 2048 HOH A O   1 
HETATM 8495 O O   . HOH M 7 .   ? 48.692  3.843   26.825  1.00   59.94  ? 2049 HOH A O   1 
HETATM 8496 O O   . HOH M 7 .   ? 46.820  8.350   27.162  1.00   49.86  ? 2050 HOH A O   1 
HETATM 8497 O O   . HOH M 7 .   ? 45.589  8.066   29.682  1.00   41.58  ? 2051 HOH A O   1 
HETATM 8498 O O   . HOH M 7 .   ? 9.039   7.862   35.983  1.00   59.99  ? 2052 HOH A O   1 
HETATM 8499 O O   . HOH M 7 .   ? 40.017  3.792   39.494  1.00   54.38  ? 2053 HOH A O   1 
HETATM 8500 O O   . HOH M 7 .   ? 41.943  13.232  35.775  1.00   50.04  ? 2054 HOH A O   1 
HETATM 8501 O O   . HOH M 7 .   ? 49.987  4.856   40.473  1.00   70.24  ? 2055 HOH A O   1 
HETATM 8502 O O   . HOH M 7 .   ? 44.608  9.803   40.779  1.00   57.78  ? 2056 HOH A O   1 
HETATM 8503 O O   . HOH M 7 .   ? 39.776  6.305   46.354  1.00   46.55  ? 2057 HOH A O   1 
HETATM 8504 O O   . HOH M 7 .   ? 38.142  8.878   47.610  1.00   46.36  ? 2058 HOH A O   1 
HETATM 8505 O O   . HOH M 7 .   ? 37.254  15.307  51.206  1.00   47.65  ? 2059 HOH A O   1 
HETATM 8506 O O   . HOH M 7 .   ? 39.588  15.858  46.567  1.00   58.38  ? 2060 HOH A O   1 
HETATM 8507 O O   . HOH M 7 .   ? 50.020  -2.744  14.504  1.00   59.44  ? 2061 HOH A O   1 
HETATM 8508 O O   . HOH M 7 .   ? 48.831  -0.790  18.519  1.00   57.65  ? 2062 HOH A O   1 
HETATM 8509 O O   . HOH M 7 .   ? 33.886  18.114  38.673  1.00   46.80  ? 2063 HOH A O   1 
HETATM 8510 O O   . HOH M 7 .   ? 29.777  21.481  46.134  1.00   61.48  ? 2064 HOH A O   1 
HETATM 8511 O O   . HOH M 7 .   ? 33.822  20.375  40.325  1.00   56.42  ? 2065 HOH A O   1 
HETATM 8512 O O   . HOH M 7 .   ? 45.985  0.822   20.423  1.00   47.44  ? 2066 HOH A O   1 
HETATM 8513 O O   . HOH M 7 .   ? 26.020  23.849  38.477  1.00   62.27  ? 2067 HOH A O   1 
HETATM 8514 O O   . HOH M 7 .   ? 33.065  19.309  29.091  1.00   38.67  ? 2068 HOH A O   1 
HETATM 8515 O O   . HOH M 7 .   ? 34.818  -4.294  30.867  1.00   51.87  ? 2069 HOH A O   1 
HETATM 8516 O O   . HOH M 7 .   ? 33.350  -4.889  35.399  1.00   50.89  ? 2070 HOH A O   1 
HETATM 8517 O O   . HOH M 7 .   ? 38.559  -0.034  33.341  1.00   56.35  ? 2071 HOH A O   1 
HETATM 8518 O O   . HOH M 7 .   ? 26.335  -7.059  29.929  1.00   58.18  ? 2072 HOH A O   1 
HETATM 8519 O O   . HOH M 7 .   ? 27.792  -6.469  35.248  1.00   52.55  ? 2073 HOH A O   1 
HETATM 8520 O O   . HOH M 7 .   ? 36.339  23.822  33.488  1.00   56.41  ? 2074 HOH A O   1 
HETATM 8521 O O   . HOH M 7 .   ? 36.766  1.645   34.459  1.00   46.81  ? 2075 HOH A O   1 
HETATM 8522 O O   . HOH M 7 .   ? 0.314   13.412  18.885  1.00   60.83  ? 2076 HOH A O   1 
HETATM 8523 O O   . HOH M 7 .   ? 41.333  19.140  18.085  1.00   35.13  ? 2077 HOH A O   1 
HETATM 8524 O O   . HOH M 7 .   ? 41.234  16.708  21.533  1.00   37.79  ? 2078 HOH A O   1 
HETATM 8525 O O   . HOH M 7 .   ? 42.181  17.191  23.783  1.00   47.23  ? 2079 HOH A O   1 
HETATM 8526 O O   . HOH M 7 .   ? 14.374  -2.993  32.714  1.00   51.88  ? 2080 HOH A O   1 
HETATM 8527 O O   . HOH M 7 .   ? 24.802  -6.540  37.260  1.00   52.47  ? 2081 HOH A O   1 
HETATM 8528 O O   . HOH M 7 .   ? 17.245  -5.539  30.224  1.00   54.43  ? 2082 HOH A O   1 
HETATM 8529 O O   . HOH M 7 .   ? 24.492  -8.993  30.684  1.00   60.75  ? 2083 HOH A O   1 
HETATM 8530 O O   . HOH M 7 .   ? 40.928  26.412  19.027  1.00   41.87  ? 2084 HOH A O   1 
HETATM 8531 O O   . HOH M 7 .   ? 34.173  23.635  18.543  1.00   36.84  ? 2085 HOH A O   1 
HETATM 8532 O O   . HOH M 7 .   ? 40.389  27.461  16.855  1.00   42.35  ? 2086 HOH A O   1 
HETATM 8533 O O   A HOH M 7 .   ? 26.647  17.371  14.601  0.50   46.85  ? 2087 HOH A O   1 
HETATM 8534 O O   B HOH M 7 .   ? 25.786  19.630  14.773  0.50   48.94  ? 2087 HOH A O   1 
HETATM 8535 O O   . HOH M 7 .   ? 34.455  27.723  11.170  1.00   55.14  ? 2088 HOH A O   1 
HETATM 8536 O O   . HOH M 7 .   ? 21.657  34.410  17.258  1.00   46.18  ? 2089 HOH A O   1 
HETATM 8537 O O   . HOH M 7 .   ? 30.100  25.665  15.710  1.00   47.35  ? 2090 HOH A O   1 
HETATM 8538 O O   . HOH M 7 .   ? 26.205  28.529  23.534  1.00   52.20  ? 2091 HOH A O   1 
HETATM 8539 O O   . HOH M 7 .   ? 23.905  24.036  23.303  1.00   42.63  ? 2092 HOH A O   1 
HETATM 8540 O O   . HOH M 7 .   ? 29.699  20.612  19.069  1.00   30.60  ? 2093 HOH A O   1 
HETATM 8541 O O   . HOH M 7 .   ? 32.180  21.803  21.634  1.00   39.11  ? 2094 HOH A O   1 
HETATM 8542 O O   . HOH M 7 .   ? 36.607  5.539   2.985   1.00   60.30  ? 2095 HOH A O   1 
HETATM 8543 O O   . HOH M 7 .   ? 38.869  8.798   2.538   1.00   47.57  ? 2096 HOH A O   1 
HETATM 8544 O O   . HOH M 7 .   ? 31.951  23.737  16.403  1.00   42.94  ? 2097 HOH A O   1 
HETATM 8545 O O   . HOH M 7 .   ? 33.420  30.992  20.181  1.00   55.93  ? 2098 HOH A O   1 
HETATM 8546 O O   . HOH M 7 .   ? 27.955  26.118  23.798  1.00   50.17  ? 2099 HOH A O   1 
HETATM 8547 O O   . HOH M 7 .   ? 41.281  5.257   -2.254  1.00   61.41  ? 2100 HOH A O   1 
HETATM 8548 O O   . HOH M 7 .   ? 45.018  -0.827  4.536   1.00   59.71  ? 2101 HOH A O   1 
HETATM 8549 O O   . HOH M 7 .   ? 50.664  3.516   4.410   1.00   60.47  ? 2102 HOH A O   1 
HETATM 8550 O O   . HOH M 7 .   ? 43.358  10.427  -4.269  1.00   65.47  ? 2103 HOH A O   1 
HETATM 8551 O O   . HOH M 7 .   ? 50.872  12.991  -1.001  1.00   50.79  ? 2104 HOH A O   1 
HETATM 8552 O O   . HOH M 7 .   ? 53.417  11.336  2.496   1.00   41.77  ? 2105 HOH A O   1 
HETATM 8553 O O   . HOH M 7 .   ? 35.921  27.537  25.792  1.00   46.66  ? 2106 HOH A O   1 
HETATM 8554 O O   . HOH M 7 .   ? 29.403  23.272  34.927  1.00   50.32  ? 2107 HOH A O   1 
HETATM 8555 O O   . HOH M 7 .   ? 39.064  24.978  34.711  1.00   55.38  ? 2108 HOH A O   1 
HETATM 8556 O O   . HOH M 7 .   ? 39.199  28.852  32.387  1.00   41.20  ? 2109 HOH A O   1 
HETATM 8557 O O   . HOH M 7 .   ? 40.079  27.439  26.404  1.00   51.73  ? 2110 HOH A O   1 
HETATM 8558 O O   . HOH M 7 .   ? 64.964  4.798   17.165  1.00   74.53  ? 2111 HOH A O   1 
HETATM 8559 O O   . HOH M 7 .   ? 56.551  2.709   8.365   1.00   61.04  ? 2112 HOH A O   1 
HETATM 8560 O O   . HOH M 7 .   ? 57.743  4.916   7.747   1.00   64.24  ? 2113 HOH A O   1 
HETATM 8561 O O   . HOH M 7 .   ? 43.731  15.491  24.868  1.00   44.46  ? 2114 HOH A O   1 
HETATM 8562 O O   . HOH M 7 .   ? 48.055  21.413  26.292  1.00   46.78  ? 2115 HOH A O   1 
HETATM 8563 O O   . HOH M 7 .   ? 45.815  21.396  27.593  1.00   42.95  ? 2116 HOH A O   1 
HETATM 8564 O O   . HOH M 7 .   ? 46.345  15.006  24.140  1.00   38.32  ? 2117 HOH A O   1 
HETATM 8565 O O   . HOH M 7 .   ? 41.780  13.888  31.509  1.00   36.20  ? 2118 HOH A O   1 
HETATM 8566 O O   . HOH M 7 .   ? 41.400  19.798  35.787  1.00   64.80  ? 2119 HOH A O   1 
HETATM 8567 O O   . HOH M 7 .   ? 56.024  15.845  25.942  1.00   60.57  ? 2120 HOH A O   1 
HETATM 8568 O O   . HOH M 7 .   ? 53.214  20.744  25.077  1.00   50.59  ? 2121 HOH A O   1 
HETATM 8569 O O   . HOH M 7 .   ? 40.538  12.621  33.419  1.00   40.31  ? 2122 HOH A O   1 
HETATM 8570 O O   . HOH M 7 .   ? 41.268  17.597  37.415  1.00   55.01  ? 2123 HOH A O   1 
HETATM 8571 O O   . HOH M 7 .   ? 32.299  17.114  32.554  1.00   36.23  ? 2124 HOH A O   1 
HETATM 8572 O O   . HOH M 7 .   ? 40.308  24.828  0.355   1.00   55.10  ? 2125 HOH A O   1 
HETATM 8573 O O   . HOH M 7 .   ? 43.534  21.233  -1.039  1.00   63.60  ? 2126 HOH A O   1 
HETATM 8574 O O   . HOH M 7 .   ? 40.723  12.062  -6.503  1.00   65.10  ? 2127 HOH A O   1 
HETATM 8575 O O   . HOH M 7 .   ? 37.817  22.677  4.854   0.98   61.59  ? 2128 HOH A O   1 
HETATM 8576 O O   . HOH M 7 .   ? 13.878  12.266  39.862  1.00   49.75  ? 2129 HOH A O   1 
HETATM 8577 O O   . HOH M 7 .   ? 12.989  8.762   42.426  1.00   52.59  ? 2130 HOH A O   1 
HETATM 8578 O O   . HOH M 7 .   ? 41.239  0.376   4.518   0.98   47.85  ? 2131 HOH A O   1 
HETATM 8579 O O   . HOH M 7 .   ? 34.553  4.160   2.007   1.00   66.48  ? 2132 HOH A O   1 
HETATM 8580 O O   . HOH M 7 .   ? 29.078  12.576  24.755  1.00   32.76  ? 2133 HOH A O   1 
HETATM 8581 O O   . HOH M 7 .   ? 35.221  17.324  24.490  1.00   31.42  ? 2134 HOH A O   1 
HETATM 8582 O O   . HOH M 7 .   ? 37.893  15.342  12.493  1.00   40.42  ? 2135 HOH A O   1 
HETATM 8583 O O   . HOH M 7 .   ? 33.328  28.302  -7.720  1.00   53.91  ? 2136 HOH A O   1 
HETATM 8584 O O   . HOH M 7 .   ? 39.685  20.293  16.367  1.00   33.99  ? 2137 HOH A O   1 
HETATM 8585 O O   . HOH M 7 .   ? 33.231  23.831  13.750  1.00   51.43  ? 2138 HOH A O   1 
HETATM 8586 O O   . HOH M 7 .   ? 31.000  21.055  16.584  1.00   39.49  ? 2139 HOH A O   1 
HETATM 8587 O O   . HOH M 7 .   ? 18.690  35.095  -3.007  1.00   60.20  ? 2140 HOH A O   1 
HETATM 8588 O O   . HOH M 7 .   ? 11.246  28.559  2.232   1.00   60.84  ? 2141 HOH A O   1 
HETATM 8589 O O   . HOH M 7 .   ? 25.551  15.283  28.125  1.00   39.88  ? 2142 HOH A O   1 
HETATM 8590 O O   . HOH M 7 .   ? 26.590  28.368  -16.488 1.00   56.37  ? 2143 HOH A O   1 
HETATM 8591 O O   . HOH M 7 .   ? 29.886  25.359  -15.502 1.00   47.29  ? 2144 HOH A O   1 
HETATM 8592 O O   . HOH M 7 .   ? 32.287  27.708  -12.101 1.00   60.44  ? 2145 HOH A O   1 
HETATM 8593 O O   . HOH M 7 .   ? 34.237  25.643  -14.824 1.00   61.83  ? 2146 HOH A O   1 
HETATM 8594 O O   . HOH M 7 .   ? 24.963  18.765  29.016  1.00   36.79  ? 2147 HOH A O   1 
HETATM 8595 O O   . HOH M 7 .   ? 34.410  23.951  -10.144 1.00   47.57  ? 2148 HOH A O   1 
HETATM 8596 O O   . HOH M 7 .   ? 25.136  22.750  29.931  1.00   41.48  ? 2149 HOH A O   1 
HETATM 8597 O O   . HOH M 7 .   ? 25.914  25.062  25.502  1.00   46.94  ? 2150 HOH A O   1 
HETATM 8598 O O   . HOH M 7 .   ? 25.823  15.680  18.506  1.00   38.74  ? 2151 HOH A O   1 
HETATM 8599 O O   . HOH M 7 .   ? 28.822  18.121  20.083  1.00   30.85  ? 2152 HOH A O   1 
HETATM 8600 O O   . HOH M 7 .   ? 39.695  11.199  -8.918  1.00   72.59  ? 2153 HOH A O   1 
HETATM 8601 O O   . HOH M 7 .   ? 23.739  20.600  31.014  1.00   51.42  ? 2154 HOH A O   1 
HETATM 8602 O O   . HOH M 7 .   ? 17.450  15.224  29.148  1.00   40.75  ? 2155 HOH A O   1 
HETATM 8603 O O   . HOH M 7 .   ? 21.922  23.916  36.328  1.00   58.95  ? 2156 HOH A O   1 
HETATM 8604 O O   . HOH M 7 .   ? 21.521  24.607  32.063  1.00   63.51  ? 2157 HOH A O   1 
HETATM 8605 O O   . HOH M 7 .   ? 25.066  22.340  35.026  1.00   44.13  ? 2158 HOH A O   1 
HETATM 8606 O O   . HOH M 7 .   ? 8.965   10.016  37.092  1.00   60.98  ? 2159 HOH A O   1 
HETATM 8607 O O   . HOH M 7 .   ? 8.507   12.093  38.413  1.00   61.23  ? 2160 HOH A O   1 
HETATM 8608 O O   . HOH M 7 .   ? 9.508   27.538  -5.339  1.00   63.44  ? 2161 HOH A O   1 
HETATM 8609 O O   . HOH M 7 .   ? 7.004   8.182   33.090  1.00   64.73  ? 2162 HOH A O   1 
HETATM 8610 O O   . HOH M 7 .   ? 6.803   11.641  34.194  1.00   53.28  ? 2163 HOH A O   1 
HETATM 8611 O O   . HOH M 7 .   ? 9.441   30.294  -4.077  1.00   56.61  ? 2164 HOH A O   1 
HETATM 8612 O O   . HOH M 7 .   ? 8.201   11.879  28.069  1.00   56.67  ? 2165 HOH A O   1 
HETATM 8613 O O   . HOH M 7 .   ? 8.025   5.987   32.379  1.00   64.93  ? 2166 HOH A O   1 
HETATM 8614 O O   . HOH M 7 .   ? 13.998  5.180   37.528  1.00   57.04  ? 2167 HOH A O   1 
HETATM 8615 O O   . HOH M 7 .   ? 31.757  16.954  29.793  1.00   30.77  ? 2168 HOH A O   1 
HETATM 8616 O O   . HOH M 7 .   ? 20.492  -4.434  0.944   1.00   60.55  ? 2169 HOH A O   1 
HETATM 8617 O O   . HOH M 7 .   ? 32.981  14.586  17.219  1.00   28.43  ? 2170 HOH A O   1 
HETATM 8618 O O   . HOH M 7 .   ? 14.638  -11.864 7.316   1.00   61.85  ? 2171 HOH A O   1 
HETATM 8619 O O   . HOH M 7 .   ? 25.632  -11.978 4.128   1.00   66.07  ? 2172 HOH A O   1 
HETATM 8620 O O   . HOH M 7 .   ? 43.757  18.847  16.358  1.00   42.71  ? 2173 HOH A O   1 
HETATM 8621 O O   . HOH M 7 .   ? 45.718  10.440  18.190  1.00   47.69  ? 2174 HOH A O   1 
HETATM 8622 O O   . HOH M 7 .   ? 45.894  12.595  22.478  1.00   41.39  ? 2175 HOH A O   1 
HETATM 8623 O O   . HOH M 7 .   ? 5.181   18.327  9.091   1.00   62.78  ? 2176 HOH A O   1 
HETATM 8624 O O   . HOH M 7 .   ? 42.322  7.684   13.951  1.00   37.79  ? 2177 HOH A O   1 
HETATM 8625 O O   . HOH M 7 .   ? 42.979  9.659   11.250  1.00   36.06  ? 2178 HOH A O   1 
HETATM 8626 O O   . HOH M 7 .   ? 46.180  10.609  10.897  1.00   36.43  ? 2179 HOH A O   1 
HETATM 8627 O O   . HOH M 7 .   ? 13.302  21.430  0.693   1.00   53.75  ? 2180 HOH A O   1 
HETATM 8628 O O   . HOH M 7 .   ? 12.060  24.778  2.231   1.00   55.40  ? 2181 HOH A O   1 
HETATM 8629 O O   . HOH M 7 .   ? 52.598  -1.663  18.499  1.00   68.50  ? 2182 HOH A O   1 
HETATM 8630 O O   . HOH M 7 .   ? 49.745  0.228   16.006  1.00   54.91  ? 2183 HOH A O   1 
HETATM 8631 O O   . HOH M 7 .   ? 45.038  1.317   16.097  1.00   52.30  ? 2184 HOH A O   1 
HETATM 8632 O O   . HOH M 7 .   ? 47.947  1.246   14.193  1.00   48.81  ? 2185 HOH A O   1 
HETATM 8633 O O   . HOH M 7 .   ? 44.010  1.709   18.672  1.00   44.26  ? 2186 HOH A O   1 
HETATM 8634 O O   . HOH M 7 .   ? 10.627  31.237  19.747  1.00   63.82  ? 2187 HOH A O   1 
HETATM 8635 O O   . HOH M 7 .   ? 19.008  25.703  24.589  1.00   51.02  ? 2188 HOH A O   1 
HETATM 8636 O O   . HOH M 7 .   ? 6.539   25.230  14.879  1.00   54.57  ? 2189 HOH A O   1 
HETATM 8637 O O   . HOH M 7 .   ? 1.138   12.499  22.479  1.00   64.64  ? 2190 HOH A O   1 
HETATM 8638 O O   . HOH M 7 .   ? 39.743  1.728   25.937  1.00   43.64  ? 2191 HOH A O   1 
HETATM 8639 O O   . HOH M 7 .   ? 15.110  4.317   30.966  1.00   61.19  ? 2192 HOH A O   1 
HETATM 8640 O O   . HOH M 7 .   ? 40.512  -1.940  23.588  1.00   47.81  ? 2193 HOH A O   1 
HETATM 8641 O O   . HOH M 7 .   ? 28.495  0.065   29.585  1.00   38.46  ? 2194 HOH A O   1 
HETATM 8642 O O   . HOH M 7 .   ? 39.978  -0.652  30.961  1.00   54.69  ? 2195 HOH A O   1 
HETATM 8643 O O   . HOH M 7 .   ? 34.506  -2.848  33.214  1.00   50.02  ? 2196 HOH A O   1 
HETATM 8644 O O   . HOH M 7 .   ? 36.504  6.119   38.496  1.00   52.01  ? 2197 HOH A O   1 
HETATM 8645 O O   . HOH M 7 .   ? 26.702  -6.463  32.551  1.00   54.75  ? 2198 HOH A O   1 
HETATM 8646 O O   . HOH M 7 .   ? 27.777  -1.192  37.464  1.00   29.40  ? 2199 HOH A O   1 
HETATM 8647 O O   . HOH M 7 .   ? 34.049  -1.586  41.647  1.00   43.83  ? 2200 HOH A O   1 
HETATM 8648 O O   . HOH M 7 .   ? 36.686  -1.977  34.697  1.00   50.38  ? 2201 HOH A O   1 
HETATM 8649 O O   . HOH M 7 .   ? 36.371  1.896   36.994  1.00   37.32  ? 2202 HOH A O   1 
HETATM 8650 O O   . HOH M 7 .   ? 0.152   10.802  18.520  1.00   56.49  ? 2203 HOH A O   1 
HETATM 8651 O O   . HOH M 7 .   ? 25.451  4.346   46.213  1.00   45.67  ? 2204 HOH A O   1 
HETATM 8652 O O   . HOH M 7 .   ? 16.890  -2.459  34.225  1.00   48.08  ? 2205 HOH A O   1 
HETATM 8653 O O   . HOH M 7 .   ? 22.191  -6.080  36.826  1.00   53.78  ? 2206 HOH A O   1 
HETATM 8654 O O   . HOH M 7 .   ? 21.561  -8.725  29.284  1.00   55.25  ? 2207 HOH A O   1 
HETATM 8655 O O   . HOH M 7 .   ? 18.998  -5.346  28.111  1.00   46.18  ? 2208 HOH A O   1 
HETATM 8656 O O   . HOH M 7 .   ? 15.970  -3.288  30.075  1.00   46.37  ? 2209 HOH A O   1 
HETATM 8657 O O   . HOH M 7 .   ? 19.385  0.863   28.086  1.00   43.18  ? 2210 HOH A O   1 
HETATM 8658 O O   . HOH M 7 .   ? 12.654  8.448   -13.231 1.00   57.01  ? 2211 HOH A O   1 
HETATM 8659 O O   . HOH M 7 .   ? 32.556  -7.210  14.120  1.00   47.91  ? 2212 HOH A O   1 
HETATM 8660 O O   . HOH M 7 .   ? 36.515  -6.260  16.142  1.00   51.46  ? 2213 HOH A O   1 
HETATM 8661 O O   . HOH M 7 .   ? 26.607  -5.415  21.632  1.00   52.43  ? 2214 HOH A O   1 
HETATM 8662 O O   . HOH M 7 .   ? 28.839  -9.619  23.116  1.00   57.46  ? 2215 HOH A O   1 
HETATM 8663 O O   . HOH M 7 .   ? 25.944  -7.543  25.261  1.00   59.07  ? 2216 HOH A O   1 
HETATM 8664 O O   . HOH M 7 .   ? 31.470  2.304   3.493   1.00   43.42  ? 2217 HOH A O   1 
HETATM 8665 O O   . HOH M 7 .   ? 31.500  6.187   0.505   1.00   49.11  ? 2218 HOH A O   1 
HETATM 8666 O O   . HOH M 7 .   ? 35.354  9.568   0.872   1.00   51.92  ? 2219 HOH A O   1 
HETATM 8667 O O   . HOH M 7 .   ? 36.366  12.868  6.903   1.00   42.04  ? 2220 HOH A O   1 
HETATM 8668 O O   . HOH M 7 .   ? 30.735  8.456   6.682   1.00   34.73  ? 2221 HOH A O   1 
HETATM 8669 O O   . HOH M 7 .   ? 37.495  3.815   4.895   1.00   52.61  ? 2222 HOH A O   1 
HETATM 8670 O O   . HOH M 7 .   ? 33.580  5.055   6.365   1.00   42.26  ? 2223 HOH A O   1 
HETATM 8671 O O   . HOH M 7 .   ? 37.048  9.770   4.378   1.00   39.95  ? 2224 HOH A O   1 
HETATM 8672 O O   . HOH M 7 .   ? 40.841  7.168   2.907   1.00   46.75  ? 2225 HOH A O   1 
HETATM 8673 O O   . HOH M 7 .   ? 42.708  6.371   0.095   1.00   44.80  ? 2226 HOH A O   1 
HETATM 8674 O O   . HOH M 7 .   ? 50.531  7.077   2.560   1.00   48.09  ? 2227 HOH A O   1 
HETATM 8675 O O   . HOH M 7 .   ? 45.718  2.119   3.056   1.00   54.73  ? 2228 HOH A O   1 
HETATM 8676 O O   . HOH M 7 .   ? 48.822  1.605   3.915   1.00   56.65  ? 2229 HOH A O   1 
HETATM 8677 O O   . HOH M 7 .   ? 46.776  8.833   -0.891  1.00   58.01  ? 2230 HOH A O   1 
HETATM 8678 O O   . HOH M 7 .   ? 44.479  11.285  -1.002  1.00   49.14  ? 2231 HOH A O   1 
HETATM 8679 O O   . HOH M 7 .   ? 50.585  3.310   7.331   1.00   57.11  ? 2232 HOH A O   1 
HETATM 8680 O O   . HOH M 7 .   ? 50.490  14.594  1.334   1.00   52.94  ? 2233 HOH A O   1 
HETATM 8681 O O   . HOH M 7 .   ? 46.929  18.091  1.037   1.00   50.64  ? 2234 HOH A O   1 
HETATM 8682 O O   . HOH M 7 .   ? 52.225  8.905   3.660   1.00   48.76  ? 2235 HOH A O   1 
HETATM 8683 O O   . HOH M 7 .   ? 37.976  12.240  4.609   1.00   41.74  ? 2236 HOH A O   1 
HETATM 8684 O O   . HOH M 7 .   ? 39.798  11.548  1.421   1.00   46.95  ? 2237 HOH A O   1 
HETATM 8685 O O   . HOH M 7 .   ? 58.632  21.103  8.230   1.00   48.43  ? 2238 HOH A O   1 
HETATM 8686 O O   . HOH M 7 .   ? 52.098  13.592  3.298   1.00   44.73  ? 2239 HOH A O   1 
HETATM 8687 O O   . HOH M 7 .   ? 54.805  20.244  2.577   1.00   60.78  ? 2240 HOH A O   1 
HETATM 8688 O O   . HOH M 7 .   ? 53.158  25.997  8.386   1.00   42.62  ? 2241 HOH A O   1 
HETATM 8689 O O   . HOH M 7 .   ? 54.457  25.345  14.092  1.00   54.24  ? 2242 HOH A O   1 
HETATM 8690 O O   . HOH M 7 .   ? 60.267  4.097   11.780  1.00   67.17  ? 2243 HOH A O   1 
HETATM 8691 O O   . HOH M 7 .   ? 59.753  4.170   14.378  1.00   56.67  ? 2244 HOH A O   1 
HETATM 8692 O O   . HOH M 7 .   ? 62.873  3.686   16.108  1.00   69.19  ? 2245 HOH A O   1 
HETATM 8693 O O   . HOH M 7 .   ? 56.295  2.884   13.194  1.00   57.74  ? 2246 HOH A O   1 
HETATM 8694 O O   . HOH M 7 .   ? 58.462  4.267   10.088  1.00   65.68  ? 2247 HOH A O   1 
HETATM 8695 O O   . HOH M 7 .   ? 57.580  8.569   19.953  1.00   52.12  ? 2248 HOH A O   1 
HETATM 8696 O O   . HOH M 7 .   ? 52.385  16.352  24.152  1.00   41.57  ? 2249 HOH A O   1 
HETATM 8697 O O   . HOH M 7 .   ? 54.733  18.885  26.228  1.00   59.65  ? 2250 HOH A O   1 
HETATM 8698 O O   . HOH M 7 .   ? 56.674  13.756  25.198  1.00   52.72  ? 2251 HOH A O   1 
HETATM 8699 O O   . HOH M 7 .   ? 54.329  23.008  24.592  1.00   61.05  ? 2252 HOH A O   1 
HETATM 8700 O O   . HOH M 7 .   ? 49.952  22.699  24.783  1.00   53.40  ? 2253 HOH A O   1 
HETATM 8701 O O   . HOH M 7 .   ? 41.381  27.824  21.291  1.00   50.37  ? 2254 HOH A O   1 
HETATM 8702 O O   . HOH M 7 .   ? 48.271  25.541  23.036  1.00   52.43  ? 2255 HOH A O   1 
HETATM 8703 O O   . HOH M 7 .   ? 42.390  27.514  14.764  1.00   50.70  ? 2256 HOH A O   1 
HETATM 8704 O O   . HOH M 7 .   ? 44.558  29.990  12.682  1.00   62.10  ? 2257 HOH A O   1 
HETATM 8705 O O   . HOH M 7 .   ? 40.076  16.595  12.472  1.00   41.23  ? 2258 HOH A O   1 
HETATM 8706 O O   . HOH M 7 .   ? 43.604  24.439  10.151  1.00   50.04  ? 2259 HOH A O   1 
HETATM 8707 O O   . HOH M 7 .   ? 48.659  22.943  2.991   1.00   57.62  ? 2260 HOH A O   1 
HETATM 8708 O O   . HOH M 7 .   ? 37.912  12.519  -1.367  1.00   48.59  ? 2261 HOH A O   1 
HETATM 8709 O O   . HOH M 7 .   ? 40.661  10.517  -3.487  1.00   56.86  ? 2262 HOH A O   1 
HETATM 8710 O O   . HOH M 7 .   ? 41.370  21.608  1.256   1.00   63.71  ? 2263 HOH A O   1 
HETATM 8711 O O   . HOH M 7 .   ? 38.624  15.990  1.014   1.00   46.99  ? 2264 HOH A O   1 
HETATM 8712 O O   . HOH M 7 .   ? 40.980  20.902  -4.514  1.00   54.03  ? 2265 HOH A O   1 
HETATM 8713 O O   . HOH M 7 .   ? 36.810  19.475  -4.877  1.00   47.39  ? 2266 HOH A O   1 
HETATM 8714 O O   . HOH M 7 .   ? 36.478  22.075  -6.562  1.00   49.76  ? 2267 HOH A O   1 
HETATM 8715 O O   . HOH M 7 .   ? 38.226  21.710  2.284   1.00   51.80  ? 2268 HOH A O   1 
HETATM 8716 O O   . HOH M 7 .   ? 38.108  13.709  1.877   1.00   43.97  ? 2269 HOH A O   1 
HETATM 8717 O O   . HOH M 7 .   ? 35.777  12.151  -0.140  1.00   44.68  ? 2270 HOH A O   1 
HETATM 8718 O O   . HOH M 7 .   ? 35.632  19.695  4.721   1.00   50.36  ? 2271 HOH A O   1 
HETATM 8719 O O   . HOH M 7 .   ? 38.787  18.541  10.422  1.00   50.98  ? 2272 HOH A O   1 
HETATM 8720 O O   . HOH M 7 .   ? 44.020  11.337  9.283   1.00   36.18  ? 2273 HOH A O   1 
HETATM 8721 O O   . HOH M 7 .   ? 43.339  0.628   6.094   0.81   43.49  ? 2274 HOH A O   1 
HETATM 8722 O O   . HOH M 7 .   ? 46.264  -3.246  20.114  1.00   57.99  ? 2275 HOH A O   1 
HETATM 8723 O O   . HOH M 7 .   ? 42.615  -0.554  19.227  1.00   46.50  ? 2276 HOH A O   1 
HETATM 8724 O O   . HOH M 7 .   ? 38.733  -5.148  17.346  1.00   53.44  ? 2277 HOH A O   1 
HETATM 8725 O O   . HOH M 7 .   ? 46.115  -1.131  16.805  1.00   49.25  ? 2278 HOH A O   1 
HETATM 8726 O O   . HOH M 7 .   ? 40.898  -7.134  15.105  1.00   59.88  ? 2279 HOH A O   1 
HETATM 8727 O O   . HOH M 7 .   ? 36.528  -4.700  13.831  1.00   38.09  ? 2280 HOH A O   1 
HETATM 8728 O O   . HOH M 7 .   ? 33.435  -0.121  -1.715  1.00   60.63  ? 2281 HOH A O   1 
HETATM 8729 O O   . HOH M 7 .   ? 33.626  1.989   4.460   1.00   53.99  ? 2282 HOH A O   1 
HETATM 8730 O O   . HOH M 7 .   ? 31.468  1.277   -1.943  1.00   59.69  ? 2283 HOH A O   1 
HETATM 8731 O O   . HOH M 7 .   ? 34.634  -1.454  1.530   1.00   57.90  ? 2284 HOH A O   1 
HETATM 8732 O O   . HOH M 7 .   ? 24.265  -6.181  20.931  1.00   62.28  ? 2285 HOH A O   1 
HETATM 8733 O O   . HOH M 7 .   ? 20.852  -12.786 20.936  1.00   77.18  ? 2286 HOH A O   1 
HETATM 8734 O O   . HOH M 7 .   ? 15.161  -7.320  24.098  1.00   58.69  ? 2287 HOH A O   1 
HETATM 8735 O O   . HOH M 7 .   ? 10.841  22.536  6.793   1.00   51.46  ? 2288 HOH A O   1 
HETATM 8736 O O   . HOH M 7 .   ? 18.100  14.946  4.241   1.00   40.28  ? 2289 HOH A O   1 
HETATM 8737 O O   . HOH M 7 .   ? 13.685  16.321  1.722   1.00   53.11  ? 2290 HOH A O   1 
HETATM 8738 O O   . HOH M 7 .   ? 21.770  20.465  7.539   1.00   37.09  ? 2291 HOH A O   1 
HETATM 8739 O O   . HOH M 7 .   ? 19.473  17.896  2.638   1.00   42.52  ? 2292 HOH A O   1 
HETATM 8740 O O   A HOH M 7 .   ? 25.540  22.170  13.829  0.73   48.67  ? 2293 HOH A O   1 
HETATM 8741 O O   B HOH M 7 .   ? 24.535  20.338  12.814  0.27   50.55  ? 2293 HOH A O   1 
HETATM 8742 O O   . HOH M 7 .   ? 29.198  23.954  12.968  1.00   59.91  ? 2294 HOH A O   1 
HETATM 8743 O O   . HOH M 7 .   ? 34.323  27.948  6.396   1.00   65.00  ? 2295 HOH A O   1 
HETATM 8744 O O   . HOH M 7 .   ? 30.240  28.807  1.457   1.00   46.90  ? 2296 HOH A O   1 
HETATM 8745 O O   . HOH M 7 .   ? 29.236  27.454  -6.156  1.00   43.12  ? 2297 HOH A O   1 
HETATM 8746 O O   . HOH M 7 .   ? 29.679  32.716  -0.918  1.00   63.47  ? 2298 HOH A O   1 
HETATM 8747 O O   . HOH M 7 .   ? 13.302  30.381  1.680   1.00   58.83  ? 2299 HOH A O   1 
HETATM 8748 O O   . HOH M 7 .   ? 15.445  31.338  4.067   1.00   47.23  ? 2300 HOH A O   1 
HETATM 8749 O O   . HOH M 7 .   ? 17.877  36.432  -1.022  1.00   64.89  ? 2301 HOH A O   1 
HETATM 8750 O O   . HOH M 7 .   ? 13.625  32.851  -2.353  1.00   55.29  ? 2302 HOH A O   1 
HETATM 8751 O O   . HOH M 7 .   ? 24.827  20.497  -17.161 1.00   59.16  ? 2303 HOH A O   1 
HETATM 8752 O O   . HOH M 7 .   ? 25.321  29.488  -14.739 1.00   45.08  ? 2304 HOH A O   1 
HETATM 8753 O O   . HOH M 7 .   ? 30.759  25.682  -12.705 1.00   50.44  ? 2305 HOH A O   1 
HETATM 8754 O O   . HOH M 7 .   ? 29.714  31.699  -7.051  1.00   48.24  ? 2306 HOH A O   1 
HETATM 8755 O O   . HOH M 7 .   ? 23.735  33.327  -8.221  1.00   57.47  ? 2307 HOH A O   1 
HETATM 8756 O O   . HOH M 7 .   ? 30.278  19.627  -11.581 1.00   52.39  ? 2308 HOH A O   1 
HETATM 8757 O O   . HOH M 7 .   ? 32.313  23.362  -11.950 1.00   46.68  ? 2309 HOH A O   1 
HETATM 8758 O O   . HOH M 7 .   ? 34.071  23.677  -7.457  1.00   44.16  ? 2310 HOH A O   1 
HETATM 8759 O O   . HOH M 7 .   ? 34.995  16.212  -7.418  1.00   51.17  ? 2311 HOH A O   1 
HETATM 8760 O O   . HOH M 7 .   ? 30.334  16.355  1.159   1.00   37.44  ? 2312 HOH A O   1 
HETATM 8761 O O   . HOH M 7 .   ? 38.824  13.895  -7.240  1.00   65.24  ? 2313 HOH A O   1 
HETATM 8762 O O   . HOH M 7 .   ? 38.480  13.168  -13.268 1.00   57.48  ? 2314 HOH A O   1 
HETATM 8763 O O   . HOH M 7 .   ? 35.983  10.754  -15.195 1.00   54.38  ? 2315 HOH A O   1 
HETATM 8764 O O   . HOH M 7 .   ? 28.575  19.881  -17.628 1.00   66.00  ? 2316 HOH A O   1 
HETATM 8765 O O   . HOH M 7 .   ? 14.438  26.526  -15.574 1.00   55.96  ? 2317 HOH A O   1 
HETATM 8766 O O   . HOH M 7 .   ? 10.755  26.944  -7.727  1.00   53.20  ? 2318 HOH A O   1 
HETATM 8767 O O   . HOH M 7 .   ? 12.314  30.436  -3.503  1.00   50.14  ? 2319 HOH A O   1 
HETATM 8768 O O   . HOH M 7 .   ? 12.156  28.582  -1.089  1.00   49.88  ? 2320 HOH A O   1 
HETATM 8769 O O   . HOH M 7 .   ? 17.227  24.027  0.871   1.00   48.57  ? 2321 HOH A O   1 
HETATM 8770 O O   . HOH M 7 .   ? 16.779  19.690  -0.472  1.00   45.29  ? 2322 HOH A O   1 
HETATM 8771 O O   . HOH M 7 .   ? 17.562  21.524  1.988   1.00   43.79  ? 2323 HOH A O   1 
HETATM 8772 O O   . HOH M 7 .   ? 19.344  14.962  1.907   1.00   41.18  ? 2324 HOH A O   1 
HETATM 8773 O O   . HOH M 7 .   ? 26.803  7.966   -0.143  1.00   42.62  ? 2325 HOH A O   1 
HETATM 8774 O O   . HOH M 7 .   ? 26.658  8.920   7.780   1.00   36.53  ? 2326 HOH A O   1 
HETATM 8775 O O   . HOH M 7 .   ? 21.133  0.800   -0.173  1.00   52.18  ? 2327 HOH A O   1 
HETATM 8776 O O   . HOH M 7 .   ? 27.461  3.751   2.394   1.00   42.79  ? 2328 HOH A O   1 
HETATM 8777 O O   . HOH M 7 .   ? 23.814  -2.813  -0.923  1.00   63.97  ? 2329 HOH A O   1 
HETATM 8778 O O   . HOH M 7 .   ? 28.248  1.544   -0.888  1.00   63.52  ? 2330 HOH A O   1 
HETATM 8779 O O   . HOH M 7 .   ? 27.151  -7.389  -1.229  1.00   63.67  ? 2331 HOH A O   1 
HETATM 8780 O O   . HOH M 7 .   ? 16.576  -8.747  10.530  1.00   59.31  ? 2332 HOH A O   1 
HETATM 8781 O O   . HOH M 7 .   ? 17.064  -11.968 8.153   1.00   64.52  ? 2333 HOH A O   1 
HETATM 8782 O O   . HOH M 7 .   ? 21.416  -13.533 9.164   1.00   60.59  ? 2334 HOH A O   1 
HETATM 8783 O O   . HOH M 7 .   ? 25.341  -11.508 6.801   1.00   64.01  ? 2335 HOH A O   1 
HETATM 8784 O O   . HOH M 7 .   ? 14.530  -5.234  11.457  1.00   48.31  ? 2336 HOH A O   1 
HETATM 8785 O O   . HOH M 7 .   ? 7.542   -2.948  16.679  1.00   55.84  ? 2337 HOH A O   1 
HETATM 8786 O O   . HOH M 7 .   ? 11.218  1.467   10.991  1.00   42.57  ? 2338 HOH A O   1 
HETATM 8787 O O   . HOH M 7 .   ? 18.458  12.333  13.373  1.00   34.88  ? 2339 HOH A O   1 
HETATM 8788 O O   . HOH M 7 .   ? 10.937  14.151  4.053   1.00   62.64  ? 2340 HOH A O   1 
HETATM 8789 O O   . HOH M 7 .   ? 14.101  21.041  14.599  1.00   42.27  ? 2341 HOH A O   1 
HETATM 8790 O O   . HOH M 7 .   ? 5.839   20.146  12.040  1.00   52.84  ? 2342 HOH A O   1 
HETATM 8791 O O   . HOH M 7 .   ? 8.362   21.886  10.520  1.00   43.17  ? 2343 HOH A O   1 
HETATM 8792 O O   . HOH M 7 .   ? 11.296  28.020  12.659  1.00   54.88  ? 2344 HOH A O   1 
HETATM 8793 O O   . HOH M 7 .   ? 16.628  25.852  18.056  1.00   51.15  ? 2345 HOH A O   1 
HETATM 8794 O O   . HOH M 7 .   ? 20.351  33.120  10.307  1.00   45.59  ? 2346 HOH A O   1 
HETATM 8795 O O   . HOH M 7 .   ? 19.882  28.066  17.313  1.00   57.73  ? 2347 HOH A O   1 
HETATM 8796 O O   . HOH M 7 .   ? 11.946  25.701  6.651   1.00   55.56  ? 2348 HOH A O   1 
HETATM 8797 O O   . HOH M 7 .   ? 13.721  23.367  1.941   1.00   49.92  ? 2349 HOH A O   1 
HETATM 8798 O O   . HOH M 7 .   ? 32.430  20.976  6.253   1.00   47.95  ? 2350 HOH A O   1 
HETATM 8799 O O   . HOH M 7 .   ? 20.869  15.524  13.015  1.00   38.60  ? 2351 HOH A O   1 
HETATM 8800 O O   . HOH M 7 .   ? 19.045  20.222  18.688  1.00   39.17  ? 2352 HOH A O   1 
HETATM 8801 O O   . HOH M 7 .   ? 9.833   25.634  26.210  1.00   52.47  ? 2353 HOH A O   1 
HETATM 8802 O O   . HOH M 7 .   ? 7.232   21.618  31.850  1.00   55.85  ? 2354 HOH A O   1 
HETATM 8803 O O   . HOH M 7 .   ? 16.164  23.365  33.005  1.00   58.61  ? 2355 HOH A O   1 
HETATM 8804 O O   . HOH M 7 .   ? 8.640   29.431  19.932  1.00   55.43  ? 2356 HOH A O   1 
HETATM 8805 O O   . HOH M 7 .   ? 17.494  25.370  22.393  1.00   57.47  ? 2357 HOH A O   1 
HETATM 8806 O O   . HOH M 7 .   ? 6.562   25.453  26.895  1.00   59.94  ? 2358 HOH A O   1 
HETATM 8807 O O   . HOH M 7 .   ? 4.893   24.467  17.264  1.00   50.63  ? 2359 HOH A O   1 
HETATM 8808 O O   . HOH M 7 .   ? 2.636   17.882  19.268  1.00   48.67  ? 2360 HOH A O   1 
HETATM 8809 O O   . HOH M 7 .   ? 1.941   23.832  16.712  1.00   61.43  ? 2361 HOH A O   1 
HETATM 8810 O O   . HOH M 7 .   ? 2.948   13.657  24.575  1.00   60.34  ? 2362 HOH A O   1 
HETATM 8811 O O   . HOH M 7 .   ? 6.065   12.973  29.547  1.00   55.15  ? 2363 HOH A O   1 
HETATM 8812 O O   . HOH M 7 .   ? 4.011   11.451  25.377  1.00   60.26  ? 2364 HOH A O   1 
HETATM 8813 O O   . HOH M 7 .   ? 3.001   6.751   18.275  1.00   51.94  ? 2365 HOH A O   1 
HETATM 8814 O O   . HOH M 7 .   ? 13.528  3.821   32.933  1.00   51.33  ? 2366 HOH A O   1 
HETATM 8815 O O   . HOH M 7 .   ? 11.110  3.378   33.908  1.00   60.83  ? 2367 HOH A O   1 
HETATM 8816 O O   . HOH M 7 .   ? 8.592   -0.734  24.403  1.00   60.06  ? 2368 HOH A O   1 
HETATM 8817 O O   . HOH M 7 .   ? 1.267   1.006   29.854  1.00   73.07  ? 2369 HOH A O   1 
HETATM 8818 O O   . HOH M 7 .   ? -0.229  2.046   27.265  1.00   75.27  ? 2370 HOH A O   1 
HETATM 8819 O O   . HOH M 7 .   ? 3.519   -2.873  13.382  1.00   63.93  ? 2371 HOH A O   1 
HETATM 8820 O O   . HOH M 7 .   ? 8.359   -7.052  5.909   1.00   60.90  ? 2372 HOH A O   1 
HETATM 8821 O O   . HOH M 7 .   ? 15.168  -7.854  6.222   1.00   64.60  ? 2373 HOH A O   1 
HETATM 8822 O O   . HOH M 7 .   ? 3.401   0.188   5.228   1.00   50.12  ? 2374 HOH A O   1 
HETATM 8823 O O   . HOH M 7 .   ? 9.026   -2.840  6.875   1.00   46.20  ? 2375 HOH A O   1 
HETATM 8824 O O   . HOH M 7 .   ? 9.655   10.675  3.611   1.00   50.14  ? 2376 HOH A O   1 
HETATM 8825 O O   . HOH M 7 .   ? 5.202   11.793  14.462  1.00   43.71  ? 2377 HOH A O   1 
HETATM 8826 O O   . HOH M 7 .   ? 3.607   12.126  11.437  1.00   51.97  ? 2378 HOH A O   1 
HETATM 8827 O O   . HOH M 7 .   ? 1.843   8.867   17.112  1.00   46.33  ? 2379 HOH A O   1 
HETATM 8828 O O   . HOH M 7 .   ? 0.816   5.168   8.996   1.00   48.32  ? 2380 HOH A O   1 
HETATM 8829 O O   . HOH M 7 .   ? 5.651   5.938   1.300   1.00   47.63  ? 2381 HOH A O   1 
HETATM 8830 O O   . HOH M 7 .   ? 9.137   6.978   1.168   1.00   50.17  ? 2382 HOH A O   1 
HETATM 8831 O O   . HOH M 7 .   ? 14.714  1.930   1.925   1.00   51.30  ? 2383 HOH A O   1 
HETATM 8832 O O   . HOH M 7 .   ? 16.663  2.839   0.460   1.00   47.69  ? 2384 HOH A O   1 
HETATM 8833 O O   . HOH M 7 .   ? 12.202  12.533  2.399   1.00   61.45  ? 2385 HOH A O   1 
HETATM 8834 O O   . HOH M 7 .   ? 14.356  14.035  2.893   1.00   60.58  ? 2386 HOH A O   1 
HETATM 8835 O O   . HOH M 7 .   ? 16.453  16.972  1.060   1.00   51.61  ? 2387 HOH A O   1 
HETATM 8836 O O   . HOH M 7 .   ? 12.007  6.148   -1.405  1.00   54.16  ? 2388 HOH A O   1 
HETATM 8837 O O   . HOH M 7 .   ? 17.922  1.697   -2.468  1.00   46.10  ? 2389 HOH A O   1 
HETATM 8838 O O   . HOH M 7 .   ? 11.165  3.272   -6.162  1.00   61.88  ? 2390 HOH A O   1 
HETATM 8839 O O   . HOH M 7 .   ? 12.760  6.142   -4.186  1.00   49.37  ? 2391 HOH A O   1 
HETATM 8840 O O   . HOH M 7 .   ? 14.405  8.346   -4.155  1.00   43.92  ? 2392 HOH A O   1 
HETATM 8841 O O   . HOH M 7 .   ? 28.376  4.615   -1.518  1.00   62.27  ? 2393 HOH A O   1 
HETATM 8842 O O   . HOH M 7 .   ? 26.252  5.626   0.896   1.00   46.52  ? 2394 HOH A O   1 
HETATM 8843 O O   . HOH M 7 .   ? 22.746  -3.675  -7.141  1.00   63.22  ? 2395 HOH A O   1 
HETATM 8844 O O   . HOH M 7 .   ? 38.745  7.459   -13.037 1.00   69.75  ? 2396 HOH A O   1 
HETATM 8845 O O   . HOH M 7 .   ? 23.506  33.349  -3.938  1.00   48.17  ? 2397 HOH A O   1 
HETATM 8846 O O   . HOH M 7 .   ? 25.536  33.936  -5.558  1.00   58.59  ? 2398 HOH A O   1 
HETATM 8847 O O   . HOH M 7 .   ? 26.481  37.956  2.266   1.00   55.04  ? 2399 HOH A O   1 
HETATM 8848 O O   . HOH M 7 .   ? 14.593  39.871  26.115  1.00   70.09  ? 2400 HOH A O   1 
HETATM 8849 O O   . HOH M 7 .   ? 7.255   1.584   -15.617 1.00   64.38  ? 2401 HOH A O   1 
HETATM 8850 O O   . HOH M 7 .   ? 8.877   4.826   -9.478  1.00   52.72  ? 2402 HOH A O   1 
HETATM 8851 O O   . HOH M 7 .   ? 16.643  16.821  -6.979  1.00   53.88  ? 2403 HOH A O   1 
HETATM 8852 O O   . HOH N 7 .   ? 1.492   16.579  -69.703 1.00   52.22  ? 2001 HOH B O   1 
HETATM 8853 O O   . HOH N 7 .   ? -17.900 6.383   -71.847 1.00   80.27  ? 2002 HOH B O   1 
HETATM 8854 O O   . HOH N 7 .   ? -12.156 16.462  -64.093 1.00   74.72  ? 2003 HOH B O   1 
HETATM 8855 O O   . HOH N 7 .   ? 30.511  -3.887  -27.840 1.00   60.89  ? 2004 HOH B O   1 
HETATM 8856 O O   . HOH N 7 .   ? 33.085  -3.921  -27.931 1.00   65.72  ? 2005 HOH B O   1 
HETATM 8857 O O   . HOH N 7 .   ? 0.418   16.533  -67.535 1.00   59.67  ? 2006 HOH B O   1 
HETATM 8858 O O   . HOH N 7 .   ? -5.114  15.518  -66.766 1.00   57.86  ? 2007 HOH B O   1 
HETATM 8859 O O   . HOH N 7 .   ? 8.062   -1.068  -66.920 1.00   38.01  ? 2008 HOH B O   1 
HETATM 8860 O O   . HOH N 7 .   ? 4.356   10.578  -65.131 1.00   47.51  ? 2009 HOH B O   1 
HETATM 8861 O O   . HOH N 7 .   ? 14.612  4.891   -74.347 1.00   48.35  ? 2010 HOH B O   1 
HETATM 8862 O O   . HOH N 7 .   ? -12.452 5.516   -70.072 1.00   78.45  ? 2011 HOH B O   1 
HETATM 8863 O O   . HOH N 7 .   ? -7.848  1.470   -72.781 1.00   60.27  ? 2012 HOH B O   1 
HETATM 8864 O O   . HOH N 7 .   ? -12.632 2.431   -63.044 1.00   58.51  ? 2013 HOH B O   1 
HETATM 8865 O O   . HOH N 7 .   ? -18.755 2.075   -56.160 1.00   72.86  ? 2014 HOH B O   1 
HETATM 8866 O O   . HOH N 7 .   ? -19.344 2.765   -59.014 1.00   75.28  ? 2015 HOH B O   1 
HETATM 8867 O O   . HOH N 7 .   ? 3.808   -0.140  -65.384 1.00   48.15  ? 2016 HOH B O   1 
HETATM 8868 O O   . HOH N 7 .   ? 32.886  -0.383  -32.804 1.00   66.66  ? 2017 HOH B O   1 
HETATM 8869 O O   . HOH N 7 .   ? 30.859  -3.749  -30.425 1.00   63.29  ? 2018 HOH B O   1 
HETATM 8870 O O   . HOH N 7 .   ? 34.121  -4.852  -44.257 1.00   54.13  ? 2019 HOH B O   1 
HETATM 8871 O O   . HOH N 7 .   ? 5.215   7.997   -64.092 1.00   41.95  ? 2020 HOH B O   1 
HETATM 8872 O O   . HOH N 7 .   ? 8.882   9.507   -62.499 1.00   51.90  ? 2021 HOH B O   1 
HETATM 8873 O O   . HOH N 7 .   ? 7.713   0.858   -61.852 1.00   41.27  ? 2022 HOH B O   1 
HETATM 8874 O O   . HOH N 7 .   ? 12.384  -0.963  -68.093 1.00   51.30  ? 2023 HOH B O   1 
HETATM 8875 O O   . HOH N 7 .   ? 9.334   1.212   -68.265 1.00   40.99  ? 2024 HOH B O   1 
HETATM 8876 O O   . HOH N 7 .   ? 15.146  2.474   -61.822 1.00   43.64  ? 2025 HOH B O   1 
HETATM 8877 O O   . HOH N 7 .   ? 19.863  -4.747  -67.798 1.00   60.33  ? 2026 HOH B O   1 
HETATM 8878 O O   . HOH N 7 .   ? -0.869  -2.507  -18.777 1.00   50.01  ? 2027 HOH B O   1 
HETATM 8879 O O   . HOH N 7 .   ? 17.624  -2.930  -55.796 1.00   38.51  ? 2028 HOH B O   1 
HETATM 8880 O O   . HOH N 7 .   ? 17.371  1.152   -60.419 1.00   46.53  ? 2029 HOH B O   1 
HETATM 8881 O O   . HOH N 7 .   ? 20.117  2.224   -63.014 1.00   67.83  ? 2030 HOH B O   1 
HETATM 8882 O O   . HOH N 7 .   ? 7.267   9.635   -65.100 1.00   50.75  ? 2031 HOH B O   1 
HETATM 8883 O O   . HOH N 7 .   ? 5.014   1.085   -69.197 1.00   46.83  ? 2032 HOH B O   1 
HETATM 8884 O O   . HOH N 7 .   ? 12.270  3.524   -74.376 1.00   44.28  ? 2033 HOH B O   1 
HETATM 8885 O O   . HOH N 7 .   ? 7.554   -0.541  -71.682 1.00   36.14  ? 2034 HOH B O   1 
HETATM 8886 O O   . HOH N 7 .   ? 26.388  10.415  -29.989 1.00   59.35  ? 2035 HOH B O   1 
HETATM 8887 O O   . HOH N 7 .   ? 3.051   8.995   -73.399 1.00   51.75  ? 2036 HOH B O   1 
HETATM 8888 O O   . HOH N 7 .   ? -0.524  7.470   -72.760 1.00   49.25  ? 2037 HOH B O   1 
HETATM 8889 O O   . HOH N 7 .   ? -0.958  6.861   -76.836 1.00   60.50  ? 2038 HOH B O   1 
HETATM 8890 O O   . HOH N 7 .   ? -4.969  1.399   -73.660 1.00   52.56  ? 2039 HOH B O   1 
HETATM 8891 O O   . HOH N 7 .   ? -4.812  -1.538  -70.106 1.00   58.25  ? 2040 HOH B O   1 
HETATM 8892 O O   . HOH N 7 .   ? -6.451  0.741   -69.688 1.00   61.94  ? 2041 HOH B O   1 
HETATM 8893 O O   . HOH N 7 .   ? 22.132  5.426   -61.373 1.00   58.76  ? 2042 HOH B O   1 
HETATM 8894 O O   . HOH N 7 .   ? -1.508  -1.607  -64.566 1.00   59.53  ? 2043 HOH B O   1 
HETATM 8895 O O   . HOH N 7 .   ? -2.992  -1.078  -61.436 1.00   49.99  ? 2044 HOH B O   1 
HETATM 8896 O O   . HOH N 7 .   ? -3.757  -4.005  -66.532 1.00   53.28  ? 2045 HOH B O   1 
HETATM 8897 O O   . HOH N 7 .   ? -1.327  -3.327  -60.614 1.00   53.17  ? 2046 HOH B O   1 
HETATM 8898 O O   . HOH N 7 .   ? 22.826  15.362  -54.405 1.00   55.41  ? 2047 HOH B O   1 
HETATM 8899 O O   . HOH N 7 .   ? 0.934   -0.477  -63.437 1.00   50.71  ? 2048 HOH B O   1 
HETATM 8900 O O   . HOH N 7 .   ? 0.832   -6.508  -60.861 1.00   63.16  ? 2049 HOH B O   1 
HETATM 8901 O O   . HOH N 7 .   ? 0.708   0.036   -55.842 1.00   42.93  ? 2050 HOH B O   1 
HETATM 8902 O O   . HOH N 7 .   ? 2.295   21.343  -61.299 1.00   56.83  ? 2051 HOH B O   1 
HETATM 8903 O O   . HOH N 7 .   ? 0.192   -7.154  -57.526 1.00   55.89  ? 2052 HOH B O   1 
HETATM 8904 O O   . HOH N 7 .   ? 13.067  13.465  -62.286 1.00   62.44  ? 2053 HOH B O   1 
HETATM 8905 O O   . HOH N 7 .   ? 0.836   19.209  -64.580 1.00   57.03  ? 2054 HOH B O   1 
HETATM 8906 O O   . HOH N 7 .   ? -14.100 7.376   -22.264 1.00   66.67  ? 2055 HOH B O   1 
HETATM 8907 O O   . HOH N 7 .   ? 14.311  -7.418  -48.516 1.00   42.22  ? 2056 HOH B O   1 
HETATM 8908 O O   . HOH N 7 .   ? 12.834  -4.920  -51.419 1.00   42.57  ? 2057 HOH B O   1 
HETATM 8909 O O   . HOH N 7 .   ? 4.448   -5.606  -46.074 1.00   36.05  ? 2058 HOH B O   1 
HETATM 8910 O O   . HOH N 7 .   ? 6.827   -8.315  -44.359 1.00   42.32  ? 2059 HOH B O   1 
HETATM 8911 O O   . HOH N 7 .   ? 15.353  -15.981 -40.138 1.00   64.47  ? 2060 HOH B O   1 
HETATM 8912 O O   . HOH N 7 .   ? 11.036  -14.582 -45.818 1.00   52.33  ? 2061 HOH B O   1 
HETATM 8913 O O   . HOH N 7 .   ? 4.450   -2.882  -35.940 1.00   64.00  ? 2062 HOH B O   1 
HETATM 8914 O O   . HOH N 7 .   ? 3.853   -13.978 -37.654 1.00   53.09  ? 2063 HOH B O   1 
HETATM 8915 O O   . HOH N 7 .   ? 9.200   -13.401 -38.132 1.00   58.78  ? 2064 HOH B O   1 
HETATM 8916 O O   . HOH N 7 .   ? 0.185   26.510  -48.185 1.00   53.08  ? 2065 HOH B O   1 
HETATM 8917 O O   . HOH N 7 .   ? 4.467   -8.863  -39.374 1.00   51.43  ? 2066 HOH B O   1 
HETATM 8918 O O   . HOH N 7 .   ? -3.144  -3.801  -42.594 1.00   50.19  ? 2067 HOH B O   1 
HETATM 8919 O O   . HOH N 7 .   ? 22.857  4.912   -30.472 1.00   58.12  ? 2068 HOH B O   1 
HETATM 8920 O O   . HOH N 7 .   ? 4.642   -3.866  -42.518 1.00   36.52  ? 2069 HOH B O   1 
HETATM 8921 O O   . HOH N 7 .   ? 6.370   -8.031  -41.485 1.00   45.65  ? 2070 HOH B O   1 
HETATM 8922 O O   . HOH N 7 .   ? -1.615  -7.460  -44.739 1.00   48.02  ? 2071 HOH B O   1 
HETATM 8923 O O   . HOH N 7 .   ? 30.064  0.963   -36.012 1.00   45.73  ? 2072 HOH B O   1 
HETATM 8924 O O   . HOH N 7 .   ? -0.286  -12.679 -49.738 1.00   55.98  ? 2073 HOH B O   1 
HETATM 8925 O O   . HOH N 7 .   ? 1.937   -12.281 -46.847 1.00   49.61  ? 2074 HOH B O   1 
HETATM 8926 O O   . HOH N 7 .   ? 31.923  -2.567  -35.513 1.00   66.09  ? 2075 HOH B O   1 
HETATM 8927 O O   . HOH N 7 .   ? 31.609  -3.054  -32.944 1.00   68.68  ? 2076 HOH B O   1 
HETATM 8928 O O   . HOH N 7 .   ? -4.979  -6.916  -47.310 1.00   57.54  ? 2077 HOH B O   1 
HETATM 8929 O O   . HOH N 7 .   ? 33.544  4.924   -47.359 1.00   61.63  ? 2078 HOH B O   1 
HETATM 8930 O O   . HOH N 7 .   ? 34.495  -7.225  -43.228 1.00   47.68  ? 2079 HOH B O   1 
HETATM 8931 O O   . HOH N 7 .   ? 2.546   -12.140 -50.946 1.00   61.34  ? 2080 HOH B O   1 
HETATM 8932 O O   . HOH N 7 .   ? -5.997  -3.549  -55.420 1.00   50.72  ? 2081 HOH B O   1 
HETATM 8933 O O   . HOH N 7 .   ? 31.258  -12.474 -39.391 1.00   54.36  ? 2082 HOH B O   1 
HETATM 8934 O O   . HOH N 7 .   ? 1.833   -16.801 -56.892 1.00   70.85  ? 2083 HOH B O   1 
HETATM 8935 O O   . HOH N 7 .   ? 4.539   -13.464 -53.369 1.00   57.67  ? 2084 HOH B O   1 
HETATM 8936 O O   . HOH N 7 .   ? 37.211  -0.875  -51.931 1.00   66.12  ? 2085 HOH B O   1 
HETATM 8937 O O   . HOH N 7 .   ? 13.256  -4.290  -55.478 1.00   45.18  ? 2086 HOH B O   1 
HETATM 8938 O O   . HOH N 7 .   ? 16.803  -8.050  -59.869 1.00   47.27  ? 2087 HOH B O   1 
HETATM 8939 O O   . HOH N 7 .   ? 15.558  -4.821  -56.837 1.00   39.36  ? 2088 HOH B O   1 
HETATM 8940 O O   . HOH N 7 .   ? 9.019   -1.002  -60.615 1.00   40.20  ? 2089 HOH B O   1 
HETATM 8941 O O   . HOH N 7 .   ? 10.389  -5.924  -64.236 1.00   34.87  ? 2090 HOH B O   1 
HETATM 8942 O O   . HOH N 7 .   ? 5.447   -5.634  -60.632 1.00   51.28  ? 2091 HOH B O   1 
HETATM 8943 O O   . HOH N 7 .   ? 6.713   -0.301  -64.307 1.00   46.03  ? 2092 HOH B O   1 
HETATM 8944 O O   . HOH N 7 .   ? 28.999  7.778   -39.477 1.00   51.98  ? 2093 HOH B O   1 
HETATM 8945 O O   . HOH N 7 .   ? -10.074 12.759  -59.932 1.00   58.71  ? 2094 HOH B O   1 
HETATM 8946 O O   . HOH N 7 .   ? 29.403  12.941  -52.474 1.00   63.23  ? 2095 HOH B O   1 
HETATM 8947 O O   . HOH N 7 .   ? 30.396  9.264   -52.569 1.00   64.52  ? 2096 HOH B O   1 
HETATM 8948 O O   . HOH N 7 .   ? -8.176  19.094  -61.590 1.00   66.05  ? 2097 HOH B O   1 
HETATM 8949 O O   . HOH N 7 .   ? -13.440 21.217  -54.960 1.00   69.93  ? 2098 HOH B O   1 
HETATM 8950 O O   . HOH N 7 .   ? -9.761  21.597  -51.773 1.00   59.52  ? 2099 HOH B O   1 
HETATM 8951 O O   . HOH N 7 .   ? 4.269   4.446   -48.139 1.00   32.53  ? 2100 HOH B O   1 
HETATM 8952 O O   . HOH N 7 .   ? -2.705  0.548   -21.848 1.00   61.22  ? 2101 HOH B O   1 
HETATM 8953 O O   . HOH N 7 .   ? 1.166   -1.707  -19.537 1.00   48.19  ? 2102 HOH B O   1 
HETATM 8954 O O   . HOH N 7 .   ? 2.392   -0.190  -18.382 1.00   55.03  ? 2103 HOH B O   1 
HETATM 8955 O O   . HOH N 7 .   ? 4.227   2.009   -40.692 1.00   40.45  ? 2104 HOH B O   1 
HETATM 8956 O O   . HOH N 7 .   ? 13.414  -8.052  -45.990 1.00   43.08  ? 2105 HOH B O   1 
HETATM 8957 O O   . HOH N 7 .   ? 6.525   -5.440  -41.226 1.00   49.14  ? 2106 HOH B O   1 
HETATM 8958 O O   . HOH N 7 .   ? 10.354  -0.152  -43.907 1.00   37.74  ? 2107 HOH B O   1 
HETATM 8959 O O   . HOH N 7 .   ? 6.713   -2.642  -50.391 1.00   45.66  ? 2108 HOH B O   1 
HETATM 8960 O O   . HOH N 7 .   ? -5.322  -2.461  -48.678 1.00   53.37  ? 2109 HOH B O   1 
HETATM 8961 O O   . HOH N 7 .   ? 1.698   -2.685  -52.898 1.00   40.55  ? 2110 HOH B O   1 
HETATM 8962 O O   . HOH N 7 .   ? 16.711  -15.258 -20.276 1.00   58.48  ? 2111 HOH B O   1 
HETATM 8963 O O   . HOH N 7 .   ? -3.629  0.992   -48.405 1.00   41.58  ? 2112 HOH B O   1 
HETATM 8964 O O   . HOH N 7 .   ? 22.258  -12.882 -20.356 1.00   64.38  ? 2113 HOH B O   1 
HETATM 8965 O O   . HOH N 7 .   ? -3.619  -5.575  -45.098 1.00   52.88  ? 2114 HOH B O   1 
HETATM 8966 O O   . HOH N 7 .   ? -10.357 -3.119  -47.940 1.00   67.31  ? 2115 HOH B O   1 
HETATM 8967 O O   . HOH N 7 .   ? 4.367   -1.092  -43.407 1.00   36.32  ? 2116 HOH B O   1 
HETATM 8968 O O   . HOH N 7 .   ? -8.922  -0.087  -45.219 1.00   56.74  ? 2117 HOH B O   1 
HETATM 8969 O O   . HOH N 7 .   ? -7.606  19.084  -47.280 1.00   53.07  ? 2118 HOH B O   1 
HETATM 8970 O O   . HOH N 7 .   ? -12.533 14.127  -39.492 1.00   53.12  ? 2119 HOH B O   1 
HETATM 8971 O O   . HOH N 7 .   ? -14.196 18.933  -48.231 1.00   56.67  ? 2120 HOH B O   1 
HETATM 8972 O O   . HOH N 7 .   ? -1.334  3.908   -48.708 1.00   42.46  ? 2121 HOH B O   1 
HETATM 8973 O O   . HOH N 7 .   ? 1.517   -0.001  -53.048 1.00   44.53  ? 2122 HOH B O   1 
HETATM 8974 O O   . HOH N 7 .   ? 24.354  9.520   -29.047 1.00   54.21  ? 2123 HOH B O   1 
HETATM 8975 O O   . HOH N 7 .   ? 20.921  -1.531  -52.141 1.00   47.32  ? 2124 HOH B O   1 
HETATM 8976 O O   . HOH N 7 .   ? 25.083  -2.900  -46.456 1.00   43.70  ? 2125 HOH B O   1 
HETATM 8977 O O   . HOH N 7 .   ? -4.810  -12.140 -25.632 1.00   59.90  ? 2126 HOH B O   1 
HETATM 8978 O O   . HOH N 7 .   ? 25.501  4.860   -58.426 1.00   59.00  ? 2127 HOH B O   1 
HETATM 8979 O O   . HOH N 7 .   ? 32.944  1.496   -57.915 1.00   62.54  ? 2128 HOH B O   1 
HETATM 8980 O O   . HOH N 7 .   ? 27.480  1.068   -62.867 1.00   67.36  ? 2129 HOH B O   1 
HETATM 8981 O O   . HOH N 7 .   ? 24.685  5.977   -60.823 1.00   65.67  ? 2130 HOH B O   1 
HETATM 8982 O O   . HOH N 7 .   ? 28.144  5.502   -51.319 1.00   51.74  ? 2131 HOH B O   1 
HETATM 8983 O O   . HOH N 7 .   ? 25.031  6.837   -51.130 1.00   41.95  ? 2132 HOH B O   1 
HETATM 8984 O O   . HOH N 7 .   ? 22.956  0.518   -52.727 1.00   46.70  ? 2133 HOH B O   1 
HETATM 8985 O O   . HOH N 7 .   ? 22.805  7.126   -52.680 1.00   47.26  ? 2134 HOH B O   1 
HETATM 8986 O O   . HOH N 7 .   ? -13.045 -7.950  -37.651 1.00   64.90  ? 2135 HOH B O   1 
HETATM 8987 O O   . HOH N 7 .   ? 21.724  2.087   -47.336 1.00   42.60  ? 2136 HOH B O   1 
HETATM 8988 O O   . HOH N 7 .   ? -10.587 19.797  -31.512 1.00   60.44  ? 2137 HOH B O   1 
HETATM 8989 O O   . HOH N 7 .   ? 16.014  9.717   -56.481 1.00   44.14  ? 2138 HOH B O   1 
HETATM 8990 O O   . HOH N 7 .   ? 2.278   28.266  -43.549 1.00   62.14  ? 2139 HOH B O   1 
HETATM 8991 O O   . HOH N 7 .   ? 18.915  12.685  -55.474 1.00   53.87  ? 2140 HOH B O   1 
HETATM 8992 O O   . HOH N 7 .   ? 21.050  13.570  -51.886 1.00   51.67  ? 2141 HOH B O   1 
HETATM 8993 O O   . HOH N 7 .   ? -10.604 26.404  -25.665 1.00   62.11  ? 2142 HOH B O   1 
HETATM 8994 O O   . HOH N 7 .   ? 1.848   19.113  -59.996 1.00   46.55  ? 2143 HOH B O   1 
HETATM 8995 O O   . HOH N 7 .   ? 10.308  30.471  -24.956 1.00   57.74  ? 2144 HOH B O   1 
HETATM 8996 O O   . HOH N 7 .   ? 0.918   16.809  -65.219 1.00   54.22  ? 2145 HOH B O   1 
HETATM 8997 O O   . HOH N 7 .   ? 7.010   12.450  -64.209 1.00   56.21  ? 2146 HOH B O   1 
HETATM 8998 O O   . HOH N 7 .   ? 10.553  12.427  -62.158 1.00   64.23  ? 2147 HOH B O   1 
HETATM 8999 O O   . HOH N 7 .   ? 2.039   11.754  -17.431 1.00   60.09  ? 2148 HOH B O   1 
HETATM 9000 O O   . HOH N 7 .   ? -11.485 7.162   -21.425 1.00   62.00  ? 2149 HOH B O   1 
HETATM 9001 O O   . HOH N 7 .   ? 2.149   20.357  -16.199 0.82   44.84  ? 2150 HOH B O   1 
HETATM 9002 O O   . HOH N 7 .   ? -3.693  23.727  -20.780 1.00   57.49  ? 2151 HOH B O   1 
HETATM 9003 O O   . HOH N 7 .   ? -6.669  19.813  -63.725 1.00   65.13  ? 2152 HOH B O   1 
HETATM 9004 O O   . HOH N 7 .   ? 3.004   15.220  -16.660 1.00   56.47  ? 2153 HOH B O   1 
HETATM 9005 O O   . HOH N 7 .   ? 7.728   10.043  -17.058 1.00   55.43  ? 2154 HOH B O   1 
HETATM 9006 O O   . HOH N 7 .   ? -3.796  24.233  -51.317 1.00   47.37  ? 2155 HOH B O   1 
HETATM 9007 O O   . HOH N 7 .   ? 3.282   28.428  -50.339 1.00   61.62  ? 2156 HOH B O   1 
HETATM 9008 O O   . HOH N 7 .   ? 0.007   19.548  -47.229 1.00   40.94  ? 2157 HOH B O   1 
HETATM 9009 O O   . HOH N 7 .   ? 5.776   -0.753  -37.670 1.00   55.55  ? 2158 HOH B O   1 
HETATM 9010 O O   . HOH N 7 .   ? 22.575  15.636  -45.534 1.00   45.85  ? 2159 HOH B O   1 
HETATM 9011 O O   . HOH N 7 .   ? 22.258  17.357  -47.617 1.00   49.07  ? 2160 HOH B O   1 
HETATM 9012 O O   . HOH N 7 .   ? 11.446  21.751  -46.604 1.00   50.33  ? 2161 HOH B O   1 
HETATM 9013 O O   . HOH N 7 .   ? 11.643  24.262  -45.203 1.00   64.67  ? 2162 HOH B O   1 
HETATM 9014 O O   . HOH N 7 .   ? 9.196   24.376  -52.542 1.00   59.63  ? 2163 HOH B O   1 
HETATM 9015 O O   . HOH N 7 .   ? 6.078   16.713  -53.502 1.00   32.16  ? 2164 HOH B O   1 
HETATM 9016 O O   . HOH N 7 .   ? 9.599   24.140  -50.025 1.00   54.88  ? 2165 HOH B O   1 
HETATM 9017 O O   . HOH N 7 .   ? 2.538   25.276  -47.937 1.00   49.50  ? 2166 HOH B O   1 
HETATM 9018 O O   . HOH N 7 .   ? 3.595   4.002   -33.616 1.00   37.13  ? 2167 HOH B O   1 
HETATM 9019 O O   . HOH N 7 .   ? 17.016  5.356   -34.617 1.00   40.34  ? 2168 HOH B O   1 
HETATM 9020 O O   . HOH N 7 .   ? 21.447  7.015   -30.220 1.00   47.95  ? 2169 HOH B O   1 
HETATM 9021 O O   . HOH N 7 .   ? 25.038  2.080   -32.969 1.00   57.78  ? 2170 HOH B O   1 
HETATM 9022 O O   . HOH N 7 .   ? 22.465  1.253   -36.101 1.00   36.74  ? 2171 HOH B O   1 
HETATM 9023 O O   . HOH N 7 .   ? 20.489  7.160   -36.528 1.00   46.73  ? 2172 HOH B O   1 
HETATM 9024 O O   . HOH N 7 .   ? 32.041  2.004   -37.535 1.00   58.93  ? 2173 HOH B O   1 
HETATM 9025 O O   . HOH N 7 .   ? 26.965  1.848   -37.452 1.00   42.45  ? 2174 HOH B O   1 
HETATM 9026 O O   . HOH N 7 .   ? 32.502  -2.399  -37.984 1.00   55.67  ? 2175 HOH B O   1 
HETATM 9027 O O   . HOH N 7 .   ? 30.008  -4.475  -35.628 1.00   53.42  ? 2176 HOH B O   1 
HETATM 9028 O O   . HOH N 7 .   ? 33.249  2.039   -46.875 1.00   62.34  ? 2177 HOH B O   1 
HETATM 9029 O O   . HOH N 7 .   ? 32.289  -8.653  -42.873 1.00   48.02  ? 2178 HOH B O   1 
HETATM 9030 O O   . HOH N 7 .   ? 27.872  -10.632 -37.646 1.00   49.43  ? 2179 HOH B O   1 
HETATM 9031 O O   . HOH N 7 .   ? 23.253  -3.079  -34.219 1.00   47.77  ? 2180 HOH B O   1 
HETATM 9032 O O   . HOH N 7 .   ? 21.835  -1.562  -36.560 1.00   45.30  ? 2181 HOH B O   1 
HETATM 9033 O O   . HOH N 7 .   ? 32.426  -11.583 -49.011 1.00   55.51  ? 2182 HOH B O   1 
HETATM 9034 O O   . HOH N 7 .   ? 32.644  -14.336 -42.053 1.00   62.83  ? 2183 HOH B O   1 
HETATM 9035 O O   . HOH N 7 .   ? 25.458  -20.506 -45.402 1.00   60.40  ? 2184 HOH B O   1 
HETATM 9036 O O   . HOH N 7 .   ? 26.674  -21.151 -50.473 1.00   65.34  ? 2185 HOH B O   1 
HETATM 9037 O O   . HOH N 7 .   ? 36.893  -8.705  -53.512 1.00   71.40  ? 2186 HOH B O   1 
HETATM 9038 O O   . HOH N 7 .   ? 38.299  -3.861  -60.499 1.00   75.51  ? 2187 HOH B O   1 
HETATM 9039 O O   . HOH N 7 .   ? 34.260  0.625   -54.975 1.00   58.44  ? 2188 HOH B O   1 
HETATM 9040 O O   . HOH N 7 .   ? 36.720  -3.596  -51.880 1.00   69.74  ? 2189 HOH B O   1 
HETATM 9041 O O   . HOH N 7 .   ? 36.907  -1.595  -54.841 1.00   73.29  ? 2190 HOH B O   1 
HETATM 9042 O O   . HOH N 7 .   ? 25.876  -9.836  -62.729 1.00   52.59  ? 2191 HOH B O   1 
HETATM 9043 O O   . HOH N 7 .   ? 24.206  -3.071  -59.143 1.00   54.78  ? 2192 HOH B O   1 
HETATM 9044 O O   . HOH N 7 .   ? 14.500  -13.694 -57.861 1.00   48.01  ? 2193 HOH B O   1 
HETATM 9045 O O   . HOH N 7 .   ? 10.266  -13.537 -48.435 1.00   46.63  ? 2194 HOH B O   1 
HETATM 9046 O O   . HOH N 7 .   ? 9.736   -18.775 -48.208 1.00   66.67  ? 2195 HOH B O   1 
HETATM 9047 O O   . HOH N 7 .   ? 17.073  -18.439 -43.343 1.00   65.04  ? 2196 HOH B O   1 
HETATM 9048 O O   . HOH N 7 .   ? 25.637  -20.252 -42.809 1.00   66.38  ? 2197 HOH B O   1 
HETATM 9049 O O   . HOH N 7 .   ? 16.774  -8.239  -48.462 1.00   42.30  ? 2198 HOH B O   1 
HETATM 9050 O O   . HOH N 7 .   ? 24.470  -2.378  -31.294 1.00   52.01  ? 2199 HOH B O   1 
HETATM 9051 O O   . HOH N 7 .   ? 18.462  -11.062 -33.304 1.00   66.15  ? 2200 HOH B O   1 
HETATM 9052 O O   . HOH N 7 .   ? 22.671  -5.473  -33.244 1.00   50.70  ? 2201 HOH B O   1 
HETATM 9053 O O   . HOH N 7 .   ? 17.169  -12.066 -31.272 1.00   65.95  ? 2202 HOH B O   1 
HETATM 9054 O O   . HOH N 7 .   ? 22.617  -0.732  -31.547 1.00   52.68  ? 2203 HOH B O   1 
HETATM 9055 O O   . HOH N 7 .   ? 17.227  -6.910  -34.110 1.00   54.06  ? 2204 HOH B O   1 
HETATM 9056 O O   . HOH N 7 .   ? 19.114  -1.145  -37.118 1.00   48.97  ? 2205 HOH B O   1 
HETATM 9057 O O   . HOH N 7 .   ? 24.203  -2.568  -43.731 1.00   43.57  ? 2206 HOH B O   1 
HETATM 9058 O O   . HOH N 7 .   ? 17.598  -5.510  -43.508 1.00   50.63  ? 2207 HOH B O   1 
HETATM 9059 O O   . HOH N 7 .   ? 16.314  -3.202  -42.587 1.00   40.15  ? 2208 HOH B O   1 
HETATM 9060 O O   . HOH N 7 .   ? 23.022  -0.390  -44.927 1.00   40.34  ? 2209 HOH B O   1 
HETATM 9061 O O   . HOH N 7 .   ? 29.630  6.637   -42.089 1.00   49.86  ? 2210 HOH B O   1 
HETATM 9062 O O   . HOH N 7 .   ? 30.708  10.895  -50.363 1.00   63.65  ? 2211 HOH B O   1 
HETATM 9063 O O   . HOH N 7 .   ? 25.376  11.393  -55.779 1.00   58.00  ? 2212 HOH B O   1 
HETATM 9064 O O   . HOH N 7 .   ? 22.191  15.585  -49.937 1.00   54.86  ? 2213 HOH B O   1 
HETATM 9065 O O   . HOH N 7 .   ? 22.292  9.674   -52.740 1.00   50.18  ? 2214 HOH B O   1 
HETATM 9066 O O   . HOH N 7 .   ? 26.382  8.290   -53.010 1.00   51.74  ? 2215 HOH B O   1 
HETATM 9067 O O   . HOH N 7 .   ? 24.311  6.761   -34.715 1.00   66.08  ? 2216 HOH B O   1 
HETATM 9068 O O   . HOH N 7 .   ? 27.665  15.748  -29.819 1.00   65.57  ? 2217 HOH B O   1 
HETATM 9069 O O   . HOH N 7 .   ? 23.449  21.068  -40.806 1.00   64.93  ? 2218 HOH B O   1 
HETATM 9070 O O   . HOH N 7 .   ? 8.493   27.642  -38.977 1.00   55.91  ? 2219 HOH B O   1 
HETATM 9071 O O   . HOH N 7 .   ? 13.686  25.759  -42.774 1.00   71.36  ? 2220 HOH B O   1 
HETATM 9072 O O   . HOH N 7 .   ? 6.452   4.560   -24.910 1.00   44.27  ? 2221 HOH B O   1 
HETATM 9073 O O   . HOH N 7 .   ? 6.227   2.824   -21.937 1.00   58.47  ? 2222 HOH B O   1 
HETATM 9074 O O   . HOH N 7 .   ? -0.281  1.076   -21.055 1.00   52.46  ? 2223 HOH B O   1 
HETATM 9075 O O   . HOH N 7 .   ? 5.206   -1.873  -28.746 1.00   45.39  ? 2224 HOH B O   1 
HETATM 9076 O O   . HOH N 7 .   ? 2.291   2.076   -19.934 1.00   55.46  ? 2225 HOH B O   1 
HETATM 9077 O O   . HOH N 7 .   ? 7.328   0.847   -23.907 1.00   45.10  ? 2226 HOH B O   1 
HETATM 9078 O O   . HOH N 7 .   ? -0.398  -18.134 -30.431 1.00   61.27  ? 2227 HOH B O   1 
HETATM 9079 O O   . HOH N 7 .   ? -0.393  -21.264 -26.653 1.00   69.08  ? 2228 HOH B O   1 
HETATM 9080 O O   . HOH N 7 .   ? 2.898   -19.930 -19.300 1.00   70.35  ? 2229 HOH B O   1 
HETATM 9081 O O   . HOH N 7 .   ? 20.818  -5.223  -10.523 1.00   57.69  ? 2230 HOH B O   1 
HETATM 9082 O O   . HOH N 7 .   ? 18.576  -6.866  -6.145  1.00   52.53  ? 2231 HOH B O   1 
HETATM 9083 O O   . HOH N 7 .   ? 20.698  -12.385 -16.282 1.00   58.72  ? 2232 HOH B O   1 
HETATM 9084 O O   . HOH N 7 .   ? 19.143  -14.974 -16.978 1.00   59.28  ? 2233 HOH B O   1 
HETATM 9085 O O   . HOH N 7 .   ? 15.651  -12.595 -20.622 1.00   56.94  ? 2234 HOH B O   1 
HETATM 9086 O O   . HOH N 7 .   ? 22.336  -7.000  -17.501 1.00   52.06  ? 2235 HOH B O   1 
HETATM 9087 O O   . HOH N 7 .   ? 23.700  -9.297  -17.755 1.00   56.63  ? 2236 HOH B O   1 
HETATM 9088 O O   . HOH N 7 .   ? 22.185  -11.358 -18.099 1.00   59.12  ? 2237 HOH B O   1 
HETATM 9089 O O   . HOH N 7 .   ? 21.284  -11.359 -22.705 1.00   60.12  ? 2238 HOH B O   1 
HETATM 9090 O O   . HOH N 7 .   ? 24.451  -5.284  -24.127 1.00   54.41  ? 2239 HOH B O   1 
HETATM 9091 O O   . HOH N 7 .   ? 23.264  -8.712  -26.806 1.00   48.50  ? 2240 HOH B O   1 
HETATM 9092 O O   . HOH N 7 .   ? 16.381  -2.322  -28.600 1.00   47.32  ? 2241 HOH B O   1 
HETATM 9093 O O   . HOH N 7 .   ? 31.796  -4.699  -21.247 1.00   60.26  ? 2242 HOH B O   1 
HETATM 9094 O O   . HOH N 7 .   ? 31.669  -2.291  -18.677 1.00   58.40  ? 2243 HOH B O   1 
HETATM 9095 O O   . HOH N 7 .   ? 10.418  0.866   -13.123 1.00   65.25  ? 2244 HOH B O   1 
HETATM 9096 O O   . HOH N 7 .   ? 11.711  -3.454  -10.394 1.00   53.70  ? 2245 HOH B O   1 
HETATM 9097 O O   . HOH N 7 .   ? 9.344   -1.468  -12.199 1.00   56.96  ? 2246 HOH B O   1 
HETATM 9098 O O   . HOH N 7 .   ? 6.366   0.038   -19.606 1.00   45.77  ? 2247 HOH B O   1 
HETATM 9099 O O   . HOH N 7 .   ? 4.799   -1.330  -21.690 1.00   45.40  ? 2248 HOH B O   1 
HETATM 9100 O O   . HOH N 7 .   ? 8.806   3.500   -23.912 1.00   45.04  ? 2249 HOH B O   1 
HETATM 9101 O O   . HOH N 7 .   ? 18.327  6.539   -26.876 1.00   40.34  ? 2250 HOH B O   1 
HETATM 9102 O O   . HOH N 7 .   ? 13.395  6.661   -33.222 1.00   35.44  ? 2251 HOH B O   1 
HETATM 9103 O O   . HOH N 7 .   ? 19.126  10.263  -30.263 1.00   47.92  ? 2252 HOH B O   1 
HETATM 9104 O O   . HOH N 7 .   ? 22.043  10.826  -27.601 1.00   52.11  ? 2253 HOH B O   1 
HETATM 9105 O O   . HOH N 7 .   ? 17.032  18.089  -27.136 1.00   59.30  ? 2254 HOH B O   1 
HETATM 9106 O O   . HOH N 7 .   ? 5.002   31.546  -37.498 1.00   65.98  ? 2255 HOH B O   1 
HETATM 9107 O O   . HOH N 7 .   ? 7.843   24.892  -31.644 1.00   36.79  ? 2256 HOH B O   1 
HETATM 9108 O O   . HOH N 7 .   ? 3.053   7.762   -33.013 1.00   39.49  ? 2257 HOH B O   1 
HETATM 9109 O O   . HOH N 7 .   ? 1.618   8.011   -20.909 1.00   59.04  ? 2258 HOH B O   1 
HETATM 9110 O O   . HOH N 7 .   ? -8.241  4.832   -23.602 1.00   58.69  ? 2259 HOH B O   1 
HETATM 9111 O O   . HOH N 7 .   ? -12.963 1.434   -25.905 1.00   56.57  ? 2260 HOH B O   1 
HETATM 9112 O O   . HOH N 7 .   ? -6.758  2.445   -23.745 1.00   59.20  ? 2261 HOH B O   1 
HETATM 9113 O O   . HOH N 7 .   ? -2.648  -12.043 -28.651 1.00   61.10  ? 2262 HOH B O   1 
HETATM 9114 O O   . HOH N 7 .   ? -4.214  -7.016  -34.317 1.00   65.42  ? 2263 HOH B O   1 
HETATM 9115 O O   . HOH N 7 .   ? -4.426  -10.403 -22.614 1.00   60.02  ? 2264 HOH B O   1 
HETATM 9116 O O   . HOH N 7 .   ? -3.957  -2.688  -21.252 1.00   63.07  ? 2265 HOH B O   1 
HETATM 9117 O O   . HOH N 7 .   ? 4.219   -3.748  -20.553 1.00   44.41  ? 2266 HOH B O   1 
HETATM 9118 O O   . HOH N 7 .   ? -1.655  -9.733  -20.571 1.00   55.70  ? 2267 HOH B O   1 
HETATM 9119 O O   . HOH N 7 .   ? -4.256  1.406   -30.265 1.00   45.74  ? 2268 HOH B O   1 
HETATM 9120 O O   . HOH N 7 .   ? -2.959  0.925   -36.693 1.00   46.17  ? 2269 HOH B O   1 
HETATM 9121 O O   . HOH N 7 .   ? -5.858  -3.722  -34.636 1.00   64.65  ? 2270 HOH B O   1 
HETATM 9122 O O   . HOH N 7 .   ? -7.883  7.429   -45.018 1.00   47.44  ? 2271 HOH B O   1 
HETATM 9123 O O   . HOH N 7 .   ? -15.863 -7.976  -38.607 1.00   71.34  ? 2272 HOH B O   1 
HETATM 9124 O O   . HOH N 7 .   ? -18.395 -8.742  -37.267 1.00   72.77  ? 2273 HOH B O   1 
HETATM 9125 O O   . HOH N 7 .   ? -14.158 9.732   -28.354 1.00   60.24  ? 2274 HOH B O   1 
HETATM 9126 O O   . HOH N 7 .   ? -14.783 13.999  -33.455 1.00   55.62  ? 2275 HOH B O   1 
HETATM 9127 O O   . HOH N 7 .   ? -13.872 15.842  -35.307 1.00   57.77  ? 2276 HOH B O   1 
HETATM 9128 O O   . HOH N 7 .   ? -7.181  13.667  -26.465 1.00   40.98  ? 2277 HOH B O   1 
HETATM 9129 O O   . HOH N 7 .   ? -9.444  18.027  -33.898 1.00   52.43  ? 2278 HOH B O   1 
HETATM 9130 O O   . HOH N 7 .   ? -8.582  19.664  -29.172 1.00   51.14  ? 2279 HOH B O   1 
HETATM 9131 O O   . HOH N 7 .   ? -1.559  24.618  -47.300 1.00   49.49  ? 2280 HOH B O   1 
HETATM 9132 O O   . HOH N 7 .   ? -0.054  27.712  -44.778 1.00   63.96  ? 2281 HOH B O   1 
HETATM 9133 O O   . HOH N 7 .   ? 0.603   27.989  -38.702 1.00   61.70  ? 2282 HOH B O   1 
HETATM 9134 O O   . HOH N 7 .   ? -5.399  24.821  -38.056 1.00   57.99  ? 2283 HOH B O   1 
HETATM 9135 O O   . HOH N 7 .   ? -13.016 27.625  -28.239 1.00   57.48  ? 2284 HOH B O   1 
HETATM 9136 O O   . HOH N 7 .   ? -14.111 29.487  -30.428 1.00   55.43  ? 2285 HOH B O   1 
HETATM 9137 O O   . HOH N 7 .   ? -13.132 25.409  -26.633 1.00   60.17  ? 2286 HOH B O   1 
HETATM 9138 O O   . HOH N 7 .   ? -10.478 24.485  -23.340 1.00   60.66  ? 2287 HOH B O   1 
HETATM 9139 O O   . HOH N 7 .   ? -11.182 22.380  -26.956 1.00   69.68  ? 2288 HOH B O   1 
HETATM 9140 O O   . HOH N 7 .   ? -3.841  27.545  -30.881 1.00   49.52  ? 2289 HOH B O   1 
HETATM 9141 O O   . HOH N 7 .   ? -8.065  26.447  -31.011 1.00   62.34  ? 2290 HOH B O   1 
HETATM 9142 O O   . HOH N 7 .   ? -1.759  26.705  -29.633 1.00   37.82  ? 2291 HOH B O   1 
HETATM 9143 O O   . HOH N 7 .   ? 6.228   24.269  -24.862 1.00   38.78  ? 2292 HOH B O   1 
HETATM 9144 O O   . HOH N 7 .   ? 12.100  26.464  -28.046 1.00   45.82  ? 2293 HOH B O   1 
HETATM 9145 O O   . HOH N 7 .   ? 11.693  27.734  -25.391 1.00   52.15  ? 2294 HOH B O   1 
HETATM 9146 O O   . HOH N 7 .   ? 10.870  17.136  -23.000 1.00   42.44  ? 2295 HOH B O   1 
HETATM 9147 O O   . HOH N 7 .   ? 1.313   23.498  -19.676 1.00   51.08  ? 2296 HOH B O   1 
HETATM 9148 O O   . HOH N 7 .   ? 3.283   20.182  -28.361 1.00   38.52  ? 2297 HOH B O   1 
HETATM 9149 O O   . HOH N 7 .   ? 2.658   11.494  -20.219 1.00   45.91  ? 2298 HOH B O   1 
HETATM 9150 O O   . HOH N 7 .   ? -8.964  7.194   -23.403 1.00   54.17  ? 2299 HOH B O   1 
HETATM 9151 O O   . HOH N 7 .   ? -12.580 11.663  -28.382 1.00   53.55  ? 2300 HOH B O   1 
HETATM 9152 O O   . HOH N 7 .   ? -6.584  13.605  -23.098 1.00   55.91  ? 2301 HOH B O   1 
HETATM 9153 O O   . HOH N 7 .   ? -8.615  15.602  -20.737 1.00   60.27  ? 2302 HOH B O   1 
HETATM 9154 O O   . HOH N 7 .   ? -5.508  12.549  -20.703 1.00   54.78  ? 2303 HOH B O   1 
HETATM 9155 O O   . HOH N 7 .   ? -4.486  21.221  -20.462 1.00   47.78  ? 2304 HOH B O   1 
HETATM 9156 O O   . HOH N 7 .   ? 0.858   21.234  -18.360 0.78   43.93  ? 2305 HOH B O   1 
HETATM 9157 O O   . HOH N 7 .   ? 2.672   17.741  -16.560 1.00   47.35  ? 2306 HOH B O   1 
HETATM 9158 O O   . HOH N 7 .   ? 4.998   17.640  -15.655 1.00   58.18  ? 2307 HOH B O   1 
HETATM 9159 O O   . HOH N 7 .   ? 5.167   14.707  -18.557 1.00   48.62  ? 2308 HOH B O   1 
HETATM 9160 O O   . HOH N 7 .   ? 12.619  15.101  -22.684 1.00   35.00  ? 2309 HOH B O   1 
HETATM 9161 O O   . HOH N 7 .   ? 6.588   11.720  -18.987 1.00   52.70  ? 2310 HOH B O   1 
HETATM 9162 O O   . HOH N 7 .   ? 8.806   13.900  -17.827 1.00   45.78  ? 2311 HOH B O   1 
HETATM 9163 O O   . HOH N 7 .   ? 15.296  15.757  -20.882 1.00   44.69  ? 2312 HOH B O   1 
HETATM 9164 O O   . HOH N 7 .   ? 10.808  12.990  -16.165 1.00   48.95  ? 2313 HOH B O   1 
HETATM 9165 O O   . HOH N 7 .   ? 12.342  16.820  -14.420 1.00   57.06  ? 2314 HOH B O   1 
HETATM 9166 O O   . HOH N 7 .   ? 11.381  10.617  -16.822 0.84   47.19  ? 2315 HOH B O   1 
HETATM 9167 O O   . HOH N 7 .   ? 18.071  8.913   -28.013 1.00   42.85  ? 2316 HOH B O   1 
HETATM 9168 O O   . HOH N 7 .   ? 17.100  15.214  -24.825 1.00   51.09  ? 2317 HOH B O   1 
HETATM 9169 O O   . HOH N 7 .   ? 17.594  15.286  -22.014 1.00   46.85  ? 2318 HOH B O   1 
HETATM 9170 O O   . HOH N 7 .   ? 22.124  21.936  -19.667 1.00   66.95  ? 2319 HOH B O   1 
HETATM 9171 O O   . HOH N 7 .   ? 23.335  21.621  -22.618 1.00   64.90  ? 2320 HOH B O   1 
HETATM 9172 O O   . HOH N 7 .   ? 23.925  17.935  -20.597 1.00   67.23  ? 2321 HOH B O   1 
HETATM 9173 O O   . HOH N 7 .   ? 34.637  1.788   -23.474 1.00   74.20  ? 2322 HOH B O   1 
HETATM 9174 O O   . HOH N 7 .   ? 10.539  -21.646 -23.044 1.00   72.63  ? 2323 HOH B O   1 
HETATM 9175 O O   . HOH N 7 .   ? 13.130  -6.826  -33.220 1.00   54.72  ? 2324 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SGB 203 203 203 SGB SGB A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 ?   ?   ?   A . n 
A 1 494 ASP 494 494 ?   ?   ?   A . n 
A 1 495 SER 495 495 ?   ?   ?   A . n 
A 1 496 LYS 496 496 ?   ?   ?   A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SGB 203 203 203 SGB SGB B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 ?   ?   ?   B . n 
B 1 496 LYS 496 496 ?   ?   ?   B . n 
B 1 497 SER 497 497 ?   ?   ?   B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 ?   ?   ?   B . n 
B 1 544 ALA 544 544 ?   ?   ?   B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1   601  601  NAG NAG A . 
D 2 NAG 1   701  701  NAG NAG A . 
E 3 PEG 1   1543 1543 PEG PEG A . 
F 3 PEG 1   1544 1544 PEG PEG A . 
G 4 ME2 1   1545 1545 ME2 ME2 A . 
H 5 P15 1   1546 1546 P15 P15 A . 
I 3 PEG 1   1547 1547 PEG PEG A . 
J 2 NAG 1   601  601  NAG NAG B . 
K 6 ETX 1   1543 1543 ETX ETX B . 
L 4 ME2 1   1544 1544 ME2 ME2 B . 
M 7 HOH 1   2001 2001 HOH HOH A . 
M 7 HOH 2   2002 2002 HOH HOH A . 
M 7 HOH 3   2003 2003 HOH HOH A . 
M 7 HOH 4   2004 2004 HOH HOH A . 
M 7 HOH 5   2005 2005 HOH HOH A . 
M 7 HOH 6   2006 2006 HOH HOH A . 
M 7 HOH 7   2007 2007 HOH HOH A . 
M 7 HOH 8   2008 2008 HOH HOH A . 
M 7 HOH 9   2009 2009 HOH HOH A . 
M 7 HOH 10  2010 2010 HOH HOH A . 
M 7 HOH 11  2011 2011 HOH HOH A . 
M 7 HOH 12  2012 2012 HOH HOH A . 
M 7 HOH 13  2013 2013 HOH HOH A . 
M 7 HOH 14  2014 2014 HOH HOH A . 
M 7 HOH 15  2015 2015 HOH HOH A . 
M 7 HOH 16  2016 2016 HOH HOH A . 
M 7 HOH 17  2017 2017 HOH HOH A . 
M 7 HOH 18  2018 2018 HOH HOH A . 
M 7 HOH 19  2019 2019 HOH HOH A . 
M 7 HOH 20  2020 2020 HOH HOH A . 
M 7 HOH 21  2021 2021 HOH HOH A . 
M 7 HOH 22  2022 2022 HOH HOH A . 
M 7 HOH 23  2023 2023 HOH HOH A . 
M 7 HOH 24  2024 2024 HOH HOH A . 
M 7 HOH 25  2025 2025 HOH HOH A . 
M 7 HOH 26  2026 2026 HOH HOH A . 
M 7 HOH 27  2027 2027 HOH HOH A . 
M 7 HOH 28  2028 2028 HOH HOH A . 
M 7 HOH 29  2029 2029 HOH HOH A . 
M 7 HOH 30  2030 2030 HOH HOH A . 
M 7 HOH 31  2031 2031 HOH HOH A . 
M 7 HOH 32  2032 2032 HOH HOH A . 
M 7 HOH 33  2033 2033 HOH HOH A . 
M 7 HOH 34  2034 2034 HOH HOH A . 
M 7 HOH 35  2035 2035 HOH HOH A . 
M 7 HOH 36  2036 2036 HOH HOH A . 
M 7 HOH 37  2037 2037 HOH HOH A . 
M 7 HOH 38  2038 2038 HOH HOH A . 
M 7 HOH 39  2039 2039 HOH HOH A . 
M 7 HOH 40  2040 2040 HOH HOH A . 
M 7 HOH 41  2041 2041 HOH HOH A . 
M 7 HOH 42  2042 2042 HOH HOH A . 
M 7 HOH 43  2043 2043 HOH HOH A . 
M 7 HOH 44  2044 2044 HOH HOH A . 
M 7 HOH 45  2045 2045 HOH HOH A . 
M 7 HOH 46  2046 2046 HOH HOH A . 
M 7 HOH 47  2047 2047 HOH HOH A . 
M 7 HOH 48  2048 2048 HOH HOH A . 
M 7 HOH 49  2049 2049 HOH HOH A . 
M 7 HOH 50  2050 2050 HOH HOH A . 
M 7 HOH 51  2051 2051 HOH HOH A . 
M 7 HOH 52  2052 2052 HOH HOH A . 
M 7 HOH 53  2053 2053 HOH HOH A . 
M 7 HOH 54  2054 2054 HOH HOH A . 
M 7 HOH 55  2055 2055 HOH HOH A . 
M 7 HOH 56  2056 2056 HOH HOH A . 
M 7 HOH 57  2057 2057 HOH HOH A . 
M 7 HOH 58  2058 2058 HOH HOH A . 
M 7 HOH 59  2059 2059 HOH HOH A . 
M 7 HOH 60  2060 2060 HOH HOH A . 
M 7 HOH 61  2061 2061 HOH HOH A . 
M 7 HOH 62  2062 2062 HOH HOH A . 
M 7 HOH 63  2063 2063 HOH HOH A . 
M 7 HOH 64  2064 2064 HOH HOH A . 
M 7 HOH 65  2065 2065 HOH HOH A . 
M 7 HOH 66  2066 2066 HOH HOH A . 
M 7 HOH 67  2067 2067 HOH HOH A . 
M 7 HOH 68  2068 2068 HOH HOH A . 
M 7 HOH 69  2069 2069 HOH HOH A . 
M 7 HOH 70  2070 2070 HOH HOH A . 
M 7 HOH 71  2071 2071 HOH HOH A . 
M 7 HOH 72  2072 2072 HOH HOH A . 
M 7 HOH 73  2073 2073 HOH HOH A . 
M 7 HOH 74  2074 2074 HOH HOH A . 
M 7 HOH 75  2075 2075 HOH HOH A . 
M 7 HOH 76  2076 2076 HOH HOH A . 
M 7 HOH 77  2077 2077 HOH HOH A . 
M 7 HOH 78  2078 2078 HOH HOH A . 
M 7 HOH 79  2079 2079 HOH HOH A . 
M 7 HOH 80  2080 2080 HOH HOH A . 
M 7 HOH 81  2081 2081 HOH HOH A . 
M 7 HOH 82  2082 2082 HOH HOH A . 
M 7 HOH 83  2083 2083 HOH HOH A . 
M 7 HOH 84  2084 2084 HOH HOH A . 
M 7 HOH 85  2085 2085 HOH HOH A . 
M 7 HOH 86  2086 2086 HOH HOH A . 
M 7 HOH 87  2087 2087 HOH HOH A . 
M 7 HOH 88  2088 2088 HOH HOH A . 
M 7 HOH 89  2089 2089 HOH HOH A . 
M 7 HOH 90  2090 2090 HOH HOH A . 
M 7 HOH 91  2091 2091 HOH HOH A . 
M 7 HOH 92  2092 2092 HOH HOH A . 
M 7 HOH 93  2093 2093 HOH HOH A . 
M 7 HOH 94  2094 2094 HOH HOH A . 
M 7 HOH 95  2095 2095 HOH HOH A . 
M 7 HOH 96  2096 2096 HOH HOH A . 
M 7 HOH 97  2097 2097 HOH HOH A . 
M 7 HOH 98  2098 2098 HOH HOH A . 
M 7 HOH 99  2099 2099 HOH HOH A . 
M 7 HOH 100 2100 2100 HOH HOH A . 
M 7 HOH 101 2101 2101 HOH HOH A . 
M 7 HOH 102 2102 2102 HOH HOH A . 
M 7 HOH 103 2103 2103 HOH HOH A . 
M 7 HOH 104 2104 2104 HOH HOH A . 
M 7 HOH 105 2105 2105 HOH HOH A . 
M 7 HOH 106 2106 2106 HOH HOH A . 
M 7 HOH 107 2107 2107 HOH HOH A . 
M 7 HOH 108 2108 2108 HOH HOH A . 
M 7 HOH 109 2109 2109 HOH HOH A . 
M 7 HOH 110 2110 2110 HOH HOH A . 
M 7 HOH 111 2111 2111 HOH HOH A . 
M 7 HOH 112 2112 2112 HOH HOH A . 
M 7 HOH 113 2113 2113 HOH HOH A . 
M 7 HOH 114 2114 2114 HOH HOH A . 
M 7 HOH 115 2115 2115 HOH HOH A . 
M 7 HOH 116 2116 2116 HOH HOH A . 
M 7 HOH 117 2117 2117 HOH HOH A . 
M 7 HOH 118 2118 2118 HOH HOH A . 
M 7 HOH 119 2119 2119 HOH HOH A . 
M 7 HOH 120 2120 2120 HOH HOH A . 
M 7 HOH 121 2121 2121 HOH HOH A . 
M 7 HOH 122 2122 2122 HOH HOH A . 
M 7 HOH 123 2123 2123 HOH HOH A . 
M 7 HOH 124 2124 2124 HOH HOH A . 
M 7 HOH 125 2125 2125 HOH HOH A . 
M 7 HOH 126 2126 2126 HOH HOH A . 
M 7 HOH 127 2127 2127 HOH HOH A . 
M 7 HOH 128 2128 2128 HOH HOH A . 
M 7 HOH 129 2129 2129 HOH HOH A . 
M 7 HOH 130 2130 2130 HOH HOH A . 
M 7 HOH 131 2131 2131 HOH HOH A . 
M 7 HOH 132 2132 2132 HOH HOH A . 
M 7 HOH 133 2133 2133 HOH HOH A . 
M 7 HOH 134 2134 2134 HOH HOH A . 
M 7 HOH 135 2135 2135 HOH HOH A . 
M 7 HOH 136 2136 2136 HOH HOH A . 
M 7 HOH 137 2137 2137 HOH HOH A . 
M 7 HOH 138 2138 2138 HOH HOH A . 
M 7 HOH 139 2139 2139 HOH HOH A . 
M 7 HOH 140 2140 2140 HOH HOH A . 
M 7 HOH 141 2141 2141 HOH HOH A . 
M 7 HOH 142 2142 2142 HOH HOH A . 
M 7 HOH 143 2143 2143 HOH HOH A . 
M 7 HOH 144 2144 2144 HOH HOH A . 
M 7 HOH 145 2145 2145 HOH HOH A . 
M 7 HOH 146 2146 2146 HOH HOH A . 
M 7 HOH 147 2147 2147 HOH HOH A . 
M 7 HOH 148 2148 2148 HOH HOH A . 
M 7 HOH 149 2149 2149 HOH HOH A . 
M 7 HOH 150 2150 2150 HOH HOH A . 
M 7 HOH 151 2151 2151 HOH HOH A . 
M 7 HOH 152 2152 2152 HOH HOH A . 
M 7 HOH 153 2153 2153 HOH HOH A . 
M 7 HOH 154 2154 2154 HOH HOH A . 
M 7 HOH 155 2155 2155 HOH HOH A . 
M 7 HOH 156 2156 2156 HOH HOH A . 
M 7 HOH 157 2157 2157 HOH HOH A . 
M 7 HOH 158 2158 2158 HOH HOH A . 
M 7 HOH 159 2159 2159 HOH HOH A . 
M 7 HOH 160 2160 2160 HOH HOH A . 
M 7 HOH 161 2161 2161 HOH HOH A . 
M 7 HOH 162 2162 2162 HOH HOH A . 
M 7 HOH 163 2163 2163 HOH HOH A . 
M 7 HOH 164 2164 2164 HOH HOH A . 
M 7 HOH 165 2165 2165 HOH HOH A . 
M 7 HOH 166 2166 2166 HOH HOH A . 
M 7 HOH 167 2167 2167 HOH HOH A . 
M 7 HOH 168 2168 2168 HOH HOH A . 
M 7 HOH 169 2169 2169 HOH HOH A . 
M 7 HOH 170 2170 2170 HOH HOH A . 
M 7 HOH 171 2171 2171 HOH HOH A . 
M 7 HOH 172 2172 2172 HOH HOH A . 
M 7 HOH 173 2173 2173 HOH HOH A . 
M 7 HOH 174 2174 2174 HOH HOH A . 
M 7 HOH 175 2175 2175 HOH HOH A . 
M 7 HOH 176 2176 2176 HOH HOH A . 
M 7 HOH 177 2177 2177 HOH HOH A . 
M 7 HOH 178 2178 2178 HOH HOH A . 
M 7 HOH 179 2179 2179 HOH HOH A . 
M 7 HOH 180 2180 2180 HOH HOH A . 
M 7 HOH 181 2181 2181 HOH HOH A . 
M 7 HOH 182 2182 2182 HOH HOH A . 
M 7 HOH 183 2183 2183 HOH HOH A . 
M 7 HOH 184 2184 2184 HOH HOH A . 
M 7 HOH 185 2185 2185 HOH HOH A . 
M 7 HOH 186 2186 2186 HOH HOH A . 
M 7 HOH 187 2187 2187 HOH HOH A . 
M 7 HOH 188 2188 2188 HOH HOH A . 
M 7 HOH 189 2189 2189 HOH HOH A . 
M 7 HOH 190 2190 2190 HOH HOH A . 
M 7 HOH 191 2191 2191 HOH HOH A . 
M 7 HOH 192 2192 2192 HOH HOH A . 
M 7 HOH 193 2193 2193 HOH HOH A . 
M 7 HOH 194 2194 2194 HOH HOH A . 
M 7 HOH 195 2195 2195 HOH HOH A . 
M 7 HOH 196 2196 2196 HOH HOH A . 
M 7 HOH 197 2197 2197 HOH HOH A . 
M 7 HOH 198 2198 2198 HOH HOH A . 
M 7 HOH 199 2199 2199 HOH HOH A . 
M 7 HOH 200 2200 2200 HOH HOH A . 
M 7 HOH 201 2201 2201 HOH HOH A . 
M 7 HOH 202 2202 2202 HOH HOH A . 
M 7 HOH 203 2203 2203 HOH HOH A . 
M 7 HOH 204 2204 2204 HOH HOH A . 
M 7 HOH 205 2205 2205 HOH HOH A . 
M 7 HOH 206 2206 2206 HOH HOH A . 
M 7 HOH 207 2207 2207 HOH HOH A . 
M 7 HOH 208 2208 2208 HOH HOH A . 
M 7 HOH 209 2209 2209 HOH HOH A . 
M 7 HOH 210 2210 2210 HOH HOH A . 
M 7 HOH 211 2211 2211 HOH HOH A . 
M 7 HOH 212 2212 2212 HOH HOH A . 
M 7 HOH 213 2213 2213 HOH HOH A . 
M 7 HOH 214 2214 2214 HOH HOH A . 
M 7 HOH 215 2215 2215 HOH HOH A . 
M 7 HOH 216 2216 2216 HOH HOH A . 
M 7 HOH 217 2217 2217 HOH HOH A . 
M 7 HOH 218 2218 2218 HOH HOH A . 
M 7 HOH 219 2219 2219 HOH HOH A . 
M 7 HOH 220 2220 2220 HOH HOH A . 
M 7 HOH 221 2221 2221 HOH HOH A . 
M 7 HOH 222 2222 2222 HOH HOH A . 
M 7 HOH 223 2223 2223 HOH HOH A . 
M 7 HOH 224 2224 2224 HOH HOH A . 
M 7 HOH 225 2225 2225 HOH HOH A . 
M 7 HOH 226 2226 2226 HOH HOH A . 
M 7 HOH 227 2227 2227 HOH HOH A . 
M 7 HOH 228 2228 2228 HOH HOH A . 
M 7 HOH 229 2229 2229 HOH HOH A . 
M 7 HOH 230 2230 2230 HOH HOH A . 
M 7 HOH 231 2231 2231 HOH HOH A . 
M 7 HOH 232 2232 2232 HOH HOH A . 
M 7 HOH 233 2233 2233 HOH HOH A . 
M 7 HOH 234 2234 2234 HOH HOH A . 
M 7 HOH 235 2235 2235 HOH HOH A . 
M 7 HOH 236 2236 2236 HOH HOH A . 
M 7 HOH 237 2237 2237 HOH HOH A . 
M 7 HOH 238 2238 2238 HOH HOH A . 
M 7 HOH 239 2239 2239 HOH HOH A . 
M 7 HOH 240 2240 2240 HOH HOH A . 
M 7 HOH 241 2241 2241 HOH HOH A . 
M 7 HOH 242 2242 2242 HOH HOH A . 
M 7 HOH 243 2243 2243 HOH HOH A . 
M 7 HOH 244 2244 2244 HOH HOH A . 
M 7 HOH 245 2245 2245 HOH HOH A . 
M 7 HOH 246 2246 2246 HOH HOH A . 
M 7 HOH 247 2247 2247 HOH HOH A . 
M 7 HOH 248 2248 2248 HOH HOH A . 
M 7 HOH 249 2249 2249 HOH HOH A . 
M 7 HOH 250 2250 2250 HOH HOH A . 
M 7 HOH 251 2251 2251 HOH HOH A . 
M 7 HOH 252 2252 2252 HOH HOH A . 
M 7 HOH 253 2253 2253 HOH HOH A . 
M 7 HOH 254 2254 2254 HOH HOH A . 
M 7 HOH 255 2255 2255 HOH HOH A . 
M 7 HOH 256 2256 2256 HOH HOH A . 
M 7 HOH 257 2257 2257 HOH HOH A . 
M 7 HOH 258 2258 2258 HOH HOH A . 
M 7 HOH 259 2259 2259 HOH HOH A . 
M 7 HOH 260 2260 2260 HOH HOH A . 
M 7 HOH 261 2261 2261 HOH HOH A . 
M 7 HOH 262 2262 2262 HOH HOH A . 
M 7 HOH 263 2263 2263 HOH HOH A . 
M 7 HOH 264 2264 2264 HOH HOH A . 
M 7 HOH 265 2265 2265 HOH HOH A . 
M 7 HOH 266 2266 2266 HOH HOH A . 
M 7 HOH 267 2267 2267 HOH HOH A . 
M 7 HOH 268 2268 2268 HOH HOH A . 
M 7 HOH 269 2269 2269 HOH HOH A . 
M 7 HOH 270 2270 2270 HOH HOH A . 
M 7 HOH 271 2271 2271 HOH HOH A . 
M 7 HOH 272 2272 2272 HOH HOH A . 
M 7 HOH 273 2273 2273 HOH HOH A . 
M 7 HOH 274 2274 2274 HOH HOH A . 
M 7 HOH 275 2275 2275 HOH HOH A . 
M 7 HOH 276 2276 2276 HOH HOH A . 
M 7 HOH 277 2277 2277 HOH HOH A . 
M 7 HOH 278 2278 2278 HOH HOH A . 
M 7 HOH 279 2279 2279 HOH HOH A . 
M 7 HOH 280 2280 2280 HOH HOH A . 
M 7 HOH 281 2281 2281 HOH HOH A . 
M 7 HOH 282 2282 2282 HOH HOH A . 
M 7 HOH 283 2283 2283 HOH HOH A . 
M 7 HOH 284 2284 2284 HOH HOH A . 
M 7 HOH 285 2285 2285 HOH HOH A . 
M 7 HOH 286 2286 2286 HOH HOH A . 
M 7 HOH 287 2287 2287 HOH HOH A . 
M 7 HOH 288 2288 2288 HOH HOH A . 
M 7 HOH 289 2289 2289 HOH HOH A . 
M 7 HOH 290 2290 2290 HOH HOH A . 
M 7 HOH 291 2291 2291 HOH HOH A . 
M 7 HOH 292 2292 2292 HOH HOH A . 
M 7 HOH 293 2293 2293 HOH HOH A . 
M 7 HOH 294 2294 2294 HOH HOH A . 
M 7 HOH 295 2295 2295 HOH HOH A . 
M 7 HOH 296 2296 2296 HOH HOH A . 
M 7 HOH 297 2297 2297 HOH HOH A . 
M 7 HOH 298 2298 2298 HOH HOH A . 
M 7 HOH 299 2299 2299 HOH HOH A . 
M 7 HOH 300 2300 2300 HOH HOH A . 
M 7 HOH 301 2301 2301 HOH HOH A . 
M 7 HOH 302 2302 2302 HOH HOH A . 
M 7 HOH 303 2303 2303 HOH HOH A . 
M 7 HOH 304 2304 2304 HOH HOH A . 
M 7 HOH 305 2305 2305 HOH HOH A . 
M 7 HOH 306 2306 2306 HOH HOH A . 
M 7 HOH 307 2307 2307 HOH HOH A . 
M 7 HOH 308 2308 2308 HOH HOH A . 
M 7 HOH 309 2309 2309 HOH HOH A . 
M 7 HOH 310 2310 2310 HOH HOH A . 
M 7 HOH 311 2311 2311 HOH HOH A . 
M 7 HOH 312 2312 2312 HOH HOH A . 
M 7 HOH 313 2313 2313 HOH HOH A . 
M 7 HOH 314 2314 2314 HOH HOH A . 
M 7 HOH 315 2315 2315 HOH HOH A . 
M 7 HOH 316 2316 2316 HOH HOH A . 
M 7 HOH 317 2317 2317 HOH HOH A . 
M 7 HOH 318 2318 2318 HOH HOH A . 
M 7 HOH 319 2319 2319 HOH HOH A . 
M 7 HOH 320 2320 2320 HOH HOH A . 
M 7 HOH 321 2321 2321 HOH HOH A . 
M 7 HOH 322 2322 2322 HOH HOH A . 
M 7 HOH 323 2323 2323 HOH HOH A . 
M 7 HOH 324 2324 2324 HOH HOH A . 
M 7 HOH 325 2325 2325 HOH HOH A . 
M 7 HOH 326 2326 2326 HOH HOH A . 
M 7 HOH 327 2327 2327 HOH HOH A . 
M 7 HOH 328 2328 2328 HOH HOH A . 
M 7 HOH 329 2329 2329 HOH HOH A . 
M 7 HOH 330 2330 2330 HOH HOH A . 
M 7 HOH 331 2331 2331 HOH HOH A . 
M 7 HOH 332 2332 2332 HOH HOH A . 
M 7 HOH 333 2333 2333 HOH HOH A . 
M 7 HOH 334 2334 2334 HOH HOH A . 
M 7 HOH 335 2335 2335 HOH HOH A . 
M 7 HOH 336 2336 2336 HOH HOH A . 
M 7 HOH 337 2337 2337 HOH HOH A . 
M 7 HOH 338 2338 2338 HOH HOH A . 
M 7 HOH 339 2339 2339 HOH HOH A . 
M 7 HOH 340 2340 2340 HOH HOH A . 
M 7 HOH 341 2341 2341 HOH HOH A . 
M 7 HOH 342 2342 2342 HOH HOH A . 
M 7 HOH 343 2343 2343 HOH HOH A . 
M 7 HOH 344 2344 2344 HOH HOH A . 
M 7 HOH 345 2345 2345 HOH HOH A . 
M 7 HOH 346 2346 2346 HOH HOH A . 
M 7 HOH 347 2347 2347 HOH HOH A . 
M 7 HOH 348 2348 2348 HOH HOH A . 
M 7 HOH 349 2349 2349 HOH HOH A . 
M 7 HOH 350 2350 2350 HOH HOH A . 
M 7 HOH 351 2351 2351 HOH HOH A . 
M 7 HOH 352 2352 2352 HOH HOH A . 
M 7 HOH 353 2353 2353 HOH HOH A . 
M 7 HOH 354 2354 2354 HOH HOH A . 
M 7 HOH 355 2355 2355 HOH HOH A . 
M 7 HOH 356 2356 2356 HOH HOH A . 
M 7 HOH 357 2357 2357 HOH HOH A . 
M 7 HOH 358 2358 2358 HOH HOH A . 
M 7 HOH 359 2359 2359 HOH HOH A . 
M 7 HOH 360 2360 2360 HOH HOH A . 
M 7 HOH 361 2361 2361 HOH HOH A . 
M 7 HOH 362 2362 2362 HOH HOH A . 
M 7 HOH 363 2363 2363 HOH HOH A . 
M 7 HOH 364 2364 2364 HOH HOH A . 
M 7 HOH 365 2365 2365 HOH HOH A . 
M 7 HOH 366 2366 2366 HOH HOH A . 
M 7 HOH 367 2367 2367 HOH HOH A . 
M 7 HOH 368 2368 2368 HOH HOH A . 
M 7 HOH 369 2369 2369 HOH HOH A . 
M 7 HOH 370 2370 2370 HOH HOH A . 
M 7 HOH 371 2371 2371 HOH HOH A . 
M 7 HOH 372 2372 2372 HOH HOH A . 
M 7 HOH 373 2373 2373 HOH HOH A . 
M 7 HOH 374 2374 2374 HOH HOH A . 
M 7 HOH 375 2375 2375 HOH HOH A . 
M 7 HOH 376 2376 2376 HOH HOH A . 
M 7 HOH 377 2377 2377 HOH HOH A . 
M 7 HOH 378 2378 2378 HOH HOH A . 
M 7 HOH 379 2379 2379 HOH HOH A . 
M 7 HOH 380 2380 2380 HOH HOH A . 
M 7 HOH 381 2381 2381 HOH HOH A . 
M 7 HOH 382 2382 2382 HOH HOH A . 
M 7 HOH 383 2383 2383 HOH HOH A . 
M 7 HOH 384 2384 2384 HOH HOH A . 
M 7 HOH 385 2385 2385 HOH HOH A . 
M 7 HOH 386 2386 2386 HOH HOH A . 
M 7 HOH 387 2387 2387 HOH HOH A . 
M 7 HOH 388 2388 2388 HOH HOH A . 
M 7 HOH 389 2389 2389 HOH HOH A . 
M 7 HOH 390 2390 2390 HOH HOH A . 
M 7 HOH 391 2391 2391 HOH HOH A . 
M 7 HOH 392 2392 2392 HOH HOH A . 
M 7 HOH 393 2393 2393 HOH HOH A . 
M 7 HOH 394 2394 2394 HOH HOH A . 
M 7 HOH 395 2395 2395 HOH HOH A . 
M 7 HOH 396 2396 2396 HOH HOH A . 
M 7 HOH 397 2397 2397 HOH HOH A . 
M 7 HOH 398 2398 2398 HOH HOH A . 
M 7 HOH 399 2399 2399 HOH HOH A . 
M 7 HOH 400 2400 2400 HOH HOH A . 
M 7 HOH 401 2401 2401 HOH HOH A . 
M 7 HOH 402 2402 2402 HOH HOH A . 
M 7 HOH 403 2403 2403 HOH HOH A . 
N 7 HOH 1   2001 2001 HOH HOH B . 
N 7 HOH 2   2002 2002 HOH HOH B . 
N 7 HOH 3   2003 2003 HOH HOH B . 
N 7 HOH 4   2004 2004 HOH HOH B . 
N 7 HOH 5   2005 2005 HOH HOH B . 
N 7 HOH 6   2006 2006 HOH HOH B . 
N 7 HOH 7   2007 2007 HOH HOH B . 
N 7 HOH 8   2008 2008 HOH HOH B . 
N 7 HOH 9   2009 2009 HOH HOH B . 
N 7 HOH 10  2010 2010 HOH HOH B . 
N 7 HOH 11  2011 2011 HOH HOH B . 
N 7 HOH 12  2012 2012 HOH HOH B . 
N 7 HOH 13  2013 2013 HOH HOH B . 
N 7 HOH 14  2014 2014 HOH HOH B . 
N 7 HOH 15  2015 2015 HOH HOH B . 
N 7 HOH 16  2016 2016 HOH HOH B . 
N 7 HOH 17  2017 2017 HOH HOH B . 
N 7 HOH 18  2018 2018 HOH HOH B . 
N 7 HOH 19  2019 2019 HOH HOH B . 
N 7 HOH 20  2020 2020 HOH HOH B . 
N 7 HOH 21  2021 2021 HOH HOH B . 
N 7 HOH 22  2022 2022 HOH HOH B . 
N 7 HOH 23  2023 2023 HOH HOH B . 
N 7 HOH 24  2024 2024 HOH HOH B . 
N 7 HOH 25  2025 2025 HOH HOH B . 
N 7 HOH 26  2026 2026 HOH HOH B . 
N 7 HOH 27  2027 2027 HOH HOH B . 
N 7 HOH 28  2028 2028 HOH HOH B . 
N 7 HOH 29  2029 2029 HOH HOH B . 
N 7 HOH 30  2030 2030 HOH HOH B . 
N 7 HOH 31  2031 2031 HOH HOH B . 
N 7 HOH 32  2032 2032 HOH HOH B . 
N 7 HOH 33  2033 2033 HOH HOH B . 
N 7 HOH 34  2034 2034 HOH HOH B . 
N 7 HOH 35  2035 2035 HOH HOH B . 
N 7 HOH 36  2036 2036 HOH HOH B . 
N 7 HOH 37  2037 2037 HOH HOH B . 
N 7 HOH 38  2038 2038 HOH HOH B . 
N 7 HOH 39  2039 2039 HOH HOH B . 
N 7 HOH 40  2040 2040 HOH HOH B . 
N 7 HOH 41  2041 2041 HOH HOH B . 
N 7 HOH 42  2042 2042 HOH HOH B . 
N 7 HOH 43  2043 2043 HOH HOH B . 
N 7 HOH 44  2044 2044 HOH HOH B . 
N 7 HOH 45  2045 2045 HOH HOH B . 
N 7 HOH 46  2046 2046 HOH HOH B . 
N 7 HOH 47  2047 2047 HOH HOH B . 
N 7 HOH 48  2048 2048 HOH HOH B . 
N 7 HOH 49  2049 2049 HOH HOH B . 
N 7 HOH 50  2050 2050 HOH HOH B . 
N 7 HOH 51  2051 2051 HOH HOH B . 
N 7 HOH 52  2052 2052 HOH HOH B . 
N 7 HOH 53  2053 2053 HOH HOH B . 
N 7 HOH 54  2054 2054 HOH HOH B . 
N 7 HOH 55  2055 2055 HOH HOH B . 
N 7 HOH 56  2056 2056 HOH HOH B . 
N 7 HOH 57  2057 2057 HOH HOH B . 
N 7 HOH 58  2058 2058 HOH HOH B . 
N 7 HOH 59  2059 2059 HOH HOH B . 
N 7 HOH 60  2060 2060 HOH HOH B . 
N 7 HOH 61  2061 2061 HOH HOH B . 
N 7 HOH 62  2062 2062 HOH HOH B . 
N 7 HOH 63  2063 2063 HOH HOH B . 
N 7 HOH 64  2064 2064 HOH HOH B . 
N 7 HOH 65  2065 2065 HOH HOH B . 
N 7 HOH 66  2066 2066 HOH HOH B . 
N 7 HOH 67  2067 2067 HOH HOH B . 
N 7 HOH 68  2068 2068 HOH HOH B . 
N 7 HOH 69  2069 2069 HOH HOH B . 
N 7 HOH 70  2070 2070 HOH HOH B . 
N 7 HOH 71  2071 2071 HOH HOH B . 
N 7 HOH 72  2072 2072 HOH HOH B . 
N 7 HOH 73  2073 2073 HOH HOH B . 
N 7 HOH 74  2074 2074 HOH HOH B . 
N 7 HOH 75  2075 2075 HOH HOH B . 
N 7 HOH 76  2076 2076 HOH HOH B . 
N 7 HOH 77  2077 2077 HOH HOH B . 
N 7 HOH 78  2078 2078 HOH HOH B . 
N 7 HOH 79  2079 2079 HOH HOH B . 
N 7 HOH 80  2080 2080 HOH HOH B . 
N 7 HOH 81  2081 2081 HOH HOH B . 
N 7 HOH 82  2082 2082 HOH HOH B . 
N 7 HOH 83  2083 2083 HOH HOH B . 
N 7 HOH 84  2084 2084 HOH HOH B . 
N 7 HOH 85  2085 2085 HOH HOH B . 
N 7 HOH 86  2086 2086 HOH HOH B . 
N 7 HOH 87  2087 2087 HOH HOH B . 
N 7 HOH 88  2088 2088 HOH HOH B . 
N 7 HOH 89  2089 2089 HOH HOH B . 
N 7 HOH 90  2090 2090 HOH HOH B . 
N 7 HOH 91  2091 2091 HOH HOH B . 
N 7 HOH 92  2092 2092 HOH HOH B . 
N 7 HOH 93  2093 2093 HOH HOH B . 
N 7 HOH 94  2094 2094 HOH HOH B . 
N 7 HOH 95  2095 2095 HOH HOH B . 
N 7 HOH 96  2096 2096 HOH HOH B . 
N 7 HOH 97  2097 2097 HOH HOH B . 
N 7 HOH 98  2098 2098 HOH HOH B . 
N 7 HOH 99  2099 2099 HOH HOH B . 
N 7 HOH 100 2100 2100 HOH HOH B . 
N 7 HOH 101 2101 2101 HOH HOH B . 
N 7 HOH 102 2102 2102 HOH HOH B . 
N 7 HOH 103 2103 2103 HOH HOH B . 
N 7 HOH 104 2104 2104 HOH HOH B . 
N 7 HOH 105 2105 2105 HOH HOH B . 
N 7 HOH 106 2106 2106 HOH HOH B . 
N 7 HOH 107 2107 2107 HOH HOH B . 
N 7 HOH 108 2108 2108 HOH HOH B . 
N 7 HOH 109 2109 2109 HOH HOH B . 
N 7 HOH 110 2110 2110 HOH HOH B . 
N 7 HOH 111 2111 2111 HOH HOH B . 
N 7 HOH 112 2112 2112 HOH HOH B . 
N 7 HOH 113 2113 2113 HOH HOH B . 
N 7 HOH 114 2114 2114 HOH HOH B . 
N 7 HOH 115 2115 2115 HOH HOH B . 
N 7 HOH 116 2116 2116 HOH HOH B . 
N 7 HOH 117 2117 2117 HOH HOH B . 
N 7 HOH 118 2118 2118 HOH HOH B . 
N 7 HOH 119 2119 2119 HOH HOH B . 
N 7 HOH 120 2120 2120 HOH HOH B . 
N 7 HOH 121 2121 2121 HOH HOH B . 
N 7 HOH 122 2122 2122 HOH HOH B . 
N 7 HOH 123 2123 2123 HOH HOH B . 
N 7 HOH 124 2124 2124 HOH HOH B . 
N 7 HOH 125 2125 2125 HOH HOH B . 
N 7 HOH 126 2126 2126 HOH HOH B . 
N 7 HOH 127 2127 2127 HOH HOH B . 
N 7 HOH 128 2128 2128 HOH HOH B . 
N 7 HOH 129 2129 2129 HOH HOH B . 
N 7 HOH 130 2130 2130 HOH HOH B . 
N 7 HOH 131 2131 2131 HOH HOH B . 
N 7 HOH 132 2132 2132 HOH HOH B . 
N 7 HOH 133 2133 2133 HOH HOH B . 
N 7 HOH 134 2134 2134 HOH HOH B . 
N 7 HOH 135 2135 2135 HOH HOH B . 
N 7 HOH 136 2136 2136 HOH HOH B . 
N 7 HOH 137 2137 2137 HOH HOH B . 
N 7 HOH 138 2138 2138 HOH HOH B . 
N 7 HOH 139 2139 2139 HOH HOH B . 
N 7 HOH 140 2140 2140 HOH HOH B . 
N 7 HOH 141 2141 2141 HOH HOH B . 
N 7 HOH 142 2142 2142 HOH HOH B . 
N 7 HOH 143 2143 2143 HOH HOH B . 
N 7 HOH 144 2144 2144 HOH HOH B . 
N 7 HOH 145 2145 2145 HOH HOH B . 
N 7 HOH 146 2146 2146 HOH HOH B . 
N 7 HOH 147 2147 2147 HOH HOH B . 
N 7 HOH 148 2148 2148 HOH HOH B . 
N 7 HOH 149 2149 2149 HOH HOH B . 
N 7 HOH 150 2150 2150 HOH HOH B . 
N 7 HOH 151 2151 2151 HOH HOH B . 
N 7 HOH 152 2152 2152 HOH HOH B . 
N 7 HOH 153 2153 2153 HOH HOH B . 
N 7 HOH 154 2154 2154 HOH HOH B . 
N 7 HOH 155 2155 2155 HOH HOH B . 
N 7 HOH 156 2156 2156 HOH HOH B . 
N 7 HOH 157 2157 2157 HOH HOH B . 
N 7 HOH 158 2158 2158 HOH HOH B . 
N 7 HOH 159 2159 2159 HOH HOH B . 
N 7 HOH 160 2160 2160 HOH HOH B . 
N 7 HOH 161 2161 2161 HOH HOH B . 
N 7 HOH 162 2162 2162 HOH HOH B . 
N 7 HOH 163 2163 2163 HOH HOH B . 
N 7 HOH 164 2164 2164 HOH HOH B . 
N 7 HOH 165 2165 2165 HOH HOH B . 
N 7 HOH 166 2166 2166 HOH HOH B . 
N 7 HOH 167 2167 2167 HOH HOH B . 
N 7 HOH 168 2168 2168 HOH HOH B . 
N 7 HOH 169 2169 2169 HOH HOH B . 
N 7 HOH 170 2170 2170 HOH HOH B . 
N 7 HOH 171 2171 2171 HOH HOH B . 
N 7 HOH 172 2172 2172 HOH HOH B . 
N 7 HOH 173 2173 2173 HOH HOH B . 
N 7 HOH 174 2174 2174 HOH HOH B . 
N 7 HOH 175 2175 2175 HOH HOH B . 
N 7 HOH 176 2176 2176 HOH HOH B . 
N 7 HOH 177 2177 2177 HOH HOH B . 
N 7 HOH 178 2178 2178 HOH HOH B . 
N 7 HOH 179 2179 2179 HOH HOH B . 
N 7 HOH 180 2180 2180 HOH HOH B . 
N 7 HOH 181 2181 2181 HOH HOH B . 
N 7 HOH 182 2182 2182 HOH HOH B . 
N 7 HOH 183 2183 2183 HOH HOH B . 
N 7 HOH 184 2184 2184 HOH HOH B . 
N 7 HOH 185 2185 2185 HOH HOH B . 
N 7 HOH 186 2186 2186 HOH HOH B . 
N 7 HOH 187 2187 2187 HOH HOH B . 
N 7 HOH 188 2188 2188 HOH HOH B . 
N 7 HOH 189 2189 2189 HOH HOH B . 
N 7 HOH 190 2190 2190 HOH HOH B . 
N 7 HOH 191 2191 2191 HOH HOH B . 
N 7 HOH 192 2192 2192 HOH HOH B . 
N 7 HOH 193 2193 2193 HOH HOH B . 
N 7 HOH 194 2194 2194 HOH HOH B . 
N 7 HOH 195 2195 2195 HOH HOH B . 
N 7 HOH 196 2196 2196 HOH HOH B . 
N 7 HOH 197 2197 2197 HOH HOH B . 
N 7 HOH 198 2198 2198 HOH HOH B . 
N 7 HOH 199 2199 2199 HOH HOH B . 
N 7 HOH 200 2200 2200 HOH HOH B . 
N 7 HOH 201 2201 2201 HOH HOH B . 
N 7 HOH 202 2202 2202 HOH HOH B . 
N 7 HOH 203 2203 2203 HOH HOH B . 
N 7 HOH 204 2204 2204 HOH HOH B . 
N 7 HOH 205 2205 2205 HOH HOH B . 
N 7 HOH 206 2206 2206 HOH HOH B . 
N 7 HOH 207 2207 2207 HOH HOH B . 
N 7 HOH 208 2208 2208 HOH HOH B . 
N 7 HOH 209 2209 2209 HOH HOH B . 
N 7 HOH 210 2210 2210 HOH HOH B . 
N 7 HOH 211 2211 2211 HOH HOH B . 
N 7 HOH 212 2212 2212 HOH HOH B . 
N 7 HOH 213 2213 2213 HOH HOH B . 
N 7 HOH 214 2214 2214 HOH HOH B . 
N 7 HOH 215 2215 2215 HOH HOH B . 
N 7 HOH 216 2216 2216 HOH HOH B . 
N 7 HOH 217 2217 2217 HOH HOH B . 
N 7 HOH 218 2218 2218 HOH HOH B . 
N 7 HOH 219 2219 2219 HOH HOH B . 
N 7 HOH 220 2220 2220 HOH HOH B . 
N 7 HOH 221 2221 2221 HOH HOH B . 
N 7 HOH 222 2222 2222 HOH HOH B . 
N 7 HOH 223 2223 2223 HOH HOH B . 
N 7 HOH 224 2224 2224 HOH HOH B . 
N 7 HOH 225 2225 2225 HOH HOH B . 
N 7 HOH 226 2226 2226 HOH HOH B . 
N 7 HOH 227 2227 2227 HOH HOH B . 
N 7 HOH 228 2228 2228 HOH HOH B . 
N 7 HOH 229 2229 2229 HOH HOH B . 
N 7 HOH 230 2230 2230 HOH HOH B . 
N 7 HOH 231 2231 2231 HOH HOH B . 
N 7 HOH 232 2232 2232 HOH HOH B . 
N 7 HOH 233 2233 2233 HOH HOH B . 
N 7 HOH 234 2234 2234 HOH HOH B . 
N 7 HOH 235 2235 2235 HOH HOH B . 
N 7 HOH 236 2236 2236 HOH HOH B . 
N 7 HOH 237 2237 2237 HOH HOH B . 
N 7 HOH 238 2238 2238 HOH HOH B . 
N 7 HOH 239 2239 2239 HOH HOH B . 
N 7 HOH 240 2240 2240 HOH HOH B . 
N 7 HOH 241 2241 2241 HOH HOH B . 
N 7 HOH 242 2242 2242 HOH HOH B . 
N 7 HOH 243 2243 2243 HOH HOH B . 
N 7 HOH 244 2244 2244 HOH HOH B . 
N 7 HOH 245 2245 2245 HOH HOH B . 
N 7 HOH 246 2246 2246 HOH HOH B . 
N 7 HOH 247 2247 2247 HOH HOH B . 
N 7 HOH 248 2248 2248 HOH HOH B . 
N 7 HOH 249 2249 2249 HOH HOH B . 
N 7 HOH 250 2250 2250 HOH HOH B . 
N 7 HOH 251 2251 2251 HOH HOH B . 
N 7 HOH 252 2252 2252 HOH HOH B . 
N 7 HOH 253 2253 2253 HOH HOH B . 
N 7 HOH 254 2254 2254 HOH HOH B . 
N 7 HOH 255 2255 2255 HOH HOH B . 
N 7 HOH 256 2256 2256 HOH HOH B . 
N 7 HOH 257 2257 2257 HOH HOH B . 
N 7 HOH 258 2258 2258 HOH HOH B . 
N 7 HOH 259 2259 2259 HOH HOH B . 
N 7 HOH 260 2260 2260 HOH HOH B . 
N 7 HOH 261 2261 2261 HOH HOH B . 
N 7 HOH 262 2262 2262 HOH HOH B . 
N 7 HOH 263 2263 2263 HOH HOH B . 
N 7 HOH 264 2264 2264 HOH HOH B . 
N 7 HOH 265 2265 2265 HOH HOH B . 
N 7 HOH 266 2266 2266 HOH HOH B . 
N 7 HOH 267 2267 2267 HOH HOH B . 
N 7 HOH 268 2268 2268 HOH HOH B . 
N 7 HOH 269 2269 2269 HOH HOH B . 
N 7 HOH 270 2270 2270 HOH HOH B . 
N 7 HOH 271 2271 2271 HOH HOH B . 
N 7 HOH 272 2272 2272 HOH HOH B . 
N 7 HOH 273 2273 2273 HOH HOH B . 
N 7 HOH 274 2274 2274 HOH HOH B . 
N 7 HOH 275 2275 2275 HOH HOH B . 
N 7 HOH 276 2276 2276 HOH HOH B . 
N 7 HOH 277 2277 2277 HOH HOH B . 
N 7 HOH 278 2278 2278 HOH HOH B . 
N 7 HOH 279 2279 2279 HOH HOH B . 
N 7 HOH 280 2280 2280 HOH HOH B . 
N 7 HOH 281 2281 2281 HOH HOH B . 
N 7 HOH 282 2282 2282 HOH HOH B . 
N 7 HOH 283 2283 2283 HOH HOH B . 
N 7 HOH 284 2284 2284 HOH HOH B . 
N 7 HOH 285 2285 2285 HOH HOH B . 
N 7 HOH 286 2286 2286 HOH HOH B . 
N 7 HOH 287 2287 2287 HOH HOH B . 
N 7 HOH 288 2288 2288 HOH HOH B . 
N 7 HOH 289 2289 2289 HOH HOH B . 
N 7 HOH 290 2290 2290 HOH HOH B . 
N 7 HOH 291 2291 2291 HOH HOH B . 
N 7 HOH 292 2292 2292 HOH HOH B . 
N 7 HOH 293 2293 2293 HOH HOH B . 
N 7 HOH 294 2294 2294 HOH HOH B . 
N 7 HOH 295 2295 2295 HOH HOH B . 
N 7 HOH 296 2296 2296 HOH HOH B . 
N 7 HOH 297 2297 2297 HOH HOH B . 
N 7 HOH 298 2298 2298 HOH HOH B . 
N 7 HOH 299 2299 2299 HOH HOH B . 
N 7 HOH 300 2300 2300 HOH HOH B . 
N 7 HOH 301 2301 2301 HOH HOH B . 
N 7 HOH 302 2302 2302 HOH HOH B . 
N 7 HOH 303 2303 2303 HOH HOH B . 
N 7 HOH 304 2304 2304 HOH HOH B . 
N 7 HOH 305 2305 2305 HOH HOH B . 
N 7 HOH 306 2306 2306 HOH HOH B . 
N 7 HOH 307 2307 2307 HOH HOH B . 
N 7 HOH 308 2308 2308 HOH HOH B . 
N 7 HOH 309 2309 2309 HOH HOH B . 
N 7 HOH 310 2310 2310 HOH HOH B . 
N 7 HOH 311 2311 2311 HOH HOH B . 
N 7 HOH 312 2312 2312 HOH HOH B . 
N 7 HOH 313 2313 2313 HOH HOH B . 
N 7 HOH 314 2314 2314 HOH HOH B . 
N 7 HOH 315 2315 2315 HOH HOH B . 
N 7 HOH 316 2316 2316 HOH HOH B . 
N 7 HOH 317 2317 2317 HOH HOH B . 
N 7 HOH 318 2318 2318 HOH HOH B . 
N 7 HOH 319 2319 2319 HOH HOH B . 
N 7 HOH 320 2320 2320 HOH HOH B . 
N 7 HOH 321 2321 2321 HOH HOH B . 
N 7 HOH 322 2322 2322 HOH HOH B . 
N 7 HOH 323 2323 2323 HOH HOH B . 
N 7 HOH 324 2324 2324 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
4 A SGB 203 A SGB 203 ? SER ?                    
5 B SGB 203 B SGB 203 ? SER ?                    
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,G,H,I,M 
2 1 B,J,K,L,N         
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-11-30 
2 'Structure model' 1 1 2013-05-01 
3 'Structure model' 1 2 2018-01-17 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Other                  
2 3 'Structure model' Advisory               
3 3 'Structure model' 'Data collection'      
4 4 'Structure model' 'Data collection'      
5 4 'Structure model' 'Derived calculations' 
6 4 'Structure model' Other                  
7 4 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' diffrn_source                
2  3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3  4 'Structure model' chem_comp                    
4  4 'Structure model' entity                       
5  4 'Structure model' pdbx_chem_comp_identifier    
6  4 'Structure model' pdbx_database_status         
7  4 'Structure model' pdbx_entity_nonpoly          
8  4 'Structure model' struct_conn                  
9  4 'Structure model' struct_site                  
10 4 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 4 'Structure model' '_chem_comp.name'                      
3 4 'Structure model' '_chem_comp.type'                      
4 4 'Structure model' '_entity.pdbx_description'             
5 4 'Structure model' '_pdbx_database_status.status_code_sf' 
6 4 'Structure model' '_pdbx_entity_nonpoly.name'            
7 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
8 4 'Structure model' '_struct_conn.pdbx_role'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
REFMAC phasing          .                 ? 4 
# 
_pdbx_entry_details.entry_id                 2Y2V 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       'RESIDUE SGB REPRESENTS CATALYTIC SER 203 PHOSPHONYLATED BY SARIN.' 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 83.88   -7.25   
2  1 ALA A 127 ? ? -172.59 142.92  
3  1 PHE A 158 ? ? -143.84 -6.34   
4  1 ALA A 167 ? ? -164.68 69.13   
5  1 SGB A 203 ? ? 60.00   -114.91 
6  1 ASP A 306 ? ? -135.58 -87.44  
7  1 VAL A 367 ? ? -118.52 72.09   
8  1 HIS A 387 ? ? -144.60 53.45   
9  1 VAL A 407 ? ? -130.28 -64.23  
10 1 PHE B 47  ? ? 75.01   -2.34   
11 1 PRO B 55  ? ? -48.15  151.59  
12 1 ALA B 62  ? ? -114.64 58.38   
13 1 SER B 93  ? ? -177.35 143.35  
14 1 SGB B 203 ? ? 53.41   -117.51 
15 1 ASP B 306 ? ? -122.22 -85.56  
16 1 ASP B 323 ? ? -95.05  30.34   
17 1 VAL B 407 ? ? -125.45 -63.01  
18 1 ALA B 506 ? ? -62.06  -71.99  
19 1 ASN B 514 ? ? -162.09 -166.94 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2035 ? 6.24 . 
2 1 O ? A HOH 2100 ? 5.86 . 
3 1 O ? A HOH 2136 ? 5.85 . 
4 1 O ? A HOH 2146 ? 6.86 . 
5 1 O ? B HOH 2005 ? 6.55 . 
6 1 O ? B HOH 2017 ? 7.14 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 81  ? CG  ? A GLU 81  CG  
2  1 Y 1 A GLU 81  ? CD  ? A GLU 81  CD  
3  1 Y 1 A GLU 81  ? OE1 ? A GLU 81  OE1 
4  1 Y 1 A GLU 81  ? OE2 ? A GLU 81  OE2 
5  1 Y 1 B GLU 4   ? CG  ? B GLU 4   CG  
6  1 Y 1 B GLU 4   ? CD  ? B GLU 4   CD  
7  1 Y 1 B GLU 4   ? OE1 ? B GLU 4   OE1 
8  1 Y 1 B GLU 4   ? OE2 ? B GLU 4   OE2 
9  1 Y 1 B GLU 268 ? CG  ? B GLU 268 CG  
10 1 Y 1 B GLU 268 ? CD  ? B GLU 268 CD  
11 1 Y 1 B GLU 268 ? OE1 ? B GLU 268 OE1 
12 1 Y 1 B GLU 268 ? OE2 ? B GLU 268 OE2 
13 1 Y 1 B ASP 323 ? CG  ? B ASP 323 CG  
14 1 Y 1 B ASP 323 ? OD1 ? B ASP 323 OD1 
15 1 Y 1 B ASP 323 ? OD2 ? B ASP 323 OD2 
16 1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
17 1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
18 1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
19 1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
20 1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
21 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
22 1 Y 1 B GLN 499 ? CG  ? B GLN 499 CG  
23 1 Y 1 B GLN 499 ? CD  ? B GLN 499 CD  
24 1 Y 1 B GLN 499 ? OE1 ? B GLN 499 OE1 
25 1 Y 1 B GLN 499 ? NE2 ? B GLN 499 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A ARG 493 ? A ARG 493 
9  1 Y 1 A ASP 494 ? A ASP 494 
10 1 Y 1 A SER 495 ? A SER 495 
11 1 Y 1 A LYS 496 ? A LYS 496 
12 1 Y 1 A THR 543 ? A THR 543 
13 1 Y 1 A ALA 544 ? A ALA 544 
14 1 Y 1 A THR 545 ? A THR 545 
15 1 Y 1 A GLU 546 ? A GLU 546 
16 1 Y 1 A ALA 547 ? A ALA 547 
17 1 Y 1 A PRO 548 ? A PRO 548 
18 1 Y 1 B GLU 1   ? B GLU 1   
19 1 Y 1 B GLY 2   ? B GLY 2   
20 1 Y 1 B ARG 3   ? B ARG 3   
21 1 Y 1 B PRO 258 ? B PRO 258 
22 1 Y 1 B PRO 259 ? B PRO 259 
23 1 Y 1 B GLY 260 ? B GLY 260 
24 1 Y 1 B GLY 261 ? B GLY 261 
25 1 Y 1 B ALA 262 ? B ALA 262 
26 1 Y 1 B GLY 263 ? B GLY 263 
27 1 Y 1 B GLY 264 ? B GLY 264 
28 1 Y 1 B SER 495 ? B SER 495 
29 1 Y 1 B LYS 496 ? B LYS 496 
30 1 Y 1 B SER 497 ? B SER 497 
31 1 Y 1 B THR 543 ? B THR 543 
32 1 Y 1 B ALA 544 ? B ALA 544 
33 1 Y 1 B THR 545 ? B THR 545 
34 1 Y 1 B GLU 546 ? B GLU 546 
35 1 Y 1 B ALA 547 ? B ALA 547 
36 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 'DI(HYDROXYETHYL)ETHER'                  PEG 
4 '1-ETHOXY-2-(2-METHOXYETHOXY)ETHANE'     ME2 
5 2,5,8,11,14,17-HEXAOXANONADECAN-19-OL    P15 
6 2-ETHOXYETHANOL                          ETX 
7 water                                    HOH 
#