data_2Y33
# 
_entry.id   2Y33 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y33         
PDBE  EBI-46781    
WWPDB D_1290046781 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2HBT unspecified 'CRYSTAL STRUCTURE OF HIF PROLYL HYDROXYLASE EGLN-1 IN COMPLEX WITH A BIOLOGICALLY ACTIVE INHIBITOR' 
PDB 2G19 unspecified 'CELLULAR OXYGEN SENSING: CRYSTAL STRUCTURE OF HYPOXIA-INDUCIBLE FACTOR PROLYL HYDROXYLASE (PHD2)'   
PDB 2G1M unspecified 'CELLULAR OXYGEN SENSING: CRYSTAL STRUCTURE OF HYPOXIA-INDUCIBLE FACTOR PROLYL HYDROXYLASE (PHD2)'   
PDB 2HBU unspecified 'CRYSTAL STRUCTURE OF HIF PROLYL HYDROXYLASE EGLN-1 IN COMPLEX WITH A BIOLOGICALLY ACTIVE INHIBITOR' 
PDB 2Y34 unspecified 'S-NITROSYLATED PHD2 (NO EXPOSED) IN COMPLEX WITH FE(II) AND UN9'                                    
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y33 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chowdhury, R.'   1 ? 
'Clifton, I.J.'   2 ? 
'Schofield, C.J.' 3 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Studies on the Reaction of Nitric Oxide with the Hypoxia-Inducible Factor Prolyl Hydroxylase Domain 2 (Egln1)' 
J.Mol.Biol.            410 268  279  2011 JMOBAK UK 0022-2836 0070 ? 21601578 10.1016/J.JMB.2011.04.075 
1       'Structural Basis for Binding of Hypoxia-Inducible Factor to the Oxygen-Sensing Prolyl Hydroxylases.'           Structure 
17  981  989  2009 STRUE6 UK 0969-2126 2005 ? 19604478 10.1016/J.STR.2009.06.002 
2       'Cellular Oxygen Sensing: Crystal Structure of Hypoxia-Inducible Factor Prolyl Hydroxylase (Phd2).'             
Proc.Natl.Acad.Sci.USA 103 9814 9819 2006 PNASA6 US 0027-8424 0040 ? 16782814 10.1073/PNAS.0601283103   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chowdhury, R.'   1  ? 
primary 'Flashman, E.'    2  ? 
primary 'Mecinovic, J.'   3  ? 
primary 'Kramer, H.B.'    4  ? 
primary 'Kessler, B.M.'   5  ? 
primary 'Frapart, Y.M.'   6  ? 
primary 'Boucher, J.-L.'  7  ? 
primary 'Clifton, I.J.'   8  ? 
primary 'McDonough, M.A.' 9  ? 
primary 'Schofield, C.J.' 10 ? 
1       'Chowdhury, R.'   11 ? 
1       'McDonough, M.A.' 12 ? 
1       'Mecinovic, J.'   13 ? 
1       'Loenarz, C.'     14 ? 
1       'Flashman, E.'    15 ? 
1       'Hewitson, K.S.'  16 ? 
1       'Domene, C.'      17 ? 
1       'Schofield, C.J.' 18 ? 
2       'McDonough, M.A.' 19 ? 
2       'Li, V.'          20 ? 
2       'Flashman, E.'    21 ? 
2       'Chowdhury, R.'   22 ? 
2       'Mohr, C.'        23 ? 
2       'Lienard, B.M.R.' 24 ? 
2       'Zondlo, J.'      25 ? 
2       'Oldham, N.J.'    26 ? 
2       'Clifton, I.J.'   27 ? 
2       'Lewis, J.'       28 ? 
2       'Mcneill, L.A.'   29 ? 
2       'Kurzeja, R.J.M.' 30 ? 
2       'Hewitson, K.S.'  31 ? 
2       'Yang, E.'        32 ? 
2       'Jordan, S.'      33 ? 
2       'Syed, R.S.'      34 ? 
2       'Schofield, C.J.' 35 ? 
# 
_cell.entry_id           2Y33 
_cell.length_a           111.050 
_cell.length_b           111.050 
_cell.length_c           40.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y33 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'EGL NINE HOMOLOG 1'                                      28125.939 1   1.14.11.- ? 
'CATALYTIC DOMAIN, RESIDUES 181-426' ? 
2 non-polymer syn 'ZINC ION'                                                65.409    1   ?         ? ? ? 
3 non-polymer syn 'N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE' 280.664   1   ?         ? ? ? 
4 water       nat water                                                     18.015    143 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;HYPOXIA-INDUCIBLE FACTOR PROLYL HYDROXYLASE 2, PROLYL HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2, SM-20, HIF-PH2, HIF-PROLYL HYDROXYLASE 2, HPH-2, PHD2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMASPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGD
KITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVA(SNC)YPGNGTGYVRHVDNPNGDGRCVTCIYYL
NKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGV
RVELNKPSDSVGKDVF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMASPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGD
KITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVEL
NKPSDSVGKDVF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   SER n 
1 7   PRO n 
1 8   ASN n 
1 9   GLY n 
1 10  GLN n 
1 11  THR n 
1 12  LYS n 
1 13  PRO n 
1 14  LEU n 
1 15  PRO n 
1 16  ALA n 
1 17  LEU n 
1 18  LYS n 
1 19  LEU n 
1 20  ALA n 
1 21  LEU n 
1 22  GLU n 
1 23  TYR n 
1 24  ILE n 
1 25  VAL n 
1 26  PRO n 
1 27  CYS n 
1 28  MET n 
1 29  ASN n 
1 30  LYS n 
1 31  HIS n 
1 32  GLY n 
1 33  ILE n 
1 34  CYS n 
1 35  VAL n 
1 36  VAL n 
1 37  ASP n 
1 38  ASP n 
1 39  PHE n 
1 40  LEU n 
1 41  GLY n 
1 42  LYS n 
1 43  GLU n 
1 44  THR n 
1 45  GLY n 
1 46  GLN n 
1 47  GLN n 
1 48  ILE n 
1 49  GLY n 
1 50  ASP n 
1 51  GLU n 
1 52  VAL n 
1 53  ARG n 
1 54  ALA n 
1 55  LEU n 
1 56  HIS n 
1 57  ASP n 
1 58  THR n 
1 59  GLY n 
1 60  LYS n 
1 61  PHE n 
1 62  THR n 
1 63  ASP n 
1 64  GLY n 
1 65  GLN n 
1 66  LEU n 
1 67  VAL n 
1 68  SER n 
1 69  GLN n 
1 70  LYS n 
1 71  SER n 
1 72  ASP n 
1 73  SER n 
1 74  SER n 
1 75  LYS n 
1 76  ASP n 
1 77  ILE n 
1 78  ARG n 
1 79  GLY n 
1 80  ASP n 
1 81  LYS n 
1 82  ILE n 
1 83  THR n 
1 84  TRP n 
1 85  ILE n 
1 86  GLU n 
1 87  GLY n 
1 88  LYS n 
1 89  GLU n 
1 90  PRO n 
1 91  GLY n 
1 92  CYS n 
1 93  GLU n 
1 94  THR n 
1 95  ILE n 
1 96  GLY n 
1 97  LEU n 
1 98  LEU n 
1 99  MET n 
1 100 SER n 
1 101 SER n 
1 102 MET n 
1 103 ASP n 
1 104 ASP n 
1 105 LEU n 
1 106 ILE n 
1 107 ARG n 
1 108 HIS n 
1 109 CYS n 
1 110 ASN n 
1 111 GLY n 
1 112 LYS n 
1 113 LEU n 
1 114 GLY n 
1 115 SER n 
1 116 TYR n 
1 117 LYS n 
1 118 ILE n 
1 119 ASN n 
1 120 GLY n 
1 121 ARG n 
1 122 THR n 
1 123 LYS n 
1 124 ALA n 
1 125 MET n 
1 126 VAL n 
1 127 ALA n 
1 128 SNC n 
1 129 TYR n 
1 130 PRO n 
1 131 GLY n 
1 132 ASN n 
1 133 GLY n 
1 134 THR n 
1 135 GLY n 
1 136 TYR n 
1 137 VAL n 
1 138 ARG n 
1 139 HIS n 
1 140 VAL n 
1 141 ASP n 
1 142 ASN n 
1 143 PRO n 
1 144 ASN n 
1 145 GLY n 
1 146 ASP n 
1 147 GLY n 
1 148 ARG n 
1 149 CYS n 
1 150 VAL n 
1 151 THR n 
1 152 CYS n 
1 153 ILE n 
1 154 TYR n 
1 155 TYR n 
1 156 LEU n 
1 157 ASN n 
1 158 LYS n 
1 159 ASP n 
1 160 TRP n 
1 161 ASP n 
1 162 ALA n 
1 163 LYS n 
1 164 VAL n 
1 165 SER n 
1 166 GLY n 
1 167 GLY n 
1 168 ILE n 
1 169 LEU n 
1 170 ARG n 
1 171 ILE n 
1 172 PHE n 
1 173 PRO n 
1 174 GLU n 
1 175 GLY n 
1 176 LYS n 
1 177 ALA n 
1 178 GLN n 
1 179 PHE n 
1 180 ALA n 
1 181 ASP n 
1 182 ILE n 
1 183 GLU n 
1 184 PRO n 
1 185 LYS n 
1 186 PHE n 
1 187 ASP n 
1 188 ARG n 
1 189 LEU n 
1 190 LEU n 
1 191 PHE n 
1 192 PHE n 
1 193 TRP n 
1 194 SER n 
1 195 ASP n 
1 196 ARG n 
1 197 ARG n 
1 198 ASN n 
1 199 PRO n 
1 200 HIS n 
1 201 GLU n 
1 202 VAL n 
1 203 GLN n 
1 204 PRO n 
1 205 ALA n 
1 206 TYR n 
1 207 ALA n 
1 208 THR n 
1 209 ARG n 
1 210 TYR n 
1 211 ALA n 
1 212 ILE n 
1 213 THR n 
1 214 VAL n 
1 215 TRP n 
1 216 TYR n 
1 217 PHE n 
1 218 ASP n 
1 219 ALA n 
1 220 ASP n 
1 221 GLU n 
1 222 ARG n 
1 223 ALA n 
1 224 ARG n 
1 225 ALA n 
1 226 LYS n 
1 227 VAL n 
1 228 LYS n 
1 229 TYR n 
1 230 LEU n 
1 231 THR n 
1 232 GLY n 
1 233 GLU n 
1 234 LYS n 
1 235 GLY n 
1 236 VAL n 
1 237 ARG n 
1 238 VAL n 
1 239 GLU n 
1 240 LEU n 
1 241 ASN n 
1 242 LYS n 
1 243 PRO n 
1 244 SER n 
1 245 ASP n 
1 246 SER n 
1 247 VAL n 
1 248 GLY n 
1 249 LYS n 
1 250 ASP n 
1 251 VAL n 
1 252 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET28A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EGLN1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q9GZT9 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Y33 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 7 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 252 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9GZT9 
_struct_ref_seq.db_align_beg                  181 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  426 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       181 
_struct_ref_seq.pdbx_auth_seq_align_end       426 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y33 GLY A 1 ? UNP Q9GZT9 ? ? 'expression tag' 175 1 
1 2Y33 SER A 2 ? UNP Q9GZT9 ? ? 'expression tag' 176 2 
1 2Y33 HIS A 3 ? UNP Q9GZT9 ? ? 'expression tag' 177 3 
1 2Y33 MET A 4 ? UNP Q9GZT9 ? ? 'expression tag' 178 4 
1 2Y33 ALA A 5 ? UNP Q9GZT9 ? ? 'expression tag' 179 5 
1 2Y33 SER A 6 ? UNP Q9GZT9 ? ? 'expression tag' 180 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                   ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                           ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                   ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                    ? 'C3 H7 N O3'      105.093 
SNC 'L-peptide linking' n S-NITROSO-CYSTEINE                                        ? 'C3 H6 N2 O3 S'   150.156 
THR 'L-peptide linking' y THREONINE                                                 ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                  ? 'C9 H11 N O3'     181.189 
UN9 non-polymer         . 'N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE' ? 'C12 H9 Cl N2 O4' 280.664 
VAL 'L-peptide linking' y VALINE                                                    ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                                                ? 'Zn 2'            65.409  
# 
_exptl.entry_id          2Y33 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   51.89 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;APPROX. 20 MG/ML APO-PHD2, 1MM ZN-ACETATE, 1MM FG2, VAPOR DIFFUSION, SITTING DROP, 30% PEG 4000 (W/V), 0.2M SODIUM ACETATE, 0.1 M TRIS-HCL PH 8.5; PRE-GROWN CRYSTALS WERE SOAKED WITH 50 MM GSNO FOR 12 HR.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-02-03 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9695 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9695 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y33 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.19 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   19446 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.10 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.20 
_reflns.B_iso_Wilson_estimate        18.6 
_reflns.pdbx_redundancy              5.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   98.1 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.20 
_reflns_shell.pdbx_redundancy        3.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y33 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19446 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               158464.65 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.35 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.209 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.6 
_refine.ls_number_reflns_R_free                  1030 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.8 
_refine.aniso_B[1][1]                            0.95 
_refine.aniso_B[2][2]                            0.95 
_refine.aniso_B[3][3]                            -1.89 
_refine.aniso_B[1][2]                            -0.02 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.384767 
_refine.solvent_model_param_bsol                 62.2681 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;TREATMENT OF PHD2 WITH GSNO RESULTED IN S-NITROSYLATION OF CYS 302, WHICH WAS REFINED AS R-S-NO. HOWEVER, THE DIHEDRAL ANGLE FOR THE C-S-N-O GROUP SUGGESTS THAT THE MODIFIED RESIDUE MAY, AT LEAST IN PART, BE THE R-S-N*-OH, WHICH IS A PROPOSED REACTION INTERMEDIATE OF NO WITH THIOLS, OR THE O- CENTRED THIONITROXIDE RADICAL R-S-NH-O*. OTHER POTENTIAL FORMS SUCH AS R-S-NH-OH MAY ALSO RESULT FROM PARTIAL REDUCTION OF R-S- NO DURING DATA COLLECTION.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2G19' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2Y33 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1691 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             143 
_refine_hist.number_atoms_total               1854 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.1  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.72  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   7 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.11 
_refine_ls_shell.number_reflns_R_work             4178 
_refine_ls_shell.R_factor_R_work                  0.266 
_refine_ls_shell.percent_reflns_obs               98.1 
_refine_ls_shell.R_factor_R_free                  0.295 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            5.9 
_refine_ls_shell.number_reflns_R_free             260 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 ION.PARAM         ION.TOP     
'X-RAY DIFFRACTION' 4 SNC.PAR           SNC.TOP     
'X-RAY DIFFRACTION' 5 UN9.PAR           UN9.TOP     
# 
_struct.entry_id                  2Y33 
_struct.title                     'S-nitrosylated PHD2 (GSNO soaked) in complex with Zn(II) and UN9' 
_struct.pdbx_descriptor           'EGL NINE HOMOLOG 1 (E.C.1.14.11.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y33 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'OXIDOREDUCTASE, NON-HEME, TRANSCRIPTION AND EPIGENETIC REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 15  ? TYR A 23  ? PRO A 189 TYR A 197 1 ? 9  
HELX_P HELX_P2 2 TYR A 23  ? HIS A 31  ? TYR A 197 HIS A 205 1 ? 9  
HELX_P HELX_P3 3 GLY A 41  ? THR A 58  ? GLY A 215 THR A 232 1 ? 18 
HELX_P HELX_P4 4 CYS A 92  ? HIS A 108 ? CYS A 266 HIS A 282 1 ? 17 
HELX_P HELX_P5 5 ASP A 161 ? GLY A 166 ? ASP A 335 GLY A 340 1 ? 6  
HELX_P HELX_P6 6 ALA A 219 ? TYR A 229 ? ALA A 393 TYR A 403 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 27  SG ? ? ? 1_555 A CYS 34  SG  ? ? A CYS 201 A CYS 208  1_555 ? ? ? ? ? ? ? 2.029 ? 
covale1 covale ? ? A ALA 127 C  ? ? ? 1_555 A SNC 128 N   ? ? A ALA 301 A SNC 302  1_555 ? ? ? ? ? ? ? 1.318 ? 
covale2 covale ? ? A SNC 128 C  ? ? ? 1_555 A TYR 129 N   ? ? A SNC 302 A TYR 303  1_555 ? ? ? ? ? ? ? 1.317 ? 
metalc1 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A ASP 141 OD1 ? ? A ZN  900 A ASP 315  1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc2 metalc ? ? B ZN  .   ZN ? ? ? 1_555 C UN9 .   N8  ? ? A ZN  900 A UN9 901  1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc3 metalc ? ? B ZN  .   ZN ? ? ? 1_555 D HOH .   O   ? ? A ZN  900 A HOH 2142 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc4 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A HIS 139 NE2 ? ? A ZN  900 A HIS 313  1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc5 metalc ? ? B ZN  .   ZN ? ? ? 1_555 C UN9 .   O13 ? ? A ZN  900 A UN9 901  1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc6 metalc ? ? B ZN  .   ZN ? ? ? 1_555 A HIS 200 NE2 ? ? A ZN  900 A HIS 374  1_555 ? ? ? ? ? ? ? 2.092 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 33  ? ASP A 37  ? ILE A 207 ASP A 211 
AA 2 ARG A 188 ? TRP A 193 ? ARG A 362 TRP A 367 
AA 3 ARG A 148 ? TYR A 155 ? ARG A 322 TYR A 329 
AA 4 ARG A 209 ? ASP A 218 ? ARG A 383 ASP A 392 
AA 5 ALA A 124 ? TYR A 129 ? ALA A 298 TYR A 303 
AA 6 LYS A 81  ? ILE A 85  ? LYS A 255 ILE A 259 
AB 1 ILE A 33  ? ASP A 37  ? ILE A 207 ASP A 211 
AB 2 ARG A 188 ? TRP A 193 ? ARG A 362 TRP A 367 
AB 3 ARG A 148 ? TYR A 155 ? ARG A 322 TYR A 329 
AB 4 ARG A 209 ? ASP A 218 ? ARG A 383 ASP A 392 
AB 5 ILE A 118 ? ARG A 121 ? ILE A 292 ARG A 295 
AC 1 LEU A 66  ? SER A 68  ? LEU A 240 SER A 242 
AC 2 ILE A 77  ? ARG A 78  ? ILE A 251 ARG A 252 
AD 1 TYR A 136 ? HIS A 139 ? TYR A 310 HIS A 313 
AD 2 HIS A 200 ? VAL A 202 ? HIS A 374 VAL A 376 
AD 3 LEU A 169 ? ILE A 171 ? LEU A 343 ILE A 345 
AD 4 ALA A 180 ? ILE A 182 ? ALA A 354 ILE A 356 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 36  ? N VAL A 210 O LEU A 189 ? O LEU A 363 
AA 2 3 N PHE A 192 ? N PHE A 366 O THR A 151 ? O THR A 325 
AA 3 4 N TYR A 154 ? N TYR A 328 O ILE A 212 ? O ILE A 386 
AA 4 5 N THR A 213 ? N THR A 387 O MET A 125 ? O MET A 299 
AA 5 6 N SNC A 128 ? N SNC A 302 O LYS A 81  ? O LYS A 255 
AB 1 2 N VAL A 36  ? N VAL A 210 O LEU A 189 ? O LEU A 363 
AB 2 3 N PHE A 192 ? N PHE A 366 O THR A 151 ? O THR A 325 
AB 3 4 N TYR A 154 ? N TYR A 328 O ILE A 212 ? O ILE A 386 
AB 4 5 O PHE A 217 ? O PHE A 391 N ASN A 119 ? N ASN A 293 
AC 1 2 N VAL A 67  ? N VAL A 241 O ILE A 77  ? O ILE A 251 
AD 1 2 N HIS A 139 ? N HIS A 313 O HIS A 200 ? O HIS A 374 
AD 2 3 N GLU A 201 ? N GLU A 375 O ARG A 170 ? O ARG A 344 
AD 3 4 N ILE A 171 ? N ILE A 345 O ALA A 180 ? O ALA A 354 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 900'  
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE UN9 A 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 139 ? HIS A 313  . ? 1_555 ? 
2  AC1 5  ASP A 141 ? ASP A 315  . ? 1_555 ? 
3  AC1 5  HIS A 200 ? HIS A 374  . ? 1_555 ? 
4  AC1 5  UN9 C .   ? UN9 A 901  . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 2142 . ? 1_555 ? 
6  AC2 15 ASP A 80  ? ASP A 254  . ? 1_555 ? 
7  AC2 15 MET A 125 ? MET A 299  . ? 1_555 ? 
8  AC2 15 TYR A 129 ? TYR A 303  . ? 1_555 ? 
9  AC2 15 TYR A 136 ? TYR A 310  . ? 1_555 ? 
10 AC2 15 HIS A 139 ? HIS A 313  . ? 1_555 ? 
11 AC2 15 ASP A 141 ? ASP A 315  . ? 1_555 ? 
12 AC2 15 TYR A 155 ? TYR A 329  . ? 1_555 ? 
13 AC2 15 HIS A 200 ? HIS A 374  . ? 1_555 ? 
14 AC2 15 VAL A 202 ? VAL A 376  . ? 1_555 ? 
15 AC2 15 ARG A 209 ? ARG A 383  . ? 1_555 ? 
16 AC2 15 ARG A 224 ? ARG A 398  . ? 2_565 ? 
17 AC2 15 ZN  B .   ? ZN  A 900  . ? 1_555 ? 
18 AC2 15 HOH D .   ? HOH A 2133 . ? 1_555 ? 
19 AC2 15 HOH D .   ? HOH A 2142 . ? 1_555 ? 
20 AC2 15 HOH D .   ? HOH A 2143 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y33 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y33 
_atom_sites.fract_transf_matrix[1][1]   0.009005 
_atom_sites.fract_transf_matrix[1][2]   0.005199 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010398 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024795 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 14  ? -29.463 2.707  -9.506  1.00 49.41 ? 188  LEU A N   1 
ATOM   2    C  CA  . LEU A 1 14  ? -30.674 1.866  -9.280  1.00 49.44 ? 188  LEU A CA  1 
ATOM   3    C  C   . LEU A 1 14  ? -31.911 2.426  -9.978  1.00 48.70 ? 188  LEU A C   1 
ATOM   4    O  O   . LEU A 1 14  ? -32.117 3.639  -10.024 1.00 48.85 ? 188  LEU A O   1 
ATOM   5    C  CB  . LEU A 1 14  ? -30.970 1.739  -7.781  1.00 49.67 ? 188  LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 14  ? -30.050 0.868  -6.920  1.00 51.76 ? 188  LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 14  ? -28.669 1.500  -6.805  1.00 51.48 ? 188  LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 14  ? -30.673 0.701  -5.543  1.00 51.11 ? 188  LEU A CD2 1 
ATOM   9    N  N   . PRO A 1 15  ? -32.747 1.540  -10.544 1.00 47.49 ? 189  PRO A N   1 
ATOM   10   C  CA  . PRO A 1 15  ? -33.963 1.985  -11.230 1.00 46.14 ? 189  PRO A CA  1 
ATOM   11   C  C   . PRO A 1 15  ? -34.898 2.653  -10.222 1.00 44.97 ? 189  PRO A C   1 
ATOM   12   O  O   . PRO A 1 15  ? -35.007 2.212  -9.077  1.00 44.01 ? 189  PRO A O   1 
ATOM   13   C  CB  . PRO A 1 15  ? -34.545 0.682  -11.777 1.00 46.48 ? 189  PRO A CB  1 
ATOM   14   C  CG  . PRO A 1 15  ? -33.324 -0.156 -12.013 1.00 46.49 ? 189  PRO A CG  1 
ATOM   15   C  CD  . PRO A 1 15  ? -32.520 0.102  -10.764 1.00 46.81 ? 189  PRO A CD  1 
ATOM   16   N  N   . ALA A 1 16  ? -35.566 3.717  -10.651 1.00 43.13 ? 190  ALA A N   1 
ATOM   17   C  CA  . ALA A 1 16  ? -36.486 4.436  -9.781  1.00 41.70 ? 190  ALA A CA  1 
ATOM   18   C  C   . ALA A 1 16  ? -37.446 3.500  -9.045  1.00 40.36 ? 190  ALA A C   1 
ATOM   19   O  O   . ALA A 1 16  ? -37.671 3.649  -7.851  1.00 39.70 ? 190  ALA A O   1 
ATOM   20   C  CB  . ALA A 1 16  ? -37.279 5.451  -10.593 1.00 41.95 ? 190  ALA A CB  1 
ATOM   21   N  N   . LEU A 1 17  ? -38.006 2.533  -9.762  1.00 38.82 ? 191  LEU A N   1 
ATOM   22   C  CA  . LEU A 1 17  ? -38.956 1.606  -9.161  1.00 37.09 ? 191  LEU A CA  1 
ATOM   23   C  C   . LEU A 1 17  ? -38.354 0.761  -8.043  1.00 34.80 ? 191  LEU A C   1 
ATOM   24   O  O   . LEU A 1 17  ? -38.976 0.568  -7.000  1.00 35.05 ? 191  LEU A O   1 
ATOM   25   C  CB  . LEU A 1 17  ? -39.552 0.689  -10.236 1.00 37.86 ? 191  LEU A CB  1 
ATOM   26   C  CG  . LEU A 1 17  ? -40.671 -0.248 -9.765  1.00 37.55 ? 191  LEU A CG  1 
ATOM   27   C  CD1 . LEU A 1 17  ? -41.852 0.571  -9.257  1.00 37.83 ? 191  LEU A CD1 1 
ATOM   28   C  CD2 . LEU A 1 17  ? -41.108 -1.143 -10.915 1.00 38.05 ? 191  LEU A CD2 1 
ATOM   29   N  N   . LYS A 1 18  ? -37.142 0.264  -8.260  1.00 33.66 ? 192  LYS A N   1 
ATOM   30   C  CA  . LYS A 1 18  ? -36.473 -0.572 -7.267  1.00 31.99 ? 192  LYS A CA  1 
ATOM   31   C  C   . LYS A 1 18  ? -36.173 0.236  -6.008  1.00 31.56 ? 192  LYS A C   1 
ATOM   32   O  O   . LYS A 1 18  ? -36.399 -0.228 -4.888  1.00 30.40 ? 192  LYS A O   1 
ATOM   33   C  CB  . LYS A 1 18  ? -35.175 -1.143 -7.849  1.00 31.91 ? 192  LYS A CB  1 
ATOM   34   C  CG  . LYS A 1 18  ? -34.430 -2.097 -6.928  1.00 33.70 ? 192  LYS A CG  1 
ATOM   35   C  CD  . LYS A 1 18  ? -33.157 -2.595 -7.592  1.00 36.30 ? 192  LYS A CD  1 
ATOM   36   C  CE  . LYS A 1 18  ? -32.298 -3.418 -6.639  1.00 38.32 ? 192  LYS A CE  1 
ATOM   37   N  NZ  . LYS A 1 18  ? -32.969 -4.668 -6.179  1.00 41.13 ? 192  LYS A NZ  1 
ATOM   38   N  N   . LEU A 1 19  ? -35.663 1.447  -6.204  1.00 30.99 ? 193  LEU A N   1 
ATOM   39   C  CA  . LEU A 1 19  ? -35.336 2.330  -5.092  1.00 30.60 ? 193  LEU A CA  1 
ATOM   40   C  C   . LEU A 1 19  ? -36.608 2.653  -4.313  1.00 30.17 ? 193  LEU A C   1 
ATOM   41   O  O   . LEU A 1 19  ? -36.628 2.610  -3.084  1.00 29.82 ? 193  LEU A O   1 
ATOM   42   C  CB  . LEU A 1 19  ? -34.707 3.627  -5.619  1.00 29.78 ? 193  LEU A CB  1 
ATOM   43   C  CG  . LEU A 1 19  ? -34.328 4.708  -4.595  1.00 31.54 ? 193  LEU A CG  1 
ATOM   44   C  CD1 . LEU A 1 19  ? -33.223 4.200  -3.672  1.00 30.58 ? 193  LEU A CD1 1 
ATOM   45   C  CD2 . LEU A 1 19  ? -33.869 5.962  -5.331  1.00 31.69 ? 193  LEU A CD2 1 
ATOM   46   N  N   . ALA A 1 20  ? -37.673 2.958  -5.045  1.00 29.97 ? 194  ALA A N   1 
ATOM   47   C  CA  . ALA A 1 20  ? -38.953 3.302  -4.442  1.00 31.92 ? 194  ALA A CA  1 
ATOM   48   C  C   . ALA A 1 20  ? -39.607 2.157  -3.667  1.00 32.63 ? 194  ALA A C   1 
ATOM   49   O  O   . ALA A 1 20  ? -39.960 2.311  -2.502  1.00 30.79 ? 194  ALA A O   1 
ATOM   50   C  CB  . ALA A 1 20  ? -39.902 3.804  -5.517  1.00 32.34 ? 194  ALA A CB  1 
ATOM   51   N  N   . LEU A 1 21  ? -39.761 1.007  -4.318  1.00 33.29 ? 195  LEU A N   1 
ATOM   52   C  CA  . LEU A 1 21  ? -40.401 -0.145 -3.691  1.00 34.30 ? 195  LEU A CA  1 
ATOM   53   C  C   . LEU A 1 21  ? -39.598 -0.810 -2.580  1.00 34.39 ? 195  LEU A C   1 
ATOM   54   O  O   . LEU A 1 21  ? -40.146 -1.163 -1.550  1.00 34.56 ? 195  LEU A O   1 
ATOM   55   C  CB  . LEU A 1 21  ? -40.751 -1.190 -4.754  1.00 35.93 ? 195  LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 21  ? -41.788 -0.779 -5.804  1.00 37.08 ? 195  LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 21  ? -41.966 -1.902 -6.820  1.00 39.18 ? 195  LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 21  ? -43.110 -0.467 -5.115  1.00 36.66 ? 195  LEU A CD2 1 
ATOM   59   N  N   . GLU A 1 22  ? -38.299 -0.976 -2.784  1.00 36.10 ? 196  GLU A N   1 
ATOM   60   C  CA  . GLU A 1 22  ? -37.472 -1.628 -1.776  1.00 37.18 ? 196  GLU A CA  1 
ATOM   61   C  C   . GLU A 1 22  ? -36.935 -0.726 -0.668  1.00 35.99 ? 196  GLU A C   1 
ATOM   62   O  O   . GLU A 1 22  ? -36.425 -1.222 0.328   1.00 36.85 ? 196  GLU A O   1 
ATOM   63   C  CB  . GLU A 1 22  ? -36.297 -2.347 -2.444  1.00 38.28 ? 196  GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 22  ? -36.679 -3.565 -3.269  1.00 41.81 ? 196  GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 22  ? -35.461 -4.252 -3.866  1.00 44.85 ? 196  GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 22  ? -34.533 -4.587 -3.101  1.00 47.13 ? 196  GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 22  ? -35.424 -4.456 -5.096  1.00 46.93 ? 196  GLU A OE2 1 
ATOM   68   N  N   . TYR A 1 23  ? -37.044 0.589  -0.825  1.00 35.72 ? 197  TYR A N   1 
ATOM   69   C  CA  . TYR A 1 23  ? -36.528 1.491  0.203   1.00 34.75 ? 197  TYR A CA  1 
ATOM   70   C  C   . TYR A 1 23  ? -37.467 2.626  0.599   1.00 34.12 ? 197  TYR A C   1 
ATOM   71   O  O   . TYR A 1 23  ? -37.920 2.689  1.731   1.00 34.17 ? 197  TYR A O   1 
ATOM   72   C  CB  . TYR A 1 23  ? -35.185 2.080  -0.245  1.00 36.86 ? 197  TYR A CB  1 
ATOM   73   C  CG  . TYR A 1 23  ? -34.624 3.114  0.706   1.00 39.11 ? 197  TYR A CG  1 
ATOM   74   C  CD1 . TYR A 1 23  ? -34.334 2.787  2.031   1.00 40.13 ? 197  TYR A CD1 1 
ATOM   75   C  CD2 . TYR A 1 23  ? -34.412 4.431  0.290   1.00 39.35 ? 197  TYR A CD2 1 
ATOM   76   C  CE1 . TYR A 1 23  ? -33.850 3.744  2.919   1.00 41.99 ? 197  TYR A CE1 1 
ATOM   77   C  CE2 . TYR A 1 23  ? -33.928 5.394  1.168   1.00 41.10 ? 197  TYR A CE2 1 
ATOM   78   C  CZ  . TYR A 1 23  ? -33.652 5.044  2.482   1.00 41.88 ? 197  TYR A CZ  1 
ATOM   79   O  OH  . TYR A 1 23  ? -33.192 5.993  3.364   1.00 46.26 ? 197  TYR A OH  1 
ATOM   80   N  N   . ILE A 1 24  ? -37.747 3.521  -0.341  1.00 33.82 ? 198  ILE A N   1 
ATOM   81   C  CA  . ILE A 1 24  ? -38.608 4.671  -0.086  1.00 33.38 ? 198  ILE A CA  1 
ATOM   82   C  C   . ILE A 1 24  ? -39.957 4.324  0.539   1.00 33.57 ? 198  ILE A C   1 
ATOM   83   O  O   . ILE A 1 24  ? -40.306 4.851  1.593   1.00 32.27 ? 198  ILE A O   1 
ATOM   84   C  CB  . ILE A 1 24  ? -38.844 5.470  -1.382  1.00 33.79 ? 198  ILE A CB  1 
ATOM   85   C  CG1 . ILE A 1 24  ? -37.497 5.891  -1.970  1.00 35.36 ? 198  ILE A CG1 1 
ATOM   86   C  CG2 . ILE A 1 24  ? -39.674 6.717  -1.094  1.00 32.81 ? 198  ILE A CG2 1 
ATOM   87   C  CD1 . ILE A 1 24  ? -37.594 6.479  -3.349  1.00 37.75 ? 198  ILE A CD1 1 
ATOM   88   N  N   . VAL A 1 25  ? -40.716 3.442  -0.106  1.00 33.35 ? 199  VAL A N   1 
ATOM   89   C  CA  . VAL A 1 25  ? -42.027 3.058  0.415   1.00 33.34 ? 199  VAL A CA  1 
ATOM   90   C  C   . VAL A 1 25  ? -41.957 2.553  1.857   1.00 32.67 ? 199  VAL A C   1 
ATOM   91   O  O   . VAL A 1 25  ? -42.608 3.101  2.732   1.00 33.27 ? 199  VAL A O   1 
ATOM   92   C  CB  . VAL A 1 25  ? -42.697 1.971  -0.471  1.00 34.47 ? 199  VAL A CB  1 
ATOM   93   C  CG1 . VAL A 1 25  ? -44.020 1.521  0.154   1.00 34.56 ? 199  VAL A CG1 1 
ATOM   94   C  CG2 . VAL A 1 25  ? -42.934 2.516  -1.871  1.00 33.96 ? 199  VAL A CG2 1 
ATOM   95   N  N   . PRO A 1 26  ? -41.163 1.501  2.121   1.00 32.74 ? 200  PRO A N   1 
ATOM   96   C  CA  . PRO A 1 26  ? -41.077 0.994  3.495   1.00 31.94 ? 200  PRO A CA  1 
ATOM   97   C  C   . PRO A 1 26  ? -40.472 1.989  4.476   1.00 31.86 ? 200  PRO A C   1 
ATOM   98   O  O   . PRO A 1 26  ? -40.893 2.061  5.628   1.00 31.06 ? 200  PRO A O   1 
ATOM   99   C  CB  . PRO A 1 26  ? -40.238 -0.276 3.347   1.00 32.77 ? 200  PRO A CB  1 
ATOM   100  C  CG  . PRO A 1 26  ? -39.360 0.032  2.184   1.00 32.86 ? 200  PRO A CG  1 
ATOM   101  C  CD  . PRO A 1 26  ? -40.307 0.711  1.217   1.00 32.65 ? 200  PRO A CD  1 
ATOM   102  N  N   . CYS A 1 27  ? -39.482 2.755  4.020   1.00 30.84 ? 201  CYS A N   1 
ATOM   103  C  CA  . CYS A 1 27  ? -38.852 3.745  4.887   1.00 30.09 ? 201  CYS A CA  1 
ATOM   104  C  C   . CYS A 1 27  ? -39.852 4.828  5.307   1.00 29.75 ? 201  CYS A C   1 
ATOM   105  O  O   . CYS A 1 27  ? -39.954 5.173  6.482   1.00 27.86 ? 201  CYS A O   1 
ATOM   106  C  CB  . CYS A 1 27  ? -37.654 4.413  4.200   1.00 31.72 ? 201  CYS A CB  1 
ATOM   107  S  SG  . CYS A 1 27  ? -37.084 5.826  5.199   1.00 33.27 ? 201  CYS A SG  1 
ATOM   108  N  N   . MET A 1 28  ? -40.590 5.360  4.341   1.00 28.24 ? 202  MET A N   1 
ATOM   109  C  CA  . MET A 1 28  ? -41.566 6.400  4.635   1.00 29.59 ? 202  MET A CA  1 
ATOM   110  C  C   . MET A 1 28  ? -42.667 5.952  5.592   1.00 30.65 ? 202  MET A C   1 
ATOM   111  O  O   . MET A 1 28  ? -43.020 6.679  6.509   1.00 29.66 ? 202  MET A O   1 
ATOM   112  C  CB  . MET A 1 28  ? -42.192 6.918  3.342   1.00 28.73 ? 202  MET A CB  1 
ATOM   113  C  CG  . MET A 1 28  ? -41.283 7.851  2.563   1.00 27.52 ? 202  MET A CG  1 
ATOM   114  S  SD  . MET A 1 28  ? -40.856 9.331  3.520   1.00 25.99 ? 202  MET A SD  1 
ATOM   115  C  CE  . MET A 1 28  ? -42.328 10.329 3.262   1.00 25.10 ? 202  MET A CE  1 
ATOM   116  N  N   . ASN A 1 29  ? -43.205 4.757  5.381   1.00 32.77 ? 203  ASN A N   1 
ATOM   117  C  CA  . ASN A 1 29  ? -44.267 4.255  6.246   1.00 35.17 ? 203  ASN A CA  1 
ATOM   118  C  C   . ASN A 1 29  ? -43.807 3.972  7.669   1.00 34.54 ? 203  ASN A C   1 
ATOM   119  O  O   . ASN A 1 29  ? -44.590 4.049  8.607   1.00 34.45 ? 203  ASN A O   1 
ATOM   120  C  CB  . ASN A 1 29  ? -44.889 2.996  5.641   1.00 37.53 ? 203  ASN A CB  1 
ATOM   121  C  CG  . ASN A 1 29  ? -45.724 3.302  4.420   1.00 39.76 ? 203  ASN A CG  1 
ATOM   122  O  OD1 . ASN A 1 29  ? -46.561 4.198  4.449   1.00 42.30 ? 203  ASN A OD1 1 
ATOM   123  N  ND2 . ASN A 1 29  ? -45.503 2.561  3.339   1.00 41.20 ? 203  ASN A ND2 1 
ATOM   124  N  N   . LYS A 1 30  ? -42.532 3.654  7.827   1.00 34.40 ? 204  LYS A N   1 
ATOM   125  C  CA  . LYS A 1 30  ? -42.001 3.357  9.149   1.00 35.01 ? 204  LYS A CA  1 
ATOM   126  C  C   . LYS A 1 30  ? -41.357 4.562  9.834   1.00 33.00 ? 204  LYS A C   1 
ATOM   127  O  O   . LYS A 1 30  ? -41.457 4.705  11.047  1.00 34.01 ? 204  LYS A O   1 
ATOM   128  C  CB  . LYS A 1 30  ? -40.982 2.218  9.058   1.00 37.43 ? 204  LYS A CB  1 
ATOM   129  C  CG  . LYS A 1 30  ? -40.375 1.828  10.394  1.00 41.27 ? 204  LYS A CG  1 
ATOM   130  C  CD  . LYS A 1 30  ? -39.342 0.721  10.242  1.00 44.56 ? 204  LYS A CD  1 
ATOM   131  C  CE  . LYS A 1 30  ? -38.762 0.329  11.593  1.00 44.92 ? 204  LYS A CE  1 
ATOM   132  N  NZ  . LYS A 1 30  ? -37.693 -0.700 11.463  1.00 47.81 ? 204  LYS A NZ  1 
ATOM   133  N  N   . HIS A 1 31  ? -40.708 5.430  9.062   1.00 30.57 ? 205  HIS A N   1 
ATOM   134  C  CA  . HIS A 1 31  ? -40.036 6.591  9.641   1.00 30.67 ? 205  HIS A CA  1 
ATOM   135  C  C   . HIS A 1 31  ? -40.602 7.940  9.207   1.00 29.89 ? 205  HIS A C   1 
ATOM   136  O  O   . HIS A 1 31  ? -40.625 8.884  9.993   1.00 29.76 ? 205  HIS A O   1 
ATOM   137  C  CB  . HIS A 1 31  ? -38.542 6.540  9.313   1.00 32.40 ? 205  HIS A CB  1 
ATOM   138  C  CG  . HIS A 1 31  ? -37.840 5.339  9.866   1.00 36.36 ? 205  HIS A CG  1 
ATOM   139  N  ND1 . HIS A 1 31  ? -37.779 5.067  11.217  1.00 36.60 ? 205  HIS A ND1 1 
ATOM   140  C  CD2 . HIS A 1 31  ? -37.159 4.342  9.252   1.00 36.02 ? 205  HIS A CD2 1 
ATOM   141  C  CE1 . HIS A 1 31  ? -37.092 3.956  11.410  1.00 36.48 ? 205  HIS A CE1 1 
ATOM   142  N  NE2 . HIS A 1 31  ? -36.703 3.497  10.234  1.00 36.65 ? 205  HIS A NE2 1 
ATOM   143  N  N   . GLY A 1 32  ? -41.048 8.029  7.957   1.00 27.90 ? 206  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 32  ? -41.598 9.278  7.457   1.00 26.59 ? 206  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 32  ? -40.516 10.302 7.160   1.00 25.21 ? 206  GLY A C   1 
ATOM   146  O  O   . GLY A 1 32  ? -40.802 11.476 6.933   1.00 22.61 ? 206  GLY A O   1 
ATOM   147  N  N   . ILE A 1 33  ? -39.269 9.843  7.179   1.00 24.15 ? 207  ILE A N   1 
ATOM   148  C  CA  . ILE A 1 33  ? -38.097 10.674 6.907   1.00 26.65 ? 207  ILE A CA  1 
ATOM   149  C  C   . ILE A 1 33  ? -37.105 9.745  6.205   1.00 27.07 ? 207  ILE A C   1 
ATOM   150  O  O   . ILE A 1 33  ? -36.588 8.822  6.820   1.00 28.14 ? 207  ILE A O   1 
ATOM   151  C  CB  . ILE A 1 33  ? -37.448 11.193 8.217   1.00 27.23 ? 207  ILE A CB  1 
ATOM   152  C  CG1 . ILE A 1 33  ? -38.444 12.060 8.997   1.00 27.57 ? 207  ILE A CG1 1 
ATOM   153  C  CG2 . ILE A 1 33  ? -36.186 11.979 7.888   1.00 26.11 ? 207  ILE A CG2 1 
ATOM   154  C  CD1 . ILE A 1 33  ? -37.953 12.493 10.372  1.00 28.17 ? 207  ILE A CD1 1 
ATOM   155  N  N   . CYS A 1 34  ? -36.838 9.986  4.926   1.00 26.84 ? 208  CYS A N   1 
ATOM   156  C  CA  . CYS A 1 34  ? -35.932 9.113  4.187   1.00 27.89 ? 208  CYS A CA  1 
ATOM   157  C  C   . CYS A 1 34  ? -34.887 9.853  3.369   1.00 27.26 ? 208  CYS A C   1 
ATOM   158  O  O   . CYS A 1 34  ? -35.185 10.837 2.704   1.00 27.21 ? 208  CYS A O   1 
ATOM   159  C  CB  . CYS A 1 34  ? -36.766 8.177  3.311   1.00 29.08 ? 208  CYS A CB  1 
ATOM   160  S  SG  . CYS A 1 34  ? -38.041 7.405  4.357   1.00 33.33 ? 208  CYS A SG  1 
ATOM   161  N  N   . VAL A 1 35  ? -33.655 9.359  3.432   1.00 26.56 ? 209  VAL A N   1 
ATOM   162  C  CA  . VAL A 1 35  ? -32.536 9.967  2.725   1.00 26.97 ? 209  VAL A CA  1 
ATOM   163  C  C   . VAL A 1 35  ? -31.950 9.065  1.638   1.00 26.86 ? 209  VAL A C   1 
ATOM   164  O  O   . VAL A 1 35  ? -31.724 7.885  1.861   1.00 27.10 ? 209  VAL A O   1 
ATOM   165  C  CB  . VAL A 1 35  ? -31.406 10.339 3.720   1.00 27.56 ? 209  VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 35  ? -30.208 10.911 2.974   1.00 28.08 ? 209  VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 35  ? -31.925 11.341 4.739   1.00 28.42 ? 209  VAL A CG2 1 
ATOM   168  N  N   . VAL A 1 36  ? -31.708 9.641  0.465   1.00 27.96 ? 210  VAL A N   1 
ATOM   169  C  CA  . VAL A 1 36  ? -31.123 8.917  -0.657  1.00 29.89 ? 210  VAL A CA  1 
ATOM   170  C  C   . VAL A 1 36  ? -29.882 9.665  -1.145  1.00 30.74 ? 210  VAL A C   1 
ATOM   171  O  O   . VAL A 1 36  ? -29.986 10.762 -1.698  1.00 29.19 ? 210  VAL A O   1 
ATOM   172  C  CB  . VAL A 1 36  ? -32.106 8.798  -1.847  1.00 30.63 ? 210  VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 36  ? -31.428 8.081  -3.001  1.00 31.10 ? 210  VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 36  ? -33.367 8.058  -1.423  1.00 32.01 ? 210  VAL A CG2 1 
ATOM   175  N  N   . ASP A 1 37  ? -28.711 9.069  -0.943  1.00 32.08 ? 211  ASP A N   1 
ATOM   176  C  CA  . ASP A 1 37  ? -27.464 9.689  -1.376  1.00 32.33 ? 211  ASP A CA  1 
ATOM   177  C  C   . ASP A 1 37  ? -27.081 9.275  -2.790  1.00 32.79 ? 211  ASP A C   1 
ATOM   178  O  O   . ASP A 1 37  ? -27.431 8.184  -3.239  1.00 33.26 ? 211  ASP A O   1 
ATOM   179  C  CB  . ASP A 1 37  ? -26.342 9.341  -0.399  1.00 33.34 ? 211  ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 37  ? -26.454 10.110 0.904   1.00 33.34 ? 211  ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 37  ? -26.487 11.355 0.844   1.00 34.97 ? 211  ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 37  ? -26.510 9.481  1.979   1.00 32.71 ? 211  ASP A OD2 1 
ATOM   183  N  N   . ASP A 1 38  ? -26.370 10.160 -3.488  1.00 33.83 ? 212  ASP A N   1 
ATOM   184  C  CA  . ASP A 1 38  ? -25.933 9.909  -4.860  1.00 35.74 ? 212  ASP A CA  1 
ATOM   185  C  C   . ASP A 1 38  ? -27.134 9.607  -5.754  1.00 36.62 ? 212  ASP A C   1 
ATOM   186  O  O   . ASP A 1 38  ? -27.141 8.630  -6.500  1.00 37.92 ? 212  ASP A O   1 
ATOM   187  C  CB  . ASP A 1 38  ? -24.949 8.737  -4.881  1.00 37.43 ? 212  ASP A CB  1 
ATOM   188  C  CG  . ASP A 1 38  ? -23.714 9.003  -4.043  1.00 38.18 ? 212  ASP A CG  1 
ATOM   189  O  OD1 . ASP A 1 38  ? -23.328 10.183 -3.893  1.00 38.21 ? 212  ASP A OD1 1 
ATOM   190  O  OD2 . ASP A 1 38  ? -23.121 8.030  -3.537  1.00 41.52 ? 212  ASP A OD2 1 
ATOM   191  N  N   . PHE A 1 39  ? -28.142 10.469 -5.674  1.00 36.05 ? 213  PHE A N   1 
ATOM   192  C  CA  . PHE A 1 39  ? -29.375 10.317 -6.438  1.00 35.30 ? 213  PHE A CA  1 
ATOM   193  C  C   . PHE A 1 39  ? -29.227 10.372 -7.959  1.00 35.20 ? 213  PHE A C   1 
ATOM   194  O  O   . PHE A 1 39  ? -29.706 9.489  -8.659  1.00 34.64 ? 213  PHE A O   1 
ATOM   195  C  CB  . PHE A 1 39  ? -30.386 11.384 -6.000  1.00 34.32 ? 213  PHE A CB  1 
ATOM   196  C  CG  . PHE A 1 39  ? -31.713 11.291 -6.703  1.00 33.56 ? 213  PHE A CG  1 
ATOM   197  C  CD1 . PHE A 1 39  ? -32.343 10.061 -6.878  1.00 32.32 ? 213  PHE A CD1 1 
ATOM   198  C  CD2 . PHE A 1 39  ? -32.329 12.433 -7.195  1.00 31.95 ? 213  PHE A CD2 1 
ATOM   199  C  CE1 . PHE A 1 39  ? -33.569 9.969  -7.537  1.00 31.38 ? 213  PHE A CE1 1 
ATOM   200  C  CE2 . PHE A 1 39  ? -33.556 12.351 -7.857  1.00 35.79 ? 213  PHE A CE2 1 
ATOM   201  C  CZ  . PHE A 1 39  ? -34.175 11.110 -8.027  1.00 33.29 ? 213  PHE A CZ  1 
ATOM   202  N  N   . LEU A 1 40  ? -28.576 11.415 -8.464  1.00 35.01 ? 214  LEU A N   1 
ATOM   203  C  CA  . LEU A 1 40  ? -28.407 11.588 -9.905  1.00 34.87 ? 214  LEU A CA  1 
ATOM   204  C  C   . LEU A 1 40  ? -26.982 11.353 -10.409 1.00 34.74 ? 214  LEU A C   1 
ATOM   205  O  O   . LEU A 1 40  ? -26.765 11.177 -11.609 1.00 35.20 ? 214  LEU A O   1 
ATOM   206  C  CB  . LEU A 1 40  ? -28.862 12.997 -10.309 1.00 34.05 ? 214  LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 40  ? -30.322 13.376 -10.022 1.00 34.43 ? 214  LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 40  ? -30.540 14.852 -10.312 1.00 33.55 ? 214  LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 40  ? -31.252 12.520 -10.869 1.00 34.46 ? 214  LEU A CD2 1 
ATOM   210  N  N   . GLY A 1 41  ? -26.017 11.355 -9.496  1.00 33.19 ? 215  GLY A N   1 
ATOM   211  C  CA  . GLY A 1 41  ? -24.633 11.160 -9.889  1.00 33.21 ? 215  GLY A CA  1 
ATOM   212  C  C   . GLY A 1 41  ? -23.889 12.482 -9.981  1.00 34.00 ? 215  GLY A C   1 
ATOM   213  O  O   . GLY A 1 41  ? -24.503 13.535 -10.146 1.00 33.11 ? 215  GLY A O   1 
ATOM   214  N  N   . LYS A 1 42  ? -22.562 12.423 -9.898  1.00 35.20 ? 216  LYS A N   1 
ATOM   215  C  CA  . LYS A 1 42  ? -21.715 13.614 -9.937  1.00 36.12 ? 216  LYS A CA  1 
ATOM   216  C  C   . LYS A 1 42  ? -21.929 14.557 -11.118 1.00 36.78 ? 216  LYS A C   1 
ATOM   217  O  O   . LYS A 1 42  ? -22.142 15.752 -10.929 1.00 37.08 ? 216  LYS A O   1 
ATOM   218  C  CB  . LYS A 1 42  ? -20.238 13.207 -9.883  1.00 37.20 ? 216  LYS A CB  1 
ATOM   219  N  N   . GLU A 1 43  ? -21.863 14.029 -12.334 1.00 35.56 ? 217  GLU A N   1 
ATOM   220  C  CA  . GLU A 1 43  ? -22.035 14.862 -13.516 1.00 35.86 ? 217  GLU A CA  1 
ATOM   221  C  C   . GLU A 1 43  ? -23.342 15.649 -13.512 1.00 34.27 ? 217  GLU A C   1 
ATOM   222  O  O   . GLU A 1 43  ? -23.343 16.856 -13.742 1.00 33.46 ? 217  GLU A O   1 
ATOM   223  C  CB  . GLU A 1 43  ? -21.956 14.010 -14.784 1.00 37.05 ? 217  GLU A CB  1 
ATOM   224  C  CG  . GLU A 1 43  ? -22.174 14.800 -16.069 1.00 40.56 ? 217  GLU A CG  1 
ATOM   225  N  N   . THR A 1 44  ? -24.452 14.960 -13.265 1.00 33.23 ? 218  THR A N   1 
ATOM   226  C  CA  . THR A 1 44  ? -25.758 15.609 -13.240 1.00 32.41 ? 218  THR A CA  1 
ATOM   227  C  C   . THR A 1 44  ? -25.860 16.570 -12.053 1.00 31.11 ? 218  THR A C   1 
ATOM   228  O  O   . THR A 1 44  ? -26.347 17.686 -12.192 1.00 31.20 ? 218  THR A O   1 
ATOM   229  C  CB  . THR A 1 44  ? -26.897 14.578 -13.136 1.00 32.29 ? 218  THR A CB  1 
ATOM   230  O  OG1 . THR A 1 44  ? -26.791 13.637 -14.210 1.00 33.30 ? 218  THR A OG1 1 
ATOM   231  C  CG2 . THR A 1 44  ? -28.253 15.275 -13.219 1.00 31.99 ? 218  THR A CG2 1 
ATOM   232  N  N   . GLY A 1 45  ? -25.402 16.122 -10.888 1.00 30.32 ? 219  GLY A N   1 
ATOM   233  C  CA  . GLY A 1 45  ? -25.448 16.967 -9.708  1.00 30.94 ? 219  GLY A CA  1 
ATOM   234  C  C   . GLY A 1 45  ? -24.641 18.239 -9.905  1.00 31.27 ? 219  GLY A C   1 
ATOM   235  O  O   . GLY A 1 45  ? -25.051 19.318 -9.485  1.00 30.64 ? 219  GLY A O   1 
ATOM   236  N  N   . GLN A 1 46  ? -23.487 18.110 -10.552 1.00 31.13 ? 220  GLN A N   1 
ATOM   237  C  CA  . GLN A 1 46  ? -22.622 19.253 -10.813 1.00 31.40 ? 220  GLN A CA  1 
ATOM   238  C  C   . GLN A 1 46  ? -23.301 20.228 -11.763 1.00 29.35 ? 220  GLN A C   1 
ATOM   239  O  O   . GLN A 1 46  ? -23.234 21.436 -11.563 1.00 26.31 ? 220  GLN A O   1 
ATOM   240  C  CB  . GLN A 1 46  ? -21.293 18.790 -11.418 1.00 33.80 ? 220  GLN A CB  1 
ATOM   241  C  CG  . GLN A 1 46  ? -20.083 19.002 -10.519 1.00 40.30 ? 220  GLN A CG  1 
ATOM   242  C  CD  . GLN A 1 46  ? -19.717 20.470 -10.347 0.50 42.32 ? 220  GLN A CD  1 
ATOM   243  O  OE1 . GLN A 1 46  ? -18.798 20.808 -9.603  0.50 44.49 ? 220  GLN A OE1 1 
ATOM   244  N  NE2 . GLN A 1 46  ? -20.435 21.348 -11.040 0.50 43.40 ? 220  GLN A NE2 1 
ATOM   245  N  N   . GLN A 1 47  ? -23.952 19.697 -12.798 1.00 28.75 ? 221  GLN A N   1 
ATOM   246  C  CA  . GLN A 1 47  ? -24.646 20.538 -13.773 1.00 28.81 ? 221  GLN A CA  1 
ATOM   247  C  C   . GLN A 1 47  ? -25.769 21.321 -13.095 1.00 26.77 ? 221  GLN A C   1 
ATOM   248  O  O   . GLN A 1 47  ? -26.003 22.479 -13.418 1.00 26.30 ? 221  GLN A O   1 
ATOM   249  C  CB  . GLN A 1 47  ? -25.224 19.688 -14.917 1.00 33.29 ? 221  GLN A CB  1 
ATOM   250  C  CG  . GLN A 1 47  ? -24.169 19.017 -15.805 1.00 39.02 ? 221  GLN A CG  1 
ATOM   251  C  CD  . GLN A 1 47  ? -24.773 18.145 -16.899 1.00 42.01 ? 221  GLN A CD  1 
ATOM   252  O  OE1 . GLN A 1 47  ? -25.589 17.262 -16.630 1.00 44.94 ? 221  GLN A OE1 1 
ATOM   253  N  NE2 . GLN A 1 47  ? -24.363 18.384 -18.139 1.00 43.03 ? 221  GLN A NE2 1 
ATOM   254  N  N   . ILE A 1 48  ? -26.469 20.678 -12.166 1.00 25.41 ? 222  ILE A N   1 
ATOM   255  C  CA  . ILE A 1 48  ? -27.551 21.349 -11.447 1.00 25.49 ? 222  ILE A CA  1 
ATOM   256  C  C   . ILE A 1 48  ? -26.930 22.464 -10.610 1.00 24.61 ? 222  ILE A C   1 
ATOM   257  O  O   . ILE A 1 48  ? -27.450 23.575 -10.543 1.00 23.61 ? 222  ILE A O   1 
ATOM   258  C  CB  . ILE A 1 48  ? -28.300 20.365 -10.522 1.00 25.45 ? 222  ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 48  ? -28.964 19.275 -11.369 1.00 24.62 ? 222  ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 48  ? -29.350 21.112 -9.695  1.00 25.94 ? 222  ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 48  ? -29.605 18.167 -10.570 1.00 24.67 ? 222  ILE A CD1 1 
ATOM   262  N  N   . GLY A 1 49  ? -25.797 22.152 -9.987  1.00 25.40 ? 223  GLY A N   1 
ATOM   263  C  CA  . GLY A 1 49  ? -25.099 23.131 -9.177  1.00 26.31 ? 223  GLY A CA  1 
ATOM   264  C  C   . GLY A 1 49  ? -24.719 24.345 -10.000 1.00 28.79 ? 223  GLY A C   1 
ATOM   265  O  O   . GLY A 1 49  ? -24.788 25.479 -9.517  1.00 27.35 ? 223  GLY A O   1 
ATOM   266  N  N   . ASP A 1 50  ? -24.313 24.117 -11.248 1.00 29.18 ? 224  ASP A N   1 
ATOM   267  C  CA  . ASP A 1 50  ? -23.934 25.221 -12.122 1.00 29.25 ? 224  ASP A CA  1 
ATOM   268  C  C   . ASP A 1 50  ? -25.146 26.072 -12.483 1.00 28.51 ? 224  ASP A C   1 
ATOM   269  O  O   . ASP A 1 50  ? -25.055 27.303 -12.533 1.00 27.94 ? 224  ASP A O   1 
ATOM   270  C  CB  . ASP A 1 50  ? -23.268 24.709 -13.408 1.00 30.35 ? 224  ASP A CB  1 
ATOM   271  C  CG  . ASP A 1 50  ? -21.896 24.104 -13.159 1.00 33.10 ? 224  ASP A CG  1 
ATOM   272  O  OD1 . ASP A 1 50  ? -21.081 24.729 -12.449 1.00 32.64 ? 224  ASP A OD1 1 
ATOM   273  O  OD2 . ASP A 1 50  ? -21.625 23.005 -13.682 1.00 36.51 ? 224  ASP A OD2 1 
ATOM   274  N  N   . GLU A 1 51  ? -26.282 25.425 -12.735 1.00 27.40 ? 225  GLU A N   1 
ATOM   275  C  CA  . GLU A 1 51  ? -27.487 26.173 -13.086 1.00 25.90 ? 225  GLU A CA  1 
ATOM   276  C  C   . GLU A 1 51  ? -27.953 27.005 -11.901 1.00 25.02 ? 225  GLU A C   1 
ATOM   277  O  O   . GLU A 1 51  ? -28.318 28.167 -12.056 1.00 24.11 ? 225  GLU A O   1 
ATOM   278  C  CB  . GLU A 1 51  ? -28.615 25.236 -13.529 1.00 27.69 ? 225  GLU A CB  1 
ATOM   279  C  CG  . GLU A 1 51  ? -28.223 24.260 -14.632 1.00 32.33 ? 225  GLU A CG  1 
ATOM   280  C  CD  . GLU A 1 51  ? -29.418 23.541 -15.245 1.00 36.14 ? 225  GLU A CD  1 
ATOM   281  O  OE1 . GLU A 1 51  ? -30.335 23.141 -14.496 1.00 36.69 ? 225  GLU A OE1 1 
ATOM   282  O  OE2 . GLU A 1 51  ? -29.433 23.365 -16.481 1.00 39.00 ? 225  GLU A OE2 1 
ATOM   283  N  N   . VAL A 1 52  ? -27.947 26.406 -10.714 1.00 25.58 ? 226  VAL A N   1 
ATOM   284  C  CA  . VAL A 1 52  ? -28.369 27.131 -9.521  1.00 26.06 ? 226  VAL A CA  1 
ATOM   285  C  C   . VAL A 1 52  ? -27.420 28.303 -9.265  1.00 26.15 ? 226  VAL A C   1 
ATOM   286  O  O   . VAL A 1 52  ? -27.861 29.410 -8.963  1.00 24.18 ? 226  VAL A O   1 
ATOM   287  C  CB  . VAL A 1 52  ? -28.402 26.209 -8.283  1.00 25.53 ? 226  VAL A CB  1 
ATOM   288  C  CG1 . VAL A 1 52  ? -28.735 27.017 -7.049  1.00 27.09 ? 226  VAL A CG1 1 
ATOM   289  C  CG2 . VAL A 1 52  ? -29.457 25.120 -8.471  1.00 25.45 ? 226  VAL A CG2 1 
ATOM   290  N  N   . ARG A 1 53  ? -26.117 28.060 -9.395  1.00 26.59 ? 227  ARG A N   1 
ATOM   291  C  CA  . ARG A 1 53  ? -25.139 29.121 -9.187  1.00 27.68 ? 227  ARG A CA  1 
ATOM   292  C  C   . ARG A 1 53  ? -25.321 30.214 -10.237 1.00 27.44 ? 227  ARG A C   1 
ATOM   293  O  O   . ARG A 1 53  ? -25.143 31.394 -9.950  1.00 26.33 ? 227  ARG A O   1 
ATOM   294  C  CB  . ARG A 1 53  ? -23.712 28.557 -9.226  1.00 29.55 ? 227  ARG A CB  1 
ATOM   295  C  CG  . ARG A 1 53  ? -23.173 28.221 -7.840  1.00 34.18 ? 227  ARG A CG  1 
ATOM   296  C  CD  . ARG A 1 53  ? -21.745 27.684 -7.853  1.00 36.87 ? 227  ARG A CD  1 
ATOM   297  N  NE  . ARG A 1 53  ? -21.697 26.222 -7.852  1.00 40.49 ? 227  ARG A NE  1 
ATOM   298  C  CZ  . ARG A 1 53  ? -21.709 25.467 -8.945  1.00 41.58 ? 227  ARG A CZ  1 
ATOM   299  N  NH1 . ARG A 1 53  ? -21.764 26.031 -10.143 1.00 44.79 ? 227  ARG A NH1 1 
ATOM   300  N  NH2 . ARG A 1 53  ? -21.667 24.146 -8.842  1.00 41.38 ? 227  ARG A NH2 1 
ATOM   301  N  N   . ALA A 1 54  ? -25.698 29.822 -11.449 1.00 27.44 ? 228  ALA A N   1 
ATOM   302  C  CA  . ALA A 1 54  ? -25.920 30.798 -12.510 1.00 28.69 ? 228  ALA A CA  1 
ATOM   303  C  C   . ALA A 1 54  ? -27.102 31.691 -12.141 1.00 28.17 ? 228  ALA A C   1 
ATOM   304  O  O   . ALA A 1 54  ? -27.043 32.901 -12.303 1.00 27.43 ? 228  ALA A O   1 
ATOM   305  C  CB  . ALA A 1 54  ? -26.189 30.092 -13.834 1.00 29.36 ? 228  ALA A CB  1 
ATOM   306  N  N   . LEU A 1 55  ? -28.179 31.082 -11.653 1.00 28.67 ? 229  LEU A N   1 
ATOM   307  C  CA  . LEU A 1 55  ? -29.363 31.835 -11.246 1.00 28.80 ? 229  LEU A CA  1 
ATOM   308  C  C   . LEU A 1 55  ? -28.965 32.899 -10.233 1.00 28.59 ? 229  LEU A C   1 
ATOM   309  O  O   . LEU A 1 55  ? -29.396 34.043 -10.313 1.00 26.84 ? 229  LEU A O   1 
ATOM   310  C  CB  . LEU A 1 55  ? -30.402 30.901 -10.613 1.00 30.34 ? 229  LEU A CB  1 
ATOM   311  C  CG  . LEU A 1 55  ? -31.270 30.069 -11.560 1.00 31.83 ? 229  LEU A CG  1 
ATOM   312  C  CD1 . LEU A 1 55  ? -32.046 29.025 -10.767 1.00 31.18 ? 229  LEU A CD1 1 
ATOM   313  C  CD2 . LEU A 1 55  ? -32.221 30.989 -12.322 1.00 31.66 ? 229  LEU A CD2 1 
ATOM   314  N  N   . HIS A 1 56  ? -28.128 32.507 -9.281  1.00 28.18 ? 230  HIS A N   1 
ATOM   315  C  CA  . HIS A 1 56  ? -27.674 33.423 -8.250  1.00 30.99 ? 230  HIS A CA  1 
ATOM   316  C  C   . HIS A 1 56  ? -26.802 34.542 -8.815  1.00 31.42 ? 230  HIS A C   1 
ATOM   317  O  O   . HIS A 1 56  ? -27.056 35.718 -8.566  1.00 28.72 ? 230  HIS A O   1 
ATOM   318  C  CB  . HIS A 1 56  ? -26.909 32.654 -7.175  1.00 34.29 ? 230  HIS A CB  1 
ATOM   319  C  CG  . HIS A 1 56  ? -26.426 33.512 -6.048  1.00 38.30 ? 230  HIS A CG  1 
ATOM   320  N  ND1 . HIS A 1 56  ? -25.112 33.907 -5.923  1.00 39.82 ? 230  HIS A ND1 1 
ATOM   321  C  CD2 . HIS A 1 56  ? -27.088 34.069 -5.006  1.00 39.39 ? 230  HIS A CD2 1 
ATOM   322  C  CE1 . HIS A 1 56  ? -24.984 34.669 -4.851  1.00 42.42 ? 230  HIS A CE1 1 
ATOM   323  N  NE2 . HIS A 1 56  ? -26.169 34.784 -4.277  1.00 42.17 ? 230  HIS A NE2 1 
ATOM   324  N  N   . ASP A 1 57  ? -25.781 34.169 -9.581  1.00 32.06 ? 231  ASP A N   1 
ATOM   325  C  CA  . ASP A 1 57  ? -24.871 35.149 -10.166 1.00 35.03 ? 231  ASP A CA  1 
ATOM   326  C  C   . ASP A 1 57  ? -25.556 36.122 -11.130 1.00 34.93 ? 231  ASP A C   1 
ATOM   327  O  O   . ASP A 1 57  ? -25.031 37.196 -11.401 1.00 37.17 ? 231  ASP A O   1 
ATOM   328  C  CB  . ASP A 1 57  ? -23.715 34.432 -10.874 1.00 35.44 ? 231  ASP A CB  1 
ATOM   329  C  CG  . ASP A 1 57  ? -22.773 33.743 -9.901  1.00 35.34 ? 231  ASP A CG  1 
ATOM   330  O  OD1 . ASP A 1 57  ? -22.917 33.947 -8.678  1.00 38.40 ? 231  ASP A OD1 1 
ATOM   331  O  OD2 . ASP A 1 57  ? -21.883 33.000 -10.355 1.00 36.35 ? 231  ASP A OD2 1 
ATOM   332  N  N   . THR A 1 58  ? -26.725 35.752 -11.644 1.00 34.41 ? 232  THR A N   1 
ATOM   333  C  CA  . THR A 1 58  ? -27.446 36.628 -12.563 1.00 34.14 ? 232  THR A CA  1 
ATOM   334  C  C   . THR A 1 58  ? -28.569 37.389 -11.861 1.00 34.37 ? 232  THR A C   1 
ATOM   335  O  O   . THR A 1 58  ? -29.403 38.015 -12.506 1.00 34.12 ? 232  THR A O   1 
ATOM   336  C  CB  . THR A 1 58  ? -28.040 35.845 -13.754 1.00 34.22 ? 232  THR A CB  1 
ATOM   337  O  OG1 . THR A 1 58  ? -28.868 34.779 -13.273 1.00 35.52 ? 232  THR A OG1 1 
ATOM   338  C  CG2 . THR A 1 58  ? -26.928 35.272 -14.612 1.00 35.28 ? 232  THR A CG2 1 
ATOM   339  N  N   . GLY A 1 59  ? -28.582 37.323 -10.534 1.00 33.26 ? 233  GLY A N   1 
ATOM   340  C  CA  . GLY A 1 59  ? -29.588 38.030 -9.760  1.00 32.32 ? 233  GLY A CA  1 
ATOM   341  C  C   . GLY A 1 59  ? -31.019 37.550 -9.903  1.00 31.45 ? 233  GLY A C   1 
ATOM   342  O  O   . GLY A 1 59  ? -31.938 38.355 -9.901  1.00 31.68 ? 233  GLY A O   1 
ATOM   343  N  N   . LYS A 1 60  ? -31.221 36.243 -10.011 1.00 29.89 ? 234  LYS A N   1 
ATOM   344  C  CA  . LYS A 1 60  ? -32.572 35.716 -10.146 1.00 29.38 ? 234  LYS A CA  1 
ATOM   345  C  C   . LYS A 1 60  ? -33.222 35.392 -8.799  1.00 27.70 ? 234  LYS A C   1 
ATOM   346  O  O   . LYS A 1 60  ? -34.428 35.172 -8.728  1.00 27.39 ? 234  LYS A O   1 
ATOM   347  C  CB  . LYS A 1 60  ? -32.567 34.479 -11.048 1.00 30.98 ? 234  LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 60  ? -32.150 34.773 -12.489 1.00 35.02 ? 234  LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 60  ? -33.068 35.812 -13.128 1.00 36.81 ? 234  LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 60  ? -32.772 36.008 -14.615 1.00 41.44 ? 234  LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 60  ? -31.441 36.626 -14.876 1.00 42.38 ? 234  LYS A NZ  1 
ATOM   352  N  N   . PHE A 1 61  ? -32.423 35.370 -7.735  1.00 25.35 ? 235  PHE A N   1 
ATOM   353  C  CA  . PHE A 1 61  ? -32.941 35.089 -6.398  1.00 23.06 ? 235  PHE A CA  1 
ATOM   354  C  C   . PHE A 1 61  ? -33.465 36.370 -5.764  1.00 24.01 ? 235  PHE A C   1 
ATOM   355  O  O   . PHE A 1 61  ? -33.130 37.477 -6.197  1.00 22.59 ? 235  PHE A O   1 
ATOM   356  C  CB  . PHE A 1 61  ? -31.843 34.537 -5.474  1.00 23.77 ? 235  PHE A CB  1 
ATOM   357  C  CG  . PHE A 1 61  ? -31.587 33.058 -5.616  1.00 23.69 ? 235  PHE A CG  1 
ATOM   358  C  CD1 . PHE A 1 61  ? -30.709 32.571 -6.581  1.00 25.28 ? 235  PHE A CD1 1 
ATOM   359  C  CD2 . PHE A 1 61  ? -32.197 32.156 -4.751  1.00 20.88 ? 235  PHE A CD2 1 
ATOM   360  C  CE1 . PHE A 1 61  ? -30.440 31.205 -6.677  1.00 25.95 ? 235  PHE A CE1 1 
ATOM   361  C  CE2 . PHE A 1 61  ? -31.938 30.791 -4.835  1.00 24.39 ? 235  PHE A CE2 1 
ATOM   362  C  CZ  . PHE A 1 61  ? -31.055 30.313 -5.802  1.00 25.23 ? 235  PHE A CZ  1 
ATOM   363  N  N   . THR A 1 62  ? -34.288 36.215 -4.729  1.00 21.70 ? 236  THR A N   1 
ATOM   364  C  CA  . THR A 1 62  ? -34.805 37.365 -3.996  1.00 23.06 ? 236  THR A CA  1 
ATOM   365  C  C   . THR A 1 62  ? -33.648 37.817 -3.103  1.00 22.12 ? 236  THR A C   1 
ATOM   366  O  O   . THR A 1 62  ? -32.629 37.147 -3.036  1.00 21.84 ? 236  THR A O   1 
ATOM   367  C  CB  . THR A 1 62  ? -35.999 36.975 -3.108  1.00 21.66 ? 236  THR A CB  1 
ATOM   368  O  OG1 . THR A 1 62  ? -35.580 35.994 -2.150  1.00 20.70 ? 236  THR A OG1 1 
ATOM   369  C  CG2 . THR A 1 62  ? -37.128 36.398 -3.960  1.00 22.99 ? 236  THR A CG2 1 
ATOM   370  N  N   . ASP A 1 63  ? -33.796 38.945 -2.422  1.00 23.64 ? 237  ASP A N   1 
ATOM   371  C  CA  . ASP A 1 63  ? -32.721 39.435 -1.559  1.00 24.29 ? 237  ASP A CA  1 
ATOM   372  C  C   . ASP A 1 63  ? -32.563 38.660 -0.255  1.00 23.75 ? 237  ASP A C   1 
ATOM   373  O  O   . ASP A 1 63  ? -31.563 38.817 0.446   1.00 24.78 ? 237  ASP A O   1 
ATOM   374  C  CB  . ASP A 1 63  ? -32.924 40.916 -1.240  1.00 25.95 ? 237  ASP A CB  1 
ATOM   375  C  CG  . ASP A 1 63  ? -32.593 41.816 -2.413  1.00 27.39 ? 237  ASP A CG  1 
ATOM   376  O  OD1 . ASP A 1 63  ? -32.101 41.301 -3.435  1.00 28.44 ? 237  ASP A OD1 1 
ATOM   377  O  OD2 . ASP A 1 63  ? -32.816 43.039 -2.309  1.00 28.48 ? 237  ASP A OD2 1 
ATOM   378  N  N   . GLY A 1 64  ? -33.550 37.831 0.074   1.00 23.90 ? 238  GLY A N   1 
ATOM   379  C  CA  . GLY A 1 64  ? -33.478 37.049 1.296   1.00 22.87 ? 238  GLY A CA  1 
ATOM   380  C  C   . GLY A 1 64  ? -34.533 37.414 2.326   1.00 22.30 ? 238  GLY A C   1 
ATOM   381  O  O   . GLY A 1 64  ? -34.953 38.560 2.408   1.00 21.68 ? 238  GLY A O   1 
ATOM   382  N  N   . GLN A 1 65  ? -34.956 36.428 3.114   1.00 22.60 ? 239  GLN A N   1 
ATOM   383  C  CA  . GLN A 1 65  ? -35.961 36.644 4.151   1.00 23.22 ? 239  GLN A CA  1 
ATOM   384  C  C   . GLN A 1 65  ? -35.488 37.674 5.178   1.00 25.13 ? 239  GLN A C   1 
ATOM   385  O  O   . GLN A 1 65  ? -34.384 37.577 5.707   1.00 23.68 ? 239  GLN A O   1 
ATOM   386  C  CB  . GLN A 1 65  ? -36.282 35.325 4.868   1.00 23.98 ? 239  GLN A CB  1 
ATOM   387  C  CG  . GLN A 1 65  ? -37.336 35.462 5.970   1.00 23.14 ? 239  GLN A CG  1 
ATOM   388  C  CD  . GLN A 1 65  ? -37.795 34.122 6.535   1.00 25.55 ? 239  GLN A CD  1 
ATOM   389  O  OE1 . GLN A 1 65  ? -38.727 34.065 7.338   1.00 28.29 ? 239  GLN A OE1 1 
ATOM   390  N  NE2 . GLN A 1 65  ? -37.140 33.041 6.121   1.00 23.88 ? 239  GLN A NE2 1 
ATOM   391  N  N   . LEU A 1 66  ? -36.332 38.659 5.461   1.00 26.04 ? 240  LEU A N   1 
ATOM   392  C  CA  . LEU A 1 66  ? -35.982 39.691 6.429   1.00 29.82 ? 240  LEU A CA  1 
ATOM   393  C  C   . LEU A 1 66  ? -35.935 39.069 7.822   1.00 30.64 ? 240  LEU A C   1 
ATOM   394  O  O   . LEU A 1 66  ? -36.966 38.746 8.394   1.00 30.14 ? 240  LEU A O   1 
ATOM   395  C  CB  . LEU A 1 66  ? -37.011 40.827 6.388   1.00 30.56 ? 240  LEU A CB  1 
ATOM   396  C  CG  . LEU A 1 66  ? -36.717 42.059 7.250   1.00 31.44 ? 240  LEU A CG  1 
ATOM   397  C  CD1 . LEU A 1 66  ? -35.352 42.630 6.900   1.00 29.21 ? 240  LEU A CD1 1 
ATOM   398  C  CD2 . LEU A 1 66  ? -37.811 43.098 7.028   1.00 31.64 ? 240  LEU A CD2 1 
ATOM   399  N  N   . VAL A 1 67  ? -34.725 38.897 8.348   1.00 35.01 ? 241  VAL A N   1 
ATOM   400  C  CA  . VAL A 1 67  ? -34.519 38.298 9.663   1.00 39.82 ? 241  VAL A CA  1 
ATOM   401  C  C   . VAL A 1 67  ? -34.526 39.348 10.765  1.00 43.13 ? 241  VAL A C   1 
ATOM   402  O  O   . VAL A 1 67  ? -35.194 39.188 11.782  1.00 43.05 ? 241  VAL A O   1 
ATOM   403  C  CB  . VAL A 1 67  ? -33.172 37.536 9.722   1.00 40.11 ? 241  VAL A CB  1 
ATOM   404  C  CG1 . VAL A 1 67  ? -33.019 36.842 11.071  1.00 41.47 ? 241  VAL A CG1 1 
ATOM   405  C  CG2 . VAL A 1 67  ? -33.099 36.525 8.594   1.00 40.57 ? 241  VAL A CG2 1 
ATOM   406  N  N   . SER A 1 68  ? -33.774 40.423 10.560  1.00 47.04 ? 242  SER A N   1 
ATOM   407  C  CA  . SER A 1 68  ? -33.709 41.495 11.545  1.00 51.51 ? 242  SER A CA  1 
ATOM   408  C  C   . SER A 1 68  ? -33.858 42.853 10.875  1.00 53.30 ? 242  SER A C   1 
ATOM   409  O  O   . SER A 1 68  ? -33.022 43.251 10.068  1.00 53.74 ? 242  SER A O   1 
ATOM   410  C  CB  . SER A 1 68  ? -32.383 41.438 12.306  1.00 51.40 ? 242  SER A CB  1 
ATOM   411  O  OG  . SER A 1 68  ? -32.360 42.395 13.348  1.00 53.90 ? 242  SER A OG  1 
ATOM   412  N  N   . GLN A 1 69  ? -34.931 43.559 11.216  1.00 56.45 ? 243  GLN A N   1 
ATOM   413  C  CA  . GLN A 1 69  ? -35.194 44.874 10.648  1.00 59.77 ? 243  GLN A CA  1 
ATOM   414  C  C   . GLN A 1 69  ? -34.884 45.970 11.661  1.00 61.50 ? 243  GLN A C   1 
ATOM   415  O  O   . GLN A 1 69  ? -35.762 46.415 12.394  1.00 62.44 ? 243  GLN A O   1 
ATOM   416  C  CB  . GLN A 1 69  ? -36.656 44.966 10.200  1.00 59.60 ? 243  GLN A CB  1 
ATOM   417  C  CG  . GLN A 1 69  ? -37.042 46.304 9.590   1.00 60.98 ? 243  GLN A CG  1 
ATOM   418  C  CD  . GLN A 1 69  ? -38.412 46.272 8.939   1.00 60.94 ? 243  GLN A CD  1 
ATOM   419  O  OE1 . GLN A 1 69  ? -39.386 45.824 9.540   1.00 60.53 ? 243  GLN A OE1 1 
ATOM   420  N  NE2 . GLN A 1 69  ? -38.492 46.757 7.702   1.00 60.89 ? 243  GLN A NE2 1 
ATOM   421  N  N   . LYS A 1 70  ? -33.624 46.398 11.697  1.00 63.83 ? 244  LYS A N   1 
ATOM   422  C  CA  . LYS A 1 70  ? -33.189 47.440 12.623  1.00 65.80 ? 244  LYS A CA  1 
ATOM   423  C  C   . LYS A 1 70  ? -33.818 48.786 12.279  1.00 67.30 ? 244  LYS A C   1 
ATOM   424  O  O   . LYS A 1 70  ? -34.406 48.951 11.210  1.00 67.86 ? 244  LYS A O   1 
ATOM   425  C  CB  . LYS A 1 70  ? -31.664 47.583 12.594  1.00 66.03 ? 244  LYS A CB  1 
ATOM   426  C  CG  . LYS A 1 70  ? -30.886 46.335 12.993  1.00 66.35 ? 244  LYS A CG  1 
ATOM   427  C  CD  . LYS A 1 70  ? -30.860 45.301 11.878  1.00 66.27 ? 244  LYS A CD  1 
ATOM   428  C  CE  . LYS A 1 70  ? -30.024 44.092 12.271  1.00 66.48 ? 244  LYS A CE  1 
ATOM   429  N  NZ  . LYS A 1 70  ? -28.607 44.455 12.571  1.00 67.20 ? 244  LYS A NZ  1 
ATOM   430  N  N   . SER A 1 71  ? -33.692 49.745 13.192  1.00 68.13 ? 245  SER A N   1 
ATOM   431  C  CA  . SER A 1 71  ? -34.238 51.080 12.974  1.00 68.79 ? 245  SER A CA  1 
ATOM   432  C  C   . SER A 1 71  ? -33.664 51.615 11.668  1.00 68.77 ? 245  SER A C   1 
ATOM   433  O  O   . SER A 1 71  ? -34.331 52.337 10.930  1.00 69.37 ? 245  SER A O   1 
ATOM   434  C  CB  . SER A 1 71  ? -33.861 52.001 14.136  1.00 68.99 ? 245  SER A CB  1 
ATOM   435  O  OG  . SER A 1 71  ? -32.461 51.994 14.355  1.00 70.69 ? 245  SER A OG  1 
ATOM   436  N  N   . ASP A 1 72  ? -32.416 51.249 11.398  1.00 68.63 ? 246  ASP A N   1 
ATOM   437  C  CA  . ASP A 1 72  ? -31.734 51.649 10.175  1.00 68.46 ? 246  ASP A CA  1 
ATOM   438  C  C   . ASP A 1 72  ? -31.837 50.457 9.225   1.00 67.69 ? 246  ASP A C   1 
ATOM   439  O  O   . ASP A 1 72  ? -31.625 49.317 9.633   1.00 67.36 ? 246  ASP A O   1 
ATOM   440  C  CB  . ASP A 1 72  ? -30.266 51.967 10.466  1.00 69.72 ? 246  ASP A CB  1 
ATOM   441  C  CG  . ASP A 1 72  ? -29.534 52.495 9.251   1.00 71.05 ? 246  ASP A CG  1 
ATOM   442  O  OD1 . ASP A 1 72  ? -29.895 53.587 8.764   1.00 72.40 ? 246  ASP A OD1 1 
ATOM   443  O  OD2 . ASP A 1 72  ? -28.598 51.815 8.780   1.00 72.67 ? 246  ASP A OD2 1 
ATOM   444  N  N   . SER A 1 73  ? -32.164 50.722 7.964   1.00 66.55 ? 247  SER A N   1 
ATOM   445  C  CA  . SER A 1 73  ? -32.325 49.659 6.975   1.00 65.11 ? 247  SER A CA  1 
ATOM   446  C  C   . SER A 1 73  ? -31.034 49.188 6.311   1.00 64.34 ? 247  SER A C   1 
ATOM   447  O  O   . SER A 1 73  ? -30.982 48.088 5.764   1.00 63.80 ? 247  SER A O   1 
ATOM   448  C  CB  . SER A 1 73  ? -33.319 50.101 5.901   1.00 64.71 ? 247  SER A CB  1 
ATOM   449  O  OG  . SER A 1 73  ? -34.589 50.360 6.472   1.00 64.71 ? 247  SER A OG  1 
ATOM   450  N  N   . SER A 1 74  ? -29.998 50.019 6.354   1.00 63.20 ? 248  SER A N   1 
ATOM   451  C  CA  . SER A 1 74  ? -28.718 49.657 5.752   1.00 61.52 ? 248  SER A CA  1 
ATOM   452  C  C   . SER A 1 74  ? -28.097 48.492 6.519   1.00 60.07 ? 248  SER A C   1 
ATOM   453  O  O   . SER A 1 74  ? -27.301 47.727 5.974   1.00 59.51 ? 248  SER A O   1 
ATOM   454  C  CB  . SER A 1 74  ? -27.764 50.856 5.777   1.00 61.71 ? 248  SER A CB  1 
ATOM   455  O  OG  . SER A 1 74  ? -28.310 51.961 5.075   1.00 61.86 ? 248  SER A OG  1 
ATOM   456  N  N   . LYS A 1 75  ? -28.479 48.367 7.786   1.00 58.50 ? 249  LYS A N   1 
ATOM   457  C  CA  . LYS A 1 75  ? -27.962 47.312 8.646   1.00 56.57 ? 249  LYS A CA  1 
ATOM   458  C  C   . LYS A 1 75  ? -28.909 46.121 8.784   1.00 55.32 ? 249  LYS A C   1 
ATOM   459  O  O   . LYS A 1 75  ? -28.670 45.232 9.602   1.00 55.24 ? 249  LYS A O   1 
ATOM   460  C  CB  . LYS A 1 75  ? -27.651 47.874 10.036  1.00 57.18 ? 249  LYS A CB  1 
ATOM   461  N  N   . ASP A 1 76  ? -29.982 46.100 7.993   1.00 52.00 ? 250  ASP A N   1 
ATOM   462  C  CA  . ASP A 1 76  ? -30.930 44.991 8.057   1.00 48.14 ? 250  ASP A CA  1 
ATOM   463  C  C   . ASP A 1 76  ? -30.231 43.677 7.745   1.00 44.28 ? 250  ASP A C   1 
ATOM   464  O  O   . ASP A 1 76  ? -29.260 43.641 6.996   1.00 44.10 ? 250  ASP A O   1 
ATOM   465  C  CB  . ASP A 1 76  ? -32.082 45.179 7.066   1.00 49.99 ? 250  ASP A CB  1 
ATOM   466  C  CG  . ASP A 1 76  ? -33.137 46.148 7.563   1.00 52.25 ? 250  ASP A CG  1 
ATOM   467  O  OD1 . ASP A 1 76  ? -33.291 46.291 8.796   1.00 54.20 ? 250  ASP A OD1 1 
ATOM   468  O  OD2 . ASP A 1 76  ? -33.830 46.752 6.715   1.00 53.37 ? 250  ASP A OD2 1 
ATOM   469  N  N   . ILE A 1 77  ? -30.736 42.596 8.324   1.00 41.02 ? 251  ILE A N   1 
ATOM   470  C  CA  . ILE A 1 77  ? -30.161 41.276 8.096   1.00 37.31 ? 251  ILE A CA  1 
ATOM   471  C  C   . ILE A 1 77  ? -31.175 40.380 7.391   1.00 34.67 ? 251  ILE A C   1 
ATOM   472  O  O   . ILE A 1 77  ? -32.276 40.160 7.891   1.00 34.34 ? 251  ILE A O   1 
ATOM   473  C  CB  . ILE A 1 77  ? -29.743 40.609 9.428   1.00 37.32 ? 251  ILE A CB  1 
ATOM   474  C  CG1 . ILE A 1 77  ? -28.758 41.514 10.182  1.00 36.92 ? 251  ILE A CG1 1 
ATOM   475  C  CG2 . ILE A 1 77  ? -29.126 39.238 9.156   1.00 36.27 ? 251  ILE A CG2 1 
ATOM   476  C  CD1 . ILE A 1 77  ? -27.473 41.804 9.430   1.00 38.56 ? 251  ILE A CD1 1 
ATOM   477  N  N   . ARG A 1 78  ? -30.800 39.871 6.223   1.00 32.42 ? 252  ARG A N   1 
ATOM   478  C  CA  . ARG A 1 78  ? -31.682 38.989 5.464   1.00 30.15 ? 252  ARG A CA  1 
ATOM   479  C  C   . ARG A 1 78  ? -31.100 37.576 5.391   1.00 27.76 ? 252  ARG A C   1 
ATOM   480  O  O   . ARG A 1 78  ? -29.884 37.390 5.444   1.00 27.60 ? 252  ARG A O   1 
ATOM   481  C  CB  . ARG A 1 78  ? -31.924 39.566 4.060   1.00 30.84 ? 252  ARG A CB  1 
ATOM   482  C  CG  . ARG A 1 78  ? -32.793 40.841 4.079   1.00 31.03 ? 252  ARG A CG  1 
ATOM   483  C  CD  . ARG A 1 78  ? -32.993 41.452 2.691   1.00 33.70 ? 252  ARG A CD  1 
ATOM   484  N  NE  . ARG A 1 78  ? -33.959 42.553 2.718   1.00 34.56 ? 252  ARG A NE  1 
ATOM   485  C  CZ  . ARG A 1 78  ? -35.278 42.395 2.827   1.00 36.83 ? 252  ARG A CZ  1 
ATOM   486  N  NH1 . ARG A 1 78  ? -35.804 41.177 2.913   1.00 38.53 ? 252  ARG A NH1 1 
ATOM   487  N  NH2 . ARG A 1 78  ? -36.078 43.454 2.858   1.00 35.66 ? 252  ARG A NH2 1 
ATOM   488  N  N   . GLY A 1 79  ? -31.976 36.583 5.281   1.00 25.15 ? 253  GLY A N   1 
ATOM   489  C  CA  . GLY A 1 79  ? -31.526 35.205 5.228   1.00 21.36 ? 253  GLY A CA  1 
ATOM   490  C  C   . GLY A 1 79  ? -31.682 34.494 3.897   1.00 20.17 ? 253  GLY A C   1 
ATOM   491  O  O   . GLY A 1 79  ? -31.253 34.985 2.857   1.00 20.13 ? 253  GLY A O   1 
ATOM   492  N  N   . ASP A 1 80  ? -32.304 33.322 3.937   1.00 20.20 ? 254  ASP A N   1 
ATOM   493  C  CA  . ASP A 1 80  ? -32.492 32.515 2.734   1.00 18.62 ? 254  ASP A CA  1 
ATOM   494  C  C   . ASP A 1 80  ? -33.098 33.293 1.578   1.00 19.05 ? 254  ASP A C   1 
ATOM   495  O  O   . ASP A 1 80  ? -34.050 34.053 1.751   1.00 19.31 ? 254  ASP A O   1 
ATOM   496  C  CB  . ASP A 1 80  ? -33.367 31.295 3.036   1.00 17.13 ? 254  ASP A CB  1 
ATOM   497  C  CG  . ASP A 1 80  ? -34.800 31.668 3.356   1.00 18.56 ? 254  ASP A CG  1 
ATOM   498  O  OD1 . ASP A 1 80  ? -35.069 32.129 4.488   1.00 22.79 ? 254  ASP A OD1 1 
ATOM   499  O  OD2 . ASP A 1 80  ? -35.661 31.504 2.471   1.00 20.02 ? 254  ASP A OD2 1 
ATOM   500  N  N   . LYS A 1 81  ? -32.518 33.086 0.401   1.00 19.96 ? 255  LYS A N   1 
ATOM   501  C  CA  . LYS A 1 81  ? -32.963 33.709 -0.836  1.00 21.02 ? 255  LYS A CA  1 
ATOM   502  C  C   . LYS A 1 81  ? -33.660 32.606 -1.622  1.00 20.30 ? 255  LYS A C   1 
ATOM   503  O  O   . LYS A 1 81  ? -33.251 31.450 -1.551  1.00 18.13 ? 255  LYS A O   1 
ATOM   504  C  CB  . LYS A 1 81  ? -31.764 34.205 -1.648  1.00 20.15 ? 255  LYS A CB  1 
ATOM   505  C  CG  . LYS A 1 81  ? -30.884 35.215 -0.945  1.00 24.46 ? 255  LYS A CG  1 
ATOM   506  C  CD  . LYS A 1 81  ? -29.819 35.750 -1.898  1.00 27.83 ? 255  LYS A CD  1 
ATOM   507  C  CE  . LYS A 1 81  ? -28.891 36.736 -1.201  1.00 31.22 ? 255  LYS A CE  1 
ATOM   508  N  NZ  . LYS A 1 81  ? -27.964 37.385 -2.164  1.00 33.94 ? 255  LYS A NZ  1 
ATOM   509  N  N   . ILE A 1 82  ? -34.705 32.956 -2.367  1.00 19.49 ? 256  ILE A N   1 
ATOM   510  C  CA  . ILE A 1 82  ? -35.410 31.951 -3.149  1.00 21.01 ? 256  ILE A CA  1 
ATOM   511  C  C   . ILE A 1 82  ? -35.748 32.392 -4.564  1.00 20.81 ? 256  ILE A C   1 
ATOM   512  O  O   . ILE A 1 82  ? -35.654 33.567 -4.923  1.00 20.17 ? 256  ILE A O   1 
ATOM   513  C  CB  . ILE A 1 82  ? -36.739 31.511 -2.481  1.00 21.59 ? 256  ILE A CB  1 
ATOM   514  C  CG1 . ILE A 1 82  ? -37.666 32.719 -2.314  1.00 21.81 ? 256  ILE A CG1 1 
ATOM   515  C  CG2 . ILE A 1 82  ? -36.463 30.847 -1.140  1.00 21.45 ? 256  ILE A CG2 1 
ATOM   516  C  CD1 . ILE A 1 82  ? -39.062 32.354 -1.862  1.00 23.73 ? 256  ILE A CD1 1 
ATOM   517  N  N   . THR A 1 83  ? -36.146 31.409 -5.354  1.00 22.06 ? 257  THR A N   1 
ATOM   518  C  CA  . THR A 1 83  ? -36.557 31.615 -6.724  1.00 22.95 ? 257  THR A CA  1 
ATOM   519  C  C   . THR A 1 83  ? -37.329 30.370 -7.128  1.00 22.32 ? 257  THR A C   1 
ATOM   520  O  O   . THR A 1 83  ? -36.918 29.248 -6.822  1.00 21.10 ? 257  THR A O   1 
ATOM   521  C  CB  . THR A 1 83  ? -35.347 31.816 -7.662  1.00 25.22 ? 257  THR A CB  1 
ATOM   522  O  OG1 . THR A 1 83  ? -35.817 31.988 -9.003  1.00 27.10 ? 257  THR A OG1 1 
ATOM   523  C  CG2 . THR A 1 83  ? -34.405 30.621 -7.596  1.00 27.27 ? 257  THR A CG2 1 
ATOM   524  N  N   . TRP A 1 84  ? -38.463 30.573 -7.790  1.00 22.20 ? 258  TRP A N   1 
ATOM   525  C  CA  . TRP A 1 84  ? -39.296 29.463 -8.232  1.00 22.95 ? 258  TRP A CA  1 
ATOM   526  C  C   . TRP A 1 84  ? -38.931 29.069 -9.657  1.00 24.09 ? 258  TRP A C   1 
ATOM   527  O  O   . TRP A 1 84  ? -38.859 29.918 -10.540 1.00 23.76 ? 258  TRP A O   1 
ATOM   528  C  CB  . TRP A 1 84  ? -40.774 29.852 -8.166  1.00 22.65 ? 258  TRP A CB  1 
ATOM   529  C  CG  . TRP A 1 84  ? -41.280 30.031 -6.769  1.00 21.10 ? 258  TRP A CG  1 
ATOM   530  C  CD1 . TRP A 1 84  ? -41.369 31.199 -6.067  1.00 23.81 ? 258  TRP A CD1 1 
ATOM   531  C  CD2 . TRP A 1 84  ? -41.743 29.002 -5.894  1.00 21.87 ? 258  TRP A CD2 1 
ATOM   532  N  NE1 . TRP A 1 84  ? -41.864 30.962 -4.805  1.00 22.49 ? 258  TRP A NE1 1 
ATOM   533  C  CE2 . TRP A 1 84  ? -42.102 29.620 -4.673  1.00 22.01 ? 258  TRP A CE2 1 
ATOM   534  C  CE3 . TRP A 1 84  ? -41.891 27.615 -6.020  1.00 20.01 ? 258  TRP A CE3 1 
ATOM   535  C  CZ2 . TRP A 1 84  ? -42.600 28.898 -3.588  1.00 20.74 ? 258  TRP A CZ2 1 
ATOM   536  C  CZ3 . TRP A 1 84  ? -42.386 26.898 -4.943  1.00 22.60 ? 258  TRP A CZ3 1 
ATOM   537  C  CH2 . TRP A 1 84  ? -42.735 27.541 -3.740  1.00 22.65 ? 258  TRP A CH2 1 
ATOM   538  N  N   . ILE A 1 85  ? -38.713 27.776 -9.866  1.00 24.37 ? 259  ILE A N   1 
ATOM   539  C  CA  . ILE A 1 85  ? -38.332 27.250 -11.172 1.00 26.17 ? 259  ILE A CA  1 
ATOM   540  C  C   . ILE A 1 85  ? -39.339 26.227 -11.681 1.00 27.36 ? 259  ILE A C   1 
ATOM   541  O  O   . ILE A 1 85  ? -39.663 25.270 -10.984 1.00 26.84 ? 259  ILE A O   1 
ATOM   542  C  CB  . ILE A 1 85  ? -36.943 26.577 -11.102 1.00 26.71 ? 259  ILE A CB  1 
ATOM   543  C  CG1 . ILE A 1 85  ? -35.889 27.601 -10.676 1.00 26.74 ? 259  ILE A CG1 1 
ATOM   544  C  CG2 . ILE A 1 85  ? -36.588 25.955 -12.447 1.00 29.77 ? 259  ILE A CG2 1 
ATOM   545  C  CD1 . ILE A 1 85  ? -35.769 28.791 -11.608 1.00 28.44 ? 259  ILE A CD1 1 
ATOM   546  N  N   . GLU A 1 86  ? -39.814 26.436 -12.906 1.00 28.44 ? 260  GLU A N   1 
ATOM   547  C  CA  . GLU A 1 86  ? -40.787 25.549 -13.546 1.00 31.07 ? 260  GLU A CA  1 
ATOM   548  C  C   . GLU A 1 86  ? -40.086 24.305 -14.099 1.00 30.01 ? 260  GLU A C   1 
ATOM   549  O  O   . GLU A 1 86  ? -40.674 23.231 -14.158 1.00 28.99 ? 260  GLU A O   1 
ATOM   550  C  CB  . GLU A 1 86  ? -41.504 26.317 -14.665 1.00 32.79 ? 260  GLU A CB  1 
ATOM   551  C  CG  . GLU A 1 86  ? -42.802 25.702 -15.182 1.00 37.80 ? 260  GLU A CG  1 
ATOM   552  C  CD  . GLU A 1 86  ? -42.576 24.586 -16.181 1.00 39.54 ? 260  GLU A CD  1 
ATOM   553  O  OE1 . GLU A 1 86  ? -41.639 24.699 -17.000 1.00 41.27 ? 260  GLU A OE1 1 
ATOM   554  O  OE2 . GLU A 1 86  ? -43.347 23.603 -16.159 1.00 41.88 ? 260  GLU A OE2 1 
ATOM   555  N  N   . GLY A 1 87  ? -38.828 24.464 -14.506 1.00 31.04 ? 261  GLY A N   1 
ATOM   556  C  CA  . GLY A 1 87  ? -38.060 23.340 -15.015 1.00 31.18 ? 261  GLY A CA  1 
ATOM   557  C  C   . GLY A 1 87  ? -37.846 23.290 -16.519 1.00 32.96 ? 261  GLY A C   1 
ATOM   558  O  O   . GLY A 1 87  ? -37.157 22.404 -17.021 1.00 31.63 ? 261  GLY A O   1 
ATOM   559  N  N   . LYS A 1 88  ? -38.428 24.244 -17.236 1.00 33.79 ? 262  LYS A N   1 
ATOM   560  C  CA  . LYS A 1 88  ? -38.310 24.289 -18.687 1.00 35.70 ? 262  LYS A CA  1 
ATOM   561  C  C   . LYS A 1 88  ? -37.655 25.576 -19.176 1.00 36.30 ? 262  LYS A C   1 
ATOM   562  O  O   . LYS A 1 88  ? -37.358 25.716 -20.360 1.00 36.62 ? 262  LYS A O   1 
ATOM   563  C  CB  . LYS A 1 88  ? -39.695 24.144 -19.326 1.00 35.09 ? 262  LYS A CB  1 
ATOM   564  C  CG  . LYS A 1 88  ? -40.376 22.811 -19.040 1.00 35.80 ? 262  LYS A CG  1 
ATOM   565  C  CD  . LYS A 1 88  ? -41.805 22.797 -19.559 1.00 37.33 ? 262  LYS A CD  1 
ATOM   566  C  CE  . LYS A 1 88  ? -42.424 21.404 -19.456 1.00 40.07 ? 262  LYS A CE  1 
ATOM   567  N  NZ  . LYS A 1 88  ? -42.391 20.856 -18.066 1.00 40.60 ? 262  LYS A NZ  1 
ATOM   568  N  N   . GLU A 1 89  ? -37.432 26.514 -18.264 1.00 35.69 ? 263  GLU A N   1 
ATOM   569  C  CA  . GLU A 1 89  ? -36.813 27.781 -18.632 1.00 35.74 ? 263  GLU A CA  1 
ATOM   570  C  C   . GLU A 1 89  ? -35.381 27.541 -19.094 1.00 35.73 ? 263  GLU A C   1 
ATOM   571  O  O   . GLU A 1 89  ? -34.718 26.611 -18.634 1.00 34.77 ? 263  GLU A O   1 
ATOM   572  C  CB  . GLU A 1 89  ? -36.818 28.749 -17.443 1.00 35.86 ? 263  GLU A CB  1 
ATOM   573  C  CG  . GLU A 1 89  ? -38.165 28.868 -16.753 1.00 35.49 ? 263  GLU A CG  1 
ATOM   574  C  CD  . GLU A 1 89  ? -38.298 27.932 -15.560 1.00 35.51 ? 263  GLU A CD  1 
ATOM   575  O  OE1 . GLU A 1 89  ? -37.817 26.778 -15.633 1.00 33.42 ? 263  GLU A OE1 1 
ATOM   576  O  OE2 . GLU A 1 89  ? -38.899 28.353 -14.548 1.00 35.53 ? 263  GLU A OE2 1 
ATOM   577  N  N   . PRO A 1 90  ? -34.893 28.367 -20.033 1.00 36.94 ? 264  PRO A N   1 
ATOM   578  C  CA  . PRO A 1 90  ? -33.527 28.234 -20.553 1.00 37.60 ? 264  PRO A CA  1 
ATOM   579  C  C   . PRO A 1 90  ? -32.505 28.426 -19.432 1.00 37.42 ? 264  PRO A C   1 
ATOM   580  O  O   . PRO A 1 90  ? -32.518 29.443 -18.743 1.00 38.92 ? 264  PRO A O   1 
ATOM   581  C  CB  . PRO A 1 90  ? -33.447 29.345 -21.596 1.00 36.53 ? 264  PRO A CB  1 
ATOM   582  C  CG  . PRO A 1 90  ? -34.854 29.459 -22.075 1.00 37.30 ? 264  PRO A CG  1 
ATOM   583  C  CD  . PRO A 1 90  ? -35.641 29.385 -20.789 1.00 36.73 ? 264  PRO A CD  1 
ATOM   584  N  N   . GLY A 1 91  ? -31.628 27.443 -19.254 1.00 38.08 ? 265  GLY A N   1 
ATOM   585  C  CA  . GLY A 1 91  ? -30.621 27.531 -18.210 1.00 38.63 ? 265  GLY A CA  1 
ATOM   586  C  C   . GLY A 1 91  ? -30.939 26.703 -16.976 1.00 38.76 ? 265  GLY A C   1 
ATOM   587  O  O   . GLY A 1 91  ? -30.099 26.567 -16.088 1.00 39.06 ? 265  GLY A O   1 
ATOM   588  N  N   . CYS A 1 92  ? -32.144 26.138 -16.920 1.00 37.30 ? 266  CYS A N   1 
ATOM   589  C  CA  . CYS A 1 92  ? -32.558 25.335 -15.772 1.00 35.59 ? 266  CYS A CA  1 
ATOM   590  C  C   . CYS A 1 92  ? -33.144 23.995 -16.208 1.00 34.33 ? 266  CYS A C   1 
ATOM   591  O  O   . CYS A 1 92  ? -34.012 23.442 -15.536 1.00 33.94 ? 266  CYS A O   1 
ATOM   592  C  CB  . CYS A 1 92  ? -33.608 26.096 -14.963 1.00 36.81 ? 266  CYS A CB  1 
ATOM   593  S  SG  . CYS A 1 92  ? -33.241 27.842 -14.730 1.00 41.11 ? 266  CYS A SG  1 
ATOM   594  N  N   . GLU A 1 93  ? -32.659 23.468 -17.325 1.00 32.67 ? 267  GLU A N   1 
ATOM   595  C  CA  . GLU A 1 93  ? -33.168 22.207 -17.846 1.00 31.53 ? 267  GLU A CA  1 
ATOM   596  C  C   . GLU A 1 93  ? -32.715 20.997 -17.041 1.00 29.82 ? 267  GLU A C   1 
ATOM   597  O  O   . GLU A 1 93  ? -33.404 19.985 -16.999 1.00 28.90 ? 267  GLU A O   1 
ATOM   598  C  CB  . GLU A 1 93  ? -32.759 22.050 -19.314 1.00 33.64 ? 267  GLU A CB  1 
ATOM   599  C  CG  . GLU A 1 93  ? -33.006 23.313 -20.128 1.00 35.07 ? 267  GLU A CG  1 
ATOM   600  C  CD  . GLU A 1 93  ? -33.076 23.050 -21.612 1.00 35.97 ? 267  GLU A CD  1 
ATOM   601  O  OE1 . GLU A 1 93  ? -32.143 22.422 -22.157 1.00 34.94 ? 267  GLU A OE1 1 
ATOM   602  O  OE2 . GLU A 1 93  ? -34.071 23.480 -22.232 1.00 39.75 ? 267  GLU A OE2 1 
ATOM   603  N  N   . THR A 1 94  ? -31.557 21.094 -16.401 1.00 28.15 ? 268  THR A N   1 
ATOM   604  C  CA  . THR A 1 94  ? -31.081 19.977 -15.599 1.00 28.21 ? 268  THR A CA  1 
ATOM   605  C  C   . THR A 1 94  ? -31.942 19.928 -14.336 1.00 28.27 ? 268  THR A C   1 
ATOM   606  O  O   . THR A 1 94  ? -32.195 18.854 -13.771 1.00 25.96 ? 268  THR A O   1 
ATOM   607  C  CB  . THR A 1 94  ? -29.610 20.157 -15.224 1.00 29.61 ? 268  THR A CB  1 
ATOM   608  O  OG1 . THR A 1 94  ? -28.894 20.662 -16.359 1.00 31.76 ? 268  THR A OG1 1 
ATOM   609  C  CG2 . THR A 1 94  ? -29.006 18.826 -14.812 1.00 27.44 ? 268  THR A CG2 1 
ATOM   610  N  N   . ILE A 1 95  ? -32.389 21.100 -13.897 1.00 27.46 ? 269  ILE A N   1 
ATOM   611  C  CA  . ILE A 1 95  ? -33.252 21.184 -12.726 1.00 28.77 ? 269  ILE A CA  1 
ATOM   612  C  C   . ILE A 1 95  ? -34.572 20.519 -13.106 1.00 28.32 ? 269  ILE A C   1 
ATOM   613  O  O   . ILE A 1 95  ? -35.119 19.729 -12.343 1.00 28.54 ? 269  ILE A O   1 
ATOM   614  C  CB  . ILE A 1 95  ? -33.497 22.657 -12.314 1.00 28.32 ? 269  ILE A CB  1 
ATOM   615  C  CG1 . ILE A 1 95  ? -32.195 23.252 -11.757 1.00 28.44 ? 269  ILE A CG1 1 
ATOM   616  C  CG2 . ILE A 1 95  ? -34.622 22.738 -11.270 1.00 27.10 ? 269  ILE A CG2 1 
ATOM   617  C  CD1 . ILE A 1 95  ? -32.299 24.707 -11.351 1.00 27.73 ? 269  ILE A CD1 1 
ATOM   618  N  N   . GLY A 1 96  ? -35.064 20.832 -14.302 1.00 29.88 ? 270  GLY A N   1 
ATOM   619  C  CA  . GLY A 1 96  ? -36.303 20.232 -14.770 1.00 30.47 ? 270  GLY A CA  1 
ATOM   620  C  C   . GLY A 1 96  ? -36.147 18.725 -14.830 1.00 30.44 ? 270  GLY A C   1 
ATOM   621  O  O   . GLY A 1 96  ? -37.103 17.975 -14.637 1.00 32.05 ? 270  GLY A O   1 
ATOM   622  N  N   . LEU A 1 97  ? -34.920 18.289 -15.095 1.00 29.46 ? 271  LEU A N   1 
ATOM   623  C  CA  . LEU A 1 97  ? -34.588 16.876 -15.173 1.00 28.41 ? 271  LEU A CA  1 
ATOM   624  C  C   . LEU A 1 97  ? -34.644 16.276 -13.770 1.00 28.59 ? 271  LEU A C   1 
ATOM   625  O  O   . LEU A 1 97  ? -35.097 15.147 -13.579 1.00 28.35 ? 271  LEU A O   1 
ATOM   626  C  CB  . LEU A 1 97  ? -33.187 16.719 -15.770 1.00 31.03 ? 271  LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 97  ? -32.758 15.338 -16.266 1.00 33.78 ? 271  LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 97  ? -31.541 15.484 -17.175 1.00 32.51 ? 271  LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 97  ? -32.456 14.429 -15.082 1.00 35.48 ? 271  LEU A CD2 1 
ATOM   630  N  N   . LEU A 1 98  ? -34.162 17.037 -12.788 1.00 26.24 ? 272  LEU A N   1 
ATOM   631  C  CA  . LEU A 1 98  ? -34.188 16.597 -11.397 1.00 25.18 ? 272  LEU A CA  1 
ATOM   632  C  C   . LEU A 1 98  ? -35.647 16.417 -10.975 1.00 24.18 ? 272  LEU A C   1 
ATOM   633  O  O   . LEU A 1 98  ? -36.021 15.434 -10.333 1.00 23.73 ? 272  LEU A O   1 
ATOM   634  C  CB  . LEU A 1 98  ? -33.530 17.656 -10.508 1.00 22.91 ? 272  LEU A CB  1 
ATOM   635  C  CG  . LEU A 1 98  ? -33.946 17.679 -9.029  1.00 22.15 ? 272  LEU A CG  1 
ATOM   636  C  CD1 . LEU A 1 98  ? -33.472 16.422 -8.323  1.00 20.32 ? 272  LEU A CD1 1 
ATOM   637  C  CD2 . LEU A 1 98  ? -33.357 18.921 -8.367  1.00 20.01 ? 272  LEU A CD2 1 
ATOM   638  N  N   . MET A 1 99  ? -36.464 17.391 -11.346 1.00 25.02 ? 273  MET A N   1 
ATOM   639  C  CA  . MET A 1 99  ? -37.877 17.371 -11.017 1.00 27.94 ? 273  MET A CA  1 
ATOM   640  C  C   . MET A 1 99  ? -38.555 16.150 -11.630 1.00 29.88 ? 273  MET A C   1 
ATOM   641  O  O   . MET A 1 99  ? -39.421 15.525 -11.009 1.00 28.97 ? 273  MET A O   1 
ATOM   642  C  CB  . MET A 1 99  ? -38.526 18.659 -11.516 1.00 27.38 ? 273  MET A CB  1 
ATOM   643  C  CG  . MET A 1 99  ? -37.942 19.901 -10.851 1.00 25.89 ? 273  MET A CG  1 
ATOM   644  S  SD  . MET A 1 99  ? -38.418 21.438 -11.624 1.00 27.01 ? 273  MET A SD  1 
ATOM   645  C  CE  . MET A 1 99  ? -40.184 21.524 -11.165 1.00 24.78 ? 273  MET A CE  1 
ATOM   646  N  N   . SER A 1 100 ? -38.156 15.808 -12.851 1.00 32.22 ? 274  SER A N   1 
ATOM   647  C  CA  . SER A 1 100 ? -38.735 14.657 -13.528 1.00 33.44 ? 274  SER A CA  1 
ATOM   648  C  C   . SER A 1 100 ? -38.353 13.392 -12.789 1.00 33.05 ? 274  SER A C   1 
ATOM   649  O  O   . SER A 1 100 ? -39.170 12.494 -12.615 1.00 34.75 ? 274  SER A O   1 
ATOM   650  C  CB  . SER A 1 100 ? -38.249 14.592 -14.976 1.00 35.14 ? 274  SER A CB  1 
ATOM   651  O  OG  . SER A 1 100 ? -38.772 15.685 -15.713 1.00 38.31 ? 274  SER A OG  1 
ATOM   652  N  N   . SER A 1 101 ? -37.102 13.334 -12.347 1.00 32.21 ? 275  SER A N   1 
ATOM   653  C  CA  . SER A 1 101 ? -36.610 12.181 -11.617 1.00 31.70 ? 275  SER A CA  1 
ATOM   654  C  C   . SER A 1 101 ? -37.371 12.038 -10.306 1.00 31.25 ? 275  SER A C   1 
ATOM   655  O  O   . SER A 1 101 ? -37.675 10.926 -9.873  1.00 30.68 ? 275  SER A O   1 
ATOM   656  C  CB  . SER A 1 101 ? -35.114 12.337 -11.350 1.00 34.33 ? 275  SER A CB  1 
ATOM   657  O  OG  . SER A 1 101 ? -34.407 12.488 -12.569 1.00 35.39 ? 275  SER A OG  1 
ATOM   658  N  N   . MET A 1 102 ? -37.676 13.169 -9.670  1.00 29.07 ? 276  MET A N   1 
ATOM   659  C  CA  . MET A 1 102 ? -38.425 13.142 -8.419  1.00 27.88 ? 276  MET A CA  1 
ATOM   660  C  C   . MET A 1 102 ? -39.829 12.602 -8.688  1.00 26.15 ? 276  MET A C   1 
ATOM   661  O  O   . MET A 1 102 ? -40.326 11.757 -7.952  1.00 24.85 ? 276  MET A O   1 
ATOM   662  C  CB  . MET A 1 102 ? -38.537 14.548 -7.815  1.00 27.11 ? 276  MET A CB  1 
ATOM   663  C  CG  . MET A 1 102 ? -37.271 15.099 -7.163  1.00 26.28 ? 276  MET A CG  1 
ATOM   664  S  SD  . MET A 1 102 ? -37.552 16.814 -6.626  1.00 26.80 ? 276  MET A SD  1 
ATOM   665  C  CE  . MET A 1 102 ? -36.027 17.153 -5.748  1.00 28.29 ? 276  MET A CE  1 
ATOM   666  N  N   . ASP A 1 103 ? -40.454 13.103 -9.753  1.00 27.27 ? 277  ASP A N   1 
ATOM   667  C  CA  . ASP A 1 103 ? -41.803 12.690 -10.130 1.00 30.75 ? 277  ASP A CA  1 
ATOM   668  C  C   . ASP A 1 103 ? -41.891 11.206 -10.465 1.00 32.87 ? 277  ASP A C   1 
ATOM   669  O  O   . ASP A 1 103 ? -42.758 10.506 -9.950  1.00 34.33 ? 277  ASP A O   1 
ATOM   670  C  CB  . ASP A 1 103 ? -42.307 13.503 -11.327 1.00 28.09 ? 277  ASP A CB  1 
ATOM   671  C  CG  . ASP A 1 103 ? -42.553 14.959 -10.984 1.00 30.00 ? 277  ASP A CG  1 
ATOM   672  O  OD1 . ASP A 1 103 ? -42.580 15.290 -9.781  1.00 30.06 ? 277  ASP A OD1 1 
ATOM   673  O  OD2 . ASP A 1 103 ? -42.736 15.772 -11.913 1.00 29.77 ? 277  ASP A OD2 1 
ATOM   674  N  N   . ASP A 1 104 ? -40.999 10.729 -11.332 1.00 35.87 ? 278  ASP A N   1 
ATOM   675  C  CA  . ASP A 1 104 ? -41.011 9.320  -11.712 1.00 36.31 ? 278  ASP A CA  1 
ATOM   676  C  C   . ASP A 1 104 ? -40.903 8.472  -10.461 1.00 35.95 ? 278  ASP A C   1 
ATOM   677  O  O   . ASP A 1 104 ? -41.517 7.419  -10.361 1.00 37.26 ? 278  ASP A O   1 
ATOM   678  C  CB  . ASP A 1 104 ? -39.850 8.993  -12.655 1.00 37.48 ? 278  ASP A CB  1 
ATOM   679  C  CG  . ASP A 1 104 ? -39.925 9.763  -13.959 1.00 40.22 ? 278  ASP A CG  1 
ATOM   680  O  OD1 . ASP A 1 104 ? -41.032 10.226 -14.315 1.00 41.04 ? 278  ASP A OD1 1 
ATOM   681  O  OD2 . ASP A 1 104 ? -38.878 9.894  -14.635 1.00 41.55 ? 278  ASP A OD2 1 
ATOM   682  N  N   . LEU A 1 105 ? -40.130 8.956  -9.498  1.00 36.02 ? 279  LEU A N   1 
ATOM   683  C  CA  . LEU A 1 105 ? -39.931 8.242  -8.246  1.00 36.71 ? 279  LEU A CA  1 
ATOM   684  C  C   . LEU A 1 105 ? -41.230 8.201  -7.438  1.00 36.54 ? 279  LEU A C   1 
ATOM   685  O  O   . LEU A 1 105 ? -41.606 7.164  -6.900  1.00 37.01 ? 279  LEU A O   1 
ATOM   686  C  CB  . LEU A 1 105 ? -38.815 8.922  -7.442  1.00 37.73 ? 279  LEU A CB  1 
ATOM   687  C  CG  . LEU A 1 105 ? -38.114 8.082  -6.372  1.00 39.35 ? 279  LEU A CG  1 
ATOM   688  C  CD1 . LEU A 1 105 ? -37.458 6.866  -7.025  1.00 40.00 ? 279  LEU A CD1 1 
ATOM   689  C  CD2 . LEU A 1 105 ? -37.063 8.925  -5.666  1.00 38.11 ? 279  LEU A CD2 1 
ATOM   690  N  N   . ILE A 1 106 ? -41.918 9.337  -7.366  1.00 36.37 ? 280  ILE A N   1 
ATOM   691  C  CA  . ILE A 1 106 ? -43.174 9.426  -6.631  1.00 35.80 ? 280  ILE A CA  1 
ATOM   692  C  C   . ILE A 1 106 ? -44.247 8.550  -7.269  1.00 36.29 ? 280  ILE A C   1 
ATOM   693  O  O   . ILE A 1 106 ? -45.014 7.893  -6.570  1.00 35.95 ? 280  ILE A O   1 
ATOM   694  C  CB  . ILE A 1 106 ? -43.680 10.896 -6.571  1.00 34.54 ? 280  ILE A CB  1 
ATOM   695  C  CG1 . ILE A 1 106 ? -42.817 11.695 -5.593  1.00 33.08 ? 280  ILE A CG1 1 
ATOM   696  C  CG2 . ILE A 1 106 ? -45.146 10.944 -6.144  1.00 32.50 ? 280  ILE A CG2 1 
ATOM   697  C  CD1 . ILE A 1 106 ? -42.896 11.200 -4.157  1.00 33.83 ? 280  ILE A CD1 1 
ATOM   698  N  N   . ARG A 1 107 ? -44.297 8.549  -8.598  1.00 37.44 ? 281  ARG A N   1 
ATOM   699  C  CA  . ARG A 1 107 ? -45.276 7.750  -9.328  1.00 39.70 ? 281  ARG A CA  1 
ATOM   700  C  C   . ARG A 1 107 ? -45.177 6.274  -8.966  1.00 41.42 ? 281  ARG A C   1 
ATOM   701  O  O   . ARG A 1 107 ? -46.192 5.600  -8.813  1.00 41.92 ? 281  ARG A O   1 
ATOM   702  C  CB  . ARG A 1 107 ? -45.083 7.933  -10.835 1.00 40.54 ? 281  ARG A CB  1 
ATOM   703  C  CG  . ARG A 1 107 ? -45.579 9.273  -11.339 1.00 43.65 ? 281  ARG A CG  1 
ATOM   704  C  CD  . ARG A 1 107 ? -45.032 9.605  -12.714 1.00 45.93 ? 281  ARG A CD  1 
ATOM   705  N  NE  . ARG A 1 107 ? -45.462 10.932 -13.147 1.00 48.15 ? 281  ARG A NE  1 
ATOM   706  C  CZ  . ARG A 1 107 ? -44.877 11.630 -14.116 1.00 48.93 ? 281  ARG A CZ  1 
ATOM   707  N  NH1 . ARG A 1 107 ? -43.828 11.126 -14.754 1.00 48.90 ? 281  ARG A NH1 1 
ATOM   708  N  NH2 . ARG A 1 107 ? -45.340 12.831 -14.447 1.00 48.41 ? 281  ARG A NH2 1 
ATOM   709  N  N   . HIS A 1 108 ? -43.952 5.776  -8.821  1.00 42.14 ? 282  HIS A N   1 
ATOM   710  C  CA  . HIS A 1 108 ? -43.742 4.375  -8.471  1.00 43.45 ? 282  HIS A CA  1 
ATOM   711  C  C   . HIS A 1 108 ? -44.105 4.081  -7.021  1.00 43.46 ? 282  HIS A C   1 
ATOM   712  O  O   . HIS A 1 108 ? -44.112 2.930  -6.604  1.00 44.54 ? 282  HIS A O   1 
ATOM   713  C  CB  . HIS A 1 108 ? -42.285 3.977  -8.717  1.00 44.00 ? 282  HIS A CB  1 
ATOM   714  C  CG  . HIS A 1 108 ? -41.857 4.101  -10.146 1.00 43.38 ? 282  HIS A CG  1 
ATOM   715  N  ND1 . HIS A 1 108 ? -42.629 3.648  -11.194 1.00 43.70 ? 282  HIS A ND1 1 
ATOM   716  C  CD2 . HIS A 1 108 ? -40.730 4.606  -10.699 1.00 44.07 ? 282  HIS A CD2 1 
ATOM   717  C  CE1 . HIS A 1 108 ? -41.995 3.870  -12.332 1.00 44.97 ? 282  HIS A CE1 1 
ATOM   718  N  NE2 . HIS A 1 108 ? -40.840 4.451  -12.059 1.00 44.80 ? 282  HIS A NE2 1 
ATOM   719  N  N   . CYS A 1 109 ? -44.406 5.125  -6.255  1.00 44.60 ? 283  CYS A N   1 
ATOM   720  C  CA  . CYS A 1 109 ? -44.766 4.961  -4.850  1.00 45.33 ? 283  CYS A CA  1 
ATOM   721  C  C   . CYS A 1 109 ? -46.263 5.135  -4.603  1.00 45.75 ? 283  CYS A C   1 
ATOM   722  O  O   . CYS A 1 109 ? -46.774 4.725  -3.564  1.00 45.89 ? 283  CYS A O   1 
ATOM   723  C  CB  . CYS A 1 109 ? -44.002 5.966  -3.983  1.00 45.13 ? 283  CYS A CB  1 
ATOM   724  S  SG  . CYS A 1 109 ? -42.220 5.698  -3.853  1.00 47.00 ? 283  CYS A SG  1 
ATOM   725  N  N   . ASN A 1 110 ? -46.963 5.744  -5.556  1.00 46.59 ? 284  ASN A N   1 
ATOM   726  C  CA  . ASN A 1 110 ? -48.395 5.984  -5.404  1.00 46.84 ? 284  ASN A CA  1 
ATOM   727  C  C   . ASN A 1 110 ? -49.182 4.779  -4.910  1.00 46.94 ? 284  ASN A C   1 
ATOM   728  O  O   . ASN A 1 110 ? -49.045 3.673  -5.432  1.00 46.11 ? 284  ASN A O   1 
ATOM   729  C  CB  . ASN A 1 110 ? -49.001 6.492  -6.714  1.00 47.57 ? 284  ASN A CB  1 
ATOM   730  C  CG  . ASN A 1 110 ? -49.250 7.986  -6.689  1.00 48.52 ? 284  ASN A CG  1 
ATOM   731  O  OD1 . ASN A 1 110 ? -49.800 8.512  -5.721  1.00 47.90 ? 284  ASN A OD1 1 
ATOM   732  N  ND2 . ASN A 1 110 ? -48.849 8.679  -7.752  1.00 49.29 ? 284  ASN A ND2 1 
ATOM   733  N  N   . GLY A 1 111 ? -50.010 5.016  -3.895  1.00 46.14 ? 285  GLY A N   1 
ATOM   734  C  CA  . GLY A 1 111 ? -50.816 3.956  -3.321  1.00 45.65 ? 285  GLY A CA  1 
ATOM   735  C  C   . GLY A 1 111 ? -50.062 3.218  -2.232  1.00 46.16 ? 285  GLY A C   1 
ATOM   736  O  O   . GLY A 1 111 ? -50.631 2.386  -1.526  1.00 46.88 ? 285  GLY A O   1 
ATOM   737  N  N   . LYS A 1 112 ? -48.776 3.530  -2.089  1.00 46.18 ? 286  LYS A N   1 
ATOM   738  C  CA  . LYS A 1 112 ? -47.944 2.879  -1.084  1.00 45.14 ? 286  LYS A CA  1 
ATOM   739  C  C   . LYS A 1 112 ? -47.419 3.841  -0.016  1.00 44.41 ? 286  LYS A C   1 
ATOM   740  O  O   . LYS A 1 112 ? -46.969 3.409  1.047   1.00 45.14 ? 286  LYS A O   1 
ATOM   741  C  CB  . LYS A 1 112 ? -46.780 2.157  -1.766  1.00 45.59 ? 286  LYS A CB  1 
ATOM   742  C  CG  . LYS A 1 112 ? -47.220 1.076  -2.747  1.00 46.34 ? 286  LYS A CG  1 
ATOM   743  C  CD  . LYS A 1 112 ? -46.038 0.250  -3.242  1.00 46.57 ? 286  LYS A CD  1 
ATOM   744  C  CE  . LYS A 1 112 ? -46.490 -0.827 -4.220  1.00 46.25 ? 286  LYS A CE  1 
ATOM   745  N  NZ  . LYS A 1 112 ? -47.477 -1.760 -3.602  1.00 47.05 ? 286  LYS A NZ  1 
ATOM   746  N  N   . LEU A 1 113 ? -47.469 5.140  -0.301  1.00 42.90 ? 287  LEU A N   1 
ATOM   747  C  CA  . LEU A 1 113 ? -47.021 6.147  0.661   1.00 40.16 ? 287  LEU A CA  1 
ATOM   748  C  C   . LEU A 1 113 ? -48.207 6.480  1.559   1.00 39.76 ? 287  LEU A C   1 
ATOM   749  O  O   . LEU A 1 113 ? -48.961 7.403  1.277   1.00 40.41 ? 287  LEU A O   1 
ATOM   750  C  CB  . LEU A 1 113 ? -46.546 7.412  -0.064  1.00 39.33 ? 287  LEU A CB  1 
ATOM   751  C  CG  . LEU A 1 113 ? -45.276 7.289  -0.914  1.00 39.20 ? 287  LEU A CG  1 
ATOM   752  C  CD1 . LEU A 1 113 ? -45.013 8.599  -1.632  1.00 39.19 ? 287  LEU A CD1 1 
ATOM   753  C  CD2 . LEU A 1 113 ? -44.090 6.920  -0.035  1.00 37.79 ? 287  LEU A CD2 1 
ATOM   754  N  N   . GLY A 1 114 ? -48.364 5.724  2.641   1.00 38.53 ? 288  GLY A N   1 
ATOM   755  C  CA  . GLY A 1 114 ? -49.491 5.947  3.527   1.00 38.51 ? 288  GLY A CA  1 
ATOM   756  C  C   . GLY A 1 114 ? -50.745 5.607  2.744   1.00 38.10 ? 288  GLY A C   1 
ATOM   757  O  O   . GLY A 1 114 ? -50.734 4.686  1.932   1.00 38.64 ? 288  GLY A O   1 
ATOM   758  N  N   . SER A 1 115 ? -51.829 6.335  2.976   1.00 37.80 ? 289  SER A N   1 
ATOM   759  C  CA  . SER A 1 115 ? -53.059 6.083  2.234   1.00 38.10 ? 289  SER A CA  1 
ATOM   760  C  C   . SER A 1 115 ? -53.249 7.235  1.257   1.00 37.85 ? 289  SER A C   1 
ATOM   761  O  O   . SER A 1 115 ? -54.300 7.367  0.625   1.00 39.53 ? 289  SER A O   1 
ATOM   762  C  CB  . SER A 1 115 ? -54.266 5.993  3.179   1.00 38.30 ? 289  SER A CB  1 
ATOM   763  O  OG  . SER A 1 115 ? -54.466 7.205  3.887   1.00 40.00 ? 289  SER A OG  1 
ATOM   764  N  N   . TYR A 1 116 ? -52.212 8.063  1.139   1.00 35.04 ? 290  TYR A N   1 
ATOM   765  C  CA  . TYR A 1 116 ? -52.233 9.218  0.251   1.00 32.72 ? 290  TYR A CA  1 
ATOM   766  C  C   . TYR A 1 116 ? -52.271 8.840  -1.222  1.00 32.04 ? 290  TYR A C   1 
ATOM   767  O  O   . TYR A 1 116 ? -51.811 7.773  -1.618  1.00 32.61 ? 290  TYR A O   1 
ATOM   768  C  CB  . TYR A 1 116 ? -50.997 10.090 0.472   1.00 32.18 ? 290  TYR A CB  1 
ATOM   769  C  CG  . TYR A 1 116 ? -50.848 10.675 1.854   1.00 33.51 ? 290  TYR A CG  1 
ATOM   770  C  CD1 . TYR A 1 116 ? -51.836 11.501 2.398   1.00 31.96 ? 290  TYR A CD1 1 
ATOM   771  C  CD2 . TYR A 1 116 ? -49.683 10.458 2.596   1.00 31.35 ? 290  TYR A CD2 1 
ATOM   772  C  CE1 . TYR A 1 116 ? -51.663 12.101 3.642   1.00 33.14 ? 290  TYR A CE1 1 
ATOM   773  C  CE2 . TYR A 1 116 ? -49.501 11.051 3.836   1.00 33.71 ? 290  TYR A CE2 1 
ATOM   774  C  CZ  . TYR A 1 116 ? -50.490 11.873 4.353   1.00 34.14 ? 290  TYR A CZ  1 
ATOM   775  O  OH  . TYR A 1 116 ? -50.290 12.479 5.567   1.00 34.01 ? 290  TYR A OH  1 
ATOM   776  N  N   . LYS A 1 117 ? -52.818 9.741  -2.027  1.00 30.41 ? 291  LYS A N   1 
ATOM   777  C  CA  . LYS A 1 117 ? -52.899 9.570  -3.469  1.00 29.84 ? 291  LYS A CA  1 
ATOM   778  C  C   . LYS A 1 117 ? -52.390 10.873 -4.072  1.00 29.73 ? 291  LYS A C   1 
ATOM   779  O  O   . LYS A 1 117 ? -53.152 11.824 -4.255  1.00 28.24 ? 291  LYS A O   1 
ATOM   780  C  CB  . LYS A 1 117 ? -54.344 9.331  -3.908  1.00 31.61 ? 291  LYS A CB  1 
ATOM   781  C  CG  . LYS A 1 117 ? -54.894 7.976  -3.533  1.00 34.76 ? 291  LYS A CG  1 
ATOM   782  C  CD  . LYS A 1 117 ? -54.303 6.884  -4.405  1.00 36.97 ? 291  LYS A CD  1 
ATOM   783  C  CE  . LYS A 1 117 ? -54.944 5.539  -4.104  1.00 37.42 ? 291  LYS A CE  1 
ATOM   784  N  NZ  . LYS A 1 117 ? -54.697 5.127  -2.699  1.00 40.69 ? 291  LYS A NZ  1 
ATOM   785  N  N   . ILE A 1 118 ? -51.096 10.914 -4.370  1.00 27.70 ? 292  ILE A N   1 
ATOM   786  C  CA  . ILE A 1 118 ? -50.480 12.105 -4.936  1.00 28.44 ? 292  ILE A CA  1 
ATOM   787  C  C   . ILE A 1 118 ? -50.923 12.334 -6.372  1.00 28.31 ? 292  ILE A C   1 
ATOM   788  O  O   . ILE A 1 118 ? -50.786 11.452 -7.203  1.00 31.14 ? 292  ILE A O   1 
ATOM   789  C  CB  . ILE A 1 118 ? -48.944 11.988 -4.883  1.00 26.98 ? 292  ILE A CB  1 
ATOM   790  C  CG1 . ILE A 1 118 ? -48.495 11.879 -3.423  1.00 25.21 ? 292  ILE A CG1 1 
ATOM   791  C  CG2 . ILE A 1 118 ? -48.299 13.186 -5.562  1.00 27.28 ? 292  ILE A CG2 1 
ATOM   792  C  CD1 . ILE A 1 118 ? -47.035 11.563 -3.254  1.00 25.13 ? 292  ILE A CD1 1 
ATOM   793  N  N   . ASN A 1 119 ? -51.464 13.516 -6.659  1.00 28.14 ? 293  ASN A N   1 
ATOM   794  C  CA  . ASN A 1 119 ? -51.921 13.824 -8.014  1.00 29.32 ? 293  ASN A CA  1 
ATOM   795  C  C   . ASN A 1 119 ? -51.308 15.104 -8.578  1.00 29.12 ? 293  ASN A C   1 
ATOM   796  O  O   . ASN A 1 119 ? -51.706 15.578 -9.643  1.00 31.02 ? 293  ASN A O   1 
ATOM   797  C  CB  . ASN A 1 119 ? -53.456 13.926 -8.064  1.00 30.20 ? 293  ASN A CB  1 
ATOM   798  C  CG  . ASN A 1 119 ? -54.000 15.140 -7.325  1.00 31.54 ? 293  ASN A CG  1 
ATOM   799  O  OD1 . ASN A 1 119 ? -55.156 15.512 -7.506  1.00 33.29 ? 293  ASN A OD1 1 
ATOM   800  N  ND2 . ASN A 1 119 ? -53.175 15.754 -6.485  1.00 30.07 ? 293  ASN A ND2 1 
ATOM   801  N  N   . GLY A 1 120 ? -50.337 15.664 -7.867  1.00 27.94 ? 294  GLY A N   1 
ATOM   802  C  CA  . GLY A 1 120 ? -49.705 16.879 -8.348  1.00 25.45 ? 294  GLY A CA  1 
ATOM   803  C  C   . GLY A 1 120 ? -48.610 17.394 -7.434  1.00 24.10 ? 294  GLY A C   1 
ATOM   804  O  O   . GLY A 1 120 ? -48.351 16.836 -6.359  1.00 21.97 ? 294  GLY A O   1 
ATOM   805  N  N   . ARG A 1 121 ? -47.957 18.464 -7.870  1.00 23.16 ? 295  ARG A N   1 
ATOM   806  C  CA  . ARG A 1 121 ? -46.893 19.068 -7.087  1.00 24.05 ? 295  ARG A CA  1 
ATOM   807  C  C   . ARG A 1 121 ? -46.766 20.551 -7.387  1.00 22.43 ? 295  ARG A C   1 
ATOM   808  O  O   . ARG A 1 121 ? -47.370 21.068 -8.317  1.00 20.46 ? 295  ARG A O   1 
ATOM   809  C  CB  . ARG A 1 121 ? -45.547 18.386 -7.369  1.00 25.04 ? 295  ARG A CB  1 
ATOM   810  C  CG  . ARG A 1 121 ? -45.014 18.573 -8.784  1.00 25.33 ? 295  ARG A CG  1 
ATOM   811  C  CD  . ARG A 1 121 ? -43.541 18.181 -8.867  1.00 27.04 ? 295  ARG A CD  1 
ATOM   812  N  NE  . ARG A 1 121 ? -43.091 17.999 -10.246 1.00 30.89 ? 295  ARG A NE  1 
ATOM   813  C  CZ  . ARG A 1 121 ? -43.022 18.969 -11.157 1.00 30.12 ? 295  ARG A CZ  1 
ATOM   814  N  NH1 . ARG A 1 121 ? -43.358 20.217 -10.847 1.00 30.58 ? 295  ARG A NH1 1 
ATOM   815  N  NH2 . ARG A 1 121 ? -42.604 18.687 -12.382 1.00 29.63 ? 295  ARG A NH2 1 
ATOM   816  N  N   . THR A 1 122 ? -45.972 21.224 -6.571  1.00 20.88 ? 296  THR A N   1 
ATOM   817  C  CA  . THR A 1 122 ? -45.708 22.643 -6.736  1.00 20.44 ? 296  THR A CA  1 
ATOM   818  C  C   . THR A 1 122 ? -44.545 22.743 -7.703  1.00 20.94 ? 296  THR A C   1 
ATOM   819  O  O   . THR A 1 122 ? -43.990 21.726 -8.135  1.00 19.22 ? 296  THR A O   1 
ATOM   820  C  CB  . THR A 1 122 ? -45.224 23.272 -5.424  1.00 21.65 ? 296  THR A CB  1 
ATOM   821  O  OG1 . THR A 1 122 ? -43.967 22.683 -5.062  1.00 17.39 ? 296  THR A OG1 1 
ATOM   822  C  CG2 . THR A 1 122 ? -46.223 23.022 -4.304  1.00 22.40 ? 296  THR A CG2 1 
ATOM   823  N  N   . LYS A 1 123 ? -44.177 23.973 -8.041  1.00 21.59 ? 297  LYS A N   1 
ATOM   824  C  CA  . LYS A 1 123 ? -43.022 24.187 -8.893  1.00 22.75 ? 297  LYS A CA  1 
ATOM   825  C  C   . LYS A 1 123 ? -41.838 23.995 -7.947  1.00 22.28 ? 297  LYS A C   1 
ATOM   826  O  O   . LYS A 1 123 ? -42.028 23.812 -6.743  1.00 21.00 ? 297  LYS A O   1 
ATOM   827  C  CB  . LYS A 1 123 ? -43.025 25.602 -9.486  1.00 27.46 ? 297  LYS A CB  1 
ATOM   828  C  CG  . LYS A 1 123 ? -44.102 25.800 -10.553 1.00 32.24 ? 297  LYS A CG  1 
ATOM   829  C  CD  . LYS A 1 123 ? -43.931 27.102 -11.336 1.00 38.49 ? 297  LYS A CD  1 
ATOM   830  C  CE  . LYS A 1 123 ? -44.203 28.331 -10.480 1.00 42.82 ? 297  LYS A CE  1 
ATOM   831  N  NZ  . LYS A 1 123 ? -44.071 29.595 -11.271 1.00 44.89 ? 297  LYS A NZ  1 
ATOM   832  N  N   . ALA A 1 124 ? -40.625 24.026 -8.476  1.00 21.58 ? 298  ALA A N   1 
ATOM   833  C  CA  . ALA A 1 124 ? -39.455 23.838 -7.639  1.00 21.71 ? 298  ALA A CA  1 
ATOM   834  C  C   . ALA A 1 124 ? -39.019 25.116 -6.960  1.00 21.75 ? 298  ALA A C   1 
ATOM   835  O  O   . ALA A 1 124 ? -38.936 26.165 -7.602  1.00 21.41 ? 298  ALA A O   1 
ATOM   836  C  CB  . ALA A 1 124 ? -38.320 23.280 -8.480  1.00 21.73 ? 298  ALA A CB  1 
ATOM   837  N  N   . MET A 1 125 ? -38.770 25.058 -5.657  1.00 18.53 ? 299  MET A N   1 
ATOM   838  C  CA  . MET A 1 125 ? -38.312 26.246 -4.945  1.00 19.13 ? 299  MET A CA  1 
ATOM   839  C  C   . MET A 1 125 ? -36.858 26.083 -4.631  1.00 18.77 ? 299  MET A C   1 
ATOM   840  O  O   . MET A 1 125 ? -36.493 25.257 -3.825  1.00 19.87 ? 299  MET A O   1 
ATOM   841  C  CB  . MET A 1 125 ? -39.068 26.435 -3.634  1.00 18.76 ? 299  MET A CB  1 
ATOM   842  C  CG  . MET A 1 125 ? -38.605 27.665 -2.884  1.00 17.92 ? 299  MET A CG  1 
ATOM   843  S  SD  . MET A 1 125 ? -39.307 27.868 -1.253  1.00 22.19 ? 299  MET A SD  1 
ATOM   844  C  CE  . MET A 1 125 ? -38.280 26.779 -0.261  1.00 15.13 ? 299  MET A CE  1 
ATOM   845  N  N   . VAL A 1 126 ? -36.021 26.867 -5.294  1.00 19.13 ? 300  VAL A N   1 
ATOM   846  C  CA  . VAL A 1 126 ? -34.594 26.810 -5.089  1.00 17.63 ? 300  VAL A CA  1 
ATOM   847  C  C   . VAL A 1 126 ? -34.293 27.791 -3.971  1.00 18.51 ? 300  VAL A C   1 
ATOM   848  O  O   . VAL A 1 126 ? -34.742 28.917 -4.002  1.00 16.05 ? 300  VAL A O   1 
ATOM   849  C  CB  . VAL A 1 126 ? -33.811 27.236 -6.380  1.00 19.38 ? 300  VAL A CB  1 
ATOM   850  C  CG1 . VAL A 1 126 ? -32.305 27.164 -6.110  1.00 18.12 ? 300  VAL A CG1 1 
ATOM   851  C  CG2 . VAL A 1 126 ? -34.240 26.356 -7.562  1.00 19.39 ? 300  VAL A CG2 1 
ATOM   852  N  N   . ALA A 1 127 ? -33.573 27.343 -2.953  1.00 17.79 ? 301  ALA A N   1 
ATOM   853  C  CA  . ALA A 1 127 ? -33.250 28.197 -1.820  1.00 19.34 ? 301  ALA A CA  1 
ATOM   854  C  C   . ALA A 1 127 ? -31.766 28.275 -1.597  1.00 19.51 ? 301  ALA A C   1 
ATOM   855  O  O   . ALA A 1 127 ? -31.038 27.329 -1.797  1.00 18.46 ? 301  ALA A O   1 
ATOM   856  C  CB  . ALA A 1 127 ? -33.964 27.672 -0.534  1.00 17.33 ? 301  ALA A CB  1 
HETATM 857  N  N   . SNC A 1 128 ? -31.345 29.452 -1.179  1.00 20.25 ? 302  SNC A N   1 
HETATM 858  C  CA  . SNC A 1 128 ? -29.955 29.709 -0.947  1.00 21.96 ? 302  SNC A CA  1 
HETATM 859  C  CB  . SNC A 1 128 ? -29.393 30.545 -2.088  1.00 26.33 ? 302  SNC A CB  1 
HETATM 860  S  SG  . SNC A 1 128 ? -27.619 30.668 -2.078  1.00 33.92 ? 302  SNC A SG  1 
HETATM 861  N  ND  . SNC A 1 128 ? -27.330 32.000 -0.920  1.00 35.64 ? 302  SNC A ND  1 
HETATM 862  O  OE  . SNC A 1 128 ? -27.546 33.098 -1.334  1.00 36.62 ? 302  SNC A OE  1 
HETATM 863  C  C   . SNC A 1 128 ? -29.714 30.459 0.343   1.00 21.31 ? 302  SNC A C   1 
HETATM 864  O  O   . SNC A 1 128 ? -30.174 31.572 0.494   1.00 21.81 ? 302  SNC A O   1 
ATOM   865  N  N   . TYR A 1 129 ? -29.071 29.822 1.300   1.00 19.26 ? 303  TYR A N   1 
ATOM   866  C  CA  . TYR A 1 129 ? -28.740 30.474 2.561   1.00 21.00 ? 303  TYR A CA  1 
ATOM   867  C  C   . TYR A 1 129 ? -27.373 31.047 2.263   1.00 22.36 ? 303  TYR A C   1 
ATOM   868  O  O   . TYR A 1 129 ? -26.435 30.289 2.044   1.00 20.79 ? 303  TYR A O   1 
ATOM   869  C  CB  . TYR A 1 129 ? -28.683 29.484 3.726   1.00 18.67 ? 303  TYR A CB  1 
ATOM   870  C  CG  . TYR A 1 129 ? -30.047 28.970 4.088   1.00 18.50 ? 303  TYR A CG  1 
ATOM   871  C  CD1 . TYR A 1 129 ? -30.673 28.002 3.314   1.00 17.12 ? 303  TYR A CD1 1 
ATOM   872  C  CD2 . TYR A 1 129 ? -30.758 29.509 5.162   1.00 17.00 ? 303  TYR A CD2 1 
ATOM   873  C  CE1 . TYR A 1 129 ? -31.979 27.566 3.605   1.00 18.82 ? 303  TYR A CE1 1 
ATOM   874  C  CE2 . TYR A 1 129 ? -32.073 29.087 5.462   1.00 16.79 ? 303  TYR A CE2 1 
ATOM   875  C  CZ  . TYR A 1 129 ? -32.672 28.111 4.670   1.00 17.18 ? 303  TYR A CZ  1 
ATOM   876  O  OH  . TYR A 1 129 ? -33.967 27.676 4.934   1.00 15.71 ? 303  TYR A OH  1 
ATOM   877  N  N   . PRO A 1 130 ? -27.252 32.384 2.265   1.00 24.85 ? 304  PRO A N   1 
ATOM   878  C  CA  . PRO A 1 130 ? -26.001 33.117 1.987   1.00 25.23 ? 304  PRO A CA  1 
ATOM   879  C  C   . PRO A 1 130 ? -24.756 32.818 2.836   1.00 25.89 ? 304  PRO A C   1 
ATOM   880  O  O   . PRO A 1 130 ? -23.638 33.139 2.460   1.00 27.92 ? 304  PRO A O   1 
ATOM   881  C  CB  . PRO A 1 130 ? -26.440 34.594 2.051   1.00 24.33 ? 304  PRO A CB  1 
ATOM   882  C  CG  . PRO A 1 130 ? -27.528 34.581 3.178   1.00 25.73 ? 304  PRO A CG  1 
ATOM   883  C  CD  . PRO A 1 130 ? -28.314 33.298 2.781   1.00 22.47 ? 304  PRO A CD  1 
ATOM   884  N  N   . GLY A 1 131 ? -24.952 32.179 3.993   1.00 25.79 ? 305  GLY A N   1 
ATOM   885  C  CA  . GLY A 1 131 ? -23.836 31.856 4.856   1.00 25.27 ? 305  GLY A CA  1 
ATOM   886  C  C   . GLY A 1 131 ? -23.414 32.985 5.794   1.00 26.09 ? 305  GLY A C   1 
ATOM   887  O  O   . GLY A 1 131 ? -22.242 33.113 6.142   1.00 23.95 ? 305  GLY A O   1 
ATOM   888  N  N   . ASN A 1 132 ? -24.372 33.814 6.195   1.00 24.37 ? 306  ASN A N   1 
ATOM   889  C  CA  . ASN A 1 132 ? -24.096 34.928 7.097   1.00 24.10 ? 306  ASN A CA  1 
ATOM   890  C  C   . ASN A 1 132 ? -24.609 34.609 8.496   1.00 22.97 ? 306  ASN A C   1 
ATOM   891  O  O   . ASN A 1 132 ? -24.953 35.504 9.251   1.00 24.82 ? 306  ASN A O   1 
ATOM   892  C  CB  . ASN A 1 132 ? -24.766 36.200 6.581   1.00 23.58 ? 306  ASN A CB  1 
ATOM   893  C  CG  . ASN A 1 132 ? -26.267 36.044 6.438   1.00 26.20 ? 306  ASN A CG  1 
ATOM   894  O  OD1 . ASN A 1 132 ? -26.793 34.928 6.417   1.00 22.43 ? 306  ASN A OD1 1 
ATOM   895  N  ND2 . ASN A 1 132 ? -26.965 37.167 6.321   1.00 24.23 ? 306  ASN A ND2 1 
ATOM   896  N  N   . GLY A 1 133 ? -24.662 33.325 8.835   1.00 22.25 ? 307  GLY A N   1 
ATOM   897  C  CA  . GLY A 1 133 ? -25.130 32.936 10.152  1.00 21.67 ? 307  GLY A CA  1 
ATOM   898  C  C   . GLY A 1 133 ? -26.636 32.809 10.275  1.00 21.90 ? 307  GLY A C   1 
ATOM   899  O  O   . GLY A 1 133 ? -27.149 32.560 11.352  1.00 22.11 ? 307  GLY A O   1 
ATOM   900  N  N   . THR A 1 134 ? -27.356 32.983 9.174   1.00 22.69 ? 308  THR A N   1 
ATOM   901  C  CA  . THR A 1 134 ? -28.807 32.859 9.225   1.00 21.38 ? 308  THR A CA  1 
ATOM   902  C  C   . THR A 1 134 ? -29.242 31.417 8.958   1.00 22.48 ? 308  THR A C   1 
ATOM   903  O  O   . THR A 1 134 ? -28.558 30.655 8.263   1.00 21.71 ? 308  THR A O   1 
ATOM   904  C  CB  . THR A 1 134 ? -29.491 33.786 8.194   1.00 22.24 ? 308  THR A CB  1 
ATOM   905  O  OG1 . THR A 1 134 ? -28.940 33.552 6.892   1.00 20.83 ? 308  THR A OG1 1 
ATOM   906  C  CG2 . THR A 1 134 ? -29.284 35.255 8.569   1.00 24.41 ? 308  THR A CG2 1 
ATOM   907  N  N   . GLY A 1 135 ? -30.380 31.049 9.526   1.00 20.81 ? 309  GLY A N   1 
ATOM   908  C  CA  . GLY A 1 135 ? -30.920 29.717 9.330   1.00 19.33 ? 309  GLY A CA  1 
ATOM   909  C  C   . GLY A 1 135 ? -32.412 29.851 9.075   1.00 18.79 ? 309  GLY A C   1 
ATOM   910  O  O   . GLY A 1 135 ? -32.852 30.823 8.472   1.00 18.64 ? 309  GLY A O   1 
ATOM   911  N  N   . TYR A 1 136 ? -33.192 28.879 9.529   1.00 17.61 ? 310  TYR A N   1 
ATOM   912  C  CA  . TYR A 1 136 ? -34.639 28.931 9.355   1.00 18.18 ? 310  TYR A CA  1 
ATOM   913  C  C   . TYR A 1 136 ? -35.275 28.398 10.627  1.00 18.28 ? 310  TYR A C   1 
ATOM   914  O  O   . TYR A 1 136 ? -35.029 27.263 11.013  1.00 19.39 ? 310  TYR A O   1 
ATOM   915  C  CB  . TYR A 1 136 ? -35.068 28.084 8.150   1.00 17.59 ? 310  TYR A CB  1 
ATOM   916  C  CG  . TYR A 1 136 ? -36.420 28.477 7.602   1.00 16.54 ? 310  TYR A CG  1 
ATOM   917  C  CD1 . TYR A 1 136 ? -37.599 28.111 8.251   1.00 15.37 ? 310  TYR A CD1 1 
ATOM   918  C  CD2 . TYR A 1 136 ? -36.514 29.258 6.452   1.00 17.03 ? 310  TYR A CD2 1 
ATOM   919  C  CE1 . TYR A 1 136 ? -38.848 28.519 7.760   1.00 16.23 ? 310  TYR A CE1 1 
ATOM   920  C  CE2 . TYR A 1 136 ? -37.743 29.667 5.956   1.00 17.80 ? 310  TYR A CE2 1 
ATOM   921  C  CZ  . TYR A 1 136 ? -38.908 29.297 6.612   1.00 18.44 ? 310  TYR A CZ  1 
ATOM   922  O  OH  . TYR A 1 136 ? -40.125 29.714 6.115   1.00 20.21 ? 310  TYR A OH  1 
ATOM   923  N  N   . VAL A 1 137 ? -36.081 29.233 11.276  1.00 19.91 ? 311  VAL A N   1 
ATOM   924  C  CA  . VAL A 1 137 ? -36.741 28.874 12.526  1.00 21.14 ? 311  VAL A CA  1 
ATOM   925  C  C   . VAL A 1 137 ? -37.536 27.569 12.452  1.00 21.54 ? 311  VAL A C   1 
ATOM   926  O  O   . VAL A 1 137 ? -37.936 27.134 11.374  1.00 20.09 ? 311  VAL A O   1 
ATOM   927  C  CB  . VAL A 1 137 ? -37.692 30.009 12.993  1.00 22.83 ? 311  VAL A CB  1 
ATOM   928  C  CG1 . VAL A 1 137 ? -36.928 31.326 13.067  1.00 23.23 ? 311  VAL A CG1 1 
ATOM   929  C  CG2 . VAL A 1 137 ? -38.880 30.135 12.047  1.00 21.50 ? 311  VAL A CG2 1 
ATOM   930  N  N   . ARG A 1 138 ? -37.746 26.946 13.608  1.00 21.26 ? 312  ARG A N   1 
ATOM   931  C  CA  . ARG A 1 138 ? -38.507 25.706 13.686  1.00 23.31 ? 312  ARG A CA  1 
ATOM   932  C  C   . ARG A 1 138 ? -39.887 25.955 13.078  1.00 22.59 ? 312  ARG A C   1 
ATOM   933  O  O   . ARG A 1 138 ? -40.523 26.957 13.373  1.00 20.69 ? 312  ARG A O   1 
ATOM   934  C  CB  . ARG A 1 138 ? -38.640 25.256 15.148  1.00 25.61 ? 312  ARG A CB  1 
ATOM   935  C  CG  . ARG A 1 138 ? -39.643 24.137 15.358  1.00 27.32 ? 312  ARG A CG  1 
ATOM   936  C  CD  . ARG A 1 138 ? -39.476 23.472 16.713  1.00 32.67 ? 312  ARG A CD  1 
ATOM   937  N  NE  . ARG A 1 138 ? -40.418 22.368 16.888  1.00 35.59 ? 312  ARG A NE  1 
ATOM   938  C  CZ  . ARG A 1 138 ? -40.233 21.348 17.722  1.00 35.78 ? 312  ARG A CZ  1 
ATOM   939  N  NH1 . ARG A 1 138 ? -39.134 21.285 18.461  1.00 34.33 ? 312  ARG A NH1 1 
ATOM   940  N  NH2 . ARG A 1 138 ? -41.148 20.393 17.815  1.00 35.75 ? 312  ARG A NH2 1 
ATOM   941  N  N   . HIS A 1 139 ? -40.339 25.048 12.219  1.00 22.84 ? 313  HIS A N   1 
ATOM   942  C  CA  . HIS A 1 139 ? -41.635 25.209 11.567  1.00 22.04 ? 313  HIS A CA  1 
ATOM   943  C  C   . HIS A 1 139 ? -42.154 23.895 10.996  1.00 21.58 ? 313  HIS A C   1 
ATOM   944  O  O   . HIS A 1 139 ? -41.443 22.903 10.938  1.00 21.51 ? 313  HIS A O   1 
ATOM   945  C  CB  . HIS A 1 139 ? -41.521 26.203 10.407  1.00 21.48 ? 313  HIS A CB  1 
ATOM   946  C  CG  . HIS A 1 139 ? -40.730 25.676 9.249   1.00 22.58 ? 313  HIS A CG  1 
ATOM   947  N  ND1 . HIS A 1 139 ? -39.376 25.427 9.322   1.00 22.38 ? 313  HIS A ND1 1 
ATOM   948  C  CD2 . HIS A 1 139 ? -41.114 25.299 8.005   1.00 22.46 ? 313  HIS A CD2 1 
ATOM   949  C  CE1 . HIS A 1 139 ? -38.960 24.919 8.175   1.00 22.81 ? 313  HIS A CE1 1 
ATOM   950  N  NE2 . HIS A 1 139 ? -39.994 24.831 7.360   1.00 23.23 ? 313  HIS A NE2 1 
ATOM   951  N  N   . VAL A 1 140 ? -43.414 23.920 10.581  1.00 21.05 ? 314  VAL A N   1 
ATOM   952  C  CA  . VAL A 1 140 ? -44.058 22.784 9.945   1.00 19.71 ? 314  VAL A CA  1 
ATOM   953  C  C   . VAL A 1 140 ? -44.410 23.302 8.548   1.00 17.57 ? 314  VAL A C   1 
ATOM   954  O  O   . VAL A 1 140 ? -44.995 24.365 8.425   1.00 17.31 ? 314  VAL A O   1 
ATOM   955  C  CB  . VAL A 1 140 ? -45.343 22.367 10.698  1.00 20.31 ? 314  VAL A CB  1 
ATOM   956  C  CG1 . VAL A 1 140 ? -46.150 21.383 9.849   1.00 18.20 ? 314  VAL A CG1 1 
ATOM   957  C  CG2 . VAL A 1 140 ? -44.971 21.724 12.026  1.00 17.71 ? 314  VAL A CG2 1 
ATOM   958  N  N   . ASP A 1 141 ? -44.027 22.567 7.504   1.00 16.38 ? 315  ASP A N   1 
ATOM   959  C  CA  . ASP A 1 141 ? -44.302 22.991 6.133   1.00 17.85 ? 315  ASP A CA  1 
ATOM   960  C  C   . ASP A 1 141 ? -45.788 23.191 5.861   1.00 18.55 ? 315  ASP A C   1 
ATOM   961  O  O   . ASP A 1 141 ? -46.179 24.209 5.312   1.00 16.65 ? 315  ASP A O   1 
ATOM   962  C  CB  . ASP A 1 141 ? -43.736 21.983 5.117   1.00 17.59 ? 315  ASP A CB  1 
ATOM   963  C  CG  . ASP A 1 141 ? -42.231 22.112 4.931   1.00 17.56 ? 315  ASP A CG  1 
ATOM   964  O  OD1 . ASP A 1 141 ? -41.620 23.028 5.527   1.00 13.19 ? 315  ASP A OD1 1 
ATOM   965  O  OD2 . ASP A 1 141 ? -41.664 21.291 4.181   1.00 16.03 ? 315  ASP A OD2 1 
ATOM   966  N  N   . ASN A 1 142 ? -46.608 22.212 6.239   1.00 17.91 ? 316  ASN A N   1 
ATOM   967  C  CA  . ASN A 1 142 ? -48.057 22.289 6.025   1.00 21.29 ? 316  ASN A CA  1 
ATOM   968  C  C   . ASN A 1 142 ? -48.808 21.958 7.310   1.00 22.38 ? 316  ASN A C   1 
ATOM   969  O  O   . ASN A 1 142 ? -49.169 20.811 7.554   1.00 23.18 ? 316  ASN A O   1 
ATOM   970  C  CB  . ASN A 1 142 ? -48.493 21.326 4.902   1.00 19.01 ? 316  ASN A CB  1 
ATOM   971  C  CG  . ASN A 1 142 ? -50.018 21.193 4.785   1.00 21.92 ? 316  ASN A CG  1 
ATOM   972  O  OD1 . ASN A 1 142 ? -50.766 22.120 5.110   1.00 20.40 ? 316  ASN A OD1 1 
ATOM   973  N  ND2 . ASN A 1 142 ? -50.477 20.037 4.299   1.00 17.61 ? 316  ASN A ND2 1 
ATOM   974  N  N   . PRO A 1 143 ? -49.045 22.974 8.151   1.00 23.46 ? 317  PRO A N   1 
ATOM   975  C  CA  . PRO A 1 143 ? -49.752 22.793 9.419   1.00 25.00 ? 317  PRO A CA  1 
ATOM   976  C  C   . PRO A 1 143 ? -51.271 22.967 9.330   1.00 26.30 ? 317  PRO A C   1 
ATOM   977  O  O   . PRO A 1 143 ? -51.992 22.515 10.208  1.00 27.50 ? 317  PRO A O   1 
ATOM   978  C  CB  . PRO A 1 143 ? -49.113 23.857 10.302  1.00 24.13 ? 317  PRO A CB  1 
ATOM   979  C  CG  . PRO A 1 143 ? -48.978 25.001 9.340   1.00 24.32 ? 317  PRO A CG  1 
ATOM   980  C  CD  . PRO A 1 143 ? -48.442 24.321 8.078   1.00 22.96 ? 317  PRO A CD  1 
ATOM   981  N  N   . ASN A 1 144 ? -51.743 23.611 8.266   1.00 27.21 ? 318  ASN A N   1 
ATOM   982  C  CA  . ASN A 1 144 ? -53.172 23.883 8.092   1.00 29.73 ? 318  ASN A CA  1 
ATOM   983  C  C   . ASN A 1 144 ? -53.884 23.076 7.006   1.00 29.23 ? 318  ASN A C   1 
ATOM   984  O  O   . ASN A 1 144 ? -54.896 23.522 6.465   1.00 29.92 ? 318  ASN A O   1 
ATOM   985  C  CB  . ASN A 1 144 ? -53.370 25.372 7.799   1.00 32.22 ? 318  ASN A CB  1 
ATOM   986  C  CG  . ASN A 1 144 ? -52.862 26.261 8.913   1.00 35.94 ? 318  ASN A CG  1 
ATOM   987  O  OD1 . ASN A 1 144 ? -52.572 27.434 8.695   1.00 40.25 ? 318  ASN A OD1 1 
ATOM   988  N  ND2 . ASN A 1 144 ? -52.764 25.710 10.120  1.00 35.73 ? 318  ASN A ND2 1 
ATOM   989  N  N   . GLY A 1 145 ? -53.350 21.904 6.683   1.00 27.57 ? 319  GLY A N   1 
ATOM   990  C  CA  . GLY A 1 145 ? -53.954 21.055 5.672   1.00 25.00 ? 319  GLY A CA  1 
ATOM   991  C  C   . GLY A 1 145 ? -54.181 21.721 4.332   1.00 24.87 ? 319  GLY A C   1 
ATOM   992  O  O   . GLY A 1 145 ? -55.309 21.766 3.858   1.00 25.63 ? 319  GLY A O   1 
ATOM   993  N  N   . ASP A 1 146 ? -53.119 22.223 3.706   1.00 22.07 ? 320  ASP A N   1 
ATOM   994  C  CA  . ASP A 1 146 ? -53.265 22.884 2.418   1.00 20.78 ? 320  ASP A CA  1 
ATOM   995  C  C   . ASP A 1 146 ? -53.076 21.956 1.228   1.00 21.50 ? 320  ASP A C   1 
ATOM   996  O  O   . ASP A 1 146 ? -52.973 22.415 0.095   1.00 21.74 ? 320  ASP A O   1 
ATOM   997  C  CB  . ASP A 1 146 ? -52.306 24.076 2.318   1.00 22.14 ? 320  ASP A CB  1 
ATOM   998  C  CG  . ASP A 1 146 ? -50.839 23.669 2.334   1.00 21.67 ? 320  ASP A CG  1 
ATOM   999  O  OD1 . ASP A 1 146 ? -50.500 22.512 1.992   1.00 17.94 ? 320  ASP A OD1 1 
ATOM   1000 O  OD2 . ASP A 1 146 ? -50.016 24.536 2.686   1.00 24.29 ? 320  ASP A OD2 1 
ATOM   1001 N  N   . GLY A 1 147 ? -53.026 20.653 1.492   1.00 20.25 ? 321  GLY A N   1 
ATOM   1002 C  CA  . GLY A 1 147 ? -52.871 19.688 0.419   1.00 21.75 ? 321  GLY A CA  1 
ATOM   1003 C  C   . GLY A 1 147 ? -51.508 19.023 0.323   1.00 20.84 ? 321  GLY A C   1 
ATOM   1004 O  O   . GLY A 1 147 ? -51.404 17.887 -0.129  1.00 20.73 ? 321  GLY A O   1 
ATOM   1005 N  N   . ARG A 1 148 ? -50.464 19.724 0.751   1.00 21.41 ? 322  ARG A N   1 
ATOM   1006 C  CA  . ARG A 1 148 ? -49.105 19.185 0.689   1.00 22.22 ? 322  ARG A CA  1 
ATOM   1007 C  C   . ARG A 1 148 ? -48.873 18.063 1.695   1.00 22.42 ? 322  ARG A C   1 
ATOM   1008 O  O   . ARG A 1 148 ? -48.943 18.282 2.907   1.00 21.21 ? 322  ARG A O   1 
ATOM   1009 C  CB  . ARG A 1 148 ? -48.093 20.318 0.902   1.00 21.76 ? 322  ARG A CB  1 
ATOM   1010 C  CG  . ARG A 1 148 ? -48.071 21.318 -0.242  1.00 21.15 ? 322  ARG A CG  1 
ATOM   1011 C  CD  . ARG A 1 148 ? -47.095 22.457 0.015   1.00 21.64 ? 322  ARG A CD  1 
ATOM   1012 N  NE  . ARG A 1 148 ? -47.578 23.372 1.041   1.00 21.27 ? 322  ARG A NE  1 
ATOM   1013 C  CZ  . ARG A 1 148 ? -46.792 24.178 1.744   1.00 24.27 ? 322  ARG A CZ  1 
ATOM   1014 N  NH1 . ARG A 1 148 ? -45.481 24.175 1.531   1.00 22.03 ? 322  ARG A NH1 1 
ATOM   1015 N  NH2 . ARG A 1 148 ? -47.312 24.985 2.661   1.00 22.16 ? 322  ARG A NH2 1 
ATOM   1016 N  N   . CYS A 1 149 ? -48.595 16.859 1.188   1.00 21.20 ? 323  CYS A N   1 
ATOM   1017 C  CA  . CYS A 1 149 ? -48.365 15.706 2.056   1.00 20.23 ? 323  CYS A CA  1 
ATOM   1018 C  C   . CYS A 1 149 ? -46.911 15.255 2.122   1.00 18.68 ? 323  CYS A C   1 
ATOM   1019 O  O   . CYS A 1 149 ? -46.493 14.692 3.120   1.00 17.53 ? 323  CYS A O   1 
ATOM   1020 C  CB  . CYS A 1 149 ? -49.241 14.517 1.628   1.00 19.89 ? 323  CYS A CB  1 
ATOM   1021 S  SG  . CYS A 1 149 ? -48.855 13.838 -0.007  1.00 23.69 ? 323  CYS A SG  1 
ATOM   1022 N  N   . VAL A 1 150 ? -46.140 15.493 1.065   1.00 19.44 ? 324  VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 150 ? -44.731 15.085 1.070   1.00 19.34 ? 324  VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 150 ? -43.784 16.207 0.653   1.00 17.29 ? 324  VAL A C   1 
ATOM   1025 O  O   . VAL A 1 150 ? -44.018 16.878 -0.345  1.00 17.50 ? 324  VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 150 ? -44.483 13.871 0.127   1.00 19.78 ? 324  VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 150 ? -42.986 13.590 0.029   1.00 18.85 ? 324  VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 150 ? -45.214 12.632 0.651   1.00 19.31 ? 324  VAL A CG2 1 
ATOM   1029 N  N   . THR A 1 151 ? -42.721 16.405 1.432   1.00 16.36 ? 325  THR A N   1 
ATOM   1030 C  CA  . THR A 1 151 ? -41.717 17.426 1.129   1.00 15.85 ? 325  THR A CA  1 
ATOM   1031 C  C   . THR A 1 151 ? -40.497 16.711 0.545   1.00 15.14 ? 325  THR A C   1 
ATOM   1032 O  O   . THR A 1 151 ? -40.011 15.754 1.128   1.00 16.07 ? 325  THR A O   1 
ATOM   1033 C  CB  . THR A 1 151 ? -41.246 18.195 2.391   1.00 15.33 ? 325  THR A CB  1 
ATOM   1034 O  OG1 . THR A 1 151 ? -42.345 18.917 2.966   1.00 15.98 ? 325  THR A OG1 1 
ATOM   1035 C  CG2 . THR A 1 151 ? -40.130 19.183 2.021   1.00 12.37 ? 325  THR A CG2 1 
ATOM   1036 N  N   . CYS A 1 152 ? -40.016 17.187 -0.601  1.00 15.42 ? 326  CYS A N   1 
ATOM   1037 C  CA  . CYS A 1 152 ? -38.852 16.594 -1.255  1.00 16.59 ? 326  CYS A CA  1 
ATOM   1038 C  C   . CYS A 1 152 ? -37.737 17.631 -1.425  1.00 15.41 ? 326  CYS A C   1 
ATOM   1039 O  O   . CYS A 1 152 ? -37.922 18.657 -2.085  1.00 18.28 ? 326  CYS A O   1 
ATOM   1040 C  CB  . CYS A 1 152 ? -39.262 16.023 -2.621  1.00 18.47 ? 326  CYS A CB  1 
ATOM   1041 S  SG  . CYS A 1 152 ? -37.930 15.274 -3.583  0.50 16.04 ? 326  CYS A SG  1 
ATOM   1042 N  N   . ILE A 1 153 ? -36.578 17.363 -0.829  1.00 15.32 ? 327  ILE A N   1 
ATOM   1043 C  CA  . ILE A 1 153 ? -35.455 18.291 -0.928  1.00 15.71 ? 327  ILE A CA  1 
ATOM   1044 C  C   . ILE A 1 153 ? -34.200 17.650 -1.530  1.00 15.05 ? 327  ILE A C   1 
ATOM   1045 O  O   . ILE A 1 153 ? -33.811 16.552 -1.150  1.00 16.75 ? 327  ILE A O   1 
ATOM   1046 C  CB  . ILE A 1 153 ? -35.078 18.866 0.463   1.00 15.29 ? 327  ILE A CB  1 
ATOM   1047 C  CG1 . ILE A 1 153 ? -36.324 19.464 1.135   1.00 15.73 ? 327  ILE A CG1 1 
ATOM   1048 C  CG2 . ILE A 1 153 ? -33.979 19.927 0.310   1.00 14.10 ? 327  ILE A CG2 1 
ATOM   1049 C  CD1 . ILE A 1 153 ? -36.052 20.148 2.502   1.00 14.81 ? 327  ILE A CD1 1 
ATOM   1050 N  N   . TYR A 1 154 ? -33.580 18.349 -2.472  1.00 15.26 ? 328  TYR A N   1 
ATOM   1051 C  CA  . TYR A 1 154 ? -32.348 17.880 -3.104  1.00 16.83 ? 328  TYR A CA  1 
ATOM   1052 C  C   . TYR A 1 154 ? -31.235 18.897 -2.795  1.00 18.11 ? 328  TYR A C   1 
ATOM   1053 O  O   . TYR A 1 154 ? -31.392 20.098 -3.064  1.00 19.60 ? 328  TYR A O   1 
ATOM   1054 C  CB  . TYR A 1 154 ? -32.556 17.748 -4.620  1.00 18.23 ? 328  TYR A CB  1 
ATOM   1055 C  CG  . TYR A 1 154 ? -31.327 17.307 -5.388  1.00 17.47 ? 328  TYR A CG  1 
ATOM   1056 C  CD1 . TYR A 1 154 ? -30.866 15.996 -5.308  1.00 20.34 ? 328  TYR A CD1 1 
ATOM   1057 C  CD2 . TYR A 1 154 ? -30.627 18.202 -6.196  1.00 20.86 ? 328  TYR A CD2 1 
ATOM   1058 C  CE1 . TYR A 1 154 ? -29.737 15.581 -6.020  1.00 21.16 ? 328  TYR A CE1 1 
ATOM   1059 C  CE2 . TYR A 1 154 ? -29.497 17.796 -6.917  1.00 20.57 ? 328  TYR A CE2 1 
ATOM   1060 C  CZ  . TYR A 1 154 ? -29.064 16.482 -6.821  1.00 20.82 ? 328  TYR A CZ  1 
ATOM   1061 O  OH  . TYR A 1 154 ? -27.969 16.066 -7.544  1.00 23.28 ? 328  TYR A OH  1 
ATOM   1062 N  N   . TYR A 1 155 ? -30.127 18.425 -2.221  1.00 18.40 ? 329  TYR A N   1 
ATOM   1063 C  CA  . TYR A 1 155 ? -29.004 19.303 -1.875  1.00 21.89 ? 329  TYR A CA  1 
ATOM   1064 C  C   . TYR A 1 155 ? -27.859 19.246 -2.880  1.00 23.16 ? 329  TYR A C   1 
ATOM   1065 O  O   . TYR A 1 155 ? -27.583 18.200 -3.454  1.00 23.88 ? 329  TYR A O   1 
ATOM   1066 C  CB  . TYR A 1 155 ? -28.473 18.965 -0.481  1.00 20.29 ? 329  TYR A CB  1 
ATOM   1067 C  CG  . TYR A 1 155 ? -29.529 19.015 0.591   1.00 20.99 ? 329  TYR A CG  1 
ATOM   1068 C  CD1 . TYR A 1 155 ? -29.904 20.226 1.165   1.00 19.09 ? 329  TYR A CD1 1 
ATOM   1069 C  CD2 . TYR A 1 155 ? -30.165 17.853 1.027   1.00 20.94 ? 329  TYR A CD2 1 
ATOM   1070 C  CE1 . TYR A 1 155 ? -30.879 20.286 2.148   1.00 18.87 ? 329  TYR A CE1 1 
ATOM   1071 C  CE2 . TYR A 1 155 ? -31.155 17.900 2.021   1.00 19.95 ? 329  TYR A CE2 1 
ATOM   1072 C  CZ  . TYR A 1 155 ? -31.503 19.126 2.574   1.00 20.29 ? 329  TYR A CZ  1 
ATOM   1073 O  OH  . TYR A 1 155 ? -32.478 19.196 3.547   1.00 18.70 ? 329  TYR A OH  1 
ATOM   1074 N  N   . LEU A 1 156 ? -27.178 20.375 -3.063  1.00 25.41 ? 330  LEU A N   1 
ATOM   1075 C  CA  . LEU A 1 156 ? -26.082 20.470 -4.026  1.00 29.25 ? 330  LEU A CA  1 
ATOM   1076 C  C   . LEU A 1 156 ? -24.796 21.015 -3.410  1.00 28.02 ? 330  LEU A C   1 
ATOM   1077 O  O   . LEU A 1 156 ? -24.028 21.692 -4.085  1.00 28.59 ? 330  LEU A O   1 
ATOM   1078 C  CB  . LEU A 1 156 ? -26.481 21.400 -5.180  1.00 32.13 ? 330  LEU A CB  1 
ATOM   1079 C  CG  . LEU A 1 156 ? -27.866 21.344 -5.823  1.00 35.02 ? 330  LEU A CG  1 
ATOM   1080 C  CD1 . LEU A 1 156 ? -28.923 21.799 -4.845  1.00 35.97 ? 330  LEU A CD1 1 
ATOM   1081 C  CD2 . LEU A 1 156 ? -27.880 22.259 -7.033  1.00 39.12 ? 330  LEU A CD2 1 
ATOM   1082 N  N   . ASN A 1 157 ? -24.544 20.705 -2.147  1.00 26.87 ? 331  ASN A N   1 
ATOM   1083 C  CA  . ASN A 1 157 ? -23.362 21.235 -1.478  1.00 28.31 ? 331  ASN A CA  1 
ATOM   1084 C  C   . ASN A 1 157 ? -22.201 20.252 -1.331  1.00 29.27 ? 331  ASN A C   1 
ATOM   1085 O  O   . ASN A 1 157 ? -22.179 19.425 -0.425  1.00 29.02 ? 331  ASN A O   1 
ATOM   1086 C  CB  . ASN A 1 157 ? -23.789 21.782 -0.116  1.00 25.66 ? 331  ASN A CB  1 
ATOM   1087 C  CG  . ASN A 1 157 ? -25.024 22.668 -0.219  1.00 24.87 ? 331  ASN A CG  1 
ATOM   1088 O  OD1 . ASN A 1 157 ? -24.976 23.749 -0.807  1.00 23.48 ? 331  ASN A OD1 1 
ATOM   1089 N  ND2 . ASN A 1 157 ? -26.140 22.200 0.329   1.00 20.22 ? 331  ASN A ND2 1 
ATOM   1090 N  N   . LYS A 1 158 ? -21.232 20.366 -2.234  1.00 33.32 ? 332  LYS A N   1 
ATOM   1091 C  CA  . LYS A 1 158 ? -20.053 19.502 -2.226  1.00 36.69 ? 332  LYS A CA  1 
ATOM   1092 C  C   . LYS A 1 158 ? -19.178 19.698 -0.999  1.00 38.44 ? 332  LYS A C   1 
ATOM   1093 O  O   . LYS A 1 158 ? -19.013 20.813 -0.507  1.00 38.28 ? 332  LYS A O   1 
ATOM   1094 C  CB  . LYS A 1 158 ? -19.196 19.751 -3.469  1.00 38.58 ? 332  LYS A CB  1 
ATOM   1095 C  CG  . LYS A 1 158 ? -19.653 19.036 -4.727  1.00 43.08 ? 332  LYS A CG  1 
ATOM   1096 C  CD  . LYS A 1 158 ? -18.609 19.183 -5.830  1.00 46.59 ? 332  LYS A CD  1 
ATOM   1097 C  CE  . LYS A 1 158 ? -18.946 18.333 -7.050  1.00 49.00 ? 332  LYS A CE  1 
ATOM   1098 N  NZ  . LYS A 1 158 ? -17.959 18.527 -8.152  1.00 50.78 ? 332  LYS A NZ  1 
ATOM   1099 N  N   . ASP A 1 159 ? -18.616 18.598 -0.511  1.00 40.29 ? 333  ASP A N   1 
ATOM   1100 C  CA  . ASP A 1 159 ? -17.725 18.636 0.639   1.00 41.24 ? 333  ASP A CA  1 
ATOM   1101 C  C   . ASP A 1 159 ? -18.277 19.498 1.773   1.00 41.77 ? 333  ASP A C   1 
ATOM   1102 O  O   . ASP A 1 159 ? -17.546 20.287 2.369   1.00 41.48 ? 333  ASP A O   1 
ATOM   1103 C  CB  . ASP A 1 159 ? -16.364 19.181 0.197   1.00 43.04 ? 333  ASP A CB  1 
ATOM   1104 C  CG  . ASP A 1 159 ? -15.807 18.453 -1.017  1.00 44.38 ? 333  ASP A CG  1 
ATOM   1105 O  OD1 . ASP A 1 159 ? -16.148 17.269 -1.223  1.00 44.46 ? 333  ASP A OD1 1 
ATOM   1106 O  OD2 . ASP A 1 159 ? -15.018 19.067 -1.766  1.00 45.92 ? 333  ASP A OD2 1 
ATOM   1107 N  N   . TRP A 1 160 ? -19.564 19.351 2.073   1.00 40.65 ? 334  TRP A N   1 
ATOM   1108 C  CA  . TRP A 1 160 ? -20.167 20.137 3.139   1.00 39.35 ? 334  TRP A CA  1 
ATOM   1109 C  C   . TRP A 1 160 ? -19.905 19.511 4.501   1.00 41.30 ? 334  TRP A C   1 
ATOM   1110 O  O   . TRP A 1 160 ? -20.253 18.359 4.740   1.00 42.20 ? 334  TRP A O   1 
ATOM   1111 C  CB  . TRP A 1 160 ? -21.678 20.284 2.921   1.00 34.56 ? 334  TRP A CB  1 
ATOM   1112 C  CG  . TRP A 1 160 ? -22.340 21.147 3.959   1.00 29.32 ? 334  TRP A CG  1 
ATOM   1113 C  CD1 . TRP A 1 160 ? -22.727 20.771 5.212   1.00 26.29 ? 334  TRP A CD1 1 
ATOM   1114 C  CD2 . TRP A 1 160 ? -22.623 22.550 3.855   1.00 26.21 ? 334  TRP A CD2 1 
ATOM   1115 N  NE1 . TRP A 1 160 ? -23.231 21.852 5.897   1.00 26.51 ? 334  TRP A NE1 1 
ATOM   1116 C  CE2 . TRP A 1 160 ? -23.180 22.956 5.087   1.00 24.67 ? 334  TRP A CE2 1 
ATOM   1117 C  CE3 . TRP A 1 160 ? -22.456 23.503 2.840   1.00 25.13 ? 334  TRP A CE3 1 
ATOM   1118 C  CZ2 . TRP A 1 160 ? -23.574 24.278 5.335   1.00 24.11 ? 334  TRP A CZ2 1 
ATOM   1119 C  CZ3 . TRP A 1 160 ? -22.848 24.819 3.085   1.00 24.65 ? 334  TRP A CZ3 1 
ATOM   1120 C  CH2 . TRP A 1 160 ? -23.400 25.193 4.326   1.00 23.20 ? 334  TRP A CH2 1 
ATOM   1121 N  N   . ASP A 1 161 ? -19.289 20.282 5.392   1.00 41.60 ? 335  ASP A N   1 
ATOM   1122 C  CA  . ASP A 1 161 ? -18.986 19.801 6.733   1.00 43.24 ? 335  ASP A CA  1 
ATOM   1123 C  C   . ASP A 1 161 ? -19.712 20.666 7.756   1.00 42.90 ? 335  ASP A C   1 
ATOM   1124 O  O   . ASP A 1 161 ? -19.337 21.808 8.002   1.00 42.74 ? 335  ASP A O   1 
ATOM   1125 C  CB  . ASP A 1 161 ? -17.470 19.829 6.975   1.00 45.81 ? 335  ASP A CB  1 
ATOM   1126 C  CG  . ASP A 1 161 ? -17.078 19.222 8.312   1.00 47.82 ? 335  ASP A CG  1 
ATOM   1127 O  OD1 . ASP A 1 161 ? -17.620 18.155 8.671   1.00 49.72 ? 335  ASP A OD1 1 
ATOM   1128 O  OD2 . ASP A 1 161 ? -16.218 19.809 8.998   1.00 49.93 ? 335  ASP A OD2 1 
ATOM   1129 N  N   . ALA A 1 162 ? -20.764 20.100 8.339   1.00 42.37 ? 336  ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 162 ? -21.588 20.787 9.325   1.00 42.37 ? 336  ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 162 ? -20.800 21.271 10.531  1.00 43.08 ? 336  ALA A C   1 
ATOM   1132 O  O   . ALA A 1 162 ? -21.114 22.307 11.107  1.00 41.68 ? 336  ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 162 ? -22.707 19.870 9.780   1.00 42.63 ? 336  ALA A CB  1 
ATOM   1134 N  N   . LYS A 1 163 ? -19.782 20.507 10.915  1.00 44.39 ? 337  LYS A N   1 
ATOM   1135 C  CA  . LYS A 1 163 ? -18.954 20.859 12.061  1.00 44.08 ? 337  LYS A CA  1 
ATOM   1136 C  C   . LYS A 1 163 ? -18.266 22.193 11.811  1.00 42.71 ? 337  LYS A C   1 
ATOM   1137 O  O   . LYS A 1 163 ? -17.844 22.875 12.741  1.00 44.42 ? 337  LYS A O   1 
ATOM   1138 C  CB  . LYS A 1 163 ? -17.905 19.768 12.304  1.00 45.13 ? 337  LYS A CB  1 
ATOM   1139 N  N   . VAL A 1 164 ? -18.175 22.565 10.541  1.00 41.58 ? 338  VAL A N   1 
ATOM   1140 C  CA  . VAL A 1 164 ? -17.526 23.808 10.154  1.00 40.65 ? 338  VAL A CA  1 
ATOM   1141 C  C   . VAL A 1 164 ? -18.466 24.862 9.571   1.00 39.58 ? 338  VAL A C   1 
ATOM   1142 O  O   . VAL A 1 164 ? -18.352 26.039 9.895   1.00 40.80 ? 338  VAL A O   1 
ATOM   1143 C  CB  . VAL A 1 164 ? -16.409 23.529 9.128   1.00 41.82 ? 338  VAL A CB  1 
ATOM   1144 C  CG1 . VAL A 1 164 ? -15.790 24.830 8.658   1.00 41.34 ? 338  VAL A CG1 1 
ATOM   1145 C  CG2 . VAL A 1 164 ? -15.356 22.633 9.753   1.00 42.22 ? 338  VAL A CG2 1 
ATOM   1146 N  N   . SER A 1 165 ? -19.393 24.444 8.715   1.00 36.68 ? 339  SER A N   1 
ATOM   1147 C  CA  . SER A 1 165 ? -20.304 25.393 8.084   1.00 34.30 ? 339  SER A CA  1 
ATOM   1148 C  C   . SER A 1 165 ? -21.714 25.424 8.665   1.00 31.79 ? 339  SER A C   1 
ATOM   1149 O  O   . SER A 1 165 ? -22.504 26.297 8.321   1.00 30.15 ? 339  SER A O   1 
ATOM   1150 C  CB  . SER A 1 165 ? -20.382 25.105 6.585   1.00 34.64 ? 339  SER A CB  1 
ATOM   1151 O  OG  . SER A 1 165 ? -19.092 25.108 6.000   1.00 35.13 ? 339  SER A OG  1 
ATOM   1152 N  N   . GLY A 1 166 ? -22.020 24.478 9.546   1.00 30.26 ? 340  GLY A N   1 
ATOM   1153 C  CA  . GLY A 1 166 ? -23.346 24.420 10.134  1.00 29.51 ? 340  GLY A CA  1 
ATOM   1154 C  C   . GLY A 1 166 ? -24.365 24.069 9.064   1.00 28.58 ? 340  GLY A C   1 
ATOM   1155 O  O   . GLY A 1 166 ? -24.135 23.167 8.265   1.00 27.47 ? 340  GLY A O   1 
ATOM   1156 N  N   . GLY A 1 167 ? -25.489 24.782 9.052   1.00 27.70 ? 341  GLY A N   1 
ATOM   1157 C  CA  . GLY A 1 167 ? -26.521 24.543 8.056   1.00 25.94 ? 341  GLY A CA  1 
ATOM   1158 C  C   . GLY A 1 167 ? -27.179 23.176 8.117   1.00 25.45 ? 341  GLY A C   1 
ATOM   1159 O  O   . GLY A 1 167 ? -27.674 22.678 7.117   1.00 23.35 ? 341  GLY A O   1 
ATOM   1160 N  N   . ILE A 1 168 ? -27.187 22.571 9.297   1.00 25.38 ? 342  ILE A N   1 
ATOM   1161 C  CA  . ILE A 1 168 ? -27.796 21.262 9.472   1.00 24.98 ? 342  ILE A CA  1 
ATOM   1162 C  C   . ILE A 1 168 ? -29.318 21.353 9.502   1.00 24.38 ? 342  ILE A C   1 
ATOM   1163 O  O   . ILE A 1 168 ? -29.879 22.309 10.023  1.00 22.33 ? 342  ILE A O   1 
ATOM   1164 C  CB  . ILE A 1 168 ? -27.324 20.605 10.789  1.00 28.26 ? 342  ILE A CB  1 
ATOM   1165 C  CG1 . ILE A 1 168 ? -25.849 20.216 10.671  1.00 30.66 ? 342  ILE A CG1 1 
ATOM   1166 C  CG2 . ILE A 1 168 ? -28.178 19.382 11.113  1.00 27.56 ? 342  ILE A CG2 1 
ATOM   1167 C  CD1 . ILE A 1 168 ? -25.271 19.615 11.933  1.00 34.81 ? 342  ILE A CD1 1 
ATOM   1168 N  N   . LEU A 1 169 ? -29.977 20.360 8.912   1.00 21.87 ? 343  LEU A N   1 
ATOM   1169 C  CA  . LEU A 1 169 ? -31.428 20.301 8.929   1.00 21.21 ? 343  LEU A CA  1 
ATOM   1170 C  C   . LEU A 1 169 ? -31.799 19.409 10.113  1.00 20.30 ? 343  LEU A C   1 
ATOM   1171 O  O   . LEU A 1 169 ? -31.459 18.232 10.135  1.00 21.73 ? 343  LEU A O   1 
ATOM   1172 C  CB  . LEU A 1 169 ? -31.975 19.679 7.634   1.00 22.05 ? 343  LEU A CB  1 
ATOM   1173 C  CG  . LEU A 1 169 ? -33.444 19.233 7.697   1.00 20.34 ? 343  LEU A CG  1 
ATOM   1174 C  CD1 . LEU A 1 169 ? -34.334 20.428 8.014   1.00 18.35 ? 343  LEU A CD1 1 
ATOM   1175 C  CD2 . LEU A 1 169 ? -33.860 18.598 6.370   1.00 23.28 ? 343  LEU A CD2 1 
ATOM   1176 N  N   . ARG A 1 170 ? -32.480 19.972 11.103  1.00 21.63 ? 344  ARG A N   1 
ATOM   1177 C  CA  . ARG A 1 170 ? -32.874 19.191 12.266  1.00 23.52 ? 344  ARG A CA  1 
ATOM   1178 C  C   . ARG A 1 170 ? -34.386 19.000 12.284  1.00 23.83 ? 344  ARG A C   1 
ATOM   1179 O  O   . ARG A 1 170 ? -35.140 19.962 12.312  1.00 23.25 ? 344  ARG A O   1 
ATOM   1180 C  CB  . ARG A 1 170 ? -32.403 19.877 13.555  1.00 22.92 ? 344  ARG A CB  1 
ATOM   1181 C  CG  . ARG A 1 170 ? -32.795 19.139 14.821  1.00 21.65 ? 344  ARG A CG  1 
ATOM   1182 C  CD  . ARG A 1 170 ? -32.045 19.680 16.034  1.00 24.73 ? 344  ARG A CD  1 
ATOM   1183 N  NE  . ARG A 1 170 ? -30.614 19.398 15.974  1.00 26.98 ? 344  ARG A NE  1 
ATOM   1184 C  CZ  . ARG A 1 170 ? -29.731 19.811 16.884  1.00 30.84 ? 344  ARG A CZ  1 
ATOM   1185 N  NH1 . ARG A 1 170 ? -30.129 20.528 17.931  1.00 26.95 ? 344  ARG A NH1 1 
ATOM   1186 N  NH2 . ARG A 1 170 ? -28.447 19.504 16.747  1.00 30.30 ? 344  ARG A NH2 1 
ATOM   1187 N  N   . ILE A 1 171 ? -34.812 17.742 12.254  1.00 25.77 ? 345  ILE A N   1 
ATOM   1188 C  CA  . ILE A 1 171 ? -36.229 17.404 12.256  1.00 29.42 ? 345  ILE A CA  1 
ATOM   1189 C  C   . ILE A 1 171 ? -36.590 16.744 13.579  1.00 31.08 ? 345  ILE A C   1 
ATOM   1190 O  O   . ILE A 1 171 ? -35.830 15.934 14.092  1.00 32.59 ? 345  ILE A O   1 
ATOM   1191 C  CB  . ILE A 1 171 ? -36.568 16.427 11.109  1.00 29.33 ? 345  ILE A CB  1 
ATOM   1192 C  CG1 . ILE A 1 171 ? -36.051 16.987 9.782   1.00 31.40 ? 345  ILE A CG1 1 
ATOM   1193 C  CG2 . ILE A 1 171 ? -38.078 16.199 11.044  1.00 30.05 ? 345  ILE A CG2 1 
ATOM   1194 C  CD1 . ILE A 1 171 ? -36.348 16.099 8.576   1.00 32.49 ? 345  ILE A CD1 1 
ATOM   1195 N  N   . PHE A 1 172 ? -37.750 17.091 14.126  1.00 32.47 ? 346  PHE A N   1 
ATOM   1196 C  CA  . PHE A 1 172 ? -38.182 16.516 15.393  1.00 34.88 ? 346  PHE A CA  1 
ATOM   1197 C  C   . PHE A 1 172 ? -39.407 15.630 15.211  1.00 37.47 ? 346  PHE A C   1 
ATOM   1198 O  O   . PHE A 1 172 ? -40.534 16.088 15.382  1.00 38.50 ? 346  PHE A O   1 
ATOM   1199 C  CB  . PHE A 1 172 ? -38.513 17.621 16.403  1.00 33.54 ? 346  PHE A CB  1 
ATOM   1200 C  CG  . PHE A 1 172 ? -37.419 18.637 16.582  1.00 33.33 ? 346  PHE A CG  1 
ATOM   1201 C  CD1 . PHE A 1 172 ? -37.248 19.667 15.664  1.00 31.47 ? 346  PHE A CD1 1 
ATOM   1202 C  CD2 . PHE A 1 172 ? -36.562 18.568 17.679  1.00 31.64 ? 346  PHE A CD2 1 
ATOM   1203 C  CE1 . PHE A 1 172 ? -36.240 20.619 15.835  1.00 31.10 ? 346  PHE A CE1 1 
ATOM   1204 C  CE2 . PHE A 1 172 ? -35.556 19.508 17.858  1.00 30.41 ? 346  PHE A CE2 1 
ATOM   1205 C  CZ  . PHE A 1 172 ? -35.392 20.538 16.936  1.00 31.11 ? 346  PHE A CZ  1 
ATOM   1206 N  N   . PRO A 1 173 ? -39.201 14.348 14.855  1.00 40.87 ? 347  PRO A N   1 
ATOM   1207 C  CA  . PRO A 1 173 ? -40.314 13.411 14.657  1.00 43.66 ? 347  PRO A CA  1 
ATOM   1208 C  C   . PRO A 1 173 ? -41.404 13.592 15.714  1.00 46.37 ? 347  PRO A C   1 
ATOM   1209 O  O   . PRO A 1 173 ? -41.130 13.592 16.911  1.00 45.13 ? 347  PRO A O   1 
ATOM   1210 C  CB  . PRO A 1 173 ? -39.624 12.057 14.733  1.00 43.82 ? 347  PRO A CB  1 
ATOM   1211 C  CG  . PRO A 1 173 ? -38.322 12.342 14.039  1.00 41.74 ? 347  PRO A CG  1 
ATOM   1212 C  CD  . PRO A 1 173 ? -37.907 13.673 14.648  1.00 40.84 ? 347  PRO A CD  1 
ATOM   1213 N  N   . GLU A 1 174 ? -42.637 13.754 15.240  1.00 49.77 ? 348  GLU A N   1 
ATOM   1214 C  CA  . GLU A 1 174 ? -43.814 13.984 16.075  1.00 53.79 ? 348  GLU A CA  1 
ATOM   1215 C  C   . GLU A 1 174 ? -43.811 13.454 17.505  1.00 55.54 ? 348  GLU A C   1 
ATOM   1216 O  O   . GLU A 1 174 ? -44.018 14.215 18.446  1.00 57.15 ? 348  GLU A O   1 
ATOM   1217 C  CB  . GLU A 1 174 ? -45.067 13.466 15.364  1.00 56.13 ? 348  GLU A CB  1 
ATOM   1218 C  CG  . GLU A 1 174 ? -46.368 13.896 16.035  1.00 58.75 ? 348  GLU A CG  1 
ATOM   1219 C  CD  . GLU A 1 174 ? -47.602 13.512 15.240  1.00 60.40 ? 348  GLU A CD  1 
ATOM   1220 O  OE1 . GLU A 1 174 ? -47.821 12.299 15.029  1.00 62.02 ? 348  GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A 1 174 ? -48.352 14.423 14.826  1.00 60.93 ? 348  GLU A OE2 1 
ATOM   1222 N  N   . GLY A 1 175 ? -43.589 12.156 17.675  1.00 56.38 ? 349  GLY A N   1 
ATOM   1223 C  CA  . GLY A 1 175 ? -43.609 11.597 19.017  1.00 57.54 ? 349  GLY A CA  1 
ATOM   1224 C  C   . GLY A 1 175 ? -42.263 11.358 19.670  1.00 57.69 ? 349  GLY A C   1 
ATOM   1225 O  O   . GLY A 1 175 ? -42.055 11.717 20.827  1.00 58.59 ? 349  GLY A O   1 
ATOM   1226 N  N   . LYS A 1 176 ? -41.352 10.738 18.930  1.00 57.63 ? 350  LYS A N   1 
ATOM   1227 C  CA  . LYS A 1 176 ? -40.018 10.435 19.430  1.00 57.27 ? 350  LYS A CA  1 
ATOM   1228 C  C   . LYS A 1 176 ? -39.403 11.640 20.136  1.00 56.92 ? 350  LYS A C   1 
ATOM   1229 O  O   . LYS A 1 176 ? -39.714 12.783 19.814  1.00 58.47 ? 350  LYS A O   1 
ATOM   1230 C  CB  . LYS A 1 176 ? -39.126 9.999  18.264  1.00 57.70 ? 350  LYS A CB  1 
ATOM   1231 C  CG  . LYS A 1 176 ? -37.774 9.446  18.670  1.00 58.88 ? 350  LYS A CG  1 
ATOM   1232 C  CD  . LYS A 1 176 ? -36.988 9.009  17.444  1.00 59.45 ? 350  LYS A CD  1 
ATOM   1233 C  CE  . LYS A 1 176 ? -35.668 8.354  17.826  1.00 60.17 ? 350  LYS A CE  1 
ATOM   1234 N  NZ  . LYS A 1 176 ? -34.919 7.890  16.621  1.00 60.23 ? 350  LYS A NZ  1 
ATOM   1235 N  N   . ALA A 1 177 ? -38.544 11.379 21.114  1.00 55.65 ? 351  ALA A N   1 
ATOM   1236 C  CA  . ALA A 1 177 ? -37.888 12.456 21.838  1.00 54.81 ? 351  ALA A CA  1 
ATOM   1237 C  C   . ALA A 1 177 ? -36.787 12.998 20.935  1.00 54.26 ? 351  ALA A C   1 
ATOM   1238 O  O   . ALA A 1 177 ? -36.808 14.158 20.520  1.00 54.64 ? 351  ALA A O   1 
ATOM   1239 C  CB  . ALA A 1 177 ? -37.291 11.930 23.140  1.00 55.10 ? 351  ALA A CB  1 
ATOM   1240 N  N   . GLN A 1 178 ? -35.833 12.128 20.630  1.00 52.06 ? 352  GLN A N   1 
ATOM   1241 C  CA  . GLN A 1 178 ? -34.699 12.461 19.782  1.00 50.28 ? 352  GLN A CA  1 
ATOM   1242 C  C   . GLN A 1 178 ? -35.105 13.182 18.495  1.00 48.52 ? 352  GLN A C   1 
ATOM   1243 O  O   . GLN A 1 178 ? -36.256 13.127 18.069  1.00 49.48 ? 352  GLN A O   1 
ATOM   1244 C  CB  . GLN A 1 178 ? -33.946 11.175 19.428  1.00 51.11 ? 352  GLN A CB  1 
ATOM   1245 C  CG  . GLN A 1 178 ? -32.654 11.372 18.652  1.00 51.78 ? 352  GLN A CG  1 
ATOM   1246 C  CD  . GLN A 1 178 ? -31.597 12.100 19.457  1.00 51.83 ? 352  GLN A CD  1 
ATOM   1247 O  OE1 . GLN A 1 178 ? -31.750 13.274 19.785  1.00 51.25 ? 352  GLN A OE1 1 
ATOM   1248 N  NE2 . GLN A 1 178 ? -30.517 11.400 19.783  1.00 52.65 ? 352  GLN A NE2 1 
ATOM   1249 N  N   . PHE A 1 179 ? -34.143 13.869 17.894  1.00 45.09 ? 353  PHE A N   1 
ATOM   1250 C  CA  . PHE A 1 179 ? -34.366 14.565 16.637  1.00 42.68 ? 353  PHE A CA  1 
ATOM   1251 C  C   . PHE A 1 179 ? -33.358 14.002 15.643  1.00 40.65 ? 353  PHE A C   1 
ATOM   1252 O  O   . PHE A 1 179 ? -32.422 13.315 16.036  1.00 40.54 ? 353  PHE A O   1 
ATOM   1253 C  CB  . PHE A 1 179 ? -34.188 16.077 16.812  1.00 42.18 ? 353  PHE A CB  1 
ATOM   1254 C  CG  . PHE A 1 179 ? -32.987 16.464 17.623  1.00 41.05 ? 353  PHE A CG  1 
ATOM   1255 C  CD1 . PHE A 1 179 ? -31.704 16.250 17.139  1.00 40.57 ? 353  PHE A CD1 1 
ATOM   1256 C  CD2 . PHE A 1 179 ? -33.144 17.062 18.871  1.00 40.52 ? 353  PHE A CD2 1 
ATOM   1257 C  CE1 . PHE A 1 179 ? -30.590 16.628 17.885  1.00 40.12 ? 353  PHE A CE1 1 
ATOM   1258 C  CE2 . PHE A 1 179 ? -32.039 17.444 19.626  1.00 40.48 ? 353  PHE A CE2 1 
ATOM   1259 C  CZ  . PHE A 1 179 ? -30.759 17.227 19.132  1.00 40.01 ? 353  PHE A CZ  1 
ATOM   1260 N  N   . ALA A 1 180 ? -33.559 14.269 14.359  1.00 38.19 ? 354  ALA A N   1 
ATOM   1261 C  CA  . ALA A 1 180 ? -32.655 13.758 13.338  1.00 35.27 ? 354  ALA A CA  1 
ATOM   1262 C  C   . ALA A 1 180 ? -31.922 14.883 12.617  1.00 34.31 ? 354  ALA A C   1 
ATOM   1263 O  O   . ALA A 1 180 ? -32.545 15.784 12.067  1.00 32.73 ? 354  ALA A O   1 
ATOM   1264 C  CB  . ALA A 1 180 ? -33.435 12.915 12.334  1.00 37.10 ? 354  ALA A CB  1 
ATOM   1265 N  N   . ASP A 1 181 ? -30.593 14.823 12.631  1.00 32.78 ? 355  ASP A N   1 
ATOM   1266 C  CA  . ASP A 1 181 ? -29.765 15.826 11.973  1.00 31.67 ? 355  ASP A CA  1 
ATOM   1267 C  C   . ASP A 1 181 ? -29.368 15.350 10.588  1.00 31.11 ? 355  ASP A C   1 
ATOM   1268 O  O   . ASP A 1 181 ? -28.698 14.332 10.442  1.00 32.28 ? 355  ASP A O   1 
ATOM   1269 C  CB  . ASP A 1 181 ? -28.504 16.113 12.791  1.00 31.22 ? 355  ASP A CB  1 
ATOM   1270 C  CG  . ASP A 1 181 ? -28.786 16.958 14.011  1.00 32.70 ? 355  ASP A CG  1 
ATOM   1271 O  OD1 . ASP A 1 181 ? -29.948 17.383 14.177  1.00 31.06 ? 355  ASP A OD1 1 
ATOM   1272 O  OD2 . ASP A 1 181 ? -27.849 17.209 14.800  1.00 34.87 ? 355  ASP A OD2 1 
ATOM   1273 N  N   . ILE A 1 182 ? -29.782 16.102 9.575   1.00 29.18 ? 356  ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 182 ? -29.482 15.763 8.195   1.00 27.54 ? 356  ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 182 ? -28.550 16.798 7.581   1.00 27.15 ? 356  ILE A C   1 
ATOM   1276 O  O   . ILE A 1 182 ? -28.836 17.994 7.593   1.00 24.72 ? 356  ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 182 ? -30.778 15.685 7.370   1.00 27.90 ? 356  ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 182 ? -31.696 14.613 7.969   1.00 29.90 ? 356  ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 182 ? -30.461 15.390 5.913   1.00 27.99 ? 356  ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 182 ? -33.049 14.532 7.312   1.00 29.89 ? 356  ILE A CD1 1 
ATOM   1281 N  N   . GLU A 1 183 ? -27.424 16.331 7.051   1.00 26.58 ? 357  GLU A N   1 
ATOM   1282 C  CA  . GLU A 1 183 ? -26.466 17.231 6.428   1.00 26.98 ? 357  GLU A CA  1 
ATOM   1283 C  C   . GLU A 1 183 ? -26.892 17.489 4.991   1.00 24.59 ? 357  GLU A C   1 
ATOM   1284 O  O   . GLU A 1 183 ? -27.300 16.574 4.282   1.00 23.90 ? 357  GLU A O   1 
ATOM   1285 C  CB  . GLU A 1 183 ? -25.066 16.619 6.470   1.00 31.04 ? 357  GLU A CB  1 
ATOM   1286 C  CG  . GLU A 1 183 ? -24.585 16.322 7.883   1.00 38.36 ? 357  GLU A CG  1 
ATOM   1287 C  CD  . GLU A 1 183 ? -23.204 15.710 7.917   1.00 42.96 ? 357  GLU A CD  1 
ATOM   1288 O  OE1 . GLU A 1 183 ? -22.226 16.419 7.602   1.00 47.42 ? 357  GLU A OE1 1 
ATOM   1289 O  OE2 . GLU A 1 183 ? -23.097 14.515 8.254   1.00 47.79 ? 357  GLU A OE2 1 
ATOM   1290 N  N   . PRO A 1 184 ? -26.811 18.751 4.546   1.00 24.47 ? 358  PRO A N   1 
ATOM   1291 C  CA  . PRO A 1 184 ? -27.196 19.127 3.181   1.00 23.85 ? 358  PRO A CA  1 
ATOM   1292 C  C   . PRO A 1 184 ? -26.154 18.701 2.152   1.00 23.26 ? 358  PRO A C   1 
ATOM   1293 O  O   . PRO A 1 184 ? -25.776 19.484 1.293   1.00 23.49 ? 358  PRO A O   1 
ATOM   1294 C  CB  . PRO A 1 184 ? -27.330 20.643 3.282   1.00 22.18 ? 358  PRO A CB  1 
ATOM   1295 C  CG  . PRO A 1 184 ? -26.244 20.991 4.236   1.00 21.38 ? 358  PRO A CG  1 
ATOM   1296 C  CD  . PRO A 1 184 ? -26.403 19.940 5.317   1.00 23.18 ? 358  PRO A CD  1 
ATOM   1297 N  N   . LYS A 1 185 ? -25.711 17.450 2.248   1.00 25.41 ? 359  LYS A N   1 
ATOM   1298 C  CA  . LYS A 1 185 ? -24.688 16.901 1.356   1.00 27.44 ? 359  LYS A CA  1 
ATOM   1299 C  C   . LYS A 1 185 ? -25.029 16.942 -0.130  1.00 27.73 ? 359  LYS A C   1 
ATOM   1300 O  O   . LYS A 1 185 ? -26.189 16.868 -0.524  1.00 26.47 ? 359  LYS A O   1 
ATOM   1301 C  CB  . LYS A 1 185 ? -24.364 15.454 1.751   1.00 31.50 ? 359  LYS A CB  1 
ATOM   1302 C  CG  . LYS A 1 185 ? -23.786 15.289 3.157   1.00 36.27 ? 359  LYS A CG  1 
ATOM   1303 C  CD  . LYS A 1 185 ? -23.532 13.815 3.477   1.00 39.89 ? 359  LYS A CD  1 
ATOM   1304 C  CE  . LYS A 1 185 ? -23.112 13.618 4.930   1.00 42.02 ? 359  LYS A CE  1 
ATOM   1305 N  NZ  . LYS A 1 185 ? -22.977 12.173 5.279   1.00 44.28 ? 359  LYS A NZ  1 
ATOM   1306 N  N   . PHE A 1 186 ? -23.986 17.049 -0.948  1.00 28.12 ? 360  PHE A N   1 
ATOM   1307 C  CA  . PHE A 1 186 ? -24.121 17.090 -2.404  1.00 27.62 ? 360  PHE A CA  1 
ATOM   1308 C  C   . PHE A 1 186 ? -24.781 15.825 -2.966  1.00 25.82 ? 360  PHE A C   1 
ATOM   1309 O  O   . PHE A 1 186 ? -24.447 14.708 -2.573  1.00 24.03 ? 360  PHE A O   1 
ATOM   1310 C  CB  . PHE A 1 186 ? -22.734 17.281 -3.039  1.00 29.10 ? 360  PHE A CB  1 
ATOM   1311 C  CG  . PHE A 1 186 ? -22.714 17.118 -4.537  1.00 30.62 ? 360  PHE A CG  1 
ATOM   1312 C  CD1 . PHE A 1 186 ? -23.102 18.167 -5.369  1.00 32.36 ? 360  PHE A CD1 1 
ATOM   1313 C  CD2 . PHE A 1 186 ? -22.311 15.919 -5.117  1.00 32.24 ? 360  PHE A CD2 1 
ATOM   1314 C  CE1 . PHE A 1 186 ? -23.091 18.026 -6.757  1.00 32.51 ? 360  PHE A CE1 1 
ATOM   1315 C  CE2 . PHE A 1 186 ? -22.294 15.765 -6.506  1.00 30.82 ? 360  PHE A CE2 1 
ATOM   1316 C  CZ  . PHE A 1 186 ? -22.685 16.820 -7.328  1.00 32.51 ? 360  PHE A CZ  1 
ATOM   1317 N  N   . ASP A 1 187 ? -25.723 16.031 -3.884  1.00 24.59 ? 361  ASP A N   1 
ATOM   1318 C  CA  . ASP A 1 187 ? -26.452 14.959 -4.553  1.00 27.34 ? 361  ASP A CA  1 
ATOM   1319 C  C   . ASP A 1 187 ? -27.278 14.093 -3.600  1.00 27.63 ? 361  ASP A C   1 
ATOM   1320 O  O   . ASP A 1 187 ? -27.484 12.900 -3.842  1.00 28.04 ? 361  ASP A O   1 
ATOM   1321 C  CB  . ASP A 1 187 ? -25.471 14.097 -5.370  1.00 27.52 ? 361  ASP A CB  1 
ATOM   1322 C  CG  . ASP A 1 187 ? -26.173 13.183 -6.371  1.00 28.56 ? 361  ASP A CG  1 
ATOM   1323 O  OD1 . ASP A 1 187 ? -27.232 13.568 -6.911  1.00 27.39 ? 361  ASP A OD1 1 
ATOM   1324 O  OD2 . ASP A 1 187 ? -25.648 12.081 -6.637  1.00 29.21 ? 361  ASP A OD2 1 
ATOM   1325 N  N   . ARG A 1 188 ? -27.753 14.700 -2.515  1.00 26.18 ? 362  ARG A N   1 
ATOM   1326 C  CA  . ARG A 1 188 ? -28.577 13.988 -1.544  1.00 24.37 ? 362  ARG A CA  1 
ATOM   1327 C  C   . ARG A 1 188 ? -30.050 14.361 -1.718  1.00 25.85 ? 362  ARG A C   1 
ATOM   1328 O  O   . ARG A 1 188 ? -30.391 15.537 -1.881  1.00 23.98 ? 362  ARG A O   1 
ATOM   1329 C  CB  . ARG A 1 188 ? -28.127 14.312 -0.115  1.00 25.80 ? 362  ARG A CB  1 
ATOM   1330 C  CG  . ARG A 1 188 ? -29.145 13.936 0.961   1.00 24.16 ? 362  ARG A CG  1 
ATOM   1331 C  CD  . ARG A 1 188 ? -28.557 14.054 2.358   1.00 26.86 ? 362  ARG A CD  1 
ATOM   1332 N  NE  . ARG A 1 188 ? -27.579 13.001 2.630   1.00 26.99 ? 362  ARG A NE  1 
ATOM   1333 C  CZ  . ARG A 1 188 ? -26.953 12.844 3.789   1.00 29.16 ? 362  ARG A CZ  1 
ATOM   1334 N  NH1 . ARG A 1 188 ? -27.192 13.678 4.791   1.00 31.06 ? 362  ARG A NH1 1 
ATOM   1335 N  NH2 . ARG A 1 188 ? -26.083 11.854 3.948   1.00 31.22 ? 362  ARG A NH2 1 
ATOM   1336 N  N   . LEU A 1 189 ? -30.914 13.349 -1.684  1.00 24.20 ? 363  LEU A N   1 
ATOM   1337 C  CA  . LEU A 1 189 ? -32.349 13.542 -1.829  1.00 24.39 ? 363  LEU A CA  1 
ATOM   1338 C  C   . LEU A 1 189 ? -33.017 13.192 -0.505  1.00 25.08 ? 363  LEU A C   1 
ATOM   1339 O  O   . LEU A 1 189 ? -32.657 12.201 0.144   1.00 25.35 ? 363  LEU A O   1 
ATOM   1340 C  CB  . LEU A 1 189 ? -32.904 12.643 -2.939  1.00 27.57 ? 363  LEU A CB  1 
ATOM   1341 C  CG  . LEU A 1 189 ? -34.388 12.812 -3.280  1.00 28.84 ? 363  LEU A CG  1 
ATOM   1342 C  CD1 . LEU A 1 189 ? -34.633 14.214 -3.830  1.00 28.51 ? 363  LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A 1 189 ? -34.804 11.759 -4.295  1.00 29.24 ? 363  LEU A CD2 1 
ATOM   1344 N  N   . LEU A 1 190 ? -33.990 14.004 -0.107  1.00 22.26 ? 364  LEU A N   1 
ATOM   1345 C  CA  . LEU A 1 190 ? -34.687 13.791 1.151   1.00 20.84 ? 364  LEU A CA  1 
ATOM   1346 C  C   . LEU A 1 190 ? -36.205 13.805 1.010   1.00 21.19 ? 364  LEU A C   1 
ATOM   1347 O  O   . LEU A 1 190 ? -36.758 14.605 0.260   1.00 19.48 ? 364  LEU A O   1 
ATOM   1348 C  CB  . LEU A 1 190 ? -34.270 14.870 2.156   1.00 22.70 ? 364  LEU A CB  1 
ATOM   1349 C  CG  . LEU A 1 190 ? -35.072 14.959 3.460   1.00 22.40 ? 364  LEU A CG  1 
ATOM   1350 C  CD1 . LEU A 1 190 ? -34.738 13.778 4.360   1.00 21.69 ? 364  LEU A CD1 1 
ATOM   1351 C  CD2 . LEU A 1 190 ? -34.746 16.267 4.168   1.00 22.44 ? 364  LEU A CD2 1 
ATOM   1352 N  N   . PHE A 1 191 ? -36.867 12.916 1.746   1.00 20.68 ? 365  PHE A N   1 
ATOM   1353 C  CA  . PHE A 1 191 ? -38.325 12.845 1.748   1.00 23.32 ? 365  PHE A CA  1 
ATOM   1354 C  C   . PHE A 1 191 ? -38.822 12.863 3.180   1.00 21.36 ? 365  PHE A C   1 
ATOM   1355 O  O   . PHE A 1 191 ? -38.232 12.225 4.045   1.00 23.71 ? 365  PHE A O   1 
ATOM   1356 C  CB  . PHE A 1 191 ? -38.852 11.542 1.120   1.00 24.33 ? 365  PHE A CB  1 
ATOM   1357 C  CG  . PHE A 1 191 ? -38.712 11.465 -0.373  1.00 28.80 ? 365  PHE A CG  1 
ATOM   1358 C  CD1 . PHE A 1 191 ? -39.683 12.019 -1.201  1.00 29.77 ? 365  PHE A CD1 1 
ATOM   1359 C  CD2 . PHE A 1 191 ? -37.630 10.807 -0.954  1.00 29.36 ? 365  PHE A CD2 1 
ATOM   1360 C  CE1 . PHE A 1 191 ? -39.579 11.917 -2.594  1.00 32.11 ? 365  PHE A CE1 1 
ATOM   1361 C  CE2 . PHE A 1 191 ? -37.518 10.699 -2.346  1.00 30.04 ? 365  PHE A CE2 1 
ATOM   1362 C  CZ  . PHE A 1 191 ? -38.494 11.255 -3.165  1.00 30.70 ? 365  PHE A CZ  1 
ATOM   1363 N  N   . PHE A 1 192 ? -39.891 13.610 3.434   1.00 20.20 ? 366  PHE A N   1 
ATOM   1364 C  CA  . PHE A 1 192 ? -40.511 13.608 4.755   1.00 19.51 ? 366  PHE A CA  1 
ATOM   1365 C  C   . PHE A 1 192 ? -41.934 14.155 4.728   1.00 19.40 ? 366  PHE A C   1 
ATOM   1366 O  O   . PHE A 1 192 ? -42.268 15.006 3.903   1.00 17.32 ? 366  PHE A O   1 
ATOM   1367 C  CB  . PHE A 1 192 ? -39.656 14.341 5.809   1.00 17.97 ? 366  PHE A CB  1 
ATOM   1368 C  CG  . PHE A 1 192 ? -39.480 15.820 5.570   1.00 16.82 ? 366  PHE A CG  1 
ATOM   1369 C  CD1 . PHE A 1 192 ? -40.430 16.728 6.024   1.00 17.61 ? 366  PHE A CD1 1 
ATOM   1370 C  CD2 . PHE A 1 192 ? -38.334 16.308 4.950   1.00 17.20 ? 366  PHE A CD2 1 
ATOM   1371 C  CE1 . PHE A 1 192 ? -40.246 18.100 5.871   1.00 15.39 ? 366  PHE A CE1 1 
ATOM   1372 C  CE2 . PHE A 1 192 ? -38.136 17.682 4.791   1.00 15.25 ? 366  PHE A CE2 1 
ATOM   1373 C  CZ  . PHE A 1 192 ? -39.102 18.580 5.258   1.00 13.97 ? 366  PHE A CZ  1 
ATOM   1374 N  N   . TRP A 1 193 ? -42.784 13.629 5.609   1.00 20.04 ? 367  TRP A N   1 
ATOM   1375 C  CA  . TRP A 1 193 ? -44.177 14.079 5.694   1.00 20.71 ? 367  TRP A CA  1 
ATOM   1376 C  C   . TRP A 1 193 ? -44.180 15.590 5.935   1.00 19.31 ? 367  TRP A C   1 
ATOM   1377 O  O   . TRP A 1 193 ? -43.475 16.077 6.807   1.00 20.00 ? 367  TRP A O   1 
ATOM   1378 C  CB  . TRP A 1 193 ? -44.898 13.377 6.852   1.00 20.88 ? 367  TRP A CB  1 
ATOM   1379 C  CG  . TRP A 1 193 ? -44.961 11.878 6.747   1.00 22.65 ? 367  TRP A CG  1 
ATOM   1380 C  CD1 . TRP A 1 193 ? -44.695 10.978 7.739   1.00 23.06 ? 367  TRP A CD1 1 
ATOM   1381 C  CD2 . TRP A 1 193 ? -45.337 11.106 5.596   1.00 23.41 ? 367  TRP A CD2 1 
ATOM   1382 N  NE1 . TRP A 1 193 ? -44.879 9.694  7.278   1.00 24.00 ? 367  TRP A NE1 1 
ATOM   1383 C  CE2 . TRP A 1 193 ? -45.274 9.744  5.968   1.00 23.42 ? 367  TRP A CE2 1 
ATOM   1384 C  CE3 . TRP A 1 193 ? -45.720 11.433 4.290   1.00 22.29 ? 367  TRP A CE3 1 
ATOM   1385 C  CZ2 . TRP A 1 193 ? -45.580 8.709  5.079   1.00 24.65 ? 367  TRP A CZ2 1 
ATOM   1386 C  CZ3 . TRP A 1 193 ? -46.024 10.404 3.406   1.00 23.58 ? 367  TRP A CZ3 1 
ATOM   1387 C  CH2 . TRP A 1 193 ? -45.952 9.058  3.806   1.00 23.73 ? 367  TRP A CH2 1 
ATOM   1388 N  N   . SER A 1 194 ? -44.993 16.316 5.170   1.00 19.62 ? 368  SER A N   1 
ATOM   1389 C  CA  . SER A 1 194 ? -45.074 17.771 5.274   1.00 17.70 ? 368  SER A CA  1 
ATOM   1390 C  C   . SER A 1 194 ? -45.888 18.293 6.456   1.00 17.78 ? 368  SER A C   1 
ATOM   1391 O  O   . SER A 1 194 ? -45.757 19.464 6.818   1.00 16.81 ? 368  SER A O   1 
ATOM   1392 C  CB  . SER A 1 194 ? -45.665 18.361 3.980   1.00 16.25 ? 368  SER A CB  1 
ATOM   1393 O  OG  . SER A 1 194 ? -44.949 17.920 2.841   1.00 18.52 ? 368  SER A OG  1 
ATOM   1394 N  N   . ASP A 1 195 ? -46.718 17.440 7.058   1.00 19.74 ? 369  ASP A N   1 
ATOM   1395 C  CA  . ASP A 1 195 ? -47.561 17.871 8.173   1.00 21.55 ? 369  ASP A CA  1 
ATOM   1396 C  C   . ASP A 1 195 ? -46.865 17.992 9.525   1.00 22.37 ? 369  ASP A C   1 
ATOM   1397 O  O   . ASP A 1 195 ? -45.652 17.848 9.628   1.00 22.68 ? 369  ASP A O   1 
ATOM   1398 C  CB  . ASP A 1 195 ? -48.799 16.966 8.319   1.00 23.78 ? 369  ASP A CB  1 
ATOM   1399 C  CG  . ASP A 1 195 ? -48.450 15.529 8.678   1.00 25.77 ? 369  ASP A CG  1 
ATOM   1400 O  OD1 . ASP A 1 195 ? -47.405 15.298 9.320   1.00 24.19 ? 369  ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A 1 195 ? -49.241 14.627 8.332   1.00 29.91 ? 369  ASP A OD2 1 
ATOM   1402 N  N   . ARG A 1 196 ? -47.669 18.263 10.551  1.00 22.28 ? 370  ARG A N   1 
ATOM   1403 C  CA  . ARG A 1 196 ? -47.211 18.448 11.922  1.00 26.17 ? 370  ARG A CA  1 
ATOM   1404 C  C   . ARG A 1 196 ? -46.364 17.314 12.487  1.00 25.46 ? 370  ARG A C   1 
ATOM   1405 O  O   . ARG A 1 196 ? -45.793 17.444 13.556  1.00 27.25 ? 370  ARG A O   1 
ATOM   1406 C  CB  . ARG A 1 196 ? -48.419 18.684 12.837  1.00 29.85 ? 370  ARG A CB  1 
ATOM   1407 C  CG  . ARG A 1 196 ? -49.196 19.964 12.529  1.00 37.25 ? 370  ARG A CG  1 
ATOM   1408 C  CD  . ARG A 1 196 ? -50.520 20.014 13.283  1.00 41.98 ? 370  ARG A CD  1 
ATOM   1409 N  NE  . ARG A 1 196 ? -51.342 21.157 12.891  1.00 47.51 ? 370  ARG A NE  1 
ATOM   1410 C  CZ  . ARG A 1 196 ? -51.088 22.417 13.229  1.00 50.64 ? 370  ARG A CZ  1 
ATOM   1411 N  NH1 . ARG A 1 196 ? -50.028 22.703 13.972  1.00 53.29 ? 370  ARG A NH1 1 
ATOM   1412 N  NH2 . ARG A 1 196 ? -51.896 23.391 12.827  1.00 52.01 ? 370  ARG A NH2 1 
ATOM   1413 N  N   . ARG A 1 197 ? -46.290 16.200 11.773  1.00 26.08 ? 371  ARG A N   1 
ATOM   1414 C  CA  . ARG A 1 197 ? -45.497 15.072 12.235  1.00 25.65 ? 371  ARG A CA  1 
ATOM   1415 C  C   . ARG A 1 197 ? -44.009 15.362 12.118  1.00 25.34 ? 371  ARG A C   1 
ATOM   1416 O  O   . ARG A 1 197 ? -43.193 14.736 12.799  1.00 24.11 ? 371  ARG A O   1 
ATOM   1417 C  CB  . ARG A 1 197 ? -45.833 13.821 11.427  1.00 26.96 ? 371  ARG A CB  1 
ATOM   1418 C  CG  . ARG A 1 197 ? -47.146 13.171 11.813  1.00 28.91 ? 371  ARG A CG  1 
ATOM   1419 C  CD  . ARG A 1 197 ? -47.462 12.016 10.884  1.00 29.46 ? 371  ARG A CD  1 
ATOM   1420 N  NE  . ARG A 1 197 ? -47.781 12.488 9.542   1.00 28.99 ? 371  ARG A NE  1 
ATOM   1421 C  CZ  . ARG A 1 197 ? -48.048 11.699 8.506   1.00 29.13 ? 371  ARG A CZ  1 
ATOM   1422 N  NH1 . ARG A 1 197 ? -48.034 10.379 8.640   1.00 29.49 ? 371  ARG A NH1 1 
ATOM   1423 N  NH2 . ARG A 1 197 ? -48.340 12.236 7.332   1.00 26.63 ? 371  ARG A NH2 1 
ATOM   1424 N  N   . ASN A 1 198 ? -43.656 16.315 11.261  1.00 20.95 ? 372  ASN A N   1 
ATOM   1425 C  CA  . ASN A 1 198 ? -42.253 16.646 11.068  1.00 21.36 ? 372  ASN A CA  1 
ATOM   1426 C  C   . ASN A 1 198 ? -41.852 18.105 11.243  1.00 21.65 ? 372  ASN A C   1 
ATOM   1427 O  O   . ASN A 1 198 ? -41.523 18.788 10.272  1.00 21.70 ? 372  ASN A O   1 
ATOM   1428 C  CB  . ASN A 1 198 ? -41.777 16.163 9.693   1.00 21.35 ? 372  ASN A CB  1 
ATOM   1429 C  CG  . ASN A 1 198 ? -41.648 14.658 9.620   1.00 22.16 ? 372  ASN A CG  1 
ATOM   1430 O  OD1 . ASN A 1 198 ? -41.093 14.033 10.519  1.00 24.38 ? 372  ASN A OD1 1 
ATOM   1431 N  ND2 . ASN A 1 198 ? -42.152 14.069 8.540   1.00 22.17 ? 372  ASN A ND2 1 
ATOM   1432 N  N   . PRO A 1 199 ? -41.885 18.608 12.490  1.00 22.09 ? 373  PRO A N   1 
ATOM   1433 C  CA  . PRO A 1 199 ? -41.491 20.002 12.715  1.00 21.56 ? 373  PRO A CA  1 
ATOM   1434 C  C   . PRO A 1 199 ? -39.985 20.025 12.440  1.00 21.26 ? 373  PRO A C   1 
ATOM   1435 O  O   . PRO A 1 199 ? -39.277 19.097 12.830  1.00 23.12 ? 373  PRO A O   1 
ATOM   1436 C  CB  . PRO A 1 199 ? -41.806 20.219 14.200  1.00 20.85 ? 373  PRO A CB  1 
ATOM   1437 C  CG  . PRO A 1 199 ? -42.869 19.186 14.497  1.00 18.80 ? 373  PRO A CG  1 
ATOM   1438 C  CD  . PRO A 1 199 ? -42.381 17.992 13.734  1.00 19.31 ? 373  PRO A CD  1 
ATOM   1439 N  N   . HIS A 1 200 ? -39.487 21.052 11.762  1.00 19.09 ? 374  HIS A N   1 
ATOM   1440 C  CA  . HIS A 1 200 ? -38.058 21.090 11.471  1.00 19.07 ? 374  HIS A CA  1 
ATOM   1441 C  C   . HIS A 1 200 ? -37.489 22.495 11.394  1.00 19.77 ? 374  HIS A C   1 
ATOM   1442 O  O   . HIS A 1 200 ? -38.222 23.483 11.408  1.00 19.49 ? 374  HIS A O   1 
ATOM   1443 C  CB  . HIS A 1 200 ? -37.762 20.350 10.159  1.00 18.61 ? 374  HIS A CB  1 
ATOM   1444 C  CG  . HIS A 1 200 ? -38.555 20.851 8.990   1.00 18.82 ? 374  HIS A CG  1 
ATOM   1445 N  ND1 . HIS A 1 200 ? -39.911 20.643 8.868   1.00 20.49 ? 374  HIS A ND1 1 
ATOM   1446 C  CD2 . HIS A 1 200 ? -38.184 21.559 7.899   1.00 20.27 ? 374  HIS A CD2 1 
ATOM   1447 C  CE1 . HIS A 1 200 ? -40.343 21.199 7.752   1.00 19.38 ? 374  HIS A CE1 1 
ATOM   1448 N  NE2 . HIS A 1 200 ? -39.315 21.763 7.144   1.00 20.49 ? 374  HIS A NE2 1 
ATOM   1449 N  N   . GLU A 1 201 ? -36.169 22.578 11.299  1.00 18.06 ? 375  GLU A N   1 
ATOM   1450 C  CA  . GLU A 1 201 ? -35.524 23.876 11.226  1.00 18.62 ? 375  GLU A CA  1 
ATOM   1451 C  C   . GLU A 1 201 ? -34.140 23.754 10.593  1.00 15.76 ? 375  GLU A C   1 
ATOM   1452 O  O   . GLU A 1 201 ? -33.560 22.677 10.547  1.00 17.60 ? 375  GLU A O   1 
ATOM   1453 C  CB  . GLU A 1 201 ? -35.384 24.460 12.634  1.00 19.53 ? 375  GLU A CB  1 
ATOM   1454 C  CG  . GLU A 1 201 ? -34.387 23.693 13.496  1.00 24.21 ? 375  GLU A CG  1 
ATOM   1455 C  CD  . GLU A 1 201 ? -34.371 24.146 14.950  1.00 27.29 ? 375  GLU A CD  1 
ATOM   1456 O  OE1 . GLU A 1 201 ? -35.360 24.747 15.413  1.00 29.63 ? 375  GLU A OE1 1 
ATOM   1457 O  OE2 . GLU A 1 201 ? -33.361 23.884 15.634  1.00 29.81 ? 375  GLU A OE2 1 
ATOM   1458 N  N   . VAL A 1 202 ? -33.624 24.868 10.099  1.00 15.50 ? 376  VAL A N   1 
ATOM   1459 C  CA  . VAL A 1 202 ? -32.299 24.885 9.509   1.00 17.61 ? 376  VAL A CA  1 
ATOM   1460 C  C   . VAL A 1 202 ? -31.385 25.667 10.447  1.00 18.27 ? 376  VAL A C   1 
ATOM   1461 O  O   . VAL A 1 202 ? -31.593 26.856 10.668  1.00 16.95 ? 376  VAL A O   1 
ATOM   1462 C  CB  . VAL A 1 202 ? -32.282 25.583 8.143   1.00 19.00 ? 376  VAL A CB  1 
ATOM   1463 C  CG1 . VAL A 1 202 ? -30.867 25.559 7.581   1.00 19.51 ? 376  VAL A CG1 1 
ATOM   1464 C  CG2 . VAL A 1 202 ? -33.254 24.901 7.187   1.00 20.92 ? 376  VAL A CG2 1 
ATOM   1465 N  N   . GLN A 1 203 ? -30.381 24.995 11.003  1.00 19.81 ? 377  GLN A N   1 
ATOM   1466 C  CA  . GLN A 1 203 ? -29.445 25.657 11.907  1.00 22.10 ? 377  GLN A CA  1 
ATOM   1467 C  C   . GLN A 1 203 ? -28.604 26.672 11.136  1.00 21.68 ? 377  GLN A C   1 
ATOM   1468 O  O   . GLN A 1 203 ? -28.415 26.542 9.924   1.00 22.95 ? 377  GLN A O   1 
ATOM   1469 C  CB  . GLN A 1 203 ? -28.531 24.629 12.580  1.00 23.06 ? 377  GLN A CB  1 
ATOM   1470 C  CG  . GLN A 1 203 ? -29.266 23.587 13.400  1.00 29.63 ? 377  GLN A CG  1 
ATOM   1471 C  CD  . GLN A 1 203 ? -28.325 22.729 14.222  1.00 32.38 ? 377  GLN A CD  1 
ATOM   1472 O  OE1 . GLN A 1 203 ? -27.351 22.182 13.706  1.00 35.91 ? 377  GLN A OE1 1 
ATOM   1473 N  NE2 . GLN A 1 203 ? -28.615 22.605 15.506  1.00 34.44 ? 377  GLN A NE2 1 
ATOM   1474 N  N   . PRO A 1 204 ? -28.087 27.701 11.833  1.00 23.41 ? 378  PRO A N   1 
ATOM   1475 C  CA  . PRO A 1 204 ? -27.265 28.743 11.209  1.00 22.65 ? 378  PRO A CA  1 
ATOM   1476 C  C   . PRO A 1 204 ? -26.260 28.192 10.205  1.00 21.93 ? 378  PRO A C   1 
ATOM   1477 O  O   . PRO A 1 204 ? -25.537 27.235 10.489  1.00 21.44 ? 378  PRO A O   1 
ATOM   1478 C  CB  . PRO A 1 204 ? -26.586 29.403 12.406  1.00 23.82 ? 378  PRO A CB  1 
ATOM   1479 C  CG  . PRO A 1 204 ? -27.644 29.317 13.457  1.00 24.62 ? 378  PRO A CG  1 
ATOM   1480 C  CD  . PRO A 1 204 ? -28.154 27.897 13.296  1.00 21.81 ? 378  PRO A CD  1 
ATOM   1481 N  N   . ALA A 1 205 ? -26.227 28.796 9.024   1.00 20.11 ? 379  ALA A N   1 
ATOM   1482 C  CA  . ALA A 1 205 ? -25.305 28.365 7.980   1.00 23.07 ? 379  ALA A CA  1 
ATOM   1483 C  C   . ALA A 1 205 ? -24.217 29.421 7.817   1.00 22.90 ? 379  ALA A C   1 
ATOM   1484 O  O   . ALA A 1 205 ? -24.518 30.604 7.713   1.00 21.96 ? 379  ALA A O   1 
ATOM   1485 C  CB  . ALA A 1 205 ? -26.061 28.169 6.664   1.00 22.52 ? 379  ALA A CB  1 
ATOM   1486 N  N   . TYR A 1 206 ? -22.958 28.982 7.791   1.00 24.57 ? 380  TYR A N   1 
ATOM   1487 C  CA  . TYR A 1 206 ? -21.822 29.890 7.655   1.00 26.10 ? 380  TYR A CA  1 
ATOM   1488 C  C   . TYR A 1 206 ? -21.104 29.779 6.316   1.00 27.35 ? 380  TYR A C   1 
ATOM   1489 O  O   . TYR A 1 206 ? -19.969 30.237 6.157   1.00 27.41 ? 380  TYR A O   1 
ATOM   1490 C  CB  . TYR A 1 206 ? -20.839 29.669 8.807   1.00 26.88 ? 380  TYR A CB  1 
ATOM   1491 C  CG  . TYR A 1 206 ? -21.434 30.048 10.140  1.00 28.00 ? 380  TYR A CG  1 
ATOM   1492 C  CD1 . TYR A 1 206 ? -21.503 31.383 10.531  1.00 28.96 ? 380  TYR A CD1 1 
ATOM   1493 C  CD2 . TYR A 1 206 ? -21.995 29.086 10.979  1.00 30.28 ? 380  TYR A CD2 1 
ATOM   1494 C  CE1 . TYR A 1 206 ? -22.120 31.755 11.716  1.00 30.71 ? 380  TYR A CE1 1 
ATOM   1495 C  CE2 . TYR A 1 206 ? -22.614 29.447 12.176  1.00 31.42 ? 380  TYR A CE2 1 
ATOM   1496 C  CZ  . TYR A 1 206 ? -22.675 30.785 12.535  1.00 31.67 ? 380  TYR A CZ  1 
ATOM   1497 O  OH  . TYR A 1 206 ? -23.310 31.153 13.699  1.00 32.47 ? 380  TYR A OH  1 
ATOM   1498 N  N   . ALA A 1 207 ? -21.787 29.165 5.357   1.00 26.35 ? 381  ALA A N   1 
ATOM   1499 C  CA  . ALA A 1 207 ? -21.274 28.996 4.008   1.00 25.73 ? 381  ALA A CA  1 
ATOM   1500 C  C   . ALA A 1 207 ? -22.495 28.950 3.093   1.00 25.09 ? 381  ALA A C   1 
ATOM   1501 O  O   . ALA A 1 207 ? -23.599 28.658 3.547   1.00 24.27 ? 381  ALA A O   1 
ATOM   1502 C  CB  . ALA A 1 207 ? -20.475 27.696 3.899   1.00 26.40 ? 381  ALA A CB  1 
ATOM   1503 N  N   . THR A 1 208 ? -22.298 29.257 1.817   1.00 24.54 ? 382  THR A N   1 
ATOM   1504 C  CA  . THR A 1 208 ? -23.395 29.240 0.857   1.00 25.35 ? 382  THR A CA  1 
ATOM   1505 C  C   . THR A 1 208 ? -24.021 27.850 0.832   1.00 24.27 ? 382  THR A C   1 
ATOM   1506 O  O   . THR A 1 208 ? -23.343 26.859 0.580   1.00 23.35 ? 382  THR A O   1 
ATOM   1507 C  CB  . THR A 1 208 ? -22.896 29.623 -0.540  1.00 26.37 ? 382  THR A CB  1 
ATOM   1508 O  OG1 . THR A 1 208 ? -22.217 30.884 -0.463  1.00 28.35 ? 382  THR A OG1 1 
ATOM   1509 C  CG2 . THR A 1 208 ? -24.065 29.754 -1.502  1.00 27.69 ? 382  THR A CG2 1 
ATOM   1510 N  N   . ARG A 1 209 ? -25.321 27.791 1.107   1.00 21.07 ? 383  ARG A N   1 
ATOM   1511 C  CA  . ARG A 1 209 ? -26.051 26.525 1.168   1.00 18.73 ? 383  ARG A CA  1 
ATOM   1512 C  C   . ARG A 1 209 ? -27.216 26.513 0.176   1.00 19.16 ? 383  ARG A C   1 
ATOM   1513 O  O   . ARG A 1 209 ? -28.173 27.277 0.314   1.00 17.37 ? 383  ARG A O   1 
ATOM   1514 C  CB  . ARG A 1 209 ? -26.570 26.338 2.599   1.00 17.48 ? 383  ARG A CB  1 
ATOM   1515 C  CG  . ARG A 1 209 ? -27.261 25.015 2.944   1.00 16.33 ? 383  ARG A CG  1 
ATOM   1516 C  CD  . ARG A 1 209 ? -27.844 25.173 4.353   1.00 14.08 ? 383  ARG A CD  1 
ATOM   1517 N  NE  . ARG A 1 209 ? -28.456 23.979 4.933   1.00 16.81 ? 383  ARG A NE  1 
ATOM   1518 C  CZ  . ARG A 1 209 ? -29.630 23.467 4.575   1.00 17.79 ? 383  ARG A CZ  1 
ATOM   1519 N  NH1 . ARG A 1 209 ? -30.344 24.029 3.612   1.00 18.46 ? 383  ARG A NH1 1 
ATOM   1520 N  NH2 . ARG A 1 209 ? -30.107 22.407 5.218   1.00 15.31 ? 383  ARG A NH2 1 
ATOM   1521 N  N   . TYR A 1 210 ? -27.126 25.638 -0.818  1.00 17.04 ? 384  TYR A N   1 
ATOM   1522 C  CA  . TYR A 1 210 ? -28.159 25.512 -1.837  1.00 17.63 ? 384  TYR A CA  1 
ATOM   1523 C  C   . TYR A 1 210 ? -29.020 24.257 -1.652  1.00 16.82 ? 384  TYR A C   1 
ATOM   1524 O  O   . TYR A 1 210 ? -28.535 23.208 -1.238  1.00 16.37 ? 384  TYR A O   1 
ATOM   1525 C  CB  . TYR A 1 210 ? -27.528 25.468 -3.234  1.00 18.27 ? 384  TYR A CB  1 
ATOM   1526 C  CG  . TYR A 1 210 ? -26.948 26.781 -3.714  1.00 22.34 ? 384  TYR A CG  1 
ATOM   1527 C  CD1 . TYR A 1 210 ? -27.786 27.808 -4.147  1.00 21.61 ? 384  TYR A CD1 1 
ATOM   1528 C  CD2 . TYR A 1 210 ? -25.563 26.983 -3.777  1.00 23.16 ? 384  TYR A CD2 1 
ATOM   1529 C  CE1 . TYR A 1 210 ? -27.271 29.001 -4.636  1.00 25.77 ? 384  TYR A CE1 1 
ATOM   1530 C  CE2 . TYR A 1 210 ? -25.032 28.183 -4.272  1.00 26.05 ? 384  TYR A CE2 1 
ATOM   1531 C  CZ  . TYR A 1 210 ? -25.897 29.185 -4.697  1.00 27.09 ? 384  TYR A CZ  1 
ATOM   1532 O  OH  . TYR A 1 210 ? -25.400 30.380 -5.167  1.00 33.15 ? 384  TYR A OH  1 
ATOM   1533 N  N   . ALA A 1 211 ? -30.303 24.384 -1.963  1.00 15.73 ? 385  ALA A N   1 
ATOM   1534 C  CA  . ALA A 1 211 ? -31.236 23.267 -1.872  1.00 15.09 ? 385  ALA A CA  1 
ATOM   1535 C  C   . ALA A 1 211 ? -32.410 23.542 -2.806  1.00 15.57 ? 385  ALA A C   1 
ATOM   1536 O  O   . ALA A 1 211 ? -32.760 24.704 -3.042  1.00 15.16 ? 385  ALA A O   1 
ATOM   1537 C  CB  . ALA A 1 211 ? -31.732 23.094 -0.441  1.00 15.19 ? 385  ALA A CB  1 
ATOM   1538 N  N   . ILE A 1 212 ? -33.000 22.474 -3.344  1.00 14.22 ? 386  ILE A N   1 
ATOM   1539 C  CA  . ILE A 1 212 ? -34.143 22.586 -4.252  1.00 15.72 ? 386  ILE A CA  1 
ATOM   1540 C  C   . ILE A 1 212 ? -35.287 21.778 -3.652  1.00 15.60 ? 386  ILE A C   1 
ATOM   1541 O  O   . ILE A 1 212 ? -35.156 20.578 -3.436  1.00 16.36 ? 386  ILE A O   1 
ATOM   1542 C  CB  . ILE A 1 212 ? -33.817 22.024 -5.655  1.00 17.01 ? 386  ILE A CB  1 
ATOM   1543 C  CG1 . ILE A 1 212 ? -32.606 22.756 -6.244  1.00 16.75 ? 386  ILE A CG1 1 
ATOM   1544 C  CG2 . ILE A 1 212 ? -35.034 22.186 -6.572  1.00 15.33 ? 386  ILE A CG2 1 
ATOM   1545 C  CD1 . ILE A 1 212 ? -32.164 22.231 -7.598  1.00 19.12 ? 386  ILE A CD1 1 
ATOM   1546 N  N   . THR A 1 213 ? -36.404 22.446 -3.388  1.00 16.13 ? 387  THR A N   1 
ATOM   1547 C  CA  . THR A 1 213 ? -37.556 21.793 -2.775  1.00 16.29 ? 387  THR A CA  1 
ATOM   1548 C  C   . THR A 1 213 ? -38.774 21.704 -3.678  1.00 15.65 ? 387  THR A C   1 
ATOM   1549 O  O   . THR A 1 213 ? -39.064 22.612 -4.438  1.00 15.71 ? 387  THR A O   1 
ATOM   1550 C  CB  . THR A 1 213 ? -37.996 22.529 -1.476  1.00 15.91 ? 387  THR A CB  1 
ATOM   1551 O  OG1 . THR A 1 213 ? -36.923 22.518 -0.528  1.00 15.37 ? 387  THR A OG1 1 
ATOM   1552 C  CG2 . THR A 1 213 ? -39.215 21.843 -0.852  1.00 16.85 ? 387  THR A CG2 1 
ATOM   1553 N  N   . VAL A 1 214 ? -39.473 20.580 -3.582  1.00 17.73 ? 388  VAL A N   1 
ATOM   1554 C  CA  . VAL A 1 214 ? -40.697 20.359 -4.334  1.00 17.89 ? 388  VAL A CA  1 
ATOM   1555 C  C   . VAL A 1 214 ? -41.652 19.685 -3.351  1.00 17.77 ? 388  VAL A C   1 
ATOM   1556 O  O   . VAL A 1 214 ? -41.247 18.791 -2.615  1.00 17.74 ? 388  VAL A O   1 
ATOM   1557 C  CB  . VAL A 1 214 ? -40.472 19.419 -5.547  1.00 20.81 ? 388  VAL A CB  1 
ATOM   1558 C  CG1 . VAL A 1 214 ? -41.805 18.930 -6.080  1.00 20.31 ? 388  VAL A CG1 1 
ATOM   1559 C  CG2 . VAL A 1 214 ? -39.721 20.154 -6.650  1.00 20.68 ? 388  VAL A CG2 1 
ATOM   1560 N  N   . TRP A 1 215 ? -42.907 20.132 -3.331  1.00 17.23 ? 389  TRP A N   1 
ATOM   1561 C  CA  . TRP A 1 215 ? -43.921 19.560 -2.448  1.00 14.57 ? 389  TRP A CA  1 
ATOM   1562 C  C   . TRP A 1 215 ? -44.962 18.798 -3.262  1.00 15.74 ? 389  TRP A C   1 
ATOM   1563 O  O   . TRP A 1 215 ? -45.439 19.297 -4.274  1.00 14.67 ? 389  TRP A O   1 
ATOM   1564 C  CB  . TRP A 1 215 ? -44.638 20.664 -1.660  1.00 14.90 ? 389  TRP A CB  1 
ATOM   1565 C  CG  . TRP A 1 215 ? -43.845 21.266 -0.528  1.00 13.56 ? 389  TRP A CG  1 
ATOM   1566 C  CD1 . TRP A 1 215 ? -43.702 20.764 0.736   1.00 16.74 ? 389  TRP A CD1 1 
ATOM   1567 C  CD2 . TRP A 1 215 ? -43.101 22.489 -0.561  1.00 14.15 ? 389  TRP A CD2 1 
ATOM   1568 N  NE1 . TRP A 1 215 ? -42.914 21.607 1.498   1.00 13.90 ? 389  TRP A NE1 1 
ATOM   1569 C  CE2 . TRP A 1 215 ? -42.534 22.671 0.725   1.00 14.21 ? 389  TRP A CE2 1 
ATOM   1570 C  CE3 . TRP A 1 215 ? -42.858 23.452 -1.553  1.00 14.19 ? 389  TRP A CE3 1 
ATOM   1571 C  CZ2 . TRP A 1 215 ? -41.736 23.778 1.045   1.00 15.47 ? 389  TRP A CZ2 1 
ATOM   1572 C  CZ3 . TRP A 1 215 ? -42.063 24.556 -1.236  1.00 16.61 ? 389  TRP A CZ3 1 
ATOM   1573 C  CH2 . TRP A 1 215 ? -41.511 24.707 0.058   1.00 16.60 ? 389  TRP A CH2 1 
ATOM   1574 N  N   . TYR A 1 216 ? -45.320 17.597 -2.817  1.00 15.07 ? 390  TYR A N   1 
ATOM   1575 C  CA  . TYR A 1 216 ? -46.334 16.818 -3.521  1.00 18.69 ? 390  TYR A CA  1 
ATOM   1576 C  C   . TYR A 1 216 ? -47.690 16.898 -2.823  1.00 19.74 ? 390  TYR A C   1 
ATOM   1577 O  O   . TYR A 1 216 ? -47.772 16.811 -1.594  1.00 18.41 ? 390  TYR A O   1 
ATOM   1578 C  CB  . TYR A 1 216 ? -45.898 15.356 -3.656  1.00 19.19 ? 390  TYR A CB  1 
ATOM   1579 C  CG  . TYR A 1 216 ? -44.769 15.182 -4.645  1.00 20.86 ? 390  TYR A CG  1 
ATOM   1580 C  CD1 . TYR A 1 216 ? -45.034 15.042 -6.007  1.00 23.36 ? 390  TYR A CD1 1 
ATOM   1581 C  CD2 . TYR A 1 216 ? -43.437 15.247 -4.236  1.00 22.36 ? 390  TYR A CD2 1 
ATOM   1582 C  CE1 . TYR A 1 216 ? -44.002 14.982 -6.942  1.00 23.03 ? 390  TYR A CE1 1 
ATOM   1583 C  CE2 . TYR A 1 216 ? -42.397 15.185 -5.160  1.00 22.05 ? 390  TYR A CE2 1 
ATOM   1584 C  CZ  . TYR A 1 216 ? -42.689 15.058 -6.513  1.00 23.95 ? 390  TYR A CZ  1 
ATOM   1585 O  OH  . TYR A 1 216 ? -41.672 15.051 -7.444  1.00 25.03 ? 390  TYR A OH  1 
ATOM   1586 N  N   . PHE A 1 217 ? -48.744 17.051 -3.625  1.00 21.55 ? 391  PHE A N   1 
ATOM   1587 C  CA  . PHE A 1 217 ? -50.115 17.160 -3.129  1.00 22.02 ? 391  PHE A CA  1 
ATOM   1588 C  C   . PHE A 1 217 ? -50.887 15.847 -3.026  1.00 22.25 ? 391  PHE A C   1 
ATOM   1589 O  O   . PHE A 1 217 ? -50.782 14.987 -3.894  1.00 22.35 ? 391  PHE A O   1 
ATOM   1590 C  CB  . PHE A 1 217 ? -50.949 18.082 -4.029  1.00 21.15 ? 391  PHE A CB  1 
ATOM   1591 C  CG  . PHE A 1 217 ? -50.520 19.516 -4.018  1.00 23.42 ? 391  PHE A CG  1 
ATOM   1592 C  CD1 . PHE A 1 217 ? -50.852 20.346 -2.950  1.00 24.43 ? 391  PHE A CD1 1 
ATOM   1593 C  CD2 . PHE A 1 217 ? -49.813 20.053 -5.091  1.00 23.66 ? 391  PHE A CD2 1 
ATOM   1594 C  CE1 . PHE A 1 217 ? -50.486 21.694 -2.953  1.00 23.48 ? 391  PHE A CE1 1 
ATOM   1595 C  CE2 . PHE A 1 217 ? -49.446 21.399 -5.100  1.00 20.03 ? 391  PHE A CE2 1 
ATOM   1596 C  CZ  . PHE A 1 217 ? -49.780 22.217 -4.035  1.00 21.89 ? 391  PHE A CZ  1 
ATOM   1597 N  N   . ASP A 1 218 ? -51.667 15.711 -1.956  1.00 22.13 ? 392  ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 218 ? -52.533 14.551 -1.775  1.00 22.16 ? 392  ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 218 ? -53.851 14.967 -2.439  1.00 21.60 ? 392  ASP A C   1 
ATOM   1600 O  O   . ASP A 1 218 ? -54.366 16.056 -2.169  1.00 18.69 ? 392  ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 218 ? -52.794 14.267 -0.296  1.00 23.13 ? 392  ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 218 ? -53.923 13.264 -0.094  1.00 24.42 ? 392  ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 218 ? -53.750 12.095 -0.492  1.00 22.48 ? 392  ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 218 ? -54.986 13.643 0.446   1.00 21.16 ? 392  ASP A OD2 1 
ATOM   1605 N  N   . ALA A 1 219 ? -54.395 14.102 -3.290  1.00 21.18 ? 393  ALA A N   1 
ATOM   1606 C  CA  . ALA A 1 219 ? -55.631 14.398 -4.018  1.00 22.31 ? 393  ALA A CA  1 
ATOM   1607 C  C   . ALA A 1 219 ? -56.801 14.869 -3.150  1.00 21.52 ? 393  ALA A C   1 
ATOM   1608 O  O   . ALA A 1 219 ? -57.409 15.908 -3.416  1.00 21.24 ? 393  ALA A O   1 
ATOM   1609 C  CB  . ALA A 1 219 ? -56.060 13.174 -4.835  1.00 20.80 ? 393  ALA A CB  1 
ATOM   1610 N  N   . ASP A 1 220 ? -57.118 14.105 -2.117  1.00 20.59 ? 394  ASP A N   1 
ATOM   1611 C  CA  . ASP A 1 220 ? -58.235 14.461 -1.263  1.00 21.12 ? 394  ASP A CA  1 
ATOM   1612 C  C   . ASP A 1 220 ? -58.017 15.738 -0.465  1.00 19.94 ? 394  ASP A C   1 
ATOM   1613 O  O   . ASP A 1 220 ? -58.849 16.643 -0.498  1.00 17.72 ? 394  ASP A O   1 
ATOM   1614 C  CB  . ASP A 1 220 ? -58.567 13.312 -0.315  1.00 20.20 ? 394  ASP A CB  1 
ATOM   1615 C  CG  . ASP A 1 220 ? -59.738 13.634 0.592   1.00 21.58 ? 394  ASP A CG  1 
ATOM   1616 O  OD1 . ASP A 1 220 ? -59.514 14.254 1.652   1.00 20.78 ? 394  ASP A OD1 1 
ATOM   1617 O  OD2 . ASP A 1 220 ? -60.883 13.284 0.231   1.00 17.84 ? 394  ASP A OD2 1 
ATOM   1618 N  N   . GLU A 1 221 ? -56.897 15.813 0.248   1.00 21.53 ? 395  GLU A N   1 
ATOM   1619 C  CA  . GLU A 1 221 ? -56.611 16.988 1.061   1.00 21.97 ? 395  GLU A CA  1 
ATOM   1620 C  C   . GLU A 1 221 ? -56.634 18.256 0.217   1.00 22.54 ? 395  GLU A C   1 
ATOM   1621 O  O   . GLU A 1 221 ? -57.171 19.282 0.632   1.00 21.57 ? 395  GLU A O   1 
ATOM   1622 C  CB  . GLU A 1 221 ? -55.245 16.855 1.738   1.00 22.81 ? 395  GLU A CB  1 
ATOM   1623 C  CG  . GLU A 1 221 ? -55.039 17.849 2.871   1.00 24.05 ? 395  GLU A CG  1 
ATOM   1624 C  CD  . GLU A 1 221 ? -53.643 17.787 3.466   1.00 23.41 ? 395  GLU A CD  1 
ATOM   1625 O  OE1 . GLU A 1 221 ? -53.127 16.666 3.663   1.00 25.87 ? 395  GLU A OE1 1 
ATOM   1626 O  OE2 . GLU A 1 221 ? -53.070 18.864 3.740   1.00 22.01 ? 395  GLU A OE2 1 
ATOM   1627 N  N   . ARG A 1 222 ? -56.054 18.174 -0.973  1.00 22.85 ? 396  ARG A N   1 
ATOM   1628 C  CA  . ARG A 1 222 ? -55.998 19.318 -1.870  1.00 25.23 ? 396  ARG A CA  1 
ATOM   1629 C  C   . ARG A 1 222 ? -57.389 19.698 -2.378  1.00 24.60 ? 396  ARG A C   1 
ATOM   1630 O  O   . ARG A 1 222 ? -57.720 20.878 -2.471  1.00 22.75 ? 396  ARG A O   1 
ATOM   1631 C  CB  . ARG A 1 222 ? -55.067 19.005 -3.047  1.00 28.25 ? 396  ARG A CB  1 
ATOM   1632 C  CG  . ARG A 1 222 ? -54.776 20.187 -3.959  1.00 34.02 ? 396  ARG A CG  1 
ATOM   1633 C  CD  . ARG A 1 222 ? -54.235 21.374 -3.164  1.00 39.29 ? 396  ARG A CD  1 
ATOM   1634 N  NE  . ARG A 1 222 ? -53.821 22.480 -4.026  1.00 44.35 ? 396  ARG A NE  1 
ATOM   1635 C  CZ  . ARG A 1 222 ? -53.603 23.721 -3.599  1.00 46.09 ? 396  ARG A CZ  1 
ATOM   1636 N  NH1 . ARG A 1 222 ? -53.763 24.028 -2.314  1.00 45.04 ? 396  ARG A NH1 1 
ATOM   1637 N  NH2 . ARG A 1 222 ? -53.225 24.659 -4.458  1.00 46.24 ? 396  ARG A NH2 1 
ATOM   1638 N  N   . ALA A 1 223 ? -58.202 18.697 -2.701  1.00 24.28 ? 397  ALA A N   1 
ATOM   1639 C  CA  . ALA A 1 223 ? -59.554 18.952 -3.194  1.00 24.87 ? 397  ALA A CA  1 
ATOM   1640 C  C   . ALA A 1 223 ? -60.408 19.715 -2.181  1.00 25.21 ? 397  ALA A C   1 
ATOM   1641 O  O   . ALA A 1 223 ? -61.092 20.664 -2.544  1.00 26.71 ? 397  ALA A O   1 
ATOM   1642 C  CB  . ALA A 1 223 ? -60.241 17.637 -3.563  1.00 22.58 ? 397  ALA A CB  1 
ATOM   1643 N  N   . ARG A 1 224 ? -60.371 19.305 -0.915  1.00 25.37 ? 398  ARG A N   1 
ATOM   1644 C  CA  . ARG A 1 224 ? -61.173 19.981 0.095   1.00 25.80 ? 398  ARG A CA  1 
ATOM   1645 C  C   . ARG A 1 224 ? -60.487 21.242 0.606   1.00 27.64 ? 398  ARG A C   1 
ATOM   1646 O  O   . ARG A 1 224 ? -61.112 22.069 1.264   1.00 26.82 ? 398  ARG A O   1 
ATOM   1647 C  CB  . ARG A 1 224 ? -61.503 19.034 1.255   1.00 21.07 ? 398  ARG A CB  1 
ATOM   1648 C  CG  . ARG A 1 224 ? -60.317 18.601 2.099   1.00 21.87 ? 398  ARG A CG  1 
ATOM   1649 C  CD  . ARG A 1 224 ? -60.707 17.506 3.106   1.00 18.98 ? 398  ARG A CD  1 
ATOM   1650 N  NE  . ARG A 1 224 ? -61.226 16.314 2.436   1.00 18.41 ? 398  ARG A NE  1 
ATOM   1651 C  CZ  . ARG A 1 224 ? -62.520 16.010 2.322   1.00 16.43 ? 398  ARG A CZ  1 
ATOM   1652 N  NH1 . ARG A 1 224 ? -63.446 16.799 2.843   1.00 16.75 ? 398  ARG A NH1 1 
ATOM   1653 N  NH2 . ARG A 1 224 ? -62.891 14.928 1.654   1.00 18.58 ? 398  ARG A NH2 1 
ATOM   1654 N  N   . ALA A 1 225 ? -59.203 21.393 0.300   1.00 30.36 ? 399  ALA A N   1 
ATOM   1655 C  CA  . ALA A 1 225 ? -58.481 22.591 0.722   1.00 33.86 ? 399  ALA A CA  1 
ATOM   1656 C  C   . ALA A 1 225 ? -59.123 23.755 -0.028  1.00 36.79 ? 399  ALA A C   1 
ATOM   1657 O  O   . ALA A 1 225 ? -59.280 24.843 0.512   1.00 36.78 ? 399  ALA A O   1 
ATOM   1658 C  CB  . ALA A 1 225 ? -56.999 22.483 0.363   1.00 32.43 ? 399  ALA A CB  1 
ATOM   1659 N  N   . LYS A 1 226 ? -59.491 23.503 -1.282  1.00 40.73 ? 400  LYS A N   1 
ATOM   1660 C  CA  . LYS A 1 226 ? -60.132 24.510 -2.118  1.00 45.34 ? 400  LYS A CA  1 
ATOM   1661 C  C   . LYS A 1 226 ? -61.306 25.133 -1.373  1.00 47.33 ? 400  LYS A C   1 
ATOM   1662 O  O   . LYS A 1 226 ? -61.453 26.354 -1.337  1.00 49.00 ? 400  LYS A O   1 
ATOM   1663 C  CB  . LYS A 1 226 ? -60.639 23.881 -3.421  1.00 45.61 ? 400  LYS A CB  1 
ATOM   1664 C  CG  . LYS A 1 226 ? -59.654 23.904 -4.575  1.00 46.89 ? 400  LYS A CG  1 
ATOM   1665 C  CD  . LYS A 1 226 ? -58.337 23.231 -4.235  1.00 47.68 ? 400  LYS A CD  1 
ATOM   1666 C  CE  . LYS A 1 226 ? -57.465 23.116 -5.474  1.00 47.23 ? 400  LYS A CE  1 
ATOM   1667 N  NZ  . LYS A 1 226 ? -58.157 22.331 -6.537  1.00 47.69 ? 400  LYS A NZ  1 
ATOM   1668 N  N   . VAL A 1 227 ? -62.138 24.284 -0.780  1.00 48.63 ? 401  VAL A N   1 
ATOM   1669 C  CA  . VAL A 1 227 ? -63.299 24.749 -0.030  1.00 50.98 ? 401  VAL A CA  1 
ATOM   1670 C  C   . VAL A 1 227 ? -62.866 25.770 1.020   1.00 52.50 ? 401  VAL A C   1 
ATOM   1671 O  O   . VAL A 1 227 ? -63.208 26.947 0.936   1.00 53.39 ? 401  VAL A O   1 
ATOM   1672 C  CB  . VAL A 1 227 ? -64.000 23.580 0.699   1.00 51.20 ? 401  VAL A CB  1 
ATOM   1673 C  CG1 . VAL A 1 227 ? -65.320 24.047 1.277   1.00 51.79 ? 401  VAL A CG1 1 
ATOM   1674 C  CG2 . VAL A 1 227 ? -64.205 22.413 -0.252  1.00 50.95 ? 401  VAL A CG2 1 
ATOM   1675 N  N   . LYS A 1 228 ? -62.098 25.300 2.001   1.00 52.52 ? 402  LYS A N   1 
ATOM   1676 C  CA  . LYS A 1 228 ? -61.610 26.140 3.091   1.00 52.54 ? 402  LYS A CA  1 
ATOM   1677 C  C   . LYS A 1 228 ? -60.593 27.193 2.663   1.00 52.53 ? 402  LYS A C   1 
ATOM   1678 O  O   . LYS A 1 228 ? -60.265 28.088 3.439   1.00 52.03 ? 402  LYS A O   1 
ATOM   1679 C  CB  . LYS A 1 228 ? -60.986 25.265 4.181   1.00 53.18 ? 402  LYS A CB  1 
ATOM   1680 N  N   . TYR A 1 229 ? -60.100 27.086 1.431   1.00 51.41 ? 403  TYR A N   1 
ATOM   1681 C  CA  . TYR A 1 229 ? -59.105 28.021 0.918   1.00 49.92 ? 403  TYR A CA  1 
ATOM   1682 C  C   . TYR A 1 229 ? -57.857 28.010 1.796   1.00 50.52 ? 403  TYR A C   1 
ATOM   1683 O  O   . TYR A 1 229 ? -57.219 29.043 1.993   1.00 51.46 ? 403  TYR A O   1 
ATOM   1684 C  CB  . TYR A 1 229 ? -59.663 29.445 0.864   1.00 48.29 ? 403  TYR A CB  1 
ATOM   1685 C  CG  . TYR A 1 229 ? -60.649 29.694 -0.252  1.00 47.05 ? 403  TYR A CG  1 
ATOM   1686 C  CD1 . TYR A 1 229 ? -60.214 29.838 -1.570  1.00 45.60 ? 403  TYR A CD1 1 
ATOM   1687 C  CD2 . TYR A 1 229 ? -62.017 29.796 0.007   1.00 46.22 ? 403  TYR A CD2 1 
ATOM   1688 C  CE1 . TYR A 1 229 ? -61.118 30.080 -2.603  1.00 45.96 ? 403  TYR A CE1 1 
ATOM   1689 C  CE2 . TYR A 1 229 ? -62.929 30.040 -1.018  1.00 45.87 ? 403  TYR A CE2 1 
ATOM   1690 C  CZ  . TYR A 1 229 ? -62.473 30.180 -2.318  1.00 44.96 ? 403  TYR A CZ  1 
ATOM   1691 O  OH  . TYR A 1 229 ? -63.371 30.425 -3.328  1.00 46.30 ? 403  TYR A OH  1 
HETATM 1692 ZN ZN  . ZN  B 2 .   ? -39.438 23.394 5.840   1.00 17.99 ? 900  ZN  A ZN  1 
HETATM 1693 O  O18 . UN9 C 3 .   ? -33.222 23.468 3.346   1.00 16.71 ? 901  UN9 A O18 1 
HETATM 1694 C  C16 . UN9 C 3 .   ? -33.395 22.649 4.274   1.00 15.79 ? 901  UN9 A C16 1 
HETATM 1695 O  O17 . UN9 C 3 .   ? -32.615 21.729 4.601   1.00 15.56 ? 901  UN9 A O17 1 
HETATM 1696 C  C15 . UN9 C 3 .   ? -34.678 22.787 5.098   1.00 16.65 ? 901  UN9 A C15 1 
HETATM 1697 N  N14 . UN9 C 3 .   ? -35.497 23.896 4.589   1.00 15.71 ? 901  UN9 A N14 1 
HETATM 1698 C  C12 . UN9 C 3 .   ? -36.744 24.059 5.021   1.00 16.10 ? 901  UN9 A C12 1 
HETATM 1699 O  O13 . UN9 C 3 .   ? -37.275 23.326 5.852   1.00 17.64 ? 901  UN9 A O13 1 
HETATM 1700 C  C9  . UN9 C 3 .   ? -37.526 25.237 4.439   1.00 15.90 ? 901  UN9 A C9  1 
HETATM 1701 N  N8  . UN9 C 3 .   ? -38.851 25.259 4.634   1.00 18.38 ? 901  UN9 A N8  1 
HETATM 1702 C  C7  . UN9 C 3 .   ? -39.620 26.243 4.153   1.00 15.62 ? 901  UN9 A C7  1 
HETATM 1703 CL CL1 . UN9 C 3 .   ? -41.328 26.153 4.424   1.00 21.69 ? 901  UN9 A CL1 1 
HETATM 1704 C  C2  . UN9 C 3 .   ? -39.050 27.289 3.436   1.00 17.85 ? 901  UN9 A C2  1 
HETATM 1705 C  C10 . UN9 C 3 .   ? -36.904 26.254 3.722   1.00 19.24 ? 901  UN9 A C10 1 
HETATM 1706 O  O19 . UN9 C 3 .   ? -35.559 26.227 3.512   1.00 17.15 ? 901  UN9 A O19 1 
HETATM 1707 C  C3  . UN9 C 3 .   ? -37.677 27.293 3.220   1.00 18.54 ? 901  UN9 A C3  1 
HETATM 1708 C  C4  . UN9 C 3 .   ? -37.092 28.331 2.501   1.00 19.87 ? 901  UN9 A C4  1 
HETATM 1709 C  C5  . UN9 C 3 .   ? -37.880 29.364 2.001   1.00 20.76 ? 901  UN9 A C5  1 
HETATM 1710 C  C6  . UN9 C 3 .   ? -39.252 29.359 2.215   1.00 20.95 ? 901  UN9 A C6  1 
HETATM 1711 C  C1  . UN9 C 3 .   ? -39.837 28.321 2.934   1.00 18.02 ? 901  UN9 A C1  1 
HETATM 1712 O  O   . HOH D 4 .   ? -37.594 1.972  -12.896 1.00 39.50 ? 2001 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? -42.077 -0.292 6.666   1.00 45.24 ? 2002 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? -44.585 7.147  8.835   1.00 38.02 ? 2003 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? -38.569 -2.582 13.169  1.00 50.33 ? 2004 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? -32.536 9.915  9.177   1.00 49.26 ? 2005 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? -28.021 7.738  3.984   1.00 45.45 ? 2006 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? -28.531 5.417  -4.616  1.00 52.80 ? 2007 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? -28.953 6.003  -0.272  1.00 49.10 ? 2008 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? -23.038 11.584 -6.148  1.00 27.27 ? 2009 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? -30.102 6.652  -7.429  1.00 49.53 ? 2010 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? -24.686 11.904 -13.139 1.00 43.34 ? 2011 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? -20.718 17.750 -14.648 1.00 46.17 ? 2012 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? -22.554 28.668 -12.694 1.00 26.79 ? 2013 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? -20.563 28.130 -11.088 1.00 48.71 ? 2014 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? -20.895 21.648 -8.012  1.00 55.02 ? 2015 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? -22.081 24.484 -5.551  1.00 56.36 ? 2016 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? -22.046 26.642 -4.381  1.00 47.22 ? 2017 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? -25.961 35.454 -1.637  1.00 52.02 ? 2018 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? -29.562 36.212 -7.126  1.00 27.40 ? 2019 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? -21.884 38.135 -11.255 1.00 40.00 ? 2020 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? -21.996 31.605 -12.388 1.00 43.25 ? 2021 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? -34.965 38.650 -9.019  1.00 56.34 ? 2022 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? -36.425 35.867 -10.625 1.00 50.53 ? 2023 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? -37.114 35.150 -7.403  1.00 39.59 ? 2024 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? -29.997 38.493 -5.255  1.00 54.73 ? 2025 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? -32.901 40.168 -5.606  1.00 43.48 ? 2026 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? -35.877 40.622 -3.126  1.00 27.26 ? 2027 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? -39.913 32.146 9.136   1.00 44.37 ? 2028 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? -41.709 45.813 10.804  1.00 49.88 ? 2029 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? -38.666 49.247 6.085   1.00 43.16 ? 2030 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? -27.863 40.558 5.149   1.00 29.38 ? 2031 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? -27.707 38.711 2.867   1.00 37.62 ? 2032 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? -29.918 37.197 1.959   1.00 22.00 ? 2033 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? -33.631 32.629 6.562   1.00 39.47 ? 2034 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? -36.195 32.157 -13.687 1.00 55.19 ? 2035 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? -39.192 33.454 -8.203  1.00 36.03 ? 2036 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? -43.142 22.722 -12.858 1.00 32.35 ? 2037 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? -37.216 20.414 -19.103 1.00 43.00 ? 2038 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? -40.329 19.819 -15.405 1.00 55.47 ? 2039 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? -34.050 31.743 -17.593 1.00 55.78 ? 2040 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? -30.409 24.800 -19.086 1.00 54.63 ? 2041 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? -29.081 28.793 -14.808 1.00 36.40 ? 2042 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? -27.162 28.125 -16.698 1.00 42.96 ? 2043 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? -35.440 18.660 -18.544 1.00 34.05 ? 2044 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? -21.172 28.908 -3.992  1.00 49.95 ? 2045 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? -36.943 37.856 -7.316  1.00 55.29 ? 2046 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? -35.555 41.041 -5.919  1.00 44.00 ? 2047 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? -36.093 8.786  -10.785 1.00 44.17 ? 2048 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? -35.900 9.110  -13.754 1.00 45.35 ? 2049 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? -45.075 2.663  -11.687 1.00 60.48 ? 2050 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? -39.948 5.069  -14.535 1.00 54.33 ? 2051 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? -29.971 31.411 -15.795 1.00 56.97 ? 2052 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? -49.234 6.815  -2.069  1.00 50.65 ? 2053 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? -52.038 8.092  5.206   1.00 37.96 ? 2054 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? -52.234 13.780 6.418   1.00 49.40 ? 2055 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? -53.039 19.429 -7.584  1.00 55.55 ? 2056 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? -45.203 28.652 -6.814  1.00 51.47 ? 2057 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? -41.630 30.641 -11.882 1.00 55.91 ? 2058 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? -45.864 26.165 -7.278  1.00 26.47 ? 2059 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? -28.978 36.988 12.362  1.00 54.67 ? 2060 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? -30.413 34.635 12.482  1.00 56.16 ? 2061 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? -43.855 28.602 4.968   1.00 50.83 ? 2062 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? -33.859 29.234 15.083  1.00 39.80 ? 2063 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? -46.790 21.607 15.758  1.00 53.64 ? 2064 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? -46.116 27.982 9.650   1.00 50.83 ? 2065 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? -46.982 25.240 13.007  1.00 57.05 ? 2066 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? -57.914 18.576 5.348   1.00 40.52 ? 2067 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? -23.410 34.189 -0.585  1.00 49.02 ? 2068 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? -23.124 36.459 3.139   1.00 51.24 ? 2069 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? -26.834 31.750 6.010   1.00 20.37 ? 2070 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? -24.734 38.380 10.094  1.00 48.81 ? 2071 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? -26.416 36.637 12.028  1.00 58.08 ? 2072 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? -25.495 39.856 6.633   1.00 45.70 ? 2073 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? -25.868 33.025 13.793  1.00 35.07 ? 2074 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? -35.190 33.299 9.084   1.00 52.57 ? 2075 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? -34.002 32.677 11.364  1.00 41.89 ? 2076 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? -31.866 33.227 10.505  1.00 43.33 ? 2077 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? -42.511 28.736 7.312   1.00 30.00 ? 2078 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? -40.537 31.680 4.561   1.00 21.04 ? 2079 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? -36.864 31.511 9.421   1.00 44.69 ? 2080 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? -43.161 24.357 15.513  1.00 56.30 ? 2081 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? -42.955 28.136 12.692  1.00 39.69 ? 2082 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? -43.360 22.047 16.649  1.00 52.53 ? 2083 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? -37.096 22.752 18.527  1.00 37.41 ? 2084 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? -36.267 28.014 15.795  1.00 26.64 ? 2085 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? -40.532 28.796 15.351  1.00 31.43 ? 2086 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? -39.699 18.900 19.984  1.00 38.16 ? 2087 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? -44.573 26.984 7.282   1.00 43.46 ? 2088 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? -44.945 26.275 11.368  1.00 29.99 ? 2089 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? -50.899 24.940 5.795   1.00 28.11 ? 2090 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? -57.529 20.211 3.342   1.00 26.21 ? 2091 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? -51.819 20.005 7.929   1.00 28.17 ? 2092 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? -50.750 27.072 2.782   1.00 47.29 ? 2093 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? -48.197 26.817 4.930   1.00 54.90 ? 2094 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? -44.316 25.784 3.561   1.00 50.65 ? 2095 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? -25.242 26.572 15.347  1.00 46.58 ? 2096 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? -48.062 15.068 5.568   1.00 17.94 ? 2097 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? -58.055 16.015 5.378   1.00 42.93 ? 2098 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? -55.330 17.931 7.252   1.00 52.95 ? 2099 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? -22.969 21.505 -6.637  1.00 58.95 ? 2100 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? -21.311 17.016 0.649   1.00 50.06 ? 2101 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? -22.638 24.948 -1.973  1.00 30.23 ? 2102 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? -21.064 22.911 -3.872  1.00 45.47 ? 2103 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? -20.371 23.190 0.271   1.00 40.90 ? 2104 HOH A O   1 
HETATM 1816 O  O   . HOH D 4 .   ? -19.321 16.114 -1.926  1.00 45.60 ? 2105 HOH A O   1 
HETATM 1817 O  O   . HOH D 4 .   ? -18.499 23.788 2.505   1.00 49.68 ? 2106 HOH A O   1 
HETATM 1818 O  O   . HOH D 4 .   ? -22.984 21.977 12.963  1.00 46.51 ? 2107 HOH A O   1 
HETATM 1819 O  O   . HOH D 4 .   ? -18.277 22.914 4.825   1.00 41.72 ? 2108 HOH A O   1 
HETATM 1820 O  O   . HOH D 4 .   ? -17.075 27.180 5.390   1.00 43.36 ? 2109 HOH A O   1 
HETATM 1821 O  O   . HOH D 4 .   ? -42.560 17.122 18.367  1.00 56.91 ? 2110 HOH A O   1 
HETATM 1822 O  O   . HOH D 4 .   ? -29.527 12.118 13.571  1.00 48.49 ? 2111 HOH A O   1 
HETATM 1823 O  O   . HOH D 4 .   ? -25.390 12.241 -1.672  1.00 28.84 ? 2112 HOH A O   1 
HETATM 1824 O  O   . HOH D 4 .   ? -21.823 14.135 -1.304  1.00 45.22 ? 2113 HOH A O   1 
HETATM 1825 O  O   . HOH D 4 .   ? -26.371 13.628 7.521   1.00 40.40 ? 2114 HOH A O   1 
HETATM 1826 O  O   . HOH D 4 .   ? -43.254 19.722 8.127   1.00 17.74 ? 2115 HOH A O   1 
HETATM 1827 O  O   . HOH D 4 .   ? -51.872 15.565 7.931   1.00 43.00 ? 2116 HOH A O   1 
HETATM 1828 O  O   . HOH D 4 .   ? -50.771 18.732 10.255  1.00 41.30 ? 2117 HOH A O   1 
HETATM 1829 O  O   . HOH D 4 .   ? -45.744 19.194 15.645  1.00 45.20 ? 2118 HOH A O   1 
HETATM 1830 O  O   . HOH D 4 .   ? -41.752 11.437 10.805  1.00 36.71 ? 2119 HOH A O   1 
HETATM 1831 O  O   . HOH D 4 .   ? -35.914 25.853 17.697  1.00 42.41 ? 2120 HOH A O   1 
HETATM 1832 O  O   . HOH D 4 .   ? -32.031 28.517 13.244  1.00 53.22 ? 2121 HOH A O   1 
HETATM 1833 O  O   . HOH D 4 .   ? -25.491 23.163 12.023  1.00 24.70 ? 2122 HOH A O   1 
HETATM 1834 O  O   . HOH D 4 .   ? -30.873 23.448 16.164  1.00 47.37 ? 2123 HOH A O   1 
HETATM 1835 O  O   . HOH D 4 .   ? -25.341 25.814 12.792  1.00 29.89 ? 2124 HOH A O   1 
HETATM 1836 O  O   . HOH D 4 .   ? -17.534 29.587 4.568   1.00 45.53 ? 2125 HOH A O   1 
HETATM 1837 O  O   . HOH D 4 .   ? -19.648 32.655 7.348   1.00 50.01 ? 2126 HOH A O   1 
HETATM 1838 O  O   . HOH D 4 .   ? -23.954 29.261 14.877  1.00 56.86 ? 2127 HOH A O   1 
HETATM 1839 O  O   . HOH D 4 .   ? -19.520 30.066 0.904   1.00 46.89 ? 2128 HOH A O   1 
HETATM 1840 O  O   . HOH D 4 .   ? -20.368 26.762 -0.456  1.00 56.63 ? 2129 HOH A O   1 
HETATM 1841 O  O   . HOH D 4 .   ? -30.286 25.725 1.156   1.00 26.43 ? 2130 HOH A O   1 
HETATM 1842 O  O   . HOH D 4 .   ? -22.611 30.617 -5.053  1.00 44.63 ? 2131 HOH A O   1 
HETATM 1843 O  O   . HOH D 4 .   ? -35.106 24.437 -1.177  1.00 15.57 ? 2132 HOH A O   1 
HETATM 1844 O  O   . HOH D 4 .   ? -37.773 23.448 1.944   1.00 15.72 ? 2133 HOH A O   1 
HETATM 1845 O  O   . HOH D 4 .   ? -55.460 12.748 2.922   1.00 26.33 ? 2134 HOH A O   1 
HETATM 1846 O  O   . HOH D 4 .   ? -56.056 10.873 -1.195  1.00 31.86 ? 2135 HOH A O   1 
HETATM 1847 O  O   . HOH D 4 .   ? -56.901 16.929 -5.780  1.00 35.83 ? 2136 HOH A O   1 
HETATM 1848 O  O   . HOH D 4 .   ? -57.946 14.088 3.877   1.00 28.03 ? 2137 HOH A O   1 
HETATM 1849 O  O   . HOH D 4 .   ? -54.337 14.488 4.823   1.00 35.46 ? 2138 HOH A O   1 
HETATM 1850 O  O   . HOH D 4 .   ? -52.525 17.812 6.646   1.00 37.33 ? 2139 HOH A O   1 
HETATM 1851 O  O   . HOH D 4 .   ? -50.805 16.279 4.748   1.00 37.41 ? 2140 HOH A O   1 
HETATM 1852 O  O   . HOH D 4 .   ? -62.986 21.719 3.263   1.00 43.30 ? 2141 HOH A O   1 
HETATM 1853 O  O   . HOH D 4 .   ? -39.268 22.276 3.939   1.00 14.15 ? 2142 HOH A O   1 
HETATM 1854 O  O   . HOH D 4 .   ? -34.186 25.095 1.496   1.00 20.70 ? 2143 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   175 ?   ?   ?   A . n 
A 1 2   SER 2   176 ?   ?   ?   A . n 
A 1 3   HIS 3   177 ?   ?   ?   A . n 
A 1 4   MET 4   178 ?   ?   ?   A . n 
A 1 5   ALA 5   179 ?   ?   ?   A . n 
A 1 6   SER 6   180 ?   ?   ?   A . n 
A 1 7   PRO 7   181 ?   ?   ?   A . n 
A 1 8   ASN 8   182 ?   ?   ?   A . n 
A 1 9   GLY 9   183 ?   ?   ?   A . n 
A 1 10  GLN 10  184 ?   ?   ?   A . n 
A 1 11  THR 11  185 ?   ?   ?   A . n 
A 1 12  LYS 12  186 ?   ?   ?   A . n 
A 1 13  PRO 13  187 ?   ?   ?   A . n 
A 1 14  LEU 14  188 188 LEU LEU A . n 
A 1 15  PRO 15  189 189 PRO PRO A . n 
A 1 16  ALA 16  190 190 ALA ALA A . n 
A 1 17  LEU 17  191 191 LEU LEU A . n 
A 1 18  LYS 18  192 192 LYS LYS A . n 
A 1 19  LEU 19  193 193 LEU LEU A . n 
A 1 20  ALA 20  194 194 ALA ALA A . n 
A 1 21  LEU 21  195 195 LEU LEU A . n 
A 1 22  GLU 22  196 196 GLU GLU A . n 
A 1 23  TYR 23  197 197 TYR TYR A . n 
A 1 24  ILE 24  198 198 ILE ILE A . n 
A 1 25  VAL 25  199 199 VAL VAL A . n 
A 1 26  PRO 26  200 200 PRO PRO A . n 
A 1 27  CYS 27  201 201 CYS CYS A . n 
A 1 28  MET 28  202 202 MET MET A . n 
A 1 29  ASN 29  203 203 ASN ASN A . n 
A 1 30  LYS 30  204 204 LYS LYS A . n 
A 1 31  HIS 31  205 205 HIS HIS A . n 
A 1 32  GLY 32  206 206 GLY GLY A . n 
A 1 33  ILE 33  207 207 ILE ILE A . n 
A 1 34  CYS 34  208 208 CYS CYS A . n 
A 1 35  VAL 35  209 209 VAL VAL A . n 
A 1 36  VAL 36  210 210 VAL VAL A . n 
A 1 37  ASP 37  211 211 ASP ASP A . n 
A 1 38  ASP 38  212 212 ASP ASP A . n 
A 1 39  PHE 39  213 213 PHE PHE A . n 
A 1 40  LEU 40  214 214 LEU LEU A . n 
A 1 41  GLY 41  215 215 GLY GLY A . n 
A 1 42  LYS 42  216 216 LYS LYS A . n 
A 1 43  GLU 43  217 217 GLU GLU A . n 
A 1 44  THR 44  218 218 THR THR A . n 
A 1 45  GLY 45  219 219 GLY GLY A . n 
A 1 46  GLN 46  220 220 GLN GLN A . n 
A 1 47  GLN 47  221 221 GLN GLN A . n 
A 1 48  ILE 48  222 222 ILE ILE A . n 
A 1 49  GLY 49  223 223 GLY GLY A . n 
A 1 50  ASP 50  224 224 ASP ASP A . n 
A 1 51  GLU 51  225 225 GLU GLU A . n 
A 1 52  VAL 52  226 226 VAL VAL A . n 
A 1 53  ARG 53  227 227 ARG ARG A . n 
A 1 54  ALA 54  228 228 ALA ALA A . n 
A 1 55  LEU 55  229 229 LEU LEU A . n 
A 1 56  HIS 56  230 230 HIS HIS A . n 
A 1 57  ASP 57  231 231 ASP ASP A . n 
A 1 58  THR 58  232 232 THR THR A . n 
A 1 59  GLY 59  233 233 GLY GLY A . n 
A 1 60  LYS 60  234 234 LYS LYS A . n 
A 1 61  PHE 61  235 235 PHE PHE A . n 
A 1 62  THR 62  236 236 THR THR A . n 
A 1 63  ASP 63  237 237 ASP ASP A . n 
A 1 64  GLY 64  238 238 GLY GLY A . n 
A 1 65  GLN 65  239 239 GLN GLN A . n 
A 1 66  LEU 66  240 240 LEU LEU A . n 
A 1 67  VAL 67  241 241 VAL VAL A . n 
A 1 68  SER 68  242 242 SER SER A . n 
A 1 69  GLN 69  243 243 GLN GLN A . n 
A 1 70  LYS 70  244 244 LYS LYS A . n 
A 1 71  SER 71  245 245 SER SER A . n 
A 1 72  ASP 72  246 246 ASP ASP A . n 
A 1 73  SER 73  247 247 SER SER A . n 
A 1 74  SER 74  248 248 SER SER A . n 
A 1 75  LYS 75  249 249 LYS LYS A . n 
A 1 76  ASP 76  250 250 ASP ASP A . n 
A 1 77  ILE 77  251 251 ILE ILE A . n 
A 1 78  ARG 78  252 252 ARG ARG A . n 
A 1 79  GLY 79  253 253 GLY GLY A . n 
A 1 80  ASP 80  254 254 ASP ASP A . n 
A 1 81  LYS 81  255 255 LYS LYS A . n 
A 1 82  ILE 82  256 256 ILE ILE A . n 
A 1 83  THR 83  257 257 THR THR A . n 
A 1 84  TRP 84  258 258 TRP TRP A . n 
A 1 85  ILE 85  259 259 ILE ILE A . n 
A 1 86  GLU 86  260 260 GLU GLU A . n 
A 1 87  GLY 87  261 261 GLY GLY A . n 
A 1 88  LYS 88  262 262 LYS LYS A . n 
A 1 89  GLU 89  263 263 GLU GLU A . n 
A 1 90  PRO 90  264 264 PRO PRO A . n 
A 1 91  GLY 91  265 265 GLY GLY A . n 
A 1 92  CYS 92  266 266 CYS CYS A . n 
A 1 93  GLU 93  267 267 GLU GLU A . n 
A 1 94  THR 94  268 268 THR THR A . n 
A 1 95  ILE 95  269 269 ILE ILE A . n 
A 1 96  GLY 96  270 270 GLY GLY A . n 
A 1 97  LEU 97  271 271 LEU LEU A . n 
A 1 98  LEU 98  272 272 LEU LEU A . n 
A 1 99  MET 99  273 273 MET MET A . n 
A 1 100 SER 100 274 274 SER SER A . n 
A 1 101 SER 101 275 275 SER SER A . n 
A 1 102 MET 102 276 276 MET MET A . n 
A 1 103 ASP 103 277 277 ASP ASP A . n 
A 1 104 ASP 104 278 278 ASP ASP A . n 
A 1 105 LEU 105 279 279 LEU LEU A . n 
A 1 106 ILE 106 280 280 ILE ILE A . n 
A 1 107 ARG 107 281 281 ARG ARG A . n 
A 1 108 HIS 108 282 282 HIS HIS A . n 
A 1 109 CYS 109 283 283 CYS CYS A . n 
A 1 110 ASN 110 284 284 ASN ASN A . n 
A 1 111 GLY 111 285 285 GLY GLY A . n 
A 1 112 LYS 112 286 286 LYS LYS A . n 
A 1 113 LEU 113 287 287 LEU LEU A . n 
A 1 114 GLY 114 288 288 GLY GLY A . n 
A 1 115 SER 115 289 289 SER SER A . n 
A 1 116 TYR 116 290 290 TYR TYR A . n 
A 1 117 LYS 117 291 291 LYS LYS A . n 
A 1 118 ILE 118 292 292 ILE ILE A . n 
A 1 119 ASN 119 293 293 ASN ASN A . n 
A 1 120 GLY 120 294 294 GLY GLY A . n 
A 1 121 ARG 121 295 295 ARG ARG A . n 
A 1 122 THR 122 296 296 THR THR A . n 
A 1 123 LYS 123 297 297 LYS LYS A . n 
A 1 124 ALA 124 298 298 ALA ALA A . n 
A 1 125 MET 125 299 299 MET MET A . n 
A 1 126 VAL 126 300 300 VAL VAL A . n 
A 1 127 ALA 127 301 301 ALA ALA A . n 
A 1 128 SNC 128 302 302 SNC SNC A . n 
A 1 129 TYR 129 303 303 TYR TYR A . n 
A 1 130 PRO 130 304 304 PRO PRO A . n 
A 1 131 GLY 131 305 305 GLY GLY A . n 
A 1 132 ASN 132 306 306 ASN ASN A . n 
A 1 133 GLY 133 307 307 GLY GLY A . n 
A 1 134 THR 134 308 308 THR THR A . n 
A 1 135 GLY 135 309 309 GLY GLY A . n 
A 1 136 TYR 136 310 310 TYR TYR A . n 
A 1 137 VAL 137 311 311 VAL VAL A . n 
A 1 138 ARG 138 312 312 ARG ARG A . n 
A 1 139 HIS 139 313 313 HIS HIS A . n 
A 1 140 VAL 140 314 314 VAL VAL A . n 
A 1 141 ASP 141 315 315 ASP ASP A . n 
A 1 142 ASN 142 316 316 ASN ASN A . n 
A 1 143 PRO 143 317 317 PRO PRO A . n 
A 1 144 ASN 144 318 318 ASN ASN A . n 
A 1 145 GLY 145 319 319 GLY GLY A . n 
A 1 146 ASP 146 320 320 ASP ASP A . n 
A 1 147 GLY 147 321 321 GLY GLY A . n 
A 1 148 ARG 148 322 322 ARG ARG A . n 
A 1 149 CYS 149 323 323 CYS CYS A . n 
A 1 150 VAL 150 324 324 VAL VAL A . n 
A 1 151 THR 151 325 325 THR THR A . n 
A 1 152 CYS 152 326 326 CYS CYS A . n 
A 1 153 ILE 153 327 327 ILE ILE A . n 
A 1 154 TYR 154 328 328 TYR TYR A . n 
A 1 155 TYR 155 329 329 TYR TYR A . n 
A 1 156 LEU 156 330 330 LEU LEU A . n 
A 1 157 ASN 157 331 331 ASN ASN A . n 
A 1 158 LYS 158 332 332 LYS LYS A . n 
A 1 159 ASP 159 333 333 ASP ASP A . n 
A 1 160 TRP 160 334 334 TRP TRP A . n 
A 1 161 ASP 161 335 335 ASP ASP A . n 
A 1 162 ALA 162 336 336 ALA ALA A . n 
A 1 163 LYS 163 337 337 LYS LYS A . n 
A 1 164 VAL 164 338 338 VAL VAL A . n 
A 1 165 SER 165 339 339 SER SER A . n 
A 1 166 GLY 166 340 340 GLY GLY A . n 
A 1 167 GLY 167 341 341 GLY GLY A . n 
A 1 168 ILE 168 342 342 ILE ILE A . n 
A 1 169 LEU 169 343 343 LEU LEU A . n 
A 1 170 ARG 170 344 344 ARG ARG A . n 
A 1 171 ILE 171 345 345 ILE ILE A . n 
A 1 172 PHE 172 346 346 PHE PHE A . n 
A 1 173 PRO 173 347 347 PRO PRO A . n 
A 1 174 GLU 174 348 348 GLU GLU A . n 
A 1 175 GLY 175 349 349 GLY GLY A . n 
A 1 176 LYS 176 350 350 LYS LYS A . n 
A 1 177 ALA 177 351 351 ALA ALA A . n 
A 1 178 GLN 178 352 352 GLN GLN A . n 
A 1 179 PHE 179 353 353 PHE PHE A . n 
A 1 180 ALA 180 354 354 ALA ALA A . n 
A 1 181 ASP 181 355 355 ASP ASP A . n 
A 1 182 ILE 182 356 356 ILE ILE A . n 
A 1 183 GLU 183 357 357 GLU GLU A . n 
A 1 184 PRO 184 358 358 PRO PRO A . n 
A 1 185 LYS 185 359 359 LYS LYS A . n 
A 1 186 PHE 186 360 360 PHE PHE A . n 
A 1 187 ASP 187 361 361 ASP ASP A . n 
A 1 188 ARG 188 362 362 ARG ARG A . n 
A 1 189 LEU 189 363 363 LEU LEU A . n 
A 1 190 LEU 190 364 364 LEU LEU A . n 
A 1 191 PHE 191 365 365 PHE PHE A . n 
A 1 192 PHE 192 366 366 PHE PHE A . n 
A 1 193 TRP 193 367 367 TRP TRP A . n 
A 1 194 SER 194 368 368 SER SER A . n 
A 1 195 ASP 195 369 369 ASP ASP A . n 
A 1 196 ARG 196 370 370 ARG ARG A . n 
A 1 197 ARG 197 371 371 ARG ARG A . n 
A 1 198 ASN 198 372 372 ASN ASN A . n 
A 1 199 PRO 199 373 373 PRO PRO A . n 
A 1 200 HIS 200 374 374 HIS HIS A . n 
A 1 201 GLU 201 375 375 GLU GLU A . n 
A 1 202 VAL 202 376 376 VAL VAL A . n 
A 1 203 GLN 203 377 377 GLN GLN A . n 
A 1 204 PRO 204 378 378 PRO PRO A . n 
A 1 205 ALA 205 379 379 ALA ALA A . n 
A 1 206 TYR 206 380 380 TYR TYR A . n 
A 1 207 ALA 207 381 381 ALA ALA A . n 
A 1 208 THR 208 382 382 THR THR A . n 
A 1 209 ARG 209 383 383 ARG ARG A . n 
A 1 210 TYR 210 384 384 TYR TYR A . n 
A 1 211 ALA 211 385 385 ALA ALA A . n 
A 1 212 ILE 212 386 386 ILE ILE A . n 
A 1 213 THR 213 387 387 THR THR A . n 
A 1 214 VAL 214 388 388 VAL VAL A . n 
A 1 215 TRP 215 389 389 TRP TRP A . n 
A 1 216 TYR 216 390 390 TYR TYR A . n 
A 1 217 PHE 217 391 391 PHE PHE A . n 
A 1 218 ASP 218 392 392 ASP ASP A . n 
A 1 219 ALA 219 393 393 ALA ALA A . n 
A 1 220 ASP 220 394 394 ASP ASP A . n 
A 1 221 GLU 221 395 395 GLU GLU A . n 
A 1 222 ARG 222 396 396 ARG ARG A . n 
A 1 223 ALA 223 397 397 ALA ALA A . n 
A 1 224 ARG 224 398 398 ARG ARG A . n 
A 1 225 ALA 225 399 399 ALA ALA A . n 
A 1 226 LYS 226 400 400 LYS LYS A . n 
A 1 227 VAL 227 401 401 VAL VAL A . n 
A 1 228 LYS 228 402 402 LYS LYS A . n 
A 1 229 TYR 229 403 403 TYR TYR A . n 
A 1 230 LEU 230 404 ?   ?   ?   A . n 
A 1 231 THR 231 405 ?   ?   ?   A . n 
A 1 232 GLY 232 406 ?   ?   ?   A . n 
A 1 233 GLU 233 407 ?   ?   ?   A . n 
A 1 234 LYS 234 408 ?   ?   ?   A . n 
A 1 235 GLY 235 409 ?   ?   ?   A . n 
A 1 236 VAL 236 410 ?   ?   ?   A . n 
A 1 237 ARG 237 411 ?   ?   ?   A . n 
A 1 238 VAL 238 412 ?   ?   ?   A . n 
A 1 239 GLU 239 413 ?   ?   ?   A . n 
A 1 240 LEU 240 414 ?   ?   ?   A . n 
A 1 241 ASN 241 415 ?   ?   ?   A . n 
A 1 242 LYS 242 416 ?   ?   ?   A . n 
A 1 243 PRO 243 417 ?   ?   ?   A . n 
A 1 244 SER 244 418 ?   ?   ?   A . n 
A 1 245 ASP 245 419 ?   ?   ?   A . n 
A 1 246 SER 246 420 ?   ?   ?   A . n 
A 1 247 VAL 247 421 ?   ?   ?   A . n 
A 1 248 GLY 248 422 ?   ?   ?   A . n 
A 1 249 LYS 249 423 ?   ?   ?   A . n 
A 1 250 ASP 250 424 ?   ?   ?   A . n 
A 1 251 VAL 251 425 ?   ?   ?   A . n 
A 1 252 PHE 252 426 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   900  900  ZN  ZN  A . 
C 3 UN9 1   901  901  UN9 UN9 A . 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
D 4 HOH 127 2127 2127 HOH HOH A . 
D 4 HOH 128 2128 2128 HOH HOH A . 
D 4 HOH 129 2129 2129 HOH HOH A . 
D 4 HOH 130 2130 2130 HOH HOH A . 
D 4 HOH 131 2131 2131 HOH HOH A . 
D 4 HOH 132 2132 2132 HOH HOH A . 
D 4 HOH 133 2133 2133 HOH HOH A . 
D 4 HOH 134 2134 2134 HOH HOH A . 
D 4 HOH 135 2135 2135 HOH HOH A . 
D 4 HOH 136 2136 2136 HOH HOH A . 
D 4 HOH 137 2137 2137 HOH HOH A . 
D 4 HOH 138 2138 2138 HOH HOH A . 
D 4 HOH 139 2139 2139 HOH HOH A . 
D 4 HOH 140 2140 2140 HOH HOH A . 
D 4 HOH 141 2141 2141 HOH HOH A . 
D 4 HOH 142 2142 2142 HOH HOH A . 
D 4 HOH 143 2143 2143 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SNC 
_pdbx_struct_mod_residue.label_seq_id     128 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SNC 
_pdbx_struct_mod_residue.auth_seq_id      302 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          S-NITROSO-CYSTEINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 141 ? A ASP 315  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 N8  ? C UN9 .   ? A UN9 901  ? 1_555 108.0 ? 
2  OD1 ? A ASP 141 ? A ASP 315  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O   ? D HOH .   ? A HOH 2142 ? 1_555 82.6  ? 
3  N8  ? C UN9 .   ? A UN9 901  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O   ? D HOH .   ? A HOH 2142 ? 1_555 86.5  ? 
4  OD1 ? A ASP 141 ? A ASP 315  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 139 ? A HIS 313  ? 1_555 87.5  ? 
5  N8  ? C UN9 .   ? A UN9 901  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 139 ? A HIS 313  ? 1_555 84.0  ? 
6  O   ? D HOH .   ? A HOH 2142 ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 139 ? A HIS 313  ? 1_555 163.5 ? 
7  OD1 ? A ASP 141 ? A ASP 315  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O13 ? C UN9 .   ? A UN9 901  ? 1_555 166.3 ? 
8  N8  ? C UN9 .   ? A UN9 901  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O13 ? C UN9 .   ? A UN9 901  ? 1_555 76.9  ? 
9  O   ? D HOH .   ? A HOH 2142 ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O13 ? C UN9 .   ? A UN9 901  ? 1_555 85.0  ? 
10 NE2 ? A HIS 139 ? A HIS 313  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 O13 ? C UN9 .   ? A UN9 901  ? 1_555 105.9 ? 
11 OD1 ? A ASP 141 ? A ASP 315  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 200 ? A HIS 374  ? 1_555 91.0  ? 
12 N8  ? C UN9 .   ? A UN9 901  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 200 ? A HIS 374  ? 1_555 161.0 ? 
13 O   ? D HOH .   ? A HOH 2142 ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 200 ? A HIS 374  ? 1_555 97.9  ? 
14 NE2 ? A HIS 139 ? A HIS 313  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 200 ? A HIS 374  ? 1_555 95.5  ? 
15 O13 ? C UN9 .   ? A UN9 901  ? 1_555 ZN ? B ZN . ? A ZN 900 ? 1_555 NE2 ? A HIS 200 ? A HIS 374  ? 1_555 85.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-29 
2 'Structure model' 1 1 2011-06-16 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-28 
5 'Structure model' 1 4 2019-01-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation           
2 4 'Structure model' citation_author    
3 5 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.page_last'        
2 4 'Structure model' '_citation_author.name'      
3 5 'Structure model' '_exptl_crystal_grow.method' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
PHASER phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 197 ? ? -133.93 -64.68 
2 1 GLU A 348 ? ? -26.88  -55.97 
3 1 LYS A 350 ? ? -46.25  150.30 
4 1 GLN A 352 ? ? -47.69  159.88 
5 1 PRO A 358 ? ? -75.28  47.48  
6 1 ARG A 370 ? ? -53.76  -9.73  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 216 ? CG  ? A LYS 42  CG  
2  1 Y 1 A LYS 216 ? CD  ? A LYS 42  CD  
3  1 Y 1 A LYS 216 ? CE  ? A LYS 42  CE  
4  1 Y 1 A LYS 216 ? NZ  ? A LYS 42  NZ  
5  1 Y 1 A GLU 217 ? CD  ? A GLU 43  CD  
6  1 Y 1 A GLU 217 ? OE1 ? A GLU 43  OE1 
7  1 Y 1 A GLU 217 ? OE2 ? A GLU 43  OE2 
8  1 Y 1 A LYS 249 ? CG  ? A LYS 75  CG  
9  1 Y 1 A LYS 249 ? CD  ? A LYS 75  CD  
10 1 Y 1 A LYS 249 ? CE  ? A LYS 75  CE  
11 1 Y 1 A LYS 249 ? NZ  ? A LYS 75  NZ  
12 1 Y 1 A LYS 337 ? CG  ? A LYS 163 CG  
13 1 Y 1 A LYS 337 ? CD  ? A LYS 163 CD  
14 1 Y 1 A LYS 337 ? CE  ? A LYS 163 CE  
15 1 Y 1 A LYS 337 ? NZ  ? A LYS 163 NZ  
16 1 Y 1 A LYS 402 ? CG  ? A LYS 228 CG  
17 1 Y 1 A LYS 402 ? CD  ? A LYS 228 CD  
18 1 Y 1 A LYS 402 ? CE  ? A LYS 228 CE  
19 1 Y 1 A LYS 402 ? NZ  ? A LYS 228 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 175 ? A GLY 1   
2  1 Y 1 A SER 176 ? A SER 2   
3  1 Y 1 A HIS 177 ? A HIS 3   
4  1 Y 1 A MET 178 ? A MET 4   
5  1 Y 1 A ALA 179 ? A ALA 5   
6  1 Y 1 A SER 180 ? A SER 6   
7  1 Y 1 A PRO 181 ? A PRO 7   
8  1 Y 1 A ASN 182 ? A ASN 8   
9  1 Y 1 A GLY 183 ? A GLY 9   
10 1 Y 1 A GLN 184 ? A GLN 10  
11 1 Y 1 A THR 185 ? A THR 11  
12 1 Y 1 A LYS 186 ? A LYS 12  
13 1 Y 1 A PRO 187 ? A PRO 13  
14 1 Y 1 A LEU 404 ? A LEU 230 
15 1 Y 1 A THR 405 ? A THR 231 
16 1 Y 1 A GLY 406 ? A GLY 232 
17 1 Y 1 A GLU 407 ? A GLU 233 
18 1 Y 1 A LYS 408 ? A LYS 234 
19 1 Y 1 A GLY 409 ? A GLY 235 
20 1 Y 1 A VAL 410 ? A VAL 236 
21 1 Y 1 A ARG 411 ? A ARG 237 
22 1 Y 1 A VAL 412 ? A VAL 238 
23 1 Y 1 A GLU 413 ? A GLU 239 
24 1 Y 1 A LEU 414 ? A LEU 240 
25 1 Y 1 A ASN 415 ? A ASN 241 
26 1 Y 1 A LYS 416 ? A LYS 242 
27 1 Y 1 A PRO 417 ? A PRO 243 
28 1 Y 1 A SER 418 ? A SER 244 
29 1 Y 1 A ASP 419 ? A ASP 245 
30 1 Y 1 A SER 420 ? A SER 246 
31 1 Y 1 A VAL 421 ? A VAL 247 
32 1 Y 1 A GLY 422 ? A GLY 248 
33 1 Y 1 A LYS 423 ? A LYS 249 
34 1 Y 1 A ASP 424 ? A ASP 250 
35 1 Y 1 A VAL 425 ? A VAL 251 
36 1 Y 1 A PHE 426 ? A PHE 252 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'                                                ZN  
3 'N-[(1-CHLORO-4-HYDROXYISOQUINOLIN-3-YL)CARBONYL]GLYCINE' UN9 
4 water                                                     HOH 
#