data_2Y4U
# 
_entry.id   2Y4U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y4U         
PDBE  EBI-46956    
WWPDB D_1290046956 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2Y4T 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF FULL-LENGTH HUMAN P58(IPK)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y4U 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-01-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Svard, M.'      1 
'Biterova, E.I.' 2 
'Bourhis, J.-M.' 3 
'Guy, J.E.'      4 
# 
_citation.id                        primary 
_citation.title                     'The Crystal Structure of the Human Co-Chaperone P58Ipk' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            6 
_citation.page_first                22337 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21799829 
_citation.pdbx_database_id_DOI      10.1371/JOURNAL.PONE.0022337 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Svard, M.'      1 
primary 'Biterova, E.I.' 2 
primary 'Bourhis, J.'    3 
primary 'Guy, J.E.'      4 
# 
_cell.entry_id           2Y4U 
_cell.length_a           124.620 
_cell.length_b           124.620 
_cell.length_c           92.220 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y4U 
_symmetry.space_group_name_H-M             'P 3 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                149 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'DNAJ HOMOLOG SUBFAMILY C MEMBER 3' 
_entity.formula_weight             52368.887 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'RESIDUES 35-461' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;INTERFERON-INDUCED\,DOUBLE-STRANDED RNA-ACTIVATED PROTEIN KINASE INHIBITOR, PROTEIN KINASE INHIBITOR OF 58 KDA, PROTEIN KINASE INHIBITOR P58IPK
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)HHHHHHSSGVDLGTENLYFQS(MSE)ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLA
(MSE)GKSKAALPDLTKVIQLK(MSE)DFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDE
(MSE)QRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKIS
TLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESV(MSE)KTEPSIAEYT
VRSKERICHCFSKDEKPVEAIRVCSEVLQ(MSE)EPDNVNALKDRAEAYLIEE(MSE)YDEAIQDYETAQEHNENDQQIR
EGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPE
(MSE)RKKFDDG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAAL
PDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYT
AAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKL
DQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSE
VLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEII
KAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MSE n 
1 24  ALA n 
1 25  ASP n 
1 26  VAL n 
1 27  GLU n 
1 28  LYS n 
1 29  HIS n 
1 30  LEU n 
1 31  GLU n 
1 32  LEU n 
1 33  GLY n 
1 34  LYS n 
1 35  LYS n 
1 36  LEU n 
1 37  LEU n 
1 38  ALA n 
1 39  ALA n 
1 40  GLY n 
1 41  GLN n 
1 42  LEU n 
1 43  ALA n 
1 44  ASP n 
1 45  ALA n 
1 46  LEU n 
1 47  SER n 
1 48  GLN n 
1 49  PHE n 
1 50  HIS n 
1 51  ALA n 
1 52  ALA n 
1 53  VAL n 
1 54  ASP n 
1 55  GLY n 
1 56  ASP n 
1 57  PRO n 
1 58  ASP n 
1 59  ASN n 
1 60  TYR n 
1 61  ILE n 
1 62  ALA n 
1 63  TYR n 
1 64  TYR n 
1 65  ARG n 
1 66  ARG n 
1 67  ALA n 
1 68  THR n 
1 69  VAL n 
1 70  PHE n 
1 71  LEU n 
1 72  ALA n 
1 73  MSE n 
1 74  GLY n 
1 75  LYS n 
1 76  SER n 
1 77  LYS n 
1 78  ALA n 
1 79  ALA n 
1 80  LEU n 
1 81  PRO n 
1 82  ASP n 
1 83  LEU n 
1 84  THR n 
1 85  LYS n 
1 86  VAL n 
1 87  ILE n 
1 88  GLN n 
1 89  LEU n 
1 90  LYS n 
1 91  MSE n 
1 92  ASP n 
1 93  PHE n 
1 94  THR n 
1 95  ALA n 
1 96  ALA n 
1 97  ARG n 
1 98  LEU n 
1 99  GLN n 
1 100 ARG n 
1 101 GLY n 
1 102 HIS n 
1 103 LEU n 
1 104 LEU n 
1 105 LEU n 
1 106 LYS n 
1 107 GLN n 
1 108 GLY n 
1 109 LYS n 
1 110 LEU n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 GLU n 
1 115 ASP n 
1 116 ASP n 
1 117 PHE n 
1 118 LYS n 
1 119 LYS n 
1 120 VAL n 
1 121 LEU n 
1 122 LYS n 
1 123 SER n 
1 124 ASN n 
1 125 PRO n 
1 126 SER n 
1 127 GLU n 
1 128 ASN n 
1 129 GLU n 
1 130 GLU n 
1 131 LYS n 
1 132 GLU n 
1 133 ALA n 
1 134 GLN n 
1 135 SER n 
1 136 GLN n 
1 137 LEU n 
1 138 ILE n 
1 139 LYS n 
1 140 SER n 
1 141 ASP n 
1 142 GLU n 
1 143 MSE n 
1 144 GLN n 
1 145 ARG n 
1 146 LEU n 
1 147 ARG n 
1 148 SER n 
1 149 GLN n 
1 150 ALA n 
1 151 LEU n 
1 152 ASN n 
1 153 ALA n 
1 154 PHE n 
1 155 GLY n 
1 156 SER n 
1 157 GLY n 
1 158 ASP n 
1 159 TYR n 
1 160 THR n 
1 161 ALA n 
1 162 ALA n 
1 163 ILE n 
1 164 ALA n 
1 165 PHE n 
1 166 LEU n 
1 167 ASP n 
1 168 LYS n 
1 169 ILE n 
1 170 LEU n 
1 171 GLU n 
1 172 VAL n 
1 173 CYS n 
1 174 VAL n 
1 175 TRP n 
1 176 ASP n 
1 177 ALA n 
1 178 GLU n 
1 179 LEU n 
1 180 ARG n 
1 181 GLU n 
1 182 LEU n 
1 183 ARG n 
1 184 ALA n 
1 185 GLU n 
1 186 CYS n 
1 187 PHE n 
1 188 ILE n 
1 189 LYS n 
1 190 GLU n 
1 191 GLY n 
1 192 GLU n 
1 193 PRO n 
1 194 ARG n 
1 195 LYS n 
1 196 ALA n 
1 197 ILE n 
1 198 SER n 
1 199 ASP n 
1 200 LEU n 
1 201 LYS n 
1 202 ALA n 
1 203 ALA n 
1 204 SER n 
1 205 LYS n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 ASP n 
1 210 ASN n 
1 211 THR n 
1 212 GLU n 
1 213 ALA n 
1 214 PHE n 
1 215 TYR n 
1 216 LYS n 
1 217 ILE n 
1 218 SER n 
1 219 THR n 
1 220 LEU n 
1 221 TYR n 
1 222 TYR n 
1 223 GLN n 
1 224 LEU n 
1 225 GLY n 
1 226 ASP n 
1 227 HIS n 
1 228 GLU n 
1 229 LEU n 
1 230 SER n 
1 231 LEU n 
1 232 SER n 
1 233 GLU n 
1 234 VAL n 
1 235 ARG n 
1 236 GLU n 
1 237 CYS n 
1 238 LEU n 
1 239 LYS n 
1 240 LEU n 
1 241 ASP n 
1 242 GLN n 
1 243 ASP n 
1 244 HIS n 
1 245 LYS n 
1 246 ARG n 
1 247 CYS n 
1 248 PHE n 
1 249 ALA n 
1 250 HIS n 
1 251 TYR n 
1 252 LYS n 
1 253 GLN n 
1 254 VAL n 
1 255 LYS n 
1 256 LYS n 
1 257 LEU n 
1 258 ASN n 
1 259 LYS n 
1 260 LEU n 
1 261 ILE n 
1 262 GLU n 
1 263 SER n 
1 264 ALA n 
1 265 GLU n 
1 266 GLU n 
1 267 LEU n 
1 268 ILE n 
1 269 ARG n 
1 270 ASP n 
1 271 GLY n 
1 272 ARG n 
1 273 TYR n 
1 274 THR n 
1 275 ASP n 
1 276 ALA n 
1 277 THR n 
1 278 SER n 
1 279 LYS n 
1 280 TYR n 
1 281 GLU n 
1 282 SER n 
1 283 VAL n 
1 284 MSE n 
1 285 LYS n 
1 286 THR n 
1 287 GLU n 
1 288 PRO n 
1 289 SER n 
1 290 ILE n 
1 291 ALA n 
1 292 GLU n 
1 293 TYR n 
1 294 THR n 
1 295 VAL n 
1 296 ARG n 
1 297 SER n 
1 298 LYS n 
1 299 GLU n 
1 300 ARG n 
1 301 ILE n 
1 302 CYS n 
1 303 HIS n 
1 304 CYS n 
1 305 PHE n 
1 306 SER n 
1 307 LYS n 
1 308 ASP n 
1 309 GLU n 
1 310 LYS n 
1 311 PRO n 
1 312 VAL n 
1 313 GLU n 
1 314 ALA n 
1 315 ILE n 
1 316 ARG n 
1 317 VAL n 
1 318 CYS n 
1 319 SER n 
1 320 GLU n 
1 321 VAL n 
1 322 LEU n 
1 323 GLN n 
1 324 MSE n 
1 325 GLU n 
1 326 PRO n 
1 327 ASP n 
1 328 ASN n 
1 329 VAL n 
1 330 ASN n 
1 331 ALA n 
1 332 LEU n 
1 333 LYS n 
1 334 ASP n 
1 335 ARG n 
1 336 ALA n 
1 337 GLU n 
1 338 ALA n 
1 339 TYR n 
1 340 LEU n 
1 341 ILE n 
1 342 GLU n 
1 343 GLU n 
1 344 MSE n 
1 345 TYR n 
1 346 ASP n 
1 347 GLU n 
1 348 ALA n 
1 349 ILE n 
1 350 GLN n 
1 351 ASP n 
1 352 TYR n 
1 353 GLU n 
1 354 THR n 
1 355 ALA n 
1 356 GLN n 
1 357 GLU n 
1 358 HIS n 
1 359 ASN n 
1 360 GLU n 
1 361 ASN n 
1 362 ASP n 
1 363 GLN n 
1 364 GLN n 
1 365 ILE n 
1 366 ARG n 
1 367 GLU n 
1 368 GLY n 
1 369 LEU n 
1 370 GLU n 
1 371 LYS n 
1 372 ALA n 
1 373 GLN n 
1 374 ARG n 
1 375 LEU n 
1 376 LEU n 
1 377 LYS n 
1 378 GLN n 
1 379 SER n 
1 380 GLN n 
1 381 LYS n 
1 382 ARG n 
1 383 ASP n 
1 384 TYR n 
1 385 TYR n 
1 386 LYS n 
1 387 ILE n 
1 388 LEU n 
1 389 GLY n 
1 390 VAL n 
1 391 LYS n 
1 392 ARG n 
1 393 ASN n 
1 394 ALA n 
1 395 LYS n 
1 396 LYS n 
1 397 GLN n 
1 398 GLU n 
1 399 ILE n 
1 400 ILE n 
1 401 LYS n 
1 402 ALA n 
1 403 TYR n 
1 404 ARG n 
1 405 LYS n 
1 406 LEU n 
1 407 ALA n 
1 408 LEU n 
1 409 GLN n 
1 410 TRP n 
1 411 HIS n 
1 412 PRO n 
1 413 ASP n 
1 414 ASN n 
1 415 PHE n 
1 416 GLN n 
1 417 ASN n 
1 418 GLU n 
1 419 GLU n 
1 420 GLU n 
1 421 LYS n 
1 422 LYS n 
1 423 LYS n 
1 424 ALA n 
1 425 GLU n 
1 426 LYS n 
1 427 LYS n 
1 428 PHE n 
1 429 ILE n 
1 430 ASP n 
1 431 ILE n 
1 432 ALA n 
1 433 ALA n 
1 434 ALA n 
1 435 LYS n 
1 436 GLU n 
1 437 VAL n 
1 438 LEU n 
1 439 SER n 
1 440 ASP n 
1 441 PRO n 
1 442 GLU n 
1 443 MSE n 
1 444 ARG n 
1 445 LYS n 
1 446 LYS n 
1 447 PHE n 
1 448 ASP n 
1 449 ASP n 
1 450 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ROSETTA 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PNIC28-BSA4 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P58IPK_6 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DNJC3_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q13217 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Y4U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 450 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13217 
_struct_ref_seq.db_align_beg                  35 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  461 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       35 
_struct_ref_seq.pdbx_auth_seq_align_end       461 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y4U MSE A 1  ? UNP Q13217 ? ? 'expression tag' 12 1  
1 2Y4U HIS A 2  ? UNP Q13217 ? ? 'expression tag' 13 2  
1 2Y4U HIS A 3  ? UNP Q13217 ? ? 'expression tag' 14 3  
1 2Y4U HIS A 4  ? UNP Q13217 ? ? 'expression tag' 15 4  
1 2Y4U HIS A 5  ? UNP Q13217 ? ? 'expression tag' 16 5  
1 2Y4U HIS A 6  ? UNP Q13217 ? ? 'expression tag' 17 6  
1 2Y4U HIS A 7  ? UNP Q13217 ? ? 'expression tag' 18 7  
1 2Y4U SER A 8  ? UNP Q13217 ? ? 'expression tag' 19 8  
1 2Y4U SER A 9  ? UNP Q13217 ? ? 'expression tag' 20 9  
1 2Y4U GLY A 10 ? UNP Q13217 ? ? 'expression tag' 21 10 
1 2Y4U VAL A 11 ? UNP Q13217 ? ? 'expression tag' 22 11 
1 2Y4U ASP A 12 ? UNP Q13217 ? ? 'expression tag' 23 12 
1 2Y4U LEU A 13 ? UNP Q13217 ? ? 'expression tag' 24 13 
1 2Y4U GLY A 14 ? UNP Q13217 ? ? 'expression tag' 25 14 
1 2Y4U THR A 15 ? UNP Q13217 ? ? 'expression tag' 26 15 
1 2Y4U GLU A 16 ? UNP Q13217 ? ? 'expression tag' 27 16 
1 2Y4U ASN A 17 ? UNP Q13217 ? ? 'expression tag' 28 17 
1 2Y4U LEU A 18 ? UNP Q13217 ? ? 'expression tag' 29 18 
1 2Y4U TYR A 19 ? UNP Q13217 ? ? 'expression tag' 30 19 
1 2Y4U PHE A 20 ? UNP Q13217 ? ? 'expression tag' 31 20 
1 2Y4U GLN A 21 ? UNP Q13217 ? ? 'expression tag' 32 21 
1 2Y4U SER A 22 ? UNP Q13217 ? ? 'expression tag' 33 22 
1 2Y4U MSE A 23 ? UNP Q13217 ? ? 'expression tag' 34 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Y4U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.98 
_exptl_crystal.density_percent_sol   69 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M TRIS, PH 8.5, 1.3 M SUCCINIC ACID, 1% (W/V) PEG MME 2000.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y4U 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            3.20 
_reflns.number_obs                   12967 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.37 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.60 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.10 
_reflns_shell.pdbx_redundancy        4.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y4U 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     12967 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.93 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    99.88 
_refine.ls_R_factor_obs                          0.24626 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24418 
_refine.ls_R_factor_R_free                       0.28631 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  677 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.B_iso_mean                               118.539 
_refine.aniso_B[1][1]                            1.56 
_refine.aniso_B[2][2]                            1.56 
_refine.aniso_B[3][3]                            -2.35 
_refine.aniso_B[1][2]                            0.78 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 3IEG' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.899 
_refine.pdbx_overall_ESU_R_Free                  0.479 
_refine.overall_SU_ML                            0.435 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             56.174 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3429 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3429 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        29.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 3481 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.259  1.974  ? 4668 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.986  5.000  ? 423  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.549 25.169 ? 178  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.785 15.000 ? 698  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.157 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.085  0.200  ? 504  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 2597 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.200 
_refine_ls_shell.d_res_low                        3.282 
_refine_ls_shell.number_reflns_R_work             938 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.340 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2Y4U 
_struct.title                     'Crystal structure of human P58(IPK) in space group P312' 
_struct.pdbx_descriptor           'DNAJ HOMOLOG SUBFAMILY C MEMBER 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y4U 
_struct_keywords.pdbx_keywords   CHAPERONE 
_struct_keywords.text            
'CHAPERONE, ENDOPLASMIC RETICULUM, PROTEIN FOLDING, TETRATRICOPEPTIDEREPEAT, J DOMAIN, UNFOLDED PROTEIN RESPONSE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MSE A 23  ? GLY A 40  ? MSE A 34  GLY A 51  1 ? 18 
HELX_P HELX_P2  2  LEU A 42  ? ASP A 56  ? LEU A 53  ASP A 67  1 ? 15 
HELX_P HELX_P3  3  ASN A 59  ? MSE A 73  ? ASN A 70  MSE A 84  1 ? 15 
HELX_P HELX_P4  4  LYS A 75  ? LYS A 90  ? LYS A 86  LYS A 101 1 ? 16 
HELX_P HELX_P5  5  PHE A 93  ? GLN A 107 ? PHE A 104 GLN A 118 1 ? 15 
HELX_P HELX_P6  6  LYS A 109 ? SER A 123 ? LYS A 120 SER A 134 1 ? 15 
HELX_P HELX_P7  7  SER A 126 ? GLY A 157 ? SER A 137 GLY A 168 1 ? 32 
HELX_P HELX_P8  8  ASP A 158 ? CYS A 173 ? ASP A 169 CYS A 184 1 ? 16 
HELX_P HELX_P9  9  ASP A 176 ? GLU A 190 ? ASP A 187 GLU A 201 1 ? 15 
HELX_P HELX_P10 10 GLU A 192 ? ASN A 208 ? GLU A 203 ASN A 219 1 ? 17 
HELX_P HELX_P11 11 ASN A 210 ? LEU A 224 ? ASN A 221 LEU A 235 1 ? 15 
HELX_P HELX_P12 12 ASP A 226 ? ASP A 241 ? ASP A 237 ASP A 252 1 ? 16 
HELX_P HELX_P13 13 HIS A 244 ? ASP A 270 ? HIS A 255 ASP A 281 1 ? 27 
HELX_P HELX_P14 14 ARG A 272 ? GLU A 287 ? ARG A 283 GLU A 298 1 ? 16 
HELX_P HELX_P15 15 ILE A 290 ? ASP A 308 ? ILE A 301 ASP A 319 1 ? 19 
HELX_P HELX_P16 16 LYS A 310 ? GLU A 325 ? LYS A 321 GLU A 336 1 ? 16 
HELX_P HELX_P17 17 ASN A 328 ? GLU A 343 ? ASN A 339 GLU A 354 1 ? 16 
HELX_P HELX_P18 18 MSE A 344 ? GLU A 357 ? MSE A 355 GLU A 368 1 ? 14 
HELX_P HELX_P19 19 ASP A 362 ? LYS A 381 ? ASP A 373 LYS A 392 1 ? 20 
HELX_P HELX_P20 20 LYS A 395 ? TRP A 410 ? LYS A 406 TRP A 421 1 ? 16 
HELX_P HELX_P21 21 HIS A 411 ? PHE A 415 ? HIS A 422 PHE A 426 5 ? 5  
HELX_P HELX_P22 22 ASN A 417 ? SER A 439 ? ASN A 428 SER A 450 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 237 SG ? ? ? 1_555 A CYS 247 SG ? ? A CYS 248 A CYS 258 1_555 ? ? ? ? ? ? ? 2.081 ? 
disulf2  disulf ? ? A CYS 302 SG ? ? ? 1_555 A CYS 318 SG ? ? A CYS 313 A CYS 329 1_555 ? ? ? ? ? ? ? 2.061 ? 
covale1  covale ? ? A SER 22  C  ? ? ? 1_555 A MSE 23  N  ? ? A SER 33  A MSE 34  1_555 ? ? ? ? ? ? ? 1.341 ? 
covale2  covale ? ? A MSE 23  C  ? ? ? 1_555 A ALA 24  N  ? ? A MSE 34  A ALA 35  1_555 ? ? ? ? ? ? ? 1.336 ? 
covale3  covale ? ? A ALA 72  C  ? ? ? 1_555 A MSE 73  N  ? ? A ALA 83  A MSE 84  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale4  covale ? ? A MSE 73  C  ? ? ? 1_555 A GLY 74  N  ? ? A MSE 84  A GLY 85  1_555 ? ? ? ? ? ? ? 1.316 ? 
covale5  covale ? ? A LYS 90  C  ? ? ? 1_555 A MSE 91  N  ? ? A LYS 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.363 ? 
covale6  covale ? ? A MSE 91  C  ? ? ? 1_555 A ASP 92  N  ? ? A MSE 102 A ASP 103 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale7  covale ? ? A GLU 142 C  ? ? ? 1_555 A MSE 143 N  ? ? A GLU 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale8  covale ? ? A MSE 143 C  ? ? ? 1_555 A GLN 144 N  ? ? A MSE 154 A GLN 155 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale9  covale ? ? A VAL 283 C  ? ? ? 1_555 A MSE 284 N  ? ? A VAL 294 A MSE 295 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale10 covale ? ? A MSE 284 C  ? ? ? 1_555 A LYS 285 N  ? ? A MSE 295 A LYS 296 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale11 covale ? ? A GLN 323 C  ? ? ? 1_555 A MSE 324 N  ? ? A GLN 334 A MSE 335 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale12 covale ? ? A MSE 324 C  ? ? ? 1_555 A GLU 325 N  ? ? A MSE 335 A GLU 336 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale13 covale ? ? A GLU 343 C  ? ? ? 1_555 A MSE 344 N  ? ? A GLU 354 A MSE 355 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale14 covale ? ? A MSE 344 C  ? ? ? 1_555 A TYR 345 N  ? ? A MSE 355 A TYR 356 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale15 covale ? ? A GLU 442 C  ? ? ? 1_555 A MSE 443 N  ? ? A GLU 453 A MSE 454 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale16 covale ? ? A MSE 443 C  ? ? ? 1_555 A ARG 444 N  ? ? A MSE 454 A ARG 455 1_555 ? ? ? ? ? ? ? 1.364 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_database_PDB_matrix.entry_id          2Y4U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y4U 
_atom_sites.fract_transf_matrix[1][1]   0.008024 
_atom_sites.fract_transf_matrix[1][2]   0.004633 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009266 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010844 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 21  ? -17.283 10.688  14.470  1.00 151.32 ? 32  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 21  ? -18.192 9.715   13.795  1.00 148.23 ? 32  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 21  ? -17.497 8.963   12.662  1.00 147.17 ? 32  GLN A C   1 
ATOM   4    O  O   . GLN A 1 21  ? -17.374 9.462   11.534  1.00 146.13 ? 32  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 21  ? -19.459 10.404  13.275  1.00 144.45 ? 32  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 21  ? -20.511 9.450   12.704  1.00 141.66 ? 32  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 21  ? -21.782 10.151  12.216  1.00 139.03 ? 32  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 21  ? -22.635 9.528   11.586  1.00 136.50 ? 32  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 21  ? -21.916 11.436  12.510  1.00 139.89 ? 32  GLN A NE2 1 
ATOM   10   N  N   . SER A 1 22  ? -17.046 7.753   12.985  1.00 147.56 ? 33  SER A N   1 
ATOM   11   C  CA  . SER A 1 22  ? -16.540 6.834   11.979  1.00 146.43 ? 33  SER A CA  1 
ATOM   12   C  C   . SER A 1 22  ? -17.729 6.231   11.221  1.00 141.81 ? 33  SER A C   1 
ATOM   13   O  O   . SER A 1 22  ? -18.412 5.317   11.713  1.00 139.80 ? 33  SER A O   1 
ATOM   14   C  CB  . SER A 1 22  ? -15.623 5.760   12.598  1.00 148.22 ? 33  SER A CB  1 
ATOM   15   O  OG  . SER A 1 22  ? -16.375 4.792   13.383  1.00 147.28 ? 33  SER A OG  1 
HETATM 16   N  N   . MSE A 1 23  ? -17.993 6.803   10.037  1.00 140.37 ? 34  MSE A N   1 
HETATM 17   C  CA  . MSE A 1 23  ? -18.969 6.255   9.100   1.00 136.36 ? 34  MSE A CA  1 
HETATM 18   C  C   . MSE A 1 23  ? -18.214 5.305   8.162   1.00 136.04 ? 34  MSE A C   1 
HETATM 19   O  O   . MSE A 1 23  ? -18.539 5.152   6.969   1.00 133.55 ? 34  MSE A O   1 
HETATM 20   C  CB  . MSE A 1 23  ? -19.631 7.398   8.343   1.00 135.21 ? 34  MSE A CB  1 
HETATM 21   C  CG  . MSE A 1 23  ? -20.470 6.960   7.163   1.00 131.18 ? 34  MSE A CG  1 
HETATM 22   SE SE  . MSE A 1 23  ? -21.891 8.243   6.810   1.00 129.43 ? 34  MSE A SE  1 
HETATM 23   C  CE  . MSE A 1 23  ? -21.403 8.727   4.948   1.00 130.69 ? 34  MSE A CE  1 
ATOM   24   N  N   . ALA A 1 24  ? -17.188 4.677   8.743   1.00 138.84 ? 35  ALA A N   1 
ATOM   25   C  CA  . ALA A 1 24  ? -16.372 3.688   8.073   1.00 139.00 ? 35  ALA A CA  1 
ATOM   26   C  C   . ALA A 1 24  ? -17.234 2.521   7.608   1.00 135.02 ? 35  ALA A C   1 
ATOM   27   O  O   . ALA A 1 24  ? -17.091 2.068   6.476   1.00 133.73 ? 35  ALA A O   1 
ATOM   28   C  CB  . ALA A 1 24  ? -15.261 3.199   9.007   1.00 142.33 ? 35  ALA A CB  1 
ATOM   29   N  N   . ASP A 1 25  ? -18.139 2.053   8.471   1.00 133.26 ? 36  ASP A N   1 
ATOM   30   C  CA  . ASP A 1 25  ? -19.012 0.924   8.128   1.00 129.57 ? 36  ASP A CA  1 
ATOM   31   C  C   . ASP A 1 25  ? -19.639 1.118   6.738   1.00 126.91 ? 36  ASP A C   1 
ATOM   32   O  O   . ASP A 1 25  ? -19.508 0.248   5.868   1.00 125.65 ? 36  ASP A O   1 
ATOM   33   C  CB  . ASP A 1 25  ? -20.085 0.681   9.210   1.00 128.06 ? 36  ASP A CB  1 
ATOM   34   C  CG  . ASP A 1 25  ? -19.427 0.375   10.600  1.00 130.46 ? 36  ASP A CG  1 
ATOM   35   O  OD1 . ASP A 1 25  ? -18.183 0.165   10.641  1.00 133.70 ? 36  ASP A OD1 1 
ATOM   36   O  OD2 . ASP A 1 25  ? -20.162 0.343   11.658  1.00 129.31 ? 36  ASP A OD2 1 
ATOM   37   N  N   . VAL A 1 26  ? -20.277 2.270   6.522   1.00 126.33 ? 37  VAL A N   1 
ATOM   38   C  CA  . VAL A 1 26  ? -20.862 2.616   5.212   1.00 124.19 ? 37  VAL A CA  1 
ATOM   39   C  C   . VAL A 1 26  ? -19.798 2.770   4.127   1.00 126.06 ? 37  VAL A C   1 
ATOM   40   O  O   . VAL A 1 26  ? -20.064 2.551   2.939   1.00 124.51 ? 37  VAL A O   1 
ATOM   41   C  CB  . VAL A 1 26  ? -21.670 3.935   5.281   1.00 123.71 ? 37  VAL A CB  1 
ATOM   42   C  CG1 . VAL A 1 26  ? -22.314 4.258   3.925   1.00 121.56 ? 37  VAL A CG1 1 
ATOM   43   C  CG2 . VAL A 1 26  ? -22.730 3.860   6.393   1.00 122.28 ? 37  VAL A CG2 1 
ATOM   44   N  N   . GLU A 1 27  ? -18.596 3.159   4.547   1.00 129.64 ? 38  GLU A N   1 
ATOM   45   C  CA  . GLU A 1 27  ? -17.502 3.364   3.622   1.00 131.91 ? 38  GLU A CA  1 
ATOM   46   C  C   . GLU A 1 27  ? -16.882 2.029   3.228   1.00 131.80 ? 38  GLU A C   1 
ATOM   47   O  O   . GLU A 1 27  ? -16.688 1.751   2.047   1.00 131.16 ? 38  GLU A O   1 
ATOM   48   C  CB  . GLU A 1 27  ? -16.462 4.308   4.241   1.00 136.01 ? 38  GLU A CB  1 
ATOM   49   C  CG  . GLU A 1 27  ? -15.458 4.892   3.250   1.00 138.53 ? 38  GLU A CG  1 
ATOM   50   C  CD  . GLU A 1 27  ? -16.110 5.333   1.958   1.00 136.35 ? 38  GLU A CD  1 
ATOM   51   O  OE1 . GLU A 1 27  ? -16.912 6.291   1.988   1.00 135.41 ? 38  GLU A OE1 1 
ATOM   52   O  OE2 . GLU A 1 27  ? -15.822 4.707   0.916   1.00 135.72 ? 38  GLU A OE2 1 
ATOM   53   N  N   . LYS A 1 28  ? -16.585 1.202   4.225   1.00 132.56 ? 39  LYS A N   1 
ATOM   54   C  CA  . LYS A 1 28  ? -15.988 -0.109  3.984   1.00 132.78 ? 39  LYS A CA  1 
ATOM   55   C  C   . LYS A 1 28  ? -16.888 -0.911  3.063   1.00 129.03 ? 39  LYS A C   1 
ATOM   56   O  O   . LYS A 1 28  ? -16.423 -1.440  2.054   1.00 129.06 ? 39  LYS A O   1 
ATOM   57   C  CB  . LYS A 1 28  ? -15.712 -0.872  5.296   1.00 133.96 ? 39  LYS A CB  1 
ATOM   58   C  CG  . LYS A 1 28  ? -14.750 -0.169  6.288   1.00 138.02 ? 39  LYS A CG  1 
ATOM   59   C  CD  . LYS A 1 28  ? -13.518 0.439   5.599   1.00 141.31 ? 39  LYS A CD  1 
ATOM   60   C  CE  . LYS A 1 28  ? -13.156 1.793   6.197   1.00 143.87 ? 39  LYS A CE  1 
ATOM   61   N  NZ  . LYS A 1 28  ? -12.677 2.738   5.153   1.00 145.35 ? 39  LYS A NZ  1 
ATOM   62   N  N   . HIS A 1 29  ? -18.180 -0.953  3.400   1.00 126.01 ? 40  HIS A N   1 
ATOM   63   C  CA  . HIS A 1 29  ? -19.195 -1.641  2.598   1.00 122.36 ? 40  HIS A CA  1 
ATOM   64   C  C   . HIS A 1 29  ? -18.941 -1.440  1.118   1.00 122.19 ? 40  HIS A C   1 
ATOM   65   O  O   . HIS A 1 29  ? -19.008 -2.384  0.335   1.00 120.67 ? 40  HIS A O   1 
ATOM   66   C  CB  . HIS A 1 29  ? -20.616 -1.165  2.958   1.00 119.74 ? 40  HIS A CB  1 
ATOM   67   C  CG  . HIS A 1 29  ? -21.193 -1.838  4.177   1.00 118.53 ? 40  HIS A CG  1 
ATOM   68   N  ND1 . HIS A 1 29  ? -20.939 -3.158  4.500   1.00 118.12 ? 40  HIS A ND1 1 
ATOM   69   C  CD2 . HIS A 1 29  ? -22.038 -1.382  5.138   1.00 117.77 ? 40  HIS A CD2 1 
ATOM   70   C  CE1 . HIS A 1 29  ? -21.548 -3.476  5.617   1.00 117.24 ? 40  HIS A CE1 1 
ATOM   71   N  NE2 . HIS A 1 29  ? -22.222 -2.417  6.024   1.00 117.03 ? 40  HIS A NE2 1 
ATOM   72   N  N   . LEU A 1 30  ? -18.622 -0.206  0.746   1.00 124.00 ? 41  LEU A N   1 
ATOM   73   C  CA  . LEU A 1 30  ? -18.383 0.143   -0.643  1.00 124.28 ? 41  LEU A CA  1 
ATOM   74   C  C   . LEU A 1 30  ? -17.044 -0.374  -1.130  1.00 126.95 ? 41  LEU A C   1 
ATOM   75   O  O   . LEU A 1 30  ? -16.962 -0.938  -2.216  1.00 126.30 ? 41  LEU A O   1 
ATOM   76   C  CB  . LEU A 1 30  ? -18.477 1.647   -0.830  1.00 125.53 ? 41  LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 30  ? -19.864 2.197   -0.526  1.00 123.06 ? 41  LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 30  ? -19.778 3.546   0.173   1.00 125.15 ? 41  LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 30  ? -20.665 2.286   -1.816  1.00 120.37 ? 41  LEU A CD2 1 
ATOM   80   N  N   . GLU A 1 31  ? -15.998 -0.191  -0.331  1.00 130.15 ? 42  GLU A N   1 
ATOM   81   C  CA  . GLU A 1 31  ? -14.692 -0.669  -0.733  1.00 133.06 ? 42  GLU A CA  1 
ATOM   82   C  C   . GLU A 1 31  ? -14.801 -2.160  -0.986  1.00 131.37 ? 42  GLU A C   1 
ATOM   83   O  O   . GLU A 1 31  ? -14.680 -2.608  -2.127  1.00 130.96 ? 42  GLU A O   1 
ATOM   84   C  CB  . GLU A 1 31  ? -13.633 -0.362  0.321   1.00 136.78 ? 42  GLU A CB  1 
ATOM   85   C  CG  . GLU A 1 31  ? -12.220 -0.251  -0.269  1.00 140.77 ? 42  GLU A CG  1 
ATOM   86   C  CD  . GLU A 1 31  ? -11.111 -0.245  0.782   1.00 144.70 ? 42  GLU A CD  1 
ATOM   87   O  OE1 . GLU A 1 31  ? -11.368 -0.648  1.945   1.00 144.35 ? 42  GLU A OE1 1 
ATOM   88   O  OE2 . GLU A 1 31  ? -9.976  0.165   0.437   1.00 148.35 ? 42  GLU A OE2 1 
ATOM   89   N  N   . LEU A 1 32  ? -15.077 -2.906  0.084   1.00 130.44 ? 43  LEU A N   1 
ATOM   90   C  CA  . LEU A 1 32  ? -15.343 -4.345  0.031   1.00 128.61 ? 43  LEU A CA  1 
ATOM   91   C  C   . LEU A 1 32  ? -16.275 -4.702  -1.112  1.00 125.43 ? 43  LEU A C   1 
ATOM   92   O  O   . LEU A 1 32  ? -16.054 -5.684  -1.812  1.00 125.18 ? 43  LEU A O   1 
ATOM   93   C  CB  . LEU A 1 32  ? -15.995 -4.804  1.328   1.00 127.11 ? 43  LEU A CB  1 
ATOM   94   C  CG  . LEU A 1 32  ? -15.207 -4.779  2.631   1.00 130.01 ? 43  LEU A CG  1 
ATOM   95   C  CD1 . LEU A 1 32  ? -16.089 -4.283  3.760   1.00 128.60 ? 43  LEU A CD1 1 
ATOM   96   C  CD2 . LEU A 1 32  ? -14.644 -6.160  2.950   1.00 131.06 ? 43  LEU A CD2 1 
ATOM   97   N  N   . GLY A 1 33  ? -17.321 -3.900  -1.289  1.00 123.22 ? 44  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 33  ? -18.278 -4.110  -2.356  1.00 120.32 ? 44  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 33  ? -17.634 -4.026  -3.721  1.00 121.72 ? 44  GLY A C   1 
ATOM   100  O  O   . GLY A 1 33  ? -17.865 -4.883  -4.576  1.00 120.30 ? 44  GLY A O   1 
ATOM   101  N  N   . LYS A 1 34  ? -16.814 -2.996  -3.918  1.00 124.69 ? 45  LYS A N   1 
ATOM   102  C  CA  . LYS A 1 34  ? -16.207 -2.738  -5.218  1.00 126.43 ? 45  LYS A CA  1 
ATOM   103  C  C   . LYS A 1 34  ? -15.182 -3.792  -5.579  1.00 128.26 ? 45  LYS A C   1 
ATOM   104  O  O   . LYS A 1 34  ? -15.164 -4.294  -6.702  1.00 127.84 ? 45  LYS A O   1 
ATOM   105  C  CB  . LYS A 1 34  ? -15.610 -1.337  -5.268  1.00 129.31 ? 45  LYS A CB  1 
ATOM   106  C  CG  . LYS A 1 34  ? -16.682 -0.270  -5.368  1.00 127.49 ? 45  LYS A CG  1 
ATOM   107  C  CD  . LYS A 1 34  ? -16.144 1.113   -5.091  1.00 130.34 ? 45  LYS A CD  1 
ATOM   108  C  CE  . LYS A 1 34  ? -17.283 2.114   -4.970  1.00 128.41 ? 45  LYS A CE  1 
ATOM   109  N  NZ  . LYS A 1 34  ? -16.834 3.474   -5.399  1.00 130.99 ? 45  LYS A NZ  1 
ATOM   110  N  N   . LYS A 1 35  ? -14.348 -4.141  -4.610  1.00 130.41 ? 46  LYS A N   1 
ATOM   111  C  CA  . LYS A 1 35  ? -13.380 -5.216  -4.776  1.00 132.35 ? 46  LYS A CA  1 
ATOM   112  C  C   . LYS A 1 35  ? -14.054 -6.529  -5.214  1.00 129.42 ? 46  LYS A C   1 
ATOM   113  O  O   . LYS A 1 35  ? -13.569 -7.210  -6.120  1.00 130.39 ? 46  LYS A O   1 
ATOM   114  C  CB  . LYS A 1 35  ? -12.571 -5.408  -3.485  1.00 134.79 ? 46  LYS A CB  1 
ATOM   115  C  CG  . LYS A 1 35  ? -11.955 -4.115  -2.940  1.00 137.27 ? 46  LYS A CG  1 
ATOM   116  C  CD  . LYS A 1 35  ? -10.813 -4.377  -1.964  1.00 141.07 ? 46  LYS A CD  1 
ATOM   117  C  CE  . LYS A 1 35  ? -10.168 -3.060  -1.540  1.00 143.67 ? 46  LYS A CE  1 
ATOM   118  N  NZ  . LYS A 1 35  ? -8.809  -3.251  -0.947  1.00 148.47 ? 46  LYS A NZ  1 
ATOM   119  N  N   . LEU A 1 36  ? -15.180 -6.862  -4.579  1.00 126.00 ? 47  LEU A N   1 
ATOM   120  C  CA  . LEU A 1 36  ? -15.932 -8.085  -4.883  1.00 123.06 ? 47  LEU A CA  1 
ATOM   121  C  C   . LEU A 1 36  ? -16.427 -8.090  -6.313  1.00 121.71 ? 47  LEU A C   1 
ATOM   122  O  O   . LEU A 1 36  ? -16.179 -9.034  -7.059  1.00 121.76 ? 47  LEU A O   1 
ATOM   123  C  CB  . LEU A 1 36  ? -17.126 -8.235  -3.941  1.00 119.92 ? 47  LEU A CB  1 
ATOM   124  C  CG  . LEU A 1 36  ? -16.901 -8.868  -2.568  1.00 120.42 ? 47  LEU A CG  1 
ATOM   125  C  CD1 . LEU A 1 36  ? -18.044 -8.495  -1.656  1.00 117.90 ? 47  LEU A CD1 1 
ATOM   126  C  CD2 . LEU A 1 36  ? -16.734 -10.378 -2.633  1.00 120.11 ? 47  LEU A CD2 1 
ATOM   127  N  N   . LEU A 1 37  ? -17.139 -7.031  -6.682  1.00 120.65 ? 48  LEU A N   1 
ATOM   128  C  CA  . LEU A 1 37  ? -17.568 -6.861  -8.051  1.00 119.92 ? 48  LEU A CA  1 
ATOM   129  C  C   . LEU A 1 37  ? -16.365 -7.120  -8.945  1.00 123.21 ? 48  LEU A C   1 
ATOM   130  O  O   . LEU A 1 37  ? -16.429 -7.946  -9.850  1.00 122.85 ? 48  LEU A O   1 
ATOM   131  C  CB  . LEU A 1 37  ? -18.129 -5.454  -8.278  1.00 119.52 ? 48  LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 37  ? -18.653 -5.112  -9.682  1.00 118.86 ? 48  LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 37  ? -19.718 -4.046  -9.582  1.00 117.23 ? 48  LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 37  ? -17.541 -4.663  -10.654 1.00 122.37 ? 48  LEU A CD2 1 
ATOM   135  N  N   . ALA A 1 38  ? -15.260 -6.436  -8.657  1.00 126.59 ? 49  ALA A N   1 
ATOM   136  C  CA  . ALA A 1 38  ? -14.051 -6.542  -9.467  1.00 130.20 ? 49  ALA A CA  1 
ATOM   137  C  C   . ALA A 1 38  ? -13.576 -7.985  -9.599  1.00 130.49 ? 49  ALA A C   1 
ATOM   138  O  O   . ALA A 1 38  ? -13.048 -8.379  -10.640 1.00 132.17 ? 49  ALA A O   1 
ATOM   139  C  CB  . ALA A 1 38  ? -12.956 -5.675  -8.890  1.00 133.75 ? 49  ALA A CB  1 
ATOM   140  N  N   . ALA A 1 39  ? -13.783 -8.770  -8.546  1.00 128.99 ? 50  ALA A N   1 
ATOM   141  C  CA  . ALA A 1 39  ? -13.341 -10.154 -8.522  1.00 129.29 ? 50  ALA A CA  1 
ATOM   142  C  C   . ALA A 1 39  ? -14.296 -11.050 -9.303  1.00 126.23 ? 50  ALA A C   1 
ATOM   143  O  O   . ALA A 1 39  ? -13.978 -12.202 -9.599  1.00 126.49 ? 50  ALA A O   1 
ATOM   144  C  CB  . ALA A 1 39  ? -13.207 -10.628 -7.094  1.00 129.08 ? 50  ALA A CB  1 
ATOM   145  N  N   . GLY A 1 40  ? -15.463 -10.507 -9.636  1.00 123.51 ? 51  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 40  ? -16.494 -11.249 -10.359 1.00 120.53 ? 51  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 40  ? -17.614 -11.805 -9.489  1.00 117.12 ? 51  GLY A C   1 
ATOM   148  O  O   . GLY A 1 40  ? -18.440 -12.574 -9.967  1.00 114.68 ? 51  GLY A O   1 
ATOM   149  N  N   . GLN A 1 41  ? -17.670 -11.386 -8.225  1.00 117.09 ? 52  GLN A N   1 
ATOM   150  C  CA  . GLN A 1 41  ? -18.538 -12.044 -7.254  1.00 114.46 ? 52  GLN A CA  1 
ATOM   151  C  C   . GLN A 1 41  ? -20.028 -11.755 -7.375  1.00 110.91 ? 52  GLN A C   1 
ATOM   152  O  O   . GLN A 1 41  ? -20.857 -12.658 -7.175  1.00 108.44 ? 52  GLN A O   1 
ATOM   153  C  CB  . GLN A 1 41  ? -18.046 -11.802 -5.834  1.00 115.85 ? 52  GLN A CB  1 
ATOM   154  C  CG  . GLN A 1 41  ? -16.657 -12.429 -5.589  1.00 119.07 ? 52  GLN A CG  1 
ATOM   155  C  CD  . GLN A 1 41  ? -16.425 -13.682 -6.446  1.00 118.75 ? 52  GLN A CD  1 
ATOM   156  O  OE1 . GLN A 1 41  ? -16.941 -14.764 -6.143  1.00 116.29 ? 52  GLN A OE1 1 
ATOM   157  N  NE2 . GLN A 1 41  ? -15.633 -13.533 -7.492  1.00 121.46 ? 52  GLN A NE2 1 
ATOM   158  N  N   . LEU A 1 42  ? -20.379 -10.513 -7.690  1.00 110.78 ? 53  LEU A N   1 
ATOM   159  C  CA  . LEU A 1 42  ? -21.765 -10.166 -8.009  1.00 107.78 ? 53  LEU A CA  1 
ATOM   160  C  C   . LEU A 1 42  ? -22.702 -10.445 -6.848  1.00 105.28 ? 53  LEU A C   1 
ATOM   161  O  O   . LEU A 1 42  ? -23.169 -9.523  -6.183  1.00 104.95 ? 53  LEU A O   1 
ATOM   162  C  CB  . LEU A 1 42  ? -22.247 -10.909 -9.269  1.00 106.45 ? 53  LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 42  ? -22.014 -10.299 -10.659 1.00 107.77 ? 53  LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 42  ? -20.539 -10.190 -10.972 1.00 111.28 ? 53  LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 42  ? -22.714 -11.108 -11.746 1.00 107.26 ? 53  LEU A CD2 1 
ATOM   166  N  N   . ALA A 1 43  ? -22.984 -11.727 -6.618  1.00 103.70 ? 54  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 43  ? -23.836 -12.107 -5.519  1.00 101.65 ? 54  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 43  ? -23.422 -11.387 -4.242  1.00 103.16 ? 54  ALA A C   1 
ATOM   169  O  O   . ALA A 1 43  ? -24.246 -10.742 -3.595  1.00 102.07 ? 54  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 43  ? -23.771 -13.615 -5.316  1.00 100.59 ? 54  ALA A CB  1 
ATOM   171  N  N   . ASP A 1 44  ? -22.140 -11.487 -3.891  1.00 105.89 ? 55  ASP A N   1 
ATOM   172  C  CA  . ASP A 1 44  ? -21.648 -10.947 -2.622  1.00 107.80 ? 55  ASP A CA  1 
ATOM   173  C  C   . ASP A 1 44  ? -21.416 -9.465  -2.730  1.00 108.99 ? 55  ASP A C   1 
ATOM   174  O  O   . ASP A 1 44  ? -21.642 -8.720  -1.784  1.00 109.26 ? 55  ASP A O   1 
ATOM   175  C  CB  . ASP A 1 44  ? -20.363 -11.638 -2.217  1.00 110.75 ? 55  ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 44  ? -20.407 -13.107 -2.479  1.00 109.96 ? 55  ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 44  ? -21.391 -13.752 -2.078  1.00 107.42 ? 55  ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 44  ? -19.465 -13.624 -3.096  1.00 112.04 ? 55  ASP A OD2 1 
ATOM   179  N  N   . ALA A 1 45  ? -20.957 -9.040  -3.894  1.00 109.95 ? 56  ALA A N   1 
ATOM   180  C  CA  . ALA A 1 45  ? -20.860 -7.637  -4.158  1.00 111.07 ? 56  ALA A CA  1 
ATOM   181  C  C   . ALA A 1 45  ? -22.189 -7.015  -3.748  1.00 108.50 ? 56  ALA A C   1 
ATOM   182  O  O   . ALA A 1 45  ? -22.217 -6.053  -2.981  1.00 109.26 ? 56  ALA A O   1 
ATOM   183  C  CB  . ALA A 1 45  ? -20.576 -7.413  -5.617  1.00 111.96 ? 56  ALA A CB  1 
ATOM   184  N  N   . LEU A 1 46  ? -23.287 -7.608  -4.222  1.00 105.61 ? 57  LEU A N   1 
ATOM   185  C  CA  . LEU A 1 46  ? -24.637 -7.103  -3.971  1.00 103.17 ? 57  LEU A CA  1 
ATOM   186  C  C   . LEU A 1 46  ? -25.009 -7.121  -2.495  1.00 102.71 ? 57  LEU A C   1 
ATOM   187  O  O   . LEU A 1 46  ? -25.542 -6.144  -1.978  1.00 102.63 ? 57  LEU A O   1 
ATOM   188  C  CB  . LEU A 1 46  ? -25.674 -7.888  -4.772  1.00 100.44 ? 57  LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 46  ? -27.138 -7.502  -4.547  1.00 97.92  ? 57  LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 46  ? -27.571 -6.404  -5.491  1.00 98.08  ? 57  LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 46  ? -28.057 -8.699  -4.676  1.00 95.46  ? 57  LEU A CD2 1 
ATOM   192  N  N   . SER A 1 47  ? -24.731 -8.224  -1.813  1.00 102.57 ? 58  SER A N   1 
ATOM   193  C  CA  . SER A 1 47  ? -24.976 -8.281  -0.384  1.00 102.63 ? 58  SER A CA  1 
ATOM   194  C  C   . SER A 1 47  ? -24.330 -7.085  0.278   1.00 105.14 ? 58  SER A C   1 
ATOM   195  O  O   . SER A 1 47  ? -24.793 -6.629  1.311   1.00 105.11 ? 58  SER A O   1 
ATOM   196  C  CB  . SER A 1 47  ? -24.383 -9.544  0.222   1.00 103.34 ? 58  SER A CB  1 
ATOM   197  O  OG  . SER A 1 47  ? -22.982 -9.387  0.397   1.00 106.48 ? 58  SER A OG  1 
ATOM   198  N  N   . GLN A 1 48  ? -23.251 -6.590  -0.323  1.00 107.48 ? 59  GLN A N   1 
ATOM   199  C  CA  . GLN A 1 48  ? -22.498 -5.490  0.253   1.00 110.19 ? 59  GLN A CA  1 
ATOM   200  C  C   . GLN A 1 48  ? -23.115 -4.167  -0.055  1.00 109.81 ? 59  GLN A C   1 
ATOM   201  O  O   . GLN A 1 48  ? -23.294 -3.352  0.836   1.00 110.63 ? 59  GLN A O   1 
ATOM   202  C  CB  . GLN A 1 48  ? -21.051 -5.503  -0.210  1.00 113.14 ? 59  GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 48  ? -20.199 -6.481  0.555   1.00 114.92 ? 59  GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 48  ? -20.461 -6.439  2.047   1.00 115.13 ? 59  GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 48  ? -20.373 -5.392  2.679   1.00 115.26 ? 59  GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 48  ? -20.792 -7.581  2.611   1.00 115.30 ? 59  GLN A NE2 1 
ATOM   207  N  N   . PHE A 1 49  ? -23.448 -3.953  -1.318  1.00 108.74 ? 60  PHE A N   1 
ATOM   208  C  CA  . PHE A 1 49  ? -24.022 -2.677  -1.718  1.00 108.68 ? 60  PHE A CA  1 
ATOM   209  C  C   . PHE A 1 49  ? -25.415 -2.445  -1.135  1.00 106.37 ? 60  PHE A C   1 
ATOM   210  O  O   . PHE A 1 49  ? -25.827 -1.303  -0.933  1.00 106.84 ? 60  PHE A O   1 
ATOM   211  C  CB  . PHE A 1 49  ? -24.000 -2.512  -3.239  1.00 108.62 ? 60  PHE A CB  1 
ATOM   212  C  CG  . PHE A 1 49  ? -22.609 -2.480  -3.822  1.00 111.48 ? 60  PHE A CG  1 
ATOM   213  C  CD1 . PHE A 1 49  ? -21.627 -1.650  -3.283  1.00 114.50 ? 60  PHE A CD1 1 
ATOM   214  C  CD2 . PHE A 1 49  ? -22.279 -3.278  -4.913  1.00 111.38 ? 60  PHE A CD2 1 
ATOM   215  C  CE1 . PHE A 1 49  ? -20.335 -1.627  -3.819  1.00 117.39 ? 60  PHE A CE1 1 
ATOM   216  C  CE2 . PHE A 1 49  ? -20.989 -3.259  -5.458  1.00 114.26 ? 60  PHE A CE2 1 
ATOM   217  C  CZ  . PHE A 1 49  ? -20.021 -2.431  -4.912  1.00 117.29 ? 60  PHE A CZ  1 
ATOM   218  N  N   . HIS A 1 50  ? -26.128 -3.531  -0.850  1.00 104.05 ? 61  HIS A N   1 
ATOM   219  C  CA  . HIS A 1 50  ? -27.362 -3.441  -0.086  1.00 102.16 ? 61  HIS A CA  1 
ATOM   220  C  C   . HIS A 1 50  ? -27.046 -2.779  1.253   1.00 103.99 ? 61  HIS A C   1 
ATOM   221  O  O   . HIS A 1 50  ? -27.674 -1.781  1.616   1.00 104.09 ? 61  HIS A O   1 
ATOM   222  C  CB  . HIS A 1 50  ? -28.017 -4.822  0.089   1.00 99.91  ? 61  HIS A CB  1 
ATOM   223  C  CG  . HIS A 1 50  ? -29.058 -5.131  -0.946  1.00 97.46  ? 61  HIS A CG  1 
ATOM   224  N  ND1 . HIS A 1 50  ? -30.363 -4.697  -0.844  1.00 95.71  ? 61  HIS A ND1 1 
ATOM   225  C  CD2 . HIS A 1 50  ? -28.986 -5.821  -2.107  1.00 96.69  ? 61  HIS A CD2 1 
ATOM   226  C  CE1 . HIS A 1 50  ? -31.047 -5.103  -1.898  1.00 93.97  ? 61  HIS A CE1 1 
ATOM   227  N  NE2 . HIS A 1 50  ? -30.234 -5.786  -2.682  1.00 94.52  ? 61  HIS A NE2 1 
ATOM   228  N  N   . ALA A 1 51  ? -26.038 -3.307  1.950   1.00 105.70 ? 62  ALA A N   1 
ATOM   229  C  CA  . ALA A 1 51  ? -25.597 -2.762  3.229   1.00 107.90 ? 62  ALA A CA  1 
ATOM   230  C  C   . ALA A 1 51  ? -25.361 -1.254  3.149   1.00 109.61 ? 62  ALA A C   1 
ATOM   231  O  O   . ALA A 1 51  ? -25.876 -0.482  3.963   1.00 109.96 ? 62  ALA A O   1 
ATOM   232  C  CB  . ALA A 1 51  ? -24.346 -3.459  3.676   1.00 110.11 ? 62  ALA A CB  1 
ATOM   233  N  N   . ALA A 1 52  ? -24.589 -0.845  2.147   1.00 110.82 ? 63  ALA A N   1 
ATOM   234  C  CA  . ALA A 1 52  ? -24.239 0.550   1.961   1.00 112.75 ? 63  ALA A CA  1 
ATOM   235  C  C   . ALA A 1 52  ? -25.482 1.403   1.725   1.00 111.02 ? 63  ALA A C   1 
ATOM   236  O  O   . ALA A 1 52  ? -25.563 2.525   2.215   1.00 112.24 ? 63  ALA A O   1 
ATOM   237  C  CB  . ALA A 1 52  ? -23.259 0.690   0.819   1.00 114.28 ? 63  ALA A CB  1 
ATOM   238  N  N   . VAL A 1 53  ? -26.455 0.865   0.993   1.00 108.33 ? 64  VAL A N   1 
ATOM   239  C  CA  . VAL A 1 53  ? -27.666 1.623   0.682   1.00 106.81 ? 64  VAL A CA  1 
ATOM   240  C  C   . VAL A 1 53  ? -28.520 1.812   1.917   1.00 106.22 ? 64  VAL A C   1 
ATOM   241  O  O   . VAL A 1 53  ? -29.030 2.894   2.156   1.00 106.83 ? 64  VAL A O   1 
ATOM   242  C  CB  . VAL A 1 53  ? -28.503 0.992   -0.438  1.00 104.19 ? 64  VAL A CB  1 
ATOM   243  C  CG1 . VAL A 1 53  ? -29.812 1.745   -0.605  1.00 102.73 ? 64  VAL A CG1 1 
ATOM   244  C  CG2 . VAL A 1 53  ? -27.741 1.019   -1.734  1.00 105.06 ? 64  VAL A CG2 1 
ATOM   245  N  N   . ASP A 1 54  ? -28.671 0.770   2.713   1.00 105.25 ? 65  ASP A N   1 
ATOM   246  C  CA  . ASP A 1 54  ? -29.413 0.919   3.950   1.00 105.00 ? 65  ASP A CA  1 
ATOM   247  C  C   . ASP A 1 54  ? -28.574 1.668   4.969   1.00 107.90 ? 65  ASP A C   1 
ATOM   248  O  O   . ASP A 1 54  ? -29.109 2.269   5.899   1.00 108.41 ? 65  ASP A O   1 
ATOM   249  C  CB  . ASP A 1 54  ? -29.859 -0.443  4.481   1.00 103.43 ? 65  ASP A CB  1 
ATOM   250  C  CG  . ASP A 1 54  ? -30.873 -1.120  3.562   1.00 100.52 ? 65  ASP A CG  1 
ATOM   251  O  OD1 . ASP A 1 54  ? -31.367 -0.460  2.603   1.00 99.71  ? 65  ASP A OD1 1 
ATOM   252  O  OD2 . ASP A 1 54  ? -31.171 -2.312  3.803   1.00 99.22  ? 65  ASP A OD2 1 
ATOM   253  N  N   . GLY A 1 55  ? -27.259 1.639   4.768   1.00 109.98 ? 66  GLY A N   1 
ATOM   254  C  CA  . GLY A 1 55  ? -26.327 2.418   5.571   1.00 113.12 ? 66  GLY A CA  1 
ATOM   255  C  C   . GLY A 1 55  ? -26.509 3.913   5.377   1.00 114.20 ? 66  GLY A C   1 
ATOM   256  O  O   . GLY A 1 55  ? -26.647 4.647   6.347   1.00 115.62 ? 66  GLY A O   1 
ATOM   257  N  N   . ASP A 1 56  ? -26.511 4.367   4.128   1.00 113.67 ? 67  ASP A N   1 
ATOM   258  C  CA  . ASP A 1 56  ? -26.685 5.777   3.841   1.00 114.90 ? 67  ASP A CA  1 
ATOM   259  C  C   . ASP A 1 56  ? -27.688 5.964   2.709   1.00 112.70 ? 67  ASP A C   1 
ATOM   260  O  O   . ASP A 1 56  ? -27.297 6.173   1.553   1.00 113.11 ? 67  ASP A O   1 
ATOM   261  C  CB  . ASP A 1 56  ? -25.343 6.417   3.484   1.00 117.85 ? 67  ASP A CB  1 
ATOM   262  C  CG  . ASP A 1 56  ? -25.378 7.932   3.563   1.00 119.93 ? 67  ASP A CG  1 
ATOM   263  O  OD1 . ASP A 1 56  ? -26.183 8.570   2.850   1.00 118.98 ? 67  ASP A OD1 1 
ATOM   264  O  OD2 . ASP A 1 56  ? -24.585 8.489   4.347   1.00 122.72 ? 67  ASP A OD2 1 
ATOM   265  N  N   . PRO A 1 57  ? -28.993 5.922   3.032   1.00 110.59 ? 68  PRO A N   1 
ATOM   266  C  CA  . PRO A 1 57  ? -29.987 6.009   1.967   1.00 108.62 ? 68  PRO A CA  1 
ATOM   267  C  C   . PRO A 1 57  ? -29.786 7.274   1.142   1.00 110.25 ? 68  PRO A C   1 
ATOM   268  O  O   . PRO A 1 57  ? -30.184 7.329   -0.019  1.00 109.44 ? 68  PRO A O   1 
ATOM   269  C  CB  . PRO A 1 57  ? -31.314 6.075   2.727   1.00 107.02 ? 68  PRO A CB  1 
ATOM   270  C  CG  . PRO A 1 57  ? -31.009 5.545   4.082   1.00 107.39 ? 68  PRO A CG  1 
ATOM   271  C  CD  . PRO A 1 57  ? -29.617 5.981   4.365   1.00 110.23 ? 68  PRO A CD  1 
ATOM   272  N  N   . ASP A 1 58  ? -29.150 8.274   1.747   1.00 112.74 ? 69  ASP A N   1 
ATOM   273  C  CA  . ASP A 1 58  ? -28.938 9.562   1.105   1.00 114.68 ? 69  ASP A CA  1 
ATOM   274  C  C   . ASP A 1 58  ? -27.788 9.569   0.101   1.00 116.22 ? 69  ASP A C   1 
ATOM   275  O  O   . ASP A 1 58  ? -27.769 10.402  -0.814  1.00 117.18 ? 69  ASP A O   1 
ATOM   276  C  CB  . ASP A 1 58  ? -28.715 10.637  2.169   1.00 117.09 ? 69  ASP A CB  1 
ATOM   277  C  CG  . ASP A 1 58  ? -30.004 11.325  2.587   1.00 116.62 ? 69  ASP A CG  1 
ATOM   278  O  OD1 . ASP A 1 58  ? -31.101 10.847  2.203   1.00 114.24 ? 69  ASP A OD1 1 
ATOM   279  O  OD2 . ASP A 1 58  ? -29.912 12.358  3.293   1.00 118.80 ? 69  ASP A OD2 1 
ATOM   280  N  N   . ASN A 1 59  ? -26.833 8.655   0.281   1.00 116.68 ? 70  ASN A N   1 
ATOM   281  C  CA  . ASN A 1 59  ? -25.664 8.575   -0.599  1.00 118.38 ? 70  ASN A CA  1 
ATOM   282  C  C   . ASN A 1 59  ? -26.051 8.156   -2.010  1.00 116.75 ? 70  ASN A C   1 
ATOM   283  O  O   . ASN A 1 59  ? -26.923 7.323   -2.177  1.00 114.02 ? 70  ASN A O   1 
ATOM   284  C  CB  . ASN A 1 59  ? -24.624 7.612   -0.023  1.00 119.31 ? 70  ASN A CB  1 
ATOM   285  C  CG  . ASN A 1 59  ? -23.437 7.403   -0.954  1.00 120.97 ? 70  ASN A CG  1 
ATOM   286  O  OD1 . ASN A 1 59  ? -23.602 7.197   -2.158  1.00 119.72 ? 70  ASN A OD1 1 
ATOM   287  N  ND2 . ASN A 1 59  ? -22.234 7.439   -0.393  1.00 123.83 ? 70  ASN A ND2 1 
ATOM   288  N  N   . TYR A 1 60  ? -25.398 8.719   -3.019  1.00 118.60 ? 71  TYR A N   1 
ATOM   289  C  CA  . TYR A 1 60  ? -25.718 8.394   -4.404  1.00 117.55 ? 71  TYR A CA  1 
ATOM   290  C  C   . TYR A 1 60  ? -24.797 7.313   -5.001  1.00 117.87 ? 71  TYR A C   1 
ATOM   291  O  O   . TYR A 1 60  ? -25.191 6.590   -5.913  1.00 116.16 ? 71  TYR A O   1 
ATOM   292  C  CB  . TYR A 1 60  ? -25.694 9.666   -5.267  1.00 119.48 ? 71  TYR A CB  1 
ATOM   293  C  CG  . TYR A 1 60  ? -24.309 10.056  -5.770  1.00 122.80 ? 71  TYR A CG  1 
ATOM   294  C  CD1 . TYR A 1 60  ? -23.366 10.636  -4.915  1.00 125.47 ? 71  TYR A CD1 1 
ATOM   295  C  CD2 . TYR A 1 60  ? -23.937 9.820   -7.097  1.00 123.47 ? 71  TYR A CD2 1 
ATOM   296  C  CE1 . TYR A 1 60  ? -22.092 10.979  -5.374  1.00 128.74 ? 71  TYR A CE1 1 
ATOM   297  C  CE2 . TYR A 1 60  ? -22.666 10.153  -7.564  1.00 126.73 ? 71  TYR A CE2 1 
ATOM   298  C  CZ  . TYR A 1 60  ? -21.748 10.735  -6.701  1.00 129.36 ? 71  TYR A CZ  1 
ATOM   299  O  OH  . TYR A 1 60  ? -20.490 11.078  -7.165  1.00 132.79 ? 71  TYR A OH  1 
ATOM   300  N  N   . ILE A 1 61  ? -23.568 7.216   -4.504  1.00 120.25 ? 72  ILE A N   1 
ATOM   301  C  CA  . ILE A 1 61  ? -22.601 6.275   -5.066  1.00 121.09 ? 72  ILE A CA  1 
ATOM   302  C  C   . ILE A 1 61  ? -23.110 4.852   -4.866  1.00 118.24 ? 72  ILE A C   1 
ATOM   303  O  O   . ILE A 1 61  ? -23.038 4.022   -5.775  1.00 117.48 ? 72  ILE A O   1 
ATOM   304  C  CB  . ILE A 1 61  ? -21.166 6.420   -4.448  1.00 124.31 ? 72  ILE A CB  1 
ATOM   305  C  CG1 . ILE A 1 61  ? -20.659 7.870   -4.511  1.00 127.43 ? 72  ILE A CG1 1 
ATOM   306  C  CG2 . ILE A 1 61  ? -20.162 5.494   -5.151  1.00 125.25 ? 72  ILE A CG2 1 
ATOM   307  C  CD1 . ILE A 1 61  ? -20.694 8.610   -3.174  1.00 128.51 ? 72  ILE A CD1 1 
ATOM   308  N  N   . ALA A 1 62  ? -23.633 4.585   -3.671  1.00 116.84 ? 73  ALA A N   1 
ATOM   309  C  CA  . ALA A 1 62  ? -24.163 3.272   -3.325  1.00 114.25 ? 73  ALA A CA  1 
ATOM   310  C  C   . ALA A 1 62  ? -25.186 2.848   -4.361  1.00 111.66 ? 73  ALA A C   1 
ATOM   311  O  O   . ALA A 1 62  ? -24.976 1.867   -5.069  1.00 110.95 ? 73  ALA A O   1 
ATOM   312  C  CB  . ALA A 1 62  ? -24.771 3.287   -1.931  1.00 113.28 ? 73  ALA A CB  1 
ATOM   313  N  N   . TYR A 1 63  ? -26.267 3.616   -4.478  1.00 110.51 ? 74  TYR A N   1 
ATOM   314  C  CA  . TYR A 1 63  ? -27.313 3.323   -5.441  1.00 108.27 ? 74  TYR A CA  1 
ATOM   315  C  C   . TYR A 1 63  ? -26.755 3.013   -6.809  1.00 109.16 ? 74  TYR A C   1 
ATOM   316  O  O   . TYR A 1 63  ? -27.294 2.162   -7.511  1.00 107.40 ? 74  TYR A O   1 
ATOM   317  C  CB  . TYR A 1 63  ? -28.311 4.462   -5.537  1.00 107.85 ? 74  TYR A CB  1 
ATOM   318  C  CG  . TYR A 1 63  ? -29.188 4.588   -4.324  1.00 106.53 ? 74  TYR A CG  1 
ATOM   319  C  CD1 . TYR A 1 63  ? -30.351 3.835   -4.204  1.00 103.79 ? 74  TYR A CD1 1 
ATOM   320  C  CD2 . TYR A 1 63  ? -28.861 5.464   -3.294  1.00 108.21 ? 74  TYR A CD2 1 
ATOM   321  C  CE1 . TYR A 1 63  ? -31.166 3.949   -3.077  1.00 102.80 ? 74  TYR A CE1 1 
ATOM   322  C  CE2 . TYR A 1 63  ? -29.669 5.591   -2.169  1.00 107.23 ? 74  TYR A CE2 1 
ATOM   323  C  CZ  . TYR A 1 63  ? -30.821 4.829   -2.064  1.00 104.55 ? 74  TYR A CZ  1 
ATOM   324  O  OH  . TYR A 1 63  ? -31.627 4.937   -0.951  1.00 103.79 ? 74  TYR A OH  1 
ATOM   325  N  N   . TYR A 1 64  ? -25.673 3.690   -7.182  1.00 112.07 ? 75  TYR A N   1 
ATOM   326  C  CA  . TYR A 1 64  ? -25.011 3.415   -8.453  1.00 113.35 ? 75  TYR A CA  1 
ATOM   327  C  C   . TYR A 1 64  ? -24.404 2.011   -8.477  1.00 112.85 ? 75  TYR A C   1 
ATOM   328  O  O   . TYR A 1 64  ? -24.644 1.240   -9.403  1.00 111.83 ? 75  TYR A O   1 
ATOM   329  C  CB  . TYR A 1 64  ? -23.950 4.479   -8.796  1.00 116.90 ? 75  TYR A CB  1 
ATOM   330  C  CG  . TYR A 1 64  ? -23.478 4.368   -10.229 1.00 118.43 ? 75  TYR A CG  1 
ATOM   331  C  CD1 . TYR A 1 64  ? -24.240 4.906   -11.265 1.00 118.14 ? 75  TYR A CD1 1 
ATOM   332  C  CD2 . TYR A 1 64  ? -22.299 3.689   -10.555 1.00 120.33 ? 75  TYR A CD2 1 
ATOM   333  C  CE1 . TYR A 1 64  ? -23.844 4.787   -12.583 1.00 119.74 ? 75  TYR A CE1 1 
ATOM   334  C  CE2 . TYR A 1 64  ? -21.892 3.568   -11.879 1.00 121.96 ? 75  TYR A CE2 1 
ATOM   335  C  CZ  . TYR A 1 64  ? -22.677 4.122   -12.883 1.00 121.65 ? 75  TYR A CZ  1 
ATOM   336  O  OH  . TYR A 1 64  ? -22.317 4.024   -14.200 1.00 123.47 ? 75  TYR A OH  1 
ATOM   337  N  N   . ARG A 1 65  ? -23.634 1.682   -7.446  1.00 113.84 ? 76  ARG A N   1 
ATOM   338  C  CA  . ARG A 1 65  ? -22.936 0.402   -7.396  1.00 113.87 ? 76  ARG A CA  1 
ATOM   339  C  C   . ARG A 1 65  ? -23.888 -0.784  -7.340  1.00 110.61 ? 76  ARG A C   1 
ATOM   340  O  O   . ARG A 1 65  ? -23.741 -1.736  -8.104  1.00 110.13 ? 76  ARG A O   1 
ATOM   341  C  CB  . ARG A 1 65  ? -21.955 0.357   -6.224  1.00 115.61 ? 76  ARG A CB  1 
ATOM   342  C  CG  . ARG A 1 65  ? -20.860 1.418   -6.269  1.00 119.24 ? 76  ARG A CG  1 
ATOM   343  C  CD  . ARG A 1 65  ? -20.039 1.388   -7.569  1.00 121.43 ? 76  ARG A CD  1 
ATOM   344  N  NE  . ARG A 1 65  ? -19.130 2.535   -7.661  1.00 124.89 ? 76  ARG A NE  1 
ATOM   345  C  CZ  . ARG A 1 65  ? -18.126 2.651   -8.528  1.00 127.70 ? 76  ARG A CZ  1 
ATOM   346  N  NH1 . ARG A 1 65  ? -17.873 1.692   -9.412  1.00 127.56 ? 76  ARG A NH1 1 
ATOM   347  N  NH2 . ARG A 1 65  ? -17.366 3.734   -8.505  1.00 130.87 ? 76  ARG A NH2 1 
ATOM   348  N  N   . ARG A 1 66  ? -24.865 -0.722  -6.441  1.00 108.52 ? 77  ARG A N   1 
ATOM   349  C  CA  . ARG A 1 66  ? -25.887 -1.748  -6.394  1.00 105.49 ? 77  ARG A CA  1 
ATOM   350  C  C   . ARG A 1 66  ? -26.404 -1.901  -7.807  1.00 104.64 ? 77  ARG A C   1 
ATOM   351  O  O   . ARG A 1 66  ? -26.341 -2.988  -8.368  1.00 103.92 ? 77  ARG A O   1 
ATOM   352  C  CB  . ARG A 1 66  ? -27.021 -1.397  -5.420  1.00 103.65 ? 77  ARG A CB  1 
ATOM   353  C  CG  . ARG A 1 66  ? -28.008 -2.561  -5.162  1.00 100.87 ? 77  ARG A CG  1 
ATOM   354  C  CD  . ARG A 1 66  ? -28.858 -2.393  -3.886  1.00 99.68  ? 77  ARG A CD  1 
ATOM   355  N  NE  . ARG A 1 66  ? -29.839 -1.313  -3.987  1.00 98.94  ? 77  ARG A NE  1 
ATOM   356  C  CZ  . ARG A 1 66  ? -30.681 -0.962  -3.021  1.00 98.10  ? 77  ARG A CZ  1 
ATOM   357  N  NH1 . ARG A 1 66  ? -30.689 -1.606  -1.856  1.00 97.86  ? 77  ARG A NH1 1 
ATOM   358  N  NH2 . ARG A 1 66  ? -31.525 0.039   -3.224  1.00 97.68  ? 77  ARG A NH2 1 
ATOM   359  N  N   . ALA A 1 67  ? -26.856 -0.797  -8.398  1.00 105.04 ? 78  ALA A N   1 
ATOM   360  C  CA  . ALA A 1 67  ? -27.453 -0.832  -9.726  1.00 104.55 ? 78  ALA A CA  1 
ATOM   361  C  C   . ALA A 1 67  ? -26.571 -1.524  -10.753 1.00 105.94 ? 78  ALA A C   1 
ATOM   362  O  O   . ALA A 1 67  ? -27.085 -2.172  -11.650 1.00 104.71 ? 78  ALA A O   1 
ATOM   363  C  CB  . ALA A 1 67  ? -27.825 0.558   -10.189 1.00 105.71 ? 78  ALA A CB  1 
ATOM   364  N  N   . THR A 1 68  ? -25.252 -1.400  -10.621 1.00 108.62 ? 79  THR A N   1 
ATOM   365  C  CA  . THR A 1 68  ? -24.359 -1.966  -11.637 1.00 110.38 ? 79  THR A CA  1 
ATOM   366  C  C   . THR A 1 68  ? -24.263 -3.470  -11.484 1.00 108.93 ? 79  THR A C   1 
ATOM   367  O  O   . THR A 1 68  ? -24.077 -4.187  -12.459 1.00 109.23 ? 79  THR A O   1 
ATOM   368  C  CB  . THR A 1 68  ? -22.943 -1.291  -11.706 1.00 113.98 ? 79  THR A CB  1 
ATOM   369  O  OG1 . THR A 1 68  ? -22.373 -1.179  -10.398 1.00 114.33 ? 79  THR A OG1 1 
ATOM   370  C  CG2 . THR A 1 68  ? -23.031 0.092   -12.323 1.00 115.89 ? 79  THR A CG2 1 
ATOM   371  N  N   . VAL A 1 69  ? -24.431 -3.937  -10.254 1.00 107.49 ? 80  VAL A N   1 
ATOM   372  C  CA  . VAL A 1 69  ? -24.427 -5.370  -9.946  1.00 106.14 ? 80  VAL A CA  1 
ATOM   373  C  C   . VAL A 1 69  ? -25.731 -6.039  -10.369 1.00 103.19 ? 80  VAL A C   1 
ATOM   374  O  O   . VAL A 1 69  ? -25.720 -7.132  -10.927 1.00 102.66 ? 80  VAL A O   1 
ATOM   375  C  CB  . VAL A 1 69  ? -24.190 -5.619  -8.457  1.00 105.80 ? 80  VAL A CB  1 
ATOM   376  C  CG1 . VAL A 1 69  ? -23.956 -7.072  -8.201  1.00 105.17 ? 80  VAL A CG1 1 
ATOM   377  C  CG2 . VAL A 1 69  ? -22.999 -4.823  -7.979  1.00 108.76 ? 80  VAL A CG2 1 
ATOM   378  N  N   . PHE A 1 70  ? -26.854 -5.379  -10.097 1.00 101.40 ? 81  PHE A N   1 
ATOM   379  C  CA  . PHE A 1 70  ? -28.120 -5.812  -10.653 1.00 98.96  ? 81  PHE A CA  1 
ATOM   380  C  C   . PHE A 1 70  ? -27.930 -6.069  -12.120 1.00 99.86  ? 81  PHE A C   1 
ATOM   381  O  O   . PHE A 1 70  ? -28.115 -7.183  -12.565 1.00 98.87  ? 81  PHE A O   1 
ATOM   382  C  CB  . PHE A 1 70  ? -29.237 -4.796  -10.416 1.00 97.81  ? 81  PHE A CB  1 
ATOM   383  C  CG  . PHE A 1 70  ? -29.874 -4.922  -9.059  1.00 96.20  ? 81  PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1 70  ? -30.068 -6.180  -8.475  1.00 94.53  ? 81  PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1 70  ? -30.289 -3.796  -8.363  1.00 96.51  ? 81  PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1 70  ? -30.643 -6.312  -7.216  1.00 93.33  ? 81  PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1 70  ? -30.874 -3.921  -7.103  1.00 95.32  ? 81  PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1 70  ? -31.046 -5.187  -6.526  1.00 93.76  ? 81  PHE A CZ  1 
ATOM   389  N  N   . LEU A 1 71  ? -27.519 -5.042  -12.853 1.00 101.98 ? 82  LEU A N   1 
ATOM   390  C  CA  . LEU A 1 71  ? -27.250 -5.132  -14.286 1.00 103.39 ? 82  LEU A CA  1 
ATOM   391  C  C   . LEU A 1 71  ? -26.351 -6.301  -14.670 1.00 104.29 ? 82  LEU A C   1 
ATOM   392  O  O   . LEU A 1 71  ? -26.680 -7.070  -15.572 1.00 103.74 ? 82  LEU A O   1 
ATOM   393  C  CB  . LEU A 1 71  ? -26.603 -3.838  -14.770 1.00 106.21 ? 82  LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 71  ? -27.369 -2.535  -14.576 1.00 105.85 ? 82  LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 71  ? -26.497 -1.373  -14.993 1.00 109.00 ? 82  LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 71  ? -28.669 -2.549  -15.357 1.00 104.02 ? 82  LEU A CD2 1 
ATOM   397  N  N   . ALA A 1 72  ? -25.212 -6.423  -13.995 1.00 105.84 ? 83  ALA A N   1 
ATOM   398  C  CA  . ALA A 1 72  ? -24.273 -7.489  -14.285 1.00 107.05 ? 83  ALA A CA  1 
ATOM   399  C  C   . ALA A 1 72  ? -24.974 -8.841  -14.223 1.00 104.48 ? 83  ALA A C   1 
ATOM   400  O  O   . ALA A 1 72  ? -24.981 -9.570  -15.211 1.00 104.66 ? 83  ALA A O   1 
ATOM   401  C  CB  . ALA A 1 72  ? -23.106 -7.438  -13.337 1.00 108.83 ? 83  ALA A CB  1 
HETATM 402  N  N   . MSE A 1 73  ? -25.570 -9.158  -13.072 1.00 102.24 ? 84  MSE A N   1 
HETATM 403  C  CA  . MSE A 1 73  ? -26.489 -10.289 -12.938 1.00 99.56  ? 84  MSE A CA  1 
HETATM 404  C  C   . MSE A 1 73  ? -27.698 -9.968  -13.782 1.00 98.08  ? 84  MSE A C   1 
HETATM 405  O  O   . MSE A 1 73  ? -28.009 -8.810  -13.974 1.00 98.47  ? 84  MSE A O   1 
HETATM 406  C  CB  . MSE A 1 73  ? -26.944 -10.410 -11.501 1.00 97.84  ? 84  MSE A CB  1 
HETATM 407  C  CG  . MSE A 1 73  ? -25.840 -10.298 -10.495 1.00 99.53  ? 84  MSE A CG  1 
HETATM 408  SE SE  . MSE A 1 73  ? -26.515 -10.657 -8.728  1.00 97.31  ? 84  MSE A SE  1 
HETATM 409  C  CE  . MSE A 1 73  ? -27.183 -8.900  -8.276  1.00 97.63  ? 84  MSE A CE  1 
ATOM   410  N  N   . GLY A 1 74  ? -28.412 -10.948 -14.293 1.00 96.53  ? 85  GLY A N   1 
ATOM   411  C  CA  . GLY A 1 74  ? -29.450 -10.582 -15.252 1.00 95.60  ? 85  GLY A CA  1 
ATOM   412  C  C   . GLY A 1 74  ? -30.698 -9.921  -14.685 1.00 93.53  ? 85  GLY A C   1 
ATOM   413  O  O   . GLY A 1 74  ? -31.788 -10.315 -15.066 1.00 91.58  ? 85  GLY A O   1 
ATOM   414  N  N   . LYS A 1 75  ? -30.574 -8.920  -13.811 1.00 94.09  ? 86  LYS A N   1 
ATOM   415  C  CA  . LYS A 1 75  ? -31.747 -8.392  -13.072 1.00 92.28  ? 86  LYS A CA  1 
ATOM   416  C  C   . LYS A 1 75  ? -32.238 -7.036  -13.528 1.00 93.03  ? 86  LYS A C   1 
ATOM   417  O  O   . LYS A 1 75  ? -31.696 -6.007  -13.078 1.00 94.90  ? 86  LYS A O   1 
ATOM   418  C  CB  . LYS A 1 75  ? -31.432 -8.250  -11.582 1.00 92.40  ? 86  LYS A CB  1 
ATOM   419  C  CG  . LYS A 1 75  ? -30.643 -9.364  -10.990 1.00 92.28  ? 86  LYS A CG  1 
ATOM   420  C  CD  . LYS A 1 75  ? -31.293 -9.830  -9.711  1.00 90.09  ? 86  LYS A CD  1 
ATOM   421  C  CE  . LYS A 1 75  ? -30.330 -10.712 -8.941  1.00 90.53  ? 86  LYS A CE  1 
ATOM   422  N  NZ  . LYS A 1 75  ? -31.008 -11.854 -8.249  1.00 88.46  ? 86  LYS A NZ  1 
ATOM   423  N  N   . SER A 1 76  ? -33.280 -6.994  -14.362 1.00 91.76  ? 87  SER A N   1 
ATOM   424  C  CA  . SER A 1 76  ? -33.658 -5.703  -14.925 1.00 92.77  ? 87  SER A CA  1 
ATOM   425  C  C   . SER A 1 76  ? -34.598 -4.873  -14.080 1.00 91.91  ? 87  SER A C   1 
ATOM   426  O  O   . SER A 1 76  ? -34.445 -3.660  -13.985 1.00 93.34  ? 87  SER A O   1 
ATOM   427  C  CB  . SER A 1 76  ? -34.199 -5.832  -16.344 1.00 92.56  ? 87  SER A CB  1 
ATOM   428  O  OG  . SER A 1 76  ? -35.572 -6.181  -16.324 1.00 92.65  ? 87  SER A OG  1 
ATOM   429  N  N   . LYS A 1 77  ? -35.588 -5.502  -13.488 1.00 89.75  ? 88  LYS A N   1 
ATOM   430  C  CA  . LYS A 1 77  ? -36.506 -4.754  -12.663 1.00 88.98  ? 88  LYS A CA  1 
ATOM   431  C  C   . LYS A 1 77  ? -35.758 -4.025  -11.557 1.00 89.92  ? 88  LYS A C   1 
ATOM   432  O  O   . LYS A 1 77  ? -35.932 -2.812  -11.351 1.00 90.86  ? 88  LYS A O   1 
ATOM   433  C  CB  . LYS A 1 77  ? -37.576 -5.683  -12.051 1.00 86.58  ? 88  LYS A CB  1 
ATOM   434  C  CG  . LYS A 1 77  ? -38.894 -5.562  -12.790 1.00 85.82  ? 88  LYS A CG  1 
ATOM   435  C  CD  . LYS A 1 77  ? -40.044 -6.280  -12.111 1.00 83.75  ? 88  LYS A CD  1 
ATOM   436  C  CE  . LYS A 1 77  ? -41.254 -6.279  -13.087 1.00 83.46  ? 88  LYS A CE  1 
ATOM   437  N  NZ  . LYS A 1 77  ? -42.376 -7.137  -12.589 1.00 81.60  ? 88  LYS A NZ  1 
ATOM   438  N  N   . ALA A 1 78  ? -34.909 -4.777  -10.865 1.00 89.85  ? 89  ALA A N   1 
ATOM   439  C  CA  . ALA A 1 78  ? -34.309 -4.328  -9.629  1.00 90.55  ? 89  ALA A CA  1 
ATOM   440  C  C   . ALA A 1 78  ? -33.389 -3.146  -9.842  1.00 93.00  ? 89  ALA A C   1 
ATOM   441  O  O   . ALA A 1 78  ? -33.149 -2.370  -8.925  1.00 93.73  ? 89  ALA A O   1 
ATOM   442  C  CB  . ALA A 1 78  ? -33.568 -5.471  -8.973  1.00 90.25  ? 89  ALA A CB  1 
ATOM   443  N  N   . ALA A 1 79  ? -32.890 -3.001  -11.061 1.00 94.43  ? 90  ALA A N   1 
ATOM   444  C  CA  . ALA A 1 79  ? -31.914 -1.963  -11.360 1.00 97.07  ? 90  ALA A CA  1 
ATOM   445  C  C   . ALA A 1 79  ? -32.532 -0.593  -11.616 1.00 97.82  ? 90  ALA A C   1 
ATOM   446  O  O   . ALA A 1 79  ? -32.036 0.411   -11.115 1.00 99.37  ? 90  ALA A O   1 
ATOM   447  C  CB  . ALA A 1 79  ? -31.050 -2.379  -12.518 1.00 98.61  ? 90  ALA A CB  1 
ATOM   448  N  N   . LEU A 1 80  ? -33.609 -0.556  -12.390 1.00 96.89  ? 91  LEU A N   1 
ATOM   449  C  CA  . LEU A 1 80  ? -34.256 0.704   -12.752 1.00 97.77  ? 91  LEU A CA  1 
ATOM   450  C  C   . LEU A 1 80  ? -34.462 1.644   -11.564 1.00 97.85  ? 91  LEU A C   1 
ATOM   451  O  O   . LEU A 1 80  ? -33.924 2.746   -11.575 1.00 99.90  ? 91  LEU A O   1 
ATOM   452  C  CB  . LEU A 1 80  ? -35.563 0.460   -13.517 1.00 96.48  ? 91  LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 80  ? -36.412 1.650   -13.989 1.00 97.45  ? 91  LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 80  ? -37.251 1.273   -15.210 1.00 97.20  ? 91  LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 80  ? -37.316 2.191   -12.871 1.00 96.36  ? 91  LEU A CD2 1 
ATOM   456  N  N   . PRO A 1 81  ? -35.213 1.216   -10.530 1.00 95.82  ? 92  PRO A N   1 
ATOM   457  C  CA  . PRO A 1 81  ? -35.424 2.139   -9.423  1.00 96.15  ? 92  PRO A CA  1 
ATOM   458  C  C   . PRO A 1 81  ? -34.118 2.701   -8.858  1.00 98.18  ? 92  PRO A C   1 
ATOM   459  O  O   . PRO A 1 81  ? -34.081 3.869   -8.479  1.00 99.53  ? 92  PRO A O   1 
ATOM   460  C  CB  . PRO A 1 81  ? -36.130 1.271   -8.372  1.00 93.88  ? 92  PRO A CB  1 
ATOM   461  C  CG  . PRO A 1 81  ? -35.813 -0.139  -8.747  1.00 92.80  ? 92  PRO A CG  1 
ATOM   462  C  CD  . PRO A 1 81  ? -35.803 -0.102  -10.236 1.00 93.47  ? 92  PRO A CD  1 
ATOM   463  N  N   . ASP A 1 82  ? -33.065 1.883   -8.822  1.00 98.56  ? 93  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 82  ? -31.766 2.295   -8.284  1.00 100.67 ? 93  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 82  ? -31.081 3.330   -9.162  1.00 103.26 ? 93  ASP A C   1 
ATOM   466  O  O   . ASP A 1 82  ? -30.323 4.170   -8.665  1.00 105.31 ? 93  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 82  ? -30.837 1.091   -8.112  1.00 100.57 ? 93  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 82  ? -31.168 0.255   -6.877  1.00 98.70  ? 93  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 82  ? -32.346 0.254   -6.424  1.00 96.90  ? 93  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 82  ? -30.237 -0.414  -6.363  1.00 99.25  ? 93  ASP A OD2 1 
ATOM   471  N  N   . LEU A 1 83  ? -31.337 3.259   -10.465 1.00 103.35 ? 94  LEU A N   1 
ATOM   472  C  CA  . LEU A 1 83  ? -30.736 4.196   -11.397 1.00 105.96 ? 94  LEU A CA  1 
ATOM   473  C  C   . LEU A 1 83  ? -31.421 5.533   -11.311 1.00 106.73 ? 94  LEU A C   1 
ATOM   474  O  O   . LEU A 1 83  ? -30.752 6.561   -11.279 1.00 109.14 ? 94  LEU A O   1 
ATOM   475  C  CB  . LEU A 1 83  ? -30.758 3.672   -12.832 1.00 106.17 ? 94  LEU A CB  1 
ATOM   476  C  CG  . LEU A 1 83  ? -29.610 2.723   -13.200 1.00 107.06 ? 94  LEU A CG  1 
ATOM   477  C  CD1 . LEU A 1 83  ? -29.779 2.202   -14.612 1.00 107.42 ? 94  LEU A CD1 1 
ATOM   478  C  CD2 . LEU A 1 83  ? -28.234 3.367   -13.041 1.00 109.98 ? 94  LEU A CD2 1 
ATOM   479  N  N   . THR A 1 84  ? -32.749 5.525   -11.249 1.00 104.86 ? 95  THR A N   1 
ATOM   480  C  CA  . THR A 1 84  ? -33.487 6.779   -11.200 1.00 105.69 ? 95  THR A CA  1 
ATOM   481  C  C   . THR A 1 84  ? -33.270 7.528   -9.875  1.00 106.42 ? 95  THR A C   1 
ATOM   482  O  O   . THR A 1 84  ? -33.322 8.757   -9.845  1.00 108.37 ? 95  THR A O   1 
ATOM   483  C  CB  . THR A 1 84  ? -34.984 6.602   -11.480 1.00 103.77 ? 95  THR A CB  1 
ATOM   484  O  OG1 . THR A 1 84  ? -35.623 6.129   -10.298 1.00 101.68 ? 95  THR A OG1 1 
ATOM   485  C  CG2 . THR A 1 84  ? -35.224 5.630   -12.621 1.00 102.83 ? 95  THR A CG2 1 
ATOM   486  N  N   . LYS A 1 85  ? -33.015 6.797   -8.791  1.00 105.06 ? 96  LYS A N   1 
ATOM   487  C  CA  . LYS A 1 85  ? -32.655 7.423   -7.514  1.00 106.00 ? 96  LYS A CA  1 
ATOM   488  C  C   . LYS A 1 85  ? -31.354 8.198   -7.661  1.00 108.96 ? 96  LYS A C   1 
ATOM   489  O  O   . LYS A 1 85  ? -31.236 9.324   -7.178  1.00 110.67 ? 96  LYS A O   1 
ATOM   490  C  CB  . LYS A 1 85  ? -32.520 6.376   -6.400  1.00 104.44 ? 96  LYS A CB  1 
ATOM   491  C  CG  . LYS A 1 85  ? -32.163 6.932   -5.013  1.00 105.44 ? 96  LYS A CG  1 
ATOM   492  C  CD  . LYS A 1 85  ? -33.342 7.667   -4.351  1.00 104.81 ? 96  LYS A CD  1 
ATOM   493  C  CE  . LYS A 1 85  ? -33.034 8.049   -2.894  1.00 105.97 ? 96  LYS A CE  1 
ATOM   494  N  NZ  . LYS A 1 85  ? -34.257 8.348   -2.075  1.00 104.81 ? 96  LYS A NZ  1 
ATOM   495  N  N   . VAL A 1 86  ? -30.387 7.584   -8.334  1.00 109.71 ? 97  VAL A N   1 
ATOM   496  C  CA  . VAL A 1 86  ? -29.121 8.238   -8.651  1.00 112.72 ? 97  VAL A CA  1 
ATOM   497  C  C   . VAL A 1 86  ? -29.384 9.561   -9.383  1.00 114.63 ? 97  VAL A C   1 
ATOM   498  O  O   . VAL A 1 86  ? -28.945 10.626  -8.941  1.00 116.89 ? 97  VAL A O   1 
ATOM   499  C  CB  . VAL A 1 86  ? -28.194 7.314   -9.485  1.00 113.25 ? 97  VAL A CB  1 
ATOM   500  C  CG1 . VAL A 1 86  ? -27.002 8.078   -10.014 1.00 116.65 ? 97  VAL A CG1 1 
ATOM   501  C  CG2 . VAL A 1 86  ? -27.729 6.139   -8.651  1.00 112.12 ? 97  VAL A CG2 1 
ATOM   502  N  N   . ILE A 1 87  ? -30.120 9.485   -10.487 1.00 113.85 ? 98  ILE A N   1 
ATOM   503  C  CA  . ILE A 1 87  ? -30.523 10.674  -11.212 1.00 115.58 ? 98  ILE A CA  1 
ATOM   504  C  C   . ILE A 1 87  ? -31.050 11.721  -10.233 1.00 115.79 ? 98  ILE A C   1 
ATOM   505  O  O   . ILE A 1 87  ? -30.459 12.791  -10.096 1.00 118.30 ? 98  ILE A O   1 
ATOM   506  C  CB  . ILE A 1 87  ? -31.544 10.332  -12.311 1.00 114.47 ? 98  ILE A CB  1 
ATOM   507  C  CG1 . ILE A 1 87  ? -30.796 9.791   -13.525 1.00 115.35 ? 98  ILE A CG1 1 
ATOM   508  C  CG2 . ILE A 1 87  ? -32.354 11.552  -12.712 1.00 116.03 ? 98  ILE A CG2 1 
ATOM   509  C  CD1 . ILE A 1 87  ? -31.348 8.515   -14.057 1.00 112.91 ? 98  ILE A CD1 1 
ATOM   510  N  N   . GLN A 1 88  ? -32.124 11.395  -9.520  1.00 113.33 ? 99  GLN A N   1 
ATOM   511  C  CA  . GLN A 1 88  ? -32.737 12.339  -8.593  1.00 113.46 ? 99  GLN A CA  1 
ATOM   512  C  C   . GLN A 1 88  ? -31.751 12.933  -7.592  1.00 115.56 ? 99  GLN A C   1 
ATOM   513  O  O   . GLN A 1 88  ? -31.796 14.130  -7.316  1.00 117.67 ? 99  GLN A O   1 
ATOM   514  C  CB  . GLN A 1 88  ? -33.894 11.680  -7.864  1.00 115.03 ? 99  GLN A CB  1 
ATOM   515  C  CG  . GLN A 1 88  ? -35.033 11.303  -8.788  1.00 114.84 ? 99  GLN A CG  1 
ATOM   516  C  CD  . GLN A 1 88  ? -36.244 10.798  -8.023  1.00 114.55 ? 99  GLN A CD  1 
ATOM   517  O  OE1 . GLN A 1 88  ? -36.113 10.172  -6.955  1.00 114.41 ? 99  GLN A OE1 1 
ATOM   518  N  NE2 . GLN A 1 88  ? -37.439 11.066  -8.560  1.00 114.49 ? 99  GLN A NE2 1 
ATOM   519  N  N   . LEU A 1 89  ? -30.849 12.107  -7.069  1.00 115.22 ? 100 LEU A N   1 
ATOM   520  C  CA  . LEU A 1 89  ? -29.899 12.569  -6.052  1.00 117.15 ? 100 LEU A CA  1 
ATOM   521  C  C   . LEU A 1 89  ? -28.809 13.474  -6.604  1.00 120.47 ? 100 LEU A C   1 
ATOM   522  O  O   . LEU A 1 89  ? -28.613 14.582  -6.110  1.00 122.52 ? 100 LEU A O   1 
ATOM   523  C  CB  . LEU A 1 89  ? -29.272 11.395  -5.300  1.00 116.13 ? 100 LEU A CB  1 
ATOM   524  C  CG  . LEU A 1 89  ? -30.119 10.754  -4.210  1.00 113.70 ? 100 LEU A CG  1 
ATOM   525  C  CD1 . LEU A 1 89  ? -29.280 9.692   -3.547  1.00 113.14 ? 100 LEU A CD1 1 
ATOM   526  C  CD2 . LEU A 1 89  ? -30.620 11.781  -3.188  1.00 114.58 ? 100 LEU A CD2 1 
ATOM   527  N  N   . LYS A 1 90  ? -28.098 12.994  -7.616  1.00 121.16 ? 101 LYS A N   1 
ATOM   528  C  CA  . LYS A 1 90  ? -27.069 13.789  -8.249  1.00 124.46 ? 101 LYS A CA  1 
ATOM   529  C  C   . LYS A 1 90  ? -27.510 14.104  -9.687  1.00 124.94 ? 101 LYS A C   1 
ATOM   530  O  O   . LYS A 1 90  ? -27.032 13.545  -10.699 1.00 125.47 ? 101 LYS A O   1 
ATOM   531  C  CB  . LYS A 1 90  ? -25.729 13.054  -8.209  1.00 125.72 ? 101 LYS A CB  1 
ATOM   532  C  CG  . LYS A 1 90  ? -24.542 13.980  -7.917  1.00 129.53 ? 101 LYS A CG  1 
ATOM   533  C  CD  . LYS A 1 90  ? -23.267 13.406  -8.535  1.00 131.10 ? 101 LYS A CD  1 
ATOM   534  C  CE  . LYS A 1 90  ? -22.197 14.472  -8.752  1.00 135.09 ? 101 LYS A CE  1 
ATOM   535  N  NZ  . LYS A 1 90  ? -21.026 13.904  -9.505  1.00 136.60 ? 101 LYS A NZ  1 
HETATM 536  N  N   . MSE A 1 91  ? -28.532 15.003  -9.754  1.00 124.93 ? 102 MSE A N   1 
HETATM 537  C  CA  . MSE A 1 91  ? -29.222 15.356  -11.008 1.00 125.35 ? 102 MSE A CA  1 
HETATM 538  C  C   . MSE A 1 91  ? -28.250 15.722  -12.138 1.00 128.29 ? 102 MSE A C   1 
HETATM 539  O  O   . MSE A 1 91  ? -28.567 15.576  -13.324 1.00 128.35 ? 102 MSE A O   1 
HETATM 540  C  CB  . MSE A 1 91  ? -30.228 16.492  -10.756 1.00 125.87 ? 102 MSE A CB  1 
HETATM 541  C  CG  . MSE A 1 91  ? -31.212 16.764  -11.902 1.00 125.63 ? 102 MSE A CG  1 
HETATM 542  SE SE  . MSE A 1 91  ? -32.552 15.354  -12.225 1.00 121.43 ? 102 MSE A SE  1 
HETATM 543  C  CE  . MSE A 1 91  ? -34.001 15.949  -11.043 1.00 119.43 ? 102 MSE A CE  1 
ATOM   544  N  N   . ASP A 1 92  ? -27.066 16.186  -11.746 1.00 130.90 ? 103 ASP A N   1 
ATOM   545  C  CA  . ASP A 1 92  ? -26.016 16.568  -12.673 1.00 134.16 ? 103 ASP A CA  1 
ATOM   546  C  C   . ASP A 1 92  ? -25.451 15.367  -13.453 1.00 133.73 ? 103 ASP A C   1 
ATOM   547  O  O   . ASP A 1 92  ? -25.313 15.394  -14.717 1.00 135.05 ? 103 ASP A O   1 
ATOM   548  C  CB  . ASP A 1 92  ? -24.888 17.255  -11.886 1.00 136.99 ? 103 ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 92  ? -23.738 17.679  -12.776 1.00 140.75 ? 103 ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 92  ? -23.984 18.442  -13.743 1.00 142.10 ? 103 ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 92  ? -22.587 17.255  -12.503 1.00 142.56 ? 103 ASP A OD2 1 
ATOM   552  N  N   . PHE A 1 93  ? -25.086 14.321  -12.692 1.00 132.09 ? 104 PHE A N   1 
ATOM   553  C  CA  . PHE A 1 93  ? -24.327 13.164  -13.200 1.00 131.80 ? 104 PHE A CA  1 
ATOM   554  C  C   . PHE A 1 93  ? -25.035 12.427  -14.344 1.00 130.24 ? 104 PHE A C   1 
ATOM   555  O  O   . PHE A 1 93  ? -25.942 11.617  -14.110 1.00 127.11 ? 104 PHE A O   1 
ATOM   556  C  CB  . PHE A 1 93  ? -23.984 12.210  -12.027 1.00 129.71 ? 104 PHE A CB  1 
ATOM   557  C  CG  . PHE A 1 93  ? -23.269 10.943  -12.449 1.00 129.59 ? 104 PHE A CG  1 
ATOM   558  C  CD1 . PHE A 1 93  ? -22.259 10.977  -13.422 1.00 132.77 ? 104 PHE A CD1 1 
ATOM   559  C  CD2 . PHE A 1 93  ? -23.582 9.717   -11.841 1.00 126.49 ? 104 PHE A CD2 1 
ATOM   560  C  CE1 . PHE A 1 93  ? -21.600 9.808   -13.793 1.00 132.84 ? 104 PHE A CE1 1 
ATOM   561  C  CE2 . PHE A 1 93  ? -22.929 8.544   -12.258 1.00 126.50 ? 104 PHE A CE2 1 
ATOM   562  C  CZ  . PHE A 1 93  ? -21.931 8.594   -13.180 1.00 129.68 ? 104 PHE A CZ  1 
ATOM   563  N  N   . THR A 1 94  ? -24.575 12.702  -15.579 1.00 132.73 ? 105 THR A N   1 
ATOM   564  C  CA  . THR A 1 94  ? -25.316 12.280  -16.779 1.00 132.01 ? 105 THR A CA  1 
ATOM   565  C  C   . THR A 1 94  ? -25.111 10.829  -17.225 1.00 130.72 ? 105 THR A C   1 
ATOM   566  O  O   . THR A 1 94  ? -26.036 10.222  -17.778 1.00 129.35 ? 105 THR A O   1 
ATOM   567  C  CB  . THR A 1 94  ? -25.089 13.243  -17.976 1.00 135.51 ? 105 THR A CB  1 
ATOM   568  O  OG1 . THR A 1 94  ? -23.691 13.364  -18.246 1.00 138.76 ? 105 THR A OG1 1 
ATOM   569  C  CG2 . THR A 1 94  ? -25.661 14.623  -17.668 1.00 136.47 ? 105 THR A CG2 1 
ATOM   570  N  N   . ALA A 1 95  ? -23.929 10.265  -16.990 1.00 131.27 ? 106 ALA A N   1 
ATOM   571  C  CA  . ALA A 1 95  ? -23.666 8.882   -17.408 1.00 130.11 ? 106 ALA A CA  1 
ATOM   572  C  C   . ALA A 1 95  ? -24.751 7.928   -16.892 1.00 125.97 ? 106 ALA A C   1 
ATOM   573  O  O   . ALA A 1 95  ? -25.034 6.892   -17.498 1.00 124.63 ? 106 ALA A O   1 
ATOM   574  C  CB  . ALA A 1 95  ? -22.304 8.441   -16.939 1.00 131.42 ? 106 ALA A CB  1 
ATOM   575  N  N   . ALA A 1 96  ? -25.359 8.319   -15.775 1.00 124.19 ? 107 ALA A N   1 
ATOM   576  C  CA  . ALA A 1 96  ? -26.436 7.581   -15.134 1.00 120.49 ? 107 ALA A CA  1 
ATOM   577  C  C   . ALA A 1 96  ? -27.744 7.637   -15.913 1.00 119.19 ? 107 ALA A C   1 
ATOM   578  O  O   . ALA A 1 96  ? -28.427 6.621   -16.050 1.00 116.61 ? 107 ALA A O   1 
ATOM   579  C  CB  . ALA A 1 96  ? -26.647 8.107   -13.734 1.00 119.55 ? 107 ALA A CB  1 
ATOM   580  N  N   . ARG A 1 97  ? -28.111 8.821   -16.401 1.00 121.07 ? 108 ARG A N   1 
ATOM   581  C  CA  . ARG A 1 97  ? -29.292 8.946   -17.247 1.00 120.34 ? 108 ARG A CA  1 
ATOM   582  C  C   . ARG A 1 97  ? -29.064 8.177   -18.544 1.00 120.97 ? 108 ARG A C   1 
ATOM   583  O  O   . ARG A 1 97  ? -30.008 7.658   -19.136 1.00 119.25 ? 108 ARG A O   1 
ATOM   584  C  CB  . ARG A 1 97  ? -29.638 10.414  -17.517 1.00 122.52 ? 108 ARG A CB  1 
ATOM   585  C  CG  . ARG A 1 97  ? -30.981 10.602  -18.224 1.00 121.61 ? 108 ARG A CG  1 
ATOM   586  C  CD  . ARG A 1 97  ? -31.376 12.060  -18.362 1.00 123.55 ? 108 ARG A CD  1 
ATOM   587  N  NE  . ARG A 1 97  ? -32.430 12.447  -17.431 1.00 121.53 ? 108 ARG A NE  1 
ATOM   588  C  CZ  . ARG A 1 97  ? -32.222 13.027  -16.254 1.00 121.45 ? 108 ARG A CZ  1 
ATOM   589  N  NH1 . ARG A 1 97  ? -30.988 13.288  -15.846 1.00 123.25 ? 108 ARG A NH1 1 
ATOM   590  N  NH2 . ARG A 1 97  ? -33.254 13.347  -15.482 1.00 119.74 ? 108 ARG A NH2 1 
ATOM   591  N  N   . LEU A 1 98  ? -27.804 8.094   -18.961 1.00 123.56 ? 109 LEU A N   1 
ATOM   592  C  CA  . LEU A 1 98  ? -27.422 7.283   -20.105 1.00 124.48 ? 109 LEU A CA  1 
ATOM   593  C  C   . LEU A 1 98  ? -27.599 5.807   -19.770 1.00 121.51 ? 109 LEU A C   1 
ATOM   594  O  O   . LEU A 1 98  ? -28.132 5.041   -20.574 1.00 120.65 ? 109 LEU A O   1 
ATOM   595  C  CB  . LEU A 1 98  ? -25.975 7.571   -20.516 1.00 128.02 ? 109 LEU A CB  1 
ATOM   596  C  CG  . LEU A 1 98  ? -25.357 6.664   -21.589 1.00 129.36 ? 109 LEU A CG  1 
ATOM   597  C  CD1 . LEU A 1 98  ? -25.553 7.244   -22.972 1.00 132.28 ? 109 LEU A CD1 1 
ATOM   598  C  CD2 . LEU A 1 98  ? -23.876 6.394   -21.306 1.00 131.10 ? 109 LEU A CD2 1 
ATOM   599  N  N   . GLN A 1 99  ? -27.156 5.414   -18.581 1.00 120.12 ? 110 GLN A N   1 
ATOM   600  C  CA  . GLN A 1 99  ? -27.352 4.044   -18.118 1.00 117.33 ? 110 GLN A CA  1 
ATOM   601  C  C   . GLN A 1 99  ? -28.827 3.677   -18.104 1.00 114.35 ? 110 GLN A C   1 
ATOM   602  O  O   . GLN A 1 99  ? -29.209 2.641   -18.636 1.00 112.95 ? 110 GLN A O   1 
ATOM   603  C  CB  . GLN A 1 99  ? -26.720 3.816   -16.741 1.00 116.57 ? 110 GLN A CB  1 
ATOM   604  C  CG  . GLN A 1 99  ? -25.195 3.712   -16.758 1.00 119.22 ? 110 GLN A CG  1 
ATOM   605  C  CD  . GLN A 1 99  ? -24.682 2.744   -17.818 1.00 120.22 ? 110 GLN A CD  1 
ATOM   606  O  OE1 . GLN A 1 99  ? -24.250 3.160   -18.905 1.00 123.12 ? 110 GLN A OE1 1 
ATOM   607  N  NE2 . GLN A 1 99  ? -24.741 1.448   -17.514 1.00 117.96 ? 110 GLN A NE2 1 
ATOM   608  N  N   . ARG A 1 100 ? -29.649 4.543   -17.519 1.00 113.59 ? 111 ARG A N   1 
ATOM   609  C  CA  . ARG A 1 100 ? -31.088 4.346   -17.495 1.00 111.06 ? 111 ARG A CA  1 
ATOM   610  C  C   . ARG A 1 100 ? -31.613 4.101   -18.897 1.00 111.57 ? 111 ARG A C   1 
ATOM   611  O  O   . ARG A 1 100 ? -32.292 3.118   -19.135 1.00 109.57 ? 111 ARG A O   1 
ATOM   612  C  CB  . ARG A 1 100 ? -31.780 5.552   -16.878 1.00 111.07 ? 111 ARG A CB  1 
ATOM   613  C  CG  . ARG A 1 100 ? -33.082 5.227   -16.188 1.00 108.10 ? 111 ARG A CG  1 
ATOM   614  C  CD  . ARG A 1 100 ? -33.563 6.412   -15.377 1.00 108.38 ? 111 ARG A CD  1 
ATOM   615  N  NE  . ARG A 1 100 ? -34.750 7.054   -15.937 1.00 108.36 ? 111 ARG A NE  1 
ATOM   616  C  CZ  . ARG A 1 100 ? -35.371 8.102   -15.397 1.00 108.65 ? 111 ARG A CZ  1 
ATOM   617  N  NH1 . ARG A 1 100 ? -34.920 8.658   -14.279 1.00 109.00 ? 111 ARG A NH1 1 
ATOM   618  N  NH2 . ARG A 1 100 ? -36.454 8.602   -15.981 1.00 108.77 ? 111 ARG A NH2 1 
ATOM   619  N  N   . GLY A 1 101 ? -31.268 4.984   -19.828 1.00 114.47 ? 112 GLY A N   1 
ATOM   620  C  CA  . GLY A 1 101 ? -31.698 4.852   -21.214 1.00 115.57 ? 112 GLY A CA  1 
ATOM   621  C  C   . GLY A 1 101 ? -31.445 3.472   -21.783 1.00 114.82 ? 112 GLY A C   1 
ATOM   622  O  O   . GLY A 1 101 ? -32.325 2.883   -22.405 1.00 113.74 ? 112 GLY A O   1 
ATOM   623  N  N   . HIS A 1 102 ? -30.240 2.955   -21.560 1.00 115.53 ? 113 HIS A N   1 
ATOM   624  C  CA  . HIS A 1 102 ? -29.876 1.622   -22.032 1.00 115.07 ? 113 HIS A CA  1 
ATOM   625  C  C   . HIS A 1 102 ? -30.840 0.588   -21.497 1.00 111.49 ? 113 HIS A C   1 
ATOM   626  O  O   . HIS A 1 102 ? -31.434 -0.176  -22.254 1.00 110.71 ? 113 HIS A O   1 
ATOM   627  C  CB  . HIS A 1 102 ? -28.452 1.251   -21.608 1.00 116.43 ? 113 HIS A CB  1 
ATOM   628  C  CG  . HIS A 1 102 ? -27.390 1.838   -22.481 1.00 120.32 ? 113 HIS A CG  1 
ATOM   629  N  ND1 . HIS A 1 102 ? -27.135 1.374   -23.755 1.00 122.08 ? 113 HIS A ND1 1 
ATOM   630  C  CD2 . HIS A 1 102 ? -26.516 2.851   -22.266 1.00 122.98 ? 113 HIS A CD2 1 
ATOM   631  C  CE1 . HIS A 1 102 ? -26.154 2.079   -24.290 1.00 125.70 ? 113 HIS A CE1 1 
ATOM   632  N  NE2 . HIS A 1 102 ? -25.759 2.981   -23.407 1.00 126.30 ? 113 HIS A NE2 1 
ATOM   633  N  N   . LEU A 1 103 ? -30.987 0.580   -20.180 1.00 109.49 ? 114 LEU A N   1 
ATOM   634  C  CA  . LEU A 1 103 ? -31.863 -0.349  -19.503 1.00 106.21 ? 114 LEU A CA  1 
ATOM   635  C  C   . LEU A 1 103 ? -33.278 -0.277  -20.085 1.00 105.13 ? 114 LEU A C   1 
ATOM   636  O  O   . LEU A 1 103 ? -33.788 -1.271  -20.594 1.00 104.02 ? 114 LEU A O   1 
ATOM   637  C  CB  . LEU A 1 103 ? -31.841 -0.062  -18.000 1.00 104.81 ? 114 LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 103 ? -32.696 -0.884  -17.036 1.00 101.58 ? 114 LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 103 ? -32.585 -2.378  -17.309 1.00 100.30 ? 114 LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 103 ? -32.289 -0.589  -15.616 1.00 101.09 ? 114 LEU A CD2 1 
ATOM   641  N  N   . LEU A 1 104 ? -33.882 0.907   -20.044 1.00 105.70 ? 115 LEU A N   1 
ATOM   642  C  CA  . LEU A 1 104 ? -35.209 1.143   -20.611 1.00 105.10 ? 115 LEU A CA  1 
ATOM   643  C  C   . LEU A 1 104 ? -35.319 0.655   -22.047 1.00 106.28 ? 115 LEU A C   1 
ATOM   644  O  O   . LEU A 1 104 ? -36.407 0.383   -22.542 1.00 105.28 ? 115 LEU A O   1 
ATOM   645  C  CB  . LEU A 1 104 ? -35.541 2.628   -20.562 1.00 106.64 ? 115 LEU A CB  1 
ATOM   646  C  CG  . LEU A 1 104 ? -35.648 3.278   -19.183 1.00 105.69 ? 115 LEU A CG  1 
ATOM   647  C  CD1 . LEU A 1 104 ? -35.221 4.739   -19.236 1.00 108.28 ? 115 LEU A CD1 1 
ATOM   648  C  CD2 . LEU A 1 104 ? -37.047 3.144   -18.618 1.00 103.17 ? 115 LEU A CD2 1 
ATOM   649  N  N   . LEU A 1 105 ? -34.187 0.552   -22.720 1.00 108.63 ? 116 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 105 ? -34.194 0.009   -24.050 1.00 109.98 ? 116 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 105 ? -34.111 -1.504  -23.995 1.00 108.17 ? 116 LEU A C   1 
ATOM   652  O  O   . LEU A 1 105 ? -34.911 -2.182  -24.619 1.00 107.41 ? 116 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 105 ? -33.061 0.586   -24.892 1.00 113.63 ? 116 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 105 ? -33.131 0.146   -26.356 1.00 115.44 ? 116 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 105 ? -34.040 1.050   -27.164 1.00 116.74 ? 116 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 105 ? -31.755 0.079   -26.968 1.00 118.52 ? 116 LEU A CD2 1 
ATOM   657  N  N   . LYS A 1 106 ? -33.146 -2.045  -23.259 1.00 107.67 ? 117 LYS A N   1 
ATOM   658  C  CA  . LYS A 1 106 ? -33.117 -3.492  -23.064 1.00 105.86 ? 117 LYS A CA  1 
ATOM   659  C  C   . LYS A 1 106 ? -34.520 -3.926  -22.639 1.00 102.92 ? 117 LYS A C   1 
ATOM   660  O  O   . LYS A 1 106 ? -35.003 -4.977  -23.049 1.00 101.84 ? 117 LYS A O   1 
ATOM   661  C  CB  . LYS A 1 106 ? -32.090 -3.914  -22.010 1.00 105.26 ? 117 LYS A CB  1 
ATOM   662  C  CG  . LYS A 1 106 ? -30.633 -3.717  -22.385 1.00 108.17 ? 117 LYS A CG  1 
ATOM   663  C  CD  . LYS A 1 106 ? -29.752 -4.576  -21.486 1.00 107.43 ? 117 LYS A CD  1 
ATOM   664  C  CE  . LYS A 1 106 ? -28.390 -3.951  -21.224 1.00 110.18 ? 117 LYS A CE  1 
ATOM   665  N  NZ  . LYS A 1 106 ? -27.588 -4.754  -20.248 1.00 109.59 ? 117 LYS A NZ  1 
ATOM   666  N  N   . GLN A 1 107 ? -35.181 -3.089  -21.843 1.00 101.85 ? 118 GLN A N   1 
ATOM   667  C  CA  . GLN A 1 107 ? -36.546 -3.351  -21.389 1.00 99.32  ? 118 GLN A CA  1 
ATOM   668  C  C   . GLN A 1 107 ? -37.609 -3.171  -22.466 1.00 99.91  ? 118 GLN A C   1 
ATOM   669  O  O   . GLN A 1 107 ? -38.746 -3.597  -22.283 1.00 98.03  ? 118 GLN A O   1 
ATOM   670  C  CB  . GLN A 1 107 ? -36.912 -2.429  -20.241 1.00 98.45  ? 118 GLN A CB  1 
ATOM   671  C  CG  . GLN A 1 107 ? -36.381 -2.828  -18.901 1.00 96.97  ? 118 GLN A CG  1 
ATOM   672  C  CD  . GLN A 1 107 ? -36.947 -1.954  -17.804 1.00 96.06  ? 118 GLN A CD  1 
ATOM   673  O  OE1 . GLN A 1 107 ? -38.064 -1.437  -17.923 1.00 95.56  ? 118 GLN A OE1 1 
ATOM   674  N  NE2 . GLN A 1 107 ? -36.180 -1.776  -16.729 1.00 96.03  ? 118 GLN A NE2 1 
ATOM   675  N  N   . GLY A 1 108 ? -37.263 -2.504  -23.564 1.00 102.71 ? 119 GLY A N   1 
ATOM   676  C  CA  . GLY A 1 108 ? -38.213 -2.282  -24.650 1.00 103.75 ? 119 GLY A CA  1 
ATOM   677  C  C   . GLY A 1 108 ? -39.260 -1.243  -24.318 1.00 103.49 ? 119 GLY A C   1 
ATOM   678  O  O   . GLY A 1 108 ? -40.288 -1.154  -24.982 1.00 103.85 ? 119 GLY A O   1 
ATOM   679  N  N   . LYS A 1 109 ? -38.994 -0.456  -23.282 1.00 103.04 ? 120 LYS A N   1 
ATOM   680  C  CA  . LYS A 1 109 ? -39.870 0.639   -22.902 1.00 103.12 ? 120 LYS A CA  1 
ATOM   681  C  C   . LYS A 1 109 ? -39.425 1.891   -23.649 1.00 106.36 ? 120 LYS A C   1 
ATOM   682  O  O   . LYS A 1 109 ? -38.901 2.830   -23.063 1.00 107.27 ? 120 LYS A O   1 
ATOM   683  C  CB  . LYS A 1 109 ? -39.858 0.831   -21.383 1.00 101.20 ? 120 LYS A CB  1 
ATOM   684  C  CG  . LYS A 1 109 ? -40.648 -0.240  -20.610 1.00 98.09  ? 120 LYS A CG  1 
ATOM   685  C  CD  . LYS A 1 109 ? -40.726 0.090   -19.122 1.00 96.50  ? 120 LYS A CD  1 
ATOM   686  C  CE  . LYS A 1 109 ? -41.832 1.115   -18.821 1.00 96.59  ? 120 LYS A CE  1 
ATOM   687  N  NZ  . LYS A 1 109 ? -41.907 1.444   -17.360 1.00 95.29  ? 120 LYS A NZ  1 
ATOM   688  N  N   . LEU A 1 110 ? -39.676 1.880   -24.956 1.00 108.25 ? 121 LEU A N   1 
ATOM   689  C  CA  . LEU A 1 110 ? -39.032 2.763   -25.932 1.00 111.77 ? 121 LEU A CA  1 
ATOM   690  C  C   . LEU A 1 110 ? -39.268 4.250   -25.757 1.00 113.37 ? 121 LEU A C   1 
ATOM   691  O  O   . LEU A 1 110 ? -38.317 5.020   -25.765 1.00 115.43 ? 121 LEU A O   1 
ATOM   692  C  CB  . LEU A 1 110 ? -39.431 2.343   -27.339 1.00 113.43 ? 121 LEU A CB  1 
ATOM   693  C  CG  . LEU A 1 110 ? -39.221 0.855   -27.612 1.00 111.97 ? 121 LEU A CG  1 
ATOM   694  C  CD1 . LEU A 1 110 ? -39.938 0.448   -28.878 1.00 113.41 ? 121 LEU A CD1 1 
ATOM   695  C  CD2 . LEU A 1 110 ? -37.739 0.505   -27.682 1.00 113.17 ? 121 LEU A CD2 1 
ATOM   696  N  N   . ASP A 1 111 ? -40.524 4.654   -25.612 1.00 112.58 ? 122 ASP A N   1 
ATOM   697  C  CA  . ASP A 1 111 ? -40.847 6.053   -25.374 1.00 114.09 ? 122 ASP A CA  1 
ATOM   698  C  C   . ASP A 1 111 ? -40.063 6.634   -24.212 1.00 113.65 ? 122 ASP A C   1 
ATOM   699  O  O   . ASP A 1 111 ? -39.438 7.669   -24.357 1.00 116.06 ? 122 ASP A O   1 
ATOM   700  C  CB  . ASP A 1 111 ? -42.345 6.246   -25.147 1.00 113.02 ? 122 ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 111 ? -43.121 6.355   -26.440 1.00 115.20 ? 122 ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 111 ? -42.645 5.840   -27.479 1.00 117.28 ? 122 ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 111 ? -44.211 6.963   -26.419 1.00 115.04 ? 122 ASP A OD2 1 
ATOM   704  N  N   . GLU A 1 112 ? -40.074 5.943   -23.078 1.00 110.78 ? 123 GLU A N   1 
ATOM   705  C  CA  . GLU A 1 112 ? -39.380 6.385   -21.861 1.00 110.26 ? 123 GLU A CA  1 
ATOM   706  C  C   . GLU A 1 112 ? -37.873 6.480   -22.075 1.00 112.13 ? 123 GLU A C   1 
ATOM   707  O  O   . GLU A 1 112 ? -37.212 7.342   -21.501 1.00 113.45 ? 123 GLU A O   1 
ATOM   708  C  CB  . GLU A 1 112 ? -39.664 5.421   -20.697 1.00 106.91 ? 123 GLU A CB  1 
ATOM   709  C  CG  . GLU A 1 112 ? -41.145 5.273   -20.263 1.00 105.00 ? 123 GLU A CG  1 
ATOM   710  C  CD  . GLU A 1 112 ? -42.045 4.563   -21.291 1.00 104.61 ? 123 GLU A CD  1 
ATOM   711  O  OE1 . GLU A 1 112 ? -41.545 3.789   -22.145 1.00 105.01 ? 123 GLU A OE1 1 
ATOM   712  O  OE2 . GLU A 1 112 ? -43.273 4.795   -21.241 1.00 104.06 ? 123 GLU A OE2 1 
ATOM   713  N  N   . ALA A 1 113 ? -37.350 5.576   -22.902 1.00 112.38 ? 124 ALA A N   1 
ATOM   714  C  CA  . ALA A 1 113 ? -35.931 5.505   -23.219 1.00 114.35 ? 124 ALA A CA  1 
ATOM   715  C  C   . ALA A 1 113 ? -35.514 6.694   -24.072 1.00 118.02 ? 124 ALA A C   1 
ATOM   716  O  O   . ALA A 1 113 ? -34.581 7.413   -23.721 1.00 119.74 ? 124 ALA A O   1 
ATOM   717  C  CB  . ALA A 1 113 ? -35.616 4.197   -23.930 1.00 113.92 ? 124 ALA A CB  1 
ATOM   718  N  N   . GLU A 1 114 ? -36.211 6.897   -25.188 1.00 119.42 ? 125 GLU A N   1 
ATOM   719  C  CA  . GLU A 1 114 ? -36.018 8.079   -26.019 1.00 123.01 ? 125 GLU A CA  1 
ATOM   720  C  C   . GLU A 1 114 ? -36.002 9.349   -25.169 1.00 123.62 ? 125 GLU A C   1 
ATOM   721  O  O   . GLU A 1 114 ? -35.004 10.060  -25.156 1.00 126.09 ? 125 GLU A O   1 
ATOM   722  C  CB  . GLU A 1 114 ? -37.095 8.151   -27.095 1.00 123.96 ? 125 GLU A CB  1 
ATOM   723  C  CG  . GLU A 1 114 ? -36.870 7.158   -28.211 1.00 125.00 ? 125 GLU A CG  1 
ATOM   724  C  CD  . GLU A 1 114 ? -38.128 6.839   -28.998 1.00 124.83 ? 125 GLU A CD  1 
ATOM   725  O  OE1 . GLU A 1 114 ? -39.189 7.444   -28.713 1.00 124.49 ? 125 GLU A OE1 1 
ATOM   726  O  OE2 . GLU A 1 114 ? -38.056 5.974   -29.904 1.00 125.18 ? 125 GLU A OE2 1 
ATOM   727  N  N   . ASP A 1 115 ? -37.082 9.598   -24.426 1.00 121.46 ? 126 ASP A N   1 
ATOM   728  C  CA  . ASP A 1 115 ? -37.198 10.782  -23.548 1.00 121.80 ? 126 ASP A CA  1 
ATOM   729  C  C   . ASP A 1 115 ? -36.012 10.980  -22.590 1.00 121.85 ? 126 ASP A C   1 
ATOM   730  O  O   . ASP A 1 115 ? -35.827 12.075  -22.039 1.00 122.97 ? 126 ASP A O   1 
ATOM   731  C  CB  . ASP A 1 115 ? -38.495 10.750  -22.718 1.00 119.05 ? 126 ASP A CB  1 
ATOM   732  C  CG  . ASP A 1 115 ? -39.765 10.609  -23.575 1.00 119.14 ? 126 ASP A CG  1 
ATOM   733  O  OD1 . ASP A 1 115 ? -39.831 11.156  -24.704 1.00 122.01 ? 126 ASP A OD1 1 
ATOM   734  O  OD2 . ASP A 1 115 ? -40.719 9.945   -23.089 1.00 116.45 ? 126 ASP A OD2 1 
ATOM   735  N  N   . ASP A 1 116 ? -35.232 9.920   -22.373 1.00 120.76 ? 127 ASP A N   1 
ATOM   736  C  CA  . ASP A 1 116 ? -34.051 9.998   -21.518 1.00 121.01 ? 127 ASP A CA  1 
ATOM   737  C  C   . ASP A 1 116 ? -32.807 10.185  -22.346 1.00 124.21 ? 127 ASP A C   1 
ATOM   738  O  O   . ASP A 1 116 ? -31.940 10.965  -21.989 1.00 126.18 ? 127 ASP A O   1 
ATOM   739  C  CB  . ASP A 1 116 ? -33.912 8.744   -20.645 1.00 117.85 ? 127 ASP A CB  1 
ATOM   740  C  CG  . ASP A 1 116 ? -34.211 9.015   -19.172 1.00 115.96 ? 127 ASP A CG  1 
ATOM   741  O  OD1 . ASP A 1 116 ? -34.325 10.205  -18.799 1.00 117.37 ? 127 ASP A OD1 1 
ATOM   742  O  OD2 . ASP A 1 116 ? -34.319 8.044   -18.386 1.00 113.23 ? 127 ASP A OD2 1 
ATOM   743  N  N   . PHE A 1 117 ? -32.732 9.456   -23.453 1.00 124.88 ? 128 PHE A N   1 
ATOM   744  C  CA  . PHE A 1 117 ? -31.628 9.540   -24.395 1.00 128.21 ? 128 PHE A CA  1 
ATOM   745  C  C   . PHE A 1 117 ? -31.412 10.945  -24.948 1.00 131.86 ? 128 PHE A C   1 
ATOM   746  O  O   . PHE A 1 117 ? -30.284 11.339  -25.259 1.00 134.81 ? 128 PHE A O   1 
ATOM   747  C  CB  . PHE A 1 117 ? -31.922 8.631   -25.570 1.00 128.52 ? 128 PHE A CB  1 
ATOM   748  C  CG  . PHE A 1 117 ? -31.407 7.250   -25.413 1.00 126.31 ? 128 PHE A CG  1 
ATOM   749  C  CD1 . PHE A 1 117 ? -30.139 7.020   -24.890 1.00 127.09 ? 128 PHE A CD1 1 
ATOM   750  C  CD2 . PHE A 1 117 ? -32.167 6.177   -25.844 1.00 123.72 ? 128 PHE A CD2 1 
ATOM   751  C  CE1 . PHE A 1 117 ? -29.643 5.738   -24.770 1.00 125.25 ? 128 PHE A CE1 1 
ATOM   752  C  CE2 . PHE A 1 117 ? -31.687 4.892   -25.728 1.00 121.79 ? 128 PHE A CE2 1 
ATOM   753  C  CZ  . PHE A 1 117 ? -30.417 4.669   -25.186 1.00 122.55 ? 128 PHE A CZ  1 
ATOM   754  N  N   . LYS A 1 118 ? -32.514 11.675  -25.096 1.00 131.81 ? 129 LYS A N   1 
ATOM   755  C  CA  . LYS A 1 118 ? -32.497 13.013  -25.647 1.00 135.23 ? 129 LYS A CA  1 
ATOM   756  C  C   . LYS A 1 118 ? -31.999 13.996  -24.603 1.00 135.90 ? 129 LYS A C   1 
ATOM   757  O  O   . LYS A 1 118 ? -31.103 14.786  -24.897 1.00 139.25 ? 129 LYS A O   1 
ATOM   758  C  CB  . LYS A 1 118 ? -33.881 13.403  -26.165 1.00 135.08 ? 129 LYS A CB  1 
ATOM   759  C  CG  . LYS A 1 118 ? -34.345 12.575  -27.354 1.00 135.38 ? 129 LYS A CG  1 
ATOM   760  C  CD  . LYS A 1 118 ? -35.732 12.985  -27.822 1.00 136.04 ? 129 LYS A CD  1 
ATOM   761  C  CE  . LYS A 1 118 ? -36.236 12.034  -28.901 1.00 136.63 ? 129 LYS A CE  1 
ATOM   762  N  NZ  . LYS A 1 118 ? -37.190 12.707  -29.866 1.00 140.43 ? 129 LYS A NZ  1 
ATOM   763  N  N   . LYS A 1 119 ? -32.551 13.936  -23.389 1.00 132.90 ? 130 LYS A N   1 
ATOM   764  C  CA  . LYS A 1 119 ? -32.120 14.815  -22.291 1.00 133.41 ? 130 LYS A CA  1 
ATOM   765  C  C   . LYS A 1 119 ? -30.644 14.634  -21.929 1.00 134.90 ? 130 LYS A C   1 
ATOM   766  O  O   . LYS A 1 119 ? -30.099 15.397  -21.123 1.00 136.60 ? 130 LYS A O   1 
ATOM   767  C  CB  . LYS A 1 119 ? -32.938 14.579  -21.030 1.00 129.95 ? 130 LYS A CB  1 
ATOM   768  C  CG  . LYS A 1 119 ? -34.401 14.913  -21.094 1.00 129.00 ? 130 LYS A CG  1 
ATOM   769  C  CD  . LYS A 1 119 ? -35.044 14.351  -19.831 1.00 125.27 ? 130 LYS A CD  1 
ATOM   770  C  CE  . LYS A 1 119 ? -36.537 14.601  -19.754 1.00 124.36 ? 130 LYS A CE  1 
ATOM   771  N  NZ  . LYS A 1 119 ? -37.051 14.214  -18.409 1.00 121.08 ? 130 LYS A NZ  1 
ATOM   772  N  N   . VAL A 1 120 ? -30.016 13.608  -22.497 1.00 134.40 ? 131 VAL A N   1 
ATOM   773  C  CA  . VAL A 1 120 ? -28.576 13.420  -22.362 1.00 136.38 ? 131 VAL A CA  1 
ATOM   774  C  C   . VAL A 1 120 ? -27.858 14.273  -23.410 1.00 140.81 ? 131 VAL A C   1 
ATOM   775  O  O   . VAL A 1 120 ? -26.919 15.014  -23.090 1.00 143.43 ? 131 VAL A O   1 
ATOM   776  C  CB  . VAL A 1 120 ? -28.183 11.917  -22.463 1.00 134.62 ? 131 VAL A CB  1 
ATOM   777  C  CG1 . VAL A 1 120 ? -26.773 11.728  -23.042 1.00 137.77 ? 131 VAL A CG1 1 
ATOM   778  C  CG2 . VAL A 1 120 ? -28.298 11.247  -21.099 1.00 131.21 ? 131 VAL A CG2 1 
ATOM   779  N  N   . LEU A 1 121 ? -28.320 14.175  -24.655 1.00 141.82 ? 132 LEU A N   1 
ATOM   780  C  CA  . LEU A 1 121 ? -27.779 14.984  -25.740 1.00 146.18 ? 132 LEU A CA  1 
ATOM   781  C  C   . LEU A 1 121 ? -28.121 16.477  -25.553 1.00 148.00 ? 132 LEU A C   1 
ATOM   782  O  O   . LEU A 1 121 ? -27.429 17.382  -26.110 1.00 151.65 ? 132 LEU A O   1 
ATOM   783  C  CB  . LEU A 1 121 ? -28.288 14.464  -27.104 1.00 146.85 ? 132 LEU A CB  1 
ATOM   784  C  CG  . LEU A 1 121 ? -27.829 13.062  -27.567 1.00 146.65 ? 132 LEU A CG  1 
ATOM   785  C  CD1 . LEU A 1 121 ? -28.506 12.832  -28.887 1.00 147.47 ? 132 LEU A CD1 1 
ATOM   786  C  CD2 . LEU A 1 121 ? -26.322 13.049  -27.714 1.00 150.01 ? 132 LEU A CD2 1 
ATOM   787  N  N   . LYS A 1 122 ? -29.165 16.721  -24.729 1.00 145.65 ? 133 LYS A N   1 
ATOM   788  C  CA  . LYS A 1 122 ? -29.630 18.099  -24.525 1.00 147.12 ? 133 LYS A CA  1 
ATOM   789  C  C   . LYS A 1 122 ? -29.028 18.880  -23.340 1.00 147.56 ? 133 LYS A C   1 
ATOM   790  O  O   . LYS A 1 122 ? -28.627 20.041  -23.513 1.00 151.02 ? 133 LYS A O   1 
ATOM   791  C  CB  . LYS A 1 122 ? -31.160 18.146  -24.516 1.00 144.70 ? 133 LYS A CB  1 
ATOM   792  C  CG  . LYS A 1 122 ? -31.726 18.232  -25.927 1.00 146.63 ? 133 LYS A CG  1 
ATOM   793  C  CD  . LYS A 1 122 ? -33.057 17.504  -26.098 1.00 143.78 ? 133 LYS A CD  1 
ATOM   794  C  CE  . LYS A 1 122 ? -33.306 17.235  -27.586 1.00 146.03 ? 133 LYS A CE  1 
ATOM   795  N  NZ  . LYS A 1 122 ? -34.699 16.793  -27.877 1.00 143.52 ? 133 LYS A NZ  1 
ATOM   796  N  N   . SER A 1 123 ? -28.945 18.264  -22.159 1.00 144.28 ? 134 SER A N   1 
ATOM   797  C  CA  . SER A 1 123 ? -28.499 18.997  -20.957 1.00 144.50 ? 134 SER A CA  1 
ATOM   798  C  C   . SER A 1 123 ? -26.980 19.124  -20.741 1.00 146.73 ? 134 SER A C   1 
ATOM   799  O  O   . SER A 1 123 ? -26.452 20.240  -20.676 1.00 149.88 ? 134 SER A O   1 
ATOM   800  C  CB  . SER A 1 123 ? -29.205 18.502  -19.691 1.00 140.51 ? 134 SER A CB  1 
ATOM   801  O  OG  . SER A 1 123 ? -30.313 19.344  -19.400 1.00 139.96 ? 134 SER A OG  1 
ATOM   802  N  N   . ASN A 1 124 ? -26.280 17.997  -20.623 1.00 145.34 ? 135 ASN A N   1 
ATOM   803  C  CA  . ASN A 1 124 ? -24.821 18.038  -20.517 1.00 147.88 ? 135 ASN A CA  1 
ATOM   804  C  C   . ASN A 1 124 ? -24.155 17.198  -21.630 1.00 149.30 ? 135 ASN A C   1 
ATOM   805  O  O   . ASN A 1 124 ? -23.344 16.285  -21.353 1.00 148.42 ? 135 ASN A O   1 
ATOM   806  C  CB  . ASN A 1 124 ? -24.368 17.585  -19.114 1.00 145.83 ? 135 ASN A CB  1 
ATOM   807  C  CG  . ASN A 1 124 ? -22.887 17.863  -18.850 1.00 148.87 ? 135 ASN A CG  1 
ATOM   808  O  OD1 . ASN A 1 124 ? -22.382 18.974  -19.106 1.00 151.92 ? 135 ASN A OD1 1 
ATOM   809  N  ND2 . ASN A 1 124 ? -22.193 16.852  -18.317 1.00 148.18 ? 135 ASN A ND2 1 
ATOM   810  N  N   . PRO A 1 125 ? -24.491 17.515  -22.901 1.00 151.73 ? 136 PRO A N   1 
ATOM   811  C  CA  . PRO A 1 125 ? -23.989 16.617  -23.940 1.00 152.62 ? 136 PRO A CA  1 
ATOM   812  C  C   . PRO A 1 125 ? -22.471 16.693  -24.010 1.00 156.10 ? 136 PRO A C   1 
ATOM   813  O  O   . PRO A 1 125 ? -21.905 17.794  -23.890 1.00 159.72 ? 136 PRO A O   1 
ATOM   814  C  CB  . PRO A 1 125 ? -24.611 17.168  -25.228 1.00 154.54 ? 136 PRO A CB  1 
ATOM   815  C  CG  . PRO A 1 125 ? -24.975 18.598  -24.936 1.00 156.12 ? 136 PRO A CG  1 
ATOM   816  C  CD  . PRO A 1 125 ? -24.958 18.811  -23.440 1.00 154.72 ? 136 PRO A CD  1 
ATOM   817  N  N   . SER A 1 126 ? -21.813 15.536  -24.172 1.00 155.20 ? 137 SER A N   1 
ATOM   818  C  CA  . SER A 1 126 ? -20.349 15.551  -24.262 1.00 158.60 ? 137 SER A CA  1 
ATOM   819  C  C   . SER A 1 126 ? -19.677 14.235  -24.677 1.00 158.59 ? 137 SER A C   1 
ATOM   820  O  O   . SER A 1 126 ? -20.210 13.144  -24.457 1.00 155.08 ? 137 SER A O   1 
ATOM   821  C  CB  . SER A 1 126 ? -19.731 16.071  -22.949 1.00 158.60 ? 137 SER A CB  1 
ATOM   822  O  OG  . SER A 1 126 ? -20.372 15.430  -21.819 1.00 154.17 ? 137 SER A OG  1 
ATOM   823  N  N   . GLU A 1 127 ? -18.494 14.388  -25.279 1.00 162.85 ? 138 GLU A N   1 
ATOM   824  C  CA  . GLU A 1 127 ? -17.574 13.306  -25.690 1.00 164.07 ? 138 GLU A CA  1 
ATOM   825  C  C   . GLU A 1 127 ? -18.226 12.043  -26.292 1.00 161.23 ? 138 GLU A C   1 
ATOM   826  O  O   . GLU A 1 127 ? -19.241 12.130  -27.023 1.00 160.13 ? 138 GLU A O   1 
ATOM   827  C  CB  . GLU A 1 127 ? -16.569 12.970  -24.542 1.00 164.33 ? 138 GLU A CB  1 
ATOM   828  C  CG  . GLU A 1 127 ? -17.025 11.840  -23.561 1.00 159.73 ? 138 GLU A CG  1 
ATOM   829  C  CD  . GLU A 1 127 ? -17.876 12.346  -22.429 1.00 156.49 ? 138 GLU A CD  1 
ATOM   830  O  OE1 . GLU A 1 127 ? -18.223 13.551  -22.394 1.00 158.05 ? 138 GLU A OE1 1 
ATOM   831  O  OE2 . GLU A 1 127 ? -18.215 11.517  -21.560 1.00 152.54 ? 138 GLU A OE2 1 
ATOM   832  N  N   . ASN A 1 128 ? -17.604 10.885  -25.990 1.00 160.34 ? 139 ASN A N   1 
ATOM   833  C  CA  . ASN A 1 128 ? -18.087 9.568   -26.415 1.00 157.81 ? 139 ASN A CA  1 
ATOM   834  C  C   . ASN A 1 128 ? -19.577 9.316   -26.177 1.00 153.27 ? 139 ASN A C   1 
ATOM   835  O  O   . ASN A 1 128 ? -20.244 8.694   -27.004 1.00 152.29 ? 139 ASN A O   1 
ATOM   836  C  CB  . ASN A 1 128 ? -17.283 8.460   -25.730 1.00 157.07 ? 139 ASN A CB  1 
ATOM   837  C  CG  . ASN A 1 128 ? -17.730 7.078   -26.153 1.00 155.49 ? 139 ASN A CG  1 
ATOM   838  O  OD1 . ASN A 1 128 ? -17.515 6.671   -27.294 1.00 158.20 ? 139 ASN A OD1 1 
ATOM   839  N  ND2 . ASN A 1 128 ? -18.371 6.354   -25.241 1.00 151.14 ? 139 ASN A ND2 1 
ATOM   840  N  N   . GLU A 1 129 ? -20.082 9.789   -25.039 1.00 150.70 ? 140 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 129 ? -21.492 9.641   -24.674 1.00 146.67 ? 140 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 129 ? -22.438 10.035  -25.808 1.00 147.45 ? 140 GLU A C   1 
ATOM   843  O  O   . GLU A 1 129 ? -23.385 9.301   -26.111 1.00 144.89 ? 140 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 129 ? -21.810 10.471  -23.422 1.00 145.15 ? 140 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 129 ? -21.053 10.016  -22.170 1.00 144.16 ? 140 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 129 ? -21.280 10.924  -20.967 1.00 143.67 ? 140 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 129 ? -21.861 12.025  -21.129 1.00 145.10 ? 140 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 129 ? -20.867 10.534  -19.852 1.00 141.94 ? 140 GLU A OE2 1 
ATOM   849  N  N   . GLU A 1 130 ? -22.173 11.189  -26.426 1.00 151.17 ? 141 GLU A N   1 
ATOM   850  C  CA  . GLU A 1 130 ? -22.963 11.684  -27.555 1.00 152.70 ? 141 GLU A CA  1 
ATOM   851  C  C   . GLU A 1 130 ? -23.181 10.616  -28.624 1.00 152.69 ? 141 GLU A C   1 
ATOM   852  O  O   . GLU A 1 130 ? -24.284 10.490  -29.149 1.00 151.37 ? 141 GLU A O   1 
ATOM   853  C  CB  . GLU A 1 130 ? -22.291 12.900  -28.194 1.00 157.53 ? 141 GLU A CB  1 
ATOM   854  C  CG  . GLU A 1 130 ? -22.241 14.165  -27.338 1.00 158.00 ? 141 GLU A CG  1 
ATOM   855  C  CD  . GLU A 1 130 ? -21.704 15.381  -28.107 1.00 163.11 ? 141 GLU A CD  1 
ATOM   856  O  OE1 . GLU A 1 130 ? -21.531 15.292  -29.344 1.00 166.24 ? 141 GLU A OE1 1 
ATOM   857  O  OE2 . GLU A 1 130 ? -21.457 16.433  -27.476 1.00 164.10 ? 141 GLU A OE2 1 
ATOM   858  N  N   . LYS A 1 131 ? -22.123 9.856   -28.931 1.00 154.34 ? 142 LYS A N   1 
ATOM   859  C  CA  . LYS A 1 131 ? -22.153 8.802   -29.957 1.00 154.66 ? 142 LYS A CA  1 
ATOM   860  C  C   . LYS A 1 131 ? -23.069 7.653   -29.554 1.00 149.96 ? 142 LYS A C   1 
ATOM   861  O  O   . LYS A 1 131 ? -23.987 7.291   -30.297 1.00 149.21 ? 142 LYS A O   1 
ATOM   862  C  CB  . LYS A 1 131 ? -20.744 8.252   -30.245 1.00 157.39 ? 142 LYS A CB  1 
ATOM   863  C  CG  . LYS A 1 131 ? -19.744 9.243   -30.838 1.00 162.61 ? 142 LYS A CG  1 
ATOM   864  C  CD  . LYS A 1 131 ? -18.808 9.794   -29.772 1.00 163.31 ? 142 LYS A CD  1 
ATOM   865  C  CE  . LYS A 1 131 ? -17.892 10.885  -30.321 1.00 168.34 ? 142 LYS A CE  1 
ATOM   866  N  NZ  . LYS A 1 131 ? -17.001 11.450  -29.262 1.00 169.34 ? 142 LYS A NZ  1 
ATOM   867  N  N   . GLU A 1 132 ? -22.801 7.080   -28.380 1.00 147.03 ? 143 GLU A N   1 
ATOM   868  C  CA  . GLU A 1 132 ? -23.652 6.047   -27.798 1.00 142.55 ? 143 GLU A CA  1 
ATOM   869  C  C   . GLU A 1 132 ? -25.127 6.459   -27.845 1.00 140.30 ? 143 GLU A C   1 
ATOM   870  O  O   . GLU A 1 132 ? -25.936 5.798   -28.504 1.00 139.04 ? 143 GLU A O   1 
ATOM   871  C  CB  . GLU A 1 132 ? -23.225 5.735   -26.356 1.00 140.07 ? 143 GLU A CB  1 
ATOM   872  C  CG  . GLU A 1 132 ? -22.178 4.627   -26.217 1.00 140.04 ? 143 GLU A CG  1 
ATOM   873  C  CD  . GLU A 1 132 ? -22.261 3.884   -24.875 1.00 136.70 ? 143 GLU A CD  1 
ATOM   874  O  OE1 . GLU A 1 132 ? -23.277 4.023   -24.158 1.00 133.40 ? 143 GLU A OE1 1 
ATOM   875  O  OE2 . GLU A 1 132 ? -21.304 3.151   -24.537 1.00 137.57 ? 143 GLU A OE2 1 
ATOM   876  N  N   . ALA A 1 133 ? -25.452 7.568   -27.172 1.00 140.05 ? 144 ALA A N   1 
ATOM   877  C  CA  . ALA A 1 133 ? -26.819 8.088   -27.083 1.00 138.07 ? 144 ALA A CA  1 
ATOM   878  C  C   . ALA A 1 133 ? -27.492 8.127   -28.442 1.00 139.76 ? 144 ALA A C   1 
ATOM   879  O  O   . ALA A 1 133 ? -28.593 7.601   -28.627 1.00 137.44 ? 144 ALA A O   1 
ATOM   880  C  CB  . ALA A 1 133 ? -26.817 9.482   -26.460 1.00 138.93 ? 144 ALA A CB  1 
ATOM   881  N  N   . GLN A 1 134 ? -26.793 8.738   -29.391 1.00 144.03 ? 145 GLN A N   1 
ATOM   882  C  CA  . GLN A 1 134 ? -27.308 8.986   -30.713 1.00 146.53 ? 145 GLN A CA  1 
ATOM   883  C  C   . GLN A 1 134 ? -27.555 7.674   -31.449 1.00 145.99 ? 145 GLN A C   1 
ATOM   884  O  O   . GLN A 1 134 ? -28.663 7.430   -31.920 1.00 145.31 ? 145 GLN A O   1 
ATOM   885  C  CB  . GLN A 1 134 ? -26.314 9.858   -31.467 1.00 151.51 ? 145 GLN A CB  1 
ATOM   886  C  CG  . GLN A 1 134 ? -26.935 10.828  -32.462 1.00 154.50 ? 145 GLN A CG  1 
ATOM   887  C  CD  . GLN A 1 134 ? -25.927 11.291  -33.503 1.00 159.75 ? 145 GLN A CD  1 
ATOM   888  O  OE1 . GLN A 1 134 ? -24.765 11.567  -33.185 1.00 161.44 ? 145 GLN A OE1 1 
ATOM   889  N  NE2 . GLN A 1 134 ? -26.366 11.370  -34.756 1.00 162.57 ? 145 GLN A NE2 1 
ATOM   890  N  N   . SER A 1 135 ? -26.535 6.821   -31.517 1.00 146.35 ? 146 SER A N   1 
ATOM   891  C  CA  . SER A 1 135 ? -26.652 5.537   -32.214 1.00 145.77 ? 146 SER A CA  1 
ATOM   892  C  C   . SER A 1 135 ? -27.769 4.647   -31.671 1.00 141.12 ? 146 SER A C   1 
ATOM   893  O  O   . SER A 1 135 ? -28.256 3.767   -32.376 1.00 140.62 ? 146 SER A O   1 
ATOM   894  C  CB  . SER A 1 135 ? -25.329 4.773   -32.172 1.00 147.03 ? 146 SER A CB  1 
ATOM   895  O  OG  . SER A 1 135 ? -25.445 3.550   -32.884 1.00 147.59 ? 146 SER A OG  1 
ATOM   896  N  N   . GLN A 1 136 ? -28.158 4.880   -30.420 1.00 137.96 ? 147 GLN A N   1 
ATOM   897  C  CA  . GLN A 1 136 ? -29.193 4.092   -29.764 1.00 133.65 ? 147 GLN A CA  1 
ATOM   898  C  C   . GLN A 1 136 ? -30.598 4.536   -30.165 1.00 133.02 ? 147 GLN A C   1 
ATOM   899  O  O   . GLN A 1 136 ? -31.469 3.688   -30.390 1.00 130.93 ? 147 GLN A O   1 
ATOM   900  C  CB  . GLN A 1 136 ? -29.019 4.120   -28.243 1.00 130.82 ? 147 GLN A CB  1 
ATOM   901  C  CG  . GLN A 1 136 ? -27.787 3.354   -27.732 1.00 130.64 ? 147 GLN A CG  1 
ATOM   902  C  CD  . GLN A 1 136 ? -28.093 1.942   -27.245 1.00 127.33 ? 147 GLN A CD  1 
ATOM   903  O  OE1 . GLN A 1 136 ? -28.713 1.758   -26.203 1.00 123.98 ? 147 GLN A OE1 1 
ATOM   904  N  NE2 . GLN A 1 136 ? -27.626 0.942   -27.985 1.00 128.45 ? 147 GLN A NE2 1 
ATOM   905  N  N   . LEU A 1 137 ? -30.820 5.848   -30.271 1.00 134.96 ? 148 LEU A N   1 
ATOM   906  C  CA  . LEU A 1 137 ? -32.116 6.377   -30.735 1.00 134.90 ? 148 LEU A CA  1 
ATOM   907  C  C   . LEU A 1 137 ? -32.457 5.933   -32.147 1.00 136.95 ? 148 LEU A C   1 
ATOM   908  O  O   . LEU A 1 137 ? -33.573 6.128   -32.613 1.00 136.60 ? 148 LEU A O   1 
ATOM   909  C  CB  . LEU A 1 137 ? -32.154 7.904   -30.689 1.00 137.33 ? 148 LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 137 ? -32.486 8.584   -29.371 1.00 135.01 ? 148 LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 137 ? -31.185 8.823   -28.595 1.00 136.06 ? 148 LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 137 ? -33.233 9.921   -29.634 1.00 136.54 ? 148 LEU A CD2 1 
ATOM   913  N  N   . ILE A 1 138 ? -31.477 5.354   -32.827 1.00 139.41 ? 149 ILE A N   1 
ATOM   914  C  CA  . ILE A 1 138 ? -31.663 4.886   -34.189 1.00 141.51 ? 149 ILE A CA  1 
ATOM   915  C  C   . ILE A 1 138 ? -32.214 3.472   -34.165 1.00 138.27 ? 149 ILE A C   1 
ATOM   916  O  O   . ILE A 1 138 ? -33.128 3.140   -34.927 1.00 138.27 ? 149 ILE A O   1 
ATOM   917  C  CB  . ILE A 1 138 ? -30.348 4.978   -34.999 1.00 145.52 ? 149 ILE A CB  1 
ATOM   918  C  CG1 . ILE A 1 138 ? -29.886 6.441   -35.099 1.00 149.12 ? 149 ILE A CG1 1 
ATOM   919  C  CG2 . ILE A 1 138 ? -30.498 4.346   -36.385 1.00 147.58 ? 149 ILE A CG2 1 
ATOM   920  C  CD1 . ILE A 1 138 ? -30.974 7.441   -35.533 1.00 150.35 ? 149 ILE A CD1 1 
ATOM   921  N  N   . LYS A 1 139 ? -31.649 2.651   -33.283 1.00 135.70 ? 150 LYS A N   1 
ATOM   922  C  CA  . LYS A 1 139 ? -32.208 1.348   -32.961 1.00 132.28 ? 150 LYS A CA  1 
ATOM   923  C  C   . LYS A 1 139 ? -33.624 1.583   -32.471 1.00 129.52 ? 150 LYS A C   1 
ATOM   924  O  O   . LYS A 1 139 ? -34.577 1.066   -33.044 1.00 128.70 ? 150 LYS A O   1 
ATOM   925  C  CB  . LYS A 1 139 ? -31.376 0.667   -31.878 1.00 130.09 ? 150 LYS A CB  1 
ATOM   926  C  CG  . LYS A 1 139 ? -30.000 0.209   -32.330 1.00 132.55 ? 150 LYS A CG  1 
ATOM   927  C  CD  . LYS A 1 139 ? -29.055 0.063   -31.139 1.00 131.39 ? 150 LYS A CD  1 
ATOM   928  C  CE  . LYS A 1 139 ? -27.590 -0.024  -31.570 1.00 134.47 ? 150 LYS A CE  1 
ATOM   929  N  NZ  . LYS A 1 139 ? -27.299 -1.280  -32.319 1.00 134.45 ? 150 LYS A NZ  1 
ATOM   930  N  N   . SER A 1 140 ? -33.740 2.420   -31.443 1.00 128.46 ? 151 SER A N   1 
ATOM   931  C  CA  . SER A 1 140 ? -35.014 2.770   -30.825 1.00 125.88 ? 151 SER A CA  1 
ATOM   932  C  C   . SER A 1 140 ? -36.082 3.235   -31.805 1.00 127.48 ? 151 SER A C   1 
ATOM   933  O  O   . SER A 1 140 ? -37.255 2.920   -31.639 1.00 125.36 ? 151 SER A O   1 
ATOM   934  C  CB  . SER A 1 140 ? -34.797 3.844   -29.762 1.00 125.38 ? 151 SER A CB  1 
ATOM   935  O  OG  . SER A 1 140 ? -36.031 4.319   -29.259 1.00 123.19 ? 151 SER A OG  1 
ATOM   936  N  N   . ASP A 1 141 ? -35.677 3.999   -32.812 1.00 131.41 ? 152 ASP A N   1 
ATOM   937  C  CA  . ASP A 1 141 ? -36.621 4.511   -33.795 1.00 133.55 ? 152 ASP A CA  1 
ATOM   938  C  C   . ASP A 1 141 ? -37.060 3.418   -34.753 1.00 133.81 ? 152 ASP A C   1 
ATOM   939  O  O   . ASP A 1 141 ? -38.146 3.489   -35.327 1.00 134.46 ? 152 ASP A O   1 
ATOM   940  C  CB  . ASP A 1 141 ? -36.050 5.715   -34.553 1.00 138.02 ? 152 ASP A CB  1 
ATOM   941  C  CG  . ASP A 1 141 ? -36.553 7.053   -34.005 1.00 138.30 ? 152 ASP A CG  1 
ATOM   942  O  OD1 . ASP A 1 141 ? -37.339 7.071   -33.018 1.00 135.05 ? 152 ASP A OD1 1 
ATOM   943  O  OD2 . ASP A 1 141 ? -36.163 8.100   -34.573 1.00 141.97 ? 152 ASP A OD2 1 
ATOM   944  N  N   . GLU A 1 142 ? -36.223 2.403   -34.919 1.00 133.46 ? 153 GLU A N   1 
ATOM   945  C  CA  . GLU A 1 142 ? -36.614 1.270   -35.727 1.00 133.48 ? 153 GLU A CA  1 
ATOM   946  C  C   . GLU A 1 142 ? -37.380 0.264   -34.887 1.00 129.11 ? 153 GLU A C   1 
ATOM   947  O  O   . GLU A 1 142 ? -38.314 -0.374  -35.371 1.00 128.62 ? 153 GLU A O   1 
ATOM   948  C  CB  . GLU A 1 142 ? -35.406 0.603   -36.342 1.00 135.27 ? 153 GLU A CB  1 
ATOM   949  C  CG  . GLU A 1 142 ? -35.792 -0.295  -37.507 1.00 134.68 ? 153 GLU A CG  1 
ATOM   950  C  CD  . GLU A 1 142 ? -34.892 -1.510  -37.561 1.00 136.60 ? 153 GLU A CD  1 
ATOM   951  O  OE1 . GLU A 1 142 ? -33.948 -1.625  -36.718 1.00 136.05 ? 153 GLU A OE1 1 
ATOM   952  O  OE2 . GLU A 1 142 ? -35.128 -2.355  -38.447 1.00 138.81 ? 153 GLU A OE2 1 
HETATM 953  N  N   . MSE A 1 143 ? -36.970 0.112   -33.630 1.00 126.13 ? 154 MSE A N   1 
HETATM 954  C  CA  . MSE A 1 143 ? -37.687 -0.745  -32.699 1.00 122.04 ? 154 MSE A CA  1 
HETATM 955  C  C   . MSE A 1 143 ? -39.124 -0.270  -32.686 1.00 121.29 ? 154 MSE A C   1 
HETATM 956  O  O   . MSE A 1 143 ? -40.022 -1.024  -33.044 1.00 120.29 ? 154 MSE A O   1 
HETATM 957  C  CB  . MSE A 1 143 ? -37.086 -0.694  -31.288 1.00 119.47 ? 154 MSE A CB  1 
HETATM 958  C  CG  . MSE A 1 143 ? -35.680 -1.284  -31.121 1.00 119.98 ? 154 MSE A CG  1 
HETATM 959  SE SE  . MSE A 1 143 ? -35.355 -3.002  -31.970 1.00 120.11 ? 154 MSE A SE  1 
HETATM 960  C  CE  . MSE A 1 143 ? -34.583 -2.411  -33.648 1.00 125.76 ? 154 MSE A CE  1 
ATOM   961  N  N   . GLN A 1 144 ? -39.330 0.996   -32.326 1.00 122.08 ? 155 GLN A N   1 
ATOM   962  C  CA  . GLN A 1 144 ? -40.666 1.586   -32.280 1.00 121.72 ? 155 GLN A CA  1 
ATOM   963  C  C   . GLN A 1 144 ? -41.477 1.165   -33.495 1.00 123.50 ? 155 GLN A C   1 
ATOM   964  O  O   . GLN A 1 144 ? -42.677 0.939   -33.407 1.00 122.09 ? 155 GLN A O   1 
ATOM   965  C  CB  . GLN A 1 144 ? -40.572 3.108   -32.214 1.00 123.79 ? 155 GLN A CB  1 
ATOM   966  C  CG  . GLN A 1 144 ? -41.801 3.780   -31.629 1.00 122.45 ? 155 GLN A CG  1 
ATOM   967  C  CD  . GLN A 1 144 ? -41.666 4.044   -30.146 1.00 119.70 ? 155 GLN A CD  1 
ATOM   968  O  OE1 . GLN A 1 144 ? -40.595 4.419   -29.663 1.00 120.10 ? 155 GLN A OE1 1 
ATOM   969  N  NE2 . GLN A 1 144 ? -42.760 3.860   -29.411 1.00 117.11 ? 155 GLN A NE2 1 
ATOM   970  N  N   . ARG A 1 145 ? -40.789 1.042   -34.623 1.00 126.78 ? 156 ARG A N   1 
ATOM   971  C  CA  . ARG A 1 145 ? -41.407 0.713   -35.895 1.00 129.09 ? 156 ARG A CA  1 
ATOM   972  C  C   . ARG A 1 145 ? -41.614 -0.784  -35.996 1.00 127.06 ? 156 ARG A C   1 
ATOM   973  O  O   . ARG A 1 145 ? -42.612 -1.237  -36.540 1.00 127.08 ? 156 ARG A O   1 
ATOM   974  C  CB  . ARG A 1 145 ? -40.532 1.217   -37.055 1.00 133.59 ? 156 ARG A CB  1 
ATOM   975  C  CG  . ARG A 1 145 ? -41.136 1.029   -38.436 1.00 136.57 ? 156 ARG A CG  1 
ATOM   976  C  CD  . ARG A 1 145 ? -40.074 1.049   -39.528 1.00 140.28 ? 156 ARG A CD  1 
ATOM   977  N  NE  . ARG A 1 145 ? -40.624 0.606   -40.811 1.00 143.27 ? 156 ARG A NE  1 
ATOM   978  C  CZ  . ARG A 1 145 ? -41.286 1.390   -41.665 1.00 146.80 ? 156 ARG A CZ  1 
ATOM   979  N  NH1 . ARG A 1 145 ? -41.491 2.676   -41.390 1.00 147.72 ? 156 ARG A NH1 1 
ATOM   980  N  NH2 . ARG A 1 145 ? -41.748 0.886   -42.803 1.00 149.54 ? 156 ARG A NH2 1 
ATOM   981  N  N   . LEU A 1 146 ? -40.668 -1.543  -35.462 1.00 125.47 ? 157 LEU A N   1 
ATOM   982  C  CA  . LEU A 1 146 ? -40.699 -3.000  -35.538 1.00 123.71 ? 157 LEU A CA  1 
ATOM   983  C  C   . LEU A 1 146 ? -41.795 -3.676  -34.710 1.00 119.94 ? 157 LEU A C   1 
ATOM   984  O  O   . LEU A 1 146 ? -42.387 -4.665  -35.150 1.00 119.50 ? 157 LEU A O   1 
ATOM   985  C  CB  . LEU A 1 146 ? -39.341 -3.561  -35.142 1.00 123.13 ? 157 LEU A CB  1 
ATOM   986  C  CG  . LEU A 1 146 ? -38.375 -3.849  -36.273 1.00 126.50 ? 157 LEU A CG  1 
ATOM   987  C  CD1 . LEU A 1 146 ? -37.087 -4.330  -35.667 1.00 125.65 ? 157 LEU A CD1 1 
ATOM   988  C  CD2 . LEU A 1 146 ? -38.962 -4.900  -37.196 1.00 126.96 ? 157 LEU A CD2 1 
ATOM   989  N  N   . ARG A 1 147 ? -42.056 -3.155  -33.514 1.00 117.40 ? 158 ARG A N   1 
ATOM   990  C  CA  . ARG A 1 147 ? -43.079 -3.740  -32.666 1.00 113.99 ? 158 ARG A CA  1 
ATOM   991  C  C   . ARG A 1 147 ? -44.446 -3.613  -33.324 1.00 114.92 ? 158 ARG A C   1 
ATOM   992  O  O   . ARG A 1 147 ? -45.251 -4.542  -33.274 1.00 113.40 ? 158 ARG A O   1 
ATOM   993  C  CB  . ARG A 1 147 ? -43.065 -3.145  -31.250 1.00 111.48 ? 158 ARG A CB  1 
ATOM   994  C  CG  . ARG A 1 147 ? -43.977 -1.953  -31.009 1.00 112.23 ? 158 ARG A CG  1 
ATOM   995  C  CD  . ARG A 1 147 ? -43.786 -1.400  -29.603 1.00 109.97 ? 158 ARG A CD  1 
ATOM   996  N  NE  . ARG A 1 147 ? -44.737 -1.938  -28.630 1.00 106.77 ? 158 ARG A NE  1 
ATOM   997  C  CZ  . ARG A 1 147 ? -44.588 -1.870  -27.305 1.00 104.33 ? 158 ARG A CZ  1 
ATOM   998  N  NH1 . ARG A 1 147 ? -43.511 -1.305  -26.775 1.00 104.66 ? 158 ARG A NH1 1 
ATOM   999  N  NH2 . ARG A 1 147 ? -45.510 -2.381  -26.497 1.00 101.73 ? 158 ARG A NH2 1 
ATOM   1000 N  N   . SER A 1 148 ? -44.686 -2.470  -33.962 1.00 117.63 ? 159 SER A N   1 
ATOM   1001 C  CA  . SER A 1 148 ? -45.911 -2.232  -34.709 1.00 119.33 ? 159 SER A CA  1 
ATOM   1002 C  C   . SER A 1 148 ? -46.104 -3.303  -35.760 1.00 120.51 ? 159 SER A C   1 
ATOM   1003 O  O   . SER A 1 148 ? -47.172 -3.897  -35.866 1.00 119.55 ? 159 SER A O   1 
ATOM   1004 C  CB  . SER A 1 148 ? -45.854 -0.867  -35.383 1.00 122.94 ? 159 SER A CB  1 
ATOM   1005 O  OG  . SER A 1 148 ? -45.393 0.116   -34.477 1.00 122.16 ? 159 SER A OG  1 
ATOM   1006 N  N   . GLN A 1 149 ? -45.045 -3.553  -36.519 1.00 122.70 ? 160 GLN A N   1 
ATOM   1007 C  CA  . GLN A 1 149 ? -45.061 -4.549  -37.570 1.00 124.18 ? 160 GLN A CA  1 
ATOM   1008 C  C   . GLN A 1 149 ? -45.317 -5.924  -37.004 1.00 120.83 ? 160 GLN A C   1 
ATOM   1009 O  O   . GLN A 1 149 ? -46.008 -6.723  -37.627 1.00 121.20 ? 160 GLN A O   1 
ATOM   1010 C  CB  . GLN A 1 149 ? -43.731 -4.561  -38.308 1.00 126.83 ? 160 GLN A CB  1 
ATOM   1011 C  CG  . GLN A 1 149 ? -43.416 -3.321  -39.109 1.00 130.85 ? 160 GLN A CG  1 
ATOM   1012 C  CD  . GLN A 1 149 ? -41.949 -3.254  -39.450 1.00 132.63 ? 160 GLN A CD  1 
ATOM   1013 O  OE1 . GLN A 1 149 ? -41.529 -3.739  -40.499 1.00 132.04 ? 160 GLN A OE1 1 
ATOM   1014 N  NE2 . GLN A 1 149 ? -41.164 -2.619  -38.584 1.00 134.87 ? 160 GLN A NE2 1 
ATOM   1015 N  N   . ALA A 1 150 ? -44.751 -6.188  -35.826 1.00 117.79 ? 161 ALA A N   1 
ATOM   1016 C  CA  . ALA A 1 150 ? -44.936 -7.465  -35.116 1.00 114.44 ? 161 ALA A CA  1 
ATOM   1017 C  C   . ALA A 1 150 ? -46.359 -7.641  -34.635 1.00 112.46 ? 161 ALA A C   1 
ATOM   1018 O  O   . ALA A 1 150 ? -47.027 -8.610  -34.989 1.00 111.95 ? 161 ALA A O   1 
ATOM   1019 C  CB  . ALA A 1 150 ? -43.983 -7.572  -33.948 1.00 111.94 ? 161 ALA A CB  1 
ATOM   1020 N  N   . LEU A 1 151 ? -46.808 -6.684  -33.832 1.00 111.54 ? 162 LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 151 ? -48.173 -6.641  -33.336 1.00 110.00 ? 162 LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 151 ? -49.189 -6.662  -34.470 1.00 112.47 ? 162 LEU A C   1 
ATOM   1023 O  O   . LEU A 1 151 ? -50.279 -7.203  -34.318 1.00 111.30 ? 162 LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 151 ? -48.375 -5.412  -32.449 1.00 109.32 ? 162 LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 151 ? -48.043 -5.559  -30.952 1.00 105.84 ? 162 LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 151 ? -46.609 -5.986  -30.705 1.00 105.19 ? 162 LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 151 ? -48.317 -4.282  -30.180 1.00 105.64 ? 162 LEU A CD2 1 
ATOM   1028 N  N   . ASN A 1 152 ? -48.820 -6.084  -35.611 1.00 116.08 ? 163 ASN A N   1 
ATOM   1029 C  CA  . ASN A 1 152 ? -49.646 -6.167  -36.808 1.00 118.98 ? 163 ASN A CA  1 
ATOM   1030 C  C   . ASN A 1 152 ? -49.893 -7.617  -37.215 1.00 118.25 ? 163 ASN A C   1 
ATOM   1031 O  O   . ASN A 1 152 ? -51.034 -8.068  -37.245 1.00 117.71 ? 163 ASN A O   1 
ATOM   1032 C  CB  . ASN A 1 152 ? -49.015 -5.389  -37.973 1.00 123.16 ? 163 ASN A CB  1 
ATOM   1033 C  CG  . ASN A 1 152 ? -49.932 -5.301  -39.178 1.00 126.58 ? 163 ASN A CG  1 
ATOM   1034 O  OD1 . ASN A 1 152 ? -49.913 -6.185  -40.060 1.00 127.11 ? 163 ASN A OD1 1 
ATOM   1035 N  ND2 . ASN A 1 152 ? -50.743 -4.227  -39.216 1.00 129.14 ? 163 ASN A ND2 1 
ATOM   1036 N  N   . ALA A 1 153 ? -48.810 -8.335  -37.506 1.00 118.34 ? 164 ALA A N   1 
ATOM   1037 C  CA  . ALA A 1 153 ? -48.888 -9.665  -38.106 1.00 118.41 ? 164 ALA A CA  1 
ATOM   1038 C  C   . ALA A 1 153 ? -49.643 -10.598 -37.205 1.00 114.96 ? 164 ALA A C   1 
ATOM   1039 O  O   . ALA A 1 153 ? -50.401 -11.463 -37.666 1.00 115.28 ? 164 ALA A O   1 
ATOM   1040 C  CB  . ALA A 1 153 ? -47.500 -10.216 -38.361 1.00 118.62 ? 164 ALA A CB  1 
ATOM   1041 N  N   . PHE A 1 154 ? -49.415 -10.406 -35.908 1.00 111.84 ? 165 PHE A N   1 
ATOM   1042 C  CA  . PHE A 1 154 ? -50.007 -11.233 -34.892 1.00 108.38 ? 165 PHE A CA  1 
ATOM   1043 C  C   . PHE A 1 154 ? -51.501 -11.035 -34.875 1.00 108.43 ? 165 PHE A C   1 
ATOM   1044 O  O   . PHE A 1 154 ? -52.260 -11.991 -35.102 1.00 108.14 ? 165 PHE A O   1 
ATOM   1045 C  CB  . PHE A 1 154 ? -49.416 -10.901 -33.527 1.00 105.58 ? 165 PHE A CB  1 
ATOM   1046 C  CG  . PHE A 1 154 ? -49.941 -11.775 -32.433 1.00 102.17 ? 165 PHE A CG  1 
ATOM   1047 C  CD1 . PHE A 1 154 ? -49.323 -12.989 -32.137 1.00 100.63 ? 165 PHE A CD1 1 
ATOM   1048 C  CD2 . PHE A 1 154 ? -51.074 -11.404 -31.716 1.00 100.72 ? 165 PHE A CD2 1 
ATOM   1049 C  CE1 . PHE A 1 154 ? -49.814 -13.807 -31.141 1.00 97.69  ? 165 PHE A CE1 1 
ATOM   1050 C  CE2 . PHE A 1 154 ? -51.570 -12.217 -30.727 1.00 97.83  ? 165 PHE A CE2 1 
ATOM   1051 C  CZ  . PHE A 1 154 ? -50.939 -13.421 -30.435 1.00 96.30  ? 165 PHE A CZ  1 
ATOM   1052 N  N   . GLY A 1 155 ? -51.920 -9.794  -34.606 1.00 108.98 ? 166 GLY A N   1 
ATOM   1053 C  CA  . GLY A 1 155 ? -53.348 -9.465  -34.582 1.00 109.55 ? 166 GLY A CA  1 
ATOM   1054 C  C   . GLY A 1 155 ? -54.116 -10.012 -35.770 1.00 111.93 ? 166 GLY A C   1 
ATOM   1055 O  O   . GLY A 1 155 ? -55.151 -10.647 -35.593 1.00 110.85 ? 166 GLY A O   1 
ATOM   1056 N  N   . SER A 1 156 ? -53.592 -9.765  -36.975 1.00 115.34 ? 167 SER A N   1 
ATOM   1057 C  CA  . SER A 1 156 ? -54.153 -10.292 -38.228 1.00 118.13 ? 167 SER A CA  1 
ATOM   1058 C  C   . SER A 1 156 ? -54.097 -11.832 -38.298 1.00 116.66 ? 167 SER A C   1 
ATOM   1059 O  O   . SER A 1 156 ? -54.882 -12.466 -39.032 1.00 118.33 ? 167 SER A O   1 
ATOM   1060 C  CB  . SER A 1 156 ? -53.433 -9.668  -39.443 1.00 122.13 ? 167 SER A CB  1 
ATOM   1061 O  OG  . SER A 1 156 ? -52.033 -9.937  -39.401 1.00 121.78 ? 167 SER A OG  1 
ATOM   1062 N  N   . GLY A 1 157 ? -53.173 -12.428 -37.543 1.00 113.73 ? 168 GLY A N   1 
ATOM   1063 C  CA  . GLY A 1 157 ? -53.156 -13.869 -37.415 1.00 111.97 ? 168 GLY A CA  1 
ATOM   1064 C  C   . GLY A 1 157 ? -51.960 -14.563 -38.032 1.00 112.65 ? 168 GLY A C   1 
ATOM   1065 O  O   . GLY A 1 157 ? -51.841 -15.790 -37.947 1.00 110.90 ? 168 GLY A O   1 
ATOM   1066 N  N   . ASP A 1 158 ? -51.068 -13.805 -38.662 1.00 115.33 ? 169 ASP A N   1 
ATOM   1067 C  CA  . ASP A 1 158 ? -49.870 -14.425 -39.213 1.00 116.28 ? 169 ASP A CA  1 
ATOM   1068 C  C   . ASP A 1 158 ? -48.825 -14.536 -38.125 1.00 113.32 ? 169 ASP A C   1 
ATOM   1069 O  O   . ASP A 1 158 ? -48.301 -13.533 -37.652 1.00 112.69 ? 169 ASP A O   1 
ATOM   1070 C  CB  . ASP A 1 158 ? -49.325 -13.651 -40.413 1.00 120.36 ? 169 ASP A CB  1 
ATOM   1071 C  CG  . ASP A 1 158 ? -48.334 -14.469 -41.241 1.00 122.28 ? 169 ASP A CG  1 
ATOM   1072 O  OD1 . ASP A 1 158 ? -47.676 -15.398 -40.704 1.00 120.20 ? 169 ASP A OD1 1 
ATOM   1073 O  OD2 . ASP A 1 158 ? -48.208 -14.168 -42.445 1.00 126.08 ? 169 ASP A OD2 1 
ATOM   1074 N  N   . TYR A 1 159 ? -48.528 -15.768 -37.739 1.00 111.68 ? 170 TYR A N   1 
ATOM   1075 C  CA  . TYR A 1 159 ? -47.617 -16.019 -36.638 1.00 108.87 ? 170 TYR A CA  1 
ATOM   1076 C  C   . TYR A 1 159 ? -46.174 -16.074 -37.100 1.00 110.55 ? 170 TYR A C   1 
ATOM   1077 O  O   . TYR A 1 159 ? -45.316 -15.406 -36.531 1.00 110.15 ? 170 TYR A O   1 
ATOM   1078 C  CB  . TYR A 1 159 ? -47.992 -17.316 -35.919 1.00 105.88 ? 170 TYR A CB  1 
ATOM   1079 C  CG  . TYR A 1 159 ? -49.393 -17.340 -35.343 1.00 104.09 ? 170 TYR A CG  1 
ATOM   1080 C  CD1 . TYR A 1 159 ? -49.858 -16.295 -34.548 1.00 102.92 ? 170 TYR A CD1 1 
ATOM   1081 C  CD2 . TYR A 1 159 ? -50.253 -18.415 -35.598 1.00 103.76 ? 170 TYR A CD2 1 
ATOM   1082 C  CE1 . TYR A 1 159 ? -51.148 -16.317 -34.017 1.00 101.52 ? 170 TYR A CE1 1 
ATOM   1083 C  CE2 . TYR A 1 159 ? -51.546 -18.453 -35.073 1.00 102.36 ? 170 TYR A CE2 1 
ATOM   1084 C  CZ  . TYR A 1 159 ? -51.992 -17.402 -34.278 1.00 101.26 ? 170 TYR A CZ  1 
ATOM   1085 O  OH  . TYR A 1 159 ? -53.269 -17.425 -33.740 1.00 100.07 ? 170 TYR A OH  1 
ATOM   1086 N  N   . THR A 1 160 ? -45.919 -16.868 -38.137 1.00 112.64 ? 171 THR A N   1 
ATOM   1087 C  CA  . THR A 1 160 ? -44.584 -17.024 -38.717 1.00 114.80 ? 171 THR A CA  1 
ATOM   1088 C  C   . THR A 1 160 ? -44.016 -15.661 -39.089 1.00 117.25 ? 171 THR A C   1 
ATOM   1089 O  O   . THR A 1 160 ? -42.838 -15.361 -38.840 1.00 117.67 ? 171 THR A O   1 
ATOM   1090 C  CB  . THR A 1 160 ? -44.637 -17.905 -39.965 1.00 117.54 ? 171 THR A CB  1 
ATOM   1091 O  OG1 . THR A 1 160 ? -45.778 -17.534 -40.747 1.00 119.54 ? 171 THR A OG1 1 
ATOM   1092 C  CG2 . THR A 1 160 ? -44.759 -19.369 -39.580 1.00 115.36 ? 171 THR A CG2 1 
ATOM   1093 N  N   . ALA A 1 161 ? -44.879 -14.838 -39.675 1.00 118.98 ? 172 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 161 ? -44.538 -13.466 -39.961 1.00 121.24 ? 172 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 161 ? -44.032 -12.795 -38.692 1.00 118.62 ? 172 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 161 ? -42.825 -12.386 -38.597 1.00 119.28 ? 172 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 161 ? -45.730 -12.719 -40.529 1.00 123.10 ? 172 ALA A CB  1 
ATOM   1098 N  N   . ALA A 1 162 ? -44.937 -12.658 -37.708 1.00 115.80 ? 173 ALA A N   1 
ATOM   1099 C  CA  . ALA A 1 162 ? -44.613 -11.931 -36.494 1.00 113.51 ? 173 ALA A CA  1 
ATOM   1100 C  C   . ALA A 1 162 ? -43.426 -12.506 -35.728 1.00 111.63 ? 173 ALA A C   1 
ATOM   1101 O  O   . ALA A 1 162 ? -42.782 -11.785 -34.969 1.00 110.97 ? 173 ALA A O   1 
ATOM   1102 C  CB  . ALA A 1 162 ? -45.825 -11.828 -35.602 1.00 110.85 ? 173 ALA A CB  1 
ATOM   1103 N  N   . ILE A 1 163 ? -43.135 -13.793 -35.920 1.00 110.96 ? 174 ILE A N   1 
ATOM   1104 C  CA  . ILE A 1 163 ? -41.999 -14.427 -35.239 1.00 109.60 ? 174 ILE A CA  1 
ATOM   1105 C  C   . ILE A 1 163 ? -40.733 -13.722 -35.667 1.00 112.28 ? 174 ILE A C   1 
ATOM   1106 O  O   . ILE A 1 163 ? -40.020 -13.159 -34.835 1.00 111.40 ? 174 ILE A O   1 
ATOM   1107 C  CB  . ILE A 1 163 ? -41.886 -15.947 -35.548 1.00 109.25 ? 174 ILE A CB  1 
ATOM   1108 C  CG1 . ILE A 1 163 ? -42.986 -16.730 -34.830 1.00 106.25 ? 174 ILE A CG1 1 
ATOM   1109 C  CG2 . ILE A 1 163 ? -40.524 -16.501 -35.133 1.00 108.81 ? 174 ILE A CG2 1 
ATOM   1110 C  CD1 . ILE A 1 163 ? -43.189 -18.134 -35.369 1.00 106.38 ? 174 ILE A CD1 1 
ATOM   1111 N  N   . ALA A 1 164 ? -40.503 -13.737 -36.982 1.00 115.77 ? 175 ALA A N   1 
ATOM   1112 C  CA  . ALA A 1 164 ? -39.328 -13.144 -37.626 1.00 119.06 ? 175 ALA A CA  1 
ATOM   1113 C  C   . ALA A 1 164 ? -39.108 -11.684 -37.259 1.00 119.57 ? 175 ALA A C   1 
ATOM   1114 O  O   . ALA A 1 164 ? -37.967 -11.247 -37.116 1.00 120.66 ? 175 ALA A O   1 
ATOM   1115 C  CB  . ALA A 1 164 ? -39.426 -13.295 -39.123 1.00 122.89 ? 175 ALA A CB  1 
ATOM   1116 N  N   . PHE A 1 165 ? -40.202 -10.940 -37.118 1.00 118.93 ? 176 PHE A N   1 
ATOM   1117 C  CA  . PHE A 1 165 ? -40.152 -9.565  -36.631 1.00 119.10 ? 176 PHE A CA  1 
ATOM   1118 C  C   . PHE A 1 165 ? -39.602 -9.541  -35.212 1.00 116.04 ? 176 PHE A C   1 
ATOM   1119 O  O   . PHE A 1 165 ? -38.624 -8.856  -34.921 1.00 116.98 ? 176 PHE A O   1 
ATOM   1120 C  CB  . PHE A 1 165 ? -41.545 -8.912  -36.673 1.00 118.83 ? 176 PHE A CB  1 
ATOM   1121 C  CG  . PHE A 1 165 ? -42.065 -8.664  -38.068 1.00 122.40 ? 176 PHE A CG  1 
ATOM   1122 C  CD1 . PHE A 1 165 ? -42.808 -9.635  -38.729 1.00 122.77 ? 176 PHE A CD1 1 
ATOM   1123 C  CD2 . PHE A 1 165 ? -41.801 -7.463  -38.727 1.00 125.63 ? 176 PHE A CD2 1 
ATOM   1124 C  CE1 . PHE A 1 165 ? -43.286 -9.424  -40.029 1.00 126.35 ? 176 PHE A CE1 1 
ATOM   1125 C  CE2 . PHE A 1 165 ? -42.271 -7.240  -40.024 1.00 129.23 ? 176 PHE A CE2 1 
ATOM   1126 C  CZ  . PHE A 1 165 ? -43.019 -8.225  -40.672 1.00 129.60 ? 176 PHE A CZ  1 
ATOM   1127 N  N   . LEU A 1 166 ? -40.225 -10.329 -34.342 1.00 112.59 ? 177 LEU A N   1 
ATOM   1128 C  CA  . LEU A 1 166 ? -39.924 -10.304 -32.922 1.00 109.57 ? 177 LEU A CA  1 
ATOM   1129 C  C   . LEU A 1 166 ? -38.522 -10.782 -32.649 1.00 109.82 ? 177 LEU A C   1 
ATOM   1130 O  O   . LEU A 1 166 ? -37.864 -10.254 -31.764 1.00 109.05 ? 177 LEU A O   1 
ATOM   1131 C  CB  . LEU A 1 166 ? -40.935 -11.140 -32.152 1.00 106.20 ? 177 LEU A CB  1 
ATOM   1132 C  CG  . LEU A 1 166 ? -42.328 -10.524 -32.006 1.00 105.41 ? 177 LEU A CG  1 
ATOM   1133 C  CD1 . LEU A 1 166 ? -43.358 -11.591 -31.648 1.00 103.05 ? 177 LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A 1 166 ? -42.308 -9.420  -30.962 1.00 104.09 ? 177 LEU A CD2 1 
ATOM   1135 N  N   . ASP A 1 167 ? -38.068 -11.768 -33.422 1.00 111.11 ? 178 ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 167 ? -36.691 -12.248 -33.345 1.00 111.97 ? 178 ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 167 ? -35.715 -11.087 -33.309 1.00 114.04 ? 178 ASP A C   1 
ATOM   1138 O  O   . ASP A 1 167 ? -34.861 -11.011 -32.422 1.00 113.11 ? 178 ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 167 ? -36.367 -13.151 -34.531 1.00 114.38 ? 178 ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 167 ? -36.988 -14.518 -34.407 1.00 112.28 ? 178 ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 167 ? -36.638 -15.243 -33.460 1.00 109.94 ? 178 ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 167 ? -37.820 -14.881 -35.260 1.00 113.11 ? 178 ASP A OD2 1 
ATOM   1143 N  N   . LYS A 1 168 ? -35.862 -10.176 -34.266 1.00 117.00 ? 179 LYS A N   1 
ATOM   1144 C  CA  . LYS A 1 168 ? -34.996 -9.013  -34.360 1.00 119.37 ? 179 LYS A CA  1 
ATOM   1145 C  C   . LYS A 1 168 ? -35.206 -8.097  -33.174 1.00 117.12 ? 179 LYS A C   1 
ATOM   1146 O  O   . LYS A 1 168 ? -34.267 -7.821  -32.440 1.00 116.74 ? 179 LYS A O   1 
ATOM   1147 C  CB  . LYS A 1 168 ? -35.216 -8.270  -35.676 1.00 123.11 ? 179 LYS A CB  1 
ATOM   1148 C  CG  . LYS A 1 168 ? -34.617 -8.997  -36.875 1.00 126.21 ? 179 LYS A CG  1 
ATOM   1149 C  CD  . LYS A 1 168 ? -35.310 -8.625  -38.179 1.00 129.41 ? 179 LYS A CD  1 
ATOM   1150 C  CE  . LYS A 1 168 ? -34.796 -9.487  -39.329 1.00 132.20 ? 179 LYS A CE  1 
ATOM   1151 N  NZ  . LYS A 1 168 ? -35.296 -9.035  -40.661 1.00 136.38 ? 179 LYS A NZ  1 
ATOM   1152 N  N   . ILE A 1 169 ? -36.441 -7.666  -32.960 1.00 115.67 ? 180 ILE A N   1 
ATOM   1153 C  CA  . ILE A 1 169 ? -36.771 -6.767  -31.852 1.00 113.74 ? 180 ILE A CA  1 
ATOM   1154 C  C   . ILE A 1 169 ? -36.177 -7.206  -30.522 1.00 111.09 ? 180 ILE A C   1 
ATOM   1155 O  O   . ILE A 1 169 ? -35.924 -6.383  -29.642 1.00 110.44 ? 180 ILE A O   1 
ATOM   1156 C  CB  . ILE A 1 169 ? -38.289 -6.651  -31.673 1.00 111.91 ? 180 ILE A CB  1 
ATOM   1157 C  CG1 . ILE A 1 169 ? -38.957 -6.536  -33.043 1.00 114.62 ? 180 ILE A CG1 1 
ATOM   1158 C  CG2 . ILE A 1 169 ? -38.627 -5.473  -30.747 1.00 110.79 ? 180 ILE A CG2 1 
ATOM   1159 C  CD1 . ILE A 1 169 ? -40.446 -6.521  -33.028 1.00 113.56 ? 180 ILE A CD1 1 
ATOM   1160 N  N   . LEU A 1 170 ? -35.964 -8.512  -30.396 1.00 109.76 ? 181 LEU A N   1 
ATOM   1161 C  CA  . LEU A 1 170 ? -35.528 -9.124  -29.152 1.00 107.22 ? 181 LEU A CA  1 
ATOM   1162 C  C   . LEU A 1 170 ? -34.015 -9.223  -29.008 1.00 108.82 ? 181 LEU A C   1 
ATOM   1163 O  O   . LEU A 1 170 ? -33.505 -9.663  -27.959 1.00 107.15 ? 181 LEU A O   1 
ATOM   1164 C  CB  . LEU A 1 170 ? -36.159 -10.503 -28.999 1.00 105.11 ? 181 LEU A CB  1 
ATOM   1165 C  CG  . LEU A 1 170 ? -37.649 -10.524 -28.663 1.00 102.68 ? 181 LEU A CG  1 
ATOM   1166 C  CD1 . LEU A 1 170 ? -38.007 -11.881 -28.093 1.00 100.02 ? 181 LEU A CD1 1 
ATOM   1167 C  CD2 . LEU A 1 170 ? -38.033 -9.413  -27.683 1.00 101.52 ? 181 LEU A CD2 1 
ATOM   1168 N  N   . GLU A 1 171 ? -33.307 -8.823  -30.066 1.00 112.28 ? 182 GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 171 ? -31.856 -8.686  -30.021 1.00 114.43 ? 182 GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 171 ? -31.503 -7.392  -29.328 1.00 114.85 ? 182 GLU A C   1 
ATOM   1171 O  O   . GLU A 1 171 ? -30.509 -7.314  -28.615 1.00 114.97 ? 182 GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 171 ? -31.263 -8.690  -31.422 1.00 118.25 ? 182 GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 171 ? -31.649 -9.905  -32.234 1.00 118.22 ? 182 GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 171 ? -30.447 -10.631 -32.817 1.00 120.80 ? 182 GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 171 ? -29.298 -10.134 -32.681 1.00 123.07 ? 182 GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 171 ? -30.656 -11.717 -33.404 1.00 120.68 ? 182 GLU A OE2 1 
ATOM   1177 N  N   . VAL A 1 172 ? -32.342 -6.386  -29.533 1.00 115.16 ? 183 VAL A N   1 
ATOM   1178 C  CA  . VAL A 1 172 ? -32.113 -5.056  -28.987 1.00 115.88 ? 183 VAL A CA  1 
ATOM   1179 C  C   . VAL A 1 172 ? -32.743 -4.954  -27.588 1.00 112.44 ? 183 VAL A C   1 
ATOM   1180 O  O   . VAL A 1 172 ? -32.104 -4.494  -26.641 1.00 112.28 ? 183 VAL A O   1 
ATOM   1181 C  CB  . VAL A 1 172 ? -32.623 -3.935  -29.968 1.00 118.52 ? 183 VAL A CB  1 
ATOM   1182 C  CG1 . VAL A 1 172 ? -32.336 -2.545  -29.433 1.00 119.56 ? 183 VAL A CG1 1 
ATOM   1183 C  CG2 . VAL A 1 172 ? -32.008 -4.105  -31.353 1.00 122.14 ? 183 VAL A CG2 1 
ATOM   1184 N  N   . CYS A 1 173 ? -33.991 -5.389  -27.461 1.00 109.87 ? 184 CYS A N   1 
ATOM   1185 C  CA  . CYS A 1 173 ? -34.635 -5.428  -26.156 1.00 106.68 ? 184 CYS A CA  1 
ATOM   1186 C  C   . CYS A 1 173 ? -34.663 -6.867  -25.622 1.00 104.26 ? 184 CYS A C   1 
ATOM   1187 O  O   . CYS A 1 173 ? -35.677 -7.561  -25.697 1.00 102.56 ? 184 CYS A O   1 
ATOM   1188 C  CB  . CYS A 1 173 ? -36.039 -4.842  -26.217 1.00 105.72 ? 184 CYS A CB  1 
ATOM   1189 S  SG  . CYS A 1 173 ? -36.283 -3.576  -27.454 1.00 109.15 ? 184 CYS A SG  1 
ATOM   1190 N  N   . VAL A 1 174 ? -33.522 -7.300  -25.095 1.00 104.34 ? 185 VAL A N   1 
ATOM   1191 C  CA  . VAL A 1 174 ? -33.361 -8.640  -24.547 1.00 102.49 ? 185 VAL A CA  1 
ATOM   1192 C  C   . VAL A 1 174 ? -34.163 -8.854  -23.268 1.00 99.25  ? 185 VAL A C   1 
ATOM   1193 O  O   . VAL A 1 174 ? -34.372 -9.988  -22.850 1.00 97.41  ? 185 VAL A O   1 
ATOM   1194 C  CB  . VAL A 1 174 ? -31.873 -8.975  -24.270 1.00 103.96 ? 185 VAL A CB  1 
ATOM   1195 C  CG1 . VAL A 1 174 ? -31.185 -9.451  -25.543 1.00 106.94 ? 185 VAL A CG1 1 
ATOM   1196 C  CG2 . VAL A 1 174 ? -31.143 -7.771  -23.667 1.00 104.92 ? 185 VAL A CG2 1 
ATOM   1197 N  N   . TRP A 1 175 ? -34.614 -7.769  -22.652 1.00 98.75  ? 186 TRP A N   1 
ATOM   1198 C  CA  . TRP A 1 175 ? -35.297 -7.860  -21.369 1.00 96.05  ? 186 TRP A CA  1 
ATOM   1199 C  C   . TRP A 1 175 ? -36.738 -7.355  -21.399 1.00 94.90  ? 186 TRP A C   1 
ATOM   1200 O  O   . TRP A 1 175 ? -37.263 -6.919  -20.370 1.00 93.42  ? 186 TRP A O   1 
ATOM   1201 C  CB  . TRP A 1 175 ? -34.506 -7.108  -20.304 1.00 96.38  ? 186 TRP A CB  1 
ATOM   1202 C  CG  . TRP A 1 175 ? -33.117 -7.586  -20.134 1.00 97.51  ? 186 TRP A CG  1 
ATOM   1203 C  CD1 . TRP A 1 175 ? -32.561 -8.703  -20.667 1.00 98.01  ? 186 TRP A CD1 1 
ATOM   1204 C  CD2 . TRP A 1 175 ? -32.107 -6.980  -19.335 1.00 98.48  ? 186 TRP A CD2 1 
ATOM   1205 N  NE1 . TRP A 1 175 ? -31.257 -8.824  -20.272 1.00 99.29  ? 186 TRP A NE1 1 
ATOM   1206 C  CE2 . TRP A 1 175 ? -30.954 -7.777  -19.446 1.00 99.62  ? 186 TRP A CE2 1 
ATOM   1207 C  CE3 . TRP A 1 175 ? -32.059 -5.830  -18.543 1.00 98.67  ? 186 TRP A CE3 1 
ATOM   1208 C  CZ2 . TRP A 1 175 ? -29.766 -7.465  -18.792 1.00 100.98 ? 186 TRP A CZ2 1 
ATOM   1209 C  CZ3 . TRP A 1 175 ? -30.878 -5.523  -17.887 1.00 99.97  ? 186 TRP A CZ3 1 
ATOM   1210 C  CH2 . TRP A 1 175 ? -29.747 -6.338  -18.018 1.00 101.13 ? 186 TRP A CH2 1 
ATOM   1211 N  N   . ASP A 1 176 ? -37.369 -7.422  -22.574 1.00 95.76  ? 187 ASP A N   1 
ATOM   1212 C  CA  . ASP A 1 176 ? -38.765 -7.008  -22.751 1.00 94.95  ? 187 ASP A CA  1 
ATOM   1213 C  C   . ASP A 1 176 ? -39.711 -8.192  -22.684 1.00 92.80  ? 187 ASP A C   1 
ATOM   1214 O  O   . ASP A 1 176 ? -39.988 -8.853  -23.686 1.00 93.40  ? 187 ASP A O   1 
ATOM   1215 C  CB  . ASP A 1 176 ? -38.955 -6.271  -24.072 1.00 97.48  ? 187 ASP A CB  1 
ATOM   1216 C  CG  . ASP A 1 176 ? -40.332 -5.642  -24.197 1.00 97.12  ? 187 ASP A CG  1 
ATOM   1217 O  OD1 . ASP A 1 176 ? -41.297 -6.136  -23.570 1.00 94.88  ? 187 ASP A OD1 1 
ATOM   1218 O  OD2 . ASP A 1 176 ? -40.456 -4.649  -24.939 1.00 99.27  ? 187 ASP A OD2 1 
ATOM   1219 N  N   . ALA A 1 177 ? -40.231 -8.413  -21.484 1.00 90.46  ? 188 ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 177 ? -40.989 -9.606  -21.139 1.00 88.32  ? 188 ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 177 ? -42.308 -9.741  -21.901 1.00 88.24  ? 188 ALA A C   1 
ATOM   1222 O  O   . ALA A 1 177 ? -42.678 -10.837 -22.335 1.00 87.74  ? 188 ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 177 ? -41.229 -9.624  -19.648 1.00 86.25  ? 188 ALA A CB  1 
ATOM   1224 N  N   . GLU A 1 178 ? -43.004 -8.623  -22.070 1.00 88.91  ? 189 GLU A N   1 
ATOM   1225 C  CA  . GLU A 1 178 ? -44.307 -8.617  -22.722 1.00 89.07  ? 189 GLU A CA  1 
ATOM   1226 C  C   . GLU A 1 178 ? -44.211 -9.133  -24.147 1.00 90.78  ? 189 GLU A C   1 
ATOM   1227 O  O   . GLU A 1 178 ? -45.106 -9.814  -24.640 1.00 90.44  ? 189 GLU A O   1 
ATOM   1228 C  CB  . GLU A 1 178 ? -44.924 -7.216  -22.706 1.00 90.11  ? 189 GLU A CB  1 
ATOM   1229 C  CG  . GLU A 1 178 ? -45.173 -6.648  -21.318 1.00 88.73  ? 189 GLU A CG  1 
ATOM   1230 C  CD  . GLU A 1 178 ? -43.916 -6.060  -20.676 1.00 89.33  ? 189 GLU A CD  1 
ATOM   1231 O  OE1 . GLU A 1 178 ? -42.783 -6.475  -21.045 1.00 89.97  ? 189 GLU A OE1 1 
ATOM   1232 O  OE2 . GLU A 1 178 ? -44.059 -5.179  -19.789 1.00 89.31  ? 189 GLU A OE2 1 
ATOM   1233 N  N   . LEU A 1 179 ? -43.109 -8.821  -24.802 1.00 92.78  ? 190 LEU A N   1 
ATOM   1234 C  CA  . LEU A 1 179 ? -42.944 -9.234  -26.179 1.00 94.81  ? 190 LEU A CA  1 
ATOM   1235 C  C   . LEU A 1 179 ? -42.507 -10.690 -26.226 1.00 93.86  ? 190 LEU A C   1 
ATOM   1236 O  O   . LEU A 1 179 ? -43.086 -11.488 -26.963 1.00 94.14  ? 190 LEU A O   1 
ATOM   1237 C  CB  . LEU A 1 179 ? -41.980 -8.299  -26.935 1.00 97.70  ? 190 LEU A CB  1 
ATOM   1238 C  CG  . LEU A 1 179 ? -42.254 -6.791  -26.787 1.00 98.87  ? 190 LEU A CG  1 
ATOM   1239 C  CD1 . LEU A 1 179 ? -41.087 -6.018  -27.269 1.00 101.44 ? 190 LEU A CD1 1 
ATOM   1240 C  CD2 . LEU A 1 179 ? -43.501 -6.329  -27.515 1.00 99.92  ? 190 LEU A CD2 1 
ATOM   1241 N  N   . ARG A 1 180 ? -41.512 -11.045 -25.417 1.00 92.85  ? 191 ARG A N   1 
ATOM   1242 C  CA  . ARG A 1 180 ? -41.073 -12.432 -25.333 1.00 91.95  ? 191 ARG A CA  1 
ATOM   1243 C  C   . ARG A 1 180 ? -42.290 -13.339 -25.200 1.00 90.06  ? 191 ARG A C   1 
ATOM   1244 O  O   . ARG A 1 180 ? -42.455 -14.293 -25.961 1.00 90.34  ? 191 ARG A O   1 
ATOM   1245 C  CB  . ARG A 1 180 ? -40.140 -12.632 -24.151 1.00 90.77  ? 191 ARG A CB  1 
ATOM   1246 C  CG  . ARG A 1 180 ? -38.973 -11.698 -24.139 1.00 92.51  ? 191 ARG A CG  1 
ATOM   1247 C  CD  . ARG A 1 180 ? -37.849 -12.260 -23.311 1.00 91.89  ? 191 ARG A CD  1 
ATOM   1248 N  NE  . ARG A 1 180 ? -37.245 -13.431 -23.946 1.00 92.70  ? 191 ARG A NE  1 
ATOM   1249 C  CZ  . ARG A 1 180 ? -35.949 -13.572 -24.204 1.00 94.43  ? 191 ARG A CZ  1 
ATOM   1250 N  NH1 . ARG A 1 180 ? -35.093 -12.613 -23.873 1.00 95.56  ? 191 ARG A NH1 1 
ATOM   1251 N  NH2 . ARG A 1 180 ? -35.512 -14.686 -24.779 1.00 95.18  ? 191 ARG A NH2 1 
ATOM   1252 N  N   . GLU A 1 181 ? -43.153 -13.005 -24.247 1.00 88.33  ? 192 GLU A N   1 
ATOM   1253 C  CA  . GLU A 1 181 ? -44.380 -13.736 -24.015 1.00 86.63  ? 192 GLU A CA  1 
ATOM   1254 C  C   . GLU A 1 181 ? -45.178 -13.896 -25.296 1.00 88.09  ? 192 GLU A C   1 
ATOM   1255 O  O   . GLU A 1 181 ? -45.661 -14.986 -25.622 1.00 87.57  ? 192 GLU A O   1 
ATOM   1256 C  CB  . GLU A 1 181 ? -45.225 -12.994 -22.989 1.00 85.21  ? 192 GLU A CB  1 
ATOM   1257 C  CG  . GLU A 1 181 ? -44.883 -13.328 -21.549 1.00 83.30  ? 192 GLU A CG  1 
ATOM   1258 C  CD  . GLU A 1 181 ? -45.709 -12.517 -20.560 1.00 82.26  ? 192 GLU A CD  1 
ATOM   1259 O  OE1 . GLU A 1 181 ? -46.732 -11.914 -20.995 1.00 82.61  ? 192 GLU A OE1 1 
ATOM   1260 O  OE2 . GLU A 1 181 ? -45.330 -12.480 -19.357 1.00 81.28  ? 192 GLU A OE2 1 
ATOM   1261 N  N   . LEU A 1 182 ? -45.317 -12.795 -26.014 1.00 90.10  ? 193 LEU A N   1 
ATOM   1262 C  CA  . LEU A 1 182 ? -46.048 -12.804 -27.246 1.00 91.94  ? 193 LEU A CA  1 
ATOM   1263 C  C   . LEU A 1 182 ? -45.380 -13.755 -28.219 1.00 93.21  ? 193 LEU A C   1 
ATOM   1264 O  O   . LEU A 1 182 ? -46.058 -14.498 -28.922 1.00 93.66  ? 193 LEU A O   1 
ATOM   1265 C  CB  . LEU A 1 182 ? -46.108 -11.392 -27.813 1.00 94.18  ? 193 LEU A CB  1 
ATOM   1266 C  CG  . LEU A 1 182 ? -46.793 -11.201 -29.159 1.00 96.69  ? 193 LEU A CG  1 
ATOM   1267 C  CD1 . LEU A 1 182 ? -48.241 -11.591 -29.056 1.00 95.71  ? 193 LEU A CD1 1 
ATOM   1268 C  CD2 . LEU A 1 182 ? -46.644 -9.766  -29.613 1.00 98.72  ? 193 LEU A CD2 1 
ATOM   1269 N  N   . ARG A 1 183 ? -44.051 -13.747 -28.245 1.00 93.92  ? 194 ARG A N   1 
ATOM   1270 C  CA  . ARG A 1 183 ? -43.339 -14.598 -29.182 1.00 95.43  ? 194 ARG A CA  1 
ATOM   1271 C  C   . ARG A 1 183 ? -43.549 -16.035 -28.813 1.00 93.53  ? 194 ARG A C   1 
ATOM   1272 O  O   . ARG A 1 183 ? -43.843 -16.861 -29.666 1.00 94.35  ? 194 ARG A O   1 
ATOM   1273 C  CB  . ARG A 1 183 ? -41.841 -14.296 -29.246 1.00 96.74  ? 194 ARG A CB  1 
ATOM   1274 C  CG  . ARG A 1 183 ? -41.127 -15.166 -30.292 1.00 98.73  ? 194 ARG A CG  1 
ATOM   1275 C  CD  . ARG A 1 183 ? -39.742 -14.682 -30.635 1.00 101.00 ? 194 ARG A CD  1 
ATOM   1276 N  NE  . ARG A 1 183 ? -38.830 -14.887 -29.524 1.00 99.54  ? 194 ARG A NE  1 
ATOM   1277 C  CZ  . ARG A 1 183 ? -37.506 -14.845 -29.609 1.00 101.17 ? 194 ARG A CZ  1 
ATOM   1278 N  NH1 . ARG A 1 183 ? -36.895 -14.606 -30.763 1.00 104.37 ? 194 ARG A NH1 1 
ATOM   1279 N  NH2 . ARG A 1 183 ? -36.788 -15.043 -28.518 1.00 99.76  ? 194 ARG A NH2 1 
ATOM   1280 N  N   . ALA A 1 184 ? -43.399 -16.322 -27.531 1.00 91.12  ? 195 ALA A N   1 
ATOM   1281 C  CA  . ALA A 1 184 ? -43.640 -17.652 -27.018 1.00 89.16  ? 195 ALA A CA  1 
ATOM   1282 C  C   . ALA A 1 184 ? -45.009 -18.112 -27.448 1.00 88.82  ? 195 ALA A C   1 
ATOM   1283 O  O   . ALA A 1 184 ? -45.161 -19.237 -27.901 1.00 88.88  ? 195 ALA A O   1 
ATOM   1284 C  CB  . ALA A 1 184 ? -43.530 -17.662 -25.531 1.00 86.78  ? 195 ALA A CB  1 
ATOM   1285 N  N   . GLU A 1 185 ? -45.997 -17.230 -27.335 1.00 88.69  ? 196 GLU A N   1 
ATOM   1286 C  CA  . GLU A 1 185 ? -47.350 -17.580 -27.728 1.00 88.62  ? 196 GLU A CA  1 
ATOM   1287 C  C   . GLU A 1 185 ? -47.414 -17.936 -29.212 1.00 91.06  ? 196 GLU A C   1 
ATOM   1288 O  O   . GLU A 1 185 ? -48.077 -18.893 -29.597 1.00 90.94  ? 196 GLU A O   1 
ATOM   1289 C  CB  . GLU A 1 185 ? -48.341 -16.482 -27.359 1.00 88.48  ? 196 GLU A CB  1 
ATOM   1290 C  CG  . GLU A 1 185 ? -49.803 -16.868 -27.570 1.00 88.24  ? 196 GLU A CG  1 
ATOM   1291 C  CD  . GLU A 1 185 ? -50.361 -17.832 -26.507 1.00 85.65  ? 196 GLU A CD  1 
ATOM   1292 O  OE1 . GLU A 1 185 ? -49.648 -18.151 -25.515 1.00 83.97  ? 196 GLU A OE1 1 
ATOM   1293 O  OE2 . GLU A 1 185 ? -51.538 -18.256 -26.658 1.00 85.48  ? 196 GLU A OE2 1 
ATOM   1294 N  N   . CYS A 1 186 ? -46.699 -17.185 -30.039 1.00 93.43  ? 197 CYS A N   1 
ATOM   1295 C  CA  . CYS A 1 186 ? -46.596 -17.523 -31.451 1.00 96.10  ? 197 CYS A CA  1 
ATOM   1296 C  C   . CYS A 1 186 ? -46.148 -18.969 -31.636 1.00 95.72  ? 197 CYS A C   1 
ATOM   1297 O  O   . CYS A 1 186 ? -46.882 -19.770 -32.218 1.00 96.23  ? 197 CYS A O   1 
ATOM   1298 C  CB  . CYS A 1 186 ? -45.652 -16.570 -32.162 1.00 98.71  ? 197 CYS A CB  1 
ATOM   1299 S  SG  . CYS A 1 186 ? -46.298 -14.928 -32.177 1.00 99.70  ? 197 CYS A SG  1 
ATOM   1300 N  N   . PHE A 1 187 ? -44.968 -19.306 -31.121 1.00 94.94  ? 198 PHE A N   1 
ATOM   1301 C  CA  . PHE A 1 187 ? -44.470 -20.669 -31.204 1.00 94.66  ? 198 PHE A CA  1 
ATOM   1302 C  C   . PHE A 1 187 ? -45.553 -21.702 -30.895 1.00 92.92  ? 198 PHE A C   1 
ATOM   1303 O  O   . PHE A 1 187 ? -45.755 -22.648 -31.662 1.00 93.92  ? 198 PHE A O   1 
ATOM   1304 C  CB  . PHE A 1 187 ? -43.286 -20.889 -30.265 1.00 93.47  ? 198 PHE A CB  1 
ATOM   1305 C  CG  . PHE A 1 187 ? -42.016 -20.227 -30.716 1.00 95.72  ? 198 PHE A CG  1 
ATOM   1306 C  CD1 . PHE A 1 187 ? -41.792 -19.948 -32.067 1.00 98.81  ? 198 PHE A CD1 1 
ATOM   1307 C  CD2 . PHE A 1 187 ? -41.021 -19.904 -29.791 1.00 94.97  ? 198 PHE A CD2 1 
ATOM   1308 C  CE1 . PHE A 1 187 ? -40.613 -19.337 -32.488 1.00 101.11 ? 198 PHE A CE1 1 
ATOM   1309 C  CE2 . PHE A 1 187 ? -39.831 -19.300 -30.211 1.00 97.25  ? 198 PHE A CE2 1 
ATOM   1310 C  CZ  . PHE A 1 187 ? -39.634 -19.013 -31.565 1.00 100.32 ? 198 PHE A CZ  1 
ATOM   1311 N  N   . ILE A 1 188 ? -46.261 -21.533 -29.784 1.00 90.52  ? 199 ILE A N   1 
ATOM   1312 C  CA  . ILE A 1 188 ? -47.157 -22.594 -29.367 1.00 88.86  ? 199 ILE A CA  1 
ATOM   1313 C  C   . ILE A 1 188 ? -48.360 -22.627 -30.262 1.00 90.10  ? 199 ILE A C   1 
ATOM   1314 O  O   . ILE A 1 188 ? -48.884 -23.698 -30.541 1.00 89.98  ? 199 ILE A O   1 
ATOM   1315 C  CB  . ILE A 1 188 ? -47.536 -22.551 -27.867 1.00 86.02  ? 199 ILE A CB  1 
ATOM   1316 C  CG1 . ILE A 1 188 ? -48.221 -21.249 -27.487 1.00 85.73  ? 199 ILE A CG1 1 
ATOM   1317 C  CG2 . ILE A 1 188 ? -46.297 -22.750 -27.003 1.00 85.01  ? 199 ILE A CG2 1 
ATOM   1318 C  CD1 . ILE A 1 188 ? -48.174 -20.963 -25.993 1.00 83.40  ? 199 ILE A CD1 1 
ATOM   1319 N  N   . LYS A 1 189 ? -48.771 -21.456 -30.740 1.00 91.51  ? 200 LYS A N   1 
ATOM   1320 C  CA  . LYS A 1 189 ? -49.879 -21.365 -31.680 1.00 93.22  ? 200 LYS A CA  1 
ATOM   1321 C  C   . LYS A 1 189 ? -49.466 -22.056 -32.949 1.00 95.62  ? 200 LYS A C   1 
ATOM   1322 O  O   . LYS A 1 189 ? -50.291 -22.615 -33.662 1.00 96.91  ? 200 LYS A O   1 
ATOM   1323 C  CB  . LYS A 1 189 ? -50.235 -19.912 -31.983 1.00 94.65  ? 200 LYS A CB  1 
ATOM   1324 C  CG  . LYS A 1 189 ? -51.114 -19.235 -30.950 1.00 92.87  ? 200 LYS A CG  1 
ATOM   1325 C  CD  . LYS A 1 189 ? -52.577 -19.623 -31.090 1.00 92.87  ? 200 LYS A CD  1 
ATOM   1326 C  CE  . LYS A 1 189 ? -53.440 -18.867 -30.080 1.00 91.29  ? 200 LYS A CE  1 
ATOM   1327 N  NZ  . LYS A 1 189 ? -54.590 -19.702 -29.612 1.00 89.91  ? 200 LYS A NZ  1 
ATOM   1328 N  N   . GLU A 1 190 ? -48.169 -22.024 -33.217 1.00 96.37  ? 201 GLU A N   1 
ATOM   1329 C  CA  . GLU A 1 190 ? -47.642 -22.671 -34.393 1.00 98.84  ? 201 GLU A CA  1 
ATOM   1330 C  C   . GLU A 1 190 ? -47.336 -24.134 -34.092 1.00 97.57  ? 201 GLU A C   1 
ATOM   1331 O  O   . GLU A 1 190 ? -46.827 -24.861 -34.944 1.00 99.39  ? 201 GLU A O   1 
ATOM   1332 C  CB  . GLU A 1 190 ? -46.407 -21.928 -34.915 1.00 100.93 ? 201 GLU A CB  1 
ATOM   1333 C  CG  . GLU A 1 190 ? -46.147 -22.098 -36.426 1.00 104.54 ? 201 GLU A CG  1 
ATOM   1334 C  CD  . GLU A 1 190 ? -47.258 -21.512 -37.311 1.00 106.73 ? 201 GLU A CD  1 
ATOM   1335 O  OE1 . GLU A 1 190 ? -47.413 -20.271 -37.376 1.00 107.57 ? 201 GLU A OE1 1 
ATOM   1336 O  OE2 . GLU A 1 190 ? -47.978 -22.302 -37.955 1.00 107.82 ? 201 GLU A OE2 1 
ATOM   1337 N  N   . GLY A 1 191 ? -47.660 -24.571 -32.881 1.00 94.62  ? 202 GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 191 ? -47.498 -25.975 -32.520 1.00 93.39  ? 202 GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 191 ? -46.052 -26.394 -32.346 1.00 93.57  ? 202 GLY A C   1 
ATOM   1340 O  O   . GLY A 1 191 ? -45.714 -27.562 -32.523 1.00 93.92  ? 202 GLY A O   1 
ATOM   1341 N  N   . GLU A 1 192 ? -45.194 -25.443 -31.999 1.00 93.46  ? 203 GLU A N   1 
ATOM   1342 C  CA  . GLU A 1 192 ? -43.808 -25.745 -31.682 1.00 93.57  ? 203 GLU A CA  1 
ATOM   1343 C  C   . GLU A 1 192 ? -43.575 -25.323 -30.234 1.00 91.01  ? 203 GLU A C   1 
ATOM   1344 O  O   . GLU A 1 192 ? -42.822 -24.372 -29.950 1.00 91.33  ? 203 GLU A O   1 
ATOM   1345 C  CB  . GLU A 1 192 ? -42.875 -25.002 -32.625 1.00 96.38  ? 203 GLU A CB  1 
ATOM   1346 C  CG  . GLU A 1 192 ? -42.917 -25.510 -34.061 1.00 99.24  ? 203 GLU A CG  1 
ATOM   1347 C  CD  . GLU A 1 192 ? -42.693 -24.385 -35.082 1.00 102.20 ? 203 GLU A CD  1 
ATOM   1348 O  OE1 . GLU A 1 192 ? -43.253 -23.272 -34.889 1.00 101.90 ? 203 GLU A OE1 1 
ATOM   1349 O  OE2 . GLU A 1 192 ? -41.970 -24.612 -36.082 1.00 105.01 ? 203 GLU A OE2 1 
ATOM   1350 N  N   . PRO A 1 193 ? -44.225 -26.031 -29.304 1.00 88.64  ? 204 PRO A N   1 
ATOM   1351 C  CA  . PRO A 1 193 ? -44.294 -25.564 -27.939 1.00 86.31  ? 204 PRO A CA  1 
ATOM   1352 C  C   . PRO A 1 193 ? -42.938 -25.614 -27.215 1.00 86.10  ? 204 PRO A C   1 
ATOM   1353 O  O   . PRO A 1 193 ? -42.712 -24.861 -26.260 1.00 85.00  ? 204 PRO A O   1 
ATOM   1354 C  CB  . PRO A 1 193 ? -45.300 -26.527 -27.304 1.00 84.40  ? 204 PRO A CB  1 
ATOM   1355 C  CG  . PRO A 1 193 ? -45.154 -27.768 -28.051 1.00 85.51  ? 204 PRO A CG  1 
ATOM   1356 C  CD  . PRO A 1 193 ? -44.696 -27.420 -29.433 1.00 88.22  ? 204 PRO A CD  1 
ATOM   1357 N  N   . ARG A 1 194 ? -42.042 -26.480 -27.670 1.00 87.33  ? 205 ARG A N   1 
ATOM   1358 C  CA  . ARG A 1 194 ? -40.771 -26.632 -27.009 1.00 87.34  ? 205 ARG A CA  1 
ATOM   1359 C  C   . ARG A 1 194 ? -39.971 -25.342 -27.173 1.00 88.76  ? 205 ARG A C   1 
ATOM   1360 O  O   . ARG A 1 194 ? -39.150 -24.991 -26.319 1.00 88.30  ? 205 ARG A O   1 
ATOM   1361 C  CB  . ARG A 1 194 ? -40.049 -27.847 -27.582 1.00 88.65  ? 205 ARG A CB  1 
ATOM   1362 C  CG  . ARG A 1 194 ? -38.567 -27.972 -27.254 1.00 89.68  ? 205 ARG A CG  1 
ATOM   1363 C  CD  . ARG A 1 194 ? -38.314 -28.420 -25.834 1.00 87.68  ? 205 ARG A CD  1 
ATOM   1364 N  NE  . ARG A 1 194 ? -38.958 -29.700 -25.521 1.00 86.32  ? 205 ARG A NE  1 
ATOM   1365 C  CZ  . ARG A 1 194 ? -38.930 -30.303 -24.325 1.00 84.66  ? 205 ARG A CZ  1 
ATOM   1366 N  NH1 . ARG A 1 194 ? -38.268 -29.778 -23.296 1.00 84.14  ? 205 ARG A NH1 1 
ATOM   1367 N  NH2 . ARG A 1 194 ? -39.571 -31.448 -24.155 1.00 83.68  ? 205 ARG A NH2 1 
ATOM   1368 N  N   . LYS A 1 195 ? -40.250 -24.612 -28.248 1.00 90.60  ? 206 LYS A N   1 
ATOM   1369 C  CA  . LYS A 1 195 ? -39.520 -23.388 -28.540 1.00 92.26  ? 206 LYS A CA  1 
ATOM   1370 C  C   . LYS A 1 195 ? -39.888 -22.251 -27.591 1.00 90.68  ? 206 LYS A C   1 
ATOM   1371 O  O   . LYS A 1 195 ? -39.106 -21.321 -27.367 1.00 91.53  ? 206 LYS A O   1 
ATOM   1372 C  CB  . LYS A 1 195 ? -39.787 -22.964 -29.978 1.00 94.81  ? 206 LYS A CB  1 
ATOM   1373 C  CG  . LYS A 1 195 ? -39.603 -24.072 -30.982 1.00 96.61  ? 206 LYS A CG  1 
ATOM   1374 C  CD  . LYS A 1 195 ? -39.185 -23.531 -32.320 1.00 99.94  ? 206 LYS A CD  1 
ATOM   1375 C  CE  . LYS A 1 195 ? -38.923 -24.681 -33.267 1.00 101.97 ? 206 LYS A CE  1 
ATOM   1376 N  NZ  . LYS A 1 195 ? -38.006 -24.271 -34.361 1.00 105.50 ? 206 LYS A NZ  1 
ATOM   1377 N  N   . ALA A 1 196 ? -41.096 -22.337 -27.046 1.00 88.56  ? 207 ALA A N   1 
ATOM   1378 C  CA  . ALA A 1 196 ? -41.623 -21.334 -26.131 1.00 87.08  ? 207 ALA A CA  1 
ATOM   1379 C  C   . ALA A 1 196 ? -40.934 -21.339 -24.768 1.00 85.61  ? 207 ALA A C   1 
ATOM   1380 O  O   . ALA A 1 196 ? -40.935 -20.317 -24.077 1.00 85.08  ? 207 ALA A O   1 
ATOM   1381 C  CB  . ALA A 1 196 ? -43.114 -21.523 -25.961 1.00 85.54  ? 207 ALA A CB  1 
ATOM   1382 N  N   . ILE A 1 197 ? -40.346 -22.473 -24.386 1.00 85.14  ? 208 ILE A N   1 
ATOM   1383 C  CA  . ILE A 1 197 ? -39.726 -22.599 -23.066 1.00 83.81  ? 208 ILE A CA  1 
ATOM   1384 C  C   . ILE A 1 197 ? -38.797 -21.459 -22.828 1.00 84.92  ? 208 ILE A C   1 
ATOM   1385 O  O   . ILE A 1 197 ? -38.881 -20.777 -21.808 1.00 83.84  ? 208 ILE A O   1 
ATOM   1386 C  CB  . ILE A 1 197 ? -38.885 -23.866 -22.930 1.00 83.91  ? 208 ILE A CB  1 
ATOM   1387 C  CG1 . ILE A 1 197 ? -39.777 -25.053 -22.565 1.00 82.27  ? 208 ILE A CG1 1 
ATOM   1388 C  CG2 . ILE A 1 197 ? -37.824 -23.680 -21.835 1.00 83.52  ? 208 ILE A CG2 1 
ATOM   1389 C  CD1 . ILE A 1 197 ? -39.090 -26.400 -22.677 1.00 82.72  ? 208 ILE A CD1 1 
ATOM   1390 N  N   . SER A 1 198 ? -37.921 -21.269 -23.809 1.00 87.27  ? 209 SER A N   1 
ATOM   1391 C  CA  . SER A 1 198 ? -36.826 -20.337 -23.737 1.00 88.82  ? 209 SER A CA  1 
ATOM   1392 C  C   . SER A 1 198 ? -37.315 -18.973 -23.318 1.00 88.28  ? 209 SER A C   1 
ATOM   1393 O  O   . SER A 1 198 ? -36.777 -18.368 -22.391 1.00 87.97  ? 209 SER A O   1 
ATOM   1394 C  CB  . SER A 1 198 ? -36.172 -20.260 -25.097 1.00 91.66  ? 209 SER A CB  1 
ATOM   1395 O  OG  . SER A 1 198 ? -34.891 -19.693 -24.972 1.00 93.32  ? 209 SER A OG  1 
ATOM   1396 N  N   . ASP A 1 199 ? -38.370 -18.524 -23.986 1.00 88.25  ? 210 ASP A N   1 
ATOM   1397 C  CA  . ASP A 1 199 ? -38.940 -17.213 -23.749 1.00 88.08  ? 210 ASP A CA  1 
ATOM   1398 C  C   . ASP A 1 199 ? -39.680 -17.128 -22.444 1.00 85.58  ? 210 ASP A C   1 
ATOM   1399 O  O   . ASP A 1 199 ? -39.611 -16.123 -21.745 1.00 85.32  ? 210 ASP A O   1 
ATOM   1400 C  CB  . ASP A 1 199 ? -39.877 -16.831 -24.889 1.00 89.26  ? 210 ASP A CB  1 
ATOM   1401 C  CG  . ASP A 1 199 ? -39.139 -16.646 -26.199 1.00 92.16  ? 210 ASP A CG  1 
ATOM   1402 O  OD1 . ASP A 1 199 ? -38.641 -17.672 -26.731 1.00 92.83  ? 210 ASP A OD1 1 
ATOM   1403 O  OD2 . ASP A 1 199 ? -39.029 -15.486 -26.674 1.00 93.90  ? 210 ASP A OD2 1 
ATOM   1404 N  N   . LEU A 1 200 ? -40.399 -18.192 -22.117 1.00 83.91  ? 211 LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 200 ? -41.241 -18.175 -20.938 1.00 81.72  ? 211 LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 200 ? -40.407 -18.221 -19.690 1.00 80.94  ? 211 LEU A C   1 
ATOM   1407 O  O   . LEU A 1 200 ? -40.733 -17.547 -18.720 1.00 79.97  ? 211 LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 200 ? -42.267 -19.295 -20.978 1.00 80.39  ? 211 LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 200 ? -43.349 -19.046 -22.034 1.00 81.05  ? 211 LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 200 ? -44.459 -20.057 -21.935 1.00 79.61  ? 211 LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 200 ? -43.928 -17.655 -21.908 1.00 81.49  ? 211 LEU A CD2 1 
ATOM   1412 N  N   . LYS A 1 201 ? -39.311 -18.978 -19.724 1.00 81.62  ? 212 LYS A N   1 
ATOM   1413 C  CA  . LYS A 1 201 ? -38.431 -19.033 -18.576 1.00 81.30  ? 212 LYS A CA  1 
ATOM   1414 C  C   . LYS A 1 201 ? -37.949 -17.632 -18.307 1.00 82.30  ? 212 LYS A C   1 
ATOM   1415 O  O   . LYS A 1 201 ? -38.150 -17.089 -17.215 1.00 81.40  ? 212 LYS A O   1 
ATOM   1416 C  CB  . LYS A 1 201 ? -37.265 -19.993 -18.793 1.00 82.31  ? 212 LYS A CB  1 
ATOM   1417 C  CG  . LYS A 1 201 ? -36.175 -19.841 -17.742 1.00 82.65  ? 212 LYS A CG  1 
ATOM   1418 C  CD  . LYS A 1 201 ? -35.705 -21.176 -17.167 1.00 82.29  ? 212 LYS A CD  1 
ATOM   1419 C  CE  . LYS A 1 201 ? -34.316 -21.047 -16.466 1.00 83.53  ? 212 LYS A CE  1 
ATOM   1420 N  NZ  . LYS A 1 201 ? -33.146 -20.937 -17.446 1.00 86.01  ? 212 LYS A NZ  1 
ATOM   1421 N  N   . ALA A 1 202 ? -37.343 -17.043 -19.335 1.00 84.30  ? 213 ALA A N   1 
ATOM   1422 C  CA  . ALA A 1 202 ? -36.867 -15.673 -19.274 1.00 85.58  ? 213 ALA A CA  1 
ATOM   1423 C  C   . ALA A 1 202 ? -37.938 -14.737 -18.719 1.00 84.41  ? 213 ALA A C   1 
ATOM   1424 O  O   . ALA A 1 202 ? -37.716 -14.099 -17.702 1.00 84.06  ? 213 ALA A O   1 
ATOM   1425 C  CB  . ALA A 1 202 ? -36.416 -15.227 -20.623 1.00 87.90  ? 213 ALA A CB  1 
ATOM   1426 N  N   . ALA A 1 203 ? -39.105 -14.688 -19.357 1.00 83.95  ? 214 ALA A N   1 
ATOM   1427 C  CA  . ALA A 1 203 ? -40.181 -13.803 -18.915 1.00 83.10  ? 214 ALA A CA  1 
ATOM   1428 C  C   . ALA A 1 203 ? -40.412 -13.837 -17.388 1.00 81.35  ? 214 ALA A C   1 
ATOM   1429 O  O   . ALA A 1 203 ? -40.553 -12.788 -16.739 1.00 81.37  ? 214 ALA A O   1 
ATOM   1430 C  CB  . ALA A 1 203 ? -41.451 -14.110 -19.663 1.00 82.66  ? 214 ALA A CB  1 
ATOM   1431 N  N   . SER A 1 204 ? -40.425 -15.040 -16.817 1.00 80.01  ? 215 SER A N   1 
ATOM   1432 C  CA  . SER A 1 204 ? -40.614 -15.199 -15.385 1.00 78.55  ? 215 SER A CA  1 
ATOM   1433 C  C   . SER A 1 204 ? -39.402 -14.637 -14.636 1.00 79.37  ? 215 SER A C   1 
ATOM   1434 O  O   . SER A 1 204 ? -39.583 -13.881 -13.676 1.00 78.93  ? 215 SER A O   1 
ATOM   1435 C  CB  . SER A 1 204 ? -40.840 -16.664 -15.027 1.00 77.32  ? 215 SER A CB  1 
ATOM   1436 O  OG  . SER A 1 204 ? -39.614 -17.374 -15.118 1.00 78.14  ? 215 SER A OG  1 
ATOM   1437 N  N   . LYS A 1 205 ? -38.183 -15.006 -15.073 1.00 80.74  ? 216 LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 205 ? -36.929 -14.456 -14.515 1.00 82.01  ? 216 LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 205 ? -37.056 -12.953 -14.391 1.00 82.81  ? 216 LYS A C   1 
ATOM   1440 O  O   . LYS A 1 205 ? -36.904 -12.401 -13.309 1.00 82.74  ? 216 LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 205 ? -35.711 -14.749 -15.412 1.00 83.88  ? 216 LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 205 ? -34.896 -15.988 -15.075 1.00 83.81  ? 216 LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 205 ? -34.320 -15.916 -13.647 1.00 83.94  ? 216 LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 205 ? -33.963 -17.322 -13.066 1.00 83.50  ? 216 LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 205 ? -32.710 -17.904 -13.702 1.00 85.30  ? 216 LYS A NZ  1 
ATOM   1446 N  N   . LEU A 1 206 ? -37.363 -12.319 -15.522 1.00 83.70  ? 217 LEU A N   1 
ATOM   1447 C  CA  . LEU A 1 206 ? -37.428 -10.877 -15.667 1.00 84.86  ? 217 LEU A CA  1 
ATOM   1448 C  C   . LEU A 1 206 ? -38.316 -10.202 -14.640 1.00 83.66  ? 217 LEU A C   1 
ATOM   1449 O  O   . LEU A 1 206 ? -37.903 -9.242  -13.988 1.00 84.38  ? 217 LEU A O   1 
ATOM   1450 C  CB  . LEU A 1 206 ? -37.936 -10.529 -17.066 1.00 85.88  ? 217 LEU A CB  1 
ATOM   1451 C  CG  . LEU A 1 206 ? -36.958 -10.299 -18.207 1.00 88.27  ? 217 LEU A CG  1 
ATOM   1452 C  CD1 . LEU A 1 206 ? -35.932 -9.303  -17.794 1.00 89.87  ? 217 LEU A CD1 1 
ATOM   1453 C  CD2 . LEU A 1 206 ? -36.282 -11.567 -18.633 1.00 88.45  ? 217 LEU A CD2 1 
ATOM   1454 N  N   . LYS A 1 207 ? -39.541 -10.693 -14.516 1.00 81.98  ? 218 LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 207 ? -40.517 -10.021 -13.679 1.00 81.08  ? 218 LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 207 ? -40.322 -10.410 -12.210 1.00 80.06  ? 218 LYS A C   1 
ATOM   1457 O  O   . LYS A 1 207 ? -40.780 -9.697  -11.288 1.00 79.86  ? 218 LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 207 ? -41.941 -10.367 -14.109 1.00 79.95  ? 218 LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 207 ? -42.290 -10.159 -15.571 1.00 81.09  ? 218 LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 207 ? -43.819 -10.138 -15.665 1.00 80.14  ? 218 LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 207 ? -44.347 -10.754 -16.946 1.00 80.26  ? 218 LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 207 ? -45.803 -10.455 -17.119 1.00 80.07  ? 218 LYS A NZ  1 
ATOM   1463 N  N   . ASN A 1 208 ? -39.660 -11.548 -11.997 1.00 79.57  ? 219 ASN A N   1 
ATOM   1464 C  CA  . ASN A 1 208 ? -39.185 -11.952 -10.672 1.00 78.98  ? 219 ASN A CA  1 
ATOM   1465 C  C   . ASN A 1 208 ? -40.279 -12.320 -9.630  1.00 77.44  ? 219 ASN A C   1 
ATOM   1466 O  O   . ASN A 1 208 ? -40.147 -13.332 -8.895  1.00 76.57  ? 219 ASN A O   1 
ATOM   1467 C  CB  . ASN A 1 208 ? -38.194 -10.914 -10.125 1.00 80.45  ? 219 ASN A CB  1 
ATOM   1468 C  CG  . ASN A 1 208 ? -37.588 -11.327 -8.814  1.00 80.19  ? 219 ASN A CG  1 
ATOM   1469 O  OD1 . ASN A 1 208 ? -37.759 -12.460 -8.348  1.00 79.09  ? 219 ASN A OD1 1 
ATOM   1470 N  ND2 . ASN A 1 208 ? -36.886 -10.403 -8.185  1.00 81.34  ? 219 ASN A ND2 1 
ATOM   1471 N  N   . ASP A 1 209 ? -41.334 -11.513 -9.546  1.00 77.33  ? 220 ASP A N   1 
ATOM   1472 C  CA  . ASP A 1 209 ? -42.402 -11.802 -8.593  1.00 76.23  ? 220 ASP A CA  1 
ATOM   1473 C  C   . ASP A 1 209 ? -43.774 -11.984 -9.255  1.00 75.19  ? 220 ASP A C   1 
ATOM   1474 O  O   . ASP A 1 209 ? -44.797 -11.816 -8.585  1.00 74.33  ? 220 ASP A O   1 
ATOM   1475 C  CB  . ASP A 1 209 ? -42.475 -10.729 -7.506  1.00 76.93  ? 220 ASP A CB  1 
ATOM   1476 C  CG  . ASP A 1 209 ? -43.010 -9.399  -8.030  1.00 77.30  ? 220 ASP A CG  1 
ATOM   1477 O  OD1 . ASP A 1 209 ? -43.311 -9.296  -9.247  1.00 77.00  ? 220 ASP A OD1 1 
ATOM   1478 O  OD2 . ASP A 1 209 ? -43.139 -8.436  -7.238  1.00 78.05  ? 220 ASP A OD2 1 
ATOM   1479 N  N   . ASN A 1 210 ? -43.810 -12.307 -10.557 1.00 75.47  ? 221 ASN A N   1 
ATOM   1480 C  CA  . ASN A 1 210 ? -45.099 -12.511 -11.216 1.00 74.83  ? 221 ASN A CA  1 
ATOM   1481 C  C   . ASN A 1 210 ? -45.606 -13.915 -11.039 1.00 73.59  ? 221 ASN A C   1 
ATOM   1482 O  O   . ASN A 1 210 ? -45.092 -14.865 -11.633 1.00 73.52  ? 221 ASN A O   1 
ATOM   1483 C  CB  . ASN A 1 210 ? -45.085 -12.194 -12.694 1.00 75.72  ? 221 ASN A CB  1 
ATOM   1484 C  CG  . ASN A 1 210 ? -46.489 -12.239 -13.298 1.00 75.54  ? 221 ASN A CG  1 
ATOM   1485 O  OD1 . ASN A 1 210 ? -47.135 -13.294 -13.345 1.00 75.84  ? 221 ASN A OD1 1 
ATOM   1486 N  ND2 . ASN A 1 210 ? -46.977 -11.085 -13.741 1.00 75.20  ? 221 ASN A ND2 1 
ATOM   1487 N  N   . THR A 1 211 ? -46.649 -14.026 -10.233 1.00 72.77  ? 222 THR A N   1 
ATOM   1488 C  CA  . THR A 1 211 ? -47.233 -15.294 -9.920  1.00 71.67  ? 222 THR A CA  1 
ATOM   1489 C  C   . THR A 1 211 ? -47.637 -16.016 -11.223 1.00 71.54  ? 222 THR A C   1 
ATOM   1490 O  O   . THR A 1 211 ? -47.170 -17.129 -11.469 1.00 71.18  ? 222 THR A O   1 
ATOM   1491 C  CB  . THR A 1 211 ? -48.379 -15.094 -8.925  1.00 71.17  ? 222 THR A CB  1 
ATOM   1492 O  OG1 . THR A 1 211 ? -48.764 -16.352 -8.384  1.00 70.25  ? 222 THR A OG1 1 
ATOM   1493 C  CG2 . THR A 1 211 ? -49.602 -14.408 -9.590  1.00 71.56  ? 222 THR A CG2 1 
ATOM   1494 N  N   . GLU A 1 212 ? -48.432 -15.370 -12.083 1.00 72.03  ? 223 GLU A N   1 
ATOM   1495 C  CA  . GLU A 1 212 ? -48.969 -16.038 -13.275 1.00 72.14  ? 223 GLU A CA  1 
ATOM   1496 C  C   . GLU A 1 212 ? -47.871 -16.411 -14.297 1.00 72.86  ? 223 GLU A C   1 
ATOM   1497 O  O   . GLU A 1 212 ? -48.061 -17.296 -15.144 1.00 72.90  ? 223 GLU A O   1 
ATOM   1498 C  CB  . GLU A 1 212 ? -50.122 -15.221 -13.882 1.00 72.80  ? 223 GLU A CB  1 
ATOM   1499 C  CG  . GLU A 1 212 ? -50.758 -15.750 -15.198 1.00 73.34  ? 223 GLU A CG  1 
ATOM   1500 C  CD  . GLU A 1 212 ? -51.668 -17.004 -15.038 1.00 72.47  ? 223 GLU A CD  1 
ATOM   1501 O  OE1 . GLU A 1 212 ? -52.245 -17.213 -13.935 1.00 71.66  ? 223 GLU A OE1 1 
ATOM   1502 O  OE2 . GLU A 1 212 ? -51.794 -17.782 -16.044 1.00 72.79  ? 223 GLU A OE2 1 
ATOM   1503 N  N   . ALA A 1 213 ? -46.705 -15.785 -14.187 1.00 73.56  ? 224 ALA A N   1 
ATOM   1504 C  CA  . ALA A 1 213 ? -45.651 -16.066 -15.147 1.00 74.54  ? 224 ALA A CA  1 
ATOM   1505 C  C   . ALA A 1 213 ? -45.067 -17.432 -14.884 1.00 73.87  ? 224 ALA A C   1 
ATOM   1506 O  O   . ALA A 1 213 ? -44.723 -18.146 -15.833 1.00 74.38  ? 224 ALA A O   1 
ATOM   1507 C  CB  . ALA A 1 213 ? -44.580 -15.015 -15.112 1.00 75.58  ? 224 ALA A CB  1 
ATOM   1508 N  N   . PHE A 1 214 ? -44.972 -17.799 -13.605 1.00 72.91  ? 225 PHE A N   1 
ATOM   1509 C  CA  . PHE A 1 214 ? -44.366 -19.073 -13.227 1.00 72.39  ? 225 PHE A CA  1 
ATOM   1510 C  C   . PHE A 1 214 ? -45.257 -20.239 -13.559 1.00 71.55  ? 225 PHE A C   1 
ATOM   1511 O  O   . PHE A 1 214 ? -44.810 -21.263 -14.081 1.00 71.61  ? 225 PHE A O   1 
ATOM   1512 C  CB  . PHE A 1 214 ? -44.017 -19.101 -11.756 1.00 71.88  ? 225 PHE A CB  1 
ATOM   1513 C  CG  . PHE A 1 214 ? -42.747 -18.425 -11.456 1.00 72.89  ? 225 PHE A CG  1 
ATOM   1514 C  CD1 . PHE A 1 214 ? -41.537 -19.079 -11.652 1.00 73.62  ? 225 PHE A CD1 1 
ATOM   1515 C  CD2 . PHE A 1 214 ? -42.738 -17.109 -11.012 1.00 73.31  ? 225 PHE A CD2 1 
ATOM   1516 C  CE1 . PHE A 1 214 ? -40.319 -18.436 -11.395 1.00 74.78  ? 225 PHE A CE1 1 
ATOM   1517 C  CE2 . PHE A 1 214 ? -41.529 -16.447 -10.758 1.00 74.43  ? 225 PHE A CE2 1 
ATOM   1518 C  CZ  . PHE A 1 214 ? -40.315 -17.118 -10.951 1.00 75.19  ? 225 PHE A CZ  1 
ATOM   1519 N  N   . TYR A 1 215 ? -46.527 -20.085 -13.228 1.00 70.90  ? 226 TYR A N   1 
ATOM   1520 C  CA  . TYR A 1 215 ? -47.522 -20.989 -13.720 1.00 70.37  ? 226 TYR A CA  1 
ATOM   1521 C  C   . TYR A 1 215 ? -47.261 -21.172 -15.215 1.00 71.30  ? 226 TYR A C   1 
ATOM   1522 O  O   . TYR A 1 215 ? -46.916 -22.275 -15.657 1.00 71.26  ? 226 TYR A O   1 
ATOM   1523 C  CB  . TYR A 1 215 ? -48.896 -20.388 -13.488 1.00 70.03  ? 226 TYR A CB  1 
ATOM   1524 C  CG  . TYR A 1 215 ? -50.028 -21.367 -13.569 1.00 69.46  ? 226 TYR A CG  1 
ATOM   1525 C  CD1 . TYR A 1 215 ? -50.135 -22.401 -12.649 1.00 68.62  ? 226 TYR A CD1 1 
ATOM   1526 C  CD2 . TYR A 1 215 ? -51.021 -21.227 -14.540 1.00 69.97  ? 226 TYR A CD2 1 
ATOM   1527 C  CE1 . TYR A 1 215 ? -51.187 -23.284 -12.695 1.00 68.24  ? 226 TYR A CE1 1 
ATOM   1528 C  CE2 . TYR A 1 215 ? -52.092 -22.111 -14.609 1.00 69.62  ? 226 TYR A CE2 1 
ATOM   1529 C  CZ  . TYR A 1 215 ? -52.166 -23.141 -13.684 1.00 68.73  ? 226 TYR A CZ  1 
ATOM   1530 O  OH  . TYR A 1 215 ? -53.226 -24.027 -13.727 1.00 68.52  ? 226 TYR A OH  1 
ATOM   1531 N  N   . LYS A 1 216 ? -47.375 -20.085 -15.982 1.00 72.31  ? 227 LYS A N   1 
ATOM   1532 C  CA  . LYS A 1 216 ? -47.344 -20.208 -17.427 1.00 73.45  ? 227 LYS A CA  1 
ATOM   1533 C  C   . LYS A 1 216 ? -46.296 -21.208 -17.884 1.00 73.86  ? 227 LYS A C   1 
ATOM   1534 O  O   . LYS A 1 216 ? -46.601 -22.142 -18.622 1.00 74.07  ? 227 LYS A O   1 
ATOM   1535 C  CB  . LYS A 1 216 ? -47.171 -18.854 -18.113 1.00 74.79  ? 227 LYS A CB  1 
ATOM   1536 C  CG  . LYS A 1 216 ? -48.515 -18.129 -18.358 1.00 74.99  ? 227 LYS A CG  1 
ATOM   1537 C  CD  . LYS A 1 216 ? -49.490 -18.957 -19.236 1.00 75.23  ? 227 LYS A CD  1 
ATOM   1538 C  CE  . LYS A 1 216 ? -49.081 -18.948 -20.731 1.00 77.00  ? 227 LYS A CE  1 
ATOM   1539 N  NZ  . LYS A 1 216 ? -49.427 -20.250 -21.403 1.00 77.10  ? 227 LYS A NZ  1 
ATOM   1540 N  N   . ILE A 1 217 ? -45.075 -21.048 -17.404 1.00 74.12  ? 228 ILE A N   1 
ATOM   1541 C  CA  . ILE A 1 217 ? -44.032 -21.944 -17.842 1.00 74.77  ? 228 ILE A CA  1 
ATOM   1542 C  C   . ILE A 1 217 ? -44.130 -23.348 -17.228 1.00 73.67  ? 228 ILE A C   1 
ATOM   1543 O  O   . ILE A 1 217 ? -44.112 -24.342 -17.953 1.00 73.98  ? 228 ILE A O   1 
ATOM   1544 C  CB  . ILE A 1 217 ? -42.637 -21.353 -17.672 1.00 75.72  ? 228 ILE A CB  1 
ATOM   1545 C  CG1 . ILE A 1 217 ? -41.623 -22.442 -17.984 1.00 76.29  ? 228 ILE A CG1 1 
ATOM   1546 C  CG2 . ILE A 1 217 ? -42.457 -20.766 -16.280 1.00 74.88  ? 228 ILE A CG2 1 
ATOM   1547 C  CD1 . ILE A 1 217 ? -40.313 -21.957 -18.350 1.00 78.02  ? 228 ILE A CD1 1 
ATOM   1548 N  N   . SER A 1 218 ? -44.232 -23.437 -15.906 1.00 72.54  ? 229 SER A N   1 
ATOM   1549 C  CA  . SER A 1 218 ? -44.427 -24.731 -15.248 1.00 71.65  ? 229 SER A CA  1 
ATOM   1550 C  C   . SER A 1 218 ? -45.487 -25.550 -15.991 1.00 71.39  ? 229 SER A C   1 
ATOM   1551 O  O   . SER A 1 218 ? -45.251 -26.707 -16.354 1.00 71.58  ? 229 SER A O   1 
ATOM   1552 C  CB  . SER A 1 218 ? -44.834 -24.536 -13.791 1.00 70.55  ? 229 SER A CB  1 
ATOM   1553 O  OG  . SER A 1 218 ? -45.096 -25.781 -13.178 1.00 69.88  ? 229 SER A OG  1 
ATOM   1554 N  N   . THR A 1 219 ? -46.634 -24.920 -16.237 1.00 71.15  ? 230 THR A N   1 
ATOM   1555 C  CA  . THR A 1 219 ? -47.688 -25.494 -17.042 1.00 71.15  ? 230 THR A CA  1 
ATOM   1556 C  C   . THR A 1 219 ? -47.107 -26.068 -18.337 1.00 72.32  ? 230 THR A C   1 
ATOM   1557 O  O   . THR A 1 219 ? -47.336 -27.240 -18.660 1.00 72.26  ? 230 THR A O   1 
ATOM   1558 C  CB  . THR A 1 219 ? -48.789 -24.441 -17.308 1.00 71.28  ? 230 THR A CB  1 
ATOM   1559 O  OG1 . THR A 1 219 ? -49.566 -24.278 -16.114 1.00 70.23  ? 230 THR A OG1 1 
ATOM   1560 C  CG2 . THR A 1 219 ? -49.730 -24.850 -18.464 1.00 71.82  ? 230 THR A CG2 1 
ATOM   1561 N  N   . LEU A 1 220 ? -46.331 -25.259 -19.053 1.00 73.55  ? 231 LEU A N   1 
ATOM   1562 C  CA  . LEU A 1 220 ? -45.697 -25.716 -20.279 1.00 74.99  ? 231 LEU A CA  1 
ATOM   1563 C  C   . LEU A 1 220 ? -44.717 -26.881 -20.103 1.00 75.12  ? 231 LEU A C   1 
ATOM   1564 O  O   . LEU A 1 220 ? -44.917 -27.929 -20.724 1.00 75.47  ? 231 LEU A O   1 
ATOM   1565 C  CB  . LEU A 1 220 ? -45.004 -24.574 -21.008 1.00 76.48  ? 231 LEU A CB  1 
ATOM   1566 C  CG  . LEU A 1 220 ? -44.436 -25.084 -22.333 1.00 78.27  ? 231 LEU A CG  1 
ATOM   1567 C  CD1 . LEU A 1 220 ? -45.569 -25.393 -23.324 1.00 78.76  ? 231 LEU A CD1 1 
ATOM   1568 C  CD2 . LEU A 1 220 ? -43.441 -24.110 -22.922 1.00 79.97  ? 231 LEU A CD2 1 
ATOM   1569 N  N   . TYR A 1 221 ? -43.664 -26.706 -19.296 1.00 75.02  ? 232 TYR A N   1 
ATOM   1570 C  CA  . TYR A 1 221 ? -42.748 -27.809 -19.016 1.00 75.22  ? 232 TYR A CA  1 
ATOM   1571 C  C   . TYR A 1 221 ? -43.540 -29.089 -18.825 1.00 74.30  ? 232 TYR A C   1 
ATOM   1572 O  O   . TYR A 1 221 ? -43.215 -30.122 -19.425 1.00 75.03  ? 232 TYR A O   1 
ATOM   1573 C  CB  . TYR A 1 221 ? -41.952 -27.577 -17.742 1.00 74.72  ? 232 TYR A CB  1 
ATOM   1574 C  CG  . TYR A 1 221 ? -40.706 -26.742 -17.881 1.00 76.06  ? 232 TYR A CG  1 
ATOM   1575 C  CD1 . TYR A 1 221 ? -39.765 -27.000 -18.879 1.00 77.80  ? 232 TYR A CD1 1 
ATOM   1576 C  CD2 . TYR A 1 221 ? -40.467 -25.689 -17.006 1.00 75.76  ? 232 TYR A CD2 1 
ATOM   1577 C  CE1 . TYR A 1 221 ? -38.621 -26.214 -19.014 1.00 79.24  ? 232 TYR A CE1 1 
ATOM   1578 C  CE2 . TYR A 1 221 ? -39.329 -24.911 -17.118 1.00 77.12  ? 232 TYR A CE2 1 
ATOM   1579 C  CZ  . TYR A 1 221 ? -38.409 -25.169 -18.127 1.00 78.87  ? 232 TYR A CZ  1 
ATOM   1580 O  OH  . TYR A 1 221 ? -37.275 -24.382 -18.212 1.00 80.38  ? 232 TYR A OH  1 
ATOM   1581 N  N   . TYR A 1 222 ? -44.582 -29.001 -17.994 1.00 72.88  ? 233 TYR A N   1 
ATOM   1582 C  CA  . TYR A 1 222 ? -45.470 -30.113 -17.728 1.00 72.06  ? 233 TYR A CA  1 
ATOM   1583 C  C   . TYR A 1 222 ? -46.073 -30.712 -18.987 1.00 72.80  ? 233 TYR A C   1 
ATOM   1584 O  O   . TYR A 1 222 ? -45.998 -31.929 -19.149 1.00 72.96  ? 233 TYR A O   1 
ATOM   1585 C  CB  . TYR A 1 222 ? -46.578 -29.695 -16.771 1.00 70.77  ? 233 TYR A CB  1 
ATOM   1586 C  CG  . TYR A 1 222 ? -47.451 -30.832 -16.280 1.00 69.99  ? 233 TYR A CG  1 
ATOM   1587 C  CD1 . TYR A 1 222 ? -48.587 -31.224 -16.971 1.00 70.03  ? 233 TYR A CD1 1 
ATOM   1588 C  CD2 . TYR A 1 222 ? -47.148 -31.493 -15.120 1.00 69.41  ? 233 TYR A CD2 1 
ATOM   1589 C  CE1 . TYR A 1 222 ? -49.394 -32.262 -16.519 1.00 69.48  ? 233 TYR A CE1 1 
ATOM   1590 C  CE2 . TYR A 1 222 ? -47.938 -32.526 -14.647 1.00 68.88  ? 233 TYR A CE2 1 
ATOM   1591 C  CZ  . TYR A 1 222 ? -49.058 -32.917 -15.347 1.00 68.89  ? 233 TYR A CZ  1 
ATOM   1592 O  OH  . TYR A 1 222 ? -49.840 -33.953 -14.850 1.00 68.50  ? 233 TYR A OH  1 
ATOM   1593 N  N   . GLN A 1 223 ? -46.679 -29.890 -19.859 1.00 73.40  ? 234 GLN A N   1 
ATOM   1594 C  CA  . GLN A 1 223 ? -47.246 -30.396 -21.133 1.00 74.41  ? 234 GLN A CA  1 
ATOM   1595 C  C   . GLN A 1 223 ? -46.184 -31.160 -21.911 1.00 75.77  ? 234 GLN A C   1 
ATOM   1596 O  O   . GLN A 1 223 ? -46.478 -32.114 -22.648 1.00 76.50  ? 234 GLN A O   1 
ATOM   1597 C  CB  . GLN A 1 223 ? -47.722 -29.290 -22.085 1.00 75.35  ? 234 GLN A CB  1 
ATOM   1598 C  CG  . GLN A 1 223 ? -48.247 -28.005 -21.473 1.00 74.56  ? 234 GLN A CG  1 
ATOM   1599 C  CD  . GLN A 1 223 ? -49.777 -27.882 -21.546 1.00 74.37  ? 234 GLN A CD  1 
ATOM   1600 O  OE1 . GLN A 1 223 ? -50.463 -28.801 -22.052 1.00 74.78  ? 234 GLN A OE1 1 
ATOM   1601 N  NE2 . GLN A 1 223 ? -50.323 -26.746 -21.033 1.00 73.90  ? 234 GLN A NE2 1 
ATOM   1602 N  N   . LEU A 1 224 ? -44.942 -30.723 -21.784 1.00 76.30  ? 235 LEU A N   1 
ATOM   1603 C  CA  . LEU A 1 224 ? -43.918 -31.350 -22.557 1.00 77.86  ? 235 LEU A CA  1 
ATOM   1604 C  C   . LEU A 1 224 ? -43.290 -32.472 -21.773 1.00 77.38  ? 235 LEU A C   1 
ATOM   1605 O  O   . LEU A 1 224 ? -42.345 -33.098 -22.241 1.00 78.65  ? 235 LEU A O   1 
ATOM   1606 C  CB  . LEU A 1 224 ? -42.873 -30.332 -23.015 1.00 79.17  ? 235 LEU A CB  1 
ATOM   1607 C  CG  . LEU A 1 224 ? -43.305 -29.085 -23.801 1.00 79.99  ? 235 LEU A CG  1 
ATOM   1608 C  CD1 . LEU A 1 224 ? -42.079 -28.431 -24.338 1.00 81.71  ? 235 LEU A CD1 1 
ATOM   1609 C  CD2 . LEU A 1 224 ? -44.237 -29.382 -24.951 1.00 80.97  ? 235 LEU A CD2 1 
ATOM   1610 N  N   . GLY A 1 225 ? -43.813 -32.736 -20.580 1.00 75.71  ? 236 GLY A N   1 
ATOM   1611 C  CA  . GLY A 1 225 ? -43.308 -33.838 -19.754 1.00 75.31  ? 236 GLY A CA  1 
ATOM   1612 C  C   . GLY A 1 225 ? -41.987 -33.543 -19.058 1.00 75.74  ? 236 GLY A C   1 
ATOM   1613 O  O   . GLY A 1 225 ? -41.427 -34.417 -18.394 1.00 75.78  ? 236 GLY A O   1 
ATOM   1614 N  N   . ASP A 1 226 ? -41.475 -32.320 -19.219 1.00 76.28  ? 237 ASP A N   1 
ATOM   1615 C  CA  . ASP A 1 226 ? -40.365 -31.854 -18.399 1.00 76.57  ? 237 ASP A CA  1 
ATOM   1616 C  C   . ASP A 1 226 ? -40.862 -31.684 -16.960 1.00 74.95  ? 237 ASP A C   1 
ATOM   1617 O  O   . ASP A 1 226 ? -40.945 -30.571 -16.420 1.00 74.48  ? 237 ASP A O   1 
ATOM   1618 C  CB  . ASP A 1 226 ? -39.834 -30.557 -18.979 1.00 77.62  ? 237 ASP A CB  1 
ATOM   1619 C  CG  . ASP A 1 226 ? -39.126 -30.781 -20.303 1.00 79.67  ? 237 ASP A CG  1 
ATOM   1620 O  OD1 . ASP A 1 226 ? -38.671 -31.928 -20.525 1.00 80.37  ? 237 ASP A OD1 1 
ATOM   1621 O  OD2 . ASP A 1 226 ? -39.030 -29.831 -21.122 1.00 80.74  ? 237 ASP A OD2 1 
ATOM   1622 N  N   . HIS A 1 227 ? -41.221 -32.812 -16.361 1.00 74.27  ? 238 HIS A N   1 
ATOM   1623 C  CA  . HIS A 1 227 ? -41.941 -32.816 -15.119 1.00 72.85  ? 238 HIS A CA  1 
ATOM   1624 C  C   . HIS A 1 227 ? -41.078 -32.374 -13.956 1.00 72.93  ? 238 HIS A C   1 
ATOM   1625 O  O   . HIS A 1 227 ? -41.580 -31.795 -13.003 1.00 72.00  ? 238 HIS A O   1 
ATOM   1626 C  CB  . HIS A 1 227 ? -42.493 -34.201 -14.850 1.00 72.40  ? 238 HIS A CB  1 
ATOM   1627 C  CG  . HIS A 1 227 ? -41.443 -35.271 -14.777 1.00 73.44  ? 238 HIS A CG  1 
ATOM   1628 N  ND1 . HIS A 1 227 ? -40.591 -35.411 -13.699 1.00 73.76  ? 238 HIS A ND1 1 
ATOM   1629 C  CD2 . HIS A 1 227 ? -41.129 -36.270 -15.638 1.00 74.41  ? 238 HIS A CD2 1 
ATOM   1630 C  CE1 . HIS A 1 227 ? -39.792 -36.443 -13.909 1.00 74.89  ? 238 HIS A CE1 1 
ATOM   1631 N  NE2 . HIS A 1 227 ? -40.101 -36.985 -15.076 1.00 75.28  ? 238 HIS A NE2 1 
ATOM   1632 N  N   . GLU A 1 228 ? -39.780 -32.643 -14.018 1.00 74.24  ? 239 GLU A N   1 
ATOM   1633 C  CA  . GLU A 1 228 ? -38.907 -32.241 -12.925 1.00 74.59  ? 239 GLU A CA  1 
ATOM   1634 C  C   . GLU A 1 228 ? -38.859 -30.734 -12.887 1.00 74.50  ? 239 GLU A C   1 
ATOM   1635 O  O   . GLU A 1 228 ? -39.148 -30.120 -11.850 1.00 73.83  ? 239 GLU A O   1 
ATOM   1636 C  CB  . GLU A 1 228 ? -37.494 -32.767 -13.114 1.00 76.32  ? 239 GLU A CB  1 
ATOM   1637 C  CG  . GLU A 1 228 ? -36.657 -32.694 -11.828 1.00 76.88  ? 239 GLU A CG  1 
ATOM   1638 C  CD  . GLU A 1 228 ? -35.193 -33.065 -12.064 1.00 78.88  ? 239 GLU A CD  1 
ATOM   1639 O  OE1 . GLU A 1 228 ? -34.916 -33.822 -13.024 1.00 79.71  ? 239 GLU A OE1 1 
ATOM   1640 O  OE2 . GLU A 1 228 ? -34.309 -32.611 -11.303 1.00 79.80  ? 239 GLU A OE2 1 
ATOM   1641 N  N   . LEU A 1 229 ? -38.507 -30.140 -14.024 1.00 75.35  ? 240 LEU A N   1 
ATOM   1642 C  CA  . LEU A 1 229 ? -38.409 -28.691 -14.090 1.00 75.51  ? 240 LEU A CA  1 
ATOM   1643 C  C   . LEU A 1 229 ? -39.729 -28.073 -13.645 1.00 73.96  ? 240 LEU A C   1 
ATOM   1644 O  O   . LEU A 1 229 ? -39.757 -27.270 -12.701 1.00 73.60  ? 240 LEU A O   1 
ATOM   1645 C  CB  . LEU A 1 229 ? -37.993 -28.218 -15.482 1.00 76.81  ? 240 LEU A CB  1 
ATOM   1646 C  CG  . LEU A 1 229 ? -36.601 -28.687 -15.915 1.00 78.70  ? 240 LEU A CG  1 
ATOM   1647 C  CD1 . LEU A 1 229 ? -36.643 -29.878 -16.921 1.00 79.29  ? 240 LEU A CD1 1 
ATOM   1648 C  CD2 . LEU A 1 229 ? -35.856 -27.527 -16.501 1.00 80.20  ? 240 LEU A CD2 1 
ATOM   1649 N  N   . SER A 1 230 ? -40.818 -28.497 -14.283 1.00 73.20  ? 241 SER A N   1 
ATOM   1650 C  CA  . SER A 1 230 ? -42.151 -28.020 -13.932 1.00 71.91  ? 241 SER A CA  1 
ATOM   1651 C  C   . SER A 1 230 ? -42.353 -27.869 -12.415 1.00 71.07  ? 241 SER A C   1 
ATOM   1652 O  O   . SER A 1 230 ? -42.813 -26.810 -11.959 1.00 70.65  ? 241 SER A O   1 
ATOM   1653 C  CB  . SER A 1 230 ? -43.233 -28.925 -14.518 1.00 71.33  ? 241 SER A CB  1 
ATOM   1654 O  OG  . SER A 1 230 ? -44.530 -28.481 -14.126 1.00 70.33  ? 241 SER A OG  1 
ATOM   1655 N  N   . LEU A 1 231 ? -42.002 -28.914 -11.651 1.00 71.03  ? 242 LEU A N   1 
ATOM   1656 C  CA  . LEU A 1 231 ? -42.115 -28.898 -10.195 1.00 70.56  ? 242 LEU A CA  1 
ATOM   1657 C  C   . LEU A 1 231 ? -41.313 -27.764 -9.552  1.00 71.17  ? 242 LEU A C   1 
ATOM   1658 O  O   . LEU A 1 231 ? -41.869 -27.000 -8.760  1.00 70.67  ? 242 LEU A O   1 
ATOM   1659 C  CB  . LEU A 1 231 ? -41.723 -30.255 -9.612  1.00 70.74  ? 242 LEU A CB  1 
ATOM   1660 C  CG  . LEU A 1 231 ? -41.781 -30.608 -8.110  1.00 70.62  ? 242 LEU A CG  1 
ATOM   1661 C  CD1 . LEU A 1 231 ? -43.085 -30.229 -7.404  1.00 69.57  ? 242 LEU A CD1 1 
ATOM   1662 C  CD2 . LEU A 1 231 ? -41.532 -32.095 -7.934  1.00 71.07  ? 242 LEU A CD2 1 
ATOM   1663 N  N   . SER A 1 232 ? -40.035 -27.617 -9.907  1.00 72.40  ? 243 SER A N   1 
ATOM   1664 C  CA  . SER A 1 232 ? -39.231 -26.529 -9.308  1.00 73.16  ? 243 SER A CA  1 
ATOM   1665 C  C   . SER A 1 232 ? -39.829 -25.147 -9.586  1.00 72.78  ? 243 SER A C   1 
ATOM   1666 O  O   . SER A 1 232 ? -39.818 -24.257 -8.722  1.00 72.84  ? 243 SER A O   1 
ATOM   1667 C  CB  . SER A 1 232 ? -37.755 -26.573 -9.727  1.00 74.80  ? 243 SER A CB  1 
ATOM   1668 O  OG  . SER A 1 232 ? -37.594 -26.097 -11.044 1.00 75.29  ? 243 SER A OG  1 
ATOM   1669 N  N   . GLU A 1 233 ? -40.368 -24.979 -10.783 1.00 72.55  ? 244 GLU A N   1 
ATOM   1670 C  CA  . GLU A 1 233 ? -41.014 -23.730 -11.120 1.00 72.32  ? 244 GLU A CA  1 
ATOM   1671 C  C   . GLU A 1 233 ? -42.255 -23.439 -10.269 1.00 71.12  ? 244 GLU A C   1 
ATOM   1672 O  O   . GLU A 1 233 ? -42.418 -22.358 -9.718  1.00 71.13  ? 244 GLU A O   1 
ATOM   1673 C  CB  . GLU A 1 233 ? -41.354 -23.706 -12.606 1.00 72.61  ? 244 GLU A CB  1 
ATOM   1674 C  CG  . GLU A 1 233 ? -40.127 -23.752 -13.517 1.00 74.15  ? 244 GLU A CG  1 
ATOM   1675 C  CD  . GLU A 1 233 ? -39.047 -22.735 -13.154 1.00 75.23  ? 244 GLU A CD  1 
ATOM   1676 O  OE1 . GLU A 1 233 ? -39.329 -21.682 -12.532 1.00 74.94  ? 244 GLU A OE1 1 
ATOM   1677 O  OE2 . GLU A 1 233 ? -37.885 -23.004 -13.520 1.00 76.58  ? 244 GLU A OE2 1 
ATOM   1678 N  N   . VAL A 1 234 ? -43.133 -24.413 -10.147 1.00 70.24  ? 245 VAL A N   1 
ATOM   1679 C  CA  . VAL A 1 234 ? -44.360 -24.171 -9.430  1.00 69.32  ? 245 VAL A CA  1 
ATOM   1680 C  C   . VAL A 1 234 ? -44.056 -24.012 -7.935  1.00 69.39  ? 245 VAL A C   1 
ATOM   1681 O  O   . VAL A 1 234 ? -44.809 -23.383 -7.201  1.00 69.08  ? 245 VAL A O   1 
ATOM   1682 C  CB  . VAL A 1 234 ? -45.384 -25.259 -9.752  1.00 68.59  ? 245 VAL A CB  1 
ATOM   1683 C  CG1 . VAL A 1 234 ? -44.891 -26.617 -9.272  1.00 68.63  ? 245 VAL A CG1 1 
ATOM   1684 C  CG2 . VAL A 1 234 ? -46.744 -24.910 -9.178  1.00 67.89  ? 245 VAL A CG2 1 
ATOM   1685 N  N   . ARG A 1 235 ? -42.922 -24.550 -7.493  1.00 70.04  ? 246 ARG A N   1 
ATOM   1686 C  CA  . ARG A 1 235 ? -42.440 -24.279 -6.133  1.00 70.49  ? 246 ARG A CA  1 
ATOM   1687 C  C   . ARG A 1 235 ? -42.247 -22.786 -5.969  1.00 70.95  ? 246 ARG A C   1 
ATOM   1688 O  O   . ARG A 1 235 ? -42.659 -22.195 -4.967  1.00 70.92  ? 246 ARG A O   1 
ATOM   1689 C  CB  . ARG A 1 235 ? -41.108 -24.951 -5.888  1.00 71.49  ? 246 ARG A CB  1 
ATOM   1690 C  CG  . ARG A 1 235 ? -41.204 -26.417 -5.664  1.00 71.28  ? 246 ARG A CG  1 
ATOM   1691 C  CD  . ARG A 1 235 ? -39.811 -26.938 -5.403  1.00 72.54  ? 246 ARG A CD  1 
ATOM   1692 N  NE  . ARG A 1 235 ? -39.340 -26.467 -4.102  1.00 73.37  ? 246 ARG A NE  1 
ATOM   1693 C  CZ  . ARG A 1 235 ? -39.707 -27.051 -2.971  1.00 73.43  ? 246 ARG A CZ  1 
ATOM   1694 N  NH1 . ARG A 1 235 ? -40.528 -28.093 -3.057  1.00 72.66  ? 246 ARG A NH1 1 
ATOM   1695 N  NH2 . ARG A 1 235 ? -39.277 -26.612 -1.784  1.00 74.40  ? 246 ARG A NH2 1 
ATOM   1696 N  N   . GLU A 1 236 ? -41.599 -22.207 -6.976  1.00 71.52  ? 247 GLU A N   1 
ATOM   1697 C  CA  . GLU A 1 236 ? -41.404 -20.789 -7.062  1.00 72.11  ? 247 GLU A CA  1 
ATOM   1698 C  C   . GLU A 1 236 ? -42.727 -20.050 -6.963  1.00 71.36  ? 247 GLU A C   1 
ATOM   1699 O  O   . GLU A 1 236 ? -42.877 -19.117 -6.162  1.00 71.64  ? 247 GLU A O   1 
ATOM   1700 C  CB  . GLU A 1 236 ? -40.733 -20.452 -8.388  1.00 72.93  ? 247 GLU A CB  1 
ATOM   1701 C  CG  . GLU A 1 236 ? -39.269 -20.670 -8.389  1.00 74.20  ? 247 GLU A CG  1 
ATOM   1702 C  CD  . GLU A 1 236 ? -38.566 -19.709 -7.465  1.00 75.12  ? 247 GLU A CD  1 
ATOM   1703 O  OE1 . GLU A 1 236 ? -39.178 -18.673 -7.059  1.00 74.77  ? 247 GLU A OE1 1 
ATOM   1704 O  OE2 . GLU A 1 236 ? -37.393 -19.994 -7.134  1.00 76.34  ? 247 GLU A OE2 1 
ATOM   1705 N  N   . CYS A 1 237 ? -43.690 -20.457 -7.777  1.00 70.59  ? 248 CYS A N   1 
ATOM   1706 C  CA  . CYS A 1 237 ? -44.926 -19.734 -7.794  1.00 70.08  ? 248 CYS A CA  1 
ATOM   1707 C  C   . CYS A 1 237 ? -45.355 -19.641 -6.348  1.00 69.85  ? 248 CYS A C   1 
ATOM   1708 O  O   . CYS A 1 237 ? -45.647 -18.570 -5.842  1.00 70.10  ? 248 CYS A O   1 
ATOM   1709 C  CB  . CYS A 1 237 ? -45.987 -20.440 -8.633  1.00 69.36  ? 248 CYS A CB  1 
ATOM   1710 S  SG  . CYS A 1 237 ? -47.578 -19.622 -8.377  1.00 69.07  ? 248 CYS A SG  1 
ATOM   1711 N  N   . LEU A 1 238 ? -45.336 -20.779 -5.673  1.00 69.55  ? 249 LEU A N   1 
ATOM   1712 C  CA  . LEU A 1 238 ? -45.798 -20.869 -4.310  1.00 69.52  ? 249 LEU A CA  1 
ATOM   1713 C  C   . LEU A 1 238 ? -44.912 -20.128 -3.321  1.00 70.47  ? 249 LEU A C   1 
ATOM   1714 O  O   . LEU A 1 238 ? -45.402 -19.487 -2.404  1.00 70.73  ? 249 LEU A O   1 
ATOM   1715 C  CB  . LEU A 1 238 ? -45.923 -22.330 -3.925  1.00 69.15  ? 249 LEU A CB  1 
ATOM   1716 C  CG  . LEU A 1 238 ? -47.208 -23.011 -4.405  1.00 68.33  ? 249 LEU A CG  1 
ATOM   1717 C  CD1 . LEU A 1 238 ? -47.076 -24.532 -4.318  1.00 68.15  ? 249 LEU A CD1 1 
ATOM   1718 C  CD2 . LEU A 1 238 ? -48.410 -22.549 -3.598  1.00 68.20  ? 249 LEU A CD2 1 
ATOM   1719 N  N   . LYS A 1 239 ? -43.602 -20.206 -3.505  1.00 71.17  ? 250 LYS A N   1 
ATOM   1720 C  CA  . LYS A 1 239 ? -42.689 -19.476 -2.644  1.00 72.29  ? 250 LYS A CA  1 
ATOM   1721 C  C   . LYS A 1 239 ? -43.084 -17.989 -2.665  1.00 72.54  ? 250 LYS A C   1 
ATOM   1722 O  O   . LYS A 1 239 ? -42.968 -17.288 -1.668  1.00 73.25  ? 250 LYS A O   1 
ATOM   1723 C  CB  . LYS A 1 239 ? -41.250 -19.737 -3.087  1.00 73.16  ? 250 LYS A CB  1 
ATOM   1724 C  CG  . LYS A 1 239 ? -40.176 -19.026 -2.283  1.00 74.58  ? 250 LYS A CG  1 
ATOM   1725 C  CD  . LYS A 1 239 ? -38.909 -18.850 -3.162  1.00 75.53  ? 250 LYS A CD  1 
ATOM   1726 C  CE  . LYS A 1 239 ? -38.112 -17.537 -2.866  1.00 76.86  ? 250 LYS A CE  1 
ATOM   1727 N  NZ  . LYS A 1 239 ? -37.217 -17.186 -4.042  1.00 77.66  ? 250 LYS A NZ  1 
ATOM   1728 N  N   . LEU A 1 240 ? -43.599 -17.526 -3.797  1.00 72.10  ? 251 LEU A N   1 
ATOM   1729 C  CA  . LEU A 1 240 ? -44.064 -16.137 -3.896  1.00 72.43  ? 251 LEU A CA  1 
ATOM   1730 C  C   . LEU A 1 240 ? -45.400 -15.990 -3.216  1.00 71.93  ? 251 LEU A C   1 
ATOM   1731 O  O   . LEU A 1 240 ? -45.720 -14.947 -2.653  1.00 72.46  ? 251 LEU A O   1 
ATOM   1732 C  CB  . LEU A 1 240 ? -44.225 -15.673 -5.349  1.00 72.35  ? 251 LEU A CB  1 
ATOM   1733 C  CG  . LEU A 1 240 ? -42.992 -15.305 -6.141  1.00 73.24  ? 251 LEU A CG  1 
ATOM   1734 C  CD1 . LEU A 1 240 ? -43.370 -15.016 -7.566  1.00 73.16  ? 251 LEU A CD1 1 
ATOM   1735 C  CD2 . LEU A 1 240 ? -42.382 -14.108 -5.508  1.00 74.40  ? 251 LEU A CD2 1 
ATOM   1736 N  N   . ASP A 1 241 ? -46.212 -17.026 -3.306  1.00 71.04  ? 252 ASP A N   1 
ATOM   1737 C  CA  . ASP A 1 241 ? -47.538 -16.906 -2.778  1.00 70.73  ? 252 ASP A CA  1 
ATOM   1738 C  C   . ASP A 1 241 ? -48.079 -18.241 -2.275  1.00 70.13  ? 252 ASP A C   1 
ATOM   1739 O  O   . ASP A 1 241 ? -48.299 -19.178 -3.047  1.00 69.52  ? 252 ASP A O   1 
ATOM   1740 C  CB  . ASP A 1 241 ? -48.444 -16.257 -3.806  1.00 70.52  ? 252 ASP A CB  1 
ATOM   1741 C  CG  . ASP A 1 241 ? -49.882 -16.237 -3.365  1.00 70.32  ? 252 ASP A CG  1 
ATOM   1742 O  OD1 . ASP A 1 241 ? -50.154 -16.432 -2.141  1.00 70.61  ? 252 ASP A OD1 1 
ATOM   1743 O  OD2 . ASP A 1 241 ? -50.746 -16.037 -4.252  1.00 70.08  ? 252 ASP A OD2 1 
ATOM   1744 N  N   . GLN A 1 242 ? -48.275 -18.318 -0.965  1.00 70.52  ? 253 GLN A N   1 
ATOM   1745 C  CA  . GLN A 1 242 ? -48.681 -19.562 -0.333  1.00 70.29  ? 253 GLN A CA  1 
ATOM   1746 C  C   . GLN A 1 242 ? -50.076 -19.965 -0.691  1.00 69.72  ? 253 GLN A C   1 
ATOM   1747 O  O   . GLN A 1 242 ? -50.441 -21.122 -0.572  1.00 69.37  ? 253 GLN A O   1 
ATOM   1748 C  CB  . GLN A 1 242 ? -48.612 -19.428 1.190   1.00 71.28  ? 253 GLN A CB  1 
ATOM   1749 C  CG  . GLN A 1 242 ? -47.207 -19.420 1.708   1.00 72.06  ? 253 GLN A CG  1 
ATOM   1750 C  CD  . GLN A 1 242 ? -46.476 -20.660 1.265   1.00 71.72  ? 253 GLN A CD  1 
ATOM   1751 O  OE1 . GLN A 1 242 ? -46.724 -21.760 1.801   1.00 71.80  ? 253 GLN A OE1 1 
ATOM   1752 N  NE2 . GLN A 1 242 ? -45.568 -20.506 0.272   1.00 71.48  ? 253 GLN A NE2 1 
ATOM   1753 N  N   . ASP A 1 243 ? -50.861 -18.995 -1.110  1.00 69.82  ? 254 ASP A N   1 
ATOM   1754 C  CA  . ASP A 1 243 ? -52.282 -19.175 -1.128  1.00 69.71  ? 254 ASP A CA  1 
ATOM   1755 C  C   . ASP A 1 243 ? -52.868 -19.312 -2.517  1.00 69.13  ? 254 ASP A C   1 
ATOM   1756 O  O   . ASP A 1 243 ? -54.067 -19.648 -2.641  1.00 69.16  ? 254 ASP A O   1 
ATOM   1757 C  CB  . ASP A 1 243 ? -52.940 -18.020 -0.393  1.00 70.59  ? 254 ASP A CB  1 
ATOM   1758 C  CG  . ASP A 1 243 ? -52.722 -18.085 1.090   1.00 71.37  ? 254 ASP A CG  1 
ATOM   1759 O  OD1 . ASP A 1 243 ? -52.448 -19.203 1.607   1.00 71.26  ? 254 ASP A OD1 1 
ATOM   1760 O  OD2 . ASP A 1 243 ? -52.843 -17.011 1.729   1.00 72.27  ? 254 ASP A OD2 1 
ATOM   1761 N  N   . HIS A 1 244 ? -52.039 -19.045 -3.546  1.00 68.82  ? 255 HIS A N   1 
ATOM   1762 C  CA  . HIS A 1 244 ? -52.443 -19.291 -4.934  1.00 68.46  ? 255 HIS A CA  1 
ATOM   1763 C  C   . HIS A 1 244 ? -53.146 -20.648 -4.988  1.00 67.98  ? 255 HIS A C   1 
ATOM   1764 O  O   . HIS A 1 244 ? -52.521 -21.693 -4.741  1.00 67.61  ? 255 HIS A O   1 
ATOM   1765 C  CB  . HIS A 1 244 ? -51.230 -19.286 -5.863  1.00 68.40  ? 255 HIS A CB  1 
ATOM   1766 C  CG  . HIS A 1 244 ? -51.558 -18.866 -7.262  1.00 68.50  ? 255 HIS A CG  1 
ATOM   1767 N  ND1 . HIS A 1 244 ? -50.926 -17.811 -7.900  1.00 69.08  ? 255 HIS A ND1 1 
ATOM   1768 C  CD2 . HIS A 1 244 ? -52.493 -19.325 -8.132  1.00 68.31  ? 255 HIS A CD2 1 
ATOM   1769 C  CE1 . HIS A 1 244 ? -51.443 -17.644 -9.107  1.00 69.29  ? 255 HIS A CE1 1 
ATOM   1770 N  NE2 . HIS A 1 244 ? -52.400 -18.546 -9.271  1.00 68.84  ? 255 HIS A NE2 1 
ATOM   1771 N  N   . LYS A 1 245 ? -54.462 -20.611 -5.239  1.00 68.15  ? 256 LYS A N   1 
ATOM   1772 C  CA  . LYS A 1 245 ? -55.284 -21.823 -5.198  1.00 67.90  ? 256 LYS A CA  1 
ATOM   1773 C  C   . LYS A 1 245 ? -55.000 -22.686 -6.428  1.00 67.43  ? 256 LYS A C   1 
ATOM   1774 O  O   . LYS A 1 245 ? -55.398 -23.856 -6.513  1.00 67.14  ? 256 LYS A O   1 
ATOM   1775 C  CB  . LYS A 1 245 ? -56.777 -21.470 -5.092  1.00 68.46  ? 256 LYS A CB  1 
ATOM   1776 C  CG  . LYS A 1 245 ? -57.278 -21.410 -3.650  1.00 69.05  ? 256 LYS A CG  1 
ATOM   1777 C  CD  . LYS A 1 245 ? -58.779 -21.065 -3.542  1.00 69.86  ? 256 LYS A CD  1 
ATOM   1778 C  CE  . LYS A 1 245 ? -59.016 -19.574 -3.147  1.00 70.74  ? 256 LYS A CE  1 
ATOM   1779 N  NZ  . LYS A 1 245 ? -60.430 -19.142 -3.484  1.00 71.69  ? 256 LYS A NZ  1 
ATOM   1780 N  N   . ARG A 1 246 ? -54.299 -22.091 -7.384  1.00 67.52  ? 257 ARG A N   1 
ATOM   1781 C  CA  . ARG A 1 246 ? -54.164 -22.707 -8.668  1.00 67.39  ? 257 ARG A CA  1 
ATOM   1782 C  C   . ARG A 1 246 ? -52.763 -23.258 -8.826  1.00 67.09  ? 257 ARG A C   1 
ATOM   1783 O  O   . ARG A 1 246 ? -52.563 -24.272 -9.492  1.00 66.91  ? 257 ARG A O   1 
ATOM   1784 C  CB  . ARG A 1 246 ? -54.507 -21.693 -9.749  1.00 67.98  ? 257 ARG A CB  1 
ATOM   1785 C  CG  . ARG A 1 246 ? -55.211 -22.302 -10.912 1.00 68.22  ? 257 ARG A CG  1 
ATOM   1786 C  CD  . ARG A 1 246 ? -55.856 -21.234 -11.760 1.00 69.08  ? 257 ARG A CD  1 
ATOM   1787 N  NE  . ARG A 1 246 ? -54.842 -20.416 -12.414 1.00 69.49  ? 257 ARG A NE  1 
ATOM   1788 C  CZ  . ARG A 1 246 ? -54.693 -19.114 -12.216 1.00 69.94  ? 257 ARG A CZ  1 
ATOM   1789 N  NH1 . ARG A 1 246 ? -55.529 -18.462 -11.390 1.00 70.05  ? 257 ARG A NH1 1 
ATOM   1790 N  NH2 . ARG A 1 246 ? -53.715 -18.474 -12.853 1.00 70.44  ? 257 ARG A NH2 1 
ATOM   1791 N  N   . CYS A 1 247 ? -51.790 -22.582 -8.218  1.00 67.21  ? 258 CYS A N   1 
ATOM   1792 C  CA  . CYS A 1 247 ? -50.414 -23.078 -8.234  1.00 67.17  ? 258 CYS A CA  1 
ATOM   1793 C  C   . CYS A 1 247 ? -50.340 -24.314 -7.384  1.00 66.84  ? 258 CYS A C   1 
ATOM   1794 O  O   . CYS A 1 247 ? -49.786 -25.337 -7.808  1.00 66.76  ? 258 CYS A O   1 
ATOM   1795 C  CB  . CYS A 1 247 ? -49.421 -22.035 -7.738  1.00 67.61  ? 258 CYS A CB  1 
ATOM   1796 S  SG  . CYS A 1 247 ? -49.120 -20.856 -9.034  1.00 68.23  ? 258 CYS A SG  1 
ATOM   1797 N  N   . PHE A 1 248 ? -50.931 -24.216 -6.196  1.00 66.84  ? 259 PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 248 ? -50.988 -25.336 -5.288  1.00 66.75  ? 259 PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 248 ? -51.590 -26.539 -5.996  1.00 66.43  ? 259 PHE A C   1 
ATOM   1800 O  O   . PHE A 1 248 ? -51.000 -27.618 -6.004  1.00 66.38  ? 259 PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 248 ? -51.821 -24.956 -4.084  1.00 67.03  ? 259 PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 248 ? -51.494 -25.727 -2.854  1.00 67.34  ? 259 PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 248 ? -50.318 -25.475 -2.151  1.00 67.76  ? 259 PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 248 ? -52.378 -26.685 -2.374  1.00 67.42  ? 259 PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 248 ? -50.014 -26.181 -0.987  1.00 68.30  ? 259 PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 248 ? -52.097 -27.417 -1.207  1.00 67.93  ? 259 PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 248 ? -50.915 -27.163 -0.510  1.00 68.40  ? 259 PHE A CZ  1 
ATOM   1808 N  N   . ALA A 1 249 ? -52.752 -26.326 -6.615  1.00 66.37  ? 260 ALA A N   1 
ATOM   1809 C  CA  . ALA A 1 249 ? -53.470 -27.359 -7.364  1.00 66.24  ? 260 ALA A CA  1 
ATOM   1810 C  C   . ALA A 1 249 ? -52.558 -28.142 -8.319  1.00 66.15  ? 260 ALA A C   1 
ATOM   1811 O  O   . ALA A 1 249 ? -52.503 -29.370 -8.342  1.00 66.08  ? 260 ALA A O   1 
ATOM   1812 C  CB  . ALA A 1 249 ? -54.571 -26.699 -8.142  1.00 66.46  ? 260 ALA A CB  1 
ATOM   1813 N  N   . HIS A 1 250 ? -51.837 -27.388 -9.115  1.00 66.30  ? 261 HIS A N   1 
ATOM   1814 C  CA  . HIS A 1 250 ? -50.906 -27.949 -10.031 1.00 66.47  ? 261 HIS A CA  1 
ATOM   1815 C  C   . HIS A 1 250 ? -49.757 -28.640 -9.316  1.00 66.50  ? 261 HIS A C   1 
ATOM   1816 O  O   . HIS A 1 250 ? -49.193 -29.624 -9.825  1.00 66.67  ? 261 HIS A O   1 
ATOM   1817 C  CB  . HIS A 1 250 ? -50.335 -26.833 -10.858 1.00 66.89  ? 261 HIS A CB  1 
ATOM   1818 C  CG  . HIS A 1 250 ? -49.265 -27.289 -11.778 1.00 67.33  ? 261 HIS A CG  1 
ATOM   1819 N  ND1 . HIS A 1 250 ? -49.418 -28.390 -12.588 1.00 67.50  ? 261 HIS A ND1 1 
ATOM   1820 C  CD2 . HIS A 1 250 ? -48.023 -26.812 -12.010 1.00 67.84  ? 261 HIS A CD2 1 
ATOM   1821 C  CE1 . HIS A 1 250 ? -48.318 -28.559 -13.299 1.00 68.10  ? 261 HIS A CE1 1 
ATOM   1822 N  NE2 . HIS A 1 250 ? -47.454 -27.619 -12.963 1.00 68.33  ? 261 HIS A NE2 1 
ATOM   1823 N  N   . TYR A 1 251 ? -49.389 -28.089 -8.156  1.00 66.53  ? 262 TYR A N   1 
ATOM   1824 C  CA  . TYR A 1 251 ? -48.253 -28.579 -7.386  1.00 66.82  ? 262 TYR A CA  1 
ATOM   1825 C  C   . TYR A 1 251 ? -48.538 -29.959 -6.824  1.00 66.78  ? 262 TYR A C   1 
ATOM   1826 O  O   . TYR A 1 251 ? -47.696 -30.844 -6.951  1.00 67.14  ? 262 TYR A O   1 
ATOM   1827 C  CB  . TYR A 1 251 ? -47.862 -27.582 -6.300  1.00 67.06  ? 262 TYR A CB  1 
ATOM   1828 C  CG  . TYR A 1 251 ? -46.998 -28.120 -5.179  1.00 67.58  ? 262 TYR A CG  1 
ATOM   1829 C  CD1 . TYR A 1 251 ? -45.628 -28.274 -5.338  1.00 68.20  ? 262 TYR A CD1 1 
ATOM   1830 C  CD2 . TYR A 1 251 ? -47.550 -28.431 -3.947  1.00 67.69  ? 262 TYR A CD2 1 
ATOM   1831 C  CE1 . TYR A 1 251 ? -44.833 -28.744 -4.307  1.00 68.91  ? 262 TYR A CE1 1 
ATOM   1832 C  CE2 . TYR A 1 251 ? -46.774 -28.904 -2.915  1.00 68.41  ? 262 TYR A CE2 1 
ATOM   1833 C  CZ  . TYR A 1 251 ? -45.417 -29.057 -3.099  1.00 69.01  ? 262 TYR A CZ  1 
ATOM   1834 O  OH  . TYR A 1 251 ? -44.656 -29.526 -2.050  1.00 69.96  ? 262 TYR A OH  1 
ATOM   1835 N  N   . LYS A 1 252 ? -49.723 -30.171 -6.257  1.00 66.53  ? 263 LYS A N   1 
ATOM   1836 C  CA  . LYS A 1 252 ? -50.080 -31.514 -5.784  1.00 66.63  ? 263 LYS A CA  1 
ATOM   1837 C  C   . LYS A 1 252 ? -49.836 -32.475 -6.936  1.00 66.62  ? 263 LYS A C   1 
ATOM   1838 O  O   . LYS A 1 252 ? -49.397 -33.602 -6.739  1.00 66.94  ? 263 LYS A O   1 
ATOM   1839 C  CB  . LYS A 1 252 ? -51.555 -31.620 -5.382  1.00 66.50  ? 263 LYS A CB  1 
ATOM   1840 C  CG  . LYS A 1 252 ? -52.138 -30.476 -4.544  1.00 66.60  ? 263 LYS A CG  1 
ATOM   1841 C  CD  . LYS A 1 252 ? -52.037 -30.722 -3.041  1.00 67.17  ? 263 LYS A CD  1 
ATOM   1842 C  CE  . LYS A 1 252 ? -53.206 -31.595 -2.497  1.00 67.48  ? 263 LYS A CE  1 
ATOM   1843 N  NZ  . LYS A 1 252 ? -53.015 -32.035 -1.032  1.00 68.31  ? 263 LYS A NZ  1 
ATOM   1844 N  N   . GLN A 1 253 ? -50.100 -31.999 -8.152  1.00 66.43  ? 264 GLN A N   1 
ATOM   1845 C  CA  . GLN A 1 253 ? -50.088 -32.852 -9.328  1.00 66.59  ? 264 GLN A CA  1 
ATOM   1846 C  C   . GLN A 1 253 ? -48.686 -33.278 -9.676  1.00 67.06  ? 264 GLN A C   1 
ATOM   1847 O  O   . GLN A 1 253 ? -48.375 -34.480 -9.636  1.00 67.36  ? 264 GLN A O   1 
ATOM   1848 C  CB  . GLN A 1 253 ? -50.733 -32.144 -10.534 1.00 66.56  ? 264 GLN A CB  1 
ATOM   1849 C  CG  . GLN A 1 253 ? -50.684 -32.941 -11.845 1.00 66.94  ? 264 GLN A CG  1 
ATOM   1850 C  CD  . GLN A 1 253 ? -51.541 -34.189 -11.799 1.00 66.97  ? 264 GLN A CD  1 
ATOM   1851 O  OE1 . GLN A 1 253 ? -52.185 -34.485 -10.776 1.00 66.71  ? 264 GLN A OE1 1 
ATOM   1852 N  NE2 . GLN A 1 253 ? -51.561 -34.932 -12.913 1.00 67.45  ? 264 GLN A NE2 1 
ATOM   1853 N  N   . VAL A 1 254 ? -47.849 -32.300 -10.038 1.00 67.28  ? 265 VAL A N   1 
ATOM   1854 C  CA  . VAL A 1 254 ? -46.494 -32.622 -10.470 1.00 67.98  ? 265 VAL A CA  1 
ATOM   1855 C  C   . VAL A 1 254 ? -45.794 -33.390 -9.376  1.00 68.32  ? 265 VAL A C   1 
ATOM   1856 O  O   . VAL A 1 254 ? -45.094 -34.351 -9.674  1.00 68.93  ? 265 VAL A O   1 
ATOM   1857 C  CB  . VAL A 1 254 ? -45.649 -31.409 -10.850 1.00 68.39  ? 265 VAL A CB  1 
ATOM   1858 C  CG1 . VAL A 1 254 ? -46.069 -30.893 -12.171 1.00 68.56  ? 265 VAL A CG1 1 
ATOM   1859 C  CG2 . VAL A 1 254 ? -45.808 -30.319 -9.802  1.00 68.03  ? 265 VAL A CG2 1 
ATOM   1860 N  N   . LYS A 1 255 ? -46.005 -32.997 -8.122  1.00 68.10  ? 266 LYS A N   1 
ATOM   1861 C  CA  . LYS A 1 255 ? -45.302 -33.640 -7.042  1.00 68.68  ? 266 LYS A CA  1 
ATOM   1862 C  C   . LYS A 1 255 ? -45.561 -35.131 -7.165  1.00 68.84  ? 266 LYS A C   1 
ATOM   1863 O  O   . LYS A 1 255 ? -44.646 -35.933 -7.422  1.00 69.60  ? 266 LYS A O   1 
ATOM   1864 C  CB  . LYS A 1 255 ? -45.774 -33.101 -5.707  1.00 68.54  ? 266 LYS A CB  1 
ATOM   1865 C  CG  . LYS A 1 255 ? -44.944 -33.538 -4.509  1.00 69.41  ? 266 LYS A CG  1 
ATOM   1866 C  CD  . LYS A 1 255 ? -44.929 -32.436 -3.429  1.00 69.61  ? 266 LYS A CD  1 
ATOM   1867 C  CE  . LYS A 1 255 ? -46.108 -32.509 -2.460  1.00 69.26  ? 266 LYS A CE  1 
ATOM   1868 N  NZ  . LYS A 1 255 ? -45.900 -33.417 -1.254  1.00 70.15  ? 266 LYS A NZ  1 
ATOM   1869 N  N   . LYS A 1 256 ? -46.834 -35.479 -7.045  1.00 68.24  ? 267 LYS A N   1 
ATOM   1870 C  CA  . LYS A 1 256 ? -47.303 -36.853 -7.139  1.00 68.41  ? 267 LYS A CA  1 
ATOM   1871 C  C   . LYS A 1 256 ? -46.730 -37.549 -8.346  1.00 68.80  ? 267 LYS A C   1 
ATOM   1872 O  O   . LYS A 1 256 ? -46.342 -38.714 -8.265  1.00 69.42  ? 267 LYS A O   1 
ATOM   1873 C  CB  . LYS A 1 256 ? -48.819 -36.847 -7.250  1.00 67.80  ? 267 LYS A CB  1 
ATOM   1874 C  CG  . LYS A 1 256 ? -49.479 -38.176 -7.523  1.00 68.01  ? 267 LYS A CG  1 
ATOM   1875 C  CD  . LYS A 1 256 ? -50.987 -37.940 -7.592  1.00 67.57  ? 267 LYS A CD  1 
ATOM   1876 C  CE  . LYS A 1 256 ? -51.768 -39.210 -7.839  1.00 67.92  ? 267 LYS A CE  1 
ATOM   1877 N  NZ  . LYS A 1 256 ? -52.407 -39.724 -6.608  1.00 68.23  ? 267 LYS A NZ  1 
ATOM   1878 N  N   . LEU A 1 257 ? -46.672 -36.830 -9.462  1.00 68.63  ? 268 LEU A N   1 
ATOM   1879 C  CA  . LEU A 1 257 ? -46.314 -37.450 -10.724 1.00 69.16  ? 268 LEU A CA  1 
ATOM   1880 C  C   . LEU A 1 257 ? -44.806 -37.632 -10.862 1.00 70.13  ? 268 LEU A C   1 
ATOM   1881 O  O   . LEU A 1 257 ? -44.328 -38.608 -11.429 1.00 70.89  ? 268 LEU A O   1 
ATOM   1882 C  CB  . LEU A 1 257 ? -46.900 -36.658 -11.877 1.00 68.91  ? 268 LEU A CB  1 
ATOM   1883 C  CG  . LEU A 1 257 ? -47.024 -37.436 -13.174 1.00 69.49  ? 268 LEU A CG  1 
ATOM   1884 C  CD1 . LEU A 1 257 ? -48.224 -36.993 -13.882 1.00 69.17  ? 268 LEU A CD1 1 
ATOM   1885 C  CD2 . LEU A 1 257 ? -45.854 -37.106 -14.023 1.00 70.39  ? 268 LEU A CD2 1 
ATOM   1886 N  N   . ASN A 1 258 ? -44.060 -36.689 -10.318 1.00 70.27  ? 269 ASN A N   1 
ATOM   1887 C  CA  . ASN A 1 258 ? -42.629 -36.798 -10.303 1.00 71.38  ? 269 ASN A CA  1 
ATOM   1888 C  C   . ASN A 1 258 ? -42.202 -37.892 -9.336  1.00 72.00  ? 269 ASN A C   1 
ATOM   1889 O  O   . ASN A 1 258 ? -41.386 -38.765 -9.674  1.00 73.06  ? 269 ASN A O   1 
ATOM   1890 C  CB  . ASN A 1 258 ? -42.038 -35.473 -9.864  1.00 71.44  ? 269 ASN A CB  1 
ATOM   1891 C  CG  . ASN A 1 258 ? -40.547 -35.524 -9.774  1.00 72.78  ? 269 ASN A CG  1 
ATOM   1892 O  OD1 . ASN A 1 258 ? -39.863 -35.672 -10.797 1.00 73.25  ? 269 ASN A OD1 1 
ATOM   1893 N  ND2 . ASN A 1 258 ? -40.019 -35.425 -8.550  1.00 73.64  ? 269 ASN A ND2 1 
ATOM   1894 N  N   . LYS A 1 259 ? -42.777 -37.837 -8.133  1.00 71.51  ? 270 LYS A N   1 
ATOM   1895 C  CA  . LYS A 1 259 ? -42.497 -38.820 -7.079  1.00 72.22  ? 270 LYS A CA  1 
ATOM   1896 C  C   . LYS A 1 259 ? -42.535 -40.243 -7.619  1.00 72.76  ? 270 LYS A C   1 
ATOM   1897 O  O   . LYS A 1 259 ? -41.781 -41.110 -7.182  1.00 73.86  ? 270 LYS A O   1 
ATOM   1898 C  CB  . LYS A 1 259 ? -43.488 -38.684 -5.923  1.00 71.60  ? 270 LYS A CB  1 
ATOM   1899 C  CG  . LYS A 1 259 ? -42.972 -39.275 -4.657  1.00 72.62  ? 270 LYS A CG  1 
ATOM   1900 C  CD  . LYS A 1 259 ? -44.002 -39.229 -3.547  1.00 72.28  ? 270 LYS A CD  1 
ATOM   1901 C  CE  . LYS A 1 259 ? -43.378 -39.777 -2.230  1.00 73.67  ? 270 LYS A CE  1 
ATOM   1902 N  NZ  . LYS A 1 259 ? -44.270 -39.916 -1.007  1.00 73.85  ? 270 LYS A NZ  1 
ATOM   1903 N  N   . LEU A 1 260 ? -43.422 -40.453 -8.581  1.00 72.10  ? 271 LEU A N   1 
ATOM   1904 C  CA  . LEU A 1 260 ? -43.708 -41.769 -9.086  1.00 72.51  ? 271 LEU A CA  1 
ATOM   1905 C  C   . LEU A 1 260 ? -42.682 -42.203 -10.114 1.00 73.57  ? 271 LEU A C   1 
ATOM   1906 O  O   . LEU A 1 260 ? -42.153 -43.318 -10.056 1.00 74.65  ? 271 LEU A O   1 
ATOM   1907 C  CB  . LEU A 1 260 ? -45.109 -41.794 -9.680  1.00 71.54  ? 271 LEU A CB  1 
ATOM   1908 C  CG  . LEU A 1 260 ? -46.200 -42.140 -8.662  1.00 71.12  ? 271 LEU A CG  1 
ATOM   1909 C  CD1 . LEU A 1 260 ? -47.569 -41.954 -9.288  1.00 70.32  ? 271 LEU A CD1 1 
ATOM   1910 C  CD2 . LEU A 1 260 ? -46.050 -43.563 -8.130  1.00 72.07  ? 271 LEU A CD2 1 
ATOM   1911 N  N   . ILE A 1 261 ? -42.402 -41.300 -11.044 1.00 73.42  ? 272 ILE A N   1 
ATOM   1912 C  CA  . ILE A 1 261 ? -41.453 -41.549 -12.097 1.00 74.59  ? 272 ILE A CA  1 
ATOM   1913 C  C   . ILE A 1 261 ? -40.061 -41.564 -11.517 1.00 75.84  ? 272 ILE A C   1 
ATOM   1914 O  O   . ILE A 1 261 ? -39.234 -42.358 -11.930 1.00 77.22  ? 272 ILE A O   1 
ATOM   1915 C  CB  . ILE A 1 261 ? -41.528 -40.481 -13.160 1.00 74.35  ? 272 ILE A CB  1 
ATOM   1916 C  CG1 . ILE A 1 261 ? -42.949 -40.349 -13.685 1.00 73.27  ? 272 ILE A CG1 1 
ATOM   1917 C  CG2 . ILE A 1 261 ? -40.626 -40.834 -14.292 1.00 75.81  ? 272 ILE A CG2 1 
ATOM   1918 C  CD1 . ILE A 1 261 ? -43.150 -39.192 -14.596 1.00 73.18  ? 272 ILE A CD1 1 
ATOM   1919 N  N   . GLU A 1 262 ? -39.792 -40.694 -10.551 1.00 75.53  ? 273 GLU A N   1 
ATOM   1920 C  CA  . GLU A 1 262 ? -38.456 -40.683 -9.955  1.00 76.92  ? 273 GLU A CA  1 
ATOM   1921 C  C   . GLU A 1 262 ? -38.290 -41.989 -9.176  1.00 77.81  ? 273 GLU A C   1 
ATOM   1922 O  O   . GLU A 1 262 ? -37.210 -42.572 -9.140  1.00 79.45  ? 273 GLU A O   1 
ATOM   1923 C  CB  . GLU A 1 262 ? -38.225 -39.448 -9.071  1.00 76.54  ? 273 GLU A CB  1 
ATOM   1924 C  CG  . GLU A 1 262 ? -36.918 -38.660 -9.392  1.00 77.72  ? 273 GLU A CG  1 
ATOM   1925 C  CD  . GLU A 1 262 ? -36.752 -37.327 -8.566  1.00 77.41  ? 273 GLU A CD  1 
ATOM   1926 O  OE1 . GLU A 1 262 ? -36.751 -37.386 -7.298  1.00 77.66  ? 273 GLU A OE1 1 
ATOM   1927 O  OE2 . GLU A 1 262 ? -36.603 -36.220 -9.186  1.00 77.07  ? 273 GLU A OE2 1 
ATOM   1928 N  N   . SER A 1 263 ? -39.383 -42.466 -8.598  1.00 76.90  ? 274 SER A N   1 
ATOM   1929 C  CA  . SER A 1 263 ? -39.373 -43.727 -7.911  1.00 77.76  ? 274 SER A CA  1 
ATOM   1930 C  C   . SER A 1 263 ? -39.154 -44.869 -8.902  1.00 78.62  ? 274 SER A C   1 
ATOM   1931 O  O   . SER A 1 263 ? -38.245 -45.687 -8.737  1.00 80.20  ? 274 SER A O   1 
ATOM   1932 C  CB  . SER A 1 263 ? -40.696 -43.902 -7.206  1.00 76.62  ? 274 SER A CB  1 
ATOM   1933 O  OG  . SER A 1 263 ? -40.627 -44.962 -6.282  1.00 77.65  ? 274 SER A OG  1 
ATOM   1934 N  N   . ALA A 1 264 ? -39.983 -44.912 -9.946  1.00 77.75  ? 275 ALA A N   1 
ATOM   1935 C  CA  . ALA A 1 264 ? -39.883 -45.947 -10.990 1.00 78.59  ? 275 ALA A CA  1 
ATOM   1936 C  C   . ALA A 1 264 ? -38.463 -46.100 -11.506 1.00 80.36  ? 275 ALA A C   1 
ATOM   1937 O  O   . ALA A 1 264 ? -37.910 -47.189 -11.445 1.00 81.78  ? 275 ALA A O   1 
ATOM   1938 C  CB  . ALA A 1 264 ? -40.831 -45.670 -12.128 1.00 77.56  ? 275 ALA A CB  1 
ATOM   1939 N  N   . GLU A 1 265 ? -37.862 -45.012 -11.984 1.00 80.44  ? 276 GLU A N   1 
ATOM   1940 C  CA  . GLU A 1 265 ? -36.468 -45.054 -12.431 1.00 82.34  ? 276 GLU A CA  1 
ATOM   1941 C  C   . GLU A 1 265 ? -35.521 -45.719 -11.433 1.00 83.88  ? 276 GLU A C   1 
ATOM   1942 O  O   . GLU A 1 265 ? -34.624 -46.468 -11.821 1.00 85.74  ? 276 GLU A O   1 
ATOM   1943 C  CB  . GLU A 1 265 ? -35.942 -43.668 -12.749 1.00 82.26  ? 276 GLU A CB  1 
ATOM   1944 C  CG  . GLU A 1 265 ? -36.560 -43.060 -13.975 1.00 81.45  ? 276 GLU A CG  1 
ATOM   1945 C  CD  . GLU A 1 265 ? -36.520 -43.972 -15.185 1.00 82.41  ? 276 GLU A CD  1 
ATOM   1946 O  OE1 . GLU A 1 265 ? -35.529 -44.720 -15.342 1.00 84.27  ? 276 GLU A OE1 1 
ATOM   1947 O  OE2 . GLU A 1 265 ? -37.482 -43.925 -15.984 1.00 81.44  ? 276 GLU A OE2 1 
ATOM   1948 N  N   . GLU A 1 266 ? -35.706 -45.455 -10.144 1.00 83.30  ? 277 GLU A N   1 
ATOM   1949 C  CA  . GLU A 1 266 ? -34.786 -46.008 -9.180  1.00 84.97  ? 277 GLU A CA  1 
ATOM   1950 C  C   . GLU A 1 266 ? -34.956 -47.505 -9.121  1.00 85.93  ? 277 GLU A C   1 
ATOM   1951 O  O   . GLU A 1 266 ? -33.989 -48.240 -8.876  1.00 88.01  ? 277 GLU A O   1 
ATOM   1952 C  CB  . GLU A 1 266 ? -34.993 -45.406 -7.811  1.00 84.31  ? 277 GLU A CB  1 
ATOM   1953 C  CG  . GLU A 1 266 ? -33.861 -45.739 -6.865  1.00 86.39  ? 277 GLU A CG  1 
ATOM   1954 C  CD  . GLU A 1 266 ? -34.011 -45.023 -5.550  1.00 85.94  ? 277 GLU A CD  1 
ATOM   1955 O  OE1 . GLU A 1 266 ? -35.006 -44.256 -5.438  1.00 83.95  ? 277 GLU A OE1 1 
ATOM   1956 O  OE2 . GLU A 1 266 ? -33.154 -45.222 -4.639  1.00 87.73  ? 277 GLU A OE2 1 
ATOM   1957 N  N   . LEU A 1 267 ? -36.182 -47.958 -9.363  1.00 84.58  ? 278 LEU A N   1 
ATOM   1958 C  CA  . LEU A 1 267 ? -36.459 -49.394 -9.377  1.00 85.44  ? 278 LEU A CA  1 
ATOM   1959 C  C   . LEU A 1 267 ? -35.905 -50.056 -10.641 1.00 86.79  ? 278 LEU A C   1 
ATOM   1960 O  O   . LEU A 1 267 ? -35.583 -51.250 -10.621 1.00 88.39  ? 278 LEU A O   1 
ATOM   1961 C  CB  . LEU A 1 267 ? -37.959 -49.667 -9.203  1.00 83.77  ? 278 LEU A CB  1 
ATOM   1962 C  CG  . LEU A 1 267 ? -38.480 -49.074 -7.895  1.00 82.79  ? 278 LEU A CG  1 
ATOM   1963 C  CD1 . LEU A 1 267 ? -39.855 -48.461 -8.054  1.00 80.73  ? 278 LEU A CD1 1 
ATOM   1964 C  CD2 . LEU A 1 267 ? -38.444 -50.096 -6.779  1.00 84.07  ? 278 LEU A CD2 1 
ATOM   1965 N  N   . ILE A 1 268 ? -35.782 -49.283 -11.724 1.00 86.34  ? 279 ILE A N   1 
ATOM   1966 C  CA  . ILE A 1 268 ? -35.191 -49.821 -12.940 1.00 87.89  ? 279 ILE A CA  1 
ATOM   1967 C  C   . ILE A 1 268 ? -33.681 -49.893 -12.794 1.00 90.20  ? 279 ILE A C   1 
ATOM   1968 O  O   . ILE A 1 268 ? -33.021 -50.656 -13.494 1.00 92.13  ? 279 ILE A O   1 
ATOM   1969 C  CB  . ILE A 1 268 ? -35.628 -49.087 -14.238 1.00 87.09  ? 279 ILE A CB  1 
ATOM   1970 C  CG1 . ILE A 1 268 ? -35.018 -47.698 -14.354 1.00 87.34  ? 279 ILE A CG1 1 
ATOM   1971 C  CG2 . ILE A 1 268 ? -37.132 -48.963 -14.312 1.00 84.84  ? 279 ILE A CG2 1 
ATOM   1972 C  CD1 . ILE A 1 268 ? -33.707 -47.606 -15.176 1.00 89.79  ? 279 ILE A CD1 1 
ATOM   1973 N  N   . ARG A 1 269 ? -33.146 -49.105 -11.864 1.00 90.19  ? 280 ARG A N   1 
ATOM   1974 C  CA  . ARG A 1 269 ? -31.727 -49.165 -11.552 1.00 92.57  ? 280 ARG A CA  1 
ATOM   1975 C  C   . ARG A 1 269 ? -31.416 -50.362 -10.674 1.00 94.16  ? 280 ARG A C   1 
ATOM   1976 O  O   . ARG A 1 269 ? -30.291 -50.869 -10.675 1.00 96.66  ? 280 ARG A O   1 
ATOM   1977 C  CB  . ARG A 1 269 ? -31.239 -47.896 -10.874 1.00 92.34  ? 280 ARG A CB  1 
ATOM   1978 C  CG  . ARG A 1 269 ? -29.718 -47.721 -11.008 1.00 95.11  ? 280 ARG A CG  1 
ATOM   1979 C  CD  . ARG A 1 269 ? -29.258 -46.306 -10.639 1.00 94.99  ? 280 ARG A CD  1 
ATOM   1980 N  NE  . ARG A 1 269 ? -30.168 -45.298 -11.196 1.00 92.66  ? 280 ARG A NE  1 
ATOM   1981 C  CZ  . ARG A 1 269 ? -31.051 -44.594 -10.482 1.00 90.43  ? 280 ARG A CZ  1 
ATOM   1982 N  NH1 . ARG A 1 269 ? -31.140 -44.760 -9.157  1.00 90.20  ? 280 ARG A NH1 1 
ATOM   1983 N  NH2 . ARG A 1 269 ? -31.841 -43.719 -11.102 1.00 88.64  ? 280 ARG A NH2 1 
ATOM   1984 N  N   . ASP A 1 270 ? -32.411 -50.823 -9.929  1.00 92.90  ? 281 ASP A N   1 
ATOM   1985 C  CA  . ASP A 1 270 ? -32.220 -52.021 -9.131  1.00 94.40  ? 281 ASP A CA  1 
ATOM   1986 C  C   . ASP A 1 270 ? -32.668 -53.300 -9.828  1.00 95.09  ? 281 ASP A C   1 
ATOM   1987 O  O   . ASP A 1 270 ? -32.591 -54.393 -9.249  1.00 97.06  ? 281 ASP A O   1 
ATOM   1988 C  CB  . ASP A 1 270 ? -32.876 -51.857 -7.767  1.00 93.23  ? 281 ASP A CB  1 
ATOM   1989 C  CG  . ASP A 1 270 ? -32.220 -50.760 -6.957  1.00 93.37  ? 281 ASP A CG  1 
ATOM   1990 O  OD1 . ASP A 1 270 ? -30.979 -50.589 -7.093  1.00 95.23  ? 281 ASP A OD1 1 
ATOM   1991 O  OD2 . ASP A 1 270 ? -32.937 -50.055 -6.204  1.00 91.78  ? 281 ASP A OD2 1 
ATOM   1992 N  N   . GLY A 1 271 ? -33.115 -53.162 -11.078 1.00 93.69  ? 282 GLY A N   1 
ATOM   1993 C  CA  . GLY A 1 271 ? -33.626 -54.307 -11.821 1.00 94.42  ? 282 GLY A CA  1 
ATOM   1994 C  C   . GLY A 1 271 ? -34.902 -54.913 -11.248 1.00 92.95  ? 282 GLY A C   1 
ATOM   1995 O  O   . GLY A 1 271 ? -35.221 -56.073 -11.506 1.00 93.68  ? 282 GLY A O   1 
ATOM   1996 N  N   . ARG A 1 272 ? -35.635 -54.127 -10.469 1.00 91.01  ? 283 ARG A N   1 
ATOM   1997 C  CA  . ARG A 1 272 ? -36.926 -54.540 -9.965  1.00 89.57  ? 283 ARG A CA  1 
ATOM   1998 C  C   . ARG A 1 272 ? -37.956 -54.145 -11.008 1.00 87.90  ? 283 ARG A C   1 
ATOM   1999 O  O   . ARG A 1 272 ? -38.831 -53.311 -10.761 1.00 85.97  ? 283 ARG A O   1 
ATOM   2000 C  CB  . ARG A 1 272 ? -37.191 -53.873 -8.623  1.00 88.52  ? 283 ARG A CB  1 
ATOM   2001 C  CG  . ARG A 1 272 ? -36.095 -54.161 -7.610  1.00 90.48  ? 283 ARG A CG  1 
ATOM   2002 C  CD  . ARG A 1 272 ? -36.350 -53.478 -6.303  1.00 89.61  ? 283 ARG A CD  1 
ATOM   2003 N  NE  . ARG A 1 272 ? -37.643 -53.850 -5.739  1.00 88.80  ? 283 ARG A NE  1 
ATOM   2004 C  CZ  . ARG A 1 272 ? -38.203 -53.262 -4.681  1.00 88.16  ? 283 ARG A CZ  1 
ATOM   2005 N  NH1 . ARG A 1 272 ? -37.585 -52.258 -4.060  1.00 88.27  ? 283 ARG A NH1 1 
ATOM   2006 N  NH2 . ARG A 1 272 ? -39.389 -53.678 -4.238  1.00 87.57  ? 283 ARG A NH2 1 
ATOM   2007 N  N   . TYR A 1 273 ? -37.827 -54.761 -12.182 1.00 88.87  ? 284 TYR A N   1 
ATOM   2008 C  CA  . TYR A 1 273 ? -38.581 -54.402 -13.386 1.00 87.81  ? 284 TYR A CA  1 
ATOM   2009 C  C   . TYR A 1 273 ? -40.087 -54.465 -13.219 1.00 86.11  ? 284 TYR A C   1 
ATOM   2010 O  O   . TYR A 1 273 ? -40.795 -53.489 -13.484 1.00 84.47  ? 284 TYR A O   1 
ATOM   2011 C  CB  . TYR A 1 273 ? -38.117 -55.275 -14.550 1.00 89.65  ? 284 TYR A CB  1 
ATOM   2012 C  CG  . TYR A 1 273 ? -36.658 -55.059 -14.822 1.00 91.43  ? 284 TYR A CG  1 
ATOM   2013 C  CD1 . TYR A 1 273 ? -36.221 -53.873 -15.430 1.00 90.98  ? 284 TYR A CD1 1 
ATOM   2014 C  CD2 . TYR A 1 273 ? -35.704 -56.001 -14.429 1.00 93.72  ? 284 TYR A CD2 1 
ATOM   2015 C  CE1 . TYR A 1 273 ? -34.872 -53.642 -15.660 1.00 92.80  ? 284 TYR A CE1 1 
ATOM   2016 C  CE2 . TYR A 1 273 ? -34.351 -55.781 -14.656 1.00 95.58  ? 284 TYR A CE2 1 
ATOM   2017 C  CZ  . TYR A 1 273 ? -33.944 -54.596 -15.269 1.00 95.09  ? 284 TYR A CZ  1 
ATOM   2018 O  OH  . TYR A 1 273 ? -32.617 -54.346 -15.499 1.00 97.08  ? 284 TYR A OH  1 
ATOM   2019 N  N   . THR A 1 274 ? -40.562 -55.619 -12.762 1.00 86.73  ? 285 THR A N   1 
ATOM   2020 C  CA  . THR A 1 274 ? -41.976 -55.802 -12.498 1.00 85.55  ? 285 THR A CA  1 
ATOM   2021 C  C   . THR A 1 274 ? -42.490 -54.671 -11.601 1.00 83.68  ? 285 THR A C   1 
ATOM   2022 O  O   . THR A 1 274 ? -43.600 -54.180 -11.810 1.00 82.24  ? 285 THR A O   1 
ATOM   2023 C  CB  . THR A 1 274 ? -42.258 -57.156 -11.839 1.00 86.74  ? 285 THR A CB  1 
ATOM   2024 O  OG1 . THR A 1 274 ? -41.519 -57.242 -10.612 1.00 88.51  ? 285 THR A OG1 1 
ATOM   2025 C  CG2 . THR A 1 274 ? -41.824 -58.287 -12.749 1.00 87.05  ? 285 THR A CG2 1 
ATOM   2026 N  N   . ASP A 1 275 ? -41.686 -54.256 -10.622 1.00 83.91  ? 286 ASP A N   1 
ATOM   2027 C  CA  . ASP A 1 275 ? -42.085 -53.182 -9.734  1.00 82.44  ? 286 ASP A CA  1 
ATOM   2028 C  C   . ASP A 1 275 ? -42.089 -51.853 -10.447 1.00 81.14  ? 286 ASP A C   1 
ATOM   2029 O  O   . ASP A 1 275 ? -43.020 -51.058 -10.292 1.00 79.59  ? 286 ASP A O   1 
ATOM   2030 C  CB  . ASP A 1 275 ? -41.145 -53.106 -8.550  1.00 83.38  ? 286 ASP A CB  1 
ATOM   2031 C  CG  . ASP A 1 275 ? -41.355 -54.218 -7.609  1.00 84.57  ? 286 ASP A CG  1 
ATOM   2032 O  OD1 . ASP A 1 275 ? -42.223 -55.043 -7.932  1.00 84.52  ? 286 ASP A OD1 1 
ATOM   2033 O  OD2 . ASP A 1 275 ? -40.678 -54.267 -6.559  1.00 85.69  ? 286 ASP A OD2 1 
ATOM   2034 N  N   . ALA A 1 276 ? -41.040 -51.606 -11.218 1.00 81.97  ? 287 ALA A N   1 
ATOM   2035 C  CA  . ALA A 1 276 ? -40.993 -50.424 -12.058 1.00 81.10  ? 287 ALA A CA  1 
ATOM   2036 C  C   . ALA A 1 276 ? -42.208 -50.383 -12.993 1.00 80.06  ? 287 ALA A C   1 
ATOM   2037 O  O   . ALA A 1 276 ? -42.834 -49.324 -13.144 1.00 78.68  ? 287 ALA A O   1 
ATOM   2038 C  CB  . ALA A 1 276 ? -39.711 -50.383 -12.849 1.00 82.60  ? 287 ALA A CB  1 
ATOM   2039 N  N   . THR A 1 277 ? -42.557 -51.531 -13.585 1.00 80.86  ? 288 THR A N   1 
ATOM   2040 C  CA  . THR A 1 277 ? -43.682 -51.594 -14.507 1.00 80.19  ? 288 THR A CA  1 
ATOM   2041 C  C   . THR A 1 277 ? -44.946 -51.150 -13.813 1.00 78.62  ? 288 THR A C   1 
ATOM   2042 O  O   . THR A 1 277 ? -45.725 -50.362 -14.353 1.00 77.60  ? 288 THR A O   1 
ATOM   2043 C  CB  . THR A 1 277 ? -43.909 -52.992 -15.064 1.00 81.42  ? 288 THR A CB  1 
ATOM   2044 O  OG1 . THR A 1 277 ? -42.703 -53.476 -15.655 1.00 83.15  ? 288 THR A OG1 1 
ATOM   2045 C  CG2 . THR A 1 277 ? -44.978 -52.959 -16.125 1.00 81.02  ? 288 THR A CG2 1 
ATOM   2046 N  N   . SER A 1 278 ? -45.150 -51.654 -12.607 1.00 78.64  ? 289 SER A N   1 
ATOM   2047 C  CA  . SER A 1 278 ? -46.321 -51.286 -11.851 1.00 77.43  ? 289 SER A CA  1 
ATOM   2048 C  C   . SER A 1 278 ? -46.326 -49.786 -11.662 1.00 76.17  ? 289 SER A C   1 
ATOM   2049 O  O   . SER A 1 278 ? -47.304 -49.106 -11.993 1.00 75.10  ? 289 SER A O   1 
ATOM   2050 C  CB  . SER A 1 278 ? -46.330 -51.971 -10.494 1.00 77.98  ? 289 SER A CB  1 
ATOM   2051 O  OG  . SER A 1 278 ? -47.587 -51.761 -9.885  1.00 77.07  ? 289 SER A OG  1 
ATOM   2052 N  N   . LYS A 1 279 ? -45.214 -49.278 -11.151 1.00 76.45  ? 290 LYS A N   1 
ATOM   2053 C  CA  . LYS A 1 279 ? -45.097 -47.868 -10.879 1.00 75.44  ? 290 LYS A CA  1 
ATOM   2054 C  C   . LYS A 1 279 ? -45.564 -47.089 -12.081 1.00 74.72  ? 290 LYS A C   1 
ATOM   2055 O  O   . LYS A 1 279 ? -46.484 -46.294 -11.960 1.00 73.60  ? 290 LYS A O   1 
ATOM   2056 C  CB  . LYS A 1 279 ? -43.669 -47.500 -10.488 1.00 76.21  ? 290 LYS A CB  1 
ATOM   2057 C  CG  . LYS A 1 279 ? -43.356 -47.760 -9.025  1.00 76.65  ? 290 LYS A CG  1 
ATOM   2058 C  CD  . LYS A 1 279 ? -43.564 -46.503 -8.190  1.00 75.62  ? 290 LYS A CD  1 
ATOM   2059 C  CE  . LYS A 1 279 ? -43.948 -46.813 -6.725  1.00 75.86  ? 290 LYS A CE  1 
ATOM   2060 N  NZ  . LYS A 1 279 ? -43.861 -45.575 -5.876  1.00 75.14  ? 290 LYS A NZ  1 
ATOM   2061 N  N   . TYR A 1 280 ? -44.979 -47.361 -13.243 1.00 75.57  ? 291 TYR A N   1 
ATOM   2062 C  CA  . TYR A 1 280 ? -45.256 -46.579 -14.448 1.00 75.26  ? 291 TYR A CA  1 
ATOM   2063 C  C   . TYR A 1 280 ? -46.704 -46.634 -14.950 1.00 74.63  ? 291 TYR A C   1 
ATOM   2064 O  O   . TYR A 1 280 ? -47.145 -45.782 -15.737 1.00 74.21  ? 291 TYR A O   1 
ATOM   2065 C  CB  . TYR A 1 280 ? -44.303 -46.971 -15.566 1.00 76.69  ? 291 TYR A CB  1 
ATOM   2066 C  CG  . TYR A 1 280 ? -43.101 -46.059 -15.676 1.00 77.10  ? 291 TYR A CG  1 
ATOM   2067 C  CD1 . TYR A 1 280 ? -43.246 -44.703 -15.994 1.00 76.35  ? 291 TYR A CD1 1 
ATOM   2068 C  CD2 . TYR A 1 280 ? -41.807 -46.550 -15.470 1.00 78.42  ? 291 TYR A CD2 1 
ATOM   2069 C  CE1 . TYR A 1 280 ? -42.120 -43.860 -16.095 1.00 76.88  ? 291 TYR A CE1 1 
ATOM   2070 C  CE2 . TYR A 1 280 ? -40.681 -45.720 -15.569 1.00 79.01  ? 291 TYR A CE2 1 
ATOM   2071 C  CZ  . TYR A 1 280 ? -40.846 -44.387 -15.875 1.00 78.21  ? 291 TYR A CZ  1 
ATOM   2072 O  OH  . TYR A 1 280 ? -39.735 -43.586 -15.965 1.00 78.95  ? 291 TYR A OH  1 
ATOM   2073 N  N   . GLU A 1 281 ? -47.441 -47.638 -14.495 1.00 74.76  ? 292 GLU A N   1 
ATOM   2074 C  CA  . GLU A 1 281 ? -48.826 -47.756 -14.887 1.00 74.42  ? 292 GLU A CA  1 
ATOM   2075 C  C   . GLU A 1 281 ? -49.694 -46.866 -14.055 1.00 73.18  ? 292 GLU A C   1 
ATOM   2076 O  O   . GLU A 1 281 ? -50.752 -46.415 -14.508 1.00 72.76  ? 292 GLU A O   1 
ATOM   2077 C  CB  . GLU A 1 281 ? -49.294 -49.185 -14.829 1.00 75.16  ? 292 GLU A CB  1 
ATOM   2078 C  CG  . GLU A 1 281 ? -49.229 -49.801 -16.220 1.00 75.65  ? 292 GLU A CG  1 
ATOM   2079 C  CD  . GLU A 1 281 ? -49.351 -51.305 -16.172 1.00 76.98  ? 292 GLU A CD  1 
ATOM   2080 O  OE1 . GLU A 1 281 ? -49.828 -51.799 -15.125 1.00 77.59  ? 292 GLU A OE1 1 
ATOM   2081 O  OE2 . GLU A 1 281 ? -48.974 -52.005 -17.148 1.00 77.57  ? 292 GLU A OE2 1 
ATOM   2082 N  N   . SER A 1 282 ? -49.234 -46.605 -12.838 1.00 72.80  ? 293 SER A N   1 
ATOM   2083 C  CA  . SER A 1 282 ? -49.895 -45.652 -11.975 1.00 71.78  ? 293 SER A CA  1 
ATOM   2084 C  C   . SER A 1 282 ? -49.504 -44.287 -12.499 1.00 71.19  ? 293 SER A C   1 
ATOM   2085 O  O   . SER A 1 282 ? -50.250 -43.336 -12.368 1.00 70.43  ? 293 SER A O   1 
ATOM   2086 C  CB  . SER A 1 282 ? -49.496 -45.845 -10.508 1.00 71.83  ? 293 SER A CB  1 
ATOM   2087 O  OG  . SER A 1 282 ? -49.517 -47.227 -10.134 1.00 72.74  ? 293 SER A OG  1 
ATOM   2088 N  N   . VAL A 1 283 ? -48.354 -44.180 -13.141 1.00 71.71  ? 294 VAL A N   1 
ATOM   2089 C  CA  . VAL A 1 283 ? -48.004 -42.891 -13.708 1.00 71.35  ? 294 VAL A CA  1 
ATOM   2090 C  C   . VAL A 1 283 ? -49.019 -42.538 -14.775 1.00 71.22  ? 294 VAL A C   1 
ATOM   2091 O  O   . VAL A 1 283 ? -49.611 -41.463 -14.728 1.00 70.50  ? 294 VAL A O   1 
ATOM   2092 C  CB  . VAL A 1 283 ? -46.583 -42.836 -14.259 1.00 72.21  ? 294 VAL A CB  1 
ATOM   2093 C  CG1 . VAL A 1 283 ? -46.354 -41.506 -14.984 1.00 72.02  ? 294 VAL A CG1 1 
ATOM   2094 C  CG2 . VAL A 1 283 ? -45.577 -43.052 -13.115 1.00 72.50  ? 294 VAL A CG2 1 
HETATM 2095 N  N   . MSE A 1 284 ? -49.263 -43.459 -15.704 1.00 72.05  ? 295 MSE A N   1 
HETATM 2096 C  CA  . MSE A 1 284 ? -50.236 -43.206 -16.771 1.00 72.23  ? 295 MSE A CA  1 
HETATM 2097 C  C   . MSE A 1 284 ? -51.616 -42.919 -16.236 1.00 71.52  ? 295 MSE A C   1 
HETATM 2098 O  O   . MSE A 1 284 ? -52.355 -42.089 -16.767 1.00 71.43  ? 295 MSE A O   1 
HETATM 2099 C  CB  . MSE A 1 284 ? -50.301 -44.379 -17.714 1.00 73.41  ? 295 MSE A CB  1 
HETATM 2100 C  CG  . MSE A 1 284 ? -49.265 -44.271 -18.772 1.00 74.43  ? 295 MSE A CG  1 
HETATM 2101 SE SE  . MSE A 1 284 ? -48.847 -46.042 -19.412 1.00 76.02  ? 295 MSE A SE  1 
HETATM 2102 C  CE  . MSE A 1 284 ? -50.539 -46.500 -20.328 1.00 76.50  ? 295 MSE A CE  1 
ATOM   2103 N  N   . LYS A 1 285 ? -51.939 -43.630 -15.171 1.00 71.23  ? 296 LYS A N   1 
ATOM   2104 C  CA  . LYS A 1 285 ? -53.184 -43.478 -14.486 1.00 70.76  ? 296 LYS A CA  1 
ATOM   2105 C  C   . LYS A 1 285 ? -53.303 -42.073 -13.910 1.00 69.87  ? 296 LYS A C   1 
ATOM   2106 O  O   . LYS A 1 285 ? -54.359 -41.442 -14.021 1.00 69.68  ? 296 LYS A O   1 
ATOM   2107 C  CB  . LYS A 1 285 ? -53.268 -44.515 -13.369 1.00 70.91  ? 296 LYS A CB  1 
ATOM   2108 C  CG  . LYS A 1 285 ? -54.569 -45.276 -13.345 1.00 71.31  ? 296 LYS A CG  1 
ATOM   2109 C  CD  . LYS A 1 285 ? -54.678 -46.205 -14.540 1.00 72.29  ? 296 LYS A CD  1 
ATOM   2110 C  CE  . LYS A 1 285 ? -56.082 -46.737 -14.677 1.00 72.80  ? 296 LYS A CE  1 
ATOM   2111 N  NZ  . LYS A 1 285 ? -56.997 -45.758 -15.326 1.00 72.79  ? 296 LYS A NZ  1 
ATOM   2112 N  N   . THR A 1 286 ? -52.235 -41.559 -13.303 1.00 69.48  ? 297 THR A N   1 
ATOM   2113 C  CA  . THR A 1 286 ? -52.370 -40.234 -12.704 1.00 68.74  ? 297 THR A CA  1 
ATOM   2114 C  C   . THR A 1 286 ? -52.478 -39.142 -13.757 1.00 68.72  ? 297 THR A C   1 
ATOM   2115 O  O   . THR A 1 286 ? -53.255 -38.231 -13.573 1.00 68.32  ? 297 THR A O   1 
ATOM   2116 C  CB  . THR A 1 286 ? -51.319 -39.852 -11.599 1.00 68.44  ? 297 THR A CB  1 
ATOM   2117 O  OG1 . THR A 1 286 ? -50.104 -39.439 -12.214 1.00 68.66  ? 297 THR A OG1 1 
ATOM   2118 C  CG2 . THR A 1 286 ? -51.057 -40.982 -10.638 1.00 68.81  ? 297 THR A CG2 1 
ATOM   2119 N  N   . GLU A 1 287 ? -51.732 -39.230 -14.849 1.00 69.32  ? 298 GLU A N   1 
ATOM   2120 C  CA  . GLU A 1 287 ? -51.834 -38.198 -15.875 1.00 69.57  ? 298 GLU A CA  1 
ATOM   2121 C  C   . GLU A 1 287 ? -52.231 -38.740 -17.244 1.00 70.57  ? 298 GLU A C   1 
ATOM   2122 O  O   . GLU A 1 287 ? -51.397 -38.854 -18.150 1.00 71.36  ? 298 GLU A O   1 
ATOM   2123 C  CB  . GLU A 1 287 ? -50.549 -37.378 -15.943 1.00 69.59  ? 298 GLU A CB  1 
ATOM   2124 C  CG  . GLU A 1 287 ? -50.510 -36.259 -16.996 1.00 70.01  ? 298 GLU A CG  1 
ATOM   2125 C  CD  . GLU A 1 287 ? -51.846 -35.566 -17.189 1.00 69.85  ? 298 GLU A CD  1 
ATOM   2126 O  OE1 . GLU A 1 287 ? -52.344 -34.877 -16.258 1.00 69.10  ? 298 GLU A OE1 1 
ATOM   2127 O  OE2 . GLU A 1 287 ? -52.387 -35.736 -18.298 1.00 70.67  ? 298 GLU A OE2 1 
ATOM   2128 N  N   . PRO A 1 288 ? -53.524 -39.029 -17.410 1.00 70.73  ? 299 PRO A N   1 
ATOM   2129 C  CA  . PRO A 1 288 ? -54.035 -39.755 -18.559 1.00 71.82  ? 299 PRO A CA  1 
ATOM   2130 C  C   . PRO A 1 288 ? -54.338 -38.869 -19.775 1.00 72.66  ? 299 PRO A C   1 
ATOM   2131 O  O   . PRO A 1 288 ? -54.433 -39.379 -20.894 1.00 73.87  ? 299 PRO A O   1 
ATOM   2132 C  CB  . PRO A 1 288 ? -55.318 -40.369 -18.022 1.00 71.71  ? 299 PRO A CB  1 
ATOM   2133 C  CG  . PRO A 1 288 ? -55.625 -39.623 -16.693 1.00 70.66  ? 299 PRO A CG  1 
ATOM   2134 C  CD  . PRO A 1 288 ? -54.606 -38.564 -16.534 1.00 70.05  ? 299 PRO A CD  1 
ATOM   2135 N  N   . SER A 1 289 ? -54.472 -37.560 -19.555 1.00 72.18  ? 300 SER A N   1 
ATOM   2136 C  CA  . SER A 1 289 ? -54.699 -36.599 -20.633 1.00 73.06  ? 300 SER A CA  1 
ATOM   2137 C  C   . SER A 1 289 ? -53.521 -36.469 -21.598 1.00 73.92  ? 300 SER A C   1 
ATOM   2138 O  O   . SER A 1 289 ? -53.696 -36.655 -22.792 1.00 75.30  ? 300 SER A O   1 
ATOM   2139 C  CB  . SER A 1 289 ? -55.051 -35.223 -20.063 1.00 72.37  ? 300 SER A CB  1 
ATOM   2140 O  OG  . SER A 1 289 ? -55.954 -35.346 -18.971 1.00 71.51  ? 300 SER A OG  1 
ATOM   2141 N  N   . ILE A 1 290 ? -52.333 -36.153 -21.091 1.00 73.35  ? 301 ILE A N   1 
ATOM   2142 C  CA  . ILE A 1 290 ? -51.202 -35.783 -21.966 1.00 74.35  ? 301 ILE A CA  1 
ATOM   2143 C  C   . ILE A 1 290 ? -50.507 -36.987 -22.632 1.00 75.40  ? 301 ILE A C   1 
ATOM   2144 O  O   . ILE A 1 290 ? -50.000 -37.890 -21.941 1.00 74.92  ? 301 ILE A O   1 
ATOM   2145 C  CB  . ILE A 1 290 ? -50.162 -34.954 -21.199 1.00 73.63  ? 301 ILE A CB  1 
ATOM   2146 C  CG1 . ILE A 1 290 ? -50.813 -33.676 -20.679 1.00 72.95  ? 301 ILE A CG1 1 
ATOM   2147 C  CG2 . ILE A 1 290 ? -48.910 -34.694 -22.074 1.00 74.89  ? 301 ILE A CG2 1 
ATOM   2148 C  CD1 . ILE A 1 290 ? -49.831 -32.725 -20.042 1.00 72.36  ? 301 ILE A CD1 1 
ATOM   2149 N  N   . ALA A 1 291 ? -50.463 -36.994 -23.964 1.00 77.01  ? 302 ALA A N   1 
ATOM   2150 C  CA  . ALA A 1 291 ? -49.981 -38.174 -24.667 1.00 78.27  ? 302 ALA A CA  1 
ATOM   2151 C  C   . ALA A 1 291 ? -48.559 -38.511 -24.237 1.00 78.24  ? 302 ALA A C   1 
ATOM   2152 O  O   . ALA A 1 291 ? -48.257 -39.656 -23.897 1.00 78.33  ? 302 ALA A O   1 
ATOM   2153 C  CB  . ALA A 1 291 ? -50.068 -37.979 -26.152 1.00 80.26  ? 302 ALA A CB  1 
ATOM   2154 N  N   . GLU A 1 292 ? -47.700 -37.497 -24.207 1.00 78.24  ? 303 GLU A N   1 
ATOM   2155 C  CA  . GLU A 1 292 ? -46.295 -37.702 -23.871 1.00 78.61  ? 303 GLU A CA  1 
ATOM   2156 C  C   . GLU A 1 292 ? -46.082 -38.580 -22.633 1.00 77.52  ? 303 GLU A C   1 
ATOM   2157 O  O   . GLU A 1 292 ? -45.085 -39.303 -22.550 1.00 78.28  ? 303 GLU A O   1 
ATOM   2158 C  CB  . GLU A 1 292 ? -45.569 -36.361 -23.725 1.00 78.53  ? 303 GLU A CB  1 
ATOM   2159 C  CG  . GLU A 1 292 ? -44.295 -36.402 -22.883 1.00 78.43  ? 303 GLU A CG  1 
ATOM   2160 C  CD  . GLU A 1 292 ? -43.106 -37.033 -23.584 1.00 80.33  ? 303 GLU A CD  1 
ATOM   2161 O  OE1 . GLU A 1 292 ? -43.202 -37.416 -24.774 1.00 81.82  ? 303 GLU A OE1 1 
ATOM   2162 O  OE2 . GLU A 1 292 ? -42.049 -37.136 -22.930 1.00 80.53  ? 303 GLU A OE2 1 
ATOM   2163 N  N   . TYR A 1 293 ? -47.009 -38.540 -21.682 1.00 75.95  ? 304 TYR A N   1 
ATOM   2164 C  CA  . TYR A 1 293 ? -46.810 -39.335 -20.472 1.00 75.05  ? 304 TYR A CA  1 
ATOM   2165 C  C   . TYR A 1 293 ? -47.083 -40.796 -20.621 1.00 75.52  ? 304 TYR A C   1 
ATOM   2166 O  O   . TYR A 1 293 ? -46.402 -41.595 -19.982 1.00 75.61  ? 304 TYR A O   1 
ATOM   2167 C  CB  . TYR A 1 293 ? -47.581 -38.792 -19.272 1.00 73.45  ? 304 TYR A CB  1 
ATOM   2168 C  CG  . TYR A 1 293 ? -46.963 -37.536 -18.773 1.00 72.91  ? 304 TYR A CG  1 
ATOM   2169 C  CD1 . TYR A 1 293 ? -45.742 -37.546 -18.087 1.00 73.00  ? 304 TYR A CD1 1 
ATOM   2170 C  CD2 . TYR A 1 293 ? -47.555 -36.328 -19.046 1.00 72.50  ? 304 TYR A CD2 1 
ATOM   2171 C  CE1 . TYR A 1 293 ? -45.152 -36.374 -17.662 1.00 72.63  ? 304 TYR A CE1 1 
ATOM   2172 C  CE2 . TYR A 1 293 ? -46.980 -35.142 -18.626 1.00 72.11  ? 304 TYR A CE2 1 
ATOM   2173 C  CZ  . TYR A 1 293 ? -45.785 -35.169 -17.936 1.00 72.17  ? 304 TYR A CZ  1 
ATOM   2174 O  OH  . TYR A 1 293 ? -45.275 -33.951 -17.546 1.00 71.87  ? 304 TYR A OH  1 
ATOM   2175 N  N   . THR A 1 294 ? -48.081 -41.151 -21.429 1.00 75.95  ? 305 THR A N   1 
ATOM   2176 C  CA  . THR A 1 294 ? -48.359 -42.570 -21.684 1.00 76.65  ? 305 THR A CA  1 
ATOM   2177 C  C   . THR A 1 294 ? -47.234 -43.132 -22.558 1.00 78.32  ? 305 THR A C   1 
ATOM   2178 O  O   . THR A 1 294 ? -46.786 -44.262 -22.360 1.00 78.85  ? 305 THR A O   1 
ATOM   2179 C  CB  . THR A 1 294 ? -49.774 -42.833 -22.310 1.00 76.96  ? 305 THR A CB  1 
ATOM   2180 O  OG1 . THR A 1 294 ? -49.863 -42.192 -23.579 1.00 77.96  ? 305 THR A OG1 1 
ATOM   2181 C  CG2 . THR A 1 294 ? -50.898 -42.277 -21.428 1.00 75.53  ? 305 THR A CG2 1 
ATOM   2182 N  N   . VAL A 1 295 ? -46.743 -42.309 -23.478 1.00 79.31  ? 306 VAL A N   1 
ATOM   2183 C  CA  . VAL A 1 295 ? -45.749 -42.767 -24.424 1.00 81.23  ? 306 VAL A CA  1 
ATOM   2184 C  C   . VAL A 1 295 ? -44.449 -43.072 -23.729 1.00 81.36  ? 306 VAL A C   1 
ATOM   2185 O  O   . VAL A 1 295 ? -43.963 -44.198 -23.800 1.00 82.44  ? 306 VAL A O   1 
ATOM   2186 C  CB  . VAL A 1 295 ? -45.491 -41.763 -25.531 1.00 82.47  ? 306 VAL A CB  1 
ATOM   2187 C  CG1 . VAL A 1 295 ? -44.502 -42.347 -26.516 1.00 84.72  ? 306 VAL A CG1 1 
ATOM   2188 C  CG2 . VAL A 1 295 ? -46.792 -41.442 -26.233 1.00 82.55  ? 306 VAL A CG2 1 
ATOM   2189 N  N   . ARG A 1 296 ? -43.884 -42.080 -23.054 1.00 80.43  ? 307 ARG A N   1 
ATOM   2190 C  CA  . ARG A 1 296 ? -42.626 -42.303 -22.370 1.00 80.85  ? 307 ARG A CA  1 
ATOM   2191 C  C   . ARG A 1 296 ? -42.768 -43.383 -21.331 1.00 80.12  ? 307 ARG A C   1 
ATOM   2192 O  O   . ARG A 1 296 ? -41.837 -44.134 -21.099 1.00 81.03  ? 307 ARG A O   1 
ATOM   2193 C  CB  . ARG A 1 296 ? -42.089 -41.029 -21.732 1.00 80.17  ? 307 ARG A CB  1 
ATOM   2194 C  CG  . ARG A 1 296 ? -41.335 -40.120 -22.685 1.00 81.50  ? 307 ARG A CG  1 
ATOM   2195 C  CD  . ARG A 1 296 ? -40.383 -40.896 -23.547 1.00 83.75  ? 307 ARG A CD  1 
ATOM   2196 N  NE  . ARG A 1 296 ? -40.162 -40.265 -24.845 1.00 85.32  ? 307 ARG A NE  1 
ATOM   2197 C  CZ  . ARG A 1 296 ? -41.019 -40.275 -25.861 1.00 86.07  ? 307 ARG A CZ  1 
ATOM   2198 N  NH1 . ARG A 1 296 ? -42.209 -40.854 -25.762 1.00 85.33  ? 307 ARG A NH1 1 
ATOM   2199 N  NH2 . ARG A 1 296 ? -40.684 -39.676 -26.991 1.00 87.78  ? 307 ARG A NH2 1 
ATOM   2200 N  N   . SER A 1 297 ? -43.938 -43.465 -20.709 1.00 78.67  ? 308 SER A N   1 
ATOM   2201 C  CA  . SER A 1 297 ? -44.182 -44.507 -19.730 1.00 78.07  ? 308 SER A CA  1 
ATOM   2202 C  C   . SER A 1 297 ? -44.056 -45.854 -20.403 1.00 79.46  ? 308 SER A C   1 
ATOM   2203 O  O   . SER A 1 297 ? -43.308 -46.716 -19.926 1.00 80.11  ? 308 SER A O   1 
ATOM   2204 C  CB  . SER A 1 297 ? -45.540 -44.347 -19.080 1.00 76.50  ? 308 SER A CB  1 
ATOM   2205 O  OG  . SER A 1 297 ? -45.482 -43.283 -18.156 1.00 75.31  ? 308 SER A OG  1 
ATOM   2206 N  N   . LYS A 1 298 ? -44.743 -46.015 -21.536 1.00 80.13  ? 309 LYS A N   1 
ATOM   2207 C  CA  . LYS A 1 298 ? -44.695 -47.271 -22.280 1.00 81.68  ? 309 LYS A CA  1 
ATOM   2208 C  C   . LYS A 1 298 ? -43.282 -47.638 -22.696 1.00 83.44  ? 309 LYS A C   1 
ATOM   2209 O  O   . LYS A 1 298 ? -42.856 -48.770 -22.497 1.00 84.37  ? 309 LYS A O   1 
ATOM   2210 C  CB  . LYS A 1 298 ? -45.667 -47.266 -23.448 1.00 82.29  ? 309 LYS A CB  1 
ATOM   2211 C  CG  . LYS A 1 298 ? -47.075 -47.559 -22.968 1.00 81.06  ? 309 LYS A CG  1 
ATOM   2212 C  CD  . LYS A 1 298 ? -48.015 -47.978 -24.078 1.00 82.13  ? 309 LYS A CD  1 
ATOM   2213 C  CE  . LYS A 1 298 ? -49.467 -47.876 -23.640 1.00 81.03  ? 309 LYS A CE  1 
ATOM   2214 N  NZ  . LYS A 1 298 ? -50.391 -48.690 -24.491 1.00 82.29  ? 309 LYS A NZ  1 
ATOM   2215 N  N   . GLU A 1 299 ? -42.539 -46.667 -23.215 1.00 84.03  ? 310 GLU A N   1 
ATOM   2216 C  CA  . GLU A 1 299 ? -41.154 -46.912 -23.601 1.00 85.90  ? 310 GLU A CA  1 
ATOM   2217 C  C   . GLU A 1 299 ? -40.445 -47.675 -22.487 1.00 85.89  ? 310 GLU A C   1 
ATOM   2218 O  O   . GLU A 1 299 ? -39.861 -48.738 -22.726 1.00 87.55  ? 310 GLU A O   1 
ATOM   2219 C  CB  . GLU A 1 299 ? -40.414 -45.606 -23.935 1.00 86.29  ? 310 GLU A CB  1 
ATOM   2220 C  CG  . GLU A 1 299 ? -38.907 -45.784 -24.125 1.00 88.36  ? 310 GLU A CG  1 
ATOM   2221 C  CD  . GLU A 1 299 ? -38.151 -44.477 -24.395 1.00 88.78  ? 310 GLU A CD  1 
ATOM   2222 O  OE1 . GLU A 1 299 ? -38.717 -43.526 -25.010 1.00 88.30  ? 310 GLU A OE1 1 
ATOM   2223 O  OE2 . GLU A 1 299 ? -36.961 -44.407 -24.010 1.00 89.80  ? 310 GLU A OE2 1 
ATOM   2224 N  N   . ARG A 1 300 ? -40.548 -47.147 -21.271 1.00 84.19  ? 311 ARG A N   1 
ATOM   2225 C  CA  . ARG A 1 300 ? -39.800 -47.649 -20.143 1.00 84.31  ? 311 ARG A CA  1 
ATOM   2226 C  C   . ARG A 1 300 ? -40.265 -49.046 -19.789 1.00 84.52  ? 311 ARG A C   1 
ATOM   2227 O  O   . ARG A 1 300 ? -39.476 -49.895 -19.355 1.00 85.74  ? 311 ARG A O   1 
ATOM   2228 C  CB  . ARG A 1 300 ? -39.970 -46.709 -18.951 1.00 82.54  ? 311 ARG A CB  1 
ATOM   2229 C  CG  . ARG A 1 300 ? -39.328 -45.339 -19.133 1.00 82.58  ? 311 ARG A CG  1 
ATOM   2230 C  CD  . ARG A 1 300 ? -37.905 -45.477 -19.643 1.00 84.75  ? 311 ARG A CD  1 
ATOM   2231 N  NE  . ARG A 1 300 ? -36.924 -45.613 -18.569 1.00 85.18  ? 311 ARG A NE  1 
ATOM   2232 C  CZ  . ARG A 1 300 ? -35.719 -46.156 -18.725 1.00 87.25  ? 311 ARG A CZ  1 
ATOM   2233 N  NH1 . ARG A 1 300 ? -35.346 -46.645 -19.904 1.00 89.08  ? 311 ARG A NH1 1 
ATOM   2234 N  NH2 . ARG A 1 300 ? -34.888 -46.223 -17.695 1.00 87.70  ? 311 ARG A NH2 1 
ATOM   2235 N  N   . ILE A 1 301 ? -41.559 -49.282 -19.980 1.00 83.50  ? 312 ILE A N   1 
ATOM   2236 C  CA  . ILE A 1 301 ? -42.143 -50.579 -19.721 1.00 83.72  ? 312 ILE A CA  1 
ATOM   2237 C  C   . ILE A 1 301 ? -41.568 -51.537 -20.738 1.00 85.87  ? 312 ILE A C   1 
ATOM   2238 O  O   . ILE A 1 301 ? -41.038 -52.572 -20.374 1.00 86.94  ? 312 ILE A O   1 
ATOM   2239 C  CB  . ILE A 1 301 ? -43.668 -50.519 -19.815 1.00 82.43  ? 312 ILE A CB  1 
ATOM   2240 C  CG1 . ILE A 1 301 ? -44.225 -49.771 -18.591 1.00 80.50  ? 312 ILE A CG1 1 
ATOM   2241 C  CG2 . ILE A 1 301 ? -44.249 -51.916 -19.909 1.00 83.20  ? 312 ILE A CG2 1 
ATOM   2242 C  CD1 . ILE A 1 301 ? -45.614 -49.157 -18.755 1.00 79.21  ? 312 ILE A CD1 1 
ATOM   2243 N  N   . CYS A 1 302 ? -41.631 -51.171 -22.016 1.00 86.72  ? 313 CYS A N   1 
ATOM   2244 C  CA  . CYS A 1 302 ? -40.984 -51.968 -23.048 1.00 89.05  ? 313 CYS A CA  1 
ATOM   2245 C  C   . CYS A 1 302 ? -39.544 -52.247 -22.651 1.00 90.38  ? 313 CYS A C   1 
ATOM   2246 O  O   . CYS A 1 302 ? -39.064 -53.360 -22.824 1.00 91.93  ? 313 CYS A O   1 
ATOM   2247 C  CB  . CYS A 1 302 ? -41.067 -51.299 -24.418 1.00 90.05  ? 313 CYS A CB  1 
ATOM   2248 S  SG  . CYS A 1 302 ? -39.753 -51.906 -25.631 1.00 93.39  ? 313 CYS A SG  1 
ATOM   2249 N  N   . HIS A 1 303 ? -38.874 -51.250 -22.086 1.00 89.87  ? 314 HIS A N   1 
ATOM   2250 C  CA  . HIS A 1 303 ? -37.536 -51.440 -21.531 1.00 91.13  ? 314 HIS A CA  1 
ATOM   2251 C  C   . HIS A 1 303 ? -37.526 -52.431 -20.375 1.00 91.00  ? 314 HIS A C   1 
ATOM   2252 O  O   . HIS A 1 303 ? -36.630 -53.255 -20.281 1.00 92.89  ? 314 HIS A O   1 
ATOM   2253 C  CB  . HIS A 1 303 ? -36.956 -50.095 -21.097 1.00 90.38  ? 314 HIS A CB  1 
ATOM   2254 C  CG  . HIS A 1 303 ? -35.566 -50.169 -20.535 1.00 91.79  ? 314 HIS A CG  1 
ATOM   2255 N  ND1 . HIS A 1 303 ? -34.450 -49.807 -21.259 1.00 93.81  ? 314 HIS A ND1 1 
ATOM   2256 C  CD2 . HIS A 1 303 ? -35.115 -50.522 -19.306 1.00 91.66  ? 314 HIS A CD2 1 
ATOM   2257 C  CE1 . HIS A 1 303 ? -33.372 -49.944 -20.503 1.00 94.84  ? 314 HIS A CE1 1 
ATOM   2258 N  NE2 . HIS A 1 303 ? -33.748 -50.377 -19.315 1.00 93.58  ? 314 HIS A NE2 1 
ATOM   2259 N  N   . CYS A 1 304 ? -38.531 -52.353 -19.512 1.00 88.99  ? 315 CYS A N   1 
ATOM   2260 C  CA  . CYS A 1 304 ? -38.621 -53.209 -18.309 1.00 88.87  ? 315 CYS A CA  1 
ATOM   2261 C  C   . CYS A 1 304 ? -38.724 -54.707 -18.573 1.00 90.35  ? 315 CYS A C   1 
ATOM   2262 O  O   . CYS A 1 304 ? -38.093 -55.507 -17.886 1.00 91.62  ? 315 CYS A O   1 
ATOM   2263 C  CB  . CYS A 1 304 ? -39.811 -52.794 -17.438 1.00 86.59  ? 315 CYS A CB  1 
ATOM   2264 S  SG  . CYS A 1 304 ? -39.400 -51.554 -16.242 1.00 85.24  ? 315 CYS A SG  1 
ATOM   2265 N  N   . PHE A 1 305 ? -39.550 -55.072 -19.546 1.00 90.28  ? 316 PHE A N   1 
ATOM   2266 C  CA  . PHE A 1 305 ? -39.694 -56.453 -19.943 1.00 91.77  ? 316 PHE A CA  1 
ATOM   2267 C  C   . PHE A 1 305 ? -38.408 -56.954 -20.586 1.00 94.34  ? 316 PHE A C   1 
ATOM   2268 O  O   . PHE A 1 305 ? -37.882 -58.022 -20.223 1.00 95.88  ? 316 PHE A O   1 
ATOM   2269 C  CB  . PHE A 1 305 ? -40.868 -56.597 -20.899 1.00 91.34  ? 316 PHE A CB  1 
ATOM   2270 C  CG  . PHE A 1 305 ? -42.197 -56.447 -20.236 1.00 89.33  ? 316 PHE A CG  1 
ATOM   2271 C  CD1 . PHE A 1 305 ? -42.473 -57.115 -19.051 1.00 88.80  ? 316 PHE A CD1 1 
ATOM   2272 C  CD2 . PHE A 1 305 ? -43.180 -55.647 -20.797 1.00 88.20  ? 316 PHE A CD2 1 
ATOM   2273 C  CE1 . PHE A 1 305 ? -43.695 -56.980 -18.438 1.00 87.18  ? 316 PHE A CE1 1 
ATOM   2274 C  CE2 . PHE A 1 305 ? -44.415 -55.516 -20.188 1.00 86.57  ? 316 PHE A CE2 1 
ATOM   2275 C  CZ  . PHE A 1 305 ? -44.671 -56.183 -19.011 1.00 86.06  ? 316 PHE A CZ  1 
ATOM   2276 N  N   . SER A 1 306 ? -37.897 -56.154 -21.518 1.00 94.95  ? 317 SER A N   1 
ATOM   2277 C  CA  . SER A 1 306 ? -36.667 -56.456 -22.223 1.00 97.57  ? 317 SER A CA  1 
ATOM   2278 C  C   . SER A 1 306 ? -35.510 -56.806 -21.287 1.00 98.72  ? 317 SER A C   1 
ATOM   2279 O  O   . SER A 1 306 ? -34.917 -57.870 -21.410 1.00 100.86 ? 317 SER A O   1 
ATOM   2280 C  CB  . SER A 1 306 ? -36.285 -55.298 -23.134 1.00 97.88  ? 317 SER A CB  1 
ATOM   2281 O  OG  . SER A 1 306 ? -35.323 -55.714 -24.085 1.00 100.75 ? 317 SER A OG  1 
ATOM   2282 N  N   . LYS A 1 307 ? -35.195 -55.933 -20.342 1.00 97.48  ? 318 LYS A N   1 
ATOM   2283 C  CA  . LYS A 1 307 ? -34.077 -56.205 -19.451 1.00 98.77  ? 318 LYS A CA  1 
ATOM   2284 C  C   . LYS A 1 307 ? -34.396 -57.322 -18.469 1.00 98.87  ? 318 LYS A C   1 
ATOM   2285 O  O   . LYS A 1 307 ? -33.497 -57.840 -17.807 1.00 100.51 ? 318 LYS A O   1 
ATOM   2286 C  CB  . LYS A 1 307 ? -33.646 -54.942 -18.708 1.00 97.51  ? 318 LYS A CB  1 
ATOM   2287 C  CG  . LYS A 1 307 ? -33.253 -53.760 -19.609 1.00 97.59  ? 318 LYS A CG  1 
ATOM   2288 C  CD  . LYS A 1 307 ? -31.765 -53.719 -19.968 1.00 100.42 ? 318 LYS A CD  1 
ATOM   2289 C  CE  . LYS A 1 307 ? -31.516 -52.639 -21.022 1.00 100.58 ? 318 LYS A CE  1 
ATOM   2290 N  NZ  . LYS A 1 307 ? -30.114 -52.556 -21.553 1.00 103.61 ? 318 LYS A NZ  1 
ATOM   2291 N  N   . ASP A 1 308 ? -35.671 -57.701 -18.398 1.00 97.31  ? 319 ASP A N   1 
ATOM   2292 C  CA  . ASP A 1 308 ? -36.118 -58.760 -17.491 1.00 97.39  ? 319 ASP A CA  1 
ATOM   2293 C  C   . ASP A 1 308 ? -36.169 -60.122 -18.156 1.00 99.40  ? 319 ASP A C   1 
ATOM   2294 O  O   . ASP A 1 308 ? -36.495 -61.118 -17.512 1.00 100.09 ? 319 ASP A O   1 
ATOM   2295 C  CB  . ASP A 1 308 ? -37.490 -58.440 -16.903 1.00 94.90  ? 319 ASP A CB  1 
ATOM   2296 C  CG  . ASP A 1 308 ? -37.697 -59.073 -15.537 1.00 94.65  ? 319 ASP A CG  1 
ATOM   2297 O  OD1 . ASP A 1 308 ? -36.802 -59.825 -15.091 1.00 96.56  ? 319 ASP A OD1 1 
ATOM   2298 O  OD2 . ASP A 1 308 ? -38.747 -58.811 -14.905 1.00 92.73  ? 319 ASP A OD2 1 
ATOM   2299 N  N   . GLU A 1 309 ? -35.845 -60.155 -19.445 1.00 100.50 ? 320 GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 309 ? -35.763 -61.396 -20.219 1.00 102.77 ? 320 GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 309 ? -37.148 -62.015 -20.441 1.00 101.83 ? 320 GLU A C   1 
ATOM   2302 O  O   . GLU A 1 309 ? -37.296 -63.245 -20.535 1.00 103.45 ? 320 GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 309 ? -34.815 -62.403 -19.552 1.00 104.90 ? 320 GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 309 ? -33.399 -61.897 -19.289 1.00 106.32 ? 320 GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 309 ? -32.590 -62.843 -18.397 1.00 108.57 ? 320 GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 309 ? -33.124 -63.328 -17.358 1.00 108.08 ? 320 GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 309 ? -31.410 -63.099 -18.735 1.00 111.05 ? 320 GLU A OE2 1 
ATOM   2308 N  N   . LYS A 1 310 ? -38.162 -61.150 -20.516 1.00 99.37  ? 321 LYS A N   1 
ATOM   2309 C  CA  . LYS A 1 310 ? -39.515 -61.585 -20.842 1.00 98.51  ? 321 LYS A CA  1 
ATOM   2310 C  C   . LYS A 1 310 ? -39.820 -61.073 -22.241 1.00 98.80  ? 321 LYS A C   1 
ATOM   2311 O  O   . LYS A 1 310 ? -40.420 -60.007 -22.404 1.00 97.04  ? 321 LYS A O   1 
ATOM   2312 C  CB  . LYS A 1 310 ? -40.512 -61.057 -19.812 1.00 95.93  ? 321 LYS A CB  1 
ATOM   2313 C  CG  . LYS A 1 310 ? -40.034 -61.241 -18.371 1.00 95.72  ? 321 LYS A CG  1 
ATOM   2314 C  CD  . LYS A 1 310 ? -41.196 -61.349 -17.402 1.00 93.86  ? 321 LYS A CD  1 
ATOM   2315 C  CE  . LYS A 1 310 ? -40.725 -61.304 -15.946 1.00 94.17  ? 321 LYS A CE  1 
ATOM   2316 N  NZ  . LYS A 1 310 ? -41.749 -60.695 -15.032 1.00 92.09  ? 321 LYS A NZ  1 
ATOM   2317 N  N   . PRO A 1 311 ? -39.393 -61.831 -23.263 1.00 101.23 ? 322 PRO A N   1 
ATOM   2318 C  CA  . PRO A 1 311 ? -39.374 -61.304 -24.611 1.00 102.07 ? 322 PRO A CA  1 
ATOM   2319 C  C   . PRO A 1 311 ? -40.756 -61.156 -25.234 1.00 101.02 ? 322 PRO A C   1 
ATOM   2320 O  O   . PRO A 1 311 ? -40.992 -60.207 -25.967 1.00 100.57 ? 322 PRO A O   1 
ATOM   2321 C  CB  . PRO A 1 311 ? -38.530 -62.322 -25.382 1.00 105.21 ? 322 PRO A CB  1 
ATOM   2322 C  CG  . PRO A 1 311 ? -38.213 -63.428 -24.428 1.00 105.79 ? 322 PRO A CG  1 
ATOM   2323 C  CD  . PRO A 1 311 ? -39.083 -63.267 -23.241 1.00 103.32 ? 322 PRO A CD  1 
ATOM   2324 N  N   . VAL A 1 312 ? -41.669 -62.068 -24.943 1.00 100.78 ? 323 VAL A N   1 
ATOM   2325 C  CA  . VAL A 1 312 ? -42.960 -62.010 -25.585 1.00 100.16 ? 323 VAL A CA  1 
ATOM   2326 C  C   . VAL A 1 312 ? -43.628 -60.679 -25.302 1.00 97.69  ? 323 VAL A C   1 
ATOM   2327 O  O   . VAL A 1 312 ? -44.087 -60.004 -26.222 1.00 97.67  ? 323 VAL A O   1 
ATOM   2328 C  CB  . VAL A 1 312 ? -43.879 -63.120 -25.132 1.00 100.14 ? 323 VAL A CB  1 
ATOM   2329 C  CG1 . VAL A 1 312 ? -45.068 -63.186 -26.062 1.00 100.00 ? 323 VAL A CG1 1 
ATOM   2330 C  CG2 . VAL A 1 312 ? -43.142 -64.435 -25.135 1.00 102.57 ? 323 VAL A CG2 1 
ATOM   2331 N  N   . GLU A 1 313 ? -43.669 -60.305 -24.025 1.00 95.80  ? 324 GLU A N   1 
ATOM   2332 C  CA  . GLU A 1 313 ? -44.323 -59.071 -23.585 1.00 93.42  ? 324 GLU A CA  1 
ATOM   2333 C  C   . GLU A 1 313 ? -43.513 -57.889 -24.063 1.00 93.33  ? 324 GLU A C   1 
ATOM   2334 O  O   . GLU A 1 313 ? -44.060 -56.897 -24.547 1.00 92.35  ? 324 GLU A O   1 
ATOM   2335 C  CB  . GLU A 1 313 ? -44.439 -59.027 -22.066 1.00 91.76  ? 324 GLU A CB  1 
ATOM   2336 C  CG  . GLU A 1 313 ? -45.208 -60.180 -21.457 1.00 91.89  ? 324 GLU A CG  1 
ATOM   2337 C  CD  . GLU A 1 313 ? -44.366 -61.443 -21.269 1.00 93.85  ? 324 GLU A CD  1 
ATOM   2338 O  OE1 . GLU A 1 313 ? -43.247 -61.536 -21.842 1.00 95.34  ? 324 GLU A OE1 1 
ATOM   2339 O  OE2 . GLU A 1 313 ? -44.834 -62.353 -20.543 1.00 94.07  ? 324 GLU A OE2 1 
ATOM   2340 N  N   . ALA A 1 314 ? -42.195 -58.016 -23.932 1.00 94.54  ? 325 ALA A N   1 
ATOM   2341 C  CA  . ALA A 1 314 ? -41.287 -57.018 -24.454 1.00 94.98  ? 325 ALA A CA  1 
ATOM   2342 C  C   . ALA A 1 314 ? -41.705 -56.672 -25.880 1.00 95.90  ? 325 ALA A C   1 
ATOM   2343 O  O   . ALA A 1 314 ? -42.028 -55.522 -26.178 1.00 94.80  ? 325 ALA A O   1 
ATOM   2344 C  CB  . ALA A 1 314 ? -39.843 -57.507 -24.393 1.00 96.98  ? 325 ALA A CB  1 
ATOM   2345 N  N   . ILE A 1 315 ? -41.763 -57.677 -26.743 1.00 98.01  ? 326 ILE A N   1 
ATOM   2346 C  CA  . ILE A 1 315 ? -42.147 -57.443 -28.120 1.00 99.28  ? 326 ILE A CA  1 
ATOM   2347 C  C   . ILE A 1 315 ? -43.500 -56.766 -28.195 1.00 97.49  ? 326 ILE A C   1 
ATOM   2348 O  O   . ILE A 1 315 ? -43.651 -55.759 -28.876 1.00 97.43  ? 326 ILE A O   1 
ATOM   2349 C  CB  . ILE A 1 315 ? -42.119 -58.719 -28.936 1.00 101.75 ? 326 ILE A CB  1 
ATOM   2350 C  CG1 . ILE A 1 315 ? -40.663 -59.078 -29.207 1.00 104.09 ? 326 ILE A CG1 1 
ATOM   2351 C  CG2 . ILE A 1 315 ? -42.848 -58.514 -30.241 1.00 102.86 ? 326 ILE A CG2 1 
ATOM   2352 C  CD1 . ILE A 1 315 ? -40.393 -60.533 -29.272 1.00 106.04 ? 326 ILE A CD1 1 
ATOM   2353 N  N   . ARG A 1 316 ? -44.464 -57.292 -27.457 1.00 96.17  ? 327 ARG A N   1 
ATOM   2354 C  CA  . ARG A 1 316 ? -45.820 -56.780 -27.513 1.00 94.77  ? 327 ARG A CA  1 
ATOM   2355 C  C   . ARG A 1 316 ? -45.867 -55.263 -27.355 1.00 93.10  ? 327 ARG A C   1 
ATOM   2356 O  O   . ARG A 1 316 ? -46.523 -54.560 -28.117 1.00 93.19  ? 327 ARG A O   1 
ATOM   2357 C  CB  . ARG A 1 316 ? -46.688 -57.479 -26.466 1.00 93.53  ? 327 ARG A CB  1 
ATOM   2358 C  CG  . ARG A 1 316 ? -48.071 -56.896 -26.358 1.00 92.03  ? 327 ARG A CG  1 
ATOM   2359 C  CD  . ARG A 1 316 ? -49.013 -57.785 -25.593 1.00 91.48  ? 327 ARG A CD  1 
ATOM   2360 N  NE  . ARG A 1 316 ? -48.614 -58.079 -24.210 1.00 90.30  ? 327 ARG A NE  1 
ATOM   2361 C  CZ  . ARG A 1 316 ? -48.662 -57.225 -23.186 1.00 88.33  ? 327 ARG A CZ  1 
ATOM   2362 N  NH1 . ARG A 1 316 ? -49.054 -55.963 -23.366 1.00 87.14  ? 327 ARG A NH1 1 
ATOM   2363 N  NH2 . ARG A 1 316 ? -48.299 -57.636 -21.971 1.00 87.70  ? 327 ARG A NH2 1 
ATOM   2364 N  N   . VAL A 1 317 ? -45.129 -54.771 -26.373 1.00 91.78  ? 328 VAL A N   1 
ATOM   2365 C  CA  . VAL A 1 317 ? -45.195 -53.366 -25.985 1.00 90.00  ? 328 VAL A CA  1 
ATOM   2366 C  C   . VAL A 1 317 ? -44.384 -52.454 -26.921 1.00 91.06  ? 328 VAL A C   1 
ATOM   2367 O  O   . VAL A 1 317 ? -44.927 -51.499 -27.481 1.00 90.60  ? 328 VAL A O   1 
ATOM   2368 C  CB  . VAL A 1 317 ? -44.820 -53.180 -24.488 1.00 88.34  ? 328 VAL A CB  1 
ATOM   2369 C  CG1 . VAL A 1 317 ? -44.641 -51.722 -24.135 1.00 86.78  ? 328 VAL A CG1 1 
ATOM   2370 C  CG2 . VAL A 1 317 ? -45.880 -53.832 -23.595 1.00 87.23  ? 328 VAL A CG2 1 
ATOM   2371 N  N   . CYS A 1 318 ? -43.106 -52.754 -27.116 1.00 92.67  ? 329 CYS A N   1 
ATOM   2372 C  CA  . CYS A 1 318 ? -42.296 -52.008 -28.080 1.00 94.00  ? 329 CYS A CA  1 
ATOM   2373 C  C   . CYS A 1 318 ? -42.990 -51.839 -29.419 1.00 95.37  ? 329 CYS A C   1 
ATOM   2374 O  O   . CYS A 1 318 ? -42.840 -50.823 -30.069 1.00 95.86  ? 329 CYS A O   1 
ATOM   2375 C  CB  . CYS A 1 318 ? -40.957 -52.689 -28.291 1.00 96.09  ? 329 CYS A CB  1 
ATOM   2376 S  SG  . CYS A 1 318 ? -40.357 -53.492 -26.801 1.00 95.60  ? 329 CYS A SG  1 
ATOM   2377 N  N   . SER A 1 319 ? -43.757 -52.832 -29.828 1.00 96.16  ? 330 SER A N   1 
ATOM   2378 C  CA  . SER A 1 319 ? -44.580 -52.695 -31.018 1.00 97.52  ? 330 SER A CA  1 
ATOM   2379 C  C   . SER A 1 319 ? -45.544 -51.503 -30.941 1.00 95.86  ? 330 SER A C   1 
ATOM   2380 O  O   . SER A 1 319 ? -45.594 -50.674 -31.861 1.00 96.93  ? 330 SER A O   1 
ATOM   2381 C  CB  . SER A 1 319 ? -45.345 -53.983 -31.257 1.00 98.52  ? 330 SER A CB  1 
ATOM   2382 O  OG  . SER A 1 319 ? -44.441 -55.061 -31.155 1.00 99.91  ? 330 SER A OG  1 
ATOM   2383 N  N   . GLU A 1 320 ? -46.297 -51.422 -29.846 1.00 93.47  ? 331 GLU A N   1 
ATOM   2384 C  CA  . GLU A 1 320 ? -47.187 -50.294 -29.609 1.00 91.81  ? 331 GLU A CA  1 
ATOM   2385 C  C   . GLU A 1 320 ? -46.374 -49.003 -29.631 1.00 91.40  ? 331 GLU A C   1 
ATOM   2386 O  O   . GLU A 1 320 ? -46.811 -47.986 -30.181 1.00 91.47  ? 331 GLU A O   1 
ATOM   2387 C  CB  . GLU A 1 320 ? -47.902 -50.453 -28.261 1.00 89.48  ? 331 GLU A CB  1 
ATOM   2388 C  CG  . GLU A 1 320 ? -49.220 -49.680 -28.123 1.00 88.19  ? 331 GLU A CG  1 
ATOM   2389 C  CD  . GLU A 1 320 ? -50.190 -50.315 -27.100 1.00 86.73  ? 331 GLU A CD  1 
ATOM   2390 O  OE1 . GLU A 1 320 ? -49.729 -51.008 -26.145 1.00 86.24  ? 331 GLU A OE1 1 
ATOM   2391 O  OE2 . GLU A 1 320 ? -51.428 -50.116 -27.248 1.00 86.28  ? 331 GLU A OE2 1 
ATOM   2392 N  N   . VAL A 1 321 ? -45.182 -49.058 -29.043 1.00 91.16  ? 332 VAL A N   1 
ATOM   2393 C  CA  . VAL A 1 321 ? -44.348 -47.874 -28.911 1.00 90.88  ? 332 VAL A CA  1 
ATOM   2394 C  C   . VAL A 1 321 ? -43.895 -47.395 -30.280 1.00 93.26  ? 332 VAL A C   1 
ATOM   2395 O  O   . VAL A 1 321 ? -44.105 -46.237 -30.634 1.00 93.17  ? 332 VAL A O   1 
ATOM   2396 C  CB  . VAL A 1 321 ? -43.141 -48.087 -27.948 1.00 90.46  ? 332 VAL A CB  1 
ATOM   2397 C  CG1 . VAL A 1 321 ? -42.111 -46.965 -28.097 1.00 90.92  ? 332 VAL A CG1 1 
ATOM   2398 C  CG2 . VAL A 1 321 ? -43.614 -48.193 -26.493 1.00 88.04  ? 332 VAL A CG2 1 
ATOM   2399 N  N   . LEU A 1 322 ? -43.305 -48.293 -31.058 1.00 95.57  ? 333 LEU A N   1 
ATOM   2400 C  CA  . LEU A 1 322 ? -42.833 -47.939 -32.388 1.00 98.22  ? 333 LEU A CA  1 
ATOM   2401 C  C   . LEU A 1 322 ? -44.001 -47.557 -33.301 1.00 98.78  ? 333 LEU A C   1 
ATOM   2402 O  O   . LEU A 1 322 ? -43.852 -46.769 -34.221 1.00 100.44 ? 333 LEU A O   1 
ATOM   2403 C  CB  . LEU A 1 322 ? -41.962 -49.046 -32.965 1.00 100.72 ? 333 LEU A CB  1 
ATOM   2404 C  CG  . LEU A 1 322 ? -40.811 -49.420 -32.023 1.00 100.70 ? 333 LEU A CG  1 
ATOM   2405 C  CD1 . LEU A 1 322 ? -40.129 -50.674 -32.483 1.00 103.50 ? 333 LEU A CD1 1 
ATOM   2406 C  CD2 . LEU A 1 322 ? -39.802 -48.316 -31.877 1.00 100.48 ? 333 LEU A CD2 1 
ATOM   2407 N  N   . GLN A 1 323 ? -45.182 -48.090 -33.018 1.00 97.55  ? 334 GLN A N   1 
ATOM   2408 C  CA  . GLN A 1 323 ? -46.375 -47.612 -33.704 1.00 97.99  ? 334 GLN A CA  1 
ATOM   2409 C  C   . GLN A 1 323 ? -46.579 -46.115 -33.466 1.00 96.67  ? 334 GLN A C   1 
ATOM   2410 O  O   . GLN A 1 323 ? -46.948 -45.409 -34.385 1.00 98.08  ? 334 GLN A O   1 
ATOM   2411 C  CB  . GLN A 1 323 ? -47.627 -48.429 -33.337 1.00 97.11  ? 334 GLN A CB  1 
ATOM   2412 C  CG  . GLN A 1 323 ? -47.643 -49.834 -33.947 1.00 99.20  ? 334 GLN A CG  1 
ATOM   2413 C  CD  . GLN A 1 323 ? -49.021 -50.497 -33.956 1.00 98.98  ? 334 GLN A CD  1 
ATOM   2414 O  OE1 . GLN A 1 323 ? -49.756 -50.490 -32.956 1.00 96.72  ? 334 GLN A OE1 1 
ATOM   2415 N  NE2 . GLN A 1 323 ? -49.367 -51.096 -35.096 1.00 101.55 ? 334 GLN A NE2 1 
HETATM 2416 N  N   . MSE A 1 324 ? -46.324 -45.627 -32.255 1.00 94.16  ? 335 MSE A N   1 
HETATM 2417 C  CA  . MSE A 1 324 ? -46.480 -44.194 -31.987 1.00 92.99  ? 335 MSE A CA  1 
HETATM 2418 C  C   . MSE A 1 324 ? -45.208 -43.426 -32.360 1.00 94.23  ? 335 MSE A C   1 
HETATM 2419 O  O   . MSE A 1 324 ? -45.251 -42.244 -32.720 1.00 94.58  ? 335 MSE A O   1 
HETATM 2420 C  CB  . MSE A 1 324 ? -46.849 -43.944 -30.533 1.00 90.07  ? 335 MSE A CB  1 
HETATM 2421 C  CG  . MSE A 1 324 ? -47.970 -44.805 -30.046 1.00 89.04  ? 335 MSE A CG  1 
HETATM 2422 SE SE  . MSE A 1 324 ? -48.064 -44.842 -28.061 1.00 85.83  ? 335 MSE A SE  1 
HETATM 2423 C  CE  . MSE A 1 324 ? -46.187 -45.353 -27.649 1.00 86.54  ? 335 MSE A CE  1 
ATOM   2424 N  N   . GLU A 1 325 ? -44.072 -44.106 -32.263 1.00 95.06  ? 336 GLU A N   1 
ATOM   2425 C  CA  . GLU A 1 325 ? -42.782 -43.514 -32.604 1.00 96.58  ? 336 GLU A CA  1 
ATOM   2426 C  C   . GLU A 1 325 ? -41.941 -44.582 -33.309 1.00 99.06  ? 336 GLU A C   1 
ATOM   2427 O  O   . GLU A 1 325 ? -41.339 -45.446 -32.644 1.00 98.62  ? 336 GLU A O   1 
ATOM   2428 C  CB  . GLU A 1 325 ? -42.062 -43.031 -31.346 1.00 94.70  ? 336 GLU A CB  1 
ATOM   2429 C  CG  . GLU A 1 325 ? -42.877 -42.045 -30.490 1.00 92.25  ? 336 GLU A CG  1 
ATOM   2430 C  CD  . GLU A 1 325 ? -42.111 -41.594 -29.266 1.00 90.69  ? 336 GLU A CD  1 
ATOM   2431 O  OE1 . GLU A 1 325 ? -41.038 -42.170 -28.984 1.00 91.41  ? 336 GLU A OE1 1 
ATOM   2432 O  OE2 . GLU A 1 325 ? -42.581 -40.649 -28.597 1.00 88.92  ? 336 GLU A OE2 1 
ATOM   2433 N  N   . PRO A 1 326 ? -41.914 -44.556 -34.661 1.00 101.89 ? 337 PRO A N   1 
ATOM   2434 C  CA  . PRO A 1 326 ? -41.186 -45.630 -35.331 1.00 104.46 ? 337 PRO A CA  1 
ATOM   2435 C  C   . PRO A 1 326 ? -39.700 -45.383 -35.213 1.00 105.77 ? 337 PRO A C   1 
ATOM   2436 O  O   . PRO A 1 326 ? -38.891 -46.280 -35.483 1.00 107.83 ? 337 PRO A O   1 
ATOM   2437 C  CB  . PRO A 1 326 ? -41.654 -45.528 -36.793 1.00 107.11 ? 337 PRO A CB  1 
ATOM   2438 C  CG  . PRO A 1 326 ? -42.869 -44.604 -36.761 1.00 106.10 ? 337 PRO A CG  1 
ATOM   2439 C  CD  . PRO A 1 326 ? -42.601 -43.676 -35.621 1.00 103.02 ? 337 PRO A CD  1 
ATOM   2440 N  N   . ASP A 1 327 ? -39.362 -44.172 -34.782 1.00 104.64 ? 338 ASP A N   1 
ATOM   2441 C  CA  . ASP A 1 327 ? -37.983 -43.717 -34.710 1.00 105.97 ? 338 ASP A CA  1 
ATOM   2442 C  C   . ASP A 1 327 ? -37.447 -43.769 -33.279 1.00 103.73 ? 338 ASP A C   1 
ATOM   2443 O  O   . ASP A 1 327 ? -36.352 -43.250 -32.995 1.00 104.54 ? 338 ASP A O   1 
ATOM   2444 C  CB  . ASP A 1 327 ? -37.865 -42.297 -35.288 1.00 106.80 ? 338 ASP A CB  1 
ATOM   2445 C  CG  . ASP A 1 327 ? -38.442 -41.231 -34.365 1.00 103.78 ? 338 ASP A CG  1 
ATOM   2446 O  OD1 . ASP A 1 327 ? -39.564 -41.421 -33.839 1.00 101.46 ? 338 ASP A OD1 1 
ATOM   2447 O  OD2 . ASP A 1 327 ? -37.766 -40.197 -34.173 1.00 103.87 ? 338 ASP A OD2 1 
ATOM   2448 N  N   . ASN A 1 328 ? -38.210 -44.391 -32.379 1.00 101.14 ? 339 ASN A N   1 
ATOM   2449 C  CA  . ASN A 1 328 ? -37.754 -44.461 -31.002 1.00 99.18  ? 339 ASN A CA  1 
ATOM   2450 C  C   . ASN A 1 328 ? -36.601 -45.451 -30.770 1.00 100.73 ? 339 ASN A C   1 
ATOM   2451 O  O   . ASN A 1 328 ? -36.823 -46.668 -30.520 1.00 100.64 ? 339 ASN A O   1 
ATOM   2452 C  CB  . ASN A 1 328 ? -38.899 -44.714 -30.026 1.00 96.22  ? 339 ASN A CB  1 
ATOM   2453 C  CG  . ASN A 1 328 ? -38.507 -44.364 -28.587 1.00 94.14  ? 339 ASN A CG  1 
ATOM   2454 O  OD1 . ASN A 1 328 ? -37.422 -44.731 -28.112 1.00 94.87  ? 339 ASN A OD1 1 
ATOM   2455 N  ND2 . ASN A 1 328 ? -39.387 -43.638 -27.893 1.00 91.76  ? 339 ASN A ND2 1 
ATOM   2456 N  N   . VAL A 1 329 ? -35.381 -44.893 -30.868 1.00 102.34 ? 340 VAL A N   1 
ATOM   2457 C  CA  . VAL A 1 329 ? -34.128 -45.632 -30.737 1.00 104.40 ? 340 VAL A CA  1 
ATOM   2458 C  C   . VAL A 1 329 ? -34.110 -46.634 -29.576 1.00 103.02 ? 340 VAL A C   1 
ATOM   2459 O  O   . VAL A 1 329 ? -33.907 -47.827 -29.792 1.00 104.47 ? 340 VAL A O   1 
ATOM   2460 C  CB  . VAL A 1 329 ? -32.946 -44.658 -30.614 1.00 105.67 ? 340 VAL A CB  1 
ATOM   2461 C  CG1 . VAL A 1 329 ? -31.626 -45.404 -30.390 1.00 107.66 ? 340 VAL A CG1 1 
ATOM   2462 C  CG2 . VAL A 1 329 ? -32.874 -43.769 -31.846 1.00 107.87 ? 340 VAL A CG2 1 
ATOM   2463 N  N   . ASN A 1 330 ? -34.318 -46.155 -28.353 1.00 100.40 ? 341 ASN A N   1 
ATOM   2464 C  CA  . ASN A 1 330 ? -34.384 -47.038 -27.186 1.00 99.14  ? 341 ASN A CA  1 
ATOM   2465 C  C   . ASN A 1 330 ? -35.289 -48.240 -27.402 1.00 98.88  ? 341 ASN A C   1 
ATOM   2466 O  O   . ASN A 1 330 ? -34.888 -49.386 -27.198 1.00 100.03 ? 341 ASN A O   1 
ATOM   2467 C  CB  . ASN A 1 330 ? -34.882 -46.262 -25.977 1.00 96.24  ? 341 ASN A CB  1 
ATOM   2468 C  CG  . ASN A 1 330 ? -33.925 -45.210 -25.558 1.00 96.32  ? 341 ASN A CG  1 
ATOM   2469 O  OD1 . ASN A 1 330 ? -33.006 -45.470 -24.764 1.00 96.26  ? 341 ASN A OD1 1 
ATOM   2470 N  ND2 . ASN A 1 330 ? -34.104 -44.011 -26.102 1.00 96.66  ? 341 ASN A ND2 1 
ATOM   2471 N  N   . ALA A 1 331 ? -36.509 -47.952 -27.830 1.00 97.55  ? 342 ALA A N   1 
ATOM   2472 C  CA  . ALA A 1 331 ? -37.498 -48.976 -28.054 1.00 97.26  ? 342 ALA A CA  1 
ATOM   2473 C  C   . ALA A 1 331 ? -36.974 -50.026 -29.025 1.00 100.18 ? 342 ALA A C   1 
ATOM   2474 O  O   . ALA A 1 331 ? -36.968 -51.226 -28.710 1.00 100.70 ? 342 ALA A O   1 
ATOM   2475 C  CB  . ALA A 1 331 ? -38.756 -48.362 -28.572 1.00 96.16  ? 342 ALA A CB  1 
ATOM   2476 N  N   . LEU A 1 332 ? -36.517 -49.575 -30.193 1.00 102.27 ? 343 LEU A N   1 
ATOM   2477 C  CA  . LEU A 1 332 ? -35.895 -50.478 -31.165 1.00 105.45 ? 343 LEU A CA  1 
ATOM   2478 C  C   . LEU A 1 332 ? -34.863 -51.382 -30.479 1.00 106.47 ? 343 LEU A C   1 
ATOM   2479 O  O   . LEU A 1 332 ? -34.971 -52.604 -30.555 1.00 107.45 ? 343 LEU A O   1 
ATOM   2480 C  CB  . LEU A 1 332 ? -35.264 -49.691 -32.326 1.00 107.76 ? 343 LEU A CB  1 
ATOM   2481 C  CG  . LEU A 1 332 ? -36.166 -48.768 -33.168 1.00 107.81 ? 343 LEU A CG  1 
ATOM   2482 C  CD1 . LEU A 1 332 ? -35.381 -47.580 -33.675 1.00 108.34 ? 343 LEU A CD1 1 
ATOM   2483 C  CD2 . LEU A 1 332 ? -36.842 -49.473 -34.337 1.00 110.48 ? 343 LEU A CD2 1 
ATOM   2484 N  N   . LYS A 1 333 ? -33.909 -50.767 -29.776 1.00 106.27 ? 344 LYS A N   1 
ATOM   2485 C  CA  . LYS A 1 333 ? -32.790 -51.471 -29.140 1.00 107.65 ? 344 LYS A CA  1 
ATOM   2486 C  C   . LYS A 1 333 ? -33.225 -52.571 -28.202 1.00 106.43 ? 344 LYS A C   1 
ATOM   2487 O  O   . LYS A 1 333 ? -32.694 -53.681 -28.234 1.00 108.35 ? 344 LYS A O   1 
ATOM   2488 C  CB  . LYS A 1 333 ? -31.927 -50.497 -28.345 1.00 107.15 ? 344 LYS A CB  1 
ATOM   2489 C  CG  . LYS A 1 333 ? -30.893 -49.758 -29.168 1.00 109.71 ? 344 LYS A CG  1 
ATOM   2490 C  CD  . LYS A 1 333 ? -30.122 -48.728 -28.320 1.00 109.01 ? 344 LYS A CD  1 
ATOM   2491 C  CE  . LYS A 1 333 ? -29.119 -49.369 -27.339 1.00 110.02 ? 344 LYS A CE  1 
ATOM   2492 N  NZ  . LYS A 1 333 ? -28.352 -48.354 -26.537 1.00 109.43 ? 344 LYS A NZ  1 
ATOM   2493 N  N   . ASP A 1 334 ? -34.180 -52.245 -27.344 1.00 103.40 ? 345 ASP A N   1 
ATOM   2494 C  CA  . ASP A 1 334 ? -34.622 -53.184 -26.332 1.00 102.14 ? 345 ASP A CA  1 
ATOM   2495 C  C   . ASP A 1 334 ? -35.344 -54.349 -26.995 1.00 102.98 ? 345 ASP A C   1 
ATOM   2496 O  O   . ASP A 1 334 ? -35.073 -55.500 -26.679 1.00 104.06 ? 345 ASP A O   1 
ATOM   2497 C  CB  . ASP A 1 334 ? -35.497 -52.484 -25.287 1.00 98.91  ? 345 ASP A CB  1 
ATOM   2498 C  CG  . ASP A 1 334 ? -34.707 -51.522 -24.411 1.00 98.21  ? 345 ASP A CG  1 
ATOM   2499 O  OD1 . ASP A 1 334 ? -34.137 -50.543 -24.933 1.00 98.91  ? 345 ASP A OD1 1 
ATOM   2500 O  OD2 . ASP A 1 334 ? -34.648 -51.748 -23.191 1.00 97.13  ? 345 ASP A OD2 1 
ATOM   2501 N  N   . ARG A 1 335 ? -36.230 -54.046 -27.938 1.00 102.75 ? 346 ARG A N   1 
ATOM   2502 C  CA  . ARG A 1 335 ? -36.940 -55.085 -28.678 1.00 103.78 ? 346 ARG A CA  1 
ATOM   2503 C  C   . ARG A 1 335 ? -35.995 -55.958 -29.491 1.00 107.18 ? 346 ARG A C   1 
ATOM   2504 O  O   . ARG A 1 335 ? -36.273 -57.130 -29.745 1.00 108.30 ? 346 ARG A O   1 
ATOM   2505 C  CB  . ARG A 1 335 ? -37.988 -54.498 -29.616 1.00 103.24 ? 346 ARG A CB  1 
ATOM   2506 C  CG  . ARG A 1 335 ? -38.858 -55.583 -30.200 1.00 104.42 ? 346 ARG A CG  1 
ATOM   2507 C  CD  . ARG A 1 335 ? -39.988 -55.059 -30.990 1.00 103.87 ? 346 ARG A CD  1 
ATOM   2508 N  NE  . ARG A 1 335 ? -39.514 -54.503 -32.246 1.00 106.13 ? 346 ARG A NE  1 
ATOM   2509 C  CZ  . ARG A 1 335 ? -40.313 -54.159 -33.246 1.00 106.70 ? 346 ARG A CZ  1 
ATOM   2510 N  NH1 . ARG A 1 335 ? -41.626 -54.325 -33.133 1.00 105.14 ? 346 ARG A NH1 1 
ATOM   2511 N  NH2 . ARG A 1 335 ? -39.802 -53.651 -34.354 1.00 109.03 ? 346 ARG A NH2 1 
ATOM   2512 N  N   . ALA A 1 336 ? -34.889 -55.375 -29.923 1.00 108.99 ? 347 ALA A N   1 
ATOM   2513 C  CA  . ALA A 1 336 ? -33.874 -56.146 -30.576 1.00 112.38 ? 347 ALA A CA  1 
ATOM   2514 C  C   . ALA A 1 336 ? -33.339 -57.185 -29.587 1.00 112.73 ? 347 ALA A C   1 
ATOM   2515 O  O   . ALA A 1 336 ? -33.376 -58.386 -29.872 1.00 114.42 ? 347 ALA A O   1 
ATOM   2516 C  CB  . ALA A 1 336 ? -32.792 -55.246 -31.064 1.00 114.22 ? 347 ALA A CB  1 
ATOM   2517 N  N   . GLU A 1 337 ? -32.897 -56.733 -28.411 1.00 111.22 ? 348 GLU A N   1 
ATOM   2518 C  CA  . GLU A 1 337 ? -32.329 -57.641 -27.406 1.00 111.63 ? 348 GLU A CA  1 
ATOM   2519 C  C   . GLU A 1 337 ? -33.285 -58.781 -27.070 1.00 110.78 ? 348 GLU A C   1 
ATOM   2520 O  O   . GLU A 1 337 ? -32.856 -59.833 -26.599 1.00 112.25 ? 348 GLU A O   1 
ATOM   2521 C  CB  . GLU A 1 337 ? -31.921 -56.900 -26.130 1.00 109.77 ? 348 GLU A CB  1 
ATOM   2522 C  CG  . GLU A 1 337 ? -30.968 -57.712 -25.228 1.00 111.26 ? 348 GLU A CG  1 
ATOM   2523 C  CD  . GLU A 1 337 ? -30.828 -57.159 -23.785 1.00 109.32 ? 348 GLU A CD  1 
ATOM   2524 O  OE1 . GLU A 1 337 ? -30.984 -55.928 -23.560 1.00 107.28 ? 348 GLU A OE1 1 
ATOM   2525 O  OE2 . GLU A 1 337 ? -30.544 -57.971 -22.863 1.00 110.03 ? 348 GLU A OE2 1 
ATOM   2526 N  N   . ALA A 1 338 ? -34.573 -58.561 -27.332 1.00 108.61 ? 349 ALA A N   1 
ATOM   2527 C  CA  . ALA A 1 338 ? -35.625 -59.546 -27.070 1.00 107.74 ? 349 ALA A CA  1 
ATOM   2528 C  C   . ALA A 1 338 ? -35.695 -60.554 -28.196 1.00 110.39 ? 349 ALA A C   1 
ATOM   2529 O  O   . ALA A 1 338 ? -35.737 -61.763 -27.955 1.00 111.42 ? 349 ALA A O   1 
ATOM   2530 C  CB  . ALA A 1 338 ? -36.971 -58.853 -26.903 1.00 104.92 ? 349 ALA A CB  1 
ATOM   2531 N  N   . TYR A 1 339 ? -35.716 -60.041 -29.425 1.00 111.63 ? 350 TYR A N   1 
ATOM   2532 C  CA  . TYR A 1 339 ? -35.679 -60.872 -30.612 1.00 114.55 ? 350 TYR A CA  1 
ATOM   2533 C  C   . TYR A 1 339 ? -34.507 -61.832 -30.488 1.00 117.20 ? 350 TYR A C   1 
ATOM   2534 O  O   . TYR A 1 339 ? -34.617 -62.991 -30.875 1.00 118.99 ? 350 TYR A O   1 
ATOM   2535 C  CB  . TYR A 1 339 ? -35.544 -60.022 -31.875 1.00 115.96 ? 350 TYR A CB  1 
ATOM   2536 C  CG  . TYR A 1 339 ? -36.835 -59.432 -32.415 1.00 114.41 ? 350 TYR A CG  1 
ATOM   2537 C  CD1 . TYR A 1 339 ? -37.937 -60.238 -32.703 1.00 114.13 ? 350 TYR A CD1 1 
ATOM   2538 C  CD2 . TYR A 1 339 ? -36.947 -58.062 -32.667 1.00 113.45 ? 350 TYR A CD2 1 
ATOM   2539 C  CE1 . TYR A 1 339 ? -39.125 -59.692 -33.218 1.00 112.98 ? 350 TYR A CE1 1 
ATOM   2540 C  CE2 . TYR A 1 339 ? -38.125 -57.508 -33.192 1.00 112.30 ? 350 TYR A CE2 1 
ATOM   2541 C  CZ  . TYR A 1 339 ? -39.203 -58.331 -33.459 1.00 112.10 ? 350 TYR A CZ  1 
ATOM   2542 O  OH  . TYR A 1 339 ? -40.356 -57.798 -33.965 1.00 111.20 ? 350 TYR A OH  1 
ATOM   2543 N  N   . LEU A 1 340 ? -33.402 -61.350 -29.919 1.00 117.55 ? 351 LEU A N   1 
ATOM   2544 C  CA  . LEU A 1 340 ? -32.229 -62.181 -29.680 1.00 120.16 ? 351 LEU A CA  1 
ATOM   2545 C  C   . LEU A 1 340 ? -32.568 -63.421 -28.874 1.00 119.83 ? 351 LEU A C   1 
ATOM   2546 O  O   . LEU A 1 340 ? -32.289 -64.536 -29.283 1.00 122.31 ? 351 LEU A O   1 
ATOM   2547 C  CB  . LEU A 1 340 ? -31.139 -61.389 -28.954 1.00 120.14 ? 351 LEU A CB  1 
ATOM   2548 C  CG  . LEU A 1 340 ? -30.394 -60.265 -29.680 1.00 121.62 ? 351 LEU A CG  1 
ATOM   2549 C  CD1 . LEU A 1 340 ? -29.277 -59.744 -28.791 1.00 121.82 ? 351 LEU A CD1 1 
ATOM   2550 C  CD2 . LEU A 1 340 ? -29.830 -60.718 -31.014 1.00 125.49 ? 351 LEU A CD2 1 
ATOM   2551 N  N   . ILE A 1 341 ? -33.188 -63.215 -27.725 1.00 116.88 ? 352 ILE A N   1 
ATOM   2552 C  CA  . ILE A 1 341 ? -33.527 -64.305 -26.825 1.00 116.49 ? 352 ILE A CA  1 
ATOM   2553 C  C   . ILE A 1 341 ? -34.504 -65.280 -27.482 1.00 117.20 ? 352 ILE A C   1 
ATOM   2554 O  O   . ILE A 1 341 ? -34.676 -66.403 -27.025 1.00 117.86 ? 352 ILE A O   1 
ATOM   2555 C  CB  . ILE A 1 341 ? -34.108 -63.757 -25.507 1.00 113.10 ? 352 ILE A CB  1 
ATOM   2556 C  CG1 . ILE A 1 341 ? -33.324 -62.520 -25.059 1.00 112.34 ? 352 ILE A CG1 1 
ATOM   2557 C  CG2 . ILE A 1 341 ? -34.093 -64.832 -24.420 1.00 113.12 ? 352 ILE A CG2 1 
ATOM   2558 C  CD1 . ILE A 1 341 ? -34.113 -61.578 -24.199 1.00 108.96 ? 352 ILE A CD1 1 
ATOM   2559 N  N   . GLU A 1 342 ? -35.137 -64.837 -28.559 1.00 117.23 ? 353 GLU A N   1 
ATOM   2560 C  CA  . GLU A 1 342 ? -36.016 -65.681 -29.346 1.00 118.20 ? 353 GLU A CA  1 
ATOM   2561 C  C   . GLU A 1 342 ? -35.322 -66.178 -30.611 1.00 121.86 ? 353 GLU A C   1 
ATOM   2562 O  O   . GLU A 1 342 ? -35.843 -67.042 -31.343 1.00 123.55 ? 353 GLU A O   1 
ATOM   2563 C  CB  . GLU A 1 342 ? -37.280 -64.913 -29.700 1.00 115.93 ? 353 GLU A CB  1 
ATOM   2564 C  CG  . GLU A 1 342 ? -38.296 -64.904 -28.590 1.00 112.90 ? 353 GLU A CG  1 
ATOM   2565 C  CD  . GLU A 1 342 ? -38.813 -66.295 -28.249 1.00 113.57 ? 353 GLU A CD  1 
ATOM   2566 O  OE1 . GLU A 1 342 ? -38.870 -67.169 -29.151 1.00 116.03 ? 353 GLU A OE1 1 
ATOM   2567 O  OE2 . GLU A 1 342 ? -39.160 -66.516 -27.069 1.00 111.77 ? 353 GLU A OE2 1 
ATOM   2568 N  N   . GLU A 1 343 ? -34.134 -65.616 -30.850 1.00 123.19 ? 354 GLU A N   1 
ATOM   2569 C  CA  . GLU A 1 343 ? -33.298 -65.950 -32.002 1.00 126.88 ? 354 GLU A CA  1 
ATOM   2570 C  C   . GLU A 1 343 ? -33.924 -65.513 -33.330 1.00 127.53 ? 354 GLU A C   1 
ATOM   2571 O  O   . GLU A 1 343 ? -33.929 -66.268 -34.303 1.00 130.37 ? 354 GLU A O   1 
ATOM   2572 C  CB  . GLU A 1 343 ? -32.942 -67.441 -31.995 1.00 129.66 ? 354 GLU A CB  1 
ATOM   2573 C  CG  . GLU A 1 343 ? -32.297 -67.915 -30.693 1.00 129.33 ? 354 GLU A CG  1 
ATOM   2574 C  CD  . GLU A 1 343 ? -32.524 -69.400 -30.430 1.00 130.63 ? 354 GLU A CD  1 
ATOM   2575 O  OE1 . GLU A 1 343 ? -33.535 -69.959 -30.921 1.00 130.03 ? 354 GLU A OE1 1 
ATOM   2576 O  OE2 . GLU A 1 343 ? -31.690 -70.011 -29.728 1.00 132.40 ? 354 GLU A OE2 1 
HETATM 2577 N  N   . MSE A 1 344 ? -34.428 -64.283 -33.366 1.00 125.10 ? 355 MSE A N   1 
HETATM 2578 C  CA  . MSE A 1 344 ? -35.063 -63.736 -34.570 1.00 125.64 ? 355 MSE A CA  1 
HETATM 2579 C  C   . MSE A 1 344 ? -34.205 -62.641 -35.190 1.00 126.98 ? 355 MSE A C   1 
HETATM 2580 O  O   . MSE A 1 344 ? -34.508 -61.436 -35.092 1.00 125.07 ? 355 MSE A O   1 
HETATM 2581 C  CB  . MSE A 1 344 ? -36.435 -63.175 -34.233 1.00 122.27 ? 355 MSE A CB  1 
HETATM 2582 C  CG  . MSE A 1 344 ? -37.177 -63.971 -33.198 1.00 120.44 ? 355 MSE A CG  1 
HETATM 2583 SE SE  . MSE A 1 344 ? -39.051 -63.852 -33.570 1.00 118.63 ? 355 MSE A SE  1 
HETATM 2584 C  CE  . MSE A 1 344 ? -39.542 -65.420 -32.531 1.00 118.70 ? 355 MSE A CE  1 
ATOM   2585 N  N   . TYR A 1 345 ? -33.141 -63.072 -35.847 1.00 130.47 ? 356 TYR A N   1 
ATOM   2586 C  CA  . TYR A 1 345 ? -32.054 -62.182 -36.223 1.00 132.13 ? 356 TYR A CA  1 
ATOM   2587 C  C   . TYR A 1 345 ? -32.441 -61.236 -37.348 1.00 132.72 ? 356 TYR A C   1 
ATOM   2588 O  O   . TYR A 1 345 ? -32.123 -60.053 -37.292 1.00 131.71 ? 356 TYR A O   1 
ATOM   2589 C  CB  . TYR A 1 345 ? -30.822 -63.021 -36.558 1.00 136.11 ? 356 TYR A CB  1 
ATOM   2590 C  CG  . TYR A 1 345 ? -30.524 -64.038 -35.456 1.00 135.86 ? 356 TYR A CG  1 
ATOM   2591 C  CD1 . TYR A 1 345 ? -29.785 -63.671 -34.333 1.00 134.52 ? 356 TYR A CD1 1 
ATOM   2592 C  CD2 . TYR A 1 345 ? -30.977 -65.358 -35.583 1.00 137.13 ? 356 TYR A CD2 1 
ATOM   2593 C  CE1 . TYR A 1 345 ? -29.411 -64.594 -33.409 1.00 134.63 ? 356 TYR A CE1 1 
ATOM   2594 C  CE2 . TYR A 1 345 ? -30.609 -66.292 -34.662 1.00 137.18 ? 356 TYR A CE2 1 
ATOM   2595 C  CZ  . TYR A 1 345 ? -29.825 -65.896 -33.578 1.00 135.96 ? 356 TYR A CZ  1 
ATOM   2596 O  OH  . TYR A 1 345 ? -29.454 -66.795 -32.660 1.00 136.20 ? 356 TYR A OH  1 
ATOM   2597 N  N   . ASP A 1 346 ? -33.154 -61.765 -38.342 1.00 134.45 ? 357 ASP A N   1 
ATOM   2598 C  CA  . ASP A 1 346 ? -33.658 -60.979 -39.470 1.00 135.26 ? 357 ASP A CA  1 
ATOM   2599 C  C   . ASP A 1 346 ? -34.428 -59.769 -38.962 1.00 131.50 ? 357 ASP A C   1 
ATOM   2600 O  O   . ASP A 1 346 ? -34.384 -58.691 -39.558 1.00 131.75 ? 357 ASP A O   1 
ATOM   2601 C  CB  . ASP A 1 346 ? -34.560 -61.846 -40.365 1.00 136.94 ? 357 ASP A CB  1 
ATOM   2602 C  CG  . ASP A 1 346 ? -34.817 -61.221 -41.752 1.00 138.88 ? 357 ASP A CG  1 
ATOM   2603 O  OD1 . ASP A 1 346 ? -34.843 -59.968 -41.883 1.00 137.31 ? 357 ASP A OD1 1 
ATOM   2604 O  OD2 . ASP A 1 346 ? -35.011 -61.996 -42.719 1.00 142.14 ? 357 ASP A OD2 1 
ATOM   2605 N  N   . GLU A 1 347 ? -35.123 -59.963 -37.847 1.00 128.19 ? 358 GLU A N   1 
ATOM   2606 C  CA  . GLU A 1 347 ? -35.892 -58.907 -37.207 1.00 124.53 ? 358 GLU A CA  1 
ATOM   2607 C  C   . GLU A 1 347 ? -34.978 -57.996 -36.402 1.00 123.37 ? 358 GLU A C   1 
ATOM   2608 O  O   . GLU A 1 347 ? -34.993 -56.779 -36.582 1.00 122.51 ? 358 GLU A O   1 
ATOM   2609 C  CB  . GLU A 1 347 ? -36.964 -59.518 -36.310 1.00 121.78 ? 358 GLU A CB  1 
ATOM   2610 C  CG  . GLU A 1 347 ? -38.051 -60.295 -37.062 1.00 122.42 ? 358 GLU A CG  1 
ATOM   2611 C  CD  . GLU A 1 347 ? -37.687 -61.756 -37.356 1.00 125.46 ? 358 GLU A CD  1 
ATOM   2612 O  OE1 . GLU A 1 347 ? -36.480 -62.104 -37.421 1.00 127.67 ? 358 GLU A OE1 1 
ATOM   2613 O  OE2 . GLU A 1 347 ? -38.633 -62.560 -37.530 1.00 125.79 ? 358 GLU A OE2 1 
ATOM   2614 N  N   . ALA A 1 348 ? -34.173 -58.604 -35.533 1.00 123.58 ? 359 ALA A N   1 
ATOM   2615 C  CA  . ALA A 1 348 ? -33.235 -57.883 -34.680 1.00 122.63 ? 359 ALA A CA  1 
ATOM   2616 C  C   . ALA A 1 348 ? -32.327 -56.964 -35.479 1.00 124.98 ? 359 ALA A C   1 
ATOM   2617 O  O   . ALA A 1 348 ? -32.164 -55.801 -35.123 1.00 123.54 ? 359 ALA A O   1 
ATOM   2618 C  CB  . ALA A 1 348 ? -32.413 -58.852 -33.857 1.00 123.21 ? 359 ALA A CB  1 
ATOM   2619 N  N   . ILE A 1 349 ? -31.744 -57.476 -36.560 1.00 128.75 ? 360 ILE A N   1 
ATOM   2620 C  CA  . ILE A 1 349 ? -30.926 -56.634 -37.428 1.00 131.40 ? 360 ILE A CA  1 
ATOM   2621 C  C   . ILE A 1 349 ? -31.782 -55.512 -38.011 1.00 130.09 ? 360 ILE A C   1 
ATOM   2622 O  O   . ILE A 1 349 ? -31.433 -54.343 -37.875 1.00 129.40 ? 360 ILE A O   1 
ATOM   2623 C  CB  . ILE A 1 349 ? -30.145 -57.427 -38.536 1.00 136.11 ? 360 ILE A CB  1 
ATOM   2624 C  CG1 . ILE A 1 349 ? -31.093 -58.117 -39.531 1.00 137.13 ? 360 ILE A CG1 1 
ATOM   2625 C  CG2 . ILE A 1 349 ? -29.151 -58.408 -37.897 1.00 137.67 ? 360 ILE A CG2 1 
ATOM   2626 C  CD1 . ILE A 1 349 ? -30.470 -58.468 -40.885 1.00 141.85 ? 360 ILE A CD1 1 
ATOM   2627 N  N   . GLN A 1 350 ? -32.923 -55.872 -38.598 1.00 129.78 ? 361 GLN A N   1 
ATOM   2628 C  CA  . GLN A 1 350 ? -33.801 -54.901 -39.239 1.00 128.98 ? 361 GLN A CA  1 
ATOM   2629 C  C   . GLN A 1 350 ? -33.981 -53.701 -38.330 1.00 125.50 ? 361 GLN A C   1 
ATOM   2630 O  O   . GLN A 1 350 ? -33.903 -52.552 -38.779 1.00 125.69 ? 361 GLN A O   1 
ATOM   2631 C  CB  . GLN A 1 350 ? -35.157 -55.523 -39.582 1.00 128.30 ? 361 GLN A CB  1 
ATOM   2632 C  CG  . GLN A 1 350 ? -36.056 -54.620 -40.444 1.00 127.92 ? 361 GLN A CG  1 
ATOM   2633 C  CD  . GLN A 1 350 ? -37.211 -55.368 -41.119 1.00 128.94 ? 361 GLN A CD  1 
ATOM   2634 O  OE1 . GLN A 1 350 ? -37.880 -56.208 -40.502 1.00 127.29 ? 361 GLN A OE1 1 
ATOM   2635 N  NE2 . GLN A 1 350 ? -37.454 -55.052 -42.394 1.00 131.86 ? 361 GLN A NE2 1 
ATOM   2636 N  N   . ASP A 1 351 ? -34.196 -53.994 -37.047 1.00 122.53 ? 362 ASP A N   1 
ATOM   2637 C  CA  . ASP A 1 351 ? -34.353 -52.991 -35.995 1.00 119.18 ? 362 ASP A CA  1 
ATOM   2638 C  C   . ASP A 1 351 ? -33.115 -52.118 -35.797 1.00 119.99 ? 362 ASP A C   1 
ATOM   2639 O  O   . ASP A 1 351 ? -33.206 -50.892 -35.890 1.00 119.06 ? 362 ASP A O   1 
ATOM   2640 C  CB  . ASP A 1 351 ? -34.739 -53.665 -34.674 1.00 116.70 ? 362 ASP A CB  1 
ATOM   2641 C  CG  . ASP A 1 351 ? -36.190 -54.072 -34.638 1.00 114.10 ? 362 ASP A CG  1 
ATOM   2642 O  OD1 . ASP A 1 351 ? -36.884 -53.888 -35.658 1.00 114.70 ? 362 ASP A OD1 1 
ATOM   2643 O  OD2 . ASP A 1 351 ? -36.641 -54.570 -33.587 1.00 111.62 ? 362 ASP A OD2 1 
ATOM   2644 N  N   . TYR A 1 352 ? -31.967 -52.744 -35.525 1.00 121.89 ? 363 TYR A N   1 
ATOM   2645 C  CA  . TYR A 1 352 ? -30.714 -52.010 -35.368 1.00 123.08 ? 363 TYR A CA  1 
ATOM   2646 C  C   . TYR A 1 352 ? -30.437 -51.186 -36.608 1.00 125.59 ? 363 TYR A C   1 
ATOM   2647 O  O   . TYR A 1 352 ? -29.970 -50.052 -36.516 1.00 125.36 ? 363 TYR A O   1 
ATOM   2648 C  CB  . TYR A 1 352 ? -29.543 -52.953 -35.120 1.00 125.49 ? 363 TYR A CB  1 
ATOM   2649 C  CG  . TYR A 1 352 ? -29.540 -53.614 -33.771 1.00 123.41 ? 363 TYR A CG  1 
ATOM   2650 C  CD1 . TYR A 1 352 ? -29.584 -52.861 -32.604 1.00 120.32 ? 363 TYR A CD1 1 
ATOM   2651 C  CD2 . TYR A 1 352 ? -29.472 -54.998 -33.658 1.00 124.79 ? 363 TYR A CD2 1 
ATOM   2652 C  CE1 . TYR A 1 352 ? -29.580 -53.472 -31.350 1.00 118.66 ? 363 TYR A CE1 1 
ATOM   2653 C  CE2 . TYR A 1 352 ? -29.463 -55.619 -32.410 1.00 123.11 ? 363 TYR A CE2 1 
ATOM   2654 C  CZ  . TYR A 1 352 ? -29.516 -54.851 -31.257 1.00 120.08 ? 363 TYR A CZ  1 
ATOM   2655 O  OH  . TYR A 1 352 ? -29.516 -55.457 -30.017 1.00 118.63 ? 363 TYR A OH  1 
ATOM   2656 N  N   . GLU A 1 353 ? -30.742 -51.769 -37.764 1.00 128.14 ? 364 GLU A N   1 
ATOM   2657 C  CA  . GLU A 1 353 ? -30.599 -51.093 -39.044 1.00 130.90 ? 364 GLU A CA  1 
ATOM   2658 C  C   . GLU A 1 353 ? -31.490 -49.851 -39.129 1.00 128.63 ? 364 GLU A C   1 
ATOM   2659 O  O   . GLU A 1 353 ? -31.088 -48.826 -39.698 1.00 129.97 ? 364 GLU A O   1 
ATOM   2660 C  CB  . GLU A 1 353 ? -30.876 -52.061 -40.198 1.00 133.87 ? 364 GLU A CB  1 
ATOM   2661 C  CG  . GLU A 1 353 ? -29.728 -53.043 -40.467 1.00 137.56 ? 364 GLU A CG  1 
ATOM   2662 C  CD  . GLU A 1 353 ? -30.087 -54.148 -41.457 1.00 140.13 ? 364 GLU A CD  1 
ATOM   2663 O  OE1 . GLU A 1 353 ? -31.279 -54.281 -41.821 1.00 138.64 ? 364 GLU A OE1 1 
ATOM   2664 O  OE2 . GLU A 1 353 ? -29.172 -54.897 -41.867 1.00 143.81 ? 364 GLU A OE2 1 
ATOM   2665 N  N   . THR A 1 354 ? -32.687 -49.936 -38.555 1.00 125.36 ? 365 THR A N   1 
ATOM   2666 C  CA  . THR A 1 354 ? -33.556 -48.766 -38.469 1.00 122.98 ? 365 THR A CA  1 
ATOM   2667 C  C   . THR A 1 354 ? -32.963 -47.749 -37.477 1.00 121.03 ? 365 THR A C   1 
ATOM   2668 O  O   . THR A 1 354 ? -32.937 -46.546 -37.753 1.00 121.07 ? 365 THR A O   1 
ATOM   2669 C  CB  . THR A 1 354 ? -35.028 -49.140 -38.124 1.00 120.15 ? 365 THR A CB  1 
ATOM   2670 O  OG1 . THR A 1 354 ? -35.432 -50.292 -38.908 1.00 122.07 ? 365 THR A OG1 1 
ATOM   2671 C  CG2 . THR A 1 354 ? -35.977 -47.971 -38.463 1.00 118.84 ? 365 THR A CG2 1 
ATOM   2672 N  N   . ALA A 1 355 ? -32.461 -48.240 -36.345 1.00 119.59 ? 366 ALA A N   1 
ATOM   2673 C  CA  . ALA A 1 355 ? -31.807 -47.384 -35.350 1.00 118.05 ? 366 ALA A CA  1 
ATOM   2674 C  C   . ALA A 1 355 ? -30.519 -46.767 -35.903 1.00 121.20 ? 366 ALA A C   1 
ATOM   2675 O  O   . ALA A 1 355 ? -30.152 -45.640 -35.543 1.00 120.54 ? 366 ALA A O   1 
ATOM   2676 C  CB  . ALA A 1 355 ? -31.518 -48.161 -34.082 1.00 116.30 ? 366 ALA A CB  1 
ATOM   2677 N  N   . GLN A 1 356 ? -29.843 -47.518 -36.774 1.00 124.77 ? 367 GLN A N   1 
ATOM   2678 C  CA  . GLN A 1 356 ? -28.667 -47.037 -37.498 1.00 128.43 ? 367 GLN A CA  1 
ATOM   2679 C  C   . GLN A 1 356 ? -28.989 -45.738 -38.235 1.00 128.91 ? 367 GLN A C   1 
ATOM   2680 O  O   . GLN A 1 356 ? -28.242 -44.753 -38.128 1.00 129.89 ? 367 GLN A O   1 
ATOM   2681 C  CB  . GLN A 1 356 ? -28.172 -48.115 -38.484 1.00 132.31 ? 367 GLN A CB  1 
ATOM   2682 C  CG  . GLN A 1 356 ? -26.868 -47.789 -39.239 1.00 136.66 ? 367 GLN A CG  1 
ATOM   2683 C  CD  . GLN A 1 356 ? -25.666 -47.617 -38.314 1.00 136.83 ? 367 GLN A CD  1 
ATOM   2684 O  OE1 . GLN A 1 356 ? -25.168 -48.584 -37.731 1.00 137.24 ? 367 GLN A OE1 1 
ATOM   2685 N  NE2 . GLN A 1 356 ? -25.192 -46.376 -38.182 1.00 136.67 ? 367 GLN A NE2 1 
ATOM   2686 N  N   . GLU A 1 357 ? -30.112 -45.742 -38.957 1.00 128.35 ? 368 GLU A N   1 
ATOM   2687 C  CA  . GLU A 1 357 ? -30.571 -44.568 -39.695 1.00 128.96 ? 368 GLU A CA  1 
ATOM   2688 C  C   . GLU A 1 357 ? -30.723 -43.344 -38.781 1.00 126.07 ? 368 GLU A C   1 
ATOM   2689 O  O   . GLU A 1 357 ? -30.737 -42.195 -39.257 1.00 127.27 ? 368 GLU A O   1 
ATOM   2690 C  CB  . GLU A 1 357 ? -31.882 -44.867 -40.431 1.00 128.55 ? 368 GLU A CB  1 
ATOM   2691 C  CG  . GLU A 1 357 ? -32.180 -43.884 -41.572 1.00 131.47 ? 368 GLU A CG  1 
ATOM   2692 C  CD  . GLU A 1 357 ? -33.355 -44.303 -42.451 1.00 132.00 ? 368 GLU A CD  1 
ATOM   2693 O  OE1 . GLU A 1 357 ? -34.278 -44.990 -41.944 1.00 129.01 ? 368 GLU A OE1 1 
ATOM   2694 O  OE2 . GLU A 1 357 ? -33.352 -43.935 -43.654 1.00 135.68 ? 368 GLU A OE2 1 
ATOM   2695 N  N   . HIS A 1 358 ? -30.797 -43.595 -37.471 1.00 122.52 ? 369 HIS A N   1 
ATOM   2696 C  CA  . HIS A 1 358 ? -30.966 -42.518 -36.499 1.00 119.64 ? 369 HIS A CA  1 
ATOM   2697 C  C   . HIS A 1 358 ? -29.703 -42.183 -35.687 1.00 120.03 ? 369 HIS A C   1 
ATOM   2698 O  O   . HIS A 1 358 ? -29.405 -41.009 -35.470 1.00 119.53 ? 369 HIS A O   1 
ATOM   2699 C  CB  . HIS A 1 358 ? -32.189 -42.788 -35.624 1.00 115.69 ? 369 HIS A CB  1 
ATOM   2700 C  CG  . HIS A 1 358 ? -33.467 -42.856 -36.405 1.00 115.33 ? 369 HIS A CG  1 
ATOM   2701 N  ND1 . HIS A 1 358 ? -33.658 -43.744 -37.445 1.00 117.68 ? 369 HIS A ND1 1 
ATOM   2702 C  CD2 . HIS A 1 358 ? -34.613 -42.138 -36.312 1.00 113.12 ? 369 HIS A CD2 1 
ATOM   2703 C  CE1 . HIS A 1 358 ? -34.868 -43.576 -37.951 1.00 116.88 ? 369 HIS A CE1 1 
ATOM   2704 N  NE2 . HIS A 1 358 ? -35.469 -42.608 -37.282 1.00 114.20 ? 369 HIS A NE2 1 
ATOM   2705 N  N   . ASN A 1 359 ? -28.952 -43.196 -35.258 1.00 121.12 ? 370 ASN A N   1 
ATOM   2706 C  CA  . ASN A 1 359 ? -27.637 -42.941 -34.665 1.00 122.42 ? 370 ASN A CA  1 
ATOM   2707 C  C   . ASN A 1 359 ? -26.480 -43.553 -35.424 1.00 126.72 ? 370 ASN A C   1 
ATOM   2708 O  O   . ASN A 1 359 ? -26.350 -44.781 -35.517 1.00 127.85 ? 370 ASN A O   1 
ATOM   2709 C  CB  . ASN A 1 359 ? -27.584 -43.337 -33.198 1.00 119.83 ? 370 ASN A CB  1 
ATOM   2710 C  CG  . ASN A 1 359 ? -28.042 -42.221 -32.287 1.00 116.54 ? 370 ASN A CG  1 
ATOM   2711 O  OD1 . ASN A 1 359 ? -28.990 -41.490 -32.602 1.00 115.07 ? 370 ASN A OD1 1 
ATOM   2712 N  ND2 . ASN A 1 359 ? -27.371 -42.079 -31.143 1.00 115.55 ? 370 ASN A ND2 1 
ATOM   2713 N  N   . GLU A 1 360 ? -25.638 -42.669 -35.948 1.00 129.24 ? 371 GLU A N   1 
ATOM   2714 C  CA  . GLU A 1 360 ? -24.544 -43.059 -36.825 1.00 133.81 ? 371 GLU A CA  1 
ATOM   2715 C  C   . GLU A 1 360 ? -23.394 -43.760 -36.092 1.00 135.37 ? 371 GLU A C   1 
ATOM   2716 O  O   . GLU A 1 360 ? -22.822 -44.730 -36.607 1.00 138.35 ? 371 GLU A O   1 
ATOM   2717 C  CB  . GLU A 1 360 ? -24.020 -41.837 -37.594 1.00 136.30 ? 371 GLU A CB  1 
ATOM   2718 C  CG  . GLU A 1 360 ? -25.008 -41.244 -38.609 1.00 136.44 ? 371 GLU A CG  1 
ATOM   2719 C  CD  . GLU A 1 360 ? -25.301 -42.181 -39.783 1.00 139.04 ? 371 GLU A CD  1 
ATOM   2720 O  OE1 . GLU A 1 360 ? -24.380 -42.447 -40.592 1.00 143.28 ? 371 GLU A OE1 1 
ATOM   2721 O  OE2 . GLU A 1 360 ? -26.459 -42.647 -39.896 1.00 136.95 ? 371 GLU A OE2 1 
ATOM   2722 N  N   . ASN A 1 361 ? -23.064 -43.277 -34.892 1.00 133.54 ? 372 ASN A N   1 
ATOM   2723 C  CA  . ASN A 1 361 ? -21.863 -43.745 -34.187 1.00 135.38 ? 372 ASN A CA  1 
ATOM   2724 C  C   . ASN A 1 361 ? -22.080 -44.428 -32.835 1.00 132.51 ? 372 ASN A C   1 
ATOM   2725 O  O   . ASN A 1 361 ? -21.127 -44.987 -32.271 1.00 134.28 ? 372 ASN A O   1 
ATOM   2726 C  CB  . ASN A 1 361 ? -20.823 -42.614 -34.054 1.00 137.45 ? 372 ASN A CB  1 
ATOM   2727 C  CG  . ASN A 1 361 ? -19.796 -42.619 -35.190 1.00 142.26 ? 372 ASN A CG  1 
ATOM   2728 O  OD1 . ASN A 1 361 ? -19.888 -43.403 -36.140 1.00 144.22 ? 372 ASN A OD1 1 
ATOM   2729 N  ND2 . ASN A 1 361 ? -18.805 -41.741 -35.089 1.00 144.37 ? 372 ASN A ND2 1 
ATOM   2730 N  N   . ASP A 1 362 ? -23.312 -44.388 -32.324 1.00 128.37 ? 373 ASP A N   1 
ATOM   2731 C  CA  . ASP A 1 362 ? -23.636 -45.048 -31.057 1.00 125.54 ? 373 ASP A CA  1 
ATOM   2732 C  C   . ASP A 1 362 ? -23.105 -46.495 -30.990 1.00 127.27 ? 373 ASP A C   1 
ATOM   2733 O  O   . ASP A 1 362 ? -23.541 -47.363 -31.757 1.00 128.05 ? 373 ASP A O   1 
ATOM   2734 C  CB  . ASP A 1 362 ? -25.152 -45.025 -30.798 1.00 121.57 ? 373 ASP A CB  1 
ATOM   2735 C  CG  . ASP A 1 362 ? -25.557 -45.859 -29.571 1.00 118.89 ? 373 ASP A CG  1 
ATOM   2736 O  OD1 . ASP A 1 362 ? -24.689 -46.543 -28.979 1.00 120.24 ? 373 ASP A OD1 1 
ATOM   2737 O  OD2 . ASP A 1 362 ? -26.746 -45.834 -29.191 1.00 115.66 ? 373 ASP A OD2 1 
ATOM   2738 N  N   . GLN A 1 363 ? -22.179 -46.730 -30.050 1.00 127.92 ? 374 GLN A N   1 
ATOM   2739 C  CA  . GLN A 1 363 ? -21.536 -48.038 -29.834 1.00 129.85 ? 374 GLN A CA  1 
ATOM   2740 C  C   . GLN A 1 363 ? -22.540 -49.154 -29.586 1.00 127.49 ? 374 GLN A C   1 
ATOM   2741 O  O   . GLN A 1 363 ? -22.421 -50.245 -30.144 1.00 129.35 ? 374 GLN A O   1 
ATOM   2742 C  CB  . GLN A 1 363 ? -20.567 -47.970 -28.650 1.00 130.47 ? 374 GLN A CB  1 
ATOM   2743 C  CG  . GLN A 1 363 ? -19.548 -46.836 -28.735 1.00 132.33 ? 374 GLN A CG  1 
ATOM   2744 C  CD  . GLN A 1 363 ? -18.978 -46.427 -27.369 1.00 131.13 ? 374 GLN A CD  1 
ATOM   2745 O  OE1 . GLN A 1 363 ? -19.660 -46.518 -26.326 1.00 127.51 ? 374 GLN A OE1 1 
ATOM   2746 N  NE2 . GLN A 1 363 ? -17.723 -45.953 -27.379 1.00 134.37 ? 374 GLN A NE2 1 
ATOM   2747 N  N   . GLN A 1 364 ? -23.520 -48.867 -28.736 1.00 123.55 ? 375 GLN A N   1 
ATOM   2748 C  CA  . GLN A 1 364 ? -24.582 -49.802 -28.435 1.00 121.12 ? 375 GLN A CA  1 
ATOM   2749 C  C   . GLN A 1 364 ? -25.274 -50.293 -29.703 1.00 121.96 ? 375 GLN A C   1 
ATOM   2750 O  O   . GLN A 1 364 ? -25.495 -51.489 -29.841 1.00 122.49 ? 375 GLN A O   1 
ATOM   2751 C  CB  . GLN A 1 364 ? -25.600 -49.174 -27.482 1.00 116.98 ? 375 GLN A CB  1 
ATOM   2752 C  CG  . GLN A 1 364 ? -25.207 -49.193 -25.995 1.00 115.61 ? 375 GLN A CG  1 
ATOM   2753 C  CD  . GLN A 1 364 ? -24.829 -47.808 -25.439 1.00 115.48 ? 375 GLN A CD  1 
ATOM   2754 O  OE1 . GLN A 1 364 ? -24.074 -47.044 -26.063 1.00 117.55 ? 375 GLN A OE1 1 
ATOM   2755 N  NE2 . GLN A 1 364 ? -25.350 -47.488 -24.247 1.00 113.24 ? 375 GLN A NE2 1 
ATOM   2756 N  N   . ILE A 1 365 ? -25.605 -49.390 -30.629 1.00 122.31 ? 376 ILE A N   1 
ATOM   2757 C  CA  . ILE A 1 365 ? -26.241 -49.814 -31.884 1.00 123.46 ? 376 ILE A CA  1 
ATOM   2758 C  C   . ILE A 1 365 ? -25.260 -50.592 -32.771 1.00 127.81 ? 376 ILE A C   1 
ATOM   2759 O  O   . ILE A 1 365 ? -25.590 -51.659 -33.286 1.00 128.87 ? 376 ILE A O   1 
ATOM   2760 C  CB  . ILE A 1 365 ? -26.861 -48.650 -32.699 1.00 122.99 ? 376 ILE A CB  1 
ATOM   2761 C  CG1 . ILE A 1 365 ? -27.681 -47.724 -31.811 1.00 119.06 ? 376 ILE A CG1 1 
ATOM   2762 C  CG2 . ILE A 1 365 ? -27.748 -49.196 -33.823 1.00 123.67 ? 376 ILE A CG2 1 
ATOM   2763 C  CD1 . ILE A 1 365 ? -28.336 -46.584 -32.564 1.00 118.50 ? 376 ILE A CD1 1 
ATOM   2764 N  N   . ARG A 1 366 ? -24.058 -50.054 -32.944 1.00 130.48 ? 377 ARG A N   1 
ATOM   2765 C  CA  . ARG A 1 366 ? -23.041 -50.711 -33.756 1.00 134.93 ? 377 ARG A CA  1 
ATOM   2766 C  C   . ARG A 1 366 ? -22.764 -52.114 -33.225 1.00 135.77 ? 377 ARG A C   1 
ATOM   2767 O  O   . ARG A 1 366 ? -22.789 -53.086 -33.980 1.00 138.37 ? 377 ARG A O   1 
ATOM   2768 C  CB  . ARG A 1 366 ? -21.757 -49.875 -33.799 1.00 137.53 ? 377 ARG A CB  1 
ATOM   2769 C  CG  . ARG A 1 366 ? -21.726 -48.787 -34.889 1.00 139.65 ? 377 ARG A CG  1 
ATOM   2770 C  CD  . ARG A 1 366 ? -20.620 -47.736 -34.647 1.00 141.62 ? 377 ARG A CD  1 
ATOM   2771 N  NE  . ARG A 1 366 ? -19.356 -48.326 -34.187 1.00 144.34 ? 377 ARG A NE  1 
ATOM   2772 C  CZ  . ARG A 1 366 ? -18.799 -48.110 -32.993 1.00 143.09 ? 377 ARG A CZ  1 
ATOM   2773 N  NH1 . ARG A 1 366 ? -19.368 -47.293 -32.116 1.00 139.12 ? 377 ARG A NH1 1 
ATOM   2774 N  NH2 . ARG A 1 366 ? -17.658 -48.707 -32.676 1.00 146.03 ? 377 ARG A NH2 1 
ATOM   2775 N  N   . GLU A 1 367 ? -22.540 -52.212 -31.918 1.00 133.69 ? 378 GLU A N   1 
ATOM   2776 C  CA  . GLU A 1 367 ? -22.216 -53.485 -31.282 1.00 134.65 ? 378 GLU A CA  1 
ATOM   2777 C  C   . GLU A 1 367 ? -23.374 -54.462 -31.341 1.00 132.98 ? 378 GLU A C   1 
ATOM   2778 O  O   . GLU A 1 367 ? -23.176 -55.683 -31.281 1.00 134.93 ? 378 GLU A O   1 
ATOM   2779 C  CB  . GLU A 1 367 ? -21.789 -53.269 -29.837 1.00 133.13 ? 378 GLU A CB  1 
ATOM   2780 C  CG  . GLU A 1 367 ? -20.461 -52.557 -29.709 1.00 135.58 ? 378 GLU A CG  1 
ATOM   2781 C  CD  . GLU A 1 367 ? -20.079 -52.314 -28.274 1.00 134.34 ? 378 GLU A CD  1 
ATOM   2782 O  OE1 . GLU A 1 367 ? -20.432 -53.156 -27.410 1.00 132.01 ? 378 GLU A OE1 1 
ATOM   2783 O  OE2 . GLU A 1 367 ? -19.417 -51.278 -28.012 1.00 135.91 ? 378 GLU A OE2 1 
ATOM   2784 N  N   . GLY A 1 368 ? -24.579 -53.909 -31.457 1.00 129.54 ? 379 GLY A N   1 
ATOM   2785 C  CA  . GLY A 1 368 ? -25.780 -54.708 -31.628 1.00 127.91 ? 379 GLY A CA  1 
ATOM   2786 C  C   . GLY A 1 368 ? -25.665 -55.603 -32.845 1.00 131.13 ? 379 GLY A C   1 
ATOM   2787 O  O   . GLY A 1 368 ? -25.748 -56.827 -32.723 1.00 132.02 ? 379 GLY A O   1 
ATOM   2788 N  N   . LEU A 1 369 ? -25.451 -54.986 -34.009 1.00 133.06 ? 380 LEU A N   1 
ATOM   2789 C  CA  . LEU A 1 369 ? -25.336 -55.709 -35.276 1.00 136.53 ? 380 LEU A CA  1 
ATOM   2790 C  C   . LEU A 1 369 ? -24.248 -56.767 -35.237 1.00 140.07 ? 380 LEU A C   1 
ATOM   2791 O  O   . LEU A 1 369 ? -24.490 -57.935 -35.550 1.00 141.51 ? 380 LEU A O   1 
ATOM   2792 C  CB  . LEU A 1 369 ? -25.042 -54.746 -36.428 1.00 138.59 ? 380 LEU A CB  1 
ATOM   2793 C  CG  . LEU A 1 369 ? -26.175 -53.998 -37.129 1.00 137.05 ? 380 LEU A CG  1 
ATOM   2794 C  CD1 . LEU A 1 369 ? -27.371 -54.894 -37.434 1.00 136.68 ? 380 LEU A CD1 1 
ATOM   2795 C  CD2 . LEU A 1 369 ? -26.585 -52.778 -36.329 1.00 133.00 ? 380 LEU A CD2 1 
ATOM   2796 N  N   . GLU A 1 370 ? -23.049 -56.348 -34.843 1.00 141.61 ? 381 GLU A N   1 
ATOM   2797 C  CA  . GLU A 1 370 ? -21.880 -57.217 -34.871 1.00 145.50 ? 381 GLU A CA  1 
ATOM   2798 C  C   . GLU A 1 370 ? -22.103 -58.467 -34.038 1.00 144.71 ? 381 GLU A C   1 
ATOM   2799 O  O   . GLU A 1 370 ? -21.707 -59.560 -34.441 1.00 147.67 ? 381 GLU A O   1 
ATOM   2800 C  CB  . GLU A 1 370 ? -20.630 -56.463 -34.413 1.00 147.00 ? 381 GLU A CB  1 
ATOM   2801 C  CG  . GLU A 1 370 ? -20.205 -55.348 -35.372 1.00 149.27 ? 381 GLU A CG  1 
ATOM   2802 C  CD  . GLU A 1 370 ? -18.885 -54.689 -34.984 1.00 151.93 ? 381 GLU A CD  1 
ATOM   2803 O  OE1 . GLU A 1 370 ? -18.602 -54.575 -33.771 1.00 150.30 ? 381 GLU A OE1 1 
ATOM   2804 O  OE2 . GLU A 1 370 ? -18.130 -54.278 -35.899 1.00 155.85 ? 381 GLU A OE2 1 
ATOM   2805 N  N   . LYS A 1 371 ? -22.754 -58.301 -32.890 1.00 140.88 ? 382 LYS A N   1 
ATOM   2806 C  CA  . LYS A 1 371 ? -23.100 -59.436 -32.053 1.00 139.90 ? 382 LYS A CA  1 
ATOM   2807 C  C   . LYS A 1 371 ? -24.173 -60.283 -32.729 1.00 139.59 ? 382 LYS A C   1 
ATOM   2808 O  O   . LYS A 1 371 ? -24.106 -61.508 -32.706 1.00 141.38 ? 382 LYS A O   1 
ATOM   2809 C  CB  . LYS A 1 371 ? -23.559 -58.975 -30.667 1.00 135.91 ? 382 LYS A CB  1 
ATOM   2810 C  CG  . LYS A 1 371 ? -23.869 -60.122 -29.697 1.00 134.90 ? 382 LYS A CG  1 
ATOM   2811 C  CD  . LYS A 1 371 ? -24.153 -59.630 -28.274 1.00 131.93 ? 382 LYS A CD  1 
ATOM   2812 C  CE  . LYS A 1 371 ? -24.890 -60.685 -27.433 1.00 130.29 ? 382 LYS A CE  1 
ATOM   2813 N  NZ  . LYS A 1 371 ? -24.036 -61.834 -26.999 1.00 133.36 ? 382 LYS A NZ  1 
ATOM   2814 N  N   . ALA A 1 372 ? -25.145 -59.620 -33.346 1.00 137.55 ? 383 ALA A N   1 
ATOM   2815 C  CA  . ALA A 1 372 ? -26.284 -60.301 -33.953 1.00 137.05 ? 383 ALA A CA  1 
ATOM   2816 C  C   . ALA A 1 372 ? -25.897 -61.027 -35.227 1.00 141.29 ? 383 ALA A C   1 
ATOM   2817 O  O   . ALA A 1 372 ? -26.162 -62.219 -35.374 1.00 142.54 ? 383 ALA A O   1 
ATOM   2818 C  CB  . ALA A 1 372 ? -27.411 -59.322 -34.225 1.00 134.08 ? 383 ALA A CB  1 
ATOM   2819 N  N   . GLN A 1 373 ? -25.264 -60.305 -36.144 1.00 143.65 ? 384 GLN A N   1 
ATOM   2820 C  CA  . GLN A 1 373 ? -24.859 -60.874 -37.424 1.00 148.02 ? 384 GLN A CA  1 
ATOM   2821 C  C   . GLN A 1 373 ? -23.891 -62.039 -37.244 1.00 151.23 ? 384 GLN A C   1 
ATOM   2822 O  O   . GLN A 1 373 ? -23.951 -63.017 -37.990 1.00 153.89 ? 384 GLN A O   1 
ATOM   2823 C  CB  . GLN A 1 373 ? -24.269 -59.797 -38.333 1.00 150.20 ? 384 GLN A CB  1 
ATOM   2824 C  CG  . GLN A 1 373 ? -25.326 -58.884 -38.948 1.00 148.11 ? 384 GLN A CG  1 
ATOM   2825 C  CD  . GLN A 1 373 ? -24.742 -57.638 -39.585 1.00 149.56 ? 384 GLN A CD  1 
ATOM   2826 O  OE1 . GLN A 1 373 ? -25.069 -57.304 -40.725 1.00 149.93 ? 384 GLN A OE1 1 
ATOM   2827 N  NE2 . GLN A 1 373 ? -23.875 -56.940 -38.850 1.00 150.58 ? 384 GLN A NE2 1 
ATOM   2828 N  N   . ARG A 1 374 ? -23.017 -61.930 -36.246 1.00 151.07 ? 385 ARG A N   1 
ATOM   2829 C  CA  . ARG A 1 374 ? -22.147 -63.031 -35.865 1.00 153.80 ? 385 ARG A CA  1 
ATOM   2830 C  C   . ARG A 1 374 ? -22.983 -64.286 -35.639 1.00 152.92 ? 385 ARG A C   1 
ATOM   2831 O  O   . ARG A 1 374 ? -22.738 -65.327 -36.250 1.00 156.18 ? 385 ARG A O   1 
ATOM   2832 C  CB  . ARG A 1 374 ? -21.352 -62.685 -34.605 1.00 152.83 ? 385 ARG A CB  1 
ATOM   2833 C  CG  . ARG A 1 374 ? -20.640 -63.876 -33.985 1.00 155.14 ? 385 ARG A CG  1 
ATOM   2834 C  CD  . ARG A 1 374 ? -19.884 -63.497 -32.735 1.00 154.35 ? 385 ARG A CD  1 
ATOM   2835 N  NE  . ARG A 1 374 ? -20.765 -62.968 -31.698 1.00 149.44 ? 385 ARG A NE  1 
ATOM   2836 C  CZ  . ARG A 1 374 ? -20.393 -62.751 -30.439 1.00 147.94 ? 385 ARG A CZ  1 
ATOM   2837 N  NH1 . ARG A 1 374 ? -19.151 -63.023 -30.050 1.00 150.98 ? 385 ARG A NH1 1 
ATOM   2838 N  NH2 . ARG A 1 374 ? -21.266 -62.267 -29.565 1.00 143.69 ? 385 ARG A NH2 1 
ATOM   2839 N  N   . LEU A 1 375 ? -23.985 -64.167 -34.774 1.00 148.63 ? 386 LEU A N   1 
ATOM   2840 C  CA  . LEU A 1 375 ? -24.864 -65.280 -34.448 1.00 147.44 ? 386 LEU A CA  1 
ATOM   2841 C  C   . LEU A 1 375 ? -25.741 -65.705 -35.619 1.00 148.36 ? 386 LEU A C   1 
ATOM   2842 O  O   . LEU A 1 375 ? -26.176 -66.855 -35.682 1.00 149.47 ? 386 LEU A O   1 
ATOM   2843 C  CB  . LEU A 1 375 ? -25.732 -64.937 -33.236 1.00 142.70 ? 386 LEU A CB  1 
ATOM   2844 C  CG  . LEU A 1 375 ? -25.152 -65.292 -31.863 1.00 141.93 ? 386 LEU A CG  1 
ATOM   2845 C  CD1 . LEU A 1 375 ? -24.187 -64.235 -31.337 1.00 141.55 ? 386 LEU A CD1 1 
ATOM   2846 C  CD2 . LEU A 1 375 ? -26.285 -65.505 -30.881 1.00 138.18 ? 386 LEU A CD2 1 
ATOM   2847 N  N   . LEU A 1 376 ? -25.990 -64.778 -36.541 1.00 148.10 ? 387 LEU A N   1 
ATOM   2848 C  CA  . LEU A 1 376 ? -26.823 -65.051 -37.712 1.00 149.02 ? 387 LEU A CA  1 
ATOM   2849 C  C   . LEU A 1 376 ? -26.205 -66.128 -38.592 1.00 153.72 ? 387 LEU A C   1 
ATOM   2850 O  O   . LEU A 1 376 ? -26.905 -67.029 -39.047 1.00 154.36 ? 387 LEU A O   1 
ATOM   2851 C  CB  . LEU A 1 376 ? -27.074 -63.768 -38.517 1.00 148.55 ? 387 LEU A CB  1 
ATOM   2852 C  CG  . LEU A 1 376 ? -27.942 -63.711 -39.790 1.00 149.57 ? 387 LEU A CG  1 
ATOM   2853 C  CD1 . LEU A 1 376 ? -27.142 -64.086 -41.033 1.00 154.69 ? 387 LEU A CD1 1 
ATOM   2854 C  CD2 . LEU A 1 376 ? -29.254 -64.500 -39.708 1.00 147.79 ? 387 LEU A CD2 1 
ATOM   2855 N  N   . LYS A 1 377 ? -24.899 -66.027 -38.825 1.00 157.14 ? 388 LYS A N   1 
ATOM   2856 C  CA  . LYS A 1 377 ? -24.193 -67.005 -39.642 1.00 161.98 ? 388 LYS A CA  1 
ATOM   2857 C  C   . LYS A 1 377 ? -24.140 -68.358 -38.948 1.00 162.57 ? 388 LYS A C   1 
ATOM   2858 O  O   . LYS A 1 377 ? -24.584 -69.357 -39.513 1.00 164.42 ? 388 LYS A O   1 
ATOM   2859 C  CB  . LYS A 1 377 ? -22.791 -66.514 -40.006 1.00 165.65 ? 388 LYS A CB  1 
ATOM   2860 C  CG  . LYS A 1 377 ? -22.768 -65.580 -41.210 1.00 167.28 ? 388 LYS A CG  1 
ATOM   2861 C  CD  . LYS A 1 377 ? -21.348 -65.148 -41.567 1.00 171.64 ? 388 LYS A CD  1 
ATOM   2862 C  CE  . LYS A 1 377 ? -20.549 -66.253 -42.265 1.00 176.76 ? 388 LYS A CE  1 
ATOM   2863 N  NZ  . LYS A 1 377 ? -20.919 -66.417 -43.699 1.00 179.21 ? 388 LYS A NZ  1 
ATOM   2864 N  N   . GLN A 1 378 ? -23.632 -68.382 -37.717 1.00 161.04 ? 389 GLN A N   1 
ATOM   2865 C  CA  . GLN A 1 378 ? -23.549 -69.620 -36.944 1.00 161.67 ? 389 GLN A CA  1 
ATOM   2866 C  C   . GLN A 1 378 ? -24.897 -70.322 -36.832 1.00 159.28 ? 389 GLN A C   1 
ATOM   2867 O  O   . GLN A 1 378 ? -24.958 -71.515 -36.556 1.00 160.57 ? 389 GLN A O   1 
ATOM   2868 C  CB  . GLN A 1 378 ? -22.970 -69.367 -35.554 1.00 160.19 ? 389 GLN A CB  1 
ATOM   2869 C  CG  . GLN A 1 378 ? -21.476 -69.087 -35.560 1.00 163.70 ? 389 GLN A CG  1 
ATOM   2870 C  CD  . GLN A 1 378 ? -20.796 -69.413 -34.236 1.00 163.55 ? 389 GLN A CD  1 
ATOM   2871 O  OE1 . GLN A 1 378 ? -21.390 -69.291 -33.160 1.00 160.04 ? 389 GLN A OE1 1 
ATOM   2872 N  NE2 . GLN A 1 378 ? -19.537 -69.826 -34.314 1.00 167.64 ? 389 GLN A NE2 1 
ATOM   2873 N  N   . SER A 1 379 ? -25.971 -69.575 -37.057 1.00 156.00 ? 390 SER A N   1 
ATOM   2874 C  CA  . SER A 1 379 ? -27.310 -70.138 -37.029 1.00 153.81 ? 390 SER A CA  1 
ATOM   2875 C  C   . SER A 1 379 ? -27.643 -70.776 -38.366 1.00 156.85 ? 390 SER A C   1 
ATOM   2876 O  O   . SER A 1 379 ? -28.218 -71.864 -38.407 1.00 157.37 ? 390 SER A O   1 
ATOM   2877 C  CB  . SER A 1 379 ? -28.346 -69.069 -36.673 1.00 149.24 ? 390 SER A CB  1 
ATOM   2878 O  OG  . SER A 1 379 ? -28.504 -68.136 -37.724 1.00 149.65 ? 390 SER A OG  1 
ATOM   2879 N  N   . GLN A 1 380 ? -27.275 -70.092 -39.450 1.00 159.03 ? 391 GLN A N   1 
ATOM   2880 C  CA  . GLN A 1 380 ? -27.560 -70.549 -40.819 1.00 162.39 ? 391 GLN A CA  1 
ATOM   2881 C  C   . GLN A 1 380 ? -26.902 -71.894 -41.131 1.00 166.59 ? 391 GLN A C   1 
ATOM   2882 O  O   . GLN A 1 380 ? -27.577 -72.828 -41.575 1.00 167.75 ? 391 GLN A O   1 
ATOM   2883 C  CB  . GLN A 1 380 ? -27.133 -69.505 -41.858 1.00 164.39 ? 391 GLN A CB  1 
ATOM   2884 C  CG  . GLN A 1 380 ? -28.026 -68.276 -41.931 1.00 160.91 ? 391 GLN A CG  1 
ATOM   2885 C  CD  . GLN A 1 380 ? -27.683 -67.381 -43.107 1.00 163.54 ? 391 GLN A CD  1 
ATOM   2886 O  OE1 . GLN A 1 380 ? -26.856 -66.472 -42.989 1.00 162.81 ? 391 GLN A OE1 1 
ATOM   2887 N  NE2 . GLN A 1 380 ? -28.308 -67.649 -44.257 1.00 166.85 ? 391 GLN A NE2 1 
ATOM   2888 N  N   . LYS A 1 381 ? -25.591 -71.984 -40.901 1.00 169.06 ? 392 LYS A N   1 
ATOM   2889 C  CA  . LYS A 1 381 ? -24.875 -73.249 -41.049 1.00 173.08 ? 392 LYS A CA  1 
ATOM   2890 C  C   . LYS A 1 381 ? -25.293 -74.223 -39.944 1.00 171.15 ? 392 LYS A C   1 
ATOM   2891 O  O   . LYS A 1 381 ? -25.031 -73.989 -38.760 1.00 168.66 ? 392 LYS A O   1 
ATOM   2892 C  CB  . LYS A 1 381 ? -23.354 -73.042 -41.057 1.00 176.39 ? 392 LYS A CB  1 
ATOM   2893 C  CG  . LYS A 1 381 ? -22.783 -72.407 -39.803 1.00 173.89 ? 392 LYS A CG  1 
ATOM   2894 C  CD  . LYS A 1 381 ? -21.629 -73.225 -39.268 1.00 177.24 ? 392 LYS A CD  1 
ATOM   2895 C  CE  . LYS A 1 381 ? -21.273 -72.798 -37.860 1.00 174.67 ? 392 LYS A CE  1 
ATOM   2896 N  NZ  . LYS A 1 381 ? -20.432 -73.808 -37.170 1.00 177.25 ? 392 LYS A NZ  1 
ATOM   2897 N  N   . ARG A 1 382 ? -25.965 -75.303 -40.341 1.00 172.42 ? 393 ARG A N   1 
ATOM   2898 C  CA  . ARG A 1 382 ? -26.437 -76.303 -39.385 1.00 170.91 ? 393 ARG A CA  1 
ATOM   2899 C  C   . ARG A 1 382 ? -25.286 -77.048 -38.722 1.00 173.59 ? 393 ARG A C   1 
ATOM   2900 O  O   . ARG A 1 382 ? -24.221 -77.246 -39.314 1.00 178.07 ? 393 ARG A O   1 
ATOM   2901 C  CB  . ARG A 1 382 ? -27.437 -77.278 -40.020 1.00 171.78 ? 393 ARG A CB  1 
ATOM   2902 C  CG  . ARG A 1 382 ? -27.016 -77.876 -41.354 1.00 176.83 ? 393 ARG A CG  1 
ATOM   2903 C  CD  . ARG A 1 382 ? -28.125 -78.759 -41.900 1.00 177.65 ? 393 ARG A CD  1 
ATOM   2904 N  NE  . ARG A 1 382 ? -27.976 -79.035 -43.330 1.00 182.50 ? 393 ARG A NE  1 
ATOM   2905 C  CZ  . ARG A 1 382 ? -28.788 -79.819 -44.039 1.00 184.33 ? 393 ARG A CZ  1 
ATOM   2906 N  NH1 . ARG A 1 382 ? -29.821 -80.426 -43.460 1.00 181.65 ? 393 ARG A NH1 1 
ATOM   2907 N  NH2 . ARG A 1 382 ? -28.566 -80.001 -45.336 1.00 189.12 ? 393 ARG A NH2 1 
ATOM   2908 N  N   . ASP A 1 383 ? -25.516 -77.430 -37.473 1.00 170.93 ? 394 ASP A N   1 
ATOM   2909 C  CA  . ASP A 1 383 ? -24.527 -78.127 -36.679 1.00 173.06 ? 394 ASP A CA  1 
ATOM   2910 C  C   . ASP A 1 383 ? -24.786 -79.627 -36.768 1.00 175.64 ? 394 ASP A C   1 
ATOM   2911 O  O   . ASP A 1 383 ? -25.925 -80.056 -36.991 1.00 174.41 ? 394 ASP A O   1 
ATOM   2912 C  CB  . ASP A 1 383 ? -24.599 -77.638 -35.230 1.00 169.22 ? 394 ASP A CB  1 
ATOM   2913 C  CG  . ASP A 1 383 ? -23.453 -78.140 -34.387 1.00 171.44 ? 394 ASP A CG  1 
ATOM   2914 O  OD1 . ASP A 1 383 ? -22.289 -77.821 -34.705 1.00 174.49 ? 394 ASP A OD1 1 
ATOM   2915 O  OD2 . ASP A 1 383 ? -23.720 -78.847 -33.396 1.00 170.27 ? 394 ASP A OD2 1 
ATOM   2916 N  N   . TYR A 1 384 ? -23.724 -80.413 -36.605 1.00 179.39 ? 395 TYR A N   1 
ATOM   2917 C  CA  . TYR A 1 384 ? -23.806 -81.872 -36.689 1.00 182.19 ? 395 TYR A CA  1 
ATOM   2918 C  C   . TYR A 1 384 ? -23.929 -82.478 -35.306 1.00 180.54 ? 395 TYR A C   1 
ATOM   2919 O  O   . TYR A 1 384 ? -24.742 -83.384 -35.080 1.00 179.92 ? 395 TYR A O   1 
ATOM   2920 C  CB  . TYR A 1 384 ? -22.585 -82.439 -37.418 1.00 187.95 ? 395 TYR A CB  1 
ATOM   2921 C  CG  . TYR A 1 384 ? -22.356 -81.796 -38.764 1.00 189.92 ? 395 TYR A CG  1 
ATOM   2922 C  CD1 . TYR A 1 384 ? -23.199 -82.075 -39.843 1.00 190.29 ? 395 TYR A CD1 1 
ATOM   2923 C  CD2 . TYR A 1 384 ? -21.308 -80.893 -38.958 1.00 191.56 ? 395 TYR A CD2 1 
ATOM   2924 C  CE1 . TYR A 1 384 ? -23.002 -81.478 -41.082 1.00 192.42 ? 395 TYR A CE1 1 
ATOM   2925 C  CE2 . TYR A 1 384 ? -21.100 -80.290 -40.196 1.00 193.71 ? 395 TYR A CE2 1 
ATOM   2926 C  CZ  . TYR A 1 384 ? -21.952 -80.588 -41.251 1.00 194.13 ? 395 TYR A CZ  1 
ATOM   2927 O  OH  . TYR A 1 384 ? -21.759 -80.000 -42.478 1.00 196.47 ? 395 TYR A OH  1 
ATOM   2928 N  N   . TYR A 1 385 ? -23.115 -81.961 -34.387 1.00 180.00 ? 396 TYR A N   1 
ATOM   2929 C  CA  . TYR A 1 385 ? -23.226 -82.283 -32.973 1.00 178.10 ? 396 TYR A CA  1 
ATOM   2930 C  C   . TYR A 1 385 ? -24.617 -81.902 -32.474 1.00 173.06 ? 396 TYR A C   1 
ATOM   2931 O  O   . TYR A 1 385 ? -25.097 -82.438 -31.477 1.00 171.49 ? 396 TYR A O   1 
ATOM   2932 C  CB  . TYR A 1 385 ? -22.165 -81.529 -32.167 1.00 178.09 ? 396 TYR A CB  1 
ATOM   2933 C  CG  . TYR A 1 385 ? -20.727 -81.917 -32.466 1.00 183.30 ? 396 TYR A CG  1 
ATOM   2934 C  CD1 . TYR A 1 385 ? -20.023 -81.327 -33.525 1.00 185.69 ? 396 TYR A CD1 1 
ATOM   2935 C  CD2 . TYR A 1 385 ? -20.061 -82.857 -31.673 1.00 186.03 ? 396 TYR A CD2 1 
ATOM   2936 C  CE1 . TYR A 1 385 ? -18.697 -81.671 -33.799 1.00 190.68 ? 396 TYR A CE1 1 
ATOM   2937 C  CE2 . TYR A 1 385 ? -18.734 -83.211 -31.939 1.00 191.03 ? 396 TYR A CE2 1 
ATOM   2938 C  CZ  . TYR A 1 385 ? -18.060 -82.612 -33.002 1.00 193.33 ? 396 TYR A CZ  1 
ATOM   2939 O  OH  . TYR A 1 385 ? -16.751 -82.948 -33.273 1.00 198.50 ? 396 TYR A OH  1 
ATOM   2940 N  N   . LYS A 1 386 ? -25.249 -80.967 -33.184 1.00 170.80 ? 397 LYS A N   1 
ATOM   2941 C  CA  . LYS A 1 386 ? -26.633 -80.549 -32.936 1.00 166.31 ? 397 LYS A CA  1 
ATOM   2942 C  C   . LYS A 1 386 ? -27.575 -81.752 -32.883 1.00 166.38 ? 397 LYS A C   1 
ATOM   2943 O  O   . LYS A 1 386 ? -28.530 -81.772 -32.097 1.00 163.12 ? 397 LYS A O   1 
ATOM   2944 C  CB  . LYS A 1 386 ? -27.083 -79.579 -34.036 1.00 165.38 ? 397 LYS A CB  1 
ATOM   2945 C  CG  . LYS A 1 386 ? -28.429 -78.890 -33.814 1.00 160.88 ? 397 LYS A CG  1 
ATOM   2946 C  CD  . LYS A 1 386 ? -28.875 -78.149 -35.077 1.00 161.00 ? 397 LYS A CD  1 
ATOM   2947 C  CE  . LYS A 1 386 ? -30.132 -77.317 -34.838 1.00 156.53 ? 397 LYS A CE  1 
ATOM   2948 N  NZ  . LYS A 1 386 ? -29.876 -76.118 -33.984 1.00 153.10 ? 397 LYS A NZ  1 
ATOM   2949 N  N   . ILE A 1 387 ? -27.288 -82.745 -33.726 1.00 170.31 ? 398 ILE A N   1 
ATOM   2950 C  CA  . ILE A 1 387 ? -28.082 -83.967 -33.819 1.00 171.10 ? 398 ILE A CA  1 
ATOM   2951 C  C   . ILE A 1 387 ? -27.899 -84.851 -32.579 1.00 171.58 ? 398 ILE A C   1 
ATOM   2952 O  O   . ILE A 1 387 ? -28.848 -85.509 -32.125 1.00 169.92 ? 398 ILE A O   1 
ATOM   2953 C  CB  . ILE A 1 387 ? -27.727 -84.758 -35.089 1.00 175.42 ? 398 ILE A CB  1 
ATOM   2954 C  CG1 . ILE A 1 387 ? -27.601 -83.815 -36.321 1.00 174.75 ? 398 ILE A CG1 1 
ATOM   2955 C  CG2 . ILE A 1 387 ? -28.733 -85.882 -35.314 1.00 176.66 ? 398 ILE A CG2 1 
ATOM   2956 C  CD1 . ILE A 1 387 ? -28.926 -83.070 -36.723 1.00 174.67 ? 398 ILE A CD1 1 
ATOM   2957 N  N   . LEU A 1 388 ? -26.676 -84.858 -32.042 1.00 174.05 ? 399 LEU A N   1 
ATOM   2958 C  CA  . LEU A 1 388 ? -26.374 -85.521 -30.773 1.00 173.79 ? 399 LEU A CA  1 
ATOM   2959 C  C   . LEU A 1 388 ? -25.257 -84.793 -30.041 1.00 173.17 ? 399 LEU A C   1 
ATOM   2960 O  O   . LEU A 1 388 ? -25.505 -84.090 -29.055 1.00 169.63 ? 399 LEU A O   1 
ATOM   2961 C  CB  . LEU A 1 388 ? -25.972 -86.975 -31.003 1.00 178.00 ? 399 LEU A CB  1 
ATOM   2962 C  CG  . LEU A 1 388 ? -27.118 -87.976 -31.199 1.00 177.88 ? 399 LEU A CG  1 
ATOM   2963 C  CD1 . LEU A 1 388 ? -26.559 -89.209 -31.956 1.00 175.74 ? 399 LEU A CD1 1 
ATOM   2964 C  CD2 . LEU A 1 388 ? -27.780 -88.338 -29.909 1.00 181.82 ? 399 LEU A CD2 1 
ATOM   2965 N  N   . GLY A 1 389 ? -24.032 -84.966 -30.546 1.00 176.73 ? 400 GLY A N   1 
ATOM   2966 C  CA  . GLY A 1 389 ? -22.836 -84.344 -29.987 1.00 176.77 ? 400 GLY A CA  1 
ATOM   2967 C  C   . GLY A 1 389 ? -22.704 -84.482 -28.483 1.00 176.00 ? 400 GLY A C   1 
ATOM   2968 O  O   . GLY A 1 389 ? -22.561 -83.475 -27.786 1.00 172.78 ? 400 GLY A O   1 
ATOM   2969 N  N   . VAL A 1 390 ? -22.759 -85.727 -27.994 1.00 179.09 ? 401 VAL A N   1 
ATOM   2970 C  CA  . VAL A 1 390 ? -22.598 -86.044 -26.563 1.00 179.11 ? 401 VAL A CA  1 
ATOM   2971 C  C   . VAL A 1 390 ? -21.412 -85.276 -25.966 1.00 179.75 ? 401 VAL A C   1 
ATOM   2972 O  O   . VAL A 1 390 ? -21.439 -84.872 -24.796 1.00 177.24 ? 401 VAL A O   1 
ATOM   2973 C  CB  . VAL A 1 390 ? -22.472 -87.587 -26.297 1.00 183.28 ? 401 VAL A CB  1 
ATOM   2974 C  CG1 . VAL A 1 390 ? -22.318 -87.905 -24.780 1.00 184.30 ? 401 VAL A CG1 1 
ATOM   2975 C  CG2 . VAL A 1 390 ? -23.686 -88.345 -26.881 1.00 182.27 ? 401 VAL A CG2 1 
ATOM   2976 N  N   . LYS A 1 391 ? -20.384 -85.072 -26.793 1.00 183.22 ? 402 LYS A N   1 
ATOM   2977 C  CA  . LYS A 1 391 ? -19.222 -84.268 -26.431 1.00 184.41 ? 402 LYS A CA  1 
ATOM   2978 C  C   . LYS A 1 391 ? -18.848 -83.341 -27.591 1.00 184.72 ? 402 LYS A C   1 
ATOM   2979 O  O   . LYS A 1 391 ? -18.859 -83.752 -28.754 1.00 186.65 ? 402 LYS A O   1 
ATOM   2980 C  CB  . LYS A 1 391 ? -18.050 -85.179 -26.006 1.00 189.46 ? 402 LYS A CB  1 
ATOM   2981 C  CG  . LYS A 1 391 ? -16.633 -84.580 -26.098 1.00 192.40 ? 402 LYS A CG  1 
ATOM   2982 C  CD  . LYS A 1 391 ? -16.356 -83.516 -25.034 1.00 189.53 ? 402 LYS A CD  1 
ATOM   2983 C  CE  . LYS A 1 391 ? -14.928 -82.987 -25.154 1.00 192.32 ? 402 LYS A CE  1 
ATOM   2984 N  NZ  . LYS A 1 391 ? -14.844 -81.530 -24.822 1.00 188.71 ? 402 LYS A NZ  1 
ATOM   2985 N  N   . ARG A 1 392 ? -18.568 -82.076 -27.263 1.00 182.77 ? 403 ARG A N   1 
ATOM   2986 C  CA  . ARG A 1 392 ? -17.955 -81.143 -28.209 1.00 183.80 ? 403 ARG A CA  1 
ATOM   2987 C  C   . ARG A 1 392 ? -16.582 -81.730 -28.565 1.00 189.67 ? 403 ARG A C   1 
ATOM   2988 O  O   . ARG A 1 392 ? -15.662 -81.873 -27.692 1.00 191.92 ? 403 ARG A O   1 
ATOM   2989 C  CB  . ARG A 1 392 ? -17.792 -79.751 -27.547 1.00 180.95 ? 403 ARG A CB  1 
ATOM   2990 C  CG  . ARG A 1 392 ? -16.965 -78.761 -28.381 1.00 181.85 ? 403 ARG A CG  1 
ATOM   2991 C  CD  . ARG A 1 392 ? -17.651 -78.479 -29.722 1.00 179.77 ? 403 ARG A CD  1 
ATOM   2992 N  NE  . ARG A 1 392 ? -16.773 -77.768 -30.652 1.00 182.19 ? 403 ARG A NE  1 
ATOM   2993 C  CZ  . ARG A 1 392 ? -17.116 -77.464 -31.897 1.00 181.87 ? 403 ARG A CZ  1 
ATOM   2994 N  NH1 . ARG A 1 392 ? -18.325 -77.835 -32.368 1.00 179.22 ? 403 ARG A NH1 1 
ATOM   2995 N  NH2 . ARG A 1 392 ? -16.252 -76.829 -32.673 1.00 184.45 ? 403 ARG A NH2 1 
ATOM   2996 N  N   . ASN A 1 393 ? -16.445 -82.119 -29.839 1.00 192.34 ? 404 ASN A N   1 
ATOM   2997 C  CA  . ASN A 1 393 ? -15.295 -82.911 -30.260 1.00 198.16 ? 404 ASN A CA  1 
ATOM   2998 C  C   . ASN A 1 393 ? -15.381 -84.303 -29.601 1.00 199.50 ? 404 ASN A C   1 
ATOM   2999 O  O   . ASN A 1 393 ? -14.446 -84.750 -28.906 1.00 202.55 ? 404 ASN A O   1 
ATOM   3000 C  CB  . ASN A 1 393 ? -13.980 -82.176 -29.926 1.00 201.04 ? 404 ASN A CB  1 
ATOM   3001 C  CG  . ASN A 1 393 ? -12.795 -82.664 -30.746 1.00 207.31 ? 404 ASN A CG  1 
ATOM   3002 O  OD1 . ASN A 1 393 ? -12.309 -83.788 -30.563 1.00 210.66 ? 404 ASN A OD1 1 
ATOM   3003 N  ND2 . ASN A 1 393 ? -12.305 -81.804 -31.639 1.00 209.10 ? 404 ASN A ND2 1 
ATOM   3004 N  N   . ALA A 1 394 ? -16.528 -84.971 -29.815 1.00 197.26 ? 405 ALA A N   1 
ATOM   3005 C  CA  . ALA A 1 394 ? -16.773 -86.314 -29.278 1.00 198.82 ? 405 ALA A CA  1 
ATOM   3006 C  C   . ALA A 1 394 ? -15.916 -87.371 -29.966 1.00 204.79 ? 405 ALA A C   1 
ATOM   3007 O  O   . ALA A 1 394 ? -15.607 -87.249 -31.152 1.00 206.87 ? 405 ALA A O   1 
ATOM   3008 C  CB  . ALA A 1 394 ? -18.247 -86.673 -29.401 1.00 195.44 ? 405 ALA A CB  1 
ATOM   3009 N  N   . LYS A 1 395 ? -15.538 -88.405 -29.215 1.00 207.74 ? 406 LYS A N   1 
ATOM   3010 C  CA  . LYS A 1 395 ? -14.760 -89.526 -29.751 1.00 213.55 ? 406 LYS A CA  1 
ATOM   3011 C  C   . LYS A 1 395 ? -15.586 -90.324 -30.774 1.00 213.84 ? 406 LYS A C   1 
ATOM   3012 O  O   . LYS A 1 395 ? -16.771 -90.593 -30.543 1.00 210.22 ? 406 LYS A O   1 
ATOM   3013 C  CB  . LYS A 1 395 ? -14.278 -90.424 -28.602 1.00 216.27 ? 406 LYS A CB  1 
ATOM   3014 C  CG  . LYS A 1 395 ? -13.363 -91.583 -28.998 1.00 222.72 ? 406 LYS A CG  1 
ATOM   3015 C  CD  . LYS A 1 395 ? -11.911 -91.149 -29.154 1.00 226.41 ? 406 LYS A CD  1 
ATOM   3016 C  CE  . LYS A 1 395 ? -11.009 -92.350 -29.411 1.00 232.76 ? 406 LYS A CE  1 
ATOM   3017 N  NZ  . LYS A 1 395 ? -9.583  -91.937 -29.958 1.00 236.21 ? 406 LYS A NZ  1 
ATOM   3018 N  N   . LYS A 1 396 ? -14.946 -90.696 -31.891 1.00 218.27 ? 407 LYS A N   1 
ATOM   3019 C  CA  . LYS A 1 396 ? -15.612 -91.315 -33.058 1.00 219.02 ? 407 LYS A CA  1 
ATOM   3020 C  C   . LYS A 1 396 ? -16.405 -92.593 -32.788 1.00 219.02 ? 407 LYS A C   1 
ATOM   3021 O  O   . LYS A 1 396 ? -17.319 -92.929 -33.551 1.00 216.66 ? 407 LYS A O   1 
ATOM   3022 C  CB  . LYS A 1 396 ? -14.606 -91.560 -34.191 1.00 224.58 ? 407 LYS A CB  1 
ATOM   3023 C  CG  . LYS A 1 396 ? -14.348 -90.331 -35.040 1.00 223.79 ? 407 LYS A CG  1 
ATOM   3024 C  CD  . LYS A 1 396 ? -13.443 -90.639 -36.216 1.00 229.63 ? 407 LYS A CD  1 
ATOM   3025 C  CE  . LYS A 1 396 ? -13.188 -89.375 -37.040 1.00 228.75 ? 407 LYS A CE  1 
ATOM   3026 N  NZ  . LYS A 1 396 ? -12.235 -89.622 -38.156 1.00 234.75 ? 407 LYS A NZ  1 
ATOM   3027 N  N   . GLN A 1 397 ? -16.046 -93.297 -31.712 1.00 221.88 ? 408 GLN A N   1 
ATOM   3028 C  CA  . GLN A 1 397 ? -16.723 -94.531 -31.321 1.00 222.33 ? 408 GLN A CA  1 
ATOM   3029 C  C   . GLN A 1 397 ? -17.985 -94.268 -30.481 1.00 216.62 ? 408 GLN A C   1 
ATOM   3030 O  O   . GLN A 1 397 ? -19.002 -94.945 -30.661 1.00 215.40 ? 408 GLN A O   1 
ATOM   3031 C  CB  . GLN A 1 397 ? -15.747 -95.433 -30.566 1.00 226.73 ? 408 GLN A CB  1 
ATOM   3032 C  CG  . GLN A 1 397 ? -16.183 -96.883 -30.465 1.00 228.56 ? 408 GLN A CG  1 
ATOM   3033 C  CD  . GLN A 1 397 ? -15.313 -97.684 -29.518 1.00 231.74 ? 408 GLN A CD  1 
ATOM   3034 O  OE1 . GLN A 1 397 ? -14.186 -97.292 -29.202 1.00 232.98 ? 408 GLN A OE1 1 
ATOM   3035 N  NE2 . GLN A 1 397 ? -15.834 -98.815 -29.057 1.00 233.44 ? 408 GLN A NE2 1 
ATOM   3036 N  N   . GLU A 1 398 ? -17.908 -93.289 -29.571 1.00 213.36 ? 409 GLU A N   1 
ATOM   3037 C  CA  . GLU A 1 398 ? -19.043 -92.856 -28.733 1.00 207.92 ? 409 GLU A CA  1 
ATOM   3038 C  C   . GLU A 1 398 ? -20.209 -92.327 -29.562 1.00 204.02 ? 409 GLU A C   1 
ATOM   3039 O  O   . GLU A 1 398 ? -21.375 -92.496 -29.195 1.00 200.67 ? 409 GLU A O   1 
ATOM   3040 C  CB  . GLU A 1 398 ? -18.597 -91.768 -27.747 1.00 205.44 ? 409 GLU A CB  1 
ATOM   3041 C  CG  . GLU A 1 398 ? -18.102 -92.280 -26.392 1.00 207.00 ? 409 GLU A CG  1 
ATOM   3042 C  CD  . GLU A 1 398 ? -16.779 -93.039 -26.460 1.00 213.29 ? 409 GLU A CD  1 
ATOM   3043 O  OE1 . GLU A 1 398 ? -15.979 -92.790 -27.388 1.00 215.92 ? 409 GLU A OE1 1 
ATOM   3044 O  OE2 . GLU A 1 398 ? -16.535 -93.886 -25.569 1.00 215.58 ? 409 GLU A OE2 1 
ATOM   3045 N  N   . ILE A 1 399 ? -19.863 -91.678 -30.673 1.00 204.72 ? 410 ILE A N   1 
ATOM   3046 C  CA  . ILE A 1 399 ? -20.818 -91.131 -31.632 1.00 201.63 ? 410 ILE A CA  1 
ATOM   3047 C  C   . ILE A 1 399 ? -21.715 -92.226 -32.205 1.00 202.99 ? 410 ILE A C   1 
ATOM   3048 O  O   . ILE A 1 399 ? -22.943 -92.146 -32.109 1.00 199.55 ? 410 ILE A O   1 
ATOM   3049 C  CB  . ILE A 1 399 ? -20.076 -90.399 -32.783 1.00 202.66 ? 410 ILE A CB  1 
ATOM   3050 C  CG1 . ILE A 1 399 ? -19.329 -89.174 -32.238 1.00 200.72 ? 410 ILE A CG1 1 
ATOM   3051 C  CG2 . ILE A 1 399 ? -21.046 -90.001 -33.900 1.00 200.26 ? 410 ILE A CG2 1 
ATOM   3052 C  CD1 . ILE A 1 399 ? -18.276 -88.604 -33.179 1.00 203.24 ? 410 ILE A CD1 1 
ATOM   3053 N  N   . ILE A 1 400 ? -21.086 -93.247 -32.787 1.00 208.16 ? 411 ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 400 ? -21.794 -94.367 -33.397 1.00 210.21 ? 411 ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 400 ? -22.835 -94.961 -32.438 1.00 207.39 ? 411 ILE A C   1 
ATOM   3056 O  O   . ILE A 1 400 ? -23.950 -95.283 -32.853 1.00 205.81 ? 411 ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 400 ? -20.814 -95.479 -33.879 1.00 216.57 ? 411 ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 400 ? -19.450 -94.905 -34.301 1.00 219.63 ? 411 ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 400 ? -21.448 -96.319 -34.983 1.00 219.00 ? 411 ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 400 ? -19.410 -94.174 -35.644 1.00 219.98 ? 411 ILE A CD1 1 
ATOM   3061 N  N   . LYS A 1 401 ? -22.465 -95.069 -31.157 1.00 206.90 ? 412 LYS A N   1 
ATOM   3062 C  CA  . LYS A 1 401 ? -23.318 -95.658 -30.109 1.00 204.47 ? 412 LYS A CA  1 
ATOM   3063 C  C   . LYS A 1 401 ? -24.751 -95.111 -30.132 1.00 199.38 ? 412 LYS A C   1 
ATOM   3064 O  O   . LYS A 1 401 ? -25.707 -95.869 -30.330 1.00 199.17 ? 412 LYS A O   1 
ATOM   3065 C  CB  . LYS A 1 401 ? -22.673 -95.461 -28.709 1.00 203.79 ? 412 LYS A CB  1 
ATOM   3066 C  CG  . LYS A 1 401 ? -23.588 -95.883 -27.536 1.00 200.50 ? 412 LYS A CG  1 
ATOM   3067 C  CD  . LYS A 1 401 ? -23.506 -97.391 -27.253 1.00 203.81 ? 412 LYS A CD  1 
ATOM   3068 C  CE  . LYS A 1 401 ? -24.396 -97.775 -26.070 1.00 200.92 ? 412 LYS A CE  1 
ATOM   3069 N  NZ  . LYS A 1 401 ? -24.196 -99.185 -25.636 1.00 204.66 ? 412 LYS A NZ  1 
ATOM   3070 N  N   . ALA A 1 402 ? -24.886 -93.799 -29.937 1.00 195.47 ? 413 ALA A N   1 
ATOM   3071 C  CA  . ALA A 1 402 ? -26.195 -93.145 -29.936 1.00 190.57 ? 413 ALA A CA  1 
ATOM   3072 C  C   . ALA A 1 402 ? -26.806 -93.081 -31.338 1.00 190.93 ? 413 ALA A C   1 
ATOM   3073 O  O   . ALA A 1 402 ? -28.031 -93.092 -31.488 1.00 188.51 ? 413 ALA A O   1 
ATOM   3074 C  CB  . ALA A 1 402 ? -26.100 -91.756 -29.322 1.00 186.78 ? 413 ALA A CB  1 
ATOM   3075 N  N   . TYR A 1 403 ? -25.946 -93.025 -32.355 1.00 194.22 ? 414 TYR A N   1 
ATOM   3076 C  CA  . TYR A 1 403 ? -26.395 -93.058 -33.744 1.00 195.59 ? 414 TYR A CA  1 
ATOM   3077 C  C   . TYR A 1 403 ? -27.195 -94.315 -34.051 1.00 197.28 ? 414 TYR A C   1 
ATOM   3078 O  O   . TYR A 1 403 ? -28.276 -94.231 -34.622 1.00 195.43 ? 414 TYR A O   1 
ATOM   3079 C  CB  . TYR A 1 403 ? -25.215 -92.951 -34.709 1.00 199.92 ? 414 TYR A CB  1 
ATOM   3080 C  CG  . TYR A 1 403 ? -25.548 -93.391 -36.118 1.00 202.78 ? 414 TYR A CG  1 
ATOM   3081 C  CD1 . TYR A 1 403 ? -26.387 -92.625 -36.928 1.00 200.60 ? 414 TYR A CD1 1 
ATOM   3082 C  CD2 . TYR A 1 403 ? -25.033 -94.576 -36.638 1.00 207.89 ? 414 TYR A CD2 1 
ATOM   3083 C  CE1 . TYR A 1 403 ? -26.697 -93.024 -38.223 1.00 203.37 ? 414 TYR A CE1 1 
ATOM   3084 C  CE2 . TYR A 1 403 ? -25.338 -94.984 -37.935 1.00 210.76 ? 414 TYR A CE2 1 
ATOM   3085 C  CZ  . TYR A 1 403 ? -26.170 -94.203 -38.720 1.00 208.42 ? 414 TYR A CZ  1 
ATOM   3086 O  OH  . TYR A 1 403 ? -26.479 -94.597 -40.001 1.00 211.31 ? 414 TYR A OH  1 
ATOM   3087 N  N   . ARG A 1 404 ? -26.648 -95.470 -33.675 1.00 200.91 ? 415 ARG A N   1 
ATOM   3088 C  CA  . ARG A 1 404 ? -27.307 -96.755 -33.900 1.00 202.95 ? 415 ARG A CA  1 
ATOM   3089 C  C   . ARG A 1 404 ? -28.739 -96.725 -33.378 1.00 198.72 ? 415 ARG A C   1 
ATOM   3090 O  O   . ARG A 1 404 ? -29.672 -97.089 -34.095 1.00 198.73 ? 415 ARG A O   1 
ATOM   3091 C  CB  . ARG A 1 404 ? -26.526 -97.903 -33.242 1.00 206.58 ? 415 ARG A CB  1 
ATOM   3092 C  CG  . ARG A 1 404 ? -25.098 -98.097 -33.753 1.00 211.21 ? 415 ARG A CG  1 
ATOM   3093 C  CD  . ARG A 1 404 ? -25.036 -98.698 -35.161 1.00 215.67 ? 415 ARG A CD  1 
ATOM   3094 N  NE  . ARG A 1 404 ? -23.669 -98.689 -35.686 1.00 220.04 ? 415 ARG A NE  1 
ATOM   3095 C  CZ  . ARG A 1 404 ? -23.307 -99.138 -36.886 1.00 224.68 ? 415 ARG A CZ  1 
ATOM   3096 N  NH1 . ARG A 1 404 ? -24.204 -99.651 -37.719 1.00 225.13 ? 415 ARG A NH1 1 
ATOM   3097 N  NH2 . ARG A 1 404 ? -22.035 -99.075 -37.254 1.00 228.52 ? 415 ARG A NH2 1 
ATOM   3098 N  N   . LYS A 1 405 ? -28.900 -96.275 -32.134 1.00 195.37 ? 416 LYS A N   1 
ATOM   3099 C  CA  . LYS A 1 405 ? -30.219 -96.092 -31.533 1.00 191.09 ? 416 LYS A CA  1 
ATOM   3100 C  C   . LYS A 1 405 ? -31.039 -95.070 -32.312 1.00 187.93 ? 416 LYS A C   1 
ATOM   3101 O  O   . LYS A 1 405 ? -32.175 -95.343 -32.679 1.00 186.93 ? 416 LYS A O   1 
ATOM   3102 C  CB  . LYS A 1 405 ? -30.106 -95.651 -30.070 1.00 188.20 ? 416 LYS A CB  1 
ATOM   3103 C  CG  . LYS A 1 405 ? -29.711 -96.750 -29.087 1.00 190.74 ? 416 LYS A CG  1 
ATOM   3104 C  CD  . LYS A 1 405 ? -30.014 -96.352 -27.632 1.00 187.57 ? 416 LYS A CD  1 
ATOM   3105 C  CE  . LYS A 1 405 ? -29.223 -95.114 -27.172 1.00 186.10 ? 416 LYS A CE  1 
ATOM   3106 N  NZ  . LYS A 1 405 ? -27.737 -95.318 -27.199 1.00 190.38 ? 416 LYS A NZ  1 
ATOM   3107 N  N   . LEU A 1 406 ? -30.452 -93.902 -32.573 1.00 186.58 ? 417 LEU A N   1 
ATOM   3108 C  CA  . LEU A 1 406 ? -31.166 -92.818 -33.248 1.00 183.60 ? 417 LEU A CA  1 
ATOM   3109 C  C   . LEU A 1 406 ? -31.386 -93.096 -34.731 1.00 186.19 ? 417 LEU A C   1 
ATOM   3110 O  O   . LEU A 1 406 ? -32.293 -92.531 -35.338 1.00 183.99 ? 417 LEU A O   1 
ATOM   3111 C  CB  . LEU A 1 406 ? -30.474 -91.470 -33.010 1.00 181.96 ? 417 LEU A CB  1 
ATOM   3112 C  CG  . LEU A 1 406 ? -30.836 -90.846 -31.635 1.00 178.25 ? 417 LEU A CG  1 
ATOM   3113 C  CD1 . LEU A 1 406 ? -29.518 -90.390 -30.934 1.00 178.63 ? 417 LEU A CD1 1 
ATOM   3114 C  CD2 . LEU A 1 406 ? -31.774 -89.575 -31.871 1.00 173.47 ? 417 LEU A CD2 1 
ATOM   3115 N  N   . ALA A 1 407 ? -30.562 -93.969 -35.304 1.00 190.97 ? 418 ALA A N   1 
ATOM   3116 C  CA  . ALA A 1 407 ? -30.834 -94.520 -36.624 1.00 193.90 ? 418 ALA A CA  1 
ATOM   3117 C  C   . ALA A 1 407 ? -31.980 -95.526 -36.525 1.00 194.16 ? 418 ALA A C   1 
ATOM   3118 O  O   . ALA A 1 407 ? -32.884 -95.520 -37.361 1.00 193.91 ? 418 ALA A O   1 
ATOM   3119 C  CB  . ALA A 1 407 ? -29.595 -95.168 -37.201 1.00 199.05 ? 418 ALA A CB  1 
ATOM   3120 N  N   . LEU A 1 408 ? -31.940 -96.375 -35.495 1.00 194.60 ? 419 LEU A N   1 
ATOM   3121 C  CA  . LEU A 1 408 ? -33.046 -97.285 -35.180 1.00 194.53 ? 419 LEU A CA  1 
ATOM   3122 C  C   . LEU A 1 408 ? -34.310 -96.492 -34.882 1.00 189.72 ? 419 LEU A C   1 
ATOM   3123 O  O   . LEU A 1 408 ? -35.396 -96.849 -35.342 1.00 189.36 ? 419 LEU A O   1 
ATOM   3124 C  CB  . LEU A 1 408 ? -32.705 -98.183 -33.977 1.00 195.79 ? 419 LEU A CB  1 
ATOM   3125 C  CG  . LEU A 1 408 ? -33.866 -98.718 -33.086 1.00 195.23 ? 419 LEU A CG  1 
ATOM   3126 C  CD1 . LEU A 1 408 ? -34.551 -99.966 -33.712 1.00 199.81 ? 419 LEU A CD1 1 
ATOM   3127 C  CD2 . LEU A 1 408 ? -33.383 -99.001 -31.654 1.00 193.66 ? 419 LEU A CD2 1 
ATOM   3128 N  N   . GLN A 1 409 ? -34.150 -95.414 -34.113 1.00 186.02 ? 420 GLN A N   1 
ATOM   3129 C  CA  . GLN A 1 409 ? -35.270 -94.598 -33.652 1.00 181.31 ? 420 GLN A CA  1 
ATOM   3130 C  C   . GLN A 1 409 ? -35.885 -93.750 -34.755 1.00 179.84 ? 420 GLN A C   1 
ATOM   3131 O  O   . GLN A 1 409 ? -37.105 -93.744 -34.922 1.00 178.22 ? 420 GLN A O   1 
ATOM   3132 C  CB  . GLN A 1 409 ? -34.847 -93.711 -32.477 1.00 177.98 ? 420 GLN A CB  1 
ATOM   3133 C  CG  . GLN A 1 409 ? -34.825 -94.437 -31.137 1.00 178.11 ? 420 GLN A CG  1 
ATOM   3134 C  CD  . GLN A 1 409 ? -33.859 -93.825 -30.132 1.00 176.61 ? 420 GLN A CD  1 
ATOM   3135 O  OE1 . GLN A 1 409 ? -33.011 -92.997 -30.475 1.00 176.21 ? 420 GLN A OE1 1 
ATOM   3136 N  NE2 . GLN A 1 409 ? -33.979 -94.243 -28.878 1.00 175.70 ? 420 GLN A NE2 1 
ATOM   3137 N  N   . TRP A 1 410 ? -35.044 -93.048 -35.517 1.00 180.61 ? 421 TRP A N   1 
ATOM   3138 C  CA  . TRP A 1 410 ? -35.555 -92.081 -36.492 1.00 179.15 ? 421 TRP A CA  1 
ATOM   3139 C  C   . TRP A 1 410 ? -35.815 -92.616 -37.913 1.00 182.75 ? 421 TRP A C   1 
ATOM   3140 O  O   . TRP A 1 410 ? -35.949 -91.823 -38.873 1.00 182.52 ? 421 TRP A O   1 
ATOM   3141 C  CB  . TRP A 1 410 ? -34.678 -90.809 -36.515 1.00 177.56 ? 421 TRP A CB  1 
ATOM   3142 C  CG  . TRP A 1 410 ? -34.834 -90.009 -35.233 1.00 173.02 ? 421 TRP A CG  1 
ATOM   3143 C  CD1 . TRP A 1 410 ? -33.967 -89.900 -34.293 1.00 172.36 ? 421 TRP A CD1 1 
ATOM   3144 C  CD2 . TRP A 1 410 ? -35.925 -89.125 -34.930 1.00 168.79 ? 421 TRP A CD2 1 
ATOM   3145 N  NE1 . TRP A 1 410 ? -34.443 -88.957 -33.404 1.00 167.89 ? 421 TRP A NE1 1 
ATOM   3146 C  CE2 . TRP A 1 410 ? -35.650 -88.578 -33.764 1.00 165.71 ? 421 TRP A CE2 1 
ATOM   3147 C  CE3 . TRP A 1 410 ? -37.104 -88.721 -35.659 1.00 167.54 ? 421 TRP A CE3 1 
ATOM   3148 C  CZ2 . TRP A 1 410 ? -36.511 -87.656 -33.178 1.00 161.37 ? 421 TRP A CZ2 1 
ATOM   3149 C  CZ3 . TRP A 1 410 ? -37.964 -87.817 -35.040 1.00 163.23 ? 421 TRP A CZ3 1 
ATOM   3150 C  CH2 . TRP A 1 410 ? -37.664 -87.309 -33.756 1.00 160.20 ? 421 TRP A CH2 1 
ATOM   3151 N  N   . HIS A 1 411 ? -35.905 -93.945 -38.051 1.00 186.17 ? 422 HIS A N   1 
ATOM   3152 C  CA  . HIS A 1 411 ? -36.261 -94.501 -39.345 1.00 189.58 ? 422 HIS A CA  1 
ATOM   3153 C  C   . HIS A 1 411 ? -37.776 -94.539 -39.541 1.00 187.68 ? 422 HIS A C   1 
ATOM   3154 O  O   . HIS A 1 411 ? -38.491 -95.113 -38.726 1.00 186.33 ? 422 HIS A O   1 
ATOM   3155 C  CB  . HIS A 1 411 ? -35.650 -95.879 -39.570 1.00 194.41 ? 422 HIS A CB  1 
ATOM   3156 C  CG  . HIS A 1 411 ? -35.903 -96.412 -40.944 1.00 198.19 ? 422 HIS A CG  1 
ATOM   3157 N  ND1 . HIS A 1 411 ? -35.334 -95.861 -42.072 1.00 200.23 ? 422 HIS A ND1 1 
ATOM   3158 C  CD2 . HIS A 1 411 ? -36.692 -97.421 -41.374 1.00 200.43 ? 422 HIS A CD2 1 
ATOM   3159 C  CE1 . HIS A 1 411 ? -35.756 -96.516 -43.138 1.00 203.58 ? 422 HIS A CE1 1 
ATOM   3160 N  NE2 . HIS A 1 411 ? -36.580 -97.469 -42.742 1.00 203.74 ? 422 HIS A NE2 1 
ATOM   3161 N  N   . PRO A 1 412 ? -38.260 -93.934 -40.637 1.00 187.81 ? 423 PRO A N   1 
ATOM   3162 C  CA  . PRO A 1 412 ? -39.670 -93.838 -41.033 1.00 186.48 ? 423 PRO A CA  1 
ATOM   3163 C  C   . PRO A 1 412 ? -40.504 -95.102 -40.828 1.00 188.01 ? 423 PRO A C   1 
ATOM   3164 O  O   . PRO A 1 412 ? -41.748 -95.017 -40.766 1.00 186.28 ? 423 PRO A O   1 
ATOM   3165 C  CB  . PRO A 1 412 ? -39.575 -93.518 -42.526 1.00 189.15 ? 423 PRO A CB  1 
ATOM   3166 C  CG  . PRO A 1 412 ? -38.371 -92.644 -42.591 1.00 188.77 ? 423 PRO A CG  1 
ATOM   3167 C  CD  . PRO A 1 412 ? -37.374 -93.171 -41.575 1.00 189.35 ? 423 PRO A CD  1 
ATOM   3168 N  N   . ASP A 1 413 ? -39.836 -96.261 -40.689 1.00 191.33 ? 424 ASP A N   1 
ATOM   3169 C  CA  . ASP A 1 413 ? -40.538 -97.519 -40.425 1.00 193.00 ? 424 ASP A CA  1 
ATOM   3170 C  C   . ASP A 1 413 ? -41.250 -97.510 -39.082 1.00 189.40 ? 424 ASP A C   1 
ATOM   3171 O  O   . ASP A 1 413 ? -42.259 -98.192 -38.909 1.00 189.88 ? 424 ASP A O   1 
ATOM   3172 C  CB  . ASP A 1 413 ? -39.572 -98.704 -40.443 1.00 197.46 ? 424 ASP A CB  1 
ATOM   3173 C  CG  . ASP A 1 413 ? -39.303 -99.225 -41.846 1.00 202.12 ? 424 ASP A CG  1 
ATOM   3174 O  OD1 . ASP A 1 413 ? -40.055 -98.849 -42.796 1.00 202.08 ? 424 ASP A OD1 1 
ATOM   3175 O  OD2 . ASP A 1 413 ? -38.330 -99.986 -42.002 1.00 206.14 ? 424 ASP A OD2 1 
ATOM   3176 N  N   . ASN A 1 414 ? -40.713 -96.738 -38.140 1.00 186.18 ? 425 ASN A N   1 
ATOM   3177 C  CA  . ASN A 1 414 ? -41.155 -96.774 -36.746 1.00 183.25 ? 425 ASN A CA  1 
ATOM   3178 C  C   . ASN A 1 414 ? -42.578 -96.274 -36.475 1.00 180.02 ? 425 ASN A C   1 
ATOM   3179 O  O   . ASN A 1 414 ? -43.203 -96.692 -35.491 1.00 179.87 ? 425 ASN A O   1 
ATOM   3180 C  CB  . ASN A 1 414 ? -40.149 -96.041 -35.859 1.00 180.93 ? 425 ASN A CB  1 
ATOM   3181 C  CG  . ASN A 1 414 ? -38.826 -96.767 -35.770 1.00 184.26 ? 425 ASN A CG  1 
ATOM   3182 O  OD1 . ASN A 1 414 ? -38.710 -97.793 -35.098 1.00 186.16 ? 425 ASN A OD1 1 
ATOM   3183 N  ND2 . ASN A 1 414 ? -37.816 -96.240 -36.452 1.00 185.20 ? 425 ASN A ND2 1 
ATOM   3184 N  N   . PHE A 1 415 ? -43.088 -95.398 -37.343 1.00 177.78 ? 426 PHE A N   1 
ATOM   3185 C  CA  . PHE A 1 415 ? -44.440 -94.841 -37.190 1.00 174.84 ? 426 PHE A CA  1 
ATOM   3186 C  C   . PHE A 1 415 ? -45.252 -94.936 -38.476 1.00 177.08 ? 426 PHE A C   1 
ATOM   3187 O  O   . PHE A 1 415 ? -44.689 -95.025 -39.573 1.00 180.34 ? 426 PHE A O   1 
ATOM   3188 C  CB  . PHE A 1 415 ? -44.368 -93.386 -36.735 1.00 170.71 ? 426 PHE A CB  1 
ATOM   3189 C  CG  . PHE A 1 415 ? -43.276 -92.610 -37.396 1.00 171.53 ? 426 PHE A CG  1 
ATOM   3190 C  CD1 . PHE A 1 415 ? -43.416 -92.172 -38.706 1.00 173.26 ? 426 PHE A CD1 1 
ATOM   3191 C  CD2 . PHE A 1 415 ? -42.096 -92.332 -36.715 1.00 171.06 ? 426 PHE A CD2 1 
ATOM   3192 C  CE1 . PHE A 1 415 ? -42.406 -91.469 -39.321 1.00 174.35 ? 426 PHE A CE1 1 
ATOM   3193 C  CE2 . PHE A 1 415 ? -41.084 -91.623 -37.329 1.00 172.12 ? 426 PHE A CE2 1 
ATOM   3194 C  CZ  . PHE A 1 415 ? -41.243 -91.191 -38.637 1.00 173.72 ? 426 PHE A CZ  1 
ATOM   3195 N  N   . GLN A 1 416 ? -46.575 -94.885 -38.340 1.00 175.56 ? 427 GLN A N   1 
ATOM   3196 C  CA  . GLN A 1 416 ? -47.456 -95.190 -39.461 1.00 178.03 ? 427 GLN A CA  1 
ATOM   3197 C  C   . GLN A 1 416 ? -47.809 -94.016 -40.375 1.00 177.04 ? 427 GLN A C   1 
ATOM   3198 O  O   . GLN A 1 416 ? -47.703 -94.141 -41.592 1.00 180.18 ? 427 GLN A O   1 
ATOM   3199 C  CB  . GLN A 1 416 ? -48.722 -95.916 -38.987 1.00 178.21 ? 427 GLN A CB  1 
ATOM   3200 C  CG  . GLN A 1 416 ? -49.587 -96.457 -40.128 1.00 181.03 ? 427 GLN A CG  1 
ATOM   3201 C  CD  . GLN A 1 416 ? -49.989 -97.914 -39.936 1.00 184.40 ? 427 GLN A CD  1 
ATOM   3202 O  OE1 . GLN A 1 416 ? -50.084 -98.407 -38.810 1.00 183.67 ? 427 GLN A OE1 1 
ATOM   3203 N  NE2 . GLN A 1 416 ? -50.224 -98.612 -41.045 1.00 188.28 ? 427 GLN A NE2 1 
ATOM   3204 N  N   . ASN A 1 417 ? -48.224 -92.887 -39.813 1.00 172.93 ? 428 ASN A N   1 
ATOM   3205 C  CA  . ASN A 1 417 ? -48.779 -91.829 -40.655 1.00 172.09 ? 428 ASN A CA  1 
ATOM   3206 C  C   . ASN A 1 417 ? -47.756 -90.977 -41.386 1.00 172.63 ? 428 ASN A C   1 
ATOM   3207 O  O   . ASN A 1 417 ? -46.693 -90.657 -40.852 1.00 171.47 ? 428 ASN A O   1 
ATOM   3208 C  CB  . ASN A 1 417 ? -49.786 -90.976 -39.888 1.00 167.89 ? 428 ASN A CB  1 
ATOM   3209 C  CG  . ASN A 1 417 ? -50.993 -91.771 -39.436 1.00 167.81 ? 428 ASN A CG  1 
ATOM   3210 O  OD1 . ASN A 1 417 ? -51.039 -92.996 -39.600 1.00 171.01 ? 428 ASN A OD1 1 
ATOM   3211 N  ND2 . ASN A 1 417 ? -51.983 -91.078 -38.863 1.00 164.32 ? 428 ASN A ND2 1 
ATOM   3212 N  N   . GLU A 1 418 ? -48.123 -90.609 -42.611 1.00 174.52 ? 429 GLU A N   1 
ATOM   3213 C  CA  . GLU A 1 418 ? -47.240 -89.956 -43.578 1.00 175.99 ? 429 GLU A CA  1 
ATOM   3214 C  C   . GLU A 1 418 ? -46.720 -88.616 -43.086 1.00 172.33 ? 429 GLU A C   1 
ATOM   3215 O  O   . GLU A 1 418 ? -45.520 -88.349 -43.154 1.00 172.94 ? 429 GLU A O   1 
ATOM   3216 C  CB  . GLU A 1 418 ? -47.958 -89.754 -44.925 1.00 178.34 ? 429 GLU A CB  1 
ATOM   3217 C  CG  . GLU A 1 418 ? -48.769 -90.948 -45.432 1.00 181.78 ? 429 GLU A CG  1 
ATOM   3218 C  CD  . GLU A 1 418 ? -50.208 -90.961 -44.918 1.00 179.79 ? 429 GLU A CD  1 
ATOM   3219 O  OE1 . GLU A 1 418 ? -50.420 -90.896 -43.681 1.00 175.94 ? 429 GLU A OE1 1 
ATOM   3220 O  OE2 . GLU A 1 418 ? -51.132 -91.048 -45.758 1.00 182.28 ? 429 GLU A OE2 1 
ATOM   3221 N  N   . GLU A 1 419 ? -47.637 -87.779 -42.605 1.00 168.75 ? 430 GLU A N   1 
ATOM   3222 C  CA  . GLU A 1 419 ? -47.315 -86.436 -42.133 1.00 165.03 ? 430 GLU A CA  1 
ATOM   3223 C  C   . GLU A 1 419 ? -46.151 -86.467 -41.154 1.00 163.56 ? 430 GLU A C   1 
ATOM   3224 O  O   . GLU A 1 419 ? -45.191 -85.704 -41.282 1.00 162.98 ? 430 GLU A O   1 
ATOM   3225 C  CB  . GLU A 1 419 ? -48.548 -85.810 -41.486 1.00 161.61 ? 430 GLU A CB  1 
ATOM   3226 C  CG  . GLU A 1 419 ? -49.434 -85.057 -42.461 1.00 161.75 ? 430 GLU A CG  1 
ATOM   3227 C  CD  . GLU A 1 419 ? -49.136 -83.567 -42.465 1.00 158.54 ? 430 GLU A CD  1 
ATOM   3228 O  OE1 . GLU A 1 419 ? -49.484 -82.892 -41.464 1.00 154.92 ? 430 GLU A OE1 1 
ATOM   3229 O  OE2 . GLU A 1 419 ? -48.559 -83.071 -43.462 1.00 159.79 ? 430 GLU A OE2 1 
ATOM   3230 N  N   . GLU A 1 420 ? -46.251 -87.378 -40.194 1.00 163.26 ? 431 GLU A N   1 
ATOM   3231 C  CA  . GLU A 1 420 ? -45.214 -87.620 -39.206 1.00 162.54 ? 431 GLU A CA  1 
ATOM   3232 C  C   . GLU A 1 420 ? -43.975 -88.140 -39.908 1.00 166.30 ? 431 GLU A C   1 
ATOM   3233 O  O   . GLU A 1 420 ? -42.859 -87.695 -39.633 1.00 165.93 ? 431 GLU A O   1 
ATOM   3234 C  CB  . GLU A 1 420 ? -45.689 -88.657 -38.182 1.00 162.22 ? 431 GLU A CB  1 
ATOM   3235 C  CG  . GLU A 1 420 ? -47.004 -88.325 -37.460 1.00 159.21 ? 431 GLU A CG  1 
ATOM   3236 C  CD  . GLU A 1 420 ? -48.258 -88.666 -38.270 1.00 160.79 ? 431 GLU A CD  1 
ATOM   3237 O  OE1 . GLU A 1 420 ? -48.251 -88.514 -39.519 1.00 163.76 ? 431 GLU A OE1 1 
ATOM   3238 O  OE2 . GLU A 1 420 ? -49.265 -89.081 -37.646 1.00 159.32 ? 431 GLU A OE2 1 
ATOM   3239 N  N   . LYS A 1 421 ? -44.195 -89.079 -40.828 1.00 170.09 ? 432 LYS A N   1 
ATOM   3240 C  CA  . LYS A 1 421 ? -43.121 -89.763 -41.534 1.00 174.21 ? 432 LYS A CA  1 
ATOM   3241 C  C   . LYS A 1 421 ? -42.223 -88.772 -42.265 1.00 174.81 ? 432 LYS A C   1 
ATOM   3242 O  O   . LYS A 1 421 ? -41.035 -88.666 -41.952 1.00 175.22 ? 432 LYS A O   1 
ATOM   3243 C  CB  . LYS A 1 421 ? -43.706 -90.831 -42.472 1.00 178.25 ? 432 LYS A CB  1 
ATOM   3244 C  CG  . LYS A 1 421 ? -42.730 -91.937 -42.907 1.00 182.74 ? 432 LYS A CG  1 
ATOM   3245 C  CD  . LYS A 1 421 ? -43.354 -93.353 -42.880 1.00 185.33 ? 432 LYS A CD  1 
ATOM   3246 C  CE  . LYS A 1 421 ? -44.603 -93.508 -43.768 1.00 185.96 ? 432 LYS A CE  1 
ATOM   3247 N  NZ  . LYS A 1 421 ? -44.332 -93.332 -45.230 1.00 189.52 ? 432 LYS A NZ  1 
ATOM   3248 N  N   . LYS A 1 422 ? -42.807 -88.025 -43.201 1.00 175.18 ? 433 LYS A N   1 
ATOM   3249 C  CA  . LYS A 1 422 ? -42.097 -86.992 -43.961 1.00 175.73 ? 433 LYS A CA  1 
ATOM   3250 C  C   . LYS A 1 422 ? -41.202 -86.152 -43.053 1.00 172.65 ? 433 LYS A C   1 
ATOM   3251 O  O   . LYS A 1 422 ? -40.132 -85.690 -43.464 1.00 174.07 ? 433 LYS A O   1 
ATOM   3252 C  CB  . LYS A 1 422 ? -43.109 -86.101 -44.693 1.00 174.68 ? 433 LYS A CB  1 
ATOM   3253 C  CG  . LYS A 1 422 ? -42.505 -84.984 -45.548 1.00 176.41 ? 433 LYS A CG  1 
ATOM   3254 C  CD  . LYS A 1 422 ? -43.493 -84.480 -46.596 1.00 176.85 ? 433 LYS A CD  1 
ATOM   3255 C  CE  . LYS A 1 422 ? -43.500 -85.378 -47.841 1.00 181.45 ? 433 LYS A CE  1 
ATOM   3256 N  NZ  . LYS A 1 422 ? -44.447 -84.955 -48.932 1.00 181.56 ? 433 LYS A NZ  1 
ATOM   3257 N  N   . LYS A 1 423 ? -41.646 -85.982 -41.810 1.00 168.72 ? 434 LYS A N   1 
ATOM   3258 C  CA  . LYS A 1 423 ? -40.951 -85.147 -40.841 1.00 165.63 ? 434 LYS A CA  1 
ATOM   3259 C  C   . LYS A 1 423 ? -39.741 -85.838 -40.228 1.00 167.23 ? 434 LYS A C   1 
ATOM   3260 O  O   . LYS A 1 423 ? -38.723 -85.191 -39.962 1.00 166.39 ? 434 LYS A O   1 
ATOM   3261 C  CB  . LYS A 1 423 ? -41.921 -84.653 -39.762 1.00 161.23 ? 434 LYS A CB  1 
ATOM   3262 C  CG  . LYS A 1 423 ? -42.929 -83.615 -40.266 1.00 158.94 ? 434 LYS A CG  1 
ATOM   3263 C  CD  . LYS A 1 423 ? -42.230 -82.336 -40.723 1.00 158.31 ? 434 LYS A CD  1 
ATOM   3264 C  CE  . LYS A 1 423 ? -42.965 -81.679 -41.879 1.00 158.89 ? 434 LYS A CE  1 
ATOM   3265 N  NZ  . LYS A 1 423 ? -42.095 -80.696 -42.592 1.00 161.09 ? 434 LYS A NZ  1 
ATOM   3266 N  N   . ALA A 1 424 ? -39.850 -87.149 -40.019 1.00 169.72 ? 435 ALA A N   1 
ATOM   3267 C  CA  . ALA A 1 424 ? -38.726 -87.935 -39.522 1.00 171.80 ? 435 ALA A CA  1 
ATOM   3268 C  C   . ALA A 1 424 ? -37.664 -88.123 -40.590 1.00 175.93 ? 435 ALA A C   1 
ATOM   3269 O  O   . ALA A 1 424 ? -36.476 -88.184 -40.279 1.00 177.07 ? 435 ALA A O   1 
ATOM   3270 C  CB  . ALA A 1 424 ? -39.189 -89.261 -39.023 1.00 173.14 ? 435 ALA A CB  1 
ATOM   3271 N  N   . GLU A 1 425 ? -38.097 -88.219 -41.845 1.00 178.36 ? 436 GLU A N   1 
ATOM   3272 C  CA  . GLU A 1 425 ? -37.172 -88.323 -42.966 1.00 182.66 ? 436 GLU A CA  1 
ATOM   3273 C  C   . GLU A 1 425 ? -36.119 -87.243 -42.838 1.00 181.68 ? 436 GLU A C   1 
ATOM   3274 O  O   . GLU A 1 425 ? -34.932 -87.505 -43.017 1.00 184.68 ? 436 GLU A O   1 
ATOM   3275 C  CB  . GLU A 1 425 ? -37.895 -88.156 -44.299 1.00 184.67 ? 436 GLU A CB  1 
ATOM   3276 C  CG  . GLU A 1 425 ? -38.673 -89.363 -44.772 1.00 186.82 ? 436 GLU A CG  1 
ATOM   3277 C  CD  . GLU A 1 425 ? -39.340 -89.115 -46.106 1.00 188.51 ? 436 GLU A CD  1 
ATOM   3278 O  OE1 . GLU A 1 425 ? -38.732 -88.431 -46.960 1.00 190.15 ? 436 GLU A OE1 1 
ATOM   3279 O  OE2 . GLU A 1 425 ? -40.474 -89.600 -46.304 1.00 188.38 ? 436 GLU A OE2 1 
ATOM   3280 N  N   . LYS A 1 426 ? -36.571 -86.033 -42.511 1.00 177.57 ? 437 LYS A N   1 
ATOM   3281 C  CA  . LYS A 1 426 ? -35.691 -84.886 -42.350 1.00 176.16 ? 437 LYS A CA  1 
ATOM   3282 C  C   . LYS A 1 426 ? -34.659 -85.142 -41.263 1.00 175.97 ? 437 LYS A C   1 
ATOM   3283 O  O   . LYS A 1 426 ? -33.503 -84.765 -41.404 1.00 177.85 ? 437 LYS A O   1 
ATOM   3284 C  CB  . LYS A 1 426 ? -36.500 -83.625 -42.037 1.00 171.51 ? 437 LYS A CB  1 
ATOM   3285 C  CG  . LYS A 1 426 ? -37.567 -83.265 -43.079 1.00 171.34 ? 437 LYS A CG  1 
ATOM   3286 C  CD  . LYS A 1 426 ? -36.989 -83.060 -44.479 1.00 175.26 ? 437 LYS A CD  1 
ATOM   3287 C  CE  . LYS A 1 426 ? -36.059 -81.855 -44.553 1.00 175.45 ? 437 LYS A CE  1 
ATOM   3288 N  NZ  . LYS A 1 426 ? -35.334 -81.826 -45.858 1.00 180.63 ? 437 LYS A NZ  1 
ATOM   3289 N  N   . LYS A 1 427 ? -35.085 -85.802 -40.191 1.00 173.97 ? 438 LYS A N   1 
ATOM   3290 C  CA  . LYS A 1 427 ? -34.185 -86.183 -39.112 1.00 173.85 ? 438 LYS A CA  1 
ATOM   3291 C  C   . LYS A 1 427 ? -33.248 -87.289 -39.574 1.00 178.80 ? 438 LYS A C   1 
ATOM   3292 O  O   . LYS A 1 427 ? -32.073 -87.304 -39.209 1.00 180.19 ? 438 LYS A O   1 
ATOM   3293 C  CB  . LYS A 1 427 ? -34.976 -86.631 -37.880 1.00 170.81 ? 438 LYS A CB  1 
ATOM   3294 C  CG  . LYS A 1 427 ? -35.827 -85.531 -37.254 1.00 165.91 ? 438 LYS A CG  1 
ATOM   3295 C  CD  . LYS A 1 427 ? -34.970 -84.510 -36.500 1.00 163.56 ? 438 LYS A CD  1 
ATOM   3296 C  CE  . LYS A 1 427 ? -35.765 -83.256 -36.153 1.00 159.06 ? 438 LYS A CE  1 
ATOM   3297 N  NZ  . LYS A 1 427 ? -36.909 -83.527 -35.224 1.00 156.35 ? 438 LYS A NZ  1 
ATOM   3298 N  N   . PHE A 1 428 ? -33.773 -88.202 -40.391 1.00 181.61 ? 439 PHE A N   1 
ATOM   3299 C  CA  . PHE A 1 428 ? -32.994 -89.324 -40.908 1.00 186.59 ? 439 PHE A CA  1 
ATOM   3300 C  C   . PHE A 1 428 ? -31.934 -88.849 -41.892 1.00 189.81 ? 439 PHE A C   1 
ATOM   3301 O  O   . PHE A 1 428 ? -30.758 -89.170 -41.740 1.00 192.45 ? 439 PHE A O   1 
ATOM   3302 C  CB  . PHE A 1 428 ? -33.905 -90.372 -41.549 1.00 188.77 ? 439 PHE A CB  1 
ATOM   3303 C  CG  . PHE A 1 428 ? -33.325 -91.759 -41.551 1.00 193.07 ? 439 PHE A CG  1 
ATOM   3304 C  CD1 . PHE A 1 428 ? -33.371 -92.549 -40.403 1.00 192.45 ? 439 PHE A CD1 1 
ATOM   3305 C  CD2 . PHE A 1 428 ? -32.738 -92.281 -42.699 1.00 197.96 ? 439 PHE A CD2 1 
ATOM   3306 C  CE1 . PHE A 1 428 ? -32.837 -93.832 -40.398 1.00 196.58 ? 439 PHE A CE1 1 
ATOM   3307 C  CE2 . PHE A 1 428 ? -32.203 -93.566 -42.705 1.00 202.09 ? 439 PHE A CE2 1 
ATOM   3308 C  CZ  . PHE A 1 428 ? -32.255 -94.343 -41.552 1.00 201.38 ? 439 PHE A CZ  1 
ATOM   3309 N  N   . ILE A 1 429 ? -32.357 -88.073 -42.887 1.00 189.75 ? 440 ILE A N   1 
ATOM   3310 C  CA  . ILE A 1 429 ? -31.445 -87.406 -43.815 1.00 192.49 ? 440 ILE A CA  1 
ATOM   3311 C  C   . ILE A 1 429 ? -30.254 -86.822 -43.058 1.00 191.51 ? 440 ILE A C   1 
ATOM   3312 O  O   . ILE A 1 429 ? -29.113 -86.922 -43.499 1.00 195.10 ? 440 ILE A O   1 
ATOM   3313 C  CB  . ILE A 1 429 ? -32.171 -86.278 -44.600 1.00 191.05 ? 440 ILE A CB  1 
ATOM   3314 C  CG1 . ILE A 1 429 ? -33.199 -86.872 -45.572 1.00 192.58 ? 440 ILE A CG1 1 
ATOM   3315 C  CG2 . ILE A 1 429 ? -31.174 -85.391 -45.348 1.00 193.74 ? 440 ILE A CG2 1 
ATOM   3316 C  CD1 . ILE A 1 429 ? -34.297 -85.903 -46.015 1.00 190.01 ? 440 ILE A CD1 1 
ATOM   3317 N  N   . ASP A 1 430 ? -30.536 -86.244 -41.898 1.00 186.82 ? 441 ASP A N   1 
ATOM   3318 C  CA  . ASP A 1 430 ? -29.534 -85.538 -41.120 1.00 185.41 ? 441 ASP A CA  1 
ATOM   3319 C  C   . ASP A 1 430 ? -28.698 -86.449 -40.230 1.00 187.28 ? 441 ASP A C   1 
ATOM   3320 O  O   . ASP A 1 430 ? -27.475 -86.316 -40.195 1.00 189.61 ? 441 ASP A O   1 
ATOM   3321 C  CB  . ASP A 1 430 ? -30.191 -84.433 -40.288 1.00 179.89 ? 441 ASP A CB  1 
ATOM   3322 C  CG  . ASP A 1 430 ? -31.053 -83.499 -41.125 1.00 178.03 ? 441 ASP A CG  1 
ATOM   3323 O  OD1 . ASP A 1 430 ? -30.811 -83.370 -42.347 1.00 181.25 ? 441 ASP A OD1 1 
ATOM   3324 O  OD2 . ASP A 1 430 ? -31.986 -82.896 -40.553 1.00 173.61 ? 441 ASP A OD2 1 
ATOM   3325 N  N   . ILE A 1 431 ? -29.344 -87.368 -39.511 1.00 186.47 ? 442 ILE A N   1 
ATOM   3326 C  CA  . ILE A 1 431 ? -28.614 -88.262 -38.601 1.00 188.38 ? 442 ILE A CA  1 
ATOM   3327 C  C   . ILE A 1 431 ? -27.469 -88.978 -39.325 1.00 194.05 ? 442 ILE A C   1 
ATOM   3328 O  O   . ILE A 1 431 ? -26.355 -89.065 -38.809 1.00 195.97 ? 442 ILE A O   1 
ATOM   3329 C  CB  . ILE A 1 431 ? -29.532 -89.281 -37.836 1.00 187.25 ? 442 ILE A CB  1 
ATOM   3330 C  CG1 . ILE A 1 431 ? -30.416 -90.099 -38.786 1.00 188.88 ? 442 ILE A CG1 1 
ATOM   3331 C  CG2 . ILE A 1 431 ? -30.388 -88.578 -36.797 1.00 181.98 ? 442 ILE A CG2 1 
ATOM   3332 C  CD1 . ILE A 1 431 ? -29.929 -91.522 -39.050 1.00 193.95 ? 442 ILE A CD1 1 
ATOM   3333 N  N   . ALA A 1 432 ? -27.751 -89.457 -40.533 1.00 196.87 ? 443 ALA A N   1 
ATOM   3334 C  CA  . ALA A 1 432 ? -26.753 -90.128 -41.348 1.00 202.46 ? 443 ALA A CA  1 
ATOM   3335 C  C   . ALA A 1 432 ? -25.781 -89.120 -41.942 1.00 203.82 ? 443 ALA A C   1 
ATOM   3336 O  O   . ALA A 1 432 ? -24.595 -89.417 -42.091 1.00 207.93 ? 443 ALA A O   1 
ATOM   3337 C  CB  . ALA A 1 432 ? -27.421 -90.933 -42.441 1.00 204.89 ? 443 ALA A CB  1 
ATOM   3338 N  N   . ALA A 1 433 ? -26.287 -87.931 -42.271 1.00 200.53 ? 444 ALA A N   1 
ATOM   3339 C  CA  . ALA A 1 433 ? -25.448 -86.863 -42.813 1.00 201.43 ? 444 ALA A CA  1 
ATOM   3340 C  C   . ALA A 1 433 ? -24.275 -86.625 -41.881 1.00 201.66 ? 444 ALA A C   1 
ATOM   3341 O  O   . ALA A 1 433 ? -23.151 -86.435 -42.335 1.00 205.46 ? 444 ALA A O   1 
ATOM   3342 C  CB  . ALA A 1 433 ? -26.245 -85.583 -43.009 1.00 197.22 ? 444 ALA A CB  1 
ATOM   3343 N  N   . ALA A 1 434 ? -24.543 -86.672 -40.578 1.00 197.89 ? 445 ALA A N   1 
ATOM   3344 C  CA  . ALA A 1 434 ? -23.506 -86.537 -39.563 1.00 197.92 ? 445 ALA A CA  1 
ATOM   3345 C  C   . ALA A 1 434 ? -22.365 -87.540 -39.759 1.00 203.41 ? 445 ALA A C   1 
ATOM   3346 O  O   . ALA A 1 434 ? -21.187 -87.148 -39.759 1.00 205.36 ? 445 ALA A O   1 
ATOM   3347 C  CB  . ALA A 1 434 ? -24.107 -86.668 -38.171 1.00 193.61 ? 445 ALA A CB  1 
ATOM   3348 N  N   . LYS A 1 435 ? -22.721 -88.818 -39.961 1.00 206.07 ? 446 LYS A N   1 
ATOM   3349 C  CA  . LYS A 1 435 ? -21.737 -89.907 -40.049 1.00 211.45 ? 446 LYS A CA  1 
ATOM   3350 C  C   . LYS A 1 435 ? -20.628 -89.629 -41.061 1.00 215.78 ? 446 LYS A C   1 
ATOM   3351 O  O   . LYS A 1 435 ? -19.456 -89.513 -40.691 1.00 217.84 ? 446 LYS A O   1 
ATOM   3352 C  CB  . LYS A 1 435 ? -22.413 -91.251 -40.378 1.00 213.77 ? 446 LYS A CB  1 
ATOM   3353 C  CG  . LYS A 1 435 ? -23.560 -91.668 -39.456 1.00 210.17 ? 446 LYS A CG  1 
ATOM   3354 C  CD  . LYS A 1 435 ? -23.216 -91.538 -37.976 1.00 207.32 ? 446 LYS A CD  1 
ATOM   3355 C  CE  . LYS A 1 435 ? -22.265 -92.616 -37.496 1.00 211.21 ? 446 LYS A CE  1 
ATOM   3356 N  NZ  . LYS A 1 435 ? -22.071 -92.500 -36.028 1.00 208.36 ? 446 LYS A NZ  1 
ATOM   3357 N  N   . GLU A 1 436 ? -21.014 -89.511 -42.331 1.00 217.31 ? 447 GLU A N   1 
ATOM   3358 C  CA  . GLU A 1 436 ? -20.073 -89.318 -43.432 1.00 222.06 ? 447 GLU A CA  1 
ATOM   3359 C  C   . GLU A 1 436 ? -19.304 -88.001 -43.313 1.00 220.77 ? 447 GLU A C   1 
ATOM   3360 O  O   . GLU A 1 436 ? -18.149 -87.906 -43.738 1.00 224.85 ? 447 GLU A O   1 
ATOM   3361 C  CB  . GLU A 1 436 ? -20.813 -89.381 -44.773 1.00 223.57 ? 447 GLU A CB  1 
ATOM   3362 C  CG  . GLU A 1 436 ? -19.908 -89.579 -45.992 1.00 229.81 ? 447 GLU A CG  1 
ATOM   3363 C  CD  . GLU A 1 436 ? -20.664 -89.577 -47.315 1.00 231.26 ? 447 GLU A CD  1 
ATOM   3364 O  OE1 . GLU A 1 436 ? -21.883 -89.284 -47.326 1.00 227.48 ? 447 GLU A OE1 1 
ATOM   3365 O  OE2 . GLU A 1 436 ? -20.033 -89.872 -48.353 1.00 236.52 ? 447 GLU A OE2 1 
ATOM   3366 N  N   . VAL A 1 437 ? -19.947 -86.997 -42.721 1.00 215.23 ? 448 VAL A N   1 
ATOM   3367 C  CA  . VAL A 1 437 ? -19.370 -85.656 -42.629 1.00 213.55 ? 448 VAL A CA  1 
ATOM   3368 C  C   . VAL A 1 437 ? -18.409 -85.494 -41.439 1.00 213.40 ? 448 VAL A C   1 
ATOM   3369 O  O   . VAL A 1 437 ? -17.648 -84.527 -41.378 1.00 213.52 ? 448 VAL A O   1 
ATOM   3370 C  CB  . VAL A 1 437 ? -20.478 -84.559 -42.625 1.00 207.96 ? 448 VAL A CB  1 
ATOM   3371 C  CG1 . VAL A 1 437 ? -19.881 -83.174 -42.465 1.00 206.26 ? 448 VAL A CG1 1 
ATOM   3372 C  CG2 . VAL A 1 437 ? -21.293 -84.614 -43.915 1.00 208.80 ? 448 VAL A CG2 1 
ATOM   3373 N  N   . LEU A 1 438 ? -18.426 -86.437 -40.502 1.00 213.81 ? 449 LEU A N   1 
ATOM   3374 C  CA  . LEU A 1 438 ? -17.544 -86.319 -39.345 1.00 213.92 ? 449 LEU A CA  1 
ATOM   3375 C  C   . LEU A 1 438 ? -16.313 -87.233 -39.366 1.00 219.45 ? 449 LEU A C   1 
ATOM   3376 O  O   . LEU A 1 438 ? -15.237 -86.844 -38.893 1.00 221.00 ? 449 LEU A O   1 
ATOM   3377 C  CB  . LEU A 1 438 ? -18.329 -86.428 -38.022 1.00 208.57 ? 449 LEU A CB  1 
ATOM   3378 C  CG  . LEU A 1 438 ? -19.121 -87.612 -37.574 1.00 205.98 ? 449 LEU A CG  1 
ATOM   3379 C  CD1 . LEU A 1 438 ? -18.212 -88.782 -36.995 1.00 209.69 ? 449 LEU A CD1 1 
ATOM   3380 C  CD2 . LEU A 1 438 ? -20.204 -87.085 -36.568 1.00 199.91 ? 449 LEU A CD2 1 
ATOM   3381 N  N   . SER A 1 439 ? -16.468 -88.435 -39.918 1.00 222.62 ? 450 SER A N   1 
ATOM   3382 C  CA  . SER A 1 439 ? -15.346 -89.376 -40.022 1.00 228.44 ? 450 SER A CA  1 
ATOM   3383 C  C   . SER A 1 439 ? -14.305 -88.898 -41.043 1.00 233.12 ? 450 SER A C   1 
ATOM   3384 O  O   . SER A 1 439 ? -14.612 -88.087 -41.926 1.00 233.09 ? 450 SER A O   1 
ATOM   3385 C  CB  . SER A 1 439 ? -15.850 -90.778 -40.378 1.00 230.68 ? 450 SER A CB  1 
ATOM   3386 O  OG  . SER A 1 439 ? -16.446 -90.794 -41.663 1.00 231.32 ? 450 SER A OG  1 
ATOM   3387 N  N   . ASP A 1 440 ? -13.075 -89.404 -40.889 1.00 237.27 ? 451 ASP A N   1 
ATOM   3388 C  CA  . ASP A 1 440 ? -11.955 -89.121 -41.737 1.00 242.58 ? 451 ASP A CA  1 
ATOM   3389 C  C   . ASP A 1 440 ? -11.501 -87.639 -41.739 1.00 240.66 ? 451 ASP A C   1 
ATOM   3390 O  O   . ASP A 1 440 ? -11.666 -87.012 -40.702 1.00 235.91 ? 451 ASP A O   1 
ATOM   3391 C  CB  . ASP A 1 440 ? -12.297 -89.598 -43.156 1.00 246.89 ? 451 ASP A CB  1 
ATOM   3392 C  CG  . ASP A 1 440 ? -12.923 -90.989 -43.187 1.00 247.26 ? 451 ASP A CG  1 
ATOM   3393 O  OD1 . ASP A 1 440 ? -12.644 -91.794 -42.254 1.00 247.31 ? 451 ASP A OD1 1 
ATOM   3394 O  OD2 . ASP A 1 440 ? -13.704 -91.276 -44.146 1.00 247.95 ? 451 ASP A OD2 1 
ATOM   3395 N  N   . PRO A 1 441 ? -10.920 -87.078 -42.870 1.00 244.34 ? 452 PRO A N   1 
ATOM   3396 C  CA  . PRO A 1 441 ? -10.403 -85.692 -42.863 1.00 242.92 ? 452 PRO A CA  1 
ATOM   3397 C  C   . PRO A 1 441 ? -11.386 -84.632 -42.356 1.00 236.21 ? 452 PRO A C   1 
ATOM   3398 O  O   . PRO A 1 441 ? -10.969 -83.657 -41.727 1.00 234.12 ? 452 PRO A O   1 
ATOM   3399 C  CB  . PRO A 1 441 ? -10.088 -85.430 -44.344 1.00 247.55 ? 452 PRO A CB  1 
ATOM   3400 C  CG  . PRO A 1 441 ? -9.752  -86.760 -44.880 1.00 253.16 ? 452 PRO A CG  1 
ATOM   3401 C  CD  . PRO A 1 441 ? -10.657 -87.738 -44.127 1.00 250.40 ? 452 PRO A CD  1 
ATOM   3402 N  N   . GLU A 1 442 ? -12.674 -84.830 -42.623 1.00 233.07 ? 453 GLU A N   1 
ATOM   3403 C  CA  . GLU A 1 442 ? -13.714 -83.895 -42.201 1.00 226.73 ? 453 GLU A CA  1 
ATOM   3404 C  C   . GLU A 1 442 ? -13.803 -83.783 -40.678 1.00 222.66 ? 453 GLU A C   1 
ATOM   3405 O  O   . GLU A 1 442 ? -13.337 -84.675 -39.959 1.00 224.49 ? 453 GLU A O   1 
ATOM   3406 C  CB  . GLU A 1 442 ? -15.069 -84.322 -42.779 1.00 224.99 ? 453 GLU A CB  1 
ATOM   3407 C  CG  . GLU A 1 442 ? -15.210 -84.113 -44.282 1.00 225.67 ? 453 GLU A CG  1 
ATOM   3408 C  CD  . GLU A 1 442 ? -14.401 -85.089 -45.104 1.00 231.92 ? 453 GLU A CD  1 
ATOM   3409 O  OE1 . GLU A 1 442 ? -14.051 -86.189 -44.587 1.00 235.68 ? 453 GLU A OE1 1 
ATOM   3410 O  OE2 . GLU A 1 442 ? -14.226 -84.829 -46.298 1.00 233.26 ? 453 GLU A OE2 1 
HETATM 3411 N  N   . MSE A 1 443 ? -14.407 -82.677 -40.215 1.00 217.32 ? 454 MSE A N   1 
HETATM 3412 C  CA  . MSE A 1 443 ? -14.592 -82.328 -38.784 1.00 212.88 ? 454 MSE A CA  1 
HETATM 3413 C  C   . MSE A 1 443 ? -13.526 -81.316 -38.309 1.00 212.42 ? 454 MSE A C   1 
HETATM 3414 O  O   . MSE A 1 443 ? -13.832 -80.530 -37.430 1.00 207.71 ? 454 MSE A O   1 
HETATM 3415 C  CB  . MSE A 1 443 ? -14.626 -83.579 -37.873 1.00 213.89 ? 454 MSE A CB  1 
HETATM 3416 C  CG  . MSE A 1 443 ? -14.924 -83.301 -36.386 1.00 208.92 ? 454 MSE A CG  1 
HETATM 3417 SE SE  . MSE A 1 443 ? -15.206 -84.916 -35.289 1.00 211.67 ? 454 MSE A SE  1 
HETATM 3418 C  CE  . MSE A 1 443 ? -17.170 -85.022 -35.372 1.00 209.89 ? 454 MSE A CE  1 
ATOM   3419 N  N   . ARG A 1 444 ? -12.298 -81.475 -38.882 1.00 217.66 ? 455 ARG A N   1 
ATOM   3420 C  CA  . ARG A 1 444 ? -11.189 -80.523 -38.679 1.00 218.24 ? 455 ARG A CA  1 
ATOM   3421 C  C   . ARG A 1 444 ? -9.925  -81.025 -39.358 1.00 224.41 ? 455 ARG A C   1 
ATOM   3422 O  O   . ARG A 1 444 ? -9.910  -81.235 -40.570 1.00 225.45 ? 455 ARG A O   1 
ATOM   3423 C  CB  . ARG A 1 444 ? -10.896 -80.234 -37.196 1.00 216.31 ? 455 ARG A CB  1 
ATOM   3424 C  CG  . ARG A 1 444 ? -11.518 -78.988 -36.662 1.00 213.37 ? 455 ARG A CG  1 
ATOM   3425 C  CD  . ARG A 1 444 ? -11.250 -77.758 -37.609 1.00 210.83 ? 455 ARG A CD  1 
ATOM   3426 N  NE  . ARG A 1 444 ? -12.237 -76.673 -37.439 1.00 205.40 ? 455 ARG A NE  1 
ATOM   3427 C  CZ  . ARG A 1 444 ? -13.442 -76.649 -38.038 1.00 200.99 ? 455 ARG A CZ  1 
ATOM   3428 N  NH1 . ARG A 1 444 ? -13.831 -77.652 -38.854 1.00 201.48 ? 455 ARG A NH1 1 
ATOM   3429 N  NH2 . ARG A 1 444 ? -14.279 -75.614 -37.709 1.00 196.16 ? 455 ARG A NH2 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLN A 21  ? 2.0237 1.5802 2.1453 -0.1237 -0.1840 0.2222  32  GLN A N   
2    C  CA  . GLN A 21  ? 1.9843 1.5524 2.0954 -0.1230 -0.1721 0.2210  32  GLN A CA  
3    C  C   . GLN A 21  ? 1.9567 1.5462 2.0887 -0.1199 -0.1700 0.2248  32  GLN A C   
4    O  O   . GLN A 21  ? 1.9279 1.5405 2.0836 -0.1175 -0.1629 0.2301  32  GLN A O   
5    C  CB  . GLN A 21  ? 1.9333 1.5129 2.0420 -0.1231 -0.1583 0.2219  32  GLN A CB  
6    C  CG  . GLN A 21  ? 1.8993 1.4884 1.9948 -0.1228 -0.1465 0.2200  32  GLN A CG  
7    C  CD  . GLN A 21  ? 1.8628 1.4627 1.9567 -0.1229 -0.1335 0.2207  32  GLN A CD  
8    O  OE1 . GLN A 21  ? 1.8291 1.4402 1.9169 -0.1223 -0.1234 0.2199  32  GLN A OE1 
9    N  NE2 . GLN A 21  ? 1.8731 1.4694 1.9727 -0.1238 -0.1340 0.2220  32  GLN A NE2 
10   N  N   . SER A 22  ? 1.9676 1.5486 2.0903 -0.1200 -0.1761 0.2221  33  SER A N   
11   C  CA  . SER A 22  ? 1.9422 1.5415 2.0800 -0.1174 -0.1730 0.2245  33  SER A CA  
12   C  C   . SER A 22  ? 1.8827 1.4955 2.0099 -0.1169 -0.1586 0.2236  33  SER A C   
13   O  O   . SER A 22  ? 1.8693 1.4707 1.9718 -0.1184 -0.1570 0.2187  33  SER A O   
14   C  CB  . SER A 22  ? 1.9712 1.5564 2.1038 -0.1177 -0.1851 0.2218  33  SER A CB  
15   O  OG  . SER A 22  ? 1.9759 1.5434 2.0767 -0.1199 -0.1852 0.2160  33  SER A OG  
16   N  N   . MSE A 23  ? 1.8502 1.4868 1.9961 -0.1148 -0.1483 0.2283  34  MSE A N   
17   C  CA  . MSE A 23  ? 1.7955 1.4487 1.9367 -0.1137 -0.1350 0.2284  34  MSE A CA  
18   C  C   . MSE A 23  ? 1.7810 1.4501 1.9377 -0.1112 -0.1339 0.2307  34  MSE A C   
19   O  O   . MSE A 23  ? 1.7388 1.4295 1.9057 -0.1092 -0.1235 0.2336  34  MSE A O   
20   C  CB  . MSE A 23  ? 1.7717 1.4409 1.9244 -0.1129 -0.1252 0.2325  34  MSE A CB  
21   C  CG  . MSE A 23  ? 1.7134 1.4033 1.8673 -0.1112 -0.1120 0.2339  34  MSE A CG  
22   SE SE  . MSE A 23  ? 1.6890 1.3873 1.8410 -0.1118 -0.1005 0.2356  34  MSE A SE  
23   C  CE  . MSE A 23  ? 1.6828 1.4147 1.8681 -0.1078 -0.0922 0.2445  34  MSE A CE  
24   N  N   . ALA A 24  ? 1.8199 1.4774 1.9779 -0.1114 -0.1452 0.2291  35  ALA A N   
25   C  CA  . ALA A 24  ? 1.8139 1.4822 1.9851 -0.1093 -0.1461 0.2303  35  ALA A CA  
26   C  C   . ALA A 24  ? 1.7666 1.4413 1.9223 -0.1091 -0.1370 0.2274  35  ALA A C   
27   O  O   . ALA A 24  ? 1.7391 1.4337 1.9083 -0.1068 -0.1297 0.2300  35  ALA A O   
28   C  CB  . ALA A 24  ? 1.8621 1.5123 2.0332 -0.1100 -0.1610 0.2282  35  ALA A CB  
29   N  N   . ASP A 25  ? 1.7594 1.4171 1.8866 -0.1115 -0.1369 0.2220  36  ASP A N   
30   C  CA  . ASP A 25  ? 1.7167 1.3786 1.8278 -0.1115 -0.1286 0.2187  36  ASP A CA  
31   C  C   . ASP A 25  ? 1.6703 1.3582 1.7932 -0.1094 -0.1149 0.2222  36  ASP A C   
32   O  O   . ASP A 25  ? 1.6475 1.3496 1.7769 -0.1076 -0.1100 0.2228  36  ASP A O   
33   C  CB  . ASP A 25  ? 1.7150 1.3559 1.7946 -0.1146 -0.1283 0.2129  36  ASP A CB  
34   C  CG  . ASP A 25  ? 1.7592 1.3728 1.8247 -0.1167 -0.1424 0.2094  36  ASP A CG  
35   O  OD1 . ASP A 25  ? 1.7957 1.4082 1.8760 -0.1156 -0.1521 0.2112  36  ASP A OD1 
36   O  OD2 . ASP A 25  ? 1.7604 1.3530 1.7996 -0.1196 -0.1438 0.2048  36  ASP A OD2 
37   N  N   . VAL A 26  ? 1.6599 1.3536 1.7862 -0.1096 -0.1093 0.2246  37  VAL A N   
38   C  CA  . VAL A 26  ? 1.6209 1.3386 1.7591 -0.1077 -0.0972 0.2284  37  VAL A CA  
39   C  C   . VAL A 26  ? 1.6288 1.3658 1.7951 -0.1048 -0.0966 0.2342  37  VAL A C   
40   O  O   . VAL A 26  ? 1.5997 1.3566 1.7745 -0.1029 -0.0872 0.2368  37  VAL A O   
41   C  CB  . VAL A 26  ? 1.6146 1.3332 1.7524 -0.1085 -0.0926 0.2301  37  VAL A CB  
42   C  CG1 . VAL A 26  ? 1.5757 1.3183 1.7246 -0.1065 -0.0806 0.2342  37  VAL A CG1 
43   C  CG2 . VAL A 26  ? 1.6123 1.3109 1.7227 -0.1115 -0.0926 0.2243  37  VAL A CG2 
44   N  N   . GLU A 27  ? 1.6715 1.4019 1.8521 -0.1046 -0.1066 0.2361  38  GLU A N   
45   C  CA  . GLU A 27  ? 1.6855 1.4323 1.8940 -0.1021 -0.1066 0.2414  38  GLU A CA  
46   C  C   . GLU A 27  ? 1.6815 1.4330 1.8932 -0.1009 -0.1073 0.2400  38  GLU A C   
47   O  O   . GLU A 27  ? 1.6622 1.4331 1.8878 -0.0987 -0.0997 0.2431  38  GLU A O   
48   C  CB  . GLU A 27  ? 1.7353 1.4732 1.9591 -0.1025 -0.1171 0.2438  38  GLU A CB  
49   C  CG  . GLU A 27  ? 1.7509 1.5066 2.0058 -0.1000 -0.1154 0.2502  38  GLU A CG  
50   C  CD  . GLU A 27  ? 1.7132 1.4911 1.9761 -0.0984 -0.1021 0.2545  38  GLU A CD  
51   O  OE1 . GLU A 27  ? 1.7025 1.4812 1.9609 -0.0991 -0.0980 0.2559  38  GLU A OE1 
52   O  OE2 . GLU A 27  ? 1.6965 1.4904 1.9696 -0.0964 -0.0958 0.2565  38  GLU A OE2 
53   N  N   . LYS A 28  ? 1.7017 1.4348 1.8999 -0.1023 -0.1164 0.2353  39  LYS A N   
54   C  CA  . LYS A 28  ? 1.7032 1.4384 1.9035 -0.1013 -0.1183 0.2334  39  LYS A CA  
55   C  C   . LYS A 28  ? 1.6537 1.4033 1.8455 -0.1004 -0.1061 0.2323  39  LYS A C   
56   O  O   . LYS A 28  ? 1.6438 1.4097 1.8501 -0.0983 -0.1013 0.2343  39  LYS A O   
57   C  CB  . LYS A 28  ? 1.7320 1.4430 1.9149 -0.1033 -0.1300 0.2282  39  LYS A CB  
58   C  CG  . LYS A 28  ? 1.7863 1.4809 1.9766 -0.1042 -0.1438 0.2288  39  LYS A CG  
59   C  CD  . LYS A 28  ? 1.8125 1.5207 2.0358 -0.1020 -0.1461 0.2343  39  LYS A CD  
60   C  CE  . LYS A 28  ? 1.8449 1.5449 2.0767 -0.1029 -0.1531 0.2366  39  LYS A CE  
61   N  NZ  . LYS A 28  ? 1.8474 1.5676 2.1074 -0.1008 -0.1473 0.2429  39  LYS A NZ  
62   N  N   . HIS A 29  ? 1.6250 1.3686 1.7940 -0.1020 -0.1011 0.2290  40  HIS A N   
63   C  CA  . HIS A 29  ? 1.5779 1.3340 1.7370 -0.1014 -0.0897 0.2275  40  HIS A CA  
64   C  C   . HIS A 29  ? 1.5604 1.3416 1.7406 -0.0987 -0.0809 0.2327  40  HIS A C   
65   O  O   . HIS A 29  ? 1.5372 1.3297 1.7179 -0.0975 -0.0751 0.2319  40  HIS A O   
66   C  CB  . HIS A 29  ? 1.5530 1.3037 1.6925 -0.1032 -0.0840 0.2253  40  HIS A CB  
67   C  CG  . HIS A 29  ? 1.5540 1.2824 1.6669 -0.1059 -0.0884 0.2189  40  HIS A CG  
68   N  ND1 . HIS A 29  ? 1.5549 1.2754 1.6576 -0.1062 -0.0919 0.2149  40  HIS A ND1 
69   C  CD2 . HIS A 29  ? 1.5562 1.2683 1.6500 -0.1084 -0.0892 0.2158  40  HIS A CD2 
70   C  CE1 . HIS A 29  ? 1.5586 1.2585 1.6372 -0.1088 -0.0952 0.2099  40  HIS A CE1 
71   N  NE2 . HIS A 29  ? 1.5598 1.2542 1.6324 -0.1102 -0.0934 0.2102  40  HIS A NE2 
72   N  N   . LEU A 30  ? 1.5749 1.3640 1.7722 -0.0979 -0.0801 0.2379  41  LEU A N   
73   C  CA  . LEU A 30  ? 1.5643 1.3763 1.7814 -0.0955 -0.0716 0.2434  41  LEU A CA  
74   C  C   . LEU A 30  ? 1.5890 1.4080 1.8263 -0.0938 -0.0745 0.2454  41  LEU A C   
75   O  O   . LEU A 30  ? 1.5730 1.4081 1.8175 -0.0920 -0.0669 0.2468  41  LEU A O   
76   C  CB  . LEU A 30  ? 1.5745 1.3916 1.8031 -0.0953 -0.0700 0.2484  41  LEU A CB  
77   C  CG  . LEU A 30  ? 1.5504 1.3634 1.7615 -0.0968 -0.0655 0.2468  41  LEU A CG  
78   C  CD1 . LEU A 30  ? 1.5785 1.3824 1.7942 -0.0979 -0.0706 0.2489  41  LEU A CD1 
79   C  CD2 . LEU A 30  ? 1.5090 1.3421 1.7223 -0.0953 -0.0534 0.2496  41  LEU A CD2 
80   N  N   . GLU A 31  ? 1.6305 1.4373 1.8770 -0.0942 -0.0855 0.2453  42  GLU A N   
81   C  CA  . GLU A 31  ? 1.6585 1.4712 1.9257 -0.0926 -0.0888 0.2470  42  GLU A CA  
82   C  C   . GLU A 31  ? 1.6398 1.4542 1.8974 -0.0922 -0.0862 0.2430  42  GLU A C   
83   O  O   . GLU A 31  ? 1.6257 1.4573 1.8929 -0.0904 -0.0777 0.2448  42  GLU A O   
84   C  CB  . GLU A 31  ? 1.7082 1.5047 1.9841 -0.0935 -0.1025 0.2466  42  GLU A CB  
85   C  CG  . GLU A 31  ? 1.7454 1.5518 2.0515 -0.0916 -0.1046 0.2507  42  GLU A CG  
86   C  CD  . GLU A 31  ? 1.7978 1.5875 2.1124 -0.0923 -0.1193 0.2493  42  GLU A CD  
87   O  OE1 . GLU A 31  ? 1.8065 1.5764 2.1014 -0.0942 -0.1281 0.2447  42  GLU A OE1 
88   O  OE2 . GLU A 31  ? 1.8330 1.6292 2.1742 -0.0910 -0.1220 0.2530  42  GLU A OE2 
89   N  N   . LEU A 32  ? 1.6407 1.4369 1.8784 -0.0940 -0.0933 0.2375  43  LEU A N   
90   C  CA  . LEU A 32  ? 1.6224 1.4172 1.8469 -0.0940 -0.0914 0.2329  43  LEU A CA  
91   C  C   . LEU A 32  ? 1.5781 1.3905 1.7972 -0.0930 -0.0780 0.2331  43  LEU A C   
92   O  O   . LEU A 32  ? 1.5704 1.3924 1.7933 -0.0917 -0.0736 0.2321  43  LEU A O   
93   C  CB  . LEU A 32  ? 1.6196 1.3923 1.8174 -0.0966 -0.0980 0.2272  43  LEU A CB  
94   C  CG  . LEU A 32  ? 1.6644 1.4152 1.8600 -0.0980 -0.1125 0.2254  43  LEU A CG  
95   C  CD1 . LEU A 32  ? 1.6607 1.3927 1.8327 -0.1007 -0.1161 0.2225  43  LEU A CD1 
96   C  CD2 . LEU A 32  ? 1.6816 1.4247 1.8734 -0.0979 -0.1183 0.2216  43  LEU A CD2 
97   N  N   . GLY A 33  ? 1.5516 1.3679 1.7621 -0.0935 -0.0717 0.2344  44  GLY A N   
98   C  CA  . GLY A 33  ? 1.5112 1.3438 1.7164 -0.0926 -0.0596 0.2349  44  GLY A CA  
99   C  C   . GLY A 33  ? 1.5147 1.3682 1.7416 -0.0901 -0.0526 0.2397  44  GLY A C   
100  O  O   . GLY A 33  ? 1.4936 1.3586 1.7187 -0.0890 -0.0453 0.2387  44  GLY A O   
101  N  N   . LYS A 34  ? 1.5441 1.4020 1.7914 -0.0893 -0.0547 0.2449  45  LYS A N   
102  C  CA  . LYS A 34  ? 1.5526 1.4299 1.8210 -0.0871 -0.0474 0.2502  45  LYS A CA  
103  C  C   . LYS A 34  ? 1.5706 1.4518 1.8508 -0.0859 -0.0483 0.2490  45  LYS A C   
104  O  O   . LYS A 34  ? 1.5584 1.4549 1.8438 -0.0844 -0.0395 0.2501  45  LYS A O   
105  C  CB  . LYS A 34  ? 1.5819 1.4618 1.8692 -0.0867 -0.0494 0.2560  45  LYS A CB  
106  C  CG  . LYS A 34  ? 1.5607 1.4433 1.8398 -0.0873 -0.0448 0.2583  45  LYS A CG  
107  C  CD  . LYS A 34  ? 1.5923 1.4727 1.8870 -0.0874 -0.0491 0.2630  45  LYS A CD  
108  C  CE  . LYS A 34  ? 1.5717 1.4515 1.8559 -0.0883 -0.0458 0.2643  45  LYS A CE  
109  N  NZ  . LYS A 34  ? 1.5951 1.4827 1.8990 -0.0875 -0.0445 0.2709  45  LYS A NZ  
110  N  N   . LYS A 35  ? 1.6015 1.4683 1.8851 -0.0866 -0.0592 0.2466  46  LYS A N   
111  C  CA  . LYS A 35  ? 1.6221 1.4901 1.9162 -0.0857 -0.0616 0.2448  46  LYS A CA  
112  C  C   . LYS A 35  ? 1.5888 1.4612 1.8672 -0.0855 -0.0552 0.2404  46  LYS A C   
113  O  O   . LYS A 35  ? 1.5934 1.4780 1.8826 -0.0839 -0.0495 0.2409  46  LYS A O   
114  C  CB  . LYS A 35  ? 1.6589 1.5075 1.9548 -0.0868 -0.0757 0.2422  46  LYS A CB  
115  C  CG  . LYS A 35  ? 1.6878 1.5301 1.9975 -0.0872 -0.0831 0.2459  46  LYS A CG  
116  C  CD  . LYS A 35  ? 1.7378 1.5650 2.0572 -0.0877 -0.0968 0.2443  46  LYS A CD  
117  C  CE  . LYS A 35  ? 1.7669 1.5895 2.1022 -0.0879 -0.1035 0.2482  46  LYS A CE  
118  N  NZ  . LYS A 35  ? 1.8247 1.6381 2.1782 -0.0877 -0.1155 0.2479  46  LYS A NZ  
119  N  N   . LEU A 36  ? 1.5571 1.4196 1.8105 -0.0871 -0.0558 0.2362  47  LEU A N   
120  C  CA  . LEU A 36  ? 1.5246 1.3897 1.7613 -0.0872 -0.0502 0.2316  47  LEU A CA  
121  C  C   . LEU A 36  ? 1.4995 1.3853 1.7395 -0.0856 -0.0373 0.2341  47  LEU A C   
122  O  O   . LEU A 36  ? 1.4958 1.3910 1.7395 -0.0844 -0.0323 0.2328  47  LEU A O   
123  C  CB  . LEU A 36  ? 1.4985 1.3493 1.7085 -0.0893 -0.0524 0.2272  47  LEU A CB  
124  C  CG  . LEU A 36  ? 1.5163 1.3452 1.7139 -0.0911 -0.0635 0.2224  47  LEU A CG  
125  C  CD1 . LEU A 36  ? 1.4966 1.3117 1.6710 -0.0934 -0.0650 0.2197  47  LEU A CD1 
126  C  CD2 . LEU A 36  ? 1.5147 1.3422 1.7065 -0.0908 -0.0636 0.2180  47  LEU A CD2 
127  N  N   . LEU A 37  ? 1.4844 1.3769 1.7227 -0.0856 -0.0322 0.2375  48  LEU A N   
128  C  CA  . LEU A 37  ? 1.4674 1.3791 1.7096 -0.0841 -0.0207 0.2407  48  LEU A CA  
129  C  C   . LEU A 37  ? 1.4979 1.4214 1.7621 -0.0822 -0.0177 0.2436  48  LEU A C   
130  O  O   . LEU A 37  ? 1.4899 1.4243 1.7535 -0.0812 -0.0104 0.2425  48  LEU A O   
131  C  CB  . LEU A 37  ? 1.4601 1.3766 1.7042 -0.0842 -0.0177 0.2454  48  LEU A CB  
132  C  CG  . LEU A 37  ? 1.4445 1.3800 1.6914 -0.0827 -0.0063 0.2494  48  LEU A CG  
133  C  CD1 . LEU A 37  ? 1.4266 1.3622 1.6651 -0.0834 -0.0043 0.2514  48  LEU A CD1 
134  C  CD2 . LEU A 37  ? 1.4767 1.4253 1.7475 -0.0809 -0.0024 0.2552  48  LEU A CD2 
135  N  N   . ALA A 38  ? 1.5352 1.4557 1.8187 -0.0819 -0.0234 0.2471  49  ALA A N   
136  C  CA  . ALA A 38  ? 1.5695 1.5007 1.8765 -0.0802 -0.0205 0.2502  49  ALA A CA  
137  C  C   . ALA A 38  ? 1.5731 1.5044 1.8805 -0.0797 -0.0205 0.2458  49  ALA A C   
138  O  O   . ALA A 38  ? 1.5859 1.5303 1.9056 -0.0782 -0.0131 0.2473  49  ALA A O   
139  C  CB  . ALA A 38  ? 1.6100 1.5348 1.9370 -0.0803 -0.0286 0.2536  49  ALA A CB  
140  N  N   . ALA A 39  ? 1.5638 1.4800 1.8570 -0.0810 -0.0284 0.2404  50  ALA A N   
141  C  CA  . ALA A 39  ? 1.5684 1.4825 1.8613 -0.0807 -0.0297 0.2359  50  ALA A CA  
142  C  C   . ALA A 39  ? 1.5318 1.4553 1.8090 -0.0804 -0.0201 0.2328  50  ALA A C   
143  O  O   . ALA A 39  ? 1.5340 1.4599 1.8121 -0.0798 -0.0183 0.2296  50  ALA A O   
144  C  CB  . ALA A 39  ? 1.5758 1.4695 1.8589 -0.0823 -0.0421 0.2315  50  ALA A CB  
145  N  N   . GLY A 40  ? 1.5003 1.4288 1.7635 -0.0807 -0.0141 0.2339  51  GLY A N   
146  C  CA  . GLY A 40  ? 1.4650 1.4021 1.7124 -0.0805 -0.0054 0.2310  51  GLY A CA  
147  C  C   . GLY A 40  ? 1.4342 1.3590 1.6568 -0.0823 -0.0086 0.2255  51  GLY A C   
148  O  O   . GLY A 40  ? 1.4059 1.3360 1.6152 -0.0822 -0.0024 0.2223  51  GLY A O   
149  N  N   . GLN A 41  ? 1.4415 1.3496 1.6576 -0.0839 -0.0178 0.2245  52  GLN A N   
150  C  CA  . GLN A 41  ? 1.4205 1.3142 1.6139 -0.0857 -0.0218 0.2188  52  GLN A CA  
151  C  C   . GLN A 41  ? 1.3810 1.2768 1.5560 -0.0866 -0.0158 0.2176  52  GLN A C   
152  O  O   . GLN A 41  ? 1.3570 1.2487 1.5145 -0.0875 -0.0139 0.2126  52  GLN A O   
153  C  CB  . GLN A 41  ? 1.4455 1.3191 1.6369 -0.0873 -0.0339 0.2176  52  GLN A CB  
154  C  CG  . GLN A 41  ? 1.4827 1.3518 1.6895 -0.0866 -0.0410 0.2172  52  GLN A CG  
155  C  CD  . GLN A 41  ? 1.4738 1.3536 1.6842 -0.0852 -0.0350 0.2148  52  GLN A CD  
156  O  OE1 . GLN A 41  ? 1.4499 1.3237 1.6446 -0.0860 -0.0351 0.2097  52  GLN A OE1 
157  N  NE2 . GLN A 41  ? 1.4962 1.3913 1.7273 -0.0833 -0.0297 0.2184  52  GLN A NE2 
158  N  N   . LEU A 42  ? 1.3760 1.2779 1.5552 -0.0864 -0.0129 0.2221  53  LEU A N   
159  C  CA  . LEU A 42  ? 1.3409 1.2478 1.5061 -0.0869 -0.0063 0.2217  53  LEU A CA  
160  C  C   . LEU A 42  ? 1.3219 1.2122 1.4659 -0.0892 -0.0103 0.2165  53  LEU A C   
161  O  O   . LEU A 42  ? 1.3222 1.2042 1.4609 -0.0904 -0.0130 0.2174  53  LEU A O   
162  C  CB  . LEU A 42  ? 1.3194 1.2426 1.4823 -0.0856 0.0033  0.2208  53  LEU A CB  
163  C  CG  . LEU A 42  ? 1.3251 1.2674 1.5022 -0.0836 0.0112  0.2265  53  LEU A CG  
164  C  CD1 . LEU A 42  ? 1.3610 1.3074 1.5594 -0.0823 0.0093  0.2301  53  LEU A CD1 
165  C  CD2 . LEU A 42  ? 1.3169 1.2722 1.4863 -0.0827 0.0201  0.2245  53  LEU A CD2 
166  N  N   . ALA A 43  ? 1.3078 1.1930 1.4393 -0.0898 -0.0102 0.2110  54  ALA A N   
167  C  CA  . ALA A 43  ? 1.2942 1.1629 1.4050 -0.0920 -0.0134 0.2058  54  ALA A CA  
168  C  C   . ALA A 43  ? 1.3199 1.1705 1.4293 -0.0936 -0.0229 0.2063  54  ALA A C   
169  O  O   . ALA A 43  ? 1.3128 1.1545 1.4107 -0.0952 -0.0234 0.2055  54  ALA A O   
170  C  CB  . ALA A 43  ? 1.2856 1.1489 1.3872 -0.0923 -0.0143 0.2003  54  ALA A CB  
171  N  N   . ASP A 44  ? 1.3521 1.1972 1.4737 -0.0931 -0.0305 0.2076  55  ASP A N   
172  C  CA  . ASP A 44  ? 1.3833 1.2095 1.5030 -0.0947 -0.0409 0.2076  55  ASP A CA  
173  C  C   . ASP A 44  ? 1.3927 1.2230 1.5252 -0.0943 -0.0417 0.2131  55  ASP A C   
174  O  O   . ASP A 44  ? 1.4032 1.2197 1.5284 -0.0960 -0.0469 0.2129  55  ASP A O   
175  C  CB  . ASP A 44  ? 1.4200 1.2388 1.5488 -0.0943 -0.0494 0.2069  55  ASP A CB  
176  C  CG  . ASP A 44  ? 1.4116 1.2321 1.5341 -0.0939 -0.0471 0.2026  55  ASP A CG  
177  O  OD1 . ASP A 44  ? 1.3887 1.2018 1.4908 -0.0953 -0.0449 0.1980  55  ASP A OD1 
178  O  OD2 . ASP A 44  ? 1.4297 1.2591 1.5680 -0.0922 -0.0470 0.2038  55  ASP A OD2 
179  N  N   . ALA A 45  ? 1.3925 1.2413 1.5437 -0.0922 -0.0363 0.2179  56  ALA A N   
180  C  CA  . ALA A 45  ? 1.4006 1.2554 1.5638 -0.0917 -0.0354 0.2234  56  ALA A CA  
181  C  C   . ALA A 45  ? 1.3753 1.2249 1.5220 -0.0933 -0.0326 0.2221  56  ALA A C   
182  O  O   . ALA A 45  ? 1.3887 1.2280 1.5346 -0.0945 -0.0374 0.2233  56  ALA A O   
183  C  CB  . ALA A 45  ? 1.3991 1.2758 1.5790 -0.0894 -0.0270 0.2281  56  ALA A CB  
184  N  N   . LEU A 46  ? 1.3411 1.1970 1.4747 -0.0934 -0.0249 0.2192  57  LEU A N   
185  C  CA  . LEU A 46  ? 1.3159 1.1689 1.4350 -0.0948 -0.0209 0.2178  57  LEU A CA  
186  C  C   . LEU A 46  ? 1.3234 1.1537 1.4253 -0.0974 -0.0275 0.2133  57  LEU A C   
187  O  O   . LEU A 46  ? 1.3260 1.1498 1.4237 -0.0986 -0.0282 0.2141  57  LEU A O   
188  C  CB  . LEU A 46  ? 1.2810 1.1449 1.3902 -0.0943 -0.0119 0.2150  57  LEU A CB  
189  C  CG  . LEU A 46  ? 1.2549 1.1162 1.3495 -0.0957 -0.0073 0.2129  57  LEU A CG  
190  C  CD1 . LEU A 46  ? 1.2483 1.1251 1.3532 -0.0944 -0.0014 0.2182  57  LEU A CD1 
191  C  CD2 . LEU A 46  ? 1.2287 1.0903 1.3077 -0.0962 -0.0025 0.2073  57  LEU A CD2 
192  N  N   . SER A 47  ? 1.3292 1.1472 1.4208 -0.0984 -0.0322 0.2087  58  SER A N   
193  C  CA  . SER A 47  ? 1.3434 1.1383 1.4179 -0.1010 -0.0390 0.2046  58  SER A CA  
194  C  C   . SER A 47  ? 1.3753 1.1613 1.4580 -0.1016 -0.0464 0.2080  58  SER A C   
195  O  O   . SER A 47  ? 1.3848 1.1543 1.4543 -0.1037 -0.0498 0.2058  58  SER A O   
196  C  CB  . SER A 47  ? 1.3589 1.1417 1.4258 -0.1016 -0.0451 0.2006  58  SER A CB  
197  O  OG  . SER A 47  ? 1.3943 1.1744 1.4768 -0.1007 -0.0536 0.2034  58  SER A OG  
198  N  N   . GLN A 48  ? 1.3941 1.1906 1.4988 -0.0997 -0.0485 0.2131  59  GLN A N   
199  C  CA  . GLN A 48  ? 1.4276 1.2165 1.5427 -0.1000 -0.0561 0.2164  59  GLN A CA  
200  C  C   . GLN A 48  ? 1.4188 1.2148 1.5386 -0.1000 -0.0514 0.2200  59  GLN A C   
201  O  O   . GLN A 48  ? 1.4355 1.2182 1.5496 -0.1016 -0.0559 0.2198  59  GLN A O   
202  C  CB  . GLN A 48  ? 1.4548 1.2512 1.5927 -0.0981 -0.0606 0.2202  59  GLN A CB  
203  C  CG  . GLN A 48  ? 1.4830 1.2654 1.6178 -0.0987 -0.0699 0.2169  59  GLN A CG  
204  C  CD  . GLN A 48  ? 1.5004 1.2579 1.6158 -0.1014 -0.0784 0.2130  59  GLN A CD  
205  O  OE1 . GLN A 48  ? 1.5048 1.2532 1.6211 -0.1024 -0.0832 0.2146  59  GLN A OE1 
206  N  NE2 . GLN A 48  ? 1.5126 1.2584 1.6097 -0.1026 -0.0800 0.2077  59  GLN A NE2 
207  N  N   . PHE A 49  ? 1.3950 1.2116 1.5248 -0.0981 -0.0423 0.2234  60  PHE A N   
208  C  CA  . PHE A 49  ? 1.3896 1.2143 1.5253 -0.0978 -0.0376 0.2275  60  PHE A CA  
209  C  C   . PHE A 49  ? 1.3696 1.1856 1.4861 -0.0998 -0.0344 0.2238  60  PHE A C   
210  O  O   . PHE A 49  ? 1.3754 1.1899 1.4938 -0.1004 -0.0338 0.2260  60  PHE A O   
211  C  CB  . PHE A 49  ? 1.3759 1.2243 1.5266 -0.0953 -0.0291 0.2323  60  PHE A CB  
212  C  CG  . PHE A 49  ? 1.4021 1.2592 1.5742 -0.0934 -0.0316 0.2366  60  PHE A CG  
213  C  CD1 . PHE A 49  ? 1.4382 1.2884 1.6236 -0.0936 -0.0392 0.2396  60  PHE A CD1 
214  C  CD2 . PHE A 49  ? 1.3934 1.2655 1.5728 -0.0915 -0.0260 0.2375  60  PHE A CD2 
215  C  CE1 . PHE A 49  ? 1.4652 1.3233 1.6718 -0.0919 -0.0411 0.2434  60  PHE A CE1 
216  C  CE2 . PHE A 49  ? 1.4204 1.3004 1.6203 -0.0899 -0.0276 0.2413  60  PHE A CE2 
217  C  CZ  . PHE A 49  ? 1.4564 1.3295 1.6703 -0.0900 -0.0350 0.2443  60  PHE A CZ  
218  N  N   . HIS A 50  ? 1.3482 1.1582 1.4468 -0.1009 -0.0321 0.2182  61  HIS A N   
219  C  CA  . HIS A 50  ? 1.3349 1.1328 1.4140 -0.1032 -0.0299 0.2138  61  HIS A CA  
220  C  C   . HIS A 50  ? 1.3670 1.1439 1.4401 -0.1053 -0.0383 0.2127  61  HIS A C   
221  O  O   . HIS A 50  ? 1.3706 1.1431 1.4410 -0.1065 -0.0370 0.2133  61  HIS A O   
222  C  CB  . HIS A 50  ? 1.3139 1.1069 1.3752 -0.1041 -0.0270 0.2077  61  HIS A CB  
223  C  CG  . HIS A 50  ? 1.2779 1.0873 1.3378 -0.1031 -0.0169 0.2073  61  HIS A CG  
224  N  ND1 . HIS A 50  ? 1.2590 1.0677 1.3096 -0.1042 -0.0111 0.2055  61  HIS A ND1 
225  C  CD2 . HIS A 50  ? 1.2600 1.0868 1.3269 -0.1010 -0.0117 0.2084  61  HIS A CD2 
226  C  CE1 . HIS A 50  ? 1.2311 1.0560 1.2832 -0.1028 -0.0033 0.2056  61  HIS A CE1 
227  N  NE2 . HIS A 50  ? 1.2313 1.0672 1.2926 -0.1009 -0.0035 0.2073  61  HIS A NE2 
228  N  N   . ALA A 51  ? 1.3933 1.1576 1.4652 -0.1058 -0.0472 0.2113  62  ALA A N   
229  C  CA  . ALA A 51  ? 1.4301 1.1734 1.4961 -0.1078 -0.0566 0.2102  62  ALA A CA  
230  C  C   . ALA A 51  ? 1.4456 1.1928 1.5262 -0.1075 -0.0578 0.2152  62  ALA A C   
231  O  O   . ALA A 51  ? 1.4573 1.1918 1.5287 -0.1094 -0.0592 0.2139  62  ALA A O   
232  C  CB  . ALA A 51  ? 1.4599 1.1943 1.5293 -0.1076 -0.0663 0.2096  62  ALA A CB  
233  N  N   . ALA A 52  ? 1.4474 1.2122 1.5507 -0.1050 -0.0568 0.2209  63  ALA A N   
234  C  CA  . ALA A 52  ? 1.4646 1.2347 1.5843 -0.1043 -0.0579 0.2261  63  ALA A CA  
235  C  C   . ALA A 52  ? 1.4425 1.2179 1.5578 -0.1048 -0.0501 0.2269  63  ALA A C   
236  O  O   . ALA A 52  ? 1.4592 1.2282 1.5772 -0.1058 -0.0524 0.2284  63  ALA A O   
237  C  CB  . ALA A 52  ? 1.4695 1.2587 1.6136 -0.1015 -0.0567 0.2319  63  ALA A CB  
238  N  N   . VAL A 53  ? 1.4067 1.1935 1.5156 -0.1043 -0.0410 0.2256  64  VAL A N   
239  C  CA  . VAL A 53  ? 1.3863 1.1794 1.4925 -0.1045 -0.0335 0.2263  64  VAL A CA  
240  C  C   . VAL A 53  ? 1.3920 1.1651 1.4787 -0.1075 -0.0347 0.2211  64  VAL A C   
241  O  O   . VAL A 53  ? 1.4000 1.1708 1.4882 -0.1083 -0.0333 0.2224  64  VAL A O   
242  C  CB  . VAL A 53  ? 1.3478 1.1581 1.4525 -0.1031 -0.0239 0.2261  64  VAL A CB  
243  C  CG1 . VAL A 53  ? 1.3294 1.1436 1.4301 -0.1037 -0.0171 0.2262  64  VAL A CG1 
244  C  CG2 . VAL A 53  ? 1.3456 1.1762 1.4698 -0.1003 -0.0215 0.2318  64  VAL A CG2 
245  N  N   . ASP A 54  ? 1.3907 1.1489 1.4591 -0.1092 -0.0372 0.2152  65  ASP A N   
246  C  CA  . ASP A 54  ? 1.4011 1.1383 1.4498 -0.1122 -0.0384 0.2101  65  ASP A CA  
247  C  C   . ASP A 54  ? 1.4431 1.1636 1.4929 -0.1136 -0.0482 0.2108  65  ASP A C   
248  O  O   . ASP A 54  ? 1.4586 1.1636 1.4969 -0.1159 -0.0491 0.2082  65  ASP A O   
249  C  CB  . ASP A 54  ? 1.3920 1.1177 1.4199 -0.1138 -0.0377 0.2037  65  ASP A CB  
250  C  CG  . ASP A 54  ? 1.3511 1.0919 1.3763 -0.1128 -0.0277 0.2023  65  ASP A CG  
251  O  OD1 . ASP A 54  ? 1.3309 1.0893 1.3683 -0.1112 -0.0212 0.2060  65  ASP A OD1 
252  O  OD2 . ASP A 54  ? 1.3414 1.0761 1.3523 -0.1136 -0.0265 0.1976  65  ASP A OD2 
253  N  N   . GLY A 55  ? 1.4634 1.1873 1.5277 -0.1121 -0.0553 0.2143  66  GLY A N   
254  C  CA  . GLY A 55  ? 1.5057 1.2166 1.5756 -0.1129 -0.0651 0.2158  66  GLY A CA  
255  C  C   . GLY A 55  ? 1.5131 1.2299 1.5958 -0.1126 -0.0632 0.2200  66  GLY A C   
256  O  O   . GLY A 55  ? 1.5390 1.2398 1.6142 -0.1147 -0.0672 0.2184  66  GLY A O   
257  N  N   . ASP A 56  ? 1.4926 1.2320 1.5941 -0.1101 -0.0571 0.2254  67  ASP A N   
258  C  CA  . ASP A 56  ? 1.5013 1.2478 1.6162 -0.1097 -0.0548 0.2299  67  ASP A CA  
259  C  C   . ASP A 56  ? 1.4654 1.2314 1.5851 -0.1082 -0.0438 0.2322  67  ASP A C   
260  O  O   . ASP A 56  ? 1.4581 1.2435 1.5957 -0.1057 -0.0405 0.2377  67  ASP A O   
261  C  CB  . ASP A 56  ? 1.5287 1.2822 1.6666 -0.1079 -0.0608 0.2357  67  ASP A CB  
262  C  CG  . ASP A 56  ? 1.5509 1.3053 1.7006 -0.1081 -0.0612 0.2395  67  ASP A CG  
263  O  OD1 . ASP A 56  ? 1.5327 1.3000 1.6877 -0.1073 -0.0531 0.2423  67  ASP A OD1 
264  O  OD2 . ASP A 56  ? 1.5890 1.3309 1.7429 -0.1090 -0.0699 0.2398  67  ASP A OD2 
265  N  N   . PRO A 57  ? 1.4457 1.2064 1.5497 -0.1098 -0.0380 0.2281  68  PRO A N   
266  C  CA  . PRO A 57  ? 1.4134 1.1921 1.5214 -0.1084 -0.0281 0.2300  68  PRO A CA  
267  C  C   . PRO A 57  ? 1.4220 1.2159 1.5511 -0.1066 -0.0260 0.2371  68  PRO A C   
268  O  O   . PRO A 57  ? 1.4025 1.2152 1.5404 -0.1046 -0.0193 0.2406  68  PRO A O   
269  C  CB  . PRO A 57  ? 1.4033 1.1697 1.4932 -0.1109 -0.0239 0.2245  68  PRO A CB  
270  C  CG  . PRO A 57  ? 1.4218 1.1643 1.4941 -0.1135 -0.0307 0.2189  68  PRO A CG  
271  C  CD  . PRO A 57  ? 1.4554 1.1935 1.5393 -0.1129 -0.0401 0.2222  68  PRO A CD  
272  N  N   . ASP A 58  ? 1.4537 1.2391 1.5906 -0.1072 -0.0321 0.2392  69  ASP A N   
273  C  CA  . ASP A 58  ? 1.4677 1.2652 1.6244 -0.1058 -0.0307 0.2459  69  ASP A CA  
274  C  C   . ASP A 58  ? 1.4752 1.2885 1.6520 -0.1031 -0.0319 0.2521  69  ASP A C   
275  O  O   . ASP A 58  ? 1.4769 1.3055 1.6698 -0.1013 -0.0280 0.2582  69  ASP A O   
276  C  CB  . ASP A 58  ? 1.5032 1.2849 1.6605 -0.1076 -0.0366 0.2455  69  ASP A CB  
277  C  CG  . ASP A 58  ? 1.5021 1.2781 1.6505 -0.1093 -0.0316 0.2430  69  ASP A CG  
278  O  OD1 . ASP A 58  ? 1.4730 1.2548 1.6126 -0.1093 -0.0242 0.2407  69  ASP A OD1 
279  O  OD2 . ASP A 58  ? 1.5323 1.2979 1.6834 -0.1106 -0.0351 0.2434  69  ASP A OD2 
280  N  N   . ASN A 59  ? 1.4826 1.2918 1.6587 -0.1029 -0.0372 0.2506  70  ASN A N   
281  C  CA  . ASN A 59  ? 1.4932 1.3160 1.6886 -0.1005 -0.0384 0.2559  70  ASN A CA  
282  C  C   . ASN A 59  ? 1.4638 1.3077 1.6643 -0.0983 -0.0295 0.2590  70  ASN A C   
283  O  O   . ASN A 59  ? 1.4334 1.2788 1.6197 -0.0986 -0.0247 0.2552  70  ASN A O   
284  C  CB  . ASN A 59  ? 1.5094 1.3219 1.7020 -0.1009 -0.0462 0.2529  70  ASN A CB  
285  C  CG  . ASN A 59  ? 1.5189 1.3456 1.7315 -0.0985 -0.0466 0.2578  70  ASN A CG  
286  O  OD1 . ASN A 59  ? 1.4947 1.3395 1.7145 -0.0966 -0.0391 0.2611  70  ASN A OD1 
287  N  ND2 . ASN A 59  ? 1.5551 1.3731 1.7767 -0.0987 -0.0555 0.2582  70  ASN A ND2 
288  N  N   . TYR A 60  ? 1.4754 1.3349 1.6958 -0.0961 -0.0272 0.2658  71  TYR A N   
289  C  CA  . TYR A 60  ? 1.4539 1.3331 1.6791 -0.0940 -0.0188 0.2691  71  TYR A CA  
290  C  C   . TYR A 60  ? 1.4539 1.3403 1.6842 -0.0926 -0.0188 0.2693  71  TYR A C   
291  O  O   . TYR A 60  ? 1.4295 1.3279 1.6562 -0.0914 -0.0124 0.2693  71  TYR A O   
292  C  CB  . TYR A 60  ? 1.4681 1.3608 1.7106 -0.0925 -0.0148 0.2767  71  TYR A CB  
293  C  CG  . TYR A 60  ? 1.5007 1.4006 1.7645 -0.0909 -0.0171 0.2825  71  TYR A CG  
294  C  CD1 . TYR A 60  ? 1.5351 1.4238 1.8083 -0.0918 -0.0252 0.2829  71  TYR A CD1 
295  C  CD2 . TYR A 60  ? 1.4997 1.4173 1.7741 -0.0887 -0.0110 0.2872  71  TYR A CD2 
296  C  CE1 . TYR A 60  ? 1.5673 1.4626 1.8613 -0.0904 -0.0271 0.2881  71  TYR A CE1 
297  C  CE2 . TYR A 60  ? 1.5322 1.4562 1.8265 -0.0874 -0.0122 0.2924  71  TYR A CE2 
298  C  CZ  . TYR A 60  ? 1.5657 1.4787 1.8704 -0.0882 -0.0202 0.2928  71  TYR A CZ  
299  O  OH  . TYR A 60  ? 1.6000 1.5195 1.9260 -0.0869 -0.0213 0.2978  71  TYR A OH  
300  N  N   . ILE A 61  ? 1.4835 1.3626 1.7227 -0.0927 -0.0261 0.2695  72  ILE A N   
301  C  CA  . ILE A 61  ? 1.4892 1.3752 1.7361 -0.0913 -0.0262 0.2700  72  ILE A CA  
302  C  C   . ILE A 61  ? 1.4608 1.3424 1.6891 -0.0919 -0.0252 0.2635  72  ILE A C   
303  O  O   . ILE A 61  ? 1.4470 1.3404 1.6763 -0.0905 -0.0200 0.2638  72  ILE A O   
304  C  CB  . ILE A 61  ? 1.5282 1.4056 1.7891 -0.0914 -0.0353 0.2708  72  ILE A CB  
305  C  CG1 . ILE A 61  ? 1.5608 1.4407 1.8402 -0.0910 -0.0370 0.2768  72  ILE A CG1 
306  C  CG2 . ILE A 61  ? 1.5337 1.4200 1.8052 -0.0898 -0.0344 0.2717  72  ILE A CG2 
307  C  CD1 . ILE A 61  ? 1.5823 1.4437 1.8568 -0.0931 -0.0454 0.2745  72  ILE A CD1 
308  N  N   . ALA A 62  ? 1.4547 1.3187 1.6657 -0.0941 -0.0299 0.2577  73  ALA A N   
309  C  CA  . ALA A 62  ? 1.4305 1.2878 1.6226 -0.0951 -0.0294 0.2513  73  ALA A CA  
310  C  C   . ALA A 62  ? 1.3949 1.2669 1.5808 -0.0940 -0.0196 0.2512  73  ALA A C   
311  O  O   . ALA A 62  ? 1.3828 1.2639 1.5690 -0.0928 -0.0163 0.2506  73  ALA A O   
312  C  CB  . ALA A 62  ? 1.4313 1.2677 1.6049 -0.0978 -0.0345 0.2456  73  ALA A CB  
313  N  N   . TYR A 63  ? 1.3807 1.2556 1.5624 -0.0945 -0.0150 0.2521  74  TYR A N   
314  C  CA  . TYR A 63  ? 1.3497 1.2381 1.5259 -0.0935 -0.0063 0.2523  74  TYR A CA  
315  C  C   . TYR A 63  ? 1.3506 1.2576 1.5393 -0.0910 -0.0015 0.2567  74  TYR A C   
316  O  O   . TYR A 63  ? 1.3277 1.2435 1.5093 -0.0903 0.0039  0.2549  74  TYR A O   
317  C  CB  . TYR A 63  ? 1.3433 1.2346 1.5199 -0.0938 -0.0027 0.2545  74  TYR A CB  
318  C  CG  . TYR A 63  ? 1.3375 1.2117 1.4983 -0.0964 -0.0049 0.2491  74  TYR A CG  
319  C  CD1 . TYR A 63  ? 1.3091 1.1809 1.4532 -0.0974 -0.0006 0.2437  74  TYR A CD1 
320  C  CD2 . TYR A 63  ? 1.3628 1.2230 1.5254 -0.0979 -0.0109 0.2491  74  TYR A CD2 
321  C  CE1 . TYR A 63  ? 1.3069 1.1624 1.4364 -0.0999 -0.0018 0.2385  74  TYR A CE1 
322  C  CE2 . TYR A 63  ? 1.3611 1.2047 1.5083 -0.1004 -0.0124 0.2439  74  TYR A CE2 
323  C  CZ  . TYR A 63  ? 1.3334 1.1746 1.4641 -0.1014 -0.0075 0.2386  74  TYR A CZ  
324  O  OH  . TYR A 63  ? 1.3346 1.1590 1.4499 -0.1040 -0.0082 0.2333  74  TYR A OH  
325  N  N   . TYR A 64  ? 1.3794 1.2921 1.5866 -0.0898 -0.0033 0.2624  75  TYR A N   
326  C  CA  . TYR A 64  ? 1.3858 1.3151 1.6056 -0.0876 0.0013  0.2668  75  TYR A CA  
327  C  C   . TYR A 64  ? 1.3812 1.3092 1.5973 -0.0873 0.0002  0.2628  75  TYR A C   
328  O  O   . TYR A 64  ? 1.3655 1.3049 1.5786 -0.0861 0.0062  0.2624  75  TYR A O   
329  C  CB  . TYR A 64  ? 1.4218 1.3565 1.6633 -0.0865 -0.0001 0.2738  75  TYR A CB  
330  C  CG  . TYR A 64  ? 1.4311 1.3839 1.6845 -0.0842 0.0067  0.2789  75  TYR A CG  
331  C  CD1 . TYR A 64  ? 1.4230 1.3891 1.6767 -0.0831 0.0141  0.2831  75  TYR A CD1 
332  C  CD2 . TYR A 64  ? 1.4507 1.4067 1.7143 -0.0833 0.0060  0.2794  75  TYR A CD2 
333  C  CE1 . TYR A 64  ? 1.4351 1.4167 1.6976 -0.0812 0.0207  0.2877  75  TYR A CE1 
334  C  CE2 . TYR A 64  ? 1.4627 1.4347 1.7362 -0.0813 0.0132  0.2838  75  TYR A CE2 
335  C  CZ  . TYR A 64  ? 1.4552 1.4396 1.7272 -0.0804 0.0205  0.2880  75  TYR A CZ  
336  O  OH  . TYR A 64  ? 1.4707 1.4700 1.7506 -0.0786 0.0278  0.2925  75  TYR A OH  
337  N  N   . ARG A 65  ? 1.3985 1.3123 1.6146 -0.0884 -0.0077 0.2598  76  ARG A N   
338  C  CA  . ARG A 65  ? 1.4000 1.3117 1.6146 -0.0881 -0.0099 0.2563  76  ARG A CA  
339  C  C   . ARG A 65  ? 1.3660 1.2756 1.5608 -0.0888 -0.0067 0.2501  76  ARG A C   
340  O  O   . ARG A 65  ? 1.3569 1.2757 1.5516 -0.0877 -0.0025 0.2491  76  ARG A O   
341  C  CB  . ARG A 65  ? 1.4263 1.3217 1.6445 -0.0893 -0.0202 0.2543  76  ARG A CB  
342  C  CG  . ARG A 65  ? 1.4644 1.3617 1.7043 -0.0886 -0.0240 0.2600  76  ARG A CG  
343  C  CD  . ARG A 65  ? 1.4799 1.3949 1.7388 -0.0862 -0.0182 0.2652  76  ARG A CD  
344  N  NE  . ARG A 65  ? 1.5159 1.4333 1.7957 -0.0856 -0.0207 0.2711  76  ARG A NE  
345  C  CZ  . ARG A 65  ? 1.5411 1.4701 1.8408 -0.0839 -0.0178 0.2757  76  ARG A CZ  
346  N  NH1 . ARG A 65  ? 1.5352 1.4747 1.8366 -0.0826 -0.0120 0.2752  76  ARG A NH1 
347  N  NH2 . ARG A 65  ? 1.5747 1.5046 1.8929 -0.0835 -0.0203 0.2807  76  ARG A NH2 
348  N  N   . ARG A 66  ? 1.3492 1.2465 1.5275 -0.0908 -0.0085 0.2459  77  ARG A N   
349  C  CA  . ARG A 66  ? 1.3175 1.2131 1.4774 -0.0915 -0.0048 0.2402  77  ARG A CA  
350  C  C   . ARG A 66  ? 1.2993 1.2143 1.4622 -0.0897 0.0041  0.2428  77  ARG A C   
351  O  O   . ARG A 66  ? 1.2892 1.2105 1.4488 -0.0889 0.0073  0.2405  77  ARG A O   
352  C  CB  . ARG A 66  ? 1.3040 1.1863 1.4478 -0.0937 -0.0058 0.2364  77  ARG A CB  
353  C  CG  . ARG A 66  ? 1.2770 1.1543 1.4011 -0.0949 -0.0029 0.2297  77  ARG A CG  
354  C  CD  . ARG A 66  ? 1.2736 1.1325 1.3810 -0.0976 -0.0055 0.2248  77  ARG A CD  
355  N  NE  . ARG A 66  ? 1.2632 1.1252 1.3706 -0.0979 -0.0015 0.2267  77  ARG A NE  
356  C  CZ  . ARG A 66  ? 1.2614 1.1095 1.3562 -0.1002 -0.0021 0.2231  77  ARG A CZ  
357  N  NH1 . ARG A 66  ? 1.2697 1.0990 1.3494 -0.1023 -0.0066 0.2175  77  ARG A NH1 
358  N  NH2 . ARG A 66  ? 1.2537 1.1063 1.3511 -0.1003 0.0017  0.2252  77  ARG A NH2 
359  N  N   . ALA A 67  ? 1.2990 1.2233 1.4687 -0.0890 0.0081  0.2477  78  ALA A N   
360  C  CA  . ALA A 67  ? 1.2865 1.2283 1.4576 -0.0873 0.0163  0.2504  78  ALA A CA  
361  C  C   . ALA A 67  ? 1.2969 1.2509 1.4772 -0.0854 0.0194  0.2524  78  ALA A C   
362  O  O   . ALA A 67  ? 1.2797 1.2443 1.4546 -0.0845 0.0254  0.2515  78  ALA A O   
363  C  CB  . ALA A 67  ? 1.2957 1.2449 1.4756 -0.0867 0.0188  0.2563  78  ALA A CB  
364  N  N   . THR A 68  ? 1.3269 1.2791 1.5211 -0.0849 0.0154  0.2549  79  THR A N   
365  C  CA  . THR A 68  ? 1.3416 1.3057 1.5465 -0.0831 0.0191  0.2572  79  THR A CA  
366  C  C   . THR A 68  ? 1.3275 1.2882 1.5229 -0.0834 0.0187  0.2511  79  THR A C   
367  O  O   . THR A 68  ? 1.3269 1.2988 1.5242 -0.0821 0.0242  0.2512  79  THR A O   
368  C  CB  . THR A 68  ? 1.3796 1.3452 1.6058 -0.0823 0.0161  0.2625  79  THR A CB  
369  O  OG1 . THR A 68  ? 1.3890 1.3383 1.6166 -0.0837 0.0069  0.2602  79  THR A OG1 
370  C  CG2 . THR A 68  ? 1.3973 1.3716 1.6344 -0.0815 0.0194  0.2696  79  THR A CG2 
371  N  N   . VAL A 69  ? 1.3183 1.2630 1.5027 -0.0852 0.0124  0.2457  80  VAL A N   
372  C  CA  . VAL A 69  ? 1.3067 1.2458 1.4804 -0.0857 0.0113  0.2394  80  VAL A CA  
373  C  C   . VAL A 69  ? 1.2730 1.2170 1.4304 -0.0859 0.0174  0.2356  80  VAL A C   
374  O  O   . VAL A 69  ? 1.2656 1.2155 1.4193 -0.0852 0.0209  0.2328  80  VAL A O   
375  C  CB  . VAL A 69  ? 1.3115 1.2305 1.4777 -0.0876 0.0022  0.2351  80  VAL A CB  
376  C  CG1 . VAL A 69  ? 1.3079 1.2217 1.4661 -0.0879 0.0006  0.2295  80  VAL A CG1 
377  C  CG2 . VAL A 69  ? 1.3456 1.2590 1.5277 -0.0876 -0.0045 0.2389  80  VAL A CG2 
378  N  N   . PHE A 70  ? 1.2543 1.1957 1.4028 -0.0869 0.0186  0.2353  81  PHE A N   
379  C  CA  . PHE A 70  ? 1.2250 1.1734 1.3613 -0.0868 0.0249  0.2326  81  PHE A CA  
380  C  C   . PHE A 70  ? 1.2281 1.1946 1.3715 -0.0847 0.0316  0.2358  81  PHE A C   
381  O  O   . PHE A 70  ? 1.2163 1.1872 1.3530 -0.0843 0.0348  0.2322  81  PHE A O   
382  C  CB  . PHE A 70  ? 1.2128 1.1595 1.3440 -0.0877 0.0261  0.2337  81  PHE A CB  
383  C  CG  . PHE A 70  ? 1.2029 1.1319 1.3203 -0.0901 0.0220  0.2282  81  PHE A CG  
384  C  CD1 . PHE A 70  ? 1.1893 1.1089 1.2933 -0.0913 0.0207  0.2216  81  PHE A CD1 
385  C  CD2 . PHE A 70  ? 1.2095 1.1305 1.3267 -0.0913 0.0197  0.2296  81  PHE A CD2 
386  C  CE1 . PHE A 70  ? 1.1846 1.0868 1.2746 -0.0936 0.0173  0.2166  81  PHE A CE1 
387  C  CE2 . PHE A 70  ? 1.2048 1.1085 1.3082 -0.0937 0.0164  0.2244  81  PHE A CE2 
388  C  CZ  . PHE A 70  ? 1.1930 1.0870 1.2824 -0.0949 0.0153  0.2179  81  PHE A CZ  
389  N  N   . LEU A 71  ? 1.2471 1.2235 1.4040 -0.0834 0.0337  0.2426  82  LEU A N   
390  C  CA  . LEU A 71  ? 1.2569 1.2502 1.4212 -0.0814 0.0403  0.2466  82  LEU A CA  
391  C  C   . LEU A 71  ? 1.2661 1.2625 1.4336 -0.0806 0.0415  0.2444  82  LEU A C   
392  O  O   . LEU A 71  ? 1.2578 1.2637 1.4200 -0.0797 0.0471  0.2428  82  LEU A O   
393  C  CB  . LEU A 71  ? 1.2850 1.2848 1.4655 -0.0803 0.0410  0.2544  82  LEU A CB  
394  C  CG  . LEU A 71  ? 1.2807 1.2797 1.4614 -0.0808 0.0405  0.2579  82  LEU A CG  
395  C  CD1 . LEU A 71  ? 1.3129 1.3174 1.5112 -0.0797 0.0407  0.2655  82  LEU A CD1 
396  C  CD2 . LEU A 71  ? 1.2578 1.2659 1.4284 -0.0803 0.0461  0.2577  82  LEU A CD2 
397  N  N   . ALA A 72  ? 1.2855 1.2737 1.4621 -0.0809 0.0360  0.2442  83  ALA A N   
398  C  CA  . ALA A 72  ? 1.2984 1.2888 1.4802 -0.0802 0.0366  0.2422  83  ALA A CA  
399  C  C   . ALA A 72  ? 1.2718 1.2602 1.4376 -0.0807 0.0382  0.2352  83  ALA A C   
400  O  O   . ALA A 72  ? 1.2708 1.2699 1.4358 -0.0796 0.0441  0.2345  83  ALA A O   
401  C  CB  . ALA A 72  ? 1.3212 1.3002 1.5135 -0.0807 0.0289  0.2421  83  ALA A CB  
402  N  N   . MSE A 73  ? 1.2523 1.2267 1.4054 -0.0825 0.0331  0.2302  84  MSE A N   
403  C  CA  . MSE A 73  ? 1.2249 1.1965 1.3612 -0.0833 0.0350  0.2237  84  MSE A CA  
404  C  C   . MSE A 73  ? 1.2050 1.1875 1.3342 -0.0828 0.0415  0.2246  84  MSE A C   
405  O  O   . MSE A 73  ? 1.2073 1.1933 1.3408 -0.0826 0.0423  0.2292  84  MSE A O   
406  C  CB  . MSE A 73  ? 1.2131 1.1667 1.3374 -0.0854 0.0286  0.2191  84  MSE A CB  
407  C  CG  . MSE A 73  ? 1.2366 1.1772 1.3680 -0.0861 0.0204  0.2193  84  MSE A CG  
408  SE SE  . MSE A 73  ? 1.2229 1.1396 1.3349 -0.0891 0.0132  0.2127  84  MSE A SE  
409  C  CE  . MSE A 73  ? 1.2279 1.1408 1.3405 -0.0900 0.0121  0.2169  84  MSE A CE  
410  N  N   . GLY A 74  ? 1.1871 1.1748 1.3057 -0.0827 0.0459  0.2204  85  GLY A N   
411  C  CA  . GLY A 74  ? 1.1727 1.1723 1.2870 -0.0819 0.0518  0.2221  85  GLY A CA  
412  C  C   . GLY A 74  ? 1.1515 1.1455 1.2567 -0.0832 0.0509  0.2210  85  GLY A C   
413  O  O   . GLY A 74  ? 1.1286 1.1270 1.2239 -0.0833 0.0545  0.2181  85  GLY A O   
414  N  N   . LYS A 75  ? 1.1603 1.1450 1.2694 -0.0842 0.0463  0.2233  86  LYS A N   
415  C  CA  . LYS A 75  ? 1.1432 1.1199 1.2429 -0.0857 0.0453  0.2213  86  LYS A CA  
416  C  C   . LYS A 75  ? 1.1482 1.1320 1.2543 -0.0851 0.0471  0.2269  86  LYS A C   
417  O  O   . LYS A 75  ? 1.1704 1.1497 1.2854 -0.0853 0.0436  0.2311  86  LYS A O   
418  C  CB  . LYS A 75  ? 1.1519 1.1102 1.2485 -0.0877 0.0386  0.2188  86  LYS A CB  
419  C  CG  . LYS A 75  ? 1.1545 1.1037 1.2478 -0.0882 0.0349  0.2146  86  LYS A CG  
420  C  CD  . LYS A 75  ? 1.1375 1.0696 1.2158 -0.0906 0.0316  0.2084  86  LYS A CD  
421  C  CE  . LYS A 75  ? 1.1475 1.0678 1.2241 -0.0913 0.0261  0.2053  86  LYS A CE  
422  N  NZ  . LYS A 75  ? 1.1306 1.0399 1.1902 -0.0929 0.0259  0.1981  86  LYS A NZ  
423  N  N   . SER A 76  ? 1.1301 1.1242 1.2319 -0.0845 0.0520  0.2271  87  SER A N   
424  C  CA  . SER A 76  ? 1.1379 1.1398 1.2469 -0.0837 0.0536  0.2332  87  SER A CA  
425  C  C   . SER A 76  ? 1.1311 1.1244 1.2366 -0.0852 0.0517  0.2323  87  SER A C   
426  O  O   . SER A 76  ? 1.1463 1.1396 1.2605 -0.0850 0.0503  0.2374  87  SER A O   
427  C  CB  . SER A 76  ? 1.1301 1.1480 1.2385 -0.0820 0.0592  0.2354  87  SER A CB  
428  O  OG  . SER A 76  ? 1.1349 1.1529 1.2324 -0.0827 0.0611  0.2309  87  SER A OG  
429  N  N   . LYS A 77  ? 1.1102 1.0963 1.2034 -0.0866 0.0521  0.2259  88  LYS A N   
430  C  CA  . LYS A 77  ? 1.1046 1.0819 1.1943 -0.0882 0.0511  0.2246  88  LYS A CA  
431  C  C   . LYS A 77  ? 1.1195 1.0835 1.2135 -0.0894 0.0458  0.2260  88  LYS A C   
432  O  O   . LYS A 77  ? 1.1297 1.0924 1.2301 -0.0896 0.0448  0.2298  88  LYS A O   
433  C  CB  . LYS A 77  ? 1.0817 1.0509 1.1570 -0.0899 0.0524  0.2166  88  LYS A CB  
434  C  CG  . LYS A 77  ? 1.0695 1.0484 1.1426 -0.0894 0.0569  0.2161  88  LYS A CG  
435  C  CD  . LYS A 77  ? 1.0503 1.0206 1.1110 -0.0913 0.0585  0.2085  88  LYS A CD  
436  C  CE  . LYS A 77  ? 1.0424 1.0254 1.1031 -0.0903 0.0628  0.2082  88  LYS A CE  
437  N  NZ  . LYS A 77  ? 1.0247 1.0013 1.0743 -0.0919 0.0651  0.2005  88  LYS A NZ  
438  N  N   . ALA A 78  ? 1.1230 1.0771 1.2137 -0.0902 0.0422  0.2230  89  ALA A N   
439  C  CA  . ALA A 78  ? 1.1369 1.0753 1.2279 -0.0917 0.0364  0.2226  89  ALA A CA  
440  C  C   . ALA A 78  ? 1.1615 1.1038 1.2680 -0.0907 0.0339  0.2297  89  ALA A C   
441  O  O   . ALA A 78  ? 1.1739 1.1049 1.2823 -0.0919 0.0296  0.2305  89  ALA A O   
442  C  CB  . ALA A 78  ? 1.1388 1.0669 1.2233 -0.0925 0.0328  0.2181  89  ALA A CB  
443  N  N   . ALA A 79  ? 1.1710 1.1288 1.2881 -0.0885 0.0368  0.2349  90  ALA A N   
444  C  CA  . ALA A 79  ? 1.1976 1.1600 1.3305 -0.0874 0.0350  0.2419  90  ALA A CA  
445  C  C   . ALA A 79  ? 1.2034 1.1705 1.3426 -0.0871 0.0365  0.2468  90  ALA A C   
446  O  O   . ALA A 79  ? 1.2219 1.1837 1.3698 -0.0874 0.0330  0.2502  90  ALA A O   
447  C  CB  . ALA A 79  ? 1.2096 1.1856 1.3514 -0.0853 0.0379  0.2455  90  ALA A CB  
448  N  N   . LEU A 80  ? 1.1897 1.1667 1.3250 -0.0864 0.0415  0.2470  91  LEU A N   
449  C  CA  . LEU A 80  ? 1.1968 1.1795 1.3384 -0.0859 0.0431  0.2519  91  LEU A CA  
450  C  C   . LEU A 80  ? 1.2020 1.1713 1.3444 -0.0877 0.0392  0.2513  91  LEU A C   
451  O  O   . LEU A 80  ? 1.2237 1.1939 1.3779 -0.0872 0.0374  0.2569  91  LEU A O   
452  C  CB  . LEU A 80  ? 1.1796 1.1716 1.3143 -0.0854 0.0479  0.2505  91  LEU A CB  
453  C  CG  . LEU A 80  ? 1.1878 1.1866 1.3282 -0.0848 0.0498  0.2551  91  LEU A CG  
454  C  CD1 . LEU A 80  ? 1.1811 1.1937 1.3180 -0.0834 0.0544  0.2557  91  LEU A CD1 
455  C  CD2 . LEU A 80  ? 1.1794 1.1660 1.3156 -0.0868 0.0482  0.2515  91  LEU A CD2 
456  N  N   . PRO A 81  ? 1.1848 1.1411 1.3148 -0.0898 0.0381  0.2446  92  PRO A N   
457  C  CA  . PRO A 81  ? 1.1933 1.1365 1.3234 -0.0915 0.0349  0.2440  92  PRO A CA  
458  C  C   . PRO A 81  ? 1.2184 1.1543 1.3576 -0.0917 0.0293  0.2471  92  PRO A C   
459  O  O   . PRO A 81  ? 1.2344 1.1665 1.3808 -0.0921 0.0273  0.2503  92  PRO A O   
460  C  CB  . PRO A 81  ? 1.1749 1.1036 1.2885 -0.0938 0.0344  0.2356  92  PRO A CB  
461  C  CG  . PRO A 81  ? 1.1623 1.0943 1.2692 -0.0933 0.0354  0.2323  92  PRO A CG  
462  C  CD  . PRO A 81  ? 1.1616 1.1130 1.2768 -0.0908 0.0395  0.2372  92  PRO A CD  
463  N  N   . ASP A 82  ? 1.2236 1.1579 1.3633 -0.0913 0.0266  0.2463  93  ASP A N   
464  C  CA  . ASP A 82  ? 1.2496 1.1768 1.3986 -0.0915 0.0207  0.2488  93  ASP A CA  
465  C  C   . ASP A 82  ? 1.2722 1.2118 1.4393 -0.0896 0.0216  0.2570  93  ASP A C   
466  O  O   . ASP A 82  ? 1.2968 1.2306 1.4737 -0.0899 0.0172  0.2601  93  ASP A O   
467  C  CB  . ASP A 82  ? 1.2506 1.1739 1.3966 -0.0914 0.0179  0.2458  93  ASP A CB  
468  C  CG  . ASP A 82  ? 1.2383 1.1440 1.3677 -0.0937 0.0145  0.2381  93  ASP A CG  
469  O  OD1 . ASP A 82  ? 1.2215 1.1211 1.3389 -0.0952 0.0167  0.2342  93  ASP A OD1 
470  O  OD2 . ASP A 82  ? 1.2483 1.1458 1.3767 -0.0941 0.0095  0.2361  93  ASP A OD2 
471  N  N   . LEU A 83  ? 1.2663 1.2226 1.4376 -0.0877 0.0273  0.2606  94  LEU A N   
472  C  CA  . LEU A 83  ? 1.2900 1.2584 1.4775 -0.0859 0.0291  0.2686  94  LEU A CA  
473  C  C   . LEU A 83  ? 1.2981 1.2668 1.4903 -0.0861 0.0296  0.2722  94  LEU A C   
474  O  O   . LEU A 83  ? 1.3241 1.2932 1.5295 -0.0857 0.0275  0.2775  94  LEU A O   
475  C  CB  . LEU A 83  ? 1.2866 1.2717 1.4755 -0.0838 0.0351  0.2714  94  LEU A CB  
476  C  CG  . LEU A 83  ? 1.2956 1.2839 1.4882 -0.0830 0.0351  0.2710  94  LEU A CG  
477  C  CD1 . LEU A 83  ? 1.2951 1.2991 1.4869 -0.0811 0.0416  0.2732  94  LEU A CD1 
478  C  CD2 . LEU A 83  ? 1.3277 1.3144 1.5367 -0.0825 0.0316  0.2757  94  LEU A CD2 
479  N  N   . THR A 84  ? 1.2778 1.2462 1.4601 -0.0868 0.0322  0.2692  95  THR A N   
480  C  CA  . THR A 84  ? 1.2864 1.2555 1.4737 -0.0870 0.0329  0.2724  95  THR A CA  
481  C  C   . THR A 84  ? 1.3004 1.2537 1.4892 -0.0889 0.0277  0.2709  95  THR A C   
482  O  O   . THR A 84  ? 1.3217 1.2757 1.5203 -0.0888 0.0271  0.2753  95  THR A O   
483  C  CB  . THR A 84  ? 1.2640 1.2368 1.4418 -0.0872 0.0371  0.2695  95  THR A CB  
484  O  OG1 . THR A 84  ? 1.2466 1.2048 1.4117 -0.0895 0.0355  0.2619  95  THR A OG1 
485  C  CG2 . THR A 84  ? 1.2494 1.2351 1.4225 -0.0857 0.0414  0.2692  95  THR A CG2 
486  N  N   . LYS A 85  ? 1.2913 1.2301 1.4701 -0.0906 0.0238  0.2647  96  LYS A N   
487  C  CA  . LYS A 85  ? 1.3086 1.2311 1.4877 -0.0925 0.0182  0.2630  96  LYS A CA  
488  C  C   . LYS A 85  ? 1.3398 1.2646 1.5356 -0.0915 0.0145  0.2692  96  LYS A C   
489  O  O   . LYS A 85  ? 1.3607 1.2801 1.5640 -0.0921 0.0118  0.2717  96  LYS A O   
490  C  CB  . LYS A 85  ? 1.2991 1.2054 1.4634 -0.0945 0.0144  0.2555  96  LYS A CB  
491  C  CG  . LYS A 85  ? 1.3190 1.2064 1.4807 -0.0967 0.0080  0.2532  96  LYS A CG  
492  C  CD  . LYS A 85  ? 1.3160 1.1951 1.4710 -0.0984 0.0098  0.2507  96  LYS A CD  
493  C  CE  . LYS A 85  ? 1.3397 1.1979 1.4886 -0.1009 0.0036  0.2472  96  LYS A CE  
494  N  NZ  . LYS A 85  ? 1.3329 1.1795 1.4698 -0.1031 0.0061  0.2423  96  LYS A NZ  
495  N  N   . VAL A 86  ? 1.3445 1.2773 1.5465 -0.0900 0.0145  0.2714  97  VAL A N   
496  C  CA  . VAL A 86  ? 1.3753 1.3126 1.5949 -0.0889 0.0120  0.2775  97  VAL A CA  
497  C  C   . VAL A 86  ? 1.3917 1.3395 1.6240 -0.0877 0.0153  0.2847  97  VAL A C   
498  O  O   . VAL A 86  ? 1.4184 1.3615 1.6613 -0.0881 0.0119  0.2879  97  VAL A O   
499  C  CB  . VAL A 86  ? 1.3771 1.3240 1.6017 -0.0872 0.0136  0.2789  97  VAL A CB  
500  C  CG1 . VAL A 86  ? 1.4112 1.3652 1.6557 -0.0858 0.0128  0.2860  97  VAL A CG1 
501  C  CG2 . VAL A 86  ? 1.3700 1.3050 1.5849 -0.0884 0.0090  0.2725  97  VAL A CG2 
502  N  N   . ILE A 87  ? 1.3776 1.3393 1.6086 -0.0863 0.0216  0.2871  98  ILE A N   
503  C  CA  . ILE A 87  ? 1.3930 1.3644 1.6340 -0.0852 0.0248  0.2938  98  ILE A CA  
504  C  C   . ILE A 87  ? 1.3990 1.3596 1.6408 -0.0868 0.0217  0.2929  98  ILE A C   
505  O  O   . ILE A 87  ? 1.4267 1.3862 1.6818 -0.0866 0.0194  0.2976  98  ILE A O   
506  C  CB  . ILE A 87  ? 1.3766 1.3611 1.6113 -0.0839 0.0311  0.2946  98  ILE A CB  
507  C  CG1 . ILE A 87  ? 1.3817 1.3794 1.6214 -0.0820 0.0346  0.2986  98  ILE A CG1 
508  C  CG2 . ILE A 87  ? 1.3925 1.3826 1.6332 -0.0834 0.0333  0.2995  98  ILE A CG2 
509  C  CD1 . ILE A 87  ? 1.3535 1.3564 1.5801 -0.0816 0.0381  0.2943  98  ILE A CD1 
510  N  N   . GLN A 88  ? 1.3754 1.3272 1.6033 -0.0884 0.0218  0.2866  99  GLN A N   
511  C  CA  . GLN A 88  ? 1.3808 1.3219 1.6081 -0.0900 0.0198  0.2852  99  GLN A CA  
512  C  C   . GLN A 88  ? 1.4095 1.3379 1.6434 -0.0912 0.0134  0.2853  99  GLN A C   
513  O  O   . GLN A 88  ? 1.4341 1.3599 1.6770 -0.0915 0.0121  0.2885  99  GLN A O   
514  C  CB  . GLN A 88  ? 1.4097 1.3412 1.6197 -0.0919 0.0210  0.2773  99  GLN A CB  
515  C  CG  . GLN A 88  ? 1.4050 1.3484 1.6100 -0.0908 0.0270  0.2771  99  GLN A CG  
516  C  CD  . GLN A 88  ? 1.4096 1.3431 1.5996 -0.0928 0.0285  0.2694  99  GLN A CD  
517  O  OE1 . GLN A 88  ? 1.4165 1.3353 1.5952 -0.0947 0.0258  0.2632  99  GLN A OE1 
518  N  NE2 . GLN A 88  ? 1.4064 1.3476 1.5961 -0.0923 0.0329  0.2698  99  GLN A NE2 
519  N  N   . LEU A 89  ? 1.4090 1.3296 1.6390 -0.0918 0.0092  0.2821  100 LEU A N   
520  C  CA  . LEU A 89  ? 1.4363 1.3434 1.6714 -0.0930 0.0020  0.2816  100 LEU A CA  
521  C  C   . LEU A 89  ? 1.4687 1.3839 1.7245 -0.0915 0.0006  0.2892  100 LEU A C   
522  O  O   . LEU A 89  ? 1.4937 1.4032 1.7581 -0.0921 -0.0024 0.2915  100 LEU A O   
523  C  CB  . LEU A 89  ? 1.4307 1.3263 1.6554 -0.0941 -0.0027 0.2758  100 LEU A CB  
524  C  CG  . LEU A 89  ? 1.4120 1.2917 1.6163 -0.0965 -0.0038 0.2676  100 LEU A CG  
525  C  CD1 . LEU A 89  ? 1.4110 1.2798 1.6077 -0.0973 -0.0095 0.2632  100 LEU A CD1 
526  C  CD2 . LEU A 89  ? 1.4284 1.2946 1.6301 -0.0985 -0.0062 0.2660  100 LEU A CD2 
527  N  N   . LYS A 90  ? 1.4705 1.3985 1.7342 -0.0896 0.0030  0.2930  101 LYS A N   
528  C  CA  . LYS A 90  ? 1.5028 1.4394 1.7865 -0.0881 0.0027  0.3004  101 LYS A CA  
529  C  C   . LYS A 90  ? 1.5008 1.4557 1.7905 -0.0860 0.0104  0.3066  101 LYS A C   
530  O  O   . LYS A 90  ? 1.5022 1.4689 1.7959 -0.0843 0.0142  0.3095  101 LYS A O   
531  C  CB  . LYS A 90  ? 1.5171 1.4524 1.8070 -0.0876 -0.0008 0.3000  101 LYS A CB  
532  C  CG  . LYS A 90  ? 1.5602 1.4923 1.8688 -0.0875 -0.0058 0.3044  101 LYS A CG  
533  C  CD  . LYS A 90  ? 1.5736 1.5130 1.8944 -0.0861 -0.0058 0.3069  101 LYS A CD  
534  C  CE  . LYS A 90  ? 1.6154 1.5583 1.9589 -0.0853 -0.0075 0.3135  101 LYS A CE  
535  N  NZ  . LYS A 90  ? 1.6273 1.5791 1.9836 -0.0838 -0.0058 0.3163  101 LYS A NZ  
536  N  N   . MSE A 91  ? 1.5002 1.4569 1.7894 -0.0862 0.0128  0.3084  102 MSE A N   
537  C  CA  . MSE A 91  ? 1.4995 1.4716 1.7915 -0.0844 0.0194  0.3137  102 MSE A CA  
538  C  C   . MSE A 91  ? 1.5272 1.5124 1.8349 -0.0824 0.0222  0.3218  102 MSE A C   
539  O  O   . MSE A 91  ? 1.5235 1.5220 1.8310 -0.0808 0.0279  0.3256  102 MSE A O   
540  C  CB  . MSE A 91  ? 1.5062 1.4763 1.7996 -0.0850 0.0200  0.3151  102 MSE A CB  
541  C  CG  . MSE A 91  ? 1.4988 1.4827 1.7917 -0.0835 0.0260  0.3192  102 MSE A CG  
542  SE SE  . MSE A 91  ? 1.4516 1.4387 1.7233 -0.0836 0.0301  0.3123  102 MSE A SE  
543  C  CE  . MSE A 91  ? 1.4332 1.4075 1.6970 -0.0859 0.0288  0.3066  102 MSE A CE  
544  N  N   . ASP A 92  ? 1.5572 1.5379 1.8784 -0.0825 0.0182  0.3241  103 ASP A N   
545  C  CA  . ASP A 92  ? 1.5894 1.5806 1.9271 -0.0809 0.0207  0.3314  103 ASP A CA  
546  C  C   . ASP A 92  ? 1.5823 1.5814 1.9172 -0.0797 0.0241  0.3308  103 ASP A C   
547  O  O   . ASP A 92  ? 1.5929 1.6055 1.9326 -0.0780 0.0303  0.3364  103 ASP A O   
548  C  CB  . ASP A 92  ? 1.6232 1.6058 1.9758 -0.0816 0.0147  0.3327  103 ASP A CB  
549  C  CG  . ASP A 92  ? 1.6612 1.6539 2.0328 -0.0800 0.0173  0.3401  103 ASP A CG  
550  O  OD1 . ASP A 92  ? 1.6722 1.6758 2.0508 -0.0787 0.0226  0.3470  103 ASP A OD1 
551  O  OD2 . ASP A 92  ? 1.6825 1.6717 2.0621 -0.0801 0.0141  0.3391  103 ASP A OD2 
552  N  N   . PHE A 93  ? 1.5672 1.5572 1.8943 -0.0808 0.0200  0.3241  104 PHE A N   
553  C  CA  . PHE A 93  ? 1.5620 1.5569 1.8886 -0.0799 0.0219  0.3227  104 PHE A CA  
554  C  C   . PHE A 93  ? 1.5418 1.5488 1.8579 -0.0787 0.0291  0.3231  104 PHE A C   
555  O  O   . PHE A 93  ? 1.5086 1.5127 1.8080 -0.0794 0.0294  0.3173  104 PHE A O   
556  C  CB  . PHE A 93  ? 1.5430 1.5239 1.8612 -0.0815 0.0153  0.3149  104 PHE A CB  
557  C  CG  . PHE A 93  ? 1.5406 1.5253 1.8576 -0.0807 0.0167  0.3127  104 PHE A CG  
558  C  CD1 . PHE A 93  ? 1.5722 1.5678 1.9043 -0.0791 0.0207  0.3181  104 PHE A CD1 
559  C  CD2 . PHE A 93  ? 1.5093 1.4861 1.8105 -0.0817 0.0143  0.3051  104 PHE A CD2 
560  C  CE1 . PHE A 93  ? 1.5722 1.5711 1.9038 -0.0785 0.0223  0.3158  104 PHE A CE1 
561  C  CE2 . PHE A 93  ? 1.5083 1.4890 1.8090 -0.0810 0.0158  0.3030  104 PHE A CE2 
562  C  CZ  . PHE A 93  ? 1.5399 1.5311 1.8559 -0.0794 0.0195  0.3081  104 PHE A CZ  
563  N  N   . THR A 94  ? 1.5656 1.5857 1.8915 -0.0770 0.0350  0.3298  105 THR A N   
564  C  CA  . THR A 94  ? 1.5556 1.5879 1.8723 -0.0757 0.0420  0.3316  105 THR A CA  
565  C  C   . THR A 94  ? 1.5411 1.5770 1.8485 -0.0753 0.0448  0.3273  105 THR A C   
566  O  O   . THR A 94  ? 1.5266 1.5678 1.8203 -0.0749 0.0484  0.3253  105 THR A O   
567  C  CB  . THR A 94  ? 1.5920 1.6363 1.9204 -0.0741 0.0476  0.3408  105 THR A CB  
568  O  OG1 . THR A 94  ? 1.6270 1.6737 1.9714 -0.0735 0.0485  0.3447  105 THR A OG1 
569  C  CG2 . THR A 94  ? 1.6030 1.6451 1.9370 -0.0745 0.0457  0.3447  105 THR A CG2 
570  N  N   . ALA A 95  ? 1.5464 1.5795 1.8616 -0.0753 0.0430  0.3259  106 ALA A N   
571  C  CA  . ALA A 95  ? 1.5331 1.5695 1.8408 -0.0749 0.0457  0.3219  106 ALA A CA  
572  C  C   . ALA A 95  ? 1.4892 1.5202 1.7770 -0.0759 0.0441  0.3142  106 ALA A C   
573  O  O   . ALA A 95  ? 1.4737 1.5102 1.7513 -0.0753 0.0480  0.3114  106 ALA A O   
574  C  CB  . ALA A 95  ? 1.5475 1.5789 1.8668 -0.0751 0.0423  0.3204  106 ALA A CB  
575  N  N   . ALA A 96  ? 1.4721 1.4919 1.7546 -0.0774 0.0386  0.3108  107 ALA A N   
576  C  CA  . ALA A 96  ? 1.4335 1.4463 1.6979 -0.0786 0.0369  0.3035  107 ALA A CA  
577  C  C   . ALA A 96  ? 1.4176 1.4390 1.6717 -0.0780 0.0420  0.3043  107 ALA A C   
578  O  O   . ALA A 96  ? 1.3894 1.4117 1.6296 -0.0782 0.0438  0.2992  107 ALA A O   
579  C  CB  . ALA A 96  ? 1.4272 1.4250 1.6899 -0.0804 0.0301  0.3003  107 ALA A CB  
580  N  N   . ARG A 97  ? 1.4372 1.4644 1.6982 -0.0773 0.0439  0.3104  108 ARG A N   
581  C  CA  . ARG A 97  ? 1.4277 1.4639 1.6807 -0.0766 0.0484  0.3120  108 ARG A CA  
582  C  C   . ARG A 97  ? 1.4325 1.4809 1.6826 -0.0750 0.0543  0.3138  108 ARG A C   
583  O  O   . ARG A 97  ? 1.4127 1.4668 1.6512 -0.0746 0.0573  0.3120  108 ARG A O   
584  C  CB  . ARG A 97  ? 1.4510 1.4908 1.7134 -0.0761 0.0490  0.3188  108 ARG A CB  
585  C  CG  . ARG A 97  ? 1.4398 1.4870 1.6938 -0.0755 0.0523  0.3199  108 ARG A CG  
586  C  CD  . ARG A 97  ? 1.4605 1.5098 1.7238 -0.0751 0.0521  0.3262  108 ARG A CD  
587  N  NE  . ARG A 97  ? 1.4394 1.4802 1.6978 -0.0765 0.0490  0.3221  108 ARG A NE  
588  C  CZ  . ARG A 97  ? 1.4406 1.4698 1.7039 -0.0780 0.0445  0.3202  108 ARG A CZ  
589  N  NH1 . ARG A 97  ? 1.4614 1.4862 1.7351 -0.0782 0.0419  0.3221  108 ARG A NH1 
590  N  NH2 . ARG A 97  ? 1.4233 1.4451 1.6812 -0.0793 0.0427  0.3164  108 ARG A NH2 
591  N  N   . LEU A 98  ? 1.4605 1.5126 1.7214 -0.0742 0.0558  0.3172  109 LEU A N   
592  C  CA  . LEU A 98  ? 1.4697 1.5319 1.7282 -0.0729 0.0615  0.3184  109 LEU A CA  
593  C  C   . LEU A 98  ? 1.4375 1.4960 1.6832 -0.0735 0.0608  0.3102  109 LEU A C   
594  O  O   . LEU A 98  ? 1.4278 1.4934 1.6629 -0.0728 0.0650  0.3085  109 LEU A O   
595  C  CB  . LEU A 98  ? 1.5079 1.5735 1.7826 -0.0721 0.0634  0.3236  109 LEU A CB  
596  C  CG  . LEU A 98  ? 1.5222 1.5967 1.7959 -0.0709 0.0696  0.3242  109 LEU A CG  
597  C  CD1 . LEU A 98  ? 1.5550 1.6414 1.8295 -0.0695 0.0763  0.3315  109 LEU A CD1 
598  C  CD2 . LEU A 98  ? 1.5405 1.6122 1.8284 -0.0710 0.0686  0.3242  109 LEU A CD2 
599  N  N   . GLN A 99  ? 1.4236 1.4705 1.6699 -0.0748 0.0553  0.3050  110 GLN A N   
600  C  CA  . GLN A 99  ? 1.3941 1.4357 1.6281 -0.0756 0.0539  0.2971  110 GLN A CA  
601  C  C   . GLN A 99  ? 1.3617 1.4034 1.5794 -0.0761 0.0549  0.2928  110 GLN A C   
602  O  O   . GLN A 99  ? 1.3459 1.3923 1.5533 -0.0757 0.0580  0.2892  110 GLN A O   
603  C  CB  . GLN A 99  ? 1.3885 1.4158 1.6249 -0.0771 0.0469  0.2926  110 GLN A CB  
604  C  CG  . GLN A 99  ? 1.4170 1.4441 1.6683 -0.0766 0.0457  0.2948  110 GLN A CG  
605  C  CD  . GLN A 99  ? 1.4263 1.4635 1.6778 -0.0753 0.0515  0.2949  110 GLN A CD  
606  O  OE1 . GLN A 99  ? 1.4565 1.5046 1.7168 -0.0739 0.0570  0.3009  110 GLN A OE1 
607  N  NE2 . GLN A 99  ? 1.4024 1.4357 1.6439 -0.0758 0.0505  0.2882  110 GLN A NE2 
608  N  N   . ARG A 100 ? 1.3543 1.3908 1.5706 -0.0770 0.0523  0.2931  111 ARG A N   
609  C  CA  . ARG A 100 ? 1.3266 1.3632 1.5297 -0.0775 0.0533  0.2894  111 ARG A CA  
610  C  C   . ARG A 100 ? 1.3299 1.3804 1.5287 -0.0759 0.0591  0.2921  111 ARG A C   
611  O  O   . ARG A 100 ? 1.3079 1.3604 1.4946 -0.0760 0.0609  0.2872  111 ARG A O   
612  C  CB  . ARG A 100 ? 1.3275 1.3588 1.5337 -0.0783 0.0508  0.2912  111 ARG A CB  
613  C  CG  . ARG A 100 ? 1.2965 1.3209 1.4898 -0.0797 0.0497  0.2848  111 ARG A CG  
614  C  CD  . ARG A 100 ? 1.3011 1.3178 1.4988 -0.0808 0.0468  0.2859  111 ARG A CD  
615  N  NE  . ARG A 100 ? 1.2989 1.3224 1.4956 -0.0802 0.0494  0.2883  111 ARG A NE  
616  C  CZ  . ARG A 100 ? 1.3029 1.3216 1.5034 -0.0810 0.0478  0.2894  111 ARG A CZ  
617  N  NH1 . ARG A 100 ? 1.3099 1.3166 1.5148 -0.0824 0.0438  0.2884  111 ARG A NH1 
618  N  NH2 . ARG A 100 ? 1.3022 1.3279 1.5024 -0.0804 0.0501  0.2914  111 ARG A NH2 
619  N  N   . GLY A 101 ? 1.3603 1.4201 1.5687 -0.0745 0.0619  0.3000  112 GLY A N   
620  C  CA  . GLY A 101 ? 1.3715 1.4440 1.5755 -0.0730 0.0672  0.3034  112 GLY A CA  
621  C  C   . GLY A 101 ? 1.3633 1.4401 1.5589 -0.0725 0.0704  0.2994  112 GLY A C   
622  O  O   . GLY A 101 ? 1.3516 1.4339 1.5360 -0.0721 0.0728  0.2970  112 GLY A O   
623  N  N   . HIS A 102 ? 1.3712 1.4454 1.5727 -0.0726 0.0703  0.2984  113 HIS A N   
624  C  CA  . HIS A 102 ? 1.3665 1.4441 1.5614 -0.0722 0.0733  0.2943  113 HIS A CA  
625  C  C   . HIS A 102 ? 1.3276 1.4003 1.5079 -0.0732 0.0715  0.2860  113 HIS A C   
626  O  O   . HIS A 102 ? 1.3190 1.3982 1.4890 -0.0727 0.0749  0.2837  113 HIS A O   
627  C  CB  . HIS A 102 ? 1.3818 1.4550 1.5869 -0.0724 0.0721  0.2938  113 HIS A CB  
628  C  CG  . HIS A 102 ? 1.4241 1.5048 1.6425 -0.0711 0.0761  0.3011  113 HIS A CG  
629  N  ND1 . HIS A 102 ? 1.4436 1.5348 1.6598 -0.0699 0.0827  0.3033  113 HIS A ND1 
630  C  CD2 . HIS A 102 ? 1.4531 1.5323 1.6872 -0.0710 0.0748  0.3067  113 HIS A CD2 
631  C  CE1 . HIS A 102 ? 1.4836 1.5790 1.7134 -0.0691 0.0857  0.3100  113 HIS A CE1 
632  N  NE2 . HIS A 102 ? 1.4896 1.5782 1.7310 -0.0697 0.0810  0.3122  113 HIS A NE2 
633  N  N   . LEU A 103 ? 1.3067 1.3673 1.4858 -0.0748 0.0663  0.2816  114 LEU A N   
634  C  CA  . LEU A 103 ? 1.2719 1.3258 1.4376 -0.0760 0.0645  0.2736  114 LEU A CA  
635  C  C   . LEU A 103 ? 1.2593 1.3193 1.4156 -0.0757 0.0669  0.2729  114 LEU A C   
636  O  O   . LEU A 103 ? 1.2471 1.3116 1.3934 -0.0754 0.0695  0.2689  114 LEU A O   
637  C  CB  . LEU A 103 ? 1.2588 1.2980 1.4252 -0.0778 0.0587  0.2702  114 LEU A CB  
638  C  CG  . LEU A 103 ? 1.2258 1.2547 1.3787 -0.0795 0.0564  0.2619  114 LEU A CG  
639  C  CD1 . LEU A 103 ? 1.2121 1.2426 1.3561 -0.0794 0.0583  0.2565  114 LEU A CD1 
640  C  CD2 . LEU A 103 ? 1.2241 1.2378 1.3789 -0.0812 0.0506  0.2596  114 LEU A CD2 
641  N  N   . LEU A 104 ? 1.2650 1.3256 1.4254 -0.0757 0.0660  0.2770  115 LEU A N   
642  C  CA  . LEU A 104 ? 1.2575 1.3241 1.4115 -0.0753 0.0676  0.2772  115 LEU A CA  
643  C  C   . LEU A 104 ? 1.2697 1.3491 1.4191 -0.0737 0.0722  0.2794  115 LEU A C   
644  O  O   . LEU A 104 ? 1.2582 1.3423 1.3994 -0.0734 0.0734  0.2775  115 LEU A O   
645  C  CB  . LEU A 104 ? 1.2740 1.3411 1.4368 -0.0751 0.0663  0.2833  115 LEU A CB  
646  C  CG  . LEU A 104 ? 1.2648 1.3193 1.4314 -0.0768 0.0620  0.2813  115 LEU A CG  
647  C  CD1 . LEU A 104 ? 1.2928 1.3484 1.4728 -0.0763 0.0609  0.2890  115 LEU A CD1 
648  C  CD2 . LEU A 104 ? 1.2376 1.2871 1.3954 -0.0780 0.0611  0.2758  115 LEU A CD2 
649  N  N   . LEU A 105 ? 1.2958 1.3805 1.4509 -0.0726 0.0748  0.2833  116 LEU A N   
650  C  CA  . LEU A 105 ? 1.3111 1.4068 1.4608 -0.0713 0.0795  0.2849  116 LEU A CA  
651  C  C   . LEU A 105 ? 1.2917 1.3862 1.4320 -0.0716 0.0807  0.2775  116 LEU A C   
652  O  O   . LEU A 105 ? 1.2838 1.3835 1.4136 -0.0713 0.0826  0.2745  116 LEU A O   
653  C  CB  . LEU A 105 ? 1.3519 1.4540 1.5115 -0.0700 0.0828  0.2926  116 LEU A CB  
654  C  CG  . LEU A 105 ? 1.3734 1.4866 1.5261 -0.0686 0.0882  0.2949  116 LEU A CG  
655  C  CD1 . LEU A 105 ? 1.3885 1.5082 1.5388 -0.0677 0.0888  0.3004  116 LEU A CD1 
656  C  CD2 . LEU A 105 ? 1.4085 1.5256 1.5690 -0.0678 0.0924  0.2990  116 LEU A CD2 
657  N  N   . LYS A 106 ? 1.2863 1.3739 1.4305 -0.0723 0.0793  0.2746  117 LYS A N   
658  C  CA  . LYS A 106 ? 1.2672 1.3524 1.4025 -0.0729 0.0798  0.2671  117 LYS A CA  
659  C  C   . LYS A 106 ? 1.2350 1.3169 1.3586 -0.0738 0.0782  0.2610  117 LYS A C   
660  O  O   . LYS A 106 ? 1.2236 1.3087 1.3372 -0.0737 0.0802  0.2562  117 LYS A O   
661  C  CB  . LYS A 106 ? 1.2610 1.3362 1.4019 -0.0738 0.0767  0.2640  117 LYS A CB  
662  C  CG  . LYS A 106 ? 1.2928 1.3709 1.4462 -0.0729 0.0784  0.2688  117 LYS A CG  
663  C  CD  . LYS A 106 ? 1.2855 1.3547 1.4414 -0.0738 0.0754  0.2638  117 LYS A CD  
664  C  CE  . LYS A 106 ? 1.3159 1.3826 1.4879 -0.0736 0.0739  0.2685  117 LYS A CE  
665  N  NZ  . LYS A 106 ? 1.3108 1.3676 1.4854 -0.0745 0.0697  0.2635  117 LYS A NZ  
666  N  N   . GLN A 107 ? 1.2230 1.2985 1.3482 -0.0747 0.0748  0.2613  118 GLN A N   
667  C  CA  . GLN A 107 ? 1.1952 1.2671 1.3111 -0.0758 0.0736  0.2559  118 GLN A CA  
668  C  C   . GLN A 107 ? 1.2009 1.2831 1.3120 -0.0747 0.0759  0.2577  118 GLN A C   
669  O  O   . GLN A 107 ? 1.1801 1.2610 1.2834 -0.0754 0.0755  0.2526  118 GLN A O   
670  C  CB  . GLN A 107 ? 1.1862 1.2480 1.3062 -0.0771 0.0697  0.2560  118 GLN A CB  
671  C  CG  . GLN A 107 ? 1.1724 1.2205 1.2916 -0.0788 0.0664  0.2513  118 GLN A CG  
672  C  CD  . GLN A 107 ? 1.1637 1.2015 1.2844 -0.0803 0.0631  0.2506  118 GLN A CD  
673  O  OE1 . GLN A 107 ? 1.1573 1.1972 1.2764 -0.0804 0.0638  0.2508  118 GLN A OE1 
674  N  NE2 . GLN A 107 ? 1.1661 1.1924 1.2902 -0.0814 0.0594  0.2498  118 GLN A NE2 
675  N  N   . GLY A 108 ? 1.2314 1.3233 1.3476 -0.0731 0.0782  0.2649  119 GLY A N   
676  C  CA  . GLY A 108 ? 1.2429 1.3444 1.3544 -0.0720 0.0798  0.2673  119 GLY A CA  
677  C  C   . GLY A 108 ? 1.2392 1.3390 1.3537 -0.0724 0.0772  0.2692  119 GLY A C   
678  O  O   . GLY A 108 ? 1.2433 1.3491 1.3533 -0.0717 0.0774  0.2695  119 GLY A O   
679  N  N   . LYS A 109 ? 1.2337 1.3251 1.3561 -0.0733 0.0746  0.2703  120 LYS A N   
680  C  CA  . LYS A 109 ? 1.2339 1.3231 1.3611 -0.0737 0.0723  0.2724  120 LYS A CA  
681  C  C   . LYS A 109 ? 1.2695 1.3653 1.4063 -0.0723 0.0728  0.2820  120 LYS A C   
682  O  O   . LYS A 109 ? 1.2795 1.3704 1.4259 -0.0727 0.0711  0.2857  120 LYS A O   
683  C  CB  . LYS A 109 ? 1.2132 1.2890 1.3428 -0.0756 0.0694  0.2683  120 LYS A CB  
684  C  CG  . LYS A 109 ? 1.1796 1.2481 1.2990 -0.0772 0.0690  0.2590  120 LYS A CG  
685  C  CD  . LYS A 109 ? 1.1637 1.2181 1.2845 -0.0792 0.0662  0.2554  120 LYS A CD  
686  C  CE  . LYS A 109 ? 1.1642 1.2169 1.2889 -0.0797 0.0653  0.2565  120 LYS A CE  
687  N  NZ  . LYS A 109 ? 1.1523 1.1904 1.2775 -0.0818 0.0631  0.2528  120 LYS A NZ  
688  N  N   . LEU A 110 ? 1.2910 1.3974 1.4244 -0.0708 0.0750  0.2858  121 LEU A N   
689  C  CA  . LEU A 110 ? 1.3310 1.4448 1.4709 -0.0693 0.0768  0.2950  121 LEU A CA  
690  C  C   . LEU A 110 ? 1.3480 1.4610 1.4983 -0.0691 0.0747  0.3014  121 LEU A C   
691  O  O   . LEU A 110 ? 1.3711 1.4838 1.5309 -0.0688 0.0752  0.3073  121 LEU A O   
692  C  CB  . LEU A 110 ? 1.3515 1.4756 1.4826 -0.0679 0.0793  0.2968  121 LEU A CB  
693  C  CG  . LEU A 110 ? 1.3359 1.4615 1.4567 -0.0680 0.0817  0.2905  121 LEU A CG  
694  C  CD1 . LEU A 110 ? 1.3545 1.4890 1.4652 -0.0668 0.0832  0.2911  121 LEU A CD1 
695  C  CD2 . LEU A 110 ? 1.3501 1.4752 1.4746 -0.0678 0.0847  0.2920  121 LEU A CD2 
696  N  N   . ASP A 111 ? 1.3384 1.4512 1.4877 -0.0693 0.0725  0.3002  122 ASP A N   
697  C  CA  . ASP A 111 ? 1.3546 1.4661 1.5142 -0.0692 0.0703  0.3056  122 ASP A CA  
698  C  C   . ASP A 111 ? 1.3489 1.4512 1.5180 -0.0704 0.0688  0.3058  122 ASP A C   
699  O  O   . ASP A 111 ? 1.3758 1.4791 1.5549 -0.0699 0.0687  0.3128  122 ASP A O   
700  C  CB  . ASP A 111 ? 1.3419 1.4527 1.4996 -0.0696 0.0680  0.3024  122 ASP A CB  
701  C  CG  . ASP A 111 ? 1.3676 1.4884 1.5210 -0.0681 0.0682  0.3061  122 ASP A CG  
702  O  OD1 . ASP A 111 ? 1.3937 1.5214 1.5407 -0.0669 0.0705  0.3084  122 ASP A OD1 
703  O  OD2 . ASP A 111 ? 1.3643 1.4858 1.5209 -0.0680 0.0659  0.3066  122 ASP A OD2 
704  N  N   . GLU A 112 ? 1.3168 1.4097 1.4824 -0.0721 0.0675  0.2982  123 GLU A N   
705  C  CA  . GLU A 112 ? 1.3114 1.3937 1.4842 -0.0734 0.0654  0.2973  123 GLU A CA  
706  C  C   . GLU A 112 ? 1.3325 1.4159 1.5119 -0.0728 0.0664  0.3018  123 GLU A C   
707  O  O   . GLU A 112 ? 1.3474 1.4259 1.5371 -0.0732 0.0647  0.3052  123 GLU A O   
708  C  CB  . GLU A 112 ? 1.2752 1.3469 1.4400 -0.0753 0.0641  0.2879  123 GLU A CB  
709  C  CG  . GLU A 112 ? 1.2540 1.3224 1.4129 -0.0763 0.0634  0.2822  123 GLU A CG  
710  C  CD  . GLU A 112 ? 1.2485 1.3266 1.3993 -0.0752 0.0653  0.2806  123 GLU A CD  
711  O  OE1 . GLU A 112 ? 1.2531 1.3381 1.3987 -0.0742 0.0673  0.2811  123 GLU A OE1 
712  O  OE2 . GLU A 112 ? 1.2418 1.3202 1.3918 -0.0755 0.0648  0.2786  123 GLU A OE2 
713  N  N   . ALA A 113 ? 1.3353 1.4251 1.5092 -0.0719 0.0693  0.3016  124 ALA A N   
714  C  CA  . ALA A 113 ? 1.3576 1.4493 1.5376 -0.0713 0.0711  0.3054  124 ALA A CA  
715  C  C   . ALA A 113 ? 1.3985 1.4973 1.5884 -0.0699 0.0728  0.3151  124 ALA A C   
716  O  O   . ALA A 113 ? 1.4175 1.5132 1.6189 -0.0700 0.0721  0.3191  124 ALA A O   
717  C  CB  . ALA A 113 ? 1.3534 1.4504 1.5243 -0.0707 0.0744  0.3022  124 ALA A CB  
718  N  N   . GLU A 114 ? 1.4147 1.5224 1.6000 -0.0687 0.0749  0.3188  125 GLU A N   
719  C  CA  . GLU A 114 ? 1.4555 1.5695 1.6488 -0.0674 0.0763  0.3283  125 GLU A CA  
720  C  C   . GLU A 114 ? 1.4611 1.5691 1.6667 -0.0681 0.0730  0.3314  125 GLU A C   
721  O  O   . GLU A 114 ? 1.4889 1.5964 1.7056 -0.0678 0.0737  0.3368  125 GLU A O   
722  C  CB  . GLU A 114 ? 1.4676 1.5897 1.6526 -0.0663 0.0772  0.3306  125 GLU A CB  
723  C  CG  . GLU A 114 ? 1.4819 1.6112 1.6563 -0.0654 0.0812  0.3301  125 GLU A CG  
724  C  CD  . GLU A 114 ? 1.4816 1.6166 1.6447 -0.0647 0.0807  0.3289  125 GLU A CD  
725  O  OE1 . GLU A 114 ? 1.4771 1.6111 1.6418 -0.0648 0.0773  0.3289  125 GLU A OE1 
726  O  OE2 . GLU A 114 ? 1.4876 1.6281 1.6404 -0.0640 0.0836  0.3278  125 GLU A OE2 
727  N  N   . ASP A 115 ? 1.4359 1.5390 1.6400 -0.0690 0.0697  0.3276  126 ASP A N   
728  C  CA  . ASP A 115 ? 1.4388 1.5353 1.6538 -0.0698 0.0666  0.3296  126 ASP A CA  
729  C  C   . ASP A 115 ? 1.4392 1.5274 1.6631 -0.0708 0.0651  0.3291  126 ASP A C   
730  O  O   . ASP A 115 ? 1.4512 1.5351 1.6859 -0.0712 0.0629  0.3325  126 ASP A O   
731  C  CB  . ASP A 115 ? 1.4075 1.4979 1.6180 -0.0710 0.0638  0.3234  126 ASP A CB  
732  C  CG  . ASP A 115 ? 1.4084 1.5064 1.6118 -0.0701 0.0644  0.3235  126 ASP A CG  
733  O  OD1 . ASP A 115 ? 1.4412 1.5481 1.6465 -0.0685 0.0658  0.3306  126 ASP A OD1 
734  O  OD2 . ASP A 115 ? 1.3781 1.4726 1.5738 -0.0710 0.0635  0.3162  126 ASP A OD2 
735  N  N   . ASP A 116 ? 1.4276 1.5134 1.6472 -0.0712 0.0658  0.3248  127 ASP A N   
736  C  CA  . ASP A 116 ? 1.4306 1.5087 1.6586 -0.0720 0.0639  0.3241  127 ASP A CA  
737  C  C   . ASP A 116 ? 1.4660 1.5506 1.7026 -0.0708 0.0670  0.3306  127 ASP A C   
738  O  O   . ASP A 116 ? 1.4878 1.5693 1.7371 -0.0709 0.0657  0.3345  127 ASP A O   
739  C  CB  . ASP A 116 ? 1.3962 1.4661 1.6154 -0.0733 0.0621  0.3152  127 ASP A CB  
740  C  CG  . ASP A 116 ? 1.3765 1.4332 1.5961 -0.0752 0.0574  0.3102  127 ASP A CG  
741  O  OD1 . ASP A 116 ? 1.3924 1.4461 1.6208 -0.0755 0.0555  0.3139  127 ASP A OD1 
742  O  OD2 . ASP A 116 ? 1.3476 1.3963 1.5582 -0.0765 0.0557  0.3026  127 ASP A OD2 
743  N  N   . PHE A 117 ? 1.4739 1.5673 1.7036 -0.0697 0.0713  0.3316  128 PHE A N   
744  C  CA  . PHE A 117 ? 1.5116 1.6119 1.7478 -0.0685 0.0756  0.3376  128 PHE A CA  
745  C  C   . PHE A 117 ? 1.5525 1.6571 1.8002 -0.0676 0.0769  0.3470  128 PHE A C   
746  O  O   . PHE A 117 ? 1.5856 1.6921 1.8442 -0.0671 0.0792  0.3522  128 PHE A O   
747  C  CB  . PHE A 117 ? 1.5166 1.6256 1.7407 -0.0674 0.0802  0.3370  128 PHE A CB  
748  C  CG  . PHE A 117 ? 1.4913 1.5987 1.7091 -0.0678 0.0813  0.3305  128 PHE A CG  
749  C  CD1 . PHE A 117 ? 1.4996 1.6025 1.7268 -0.0683 0.0810  0.3297  128 PHE A CD1 
750  C  CD2 . PHE A 117 ? 1.4623 1.5729 1.6655 -0.0677 0.0827  0.3253  128 PHE A CD2 
751  C  CE1 . PHE A 117 ? 1.4784 1.5799 1.7006 -0.0686 0.0820  0.3238  128 PHE A CE1 
752  C  CE2 . PHE A 117 ? 1.4401 1.5494 1.6377 -0.0680 0.0839  0.3193  128 PHE A CE2 
753  C  CZ  . PHE A 117 ? 1.4482 1.5528 1.6553 -0.0684 0.0836  0.3186  128 PHE A CZ  
754  N  N   . LYS A 118 ? 1.5521 1.6583 1.7975 -0.0674 0.0755  0.3493  129 LYS A N   
755  C  CA  . LYS A 118 ? 1.5909 1.7012 1.8459 -0.0665 0.0764  0.3582  129 LYS A CA  
756  C  C   . LYS A 118 ? 1.5971 1.6998 1.8665 -0.0674 0.0728  0.3596  129 LYS A C   
757  O  O   . LYS A 118 ? 1.6348 1.7394 1.9166 -0.0669 0.0744  0.3663  129 LYS A O   
758  C  CB  . LYS A 118 ? 1.5900 1.7046 1.8378 -0.0659 0.0756  0.3598  129 LYS A CB  
759  C  CG  . LYS A 118 ? 1.5956 1.7184 1.8297 -0.0648 0.0790  0.3596  129 LYS A CG  
760  C  CD  . LYS A 118 ? 1.6048 1.7312 1.8327 -0.0642 0.0773  0.3611  129 LYS A CD  
761  C  CE  . LYS A 118 ? 1.6148 1.7483 1.8279 -0.0633 0.0798  0.3596  129 LYS A CE  
762  N  NZ  . LYS A 118 ? 1.6621 1.8017 1.8716 -0.0621 0.0792  0.3653  129 LYS A NZ  
763  N  N   . LYS A 119 ? 1.5626 1.6563 1.8305 -0.0688 0.0681  0.3533  130 LYS A N   
764  C  CA  . LYS A 119 ? 1.5680 1.6530 1.8481 -0.0699 0.0641  0.3537  130 LYS A CA  
765  C  C   . LYS A 119 ? 1.5848 1.6662 1.8744 -0.0702 0.0639  0.3540  130 LYS A C   
766  O  O   . LYS A 119 ? 1.6047 1.6794 1.9059 -0.0709 0.0606  0.3551  130 LYS A O   
767  C  CB  . LYS A 119 ? 1.5296 1.6043 1.8035 -0.0715 0.0596  0.3457  130 LYS A CB  
768  C  CG  . LYS A 119 ? 1.5191 1.5951 1.7870 -0.0716 0.0590  0.3447  130 LYS A CG  
769  C  CD  . LYS A 119 ? 1.4781 1.5432 1.7381 -0.0734 0.0557  0.3354  130 LYS A CD  
770  C  CE  . LYS A 119 ? 1.4685 1.5336 1.7230 -0.0737 0.0552  0.3332  130 LYS A CE  
771  N  NZ  . LYS A 119 ? 1.4330 1.4858 1.6815 -0.0757 0.0524  0.3246  130 LYS A NZ  
772  N  N   . VAL A 120 ? 1.5786 1.6642 1.8636 -0.0696 0.0671  0.3526  131 VAL A N   
773  C  CA  . VAL A 120 ? 1.6008 1.6848 1.8963 -0.0697 0.0677  0.3536  131 VAL A CA  
774  C  C   . VAL A 120 ? 1.6502 1.7424 1.9574 -0.0683 0.0724  0.3631  131 VAL A C   
775  O  O   . VAL A 120 ? 1.6791 1.7687 2.0018 -0.0685 0.0714  0.3669  131 VAL A O   
776  C  CB  . VAL A 120 ? 1.5813 1.6657 1.8678 -0.0697 0.0693  0.3475  131 VAL A CB  
777  C  CG1 . VAL A 120 ? 1.6162 1.7048 1.9133 -0.0690 0.0731  0.3512  131 VAL A CG1 
778  C  CG2 . VAL A 120 ? 1.5437 1.6165 1.8250 -0.0714 0.0636  0.3388  131 VAL A CG2 
779  N  N   . LEU A 121 ? 1.6623 1.7640 1.9619 -0.0671 0.0774  0.3670  132 LEU A N   
780  C  CA  . LEU A 121 ? 1.7121 1.8215 2.0203 -0.0659 0.0825  0.3764  132 LEU A CA  
781  C  C   . LEU A 121 ? 1.7322 1.8404 2.0505 -0.0658 0.0802  0.3825  132 LEU A C   
782  O  O   . LEU A 121 ? 1.7732 1.8850 2.1037 -0.0651 0.0832  0.3905  132 LEU A O   
783  C  CB  . LEU A 121 ? 1.7221 1.8407 2.0168 -0.0647 0.0880  0.3786  132 LEU A CB  
784  C  CG  . LEU A 121 ? 1.7217 1.8431 2.0072 -0.0645 0.0918  0.3741  132 LEU A CG  
785  C  CD1 . LEU A 121 ? 1.7337 1.8635 2.0059 -0.0634 0.0964  0.3771  132 LEU A CD1 
786  C  CD2 . LEU A 121 ? 1.7596 1.8815 2.0585 -0.0644 0.0954  0.3769  132 LEU A CD2 
787  N  N   . LYS A 122 ? 1.7058 1.8085 2.0197 -0.0666 0.0751  0.3785  133 LYS A N   
788  C  CA  . LYS A 122 ? 1.7218 1.8232 2.0446 -0.0666 0.0728  0.3836  133 LYS A CA  
789  C  C   . LYS A 122 ? 1.7254 1.8180 2.0629 -0.0677 0.0683  0.3831  133 LYS A C   
790  O  O   . LYS A 122 ? 1.7644 1.8582 2.1154 -0.0673 0.0688  0.3901  133 LYS A O   
791  C  CB  . LYS A 122 ? 1.6946 1.7966 2.0064 -0.0666 0.0707  0.3811  133 LYS A CB  
792  C  CG  . LYS A 122 ? 1.7183 1.8304 2.0226 -0.0651 0.0748  0.3869  133 LYS A CG  
793  C  CD  . LYS A 122 ? 1.6868 1.8007 1.9753 -0.0650 0.0737  0.3816  133 LYS A CD  
794  C  CE  . LYS A 122 ? 1.7153 1.8388 1.9943 -0.0635 0.0781  0.3864  133 LYS A CE  
795  N  NZ  . LYS A 122 ? 1.6871 1.8132 1.9529 -0.0632 0.0764  0.3829  133 LYS A NZ  
796  N  N   . SER A 123 ? 1.6879 1.7712 2.0226 -0.0691 0.0638  0.3750  134 SER A N   
797  C  CA  . SER A 123 ? 1.6900 1.7635 2.0366 -0.0704 0.0587  0.3738  134 SER A CA  
798  C  C   . SER A 123 ? 1.7141 1.7854 2.0754 -0.0705 0.0583  0.3760  134 SER A C   
799  O  O   . SER A 123 ? 1.7491 1.8199 2.1256 -0.0704 0.0578  0.3817  134 SER A O   
800  C  CB  . SER A 123 ? 1.6463 1.7091 1.9833 -0.0720 0.0535  0.3647  134 SER A CB  
801  O  OG  . SER A 123 ? 1.6403 1.7010 1.9764 -0.0724 0.0518  0.3652  134 SER A OG  
802  N  N   . ASN A 124 ? 1.6981 1.7680 2.0558 -0.0707 0.0586  0.3714  135 ASN A N   
803  C  CA  . ASN A 124 ? 1.7258 1.7945 2.0984 -0.0707 0.0586  0.3734  135 ASN A CA  
804  C  C   . ASN A 124 ? 1.7413 1.8189 2.1124 -0.0695 0.0650  0.3753  135 ASN A C   
805  O  O   . ASN A 124 ? 1.7306 1.8056 2.1029 -0.0698 0.0644  0.3711  135 ASN A O   
806  C  CB  . ASN A 124 ? 1.7035 1.7598 2.0773 -0.0722 0.0516  0.3660  135 ASN A CB  
807  C  CG  . ASN A 124 ? 1.7368 1.7905 2.1291 -0.0723 0.0500  0.3683  135 ASN A CG  
808  O  OD1 . ASN A 124 ? 1.7694 1.8255 2.1773 -0.0719 0.0510  0.3751  135 ASN A OD1 
809  N  ND2 . ASN A 124 ? 1.7302 1.7785 2.1213 -0.0729 0.0472  0.3626  135 ASN A ND2 
810  N  N   . PRO A 125 ? 1.7696 1.8574 2.1381 -0.0682 0.0713  0.3817  136 PRO A N   
811  C  CA  . PRO A 125 ? 1.7798 1.8752 2.1437 -0.0673 0.0778  0.3826  136 PRO A CA  
812  C  C   . PRO A 125 ? 1.8180 1.9137 2.1993 -0.0671 0.0799  0.3854  136 PRO A C   
813  O  O   . PRO A 125 ? 1.8588 1.9535 2.2562 -0.0671 0.0793  0.3910  136 PRO A O   
814  C  CB  . PRO A 125 ? 1.8026 1.9075 2.1614 -0.0660 0.0835  0.3899  136 PRO A CB  
815  C  CG  . PRO A 125 ? 1.8202 1.9231 2.1884 -0.0661 0.0807  0.3951  136 PRO A CG  
816  C  CD  . PRO A 125 ? 1.8041 1.8963 2.1781 -0.0675 0.0730  0.3896  136 PRO A CD  
817  N  N   . SER A 126 ? 1.8071 1.9037 2.1859 -0.0671 0.0821  0.3814  137 SER A N   
818  C  CA  . SER A 126 ? 1.8442 1.9412 2.2406 -0.0669 0.0843  0.3837  137 SER A CA  
819  C  C   . SER A 126 ? 1.8442 1.9440 2.2374 -0.0666 0.0884  0.3798  137 SER A C   
820  O  O   . SER A 126 ? 1.8052 1.9033 2.1835 -0.0669 0.0868  0.3730  137 SER A O   
821  C  CB  . SER A 126 ? 1.8425 1.9296 2.2539 -0.0680 0.0765  0.3816  137 SER A CB  
822  O  OG  . SER A 126 ? 1.7934 1.8715 2.1929 -0.0691 0.0691  0.3732  137 SER A OG  
823  N  N   . GLU A 127 ? 1.8917 1.9957 2.3002 -0.0661 0.0938  0.3844  138 GLU A N   
824  C  CA  . GLU A 127 ? 1.9053 2.0120 2.3166 -0.0658 0.0984  0.3818  138 GLU A CA  
825  C  C   . GLU A 127 ? 1.8748 1.9855 2.2655 -0.0655 0.1021  0.3770  138 GLU A C   
826  O  O   . GLU A 127 ? 1.8643 1.9800 2.2396 -0.0650 0.1052  0.3791  138 GLU A O   
827  C  CB  . GLU A 127 ? 1.9065 2.0048 2.3325 -0.0666 0.0918  0.3769  138 GLU A CB  
828  C  CG  . GLU A 127 ? 1.8551 1.9459 2.2679 -0.0675 0.0847  0.3672  138 GLU A CG  
829  C  CD  . GLU A 127 ? 1.8191 1.9012 2.2257 -0.0685 0.0759  0.3643  138 GLU A CD  
830  O  OE1 . GLU A 127 ? 1.8372 1.9193 2.2487 -0.0685 0.0749  0.3694  138 GLU A OE1 
831  O  OE2 . GLU A 127 ? 1.7748 1.8495 2.1713 -0.0693 0.0700  0.3567  138 GLU A OE2 
832  N  N   . ASN A 128 ? 1.8641 1.9725 2.2556 -0.0657 0.1015  0.3709  139 ASN A N   
833  C  CA  . ASN A 128 ? 1.8369 1.9482 2.2107 -0.0656 0.1043  0.3653  139 ASN A CA  
834  C  C   . ASN A 128 ? 1.7870 1.8968 2.1396 -0.0658 0.1005  0.3614  139 ASN A C   
835  O  O   . ASN A 128 ? 1.7779 1.8934 2.1147 -0.0653 0.1051  0.3604  139 ASN A O   
836  C  CB  . ASN A 128 ? 1.8275 1.9338 2.2066 -0.0660 0.1012  0.3583  139 ASN A CB  
837  C  CG  . ASN A 128 ? 1.8123 1.9214 2.1741 -0.0659 0.1041  0.3524  139 ASN A CG  
838  O  OD1 . ASN A 128 ? 1.8452 1.9620 2.2036 -0.0651 0.1127  0.3544  139 ASN A OD1 
839  N  ND2 . ASN A 128 ? 1.7633 1.8657 2.1135 -0.0666 0.0973  0.3450  139 ASN A ND2 
840  N  N   . GLU A 129 ? 1.7571 1.8590 2.1098 -0.0667 0.0922  0.3590  140 GLU A N   
841  C  CA  . GLU A 129 ? 1.7128 1.8122 2.0477 -0.0672 0.0883  0.3551  140 GLU A CA  
842  C  C   . GLU A 129 ? 1.7236 1.8315 2.0472 -0.0663 0.0936  0.3599  140 GLU A C   
843  O  O   . GLU A 129 ? 1.6962 1.8064 2.0026 -0.0662 0.0944  0.3560  140 GLU A O   
844  C  CB  . GLU A 129 ? 1.6950 1.7851 2.0349 -0.0682 0.0800  0.3540  140 GLU A CB  
845  C  CG  . GLU A 129 ? 1.6834 1.7632 2.0308 -0.0693 0.0731  0.3483  140 GLU A CG  
846  C  CD  . GLU A 129 ? 1.6787 1.7486 2.0313 -0.0704 0.0653  0.3477  140 GLU A CD  
847  O  OE1 . GLU A 129 ? 1.6956 1.7674 2.0499 -0.0702 0.0656  0.3526  140 GLU A OE1 
848  O  OE2 . GLU A 129 ? 1.6593 1.7192 2.0144 -0.0715 0.0586  0.3424  140 GLU A OE2 
849  N  N   . GLU A 130 ? 1.7659 1.8782 2.0995 -0.0656 0.0970  0.3683  141 GLU A N   
850  C  CA  . GLU A 130 ? 1.7858 1.9057 2.1101 -0.0647 0.1019  0.3741  141 GLU A CA  
851  C  C   . GLU A 130 ? 1.7885 1.9151 2.0979 -0.0640 0.1081  0.3723  141 GLU A C   
852  O  O   . GLU A 130 ? 1.7757 1.9059 2.0697 -0.0636 0.1087  0.3722  141 GLU A O   
853  C  CB  . GLU A 130 ? 1.8408 1.9646 2.1798 -0.0640 0.1062  0.3837  141 GLU A CB  
854  C  CG  . GLU A 130 ? 1.8440 1.9623 2.1969 -0.0646 0.1006  0.3868  141 GLU A CG  
855  C  CD  . GLU A 130 ? 1.9028 2.0258 2.2687 -0.0638 0.1056  0.3968  141 GLU A CD  
856  O  OE1 . GLU A 130 ? 1.9415 2.0717 2.3031 -0.0630 0.1134  0.4017  141 GLU A OE1 
857  O  OE2 . GLU A 130 ? 1.9119 2.0309 2.2920 -0.0642 0.1018  0.3999  141 GLU A OE2 
858  N  N   . LYS A 131 ? 1.8070 1.9353 2.1217 -0.0639 0.1127  0.3709  142 LYS A N   
859  C  CA  . LYS A 131 ? 1.8133 1.9477 2.1153 -0.0633 0.1193  0.3691  142 LYS A CA  
860  C  C   . LYS A 131 ? 1.7602 1.8924 2.0451 -0.0637 0.1155  0.3604  142 LYS A C   
861  O  O   . LYS A 131 ? 1.7546 1.8914 2.0231 -0.0633 0.1178  0.3599  142 LYS A O   
862  C  CB  . LYS A 131 ? 1.8435 1.9792 2.1573 -0.0632 0.1248  0.3690  142 LYS A CB  
863  C  CG  . LYS A 131 ? 1.9030 2.0417 2.2336 -0.0627 0.1306  0.3776  142 LYS A CG  
864  C  CD  . LYS A 131 ? 1.9067 2.0392 2.2590 -0.0634 0.1256  0.3777  142 LYS A CD  
865  C  CE  . LYS A 131 ? 1.9635 2.0989 2.3335 -0.0630 0.1310  0.3865  142 LYS A CE  
866  N  NZ  . LYS A 131 ? 1.9710 2.1002 2.3628 -0.0636 0.1255  0.3865  142 LYS A NZ  
867  N  N   . GLU A 132 ? 1.7241 1.8490 2.0131 -0.0646 0.1097  0.3537  143 GLU A N   
868  C  CA  . GLU A 132 ? 1.6735 1.7948 1.9478 -0.0652 0.1054  0.3452  143 GLU A CA  
869  C  C   . GLU A 132 ? 1.6492 1.7712 1.9101 -0.0652 0.1027  0.3454  143 GLU A C   
870  O  O   . GLU A 132 ? 1.6369 1.7634 1.8823 -0.0649 0.1050  0.3430  143 GLU A O   
871  C  CB  . GLU A 132 ? 1.6430 1.7543 1.9247 -0.0664 0.0981  0.3393  143 GLU A CB  
872  C  CG  . GLU A 132 ? 1.6415 1.7512 1.9282 -0.0665 0.0994  0.3347  143 GLU A CG  
873  C  CD  . GLU A 132 ? 1.6033 1.7030 1.8873 -0.0677 0.0917  0.3266  143 GLU A CD  
874  O  OE1 . GLU A 132 ? 1.5666 1.6609 1.8410 -0.0684 0.0864  0.3234  143 GLU A OE1 
875  O  OE2 . GLU A 132 ? 1.6129 1.7096 1.9044 -0.0679 0.0911  0.3232  143 GLU A OE2 
876  N  N   . ALA A 133 ? 1.6452 1.7630 1.9131 -0.0656 0.0978  0.3482  144 ALA A N   
877  C  CA  . ALA A 133 ? 1.6233 1.7410 1.8817 -0.0657 0.0947  0.3484  144 ALA A CA  
878  C  C   . ALA A 133 ? 1.6453 1.7721 1.8925 -0.0646 0.0999  0.3525  144 ALA A C   
879  O  O   . ALA A 133 ? 1.6204 1.7487 1.8530 -0.0646 0.0988  0.3487  144 ALA A O   
880  C  CB  . ALA A 133 ? 1.6314 1.7450 1.9023 -0.0660 0.0908  0.3532  144 ALA A CB  
881  N  N   . GLN A 134 ? 1.6952 1.8276 1.9494 -0.0637 0.1054  0.3603  145 GLN A N   
882  C  CA  . GLN A 134 ? 1.7274 1.8676 1.9721 -0.0626 0.1103  0.3657  145 GLN A CA  
883  C  C   . GLN A 134 ? 1.7245 1.8688 1.9534 -0.0623 0.1141  0.3610  145 GLN A C   
884  O  O   . GLN A 134 ? 1.7197 1.8670 1.9343 -0.0620 0.1133  0.3596  145 GLN A O   
885  C  CB  . GLN A 134 ? 1.7854 1.9291 2.0420 -0.0620 0.1160  0.3747  145 GLN A CB  
886  C  CG  . GLN A 134 ? 1.8231 1.9719 2.0751 -0.0611 0.1182  0.3828  145 GLN A CG  
887  C  CD  . GLN A 134 ? 1.8859 2.0392 2.1446 -0.0604 0.1262  0.3908  145 GLN A CD  
888  O  OE1 . GLN A 134 ? 1.9026 2.0539 2.1773 -0.0607 0.1281  0.3927  145 GLN A OE1 
889  N  NE2 . GLN A 134 ? 1.9239 2.0827 2.1702 -0.0595 0.1307  0.3955  145 GLN A NE2 
890  N  N   . SER A 135 ? 1.7280 1.8723 1.9602 -0.0625 0.1178  0.3581  146 SER A N   
891  C  CA  . SER A 135 ? 1.7240 1.8721 1.9423 -0.0622 0.1219  0.3534  146 SER A CA  
892  C  C   . SER A 135 ? 1.6705 1.8162 1.8751 -0.0627 0.1169  0.3450  146 SER A C   
893  O  O   . SER A 135 ? 1.6677 1.8173 1.8579 -0.0624 0.1195  0.3418  146 SER A O   
894  C  CB  . SER A 135 ? 1.7374 1.8849 1.9642 -0.0624 0.1261  0.3509  146 SER A CB  
895  O  OG  . SER A 135 ? 1.7477 1.8989 1.9610 -0.0621 0.1304  0.3464  146 SER A OG  
896  N  N   . GLN A 136 ? 1.6312 1.7700 1.8403 -0.0636 0.1100  0.3414  147 GLN A N   
897  C  CA  . GLN A 136 ? 1.5817 1.7170 1.7793 -0.0643 0.1052  0.3333  147 GLN A CA  
898  C  C   . GLN A 136 ? 1.5762 1.7144 1.7632 -0.0639 0.1033  0.3348  147 GLN A C   
899  O  O   . GLN A 136 ? 1.5537 1.6936 1.7271 -0.0640 0.1028  0.3295  147 GLN A O   
900  C  CB  . GLN A 136 ? 1.5464 1.6720 1.7520 -0.0656 0.0990  0.3286  147 GLN A CB  
901  C  CG  . GLN A 136 ? 1.5428 1.6645 1.7562 -0.0660 0.0995  0.3250  147 GLN A CG  
902  C  CD  . GLN A 136 ? 1.5056 1.6237 1.7083 -0.0667 0.0978  0.3157  147 GLN A CD  
903  O  OE1 . GLN A 136 ? 1.4669 1.5777 1.6658 -0.0678 0.0923  0.3104  147 GLN A OE1 
904  N  NE2 . GLN A 136 ? 1.5198 1.6426 1.7178 -0.0662 0.1028  0.3136  147 GLN A NE2 
905  N  N   . LEU A 137 ? 1.5982 1.7372 1.7922 -0.0636 0.1021  0.3418  148 LEU A N   
906  C  CA  . LEU A 137 ? 1.5991 1.7414 1.7849 -0.0631 0.1001  0.3440  148 LEU A CA  
907  C  C   . LEU A 137 ? 1.6269 1.7770 1.7995 -0.0620 0.1046  0.3461  148 LEU A C   
908  O  O   . LEU A 137 ? 1.6244 1.7775 1.7881 -0.0615 0.1027  0.3469  148 LEU A O   
909  C  CB  . LEU A 137 ? 1.6263 1.7683 1.8232 -0.0628 0.0986  0.3520  148 LEU A CB  
910  C  CG  . LEU A 137 ? 1.5963 1.7308 1.8024 -0.0638 0.0926  0.3501  148 LEU A CG  
911  C  CD1 . LEU A 137 ? 1.6066 1.7358 1.8273 -0.0644 0.0924  0.3507  148 LEU A CD1 
912  C  CD2 . LEU A 137 ? 1.6137 1.7501 1.8238 -0.0632 0.0906  0.3569  148 LEU A CD2 
913  N  N   . ILE A 138 ? 1.6573 1.8105 1.8289 -0.0617 0.1105  0.3470  149 ILE A N   
914  C  CA  . ILE A 138 ? 1.6861 1.8460 1.8444 -0.0608 0.1154  0.3488  149 ILE A CA  
915  C  C   . ILE A 138 ? 1.6495 1.8097 1.7944 -0.0611 0.1148  0.3399  149 ILE A C   
916  O  O   . ILE A 138 ? 1.6527 1.8168 1.7838 -0.0606 0.1147  0.3390  149 ILE A O   
917  C  CB  . ILE A 138 ? 1.7341 1.8970 1.8977 -0.0603 0.1230  0.3543  149 ILE A CB  
918  C  CG1 . ILE A 138 ? 1.7755 1.9383 1.9521 -0.0599 0.1237  0.3637  149 ILE A CG1 
919  C  CG2 . ILE A 138 ? 1.7636 1.9323 1.9114 -0.0595 0.1286  0.3552  149 ILE A CG2 
920  C  CD1 . ILE A 138 ? 1.7919 1.9568 1.9637 -0.0593 0.1205  0.3693  149 ILE A CD1 
921  N  N   . LYS A 139 ? 1.6169 1.7726 1.7662 -0.0619 0.1142  0.3333  150 LYS A N   
922  C  CA  . LYS A 139 ? 1.5777 1.7321 1.7162 -0.0625 0.1125  0.3240  150 LYS A CA  
923  C  C   . LYS A 139 ? 1.5452 1.6977 1.6783 -0.0628 0.1065  0.3213  150 LYS A C   
924  O  O   . LYS A 139 ? 1.5378 1.6939 1.6581 -0.0625 0.1060  0.3186  150 LYS A O   
925  C  CB  . LYS A 139 ? 1.5493 1.6975 1.6959 -0.0634 0.1114  0.3182  150 LYS A CB  
926  C  CG  . LYS A 139 ? 1.5779 1.7280 1.7302 -0.0632 0.1175  0.3194  150 LYS A CG  
927  C  CD  . LYS A 139 ? 1.5611 1.7040 1.7269 -0.0640 0.1150  0.3165  150 LYS A CD  
928  C  CE  . LYS A 139 ? 1.5959 1.7408 1.7725 -0.0637 0.1208  0.3196  150 LYS A CE  
929  N  NZ  . LYS A 139 ? 1.5972 1.7460 1.7650 -0.0634 0.1262  0.3154  150 LYS A NZ  
930  N  N   . SER A 140 ? 1.5300 1.6770 1.6736 -0.0634 0.1020  0.3222  151 SER A N   
931  C  CA  . SER A 140 ? 1.4992 1.6433 1.6404 -0.0639 0.0965  0.3197  151 SER A CA  
932  C  C   . SER A 140 ? 1.5200 1.6703 1.6532 -0.0630 0.0960  0.3236  151 SER A C   
933  O  O   . SER A 140 ? 1.4957 1.6457 1.6217 -0.0632 0.0927  0.3191  151 SER A O   
934  C  CB  . SER A 140 ? 1.4903 1.6281 1.6453 -0.0646 0.0928  0.3223  151 SER A CB  
935  O  OG  . SER A 140 ? 1.4639 1.5992 1.6174 -0.0650 0.0882  0.3207  151 SER A OG  
936  N  N   . ASP A 141 ? 1.5675 1.7228 1.7024 -0.0619 0.0991  0.3321  152 ASP A N   
937  C  CA  . ASP A 141 ? 1.5954 1.7561 1.7228 -0.0609 0.0982  0.3366  152 ASP A CA  
938  C  C   . ASP A 141 ? 1.6024 1.7680 1.7137 -0.0604 0.1003  0.3330  152 ASP A C   
939  O  O   . ASP A 141 ? 1.6124 1.7812 1.7151 -0.0598 0.0977  0.3333  152 ASP A O   
940  C  CB  . ASP A 141 ? 1.6488 1.8125 1.7825 -0.0600 0.1009  0.3472  152 ASP A CB  
941  C  CG  . ASP A 141 ? 1.6496 1.8109 1.7941 -0.0600 0.0964  0.3518  152 ASP A CG  
942  O  OD1 . ASP A 141 ? 1.6089 1.7660 1.7561 -0.0608 0.0914  0.3468  152 ASP A OD1 
943  O  OD2 . ASP A 141 ? 1.6935 1.8569 1.8438 -0.0592 0.0981  0.3606  152 ASP A OD2 
944  N  N   . GLU A 142 ? 1.5991 1.7650 1.7066 -0.0606 0.1047  0.3293  153 GLU A N   
945  C  CA  . GLU A 142 ? 1.6031 1.7729 1.6954 -0.0603 0.1067  0.3248  153 GLU A CA  
946  C  C   . GLU A 142 ? 1.5503 1.7169 1.6382 -0.0612 0.1030  0.3148  153 GLU A C   
947  O  O   . GLU A 142 ? 1.5470 1.7165 1.6232 -0.0610 0.1016  0.3109  153 GLU A O   
948  C  CB  . GLU A 142 ? 1.6259 1.7977 1.7160 -0.0601 0.1136  0.3251  153 GLU A CB  
949  C  CG  . GLU A 142 ? 1.6224 1.7991 1.6956 -0.0596 0.1164  0.3229  153 GLU A CG  
950  C  CD  . GLU A 142 ? 1.6477 1.8242 1.7183 -0.0600 0.1215  0.3175  153 GLU A CD  
951  O  OE1 . GLU A 142 ? 1.6380 1.8107 1.7205 -0.0606 0.1227  0.3159  153 GLU A OE1 
952  O  OE2 . GLU A 142 ? 1.6790 1.8591 1.7360 -0.0597 0.1242  0.3148  153 GLU A OE2 
953  N  N   . MSE A 143 ? 1.5116 1.6719 1.6087 -0.0623 0.1014  0.3107  154 MSE A N   
954  C  CA  . MSE A 143 ? 1.4624 1.6183 1.5561 -0.0633 0.0979  0.3016  154 MSE A CA  
955  C  C   . MSE A 143 ? 1.4537 1.6104 1.5442 -0.0632 0.0932  0.3013  154 MSE A C   
956  O  O   . MSE A 143 ? 1.4437 1.6028 1.5238 -0.0632 0.0922  0.2964  154 MSE A O   
957  C  CB  . MSE A 143 ? 1.4290 1.5766 1.5335 -0.0646 0.0960  0.2985  154 MSE A CB  
958  C  CG  . MSE A 143 ? 1.4345 1.5803 1.5437 -0.0648 0.0997  0.2975  154 MSE A CG  
959  SE SE  . MSE A 143 ? 1.4391 1.5894 1.5352 -0.0645 0.1048  0.2913  154 MSE A SE  
960  C  CE  . MSE A 143 ? 1.5081 1.6671 1.6029 -0.0630 0.1115  0.3010  154 MSE A CE  
961  N  N   . GLN A 144 ? 1.4611 1.6160 1.5612 -0.0632 0.0905  0.3067  155 GLN A N   
962  C  CA  . GLN A 144 ? 1.4565 1.6121 1.5562 -0.0631 0.0860  0.3071  155 GLN A CA  
963  C  C   . GLN A 144 ? 1.4809 1.6434 1.5680 -0.0621 0.0860  0.3071  155 GLN A C   
964  O  O   . GLN A 144 ? 1.4643 1.6272 1.5474 -0.0622 0.0824  0.3030  155 GLN A O   
965  C  CB  . GLN A 144 ? 1.4791 1.6343 1.5899 -0.0626 0.0845  0.3154  155 GLN A CB  
966  C  CG  . GLN A 144 ? 1.4615 1.6143 1.5768 -0.0630 0.0795  0.3145  155 GLN A CG  
967  C  CD  . GLN A 144 ? 1.4263 1.5704 1.5513 -0.0644 0.0776  0.3109  155 GLN A CD  
968  O  OE1 . GLN A 144 ? 1.4298 1.5703 1.5629 -0.0648 0.0790  0.3134  155 GLN A OE1 
969  N  NE2 . GLN A 144 ? 1.3949 1.5352 1.5193 -0.0654 0.0745  0.3049  155 GLN A NE2 
970  N  N   . ARG A 145 ? 1.5227 1.6902 1.6038 -0.0611 0.0900  0.3117  156 ARG A N   
971  C  CA  . ARG A 145 ? 1.5543 1.7280 1.6225 -0.0601 0.0902  0.3128  156 ARG A CA  
972  C  C   . ARG A 145 ? 1.5321 1.7065 1.5892 -0.0605 0.0914  0.3040  156 ARG A C   
973  O  O   . ARG A 145 ? 1.5344 1.7118 1.5819 -0.0602 0.0890  0.3010  156 ARG A O   
974  C  CB  . ARG A 145 ? 1.6109 1.7887 1.6762 -0.0590 0.0947  0.3214  156 ARG A CB  
975  C  CG  . ARG A 145 ? 1.6516 1.8349 1.7025 -0.0580 0.0946  0.3237  156 ARG A CG  
976  C  CD  . ARG A 145 ? 1.6997 1.8857 1.7445 -0.0573 0.1011  0.3296  156 ARG A CD  
977  N  NE  . ARG A 145 ? 1.7418 1.9320 1.7698 -0.0565 0.1012  0.3301  156 ARG A NE  
978  C  CZ  . ARG A 145 ? 1.7876 1.9801 1.8101 -0.0556 0.0982  0.3365  156 ARG A CZ  
979  N  NH1 . ARG A 145 ? 1.7960 1.9875 1.8290 -0.0553 0.0951  0.3432  156 ARG A NH1 
980  N  NH2 . ARG A 145 ? 1.8267 2.0222 1.8329 -0.0550 0.0981  0.3363  156 ARG A NH2 
981  N  N   . LEU A 146 ? 1.5123 1.6837 1.5713 -0.0612 0.0949  0.2998  157 LEU A N   
982  C  CA  . LEU A 146 ? 1.4931 1.6649 1.5424 -0.0617 0.0967  0.2916  157 LEU A CA  
983  C  C   . LEU A 146 ? 1.4470 1.6157 1.4944 -0.0626 0.0925  0.2829  157 LEU A C   
984  O  O   . LEU A 146 ? 1.4440 1.6152 1.4810 -0.0626 0.0924  0.2773  157 LEU A O   
985  C  CB  . LEU A 146 ? 1.4852 1.6543 1.5389 -0.0622 0.1013  0.2899  157 LEU A CB  
986  C  CG  . LEU A 146 ? 1.5281 1.7018 1.5764 -0.0614 0.1075  0.2935  157 LEU A CG  
987  C  CD1 . LEU A 146 ? 1.5160 1.6861 1.5719 -0.0620 0.1112  0.2914  157 LEU A CD1 
988  C  CD2 . LEU A 146 ? 1.5377 1.7156 1.5703 -0.0611 0.1086  0.2889  157 LEU A CD2 
989  N  N   . ARG A 147 ? 1.4134 1.5762 1.4708 -0.0635 0.0894  0.2817  158 ARG A N   
990  C  CA  . ARG A 147 ? 1.3720 1.5309 1.4282 -0.0646 0.0861  0.2736  158 ARG A CA  
991  C  C   . ARG A 147 ? 1.3841 1.5476 1.4347 -0.0640 0.0826  0.2733  158 ARG A C   
992  O  O   . ARG A 147 ? 1.3670 1.5307 1.4110 -0.0644 0.0814  0.2661  158 ARG A O   
993  C  CB  . ARG A 147 ? 1.3391 1.4899 1.4065 -0.0658 0.0838  0.2726  158 ARG A CB  
994  C  CG  . ARG A 147 ? 1.3464 1.4966 1.4209 -0.0657 0.0799  0.2763  158 ARG A CG  
995  C  CD  . ARG A 147 ? 1.3174 1.4588 1.4022 -0.0670 0.0784  0.2752  158 ARG A CD  
996  N  NE  . ARG A 147 ? 1.2792 1.4146 1.3627 -0.0684 0.0764  0.2670  158 ARG A NE  
997  C  CZ  . ARG A 147 ? 1.2498 1.3758 1.3385 -0.0700 0.0756  0.2634  158 ARG A CZ  
998  N  NH1 . ARG A 147 ? 1.2530 1.3745 1.3489 -0.0702 0.0761  0.2672  158 ARG A NH1 
999  N  NH2 . ARG A 147 ? 1.2194 1.3399 1.3058 -0.0713 0.0744  0.2560  158 ARG A NH2 
1000 N  N   . SER A 148 ? 1.4162 1.5833 1.4698 -0.0629 0.0809  0.2812  159 SER A N   
1001 C  CA  . SER A 148 ? 1.4378 1.6095 1.4867 -0.0621 0.0771  0.2821  159 SER A CA  
1002 C  C   . SER A 148 ? 1.4557 1.6326 1.4905 -0.0615 0.0783  0.2788  159 SER A C   
1003 O  O   . SER A 148 ? 1.4447 1.6229 1.4745 -0.0617 0.0753  0.2732  159 SER A O   
1004 C  CB  . SER A 148 ? 1.4809 1.6558 1.5342 -0.0609 0.0758  0.2923  159 SER A CB  
1005 O  OG  . SER A 148 ? 1.4683 1.6384 1.5346 -0.0614 0.0757  0.2960  159 SER A OG  
1006 N  N   . GLN A 149 ? 1.4846 1.6640 1.5134 -0.0610 0.0829  0.2821  160 GLN A N   
1007 C  CA  . GLN A 149 ? 1.5065 1.6903 1.5213 -0.0604 0.0848  0.2794  160 GLN A CA  
1008 C  C   . GLN A 149 ? 1.4662 1.6479 1.4769 -0.0615 0.0854  0.2690  160 GLN A C   
1009 O  O   . GLN A 149 ? 1.4731 1.6580 1.4736 -0.0612 0.0842  0.2645  160 GLN A O   
1010 C  CB  . GLN A 149 ? 1.5408 1.7264 1.5517 -0.0599 0.0908  0.2844  160 GLN A CB  
1011 C  CG  . GLN A 149 ? 1.5904 1.7785 1.6025 -0.0588 0.0913  0.2950  160 GLN A CG  
1012 C  CD  . GLN A 149 ? 1.6126 1.8007 1.6256 -0.0587 0.0980  0.2995  160 GLN A CD  
1013 O  OE1 . GLN A 149 ? 1.6022 1.7870 1.6274 -0.0591 0.0997  0.3020  160 GLN A OE1 
1014 N  NE2 . GLN A 149 ? 1.6442 1.8357 1.6445 -0.0582 0.1022  0.3001  160 GLN A NE2 
1015 N  N   . ALA A 150 ? 1.4269 1.6030 1.4454 -0.0626 0.0870  0.2653  161 ALA A N   
1016 C  CA  . ALA A 150 ? 1.3865 1.5593 1.4022 -0.0637 0.0875  0.2555  161 ALA A CA  
1017 C  C   . ALA A 150 ? 1.3617 1.5331 1.3779 -0.0643 0.0829  0.2499  161 ALA A C   
1018 O  O   . ALA A 150 ? 1.3573 1.5309 1.3652 -0.0644 0.0822  0.2437  161 ALA A O   
1019 C  CB  . ALA A 150 ? 1.3543 1.5203 1.3784 -0.0648 0.0897  0.2538  161 ALA A CB  
1020 N  N   . LEU A 151 ? 1.3479 1.5156 1.3743 -0.0648 0.0799  0.2520  162 LEU A N   
1021 C  CA  . LEU A 151 ? 1.3281 1.4942 1.3573 -0.0654 0.0758  0.2475  162 LEU A CA  
1022 C  C   . LEU A 151 ? 1.3592 1.5322 1.3818 -0.0642 0.0725  0.2482  162 LEU A C   
1023 O  O   . LEU A 151 ? 1.3448 1.5179 1.3661 -0.0647 0.0700  0.2420  162 LEU A O   
1024 C  CB  . LEU A 151 ? 1.3168 1.4783 1.3585 -0.0658 0.0736  0.2513  162 LEU A CB  
1025 C  CG  . LEU A 151 ? 1.2736 1.4258 1.3219 -0.0675 0.0748  0.2468  162 LEU A CG  
1026 C  CD1 . LEU A 151 ? 1.2667 1.4161 1.3139 -0.0678 0.0786  0.2472  162 LEU A CD1 
1027 C  CD2 . LEU A 151 ? 1.2687 1.4165 1.3286 -0.0679 0.0725  0.2507  162 LEU A CD2 
1028 N  N   . ASN A 152 ? 1.4046 1.5829 1.4229 -0.0628 0.0726  0.2558  163 ASN A N   
1029 C  CA  . ASN A 152 ? 1.4420 1.6265 1.4518 -0.0617 0.0694  0.2569  163 ASN A CA  
1030 C  C   . ASN A 152 ? 1.4359 1.6224 1.4344 -0.0620 0.0705  0.2489  163 ASN A C   
1031 O  O   . ASN A 152 ? 1.4292 1.6169 1.4262 -0.0621 0.0668  0.2435  163 ASN A O   
1032 C  CB  . ASN A 152 ? 1.4952 1.6840 1.5002 -0.0603 0.0703  0.2666  163 ASN A CB  
1033 C  CG  . ASN A 152 ? 1.5398 1.7338 1.5359 -0.0591 0.0659  0.2685  163 ASN A CG  
1034 O  OD1 . ASN A 152 ? 1.5497 1.7468 1.5328 -0.0588 0.0669  0.2658  163 ASN A OD1 
1035 N  ND2 . ASN A 152 ? 1.5695 1.7642 1.5728 -0.0585 0.0607  0.2732  163 ASN A ND2 
1036 N  N   . ALA A 153 ? 1.4393 1.6260 1.4308 -0.0620 0.0756  0.2481  164 ALA A N   
1037 C  CA  . ALA A 153 ? 1.4434 1.6327 1.4229 -0.0620 0.0772  0.2416  164 ALA A CA  
1038 C  C   . ALA A 153 ? 1.4000 1.5861 1.3818 -0.0633 0.0759  0.2318  164 ALA A C   
1039 O  O   . ALA A 153 ? 1.4056 1.5943 1.3800 -0.0633 0.0742  0.2260  164 ALA A O   
1040 C  CB  . ALA A 153 ? 1.4477 1.6368 1.4222 -0.0620 0.0835  0.2422  164 ALA A CB  
1041 N  N   . PHE A 154 ? 1.3591 1.5391 1.3511 -0.0644 0.0768  0.2301  165 PHE A N   
1042 C  CA  . PHE A 154 ? 1.3160 1.4913 1.3107 -0.0658 0.0764  0.2211  165 PHE A CA  
1043 C  C   . PHE A 154 ? 1.3153 1.4918 1.3128 -0.0659 0.0714  0.2184  165 PHE A C   
1044 O  O   . PHE A 154 ? 1.3128 1.4910 1.3050 -0.0661 0.0703  0.2115  165 PHE A O   
1045 C  CB  . PHE A 154 ? 1.2800 1.4474 1.2841 -0.0670 0.0782  0.2209  165 PHE A CB  
1046 C  CG  . PHE A 154 ? 1.2383 1.3995 1.2440 -0.0687 0.0784  0.2119  165 PHE A CG  
1047 C  CD1 . PHE A 154 ? 1.2216 1.3801 1.2219 -0.0694 0.0818  0.2059  165 PHE A CD1 
1048 C  CD2 . PHE A 154 ? 1.2188 1.3767 1.2313 -0.0695 0.0754  0.2092  165 PHE A CD2 
1049 C  CE1 . PHE A 154 ? 1.1861 1.3383 1.1870 -0.0709 0.0821  0.1977  165 PHE A CE1 
1050 C  CE2 . PHE A 154 ? 1.1841 1.3357 1.1972 -0.0711 0.0762  0.2008  165 PHE A CE2 
1051 C  CZ  . PHE A 154 ? 1.1677 1.3164 1.1747 -0.0718 0.0795  0.1952  165 PHE A CZ  
1052 N  N   . GLY A 155 ? 1.3193 1.4950 1.3262 -0.0656 0.0685  0.2238  166 GLY A N   
1053 C  CA  . GLY A 155 ? 1.3244 1.5013 1.3364 -0.0656 0.0635  0.2219  166 GLY A CA  
1054 C  C   . GLY A 155 ? 1.3554 1.5389 1.3585 -0.0646 0.0603  0.2200  166 GLY A C   
1055 O  O   . GLY A 155 ? 1.3414 1.5250 1.3453 -0.0652 0.0581  0.2130  166 GLY A O   
1056 N  N   . SER A 156 ? 1.3996 1.5884 1.3942 -0.0632 0.0601  0.2261  167 SER A N   
1057 C  CA  . SER A 156 ? 1.4367 1.6314 1.4202 -0.0622 0.0571  0.2250  167 SER A CA  
1058 C  C   . SER A 156 ? 1.4210 1.6159 1.3955 -0.0629 0.0598  0.2160  167 SER A C   
1059 O  O   . SER A 156 ? 1.4433 1.6418 1.4108 -0.0625 0.0565  0.2120  167 SER A O   
1060 C  CB  . SER A 156 ? 1.4889 1.6875 1.4638 -0.0608 0.0574  0.2340  167 SER A CB  
1061 O  OG  . SER A 156 ? 1.4863 1.6834 1.4571 -0.0610 0.0639  0.2358  167 SER A OG  
1062 N  N   . GLY A 157 ? 1.3851 1.5758 1.3600 -0.0639 0.0653  0.2129  168 GLY A N   
1063 C  CA  . GLY A 157 ? 1.3653 1.5553 1.3337 -0.0647 0.0678  0.2040  168 GLY A CA  
1064 C  C   . GLY A 157 ? 1.3769 1.5684 1.3349 -0.0644 0.0728  0.2044  168 GLY A C   
1065 O  O   . GLY A 157 ? 1.3568 1.5476 1.3092 -0.0650 0.0753  0.1972  168 GLY A O   
1066 N  N   . ASP A 158 ? 1.4111 1.6044 1.3665 -0.0634 0.0747  0.2128  169 ASP A N   
1067 C  CA  . ASP A 158 ? 1.4256 1.6200 1.3724 -0.0632 0.0803  0.2133  169 ASP A CA  
1068 C  C   . ASP A 158 ? 1.3873 1.5764 1.3419 -0.0641 0.0848  0.2126  169 ASP A C   
1069 O  O   . ASP A 158 ? 1.3773 1.5639 1.3403 -0.0641 0.0853  0.2187  169 ASP A O   
1070 C  CB  . ASP A 158 ? 1.4782 1.6766 1.4181 -0.0619 0.0810  0.2222  169 ASP A CB  
1071 C  CG  . ASP A 158 ? 1.5057 1.7061 1.4342 -0.0616 0.0868  0.2214  169 ASP A CG  
1072 O  OD1 . ASP A 158 ? 1.4799 1.6779 1.4092 -0.0624 0.0911  0.2160  169 ASP A OD1 
1073 O  OD2 . ASP A 158 ? 1.5561 1.7599 1.4744 -0.0606 0.0870  0.2264  169 ASP A OD2 
1074 N  N   . TYR A 159 ? 1.3682 1.5552 1.3199 -0.0650 0.0879  0.2050  170 TYR A N   
1075 C  CA  . TYR A 159 ? 1.3322 1.5132 1.2909 -0.0660 0.0914  0.2033  170 TYR A CA  
1076 C  C   . TYR A 159 ? 1.3540 1.5360 1.3104 -0.0655 0.0967  0.2074  170 TYR A C   
1077 O  O   . TYR A 159 ? 1.3472 1.5260 1.3119 -0.0656 0.0984  0.2120  170 TYR A O   
1078 C  CB  . TYR A 159 ? 1.2960 1.4734 1.2535 -0.0672 0.0919  0.1932  170 TYR A CB  
1079 C  CG  . TYR A 159 ? 1.2726 1.4483 1.2337 -0.0679 0.0874  0.1884  170 TYR A CG  
1080 C  CD1 . TYR A 159 ? 1.2558 1.4278 1.2267 -0.0683 0.0846  0.1916  170 TYR A CD1 
1081 C  CD2 . TYR A 159 ? 1.2699 1.4474 1.2250 -0.0683 0.0863  0.1806  170 TYR A CD2 
1082 C  CE1 . TYR A 159 ? 1.2373 1.4075 1.2124 -0.0691 0.0811  0.1870  170 TYR A CE1 
1083 C  CE2 . TYR A 159 ? 1.2512 1.4270 1.2106 -0.0690 0.0826  0.1759  170 TYR A CE2 
1084 C  CZ  . TYR A 159 ? 1.2352 1.4072 1.2047 -0.0694 0.0802  0.1791  170 TYR A CZ  
1085 O  OH  . TYR A 159 ? 1.2190 1.3891 1.1939 -0.0703 0.0772  0.1744  170 TYR A OH  
1086 N  N   . THR A 160 ? 1.3826 1.5689 1.3281 -0.0649 0.0995  0.2054  171 THR A N   
1087 C  CA  . THR A 160 ? 1.4104 1.5982 1.3530 -0.0644 0.1054  0.2087  171 THR A CA  
1088 C  C   . THR A 160 ? 1.4396 1.6286 1.3864 -0.0636 0.1061  0.2190  171 THR A C   
1089 O  O   . THR A 160 ? 1.4436 1.6307 1.3966 -0.0636 0.1101  0.2228  171 THR A O   
1090 C  CB  . THR A 160 ? 1.4482 1.6409 1.3768 -0.0639 0.1078  0.2058  171 THR A CB  
1091 O  OG1 . THR A 160 ? 1.4746 1.6710 1.3960 -0.0632 0.1029  0.2072  171 THR A OG1 
1092 C  CG2 . THR A 160 ? 1.4221 1.6132 1.3478 -0.0647 0.1091  0.1958  171 THR A CG2 
1093 N  N   . ALA A 161 ? 1.4616 1.6536 1.4055 -0.0629 0.1019  0.2234  172 ALA A N   
1094 C  CA  . ALA A 161 ? 1.4884 1.6812 1.4368 -0.0621 0.1016  0.2332  172 ALA A CA  
1095 C  C   . ALA A 161 ? 1.4521 1.6397 1.4152 -0.0628 0.1014  0.2354  172 ALA A C   
1096 O  O   . ALA A 161 ? 1.4590 1.6453 1.4278 -0.0627 0.1056  0.2402  172 ALA A O   
1097 C  CB  . ALA A 161 ? 1.5122 1.7079 1.4572 -0.0614 0.0957  0.2365  172 ALA A CB  
1098 N  N   . ALA A 162 ? 1.4153 1.5995 1.3851 -0.0635 0.0968  0.2318  173 ALA A N   
1099 C  CA  . ALA A 162 ? 1.3837 1.5623 1.3666 -0.0642 0.0959  0.2339  173 ALA A CA  
1100 C  C   . ALA A 162 ? 1.3598 1.5338 1.3476 -0.0650 0.0999  0.2313  173 ALA A C   
1101 O  O   . ALA A 162 ? 1.3494 1.5192 1.3474 -0.0653 0.1001  0.2351  173 ALA A O   
1102 C  CB  . ALA A 162 ? 1.3496 1.5249 1.3373 -0.0650 0.0909  0.2295  173 ALA A CB  
1103 N  N   . ILE A 163 ? 1.3535 1.5280 1.3345 -0.0653 0.1029  0.2249  174 ILE A N   
1104 C  CA  . ILE A 163 ? 1.3361 1.5062 1.3217 -0.0659 0.1065  0.2222  174 ILE A CA  
1105 C  C   . ILE A 163 ? 1.3680 1.5396 1.3586 -0.0652 0.1104  0.2299  174 ILE A C   
1106 O  O   . ILE A 163 ? 1.3548 1.5217 1.3561 -0.0656 0.1103  0.2328  174 ILE A O   
1107 C  CB  . ILE A 163 ? 1.3342 1.5054 1.3113 -0.0662 0.1094  0.2144  174 ILE A CB  
1108 C  CG1 . ILE A 163 ? 1.2980 1.4660 1.2728 -0.0672 0.1060  0.2060  174 ILE A CG1 
1109 C  CG2 . ILE A 163 ? 1.3280 1.4960 1.3102 -0.0665 0.1137  0.2132  174 ILE A CG2 
1110 C  CD1 . ILE A 163 ? 1.3021 1.4727 1.2669 -0.0673 0.1080  0.1985  174 ILE A CD1 
1111 N  N   . ALA A 164 ? 1.4129 1.5906 1.3952 -0.0642 0.1137  0.2333  175 ALA A N   
1112 C  CA  . ALA A 164 ? 1.4529 1.6327 1.4380 -0.0635 0.1186  0.2406  175 ALA A CA  
1113 C  C   . ALA A 164 ? 1.4563 1.6345 1.4521 -0.0633 0.1167  0.2488  175 ALA A C   
1114 O  O   . ALA A 164 ? 1.4678 1.6446 1.4720 -0.0632 0.1200  0.2533  175 ALA A O   
1115 C  CB  . ALA A 164 ? 1.5037 1.6896 1.4759 -0.0626 0.1216  0.2429  175 ALA A CB  
1116 N  N   . PHE A 165 ? 1.4481 1.6264 1.4440 -0.0631 0.1114  0.2507  176 PHE A N   
1117 C  CA  . PHE A 165 ? 1.4474 1.6237 1.4540 -0.0630 0.1088  0.2576  176 PHE A CA  
1118 C  C   . PHE A 165 ? 1.4070 1.5762 1.4257 -0.0641 0.1079  0.2553  176 PHE A C   
1119 O  O   . PHE A 165 ? 1.4163 1.5835 1.4447 -0.0640 0.1095  0.2604  176 PHE A O   
1120 C  CB  . PHE A 165 ? 1.4441 1.6216 1.4490 -0.0628 0.1030  0.2587  176 PHE A CB  
1121 C  CG  . PHE A 165 ? 1.4909 1.6746 1.4848 -0.0617 0.1028  0.2627  176 PHE A CG  
1122 C  CD1 . PHE A 165 ? 1.4988 1.6856 1.4802 -0.0615 0.1020  0.2571  176 PHE A CD1 
1123 C  CD2 . PHE A 165 ? 1.5305 1.7165 1.5263 -0.0608 0.1032  0.2723  176 PHE A CD2 
1124 C  CE1 . PHE A 165 ? 1.5462 1.7381 1.5165 -0.0605 0.1013  0.2608  176 PHE A CE1 
1125 C  CE2 . PHE A 165 ? 1.5783 1.7691 1.5627 -0.0598 0.1028  0.2762  176 PHE A CE2 
1126 C  CZ  . PHE A 165 ? 1.5864 1.7800 1.5578 -0.0596 0.1016  0.2704  176 PHE A CZ  
1127 N  N   . LEU A 166 ? 1.3650 1.5301 1.3826 -0.0651 0.1051  0.2473  177 LEU A N   
1128 C  CA  . LEU A 166 ? 1.3262 1.4833 1.3533 -0.0663 0.1032  0.2445  177 LEU A CA  
1129 C  C   . LEU A 166 ? 1.3287 1.4831 1.3608 -0.0665 0.1069  0.2441  177 LEU A C   
1130 O  O   . LEU A 166 ? 1.3172 1.4662 1.3598 -0.0670 0.1058  0.2461  177 LEU A O   
1131 C  CB  . LEU A 166 ? 1.2864 1.4394 1.3094 -0.0674 0.1001  0.2358  177 LEU A CB  
1132 C  CG  . LEU A 166 ? 1.2765 1.4297 1.2989 -0.0675 0.0957  0.2358  177 LEU A CG  
1133 C  CD1 . LEU A 166 ? 1.2494 1.4008 1.2653 -0.0684 0.0940  0.2267  177 LEU A CD1 
1134 C  CD2 . LEU A 166 ? 1.2581 1.4051 1.2916 -0.0681 0.0929  0.2392  177 LEU A CD2 
1135 N  N   . ASP A 167 ? 1.3460 1.5044 1.3712 -0.0661 0.1112  0.2413  178 ASP A N   
1136 C  CA  . ASP A 167 ? 1.3556 1.5126 1.3861 -0.0661 0.1154  0.2412  178 ASP A CA  
1137 C  C   . ASP A 167 ? 1.3781 1.5347 1.4202 -0.0657 0.1166  0.2495  178 ASP A C   
1138 O  O   . ASP A 167 ? 1.3647 1.5157 1.4173 -0.0662 0.1160  0.2494  178 ASP A O   
1139 C  CB  . ASP A 167 ? 1.3871 1.5502 1.4083 -0.0654 0.1208  0.2394  178 ASP A CB  
1140 C  CG  . ASP A 167 ? 1.3637 1.5262 1.3759 -0.0660 0.1202  0.2302  178 ASP A CG  
1141 O  OD1 . ASP A 167 ? 1.3347 1.4914 1.3509 -0.0669 0.1194  0.2248  178 ASP A OD1 
1142 O  OD2 . ASP A 167 ? 1.3764 1.5438 1.3773 -0.0656 0.1204  0.2283  178 ASP A OD2 
1143 N  N   . LYS A 168 ? 1.4143 1.5764 1.4546 -0.0647 0.1180  0.2566  179 LYS A N   
1144 C  CA  . LYS A 168 ? 1.4407 1.6029 1.4916 -0.0642 0.1196  0.2650  179 LYS A CA  
1145 C  C   . LYS A 168 ? 1.4107 1.5669 1.4721 -0.0649 0.1143  0.2668  179 LYS A C   
1146 O  O   . LYS A 168 ? 1.4036 1.5552 1.4766 -0.0653 0.1142  0.2682  179 LYS A O   
1147 C  CB  . LYS A 168 ? 1.4879 1.6568 1.5327 -0.0631 0.1222  0.2722  179 LYS A CB  
1148 C  CG  . LYS A 168 ? 1.5283 1.7023 1.5648 -0.0625 0.1290  0.2721  179 LYS A CG  
1149 C  CD  . LYS A 168 ? 1.5711 1.7508 1.5949 -0.0616 0.1300  0.2763  179 LYS A CD  
1150 C  CE  . LYS A 168 ? 1.6087 1.7924 1.6220 -0.0613 0.1368  0.2750  179 LYS A CE  
1151 N  NZ  . LYS A 168 ? 1.6643 1.8526 1.6649 -0.0604 0.1382  0.2802  179 LYS A NZ  
1152 N  N   . ILE A 169 ? 1.3938 1.5495 1.4515 -0.0651 0.1097  0.2663  180 ILE A N   
1153 C  CA  . ILE A 169 ? 1.3683 1.5180 1.4350 -0.0657 0.1048  0.2677  180 ILE A CA  
1154 C  C   . ILE A 169 ? 1.3352 1.4764 1.4090 -0.0670 0.1030  0.2629  180 ILE A C   
1155 O  O   . ILE A 169 ? 1.3257 1.4612 1.4093 -0.0675 0.1001  0.2654  180 ILE A O   
1156 C  CB  . ILE A 169 ? 1.3473 1.4969 1.4079 -0.0660 0.1004  0.2648  180 ILE A CB  
1157 C  CG1 . ILE A 169 ? 1.3820 1.5399 1.4330 -0.0649 0.1016  0.2678  180 ILE A CG1 
1158 C  CG2 . ILE A 169 ? 1.3316 1.4760 1.4019 -0.0666 0.0962  0.2679  180 ILE A CG2 
1159 C  CD1 . ILE A 169 ? 1.3701 1.5289 1.4154 -0.0650 0.0974  0.2648  180 ILE A CD1 
1160 N  N   . LEU A 170 ? 1.3207 1.4605 1.3891 -0.0674 0.1045  0.2559  181 LEU A N   
1161 C  CA  . LEU A 170 ? 1.2901 1.4211 1.3626 -0.0686 0.1023  0.2504  181 LEU A CA  
1162 C  C   . LEU A 170 ? 1.3076 1.4369 1.3899 -0.0684 0.1047  0.2524  181 LEU A C   
1163 O  O   . LEU A 170 ? 1.2876 1.4090 1.3746 -0.0694 0.1023  0.2485  181 LEU A O   
1164 C  CB  . LEU A 170 ? 1.2673 1.3970 1.3293 -0.0692 0.1022  0.2415  181 LEU A CB  
1165 C  CG  . LEU A 170 ? 1.2394 1.3676 1.2943 -0.0699 0.0987  0.2375  181 LEU A CG  
1166 C  CD1 . LEU A 170 ? 1.2096 1.3332 1.2574 -0.0709 0.0982  0.2283  181 LEU A CD1 
1167 C  CD2 . LEU A 170 ? 1.2244 1.3462 1.2865 -0.0706 0.0945  0.2401  181 LEU A CD2 
1168 N  N   . GLU A 171 ? 1.3481 1.4844 1.4335 -0.0673 0.1093  0.2585  182 GLU A N   
1169 C  CA  . GLU A 171 ? 1.3718 1.5071 1.4688 -0.0671 0.1120  0.2617  182 GLU A CA  
1170 C  C   . GLU A 171 ? 1.3743 1.5053 1.4839 -0.0673 0.1087  0.2675  182 GLU A C   
1171 O  O   . GLU A 171 ? 1.3739 1.4996 1.4946 -0.0677 0.1075  0.2678  182 GLU A O   
1172 C  CB  . GLU A 171 ? 1.4178 1.5617 1.5133 -0.0659 0.1189  0.2662  182 GLU A CB  
1173 C  CG  . GLU A 171 ? 1.4203 1.5689 1.5025 -0.0656 0.1224  0.2609  182 GLU A CG  
1174 C  CD  . GLU A 171 ? 1.4510 1.6022 1.5366 -0.0652 0.1287  0.2603  182 GLU A CD  
1175 O  OE1 . GLU A 171 ? 1.4756 1.6257 1.5745 -0.0651 0.1307  0.2646  182 GLU A OE1 
1176 O  OE2 . GLU A 171 ? 1.4517 1.6061 1.5271 -0.0651 0.1317  0.2552  182 GLU A OE2 
1177 N  N   . VAL A 172 ? 1.3782 1.5113 1.4860 -0.0670 0.1069  0.2718  183 VAL A N   
1178 C  CA  . VAL A 172 ? 1.3846 1.5143 1.5039 -0.0672 0.1040  0.2778  183 VAL A CA  
1179 C  C   . VAL A 172 ? 1.3439 1.4641 1.4638 -0.0685 0.0977  0.2733  183 VAL A C   
1180 O  O   . VAL A 172 ? 1.3409 1.4541 1.4711 -0.0692 0.0947  0.2742  183 VAL A O   
1181 C  CB  . VAL A 172 ? 1.4160 1.5527 1.5341 -0.0661 0.1056  0.2855  183 VAL A CB  
1182 C  CG1 . VAL A 172 ? 1.4261 1.5595 1.5569 -0.0662 0.1029  0.2918  183 VAL A CG1 
1183 C  CG2 . VAL A 172 ? 1.4601 1.6050 1.5754 -0.0650 0.1123  0.2896  183 VAL A CG2 
1184 N  N   . CYS A 173 ? 1.3152 1.4349 1.4243 -0.0689 0.0957  0.2684  184 CYS A N   
1185 C  CA  . CYS A 173 ? 1.2783 1.3885 1.3864 -0.0704 0.0907  0.2633  184 CYS A CA  
1186 C  C   . CYS A 173 ? 1.2517 1.3571 1.3524 -0.0713 0.0903  0.2546  184 CYS A C   
1187 O  O   . CYS A 173 ? 1.2334 1.3396 1.3237 -0.0716 0.0901  0.2493  184 CYS A O   
1188 C  CB  . CYS A 173 ? 1.2673 1.3789 1.3703 -0.0705 0.0886  0.2637  184 CYS A CB  
1189 S  SG  . CYS A 173 ? 1.3066 1.4280 1.4126 -0.0689 0.0905  0.2732  184 CYS A SG  
1190 N  N   . VAL A 174 ? 1.2524 1.3528 1.3592 -0.0716 0.0900  0.2533  185 VAL A N   
1191 C  CA  . VAL A 174 ? 1.2325 1.3276 1.3337 -0.0724 0.0894  0.2456  185 VAL A CA  
1192 C  C   . VAL A 174 ? 1.1969 1.2812 1.2928 -0.0741 0.0848  0.2397  185 VAL A C   
1193 O  O   . VAL A 174 ? 1.1775 1.2574 1.2660 -0.0749 0.0843  0.2328  185 VAL A O   
1194 C  CB  . VAL A 174 ? 1.2491 1.3410 1.3599 -0.0724 0.0897  0.2461  185 VAL A CB  
1195 C  CG1 . VAL A 174 ? 1.2832 1.3851 1.3950 -0.0710 0.0958  0.2481  185 VAL A CG1 
1196 C  CG2 . VAL A 174 ? 1.2584 1.3455 1.3825 -0.0725 0.0867  0.2518  185 VAL A CG2 
1197 N  N   . TRP A 175 ? 1.1909 1.2706 1.2906 -0.0747 0.0816  0.2425  186 TRP A N   
1198 C  CA  . TRP A 175 ? 1.1621 1.2302 1.2572 -0.0764 0.0775  0.2373  186 TRP A CA  
1199 C  C   . TRP A 175 ? 1.1488 1.2182 1.2386 -0.0768 0.0772  0.2367  186 TRP A C   
1200 O  O   . TRP A 175 ? 1.1332 1.1934 1.2227 -0.0781 0.0741  0.2349  186 TRP A O   
1201 C  CB  . TRP A 175 ? 1.1665 1.2246 1.2708 -0.0773 0.0734  0.2397  186 TRP A CB  
1202 C  CG  . TRP A 175 ? 1.1795 1.2350 1.2904 -0.0770 0.0728  0.2399  186 TRP A CG  
1203 C  CD1 . TRP A 175 ? 1.1852 1.2448 1.2939 -0.0764 0.0756  0.2372  186 TRP A CD1 
1204 C  CD2 . TRP A 175 ? 1.1909 1.2386 1.3122 -0.0775 0.0690  0.2426  186 TRP A CD2 
1205 N  NE1 . TRP A 175 ? 1.1998 1.2550 1.3177 -0.0764 0.0738  0.2382  186 TRP A NE1 
1206 C  CE2 . TRP A 175 ? 1.2038 1.2515 1.3296 -0.0771 0.0695  0.2415  186 TRP A CE2 
1207 C  CE3 . TRP A 175 ? 1.1936 1.2341 1.3213 -0.0782 0.0650  0.2457  186 TRP A CE3 
1208 C  CZ2 . TRP A 175 ? 1.2195 1.2605 1.3565 -0.0773 0.0658  0.2435  186 TRP A CZ2 
1209 C  CZ3 . TRP A 175 ? 1.2089 1.2425 1.3469 -0.0785 0.0614  0.2476  186 TRP A CZ3 
1210 C  CH2 . TRP A 175 ? 1.2218 1.2557 1.3646 -0.0780 0.0616  0.2466  186 TRP A CH2 
1211 N  N   . ASP A 176 ? 1.1574 1.2379 1.2431 -0.0756 0.0803  0.2382  187 ASP A N   
1212 C  CA  . ASP A 176 ? 1.1476 1.2307 1.2291 -0.0757 0.0799  0.2376  187 ASP A CA  
1213 C  C   . ASP A 176 ? 1.1244 1.2066 1.1947 -0.0764 0.0806  0.2296  187 ASP A C   
1214 O  O   . ASP A 176 ? 1.1311 1.2220 1.1957 -0.0754 0.0832  0.2284  187 ASP A O   
1215 C  CB  . ASP A 176 ? 1.1749 1.2700 1.2587 -0.0740 0.0819  0.2444  187 ASP A CB  
1216 C  CG  . ASP A 176 ? 1.1702 1.2675 1.2522 -0.0740 0.0806  0.2448  187 ASP A CG  
1217 O  OD1 . ASP A 176 ? 1.1453 1.2376 1.2218 -0.0752 0.0794  0.2384  187 ASP A OD1 
1218 O  OD2 . ASP A 176 ? 1.1936 1.2977 1.2803 -0.0729 0.0808  0.2516  187 ASP A OD2 
1219 N  N   . ALA A 177 ? 1.0994 1.1707 1.1668 -0.0782 0.0784  0.2242  188 ALA A N   
1220 C  CA  . ALA A 177 ? 1.0768 1.1444 1.1343 -0.0792 0.0790  0.2159  188 ALA A CA  
1221 C  C   . ALA A 177 ? 1.0748 1.1502 1.1274 -0.0787 0.0804  0.2141  188 ALA A C   
1222 O  O   . ALA A 177 ? 1.0698 1.1488 1.1150 -0.0786 0.0822  0.2091  188 ALA A O   
1223 C  CB  . ALA A 177 ? 1.0561 1.1090 1.1118 -0.0813 0.0766  0.2114  188 ALA A CB  
1224 N  N   . GLU A 178 ? 1.0808 1.1591 1.1382 -0.0784 0.0794  0.2182  189 GLU A N   
1225 C  CA  . GLU A 178 ? 1.0816 1.1666 1.1359 -0.0780 0.0798  0.2168  189 GLU A CA  
1226 C  C   . GLU A 178 ? 1.1006 1.1979 1.1507 -0.0762 0.0818  0.2184  189 GLU A C   
1227 O  O   . GLU A 178 ? 1.0968 1.1985 1.1408 -0.0761 0.0824  0.2141  189 GLU A O   
1228 C  CB  . GLU A 178 ? 1.0918 1.1780 1.1538 -0.0777 0.0780  0.2220  189 GLU A CB  
1229 C  CG  . GLU A 178 ? 1.0772 1.1512 1.1429 -0.0796 0.0764  0.2202  189 GLU A CG  
1230 C  CD  . GLU A 178 ? 1.0850 1.1524 1.1564 -0.0799 0.0751  0.2242  189 GLU A CD  
1231 O  OE1 . GLU A 178 ? 1.0924 1.1623 1.1637 -0.0791 0.0758  0.2261  189 GLU A OE1 
1232 O  OE2 . GLU A 178 ? 1.0858 1.1452 1.1622 -0.0809 0.0734  0.2254  189 GLU A OE2 
1233 N  N   . LEU A 179 ? 1.1231 1.2255 1.1766 -0.0750 0.0829  0.2243  190 LEU A N   
1234 C  CA  . LEU A 179 ? 1.1467 1.2600 1.1956 -0.0734 0.0852  0.2263  190 LEU A CA  
1235 C  C   . LEU A 179 ? 1.1373 1.2499 1.1790 -0.0737 0.0874  0.2200  190 LEU A C   
1236 O  O   . LEU A 179 ? 1.1415 1.2598 1.1755 -0.0733 0.0887  0.2164  190 LEU A O   
1237 C  CB  . LEU A 179 ? 1.1793 1.2983 1.2343 -0.0720 0.0863  0.2353  190 LEU A CB  
1238 C  CG  . LEU A 179 ? 1.1914 1.3101 1.2551 -0.0718 0.0840  0.2420  190 LEU A CG  
1239 C  CD1 . LEU A 179 ? 1.2206 1.3425 1.2911 -0.0707 0.0855  0.2499  190 LEU A CD1 
1240 C  CD2 . LEU A 179 ? 1.2033 1.3285 1.2647 -0.0710 0.0826  0.2435  190 LEU A CD2 
1241 N  N   . ARG A 180 ? 1.1261 1.2313 1.1704 -0.0745 0.0876  0.2185  191 ARG A N   
1242 C  CA  . ARG A 180 ? 1.1173 1.2207 1.1557 -0.0749 0.0894  0.2123  191 ARG A CA  
1243 C  C   . ARG A 180 ? 1.0965 1.1989 1.1263 -0.0757 0.0892  0.2047  191 ARG A C   
1244 O  O   . ARG A 180 ? 1.1003 1.2086 1.1234 -0.0752 0.0913  0.2012  191 ARG A O   
1245 C  CB  . ARG A 180 ? 1.1046 1.1972 1.1471 -0.0760 0.0880  0.2107  191 ARG A CB  
1246 C  CG  . ARG A 180 ? 1.1233 1.2157 1.1757 -0.0754 0.0876  0.2179  191 ARG A CG  
1247 C  CD  . ARG A 180 ? 1.1173 1.2014 1.1728 -0.0761 0.0868  0.2157  191 ARG A CD  
1248 N  NE  . ARG A 180 ? 1.1271 1.2157 1.1791 -0.0755 0.0899  0.2127  191 ARG A NE  
1249 C  CZ  . ARG A 180 ? 1.1464 1.2365 1.2048 -0.0748 0.0914  0.2153  191 ARG A CZ  
1250 N  NH1 . ARG A 180 ? 1.1581 1.2456 1.2271 -0.0746 0.0899  0.2210  191 ARG A NH1 
1251 N  NH2 . ARG A 180 ? 1.1558 1.2499 1.2107 -0.0743 0.0945  0.2120  191 ARG A NH2 
1252 N  N   . GLU A 181 ? 1.0769 1.1719 1.1074 -0.0770 0.0869  0.2021  192 GLU A N   
1253 C  CA  . GLU A 181 ? 1.0581 1.1513 1.0821 -0.0780 0.0869  0.1949  192 GLU A CA  
1254 C  C   . GLU A 181 ? 1.0740 1.1787 1.0941 -0.0767 0.0877  0.1951  192 GLU A C   
1255 O  O   . GLU A 181 ? 1.0689 1.1760 1.0821 -0.0768 0.0889  0.1892  192 GLU A O   
1256 C  CB  . GLU A 181 ? 1.0417 1.1267 1.0690 -0.0794 0.0848  0.1940  192 GLU A CB  
1257 C  CG  . GLU A 181 ? 1.0225 1.0935 1.0488 -0.0813 0.0840  0.1899  192 GLU A CG  
1258 C  CD  . GLU A 181 ? 1.0112 1.0736 1.0404 -0.0828 0.0825  0.1892  192 GLU A CD  
1259 O  OE1 . GLU A 181 ? 1.0130 1.0809 1.0448 -0.0824 0.0823  0.1905  192 GLU A OE1 
1260 O  OE2 . GLU A 181 ? 1.0032 1.0531 1.0320 -0.0843 0.0815  0.1875  192 GLU A OE2 
1261 N  N   . LEU A 182 ? 1.0957 1.2072 1.1202 -0.0755 0.0868  0.2021  193 LEU A N   
1262 C  CA  . LEU A 182 ? 1.1169 1.2387 1.1376 -0.0742 0.0868  0.2032  193 LEU A CA  
1263 C  C   . LEU A 182 ? 1.1331 1.2614 1.1470 -0.0732 0.0896  0.2022  193 LEU A C   
1264 O  O   . LEU A 182 ? 1.1393 1.2729 1.1462 -0.0729 0.0899  0.1982  193 LEU A O   
1265 C  CB  . LEU A 182 ? 1.1415 1.2685 1.1683 -0.0730 0.0852  0.2118  193 LEU A CB  
1266 C  CG  . LEU A 182 ? 1.1711 1.3085 1.1941 -0.0715 0.0845  0.2145  193 LEU A CG  
1267 C  CD1 . LEU A 182 ? 1.1594 1.2971 1.1800 -0.0721 0.0824  0.2085  193 LEU A CD1 
1268 C  CD2 . LEU A 182 ? 1.1935 1.3345 1.2229 -0.0705 0.0830  0.2237  193 LEU A CD2 
1269 N  N   . ARG A 183 ? 1.1416 1.2691 1.1578 -0.0728 0.0916  0.2055  194 ARG A N   
1270 C  CA  . ARG A 183 ? 1.1606 1.2941 1.1712 -0.0719 0.0949  0.2048  194 ARG A CA  
1271 C  C   . ARG A 183 ? 1.1396 1.2699 1.1439 -0.0729 0.0959  0.1959  194 ARG A C   
1272 O  O   . ARG A 183 ? 1.1506 1.2868 1.1474 -0.0723 0.0975  0.1926  194 ARG A O   
1273 C  CB  . ARG A 183 ? 1.1754 1.3085 1.1915 -0.0714 0.0972  0.2099  194 ARG A CB  
1274 C  CG  . ARG A 183 ? 1.2004 1.3400 1.2109 -0.0705 0.1014  0.2092  194 ARG A CG  
1275 C  CD  . ARG A 183 ? 1.2264 1.3677 1.2433 -0.0697 0.1042  0.2155  194 ARG A CD  
1276 N  NE  . ARG A 183 ? 1.2082 1.3412 1.2325 -0.0706 0.1037  0.2140  194 ARG A NE  
1277 C  CZ  . ARG A 183 ? 1.2267 1.3595 1.2575 -0.0701 0.1063  0.2172  194 ARG A CZ  
1278 N  NH1 . ARG A 183 ? 1.2648 1.4052 1.2955 -0.0689 0.1104  0.2221  194 ARG A NH1 
1279 N  NH2 . ARG A 183 ? 1.2095 1.3340 1.2469 -0.0710 0.1047  0.2153  194 ARG A NH2 
1280 N  N   . ALA A 184 ? 1.1116 1.2318 1.1185 -0.0743 0.0949  0.1920  195 ALA A N   
1281 C  CA  . ALA A 184 ? 1.0903 1.2058 1.0916 -0.0754 0.0956  0.1835  195 ALA A CA  
1282 C  C   . ALA A 184 ? 1.0867 1.2062 1.0818 -0.0755 0.0951  0.1787  195 ALA A C   
1283 O  O   . ALA A 184 ? 1.0885 1.2110 1.0771 -0.0755 0.0967  0.1733  195 ALA A O   
1284 C  CB  . ALA A 184 ? 1.0633 1.1663 1.0676 -0.0771 0.0939  0.1807  195 ALA A CB  
1285 N  N   . GLU A 185 ? 1.0839 1.2038 1.0819 -0.0757 0.0926  0.1806  196 GLU A N   
1286 C  CA  . GLU A 185 ? 1.0831 1.2069 1.0771 -0.0758 0.0916  0.1762  196 GLU A CA  
1287 C  C   . GLU A 185 ? 1.1123 1.2472 1.1002 -0.0742 0.0925  0.1772  196 GLU A C   
1288 O  O   . GLU A 185 ? 1.1118 1.2495 1.0937 -0.0743 0.0928  0.1712  196 GLU A O   
1289 C  CB  . GLU A 185 ? 1.0799 1.2022 1.0798 -0.0761 0.0888  0.1786  196 GLU A CB  
1290 C  CG  . GLU A 185 ? 1.0766 1.2015 1.0743 -0.0764 0.0875  0.1732  196 GLU A CG  
1291 C  CD  . GLU A 185 ? 1.0474 1.1635 1.0431 -0.0784 0.0885  0.1645  196 GLU A CD  
1292 O  OE1 . GLU A 185 ? 1.0293 1.1362 1.0248 -0.0795 0.0899  0.1627  196 GLU A OE1 
1293 O  OE2 . GLU A 185 ? 1.0451 1.1631 1.0396 -0.0787 0.0878  0.1594  196 GLU A OE2 
1294 N  N   . CYS A 186 ? 1.1400 1.2807 1.1291 -0.0728 0.0930  0.1847  197 CYS A N   
1295 C  CA  . CYS A 186 ? 1.1730 1.3231 1.1549 -0.0714 0.0944  0.1861  197 CYS A CA  
1296 C  C   . CYS A 186 ? 1.1704 1.3208 1.1456 -0.0716 0.0976  0.1796  197 CYS A C   
1297 O  O   . CYS A 186 ? 1.1778 1.3321 1.1460 -0.0715 0.0974  0.1745  197 CYS A O   
1298 C  CB  . CYS A 186 ? 1.2039 1.3583 1.1882 -0.0701 0.0957  0.1951  197 CYS A CB  
1299 S  SG  . CYS A 186 ? 1.2137 1.3693 1.2049 -0.0696 0.0919  0.2027  197 CYS A SG  
1300 N  N   . PHE A 187 ? 1.1612 1.3070 1.1390 -0.0720 0.1001  0.1796  198 PHE A N   
1301 C  CA  . PHE A 187 ? 1.1595 1.3048 1.1322 -0.0723 0.1031  0.1735  198 PHE A CA  
1302 C  C   . PHE A 187 ? 1.1398 1.2832 1.1074 -0.0733 0.1021  0.1647  198 PHE A C   
1303 O  O   . PHE A 187 ? 1.1532 1.3015 1.1136 -0.0729 0.1036  0.1604  198 PHE A O   
1304 C  CB  . PHE A 187 ? 1.1450 1.2829 1.1234 -0.0730 0.1046  0.1734  198 PHE A CB  
1305 C  CG  . PHE A 187 ? 1.1710 1.3115 1.1542 -0.0719 0.1068  0.1807  198 PHE A CG  
1306 C  CD1 . PHE A 187 ? 1.2084 1.3579 1.1878 -0.0705 0.1092  0.1852  198 PHE A CD1 
1307 C  CD2 . PHE A 187 ? 1.1611 1.2946 1.1527 -0.0724 0.1066  0.1830  198 PHE A CD2 
1308 C  CE1 . PHE A 187 ? 1.2351 1.3868 1.2195 -0.0697 0.1119  0.1919  198 PHE A CE1 
1309 C  CE2 . PHE A 187 ? 1.1871 1.3232 1.1846 -0.0715 0.1088  0.1896  198 PHE A CE2 
1310 C  CZ  . PHE A 187 ? 1.2241 1.3694 1.2181 -0.0701 0.1118  0.1941  198 PHE A CZ  
1311 N  N   . ILE A 188 ? 1.1106 1.2467 1.0819 -0.0746 0.0997  0.1620  199 ILE A N   
1312 C  CA  . ILE A 188 ? 1.0919 1.2249 1.0592 -0.0757 0.0995  0.1533  199 ILE A CA  
1313 C  C   . ILE A 188 ? 1.1065 1.2470 1.0698 -0.0751 0.0978  0.1516  199 ILE A C   
1314 O  O   . ILE A 188 ? 1.1062 1.2485 1.0641 -0.0754 0.0984  0.1449  199 ILE A O   
1315 C  CB  . ILE A 188 ? 1.0584 1.1801 1.0298 -0.0775 0.0982  0.1500  199 ILE A CB  
1316 C  CG1 . ILE A 188 ? 1.0532 1.1733 1.0306 -0.0777 0.0955  0.1544  199 ILE A CG1 
1317 C  CG2 . ILE A 188 ? 1.0475 1.1611 1.0213 -0.0782 0.0994  0.1507  199 ILE A CG2 
1318 C  CD1 . ILE A 188 ? 1.0264 1.1342 1.0080 -0.0794 0.0948  0.1532  199 ILE A CD1 
1319 N  N   . LYS A 189 ? 1.1219 1.2669 1.0882 -0.0743 0.0954  0.1578  200 LYS A N   
1320 C  CA  . LYS A 189 ? 1.1421 1.2945 1.1051 -0.0735 0.0929  0.1571  200 LYS A CA  
1321 C  C   . LYS A 189 ? 1.1729 1.3329 1.1270 -0.0723 0.0947  0.1567  200 LYS A C   
1322 O  O   . LYS A 189 ? 1.1895 1.3543 1.1381 -0.0720 0.0934  0.1526  200 LYS A O   
1323 C  CB  . LYS A 189 ? 1.1576 1.3130 1.1256 -0.0726 0.0898  0.1648  200 LYS A CB  
1324 C  CG  . LYS A 189 ? 1.1343 1.2838 1.1105 -0.0737 0.0874  0.1642  200 LYS A CG  
1325 C  CD  . LYS A 189 ? 1.1336 1.2853 1.1096 -0.0741 0.0849  0.1584  200 LYS A CD  
1326 C  CE  . LYS A 189 ? 1.1125 1.2582 1.0977 -0.0752 0.0830  0.1581  200 LYS A CE  
1327 N  NZ  . LYS A 189 ? 1.0958 1.2387 1.0815 -0.0765 0.0829  0.1494  200 LYS A NZ  
1328 N  N   . GLU A 190 ? 1.1826 1.3432 1.1357 -0.0717 0.0979  0.1606  201 GLU A N   
1329 C  CA  . GLU A 190 ? 1.2146 1.3816 1.1592 -0.0707 0.1006  0.1603  201 GLU A CA  
1330 C  C   . GLU A 190 ? 1.2006 1.3649 1.1417 -0.0715 0.1036  0.1522  201 GLU A C   
1331 O  O   . GLU A 190 ? 1.2244 1.3930 1.1587 -0.0709 0.1065  0.1506  201 GLU A O   
1332 C  CB  . GLU A 190 ? 1.2399 1.4092 1.1856 -0.0697 0.1033  0.1684  201 GLU A CB  
1333 C  CG  . GLU A 190 ? 1.2862 1.4633 1.2222 -0.0684 0.1054  0.1707  201 GLU A CG  
1334 C  CD  . GLU A 190 ? 1.3138 1.4965 1.2449 -0.0676 0.1012  0.1730  201 GLU A CD  
1335 O  OE1 . GLU A 190 ? 1.3228 1.5062 1.2581 -0.0671 0.0988  0.1802  201 GLU A OE1 
1336 O  OE2 . GLU A 190 ? 1.3292 1.5153 1.2521 -0.0675 0.1001  0.1677  201 GLU A OE2 
1337 N  N   . GLY A 191 ? 1.1644 1.3211 1.1096 -0.0730 0.1029  0.1470  202 GLY A N   
1338 C  CA  . GLY A 191 ? 1.1509 1.3044 1.0930 -0.0738 0.1052  0.1390  202 GLY A CA  
1339 C  C   . GLY A 191 ? 1.1536 1.3045 1.0968 -0.0737 0.1090  0.1400  202 GLY A C   
1340 O  O   . GLY A 191 ? 1.1594 1.3105 1.0985 -0.0739 0.1116  0.1346  202 GLY A O   
1341 N  N   . GLU A 192 ? 1.1509 1.2995 1.1005 -0.0735 0.1091  0.1468  203 GLU A N   
1342 C  CA  . GLU A 192 ? 1.1522 1.2974 1.1053 -0.0734 0.1121  0.1480  203 GLU A CA  
1343 C  C   . GLU A 192 ? 1.1207 1.2558 1.0815 -0.0746 0.1100  0.1488  203 GLU A C   
1344 O  O   . GLU A 192 ? 1.1232 1.2563 1.0905 -0.0743 0.1096  0.1552  203 GLU A O   
1345 C  CB  . GLU A 192 ? 1.1855 1.3368 1.1397 -0.0720 0.1145  0.1556  203 GLU A CB  
1346 C  CG  . GLU A 192 ? 1.2218 1.3818 1.1670 -0.0710 0.1173  0.1547  203 GLU A CG  
1347 C  CD  . GLU A 192 ? 1.2575 1.4239 1.2016 -0.0697 0.1179  0.1631  203 GLU A CD  
1348 O  OE1 . GLU A 192 ? 1.2527 1.4188 1.2001 -0.0696 0.1144  0.1680  203 GLU A OE1 
1349 O  OE2 . GLU A 192 ? 1.2930 1.4643 1.2327 -0.0689 0.1221  0.1649  203 GLU A OE2 
1350 N  N   . PRO A 193 ? 1.0934 1.2214 1.0529 -0.0760 0.1087  0.1421  204 PRO A N   
1351 C  CA  . PRO A 193 ? 1.0657 1.1833 1.0303 -0.0773 0.1063  0.1425  204 PRO A CA  
1352 C  C   . PRO A 193 ? 1.0635 1.1743 1.0333 -0.0776 0.1068  0.1445  204 PRO A C   
1353 O  O   . PRO A 193 ? 1.0504 1.1536 1.0254 -0.0783 0.1046  0.1475  204 PRO A O   
1354 C  CB  . PRO A 193 ? 1.0447 1.1570 1.0050 -0.0788 0.1058  0.1341  204 PRO A CB  
1355 C  CG  . PRO A 193 ? 1.0589 1.1763 1.0136 -0.0783 0.1084  0.1290  204 PRO A CG  
1356 C  CD  . PRO A 193 ? 1.0901 1.2184 1.0433 -0.0765 0.1101  0.1338  204 PRO A CD  
1357 N  N   . ARG A 194 ? 1.0787 1.1919 1.0475 -0.0770 0.1097  0.1427  205 ARG A N   
1358 C  CA  . ARG A 194 ? 1.0790 1.1858 1.0535 -0.0772 0.1098  0.1440  205 ARG A CA  
1359 C  C   . ARG A 194 ? 1.0938 1.2026 1.0759 -0.0763 0.1094  0.1527  205 ARG A C   
1360 O  O   . ARG A 194 ? 1.0883 1.1897 1.0770 -0.0768 0.1076  0.1552  205 ARG A O   
1361 C  CB  . ARG A 194 ? 1.0952 1.2053 1.0676 -0.0767 0.1133  0.1401  205 ARG A CB  
1362 C  CG  . ARG A 194 ? 1.1069 1.2133 1.0869 -0.0764 0.1142  0.1424  205 ARG A CG  
1363 C  CD  . ARG A 194 ? 1.0851 1.1788 1.0673 -0.0779 0.1111  0.1391  205 ARG A CD  
1364 N  NE  . ARG A 194 ? 1.0715 1.1615 1.0467 -0.0788 0.1115  0.1309  205 ARG A NE  
1365 C  CZ  . ARG A 194 ? 1.0547 1.1330 1.0290 -0.0802 0.1091  0.1268  205 ARG A CZ  
1366 N  NH1 . ARG A 194 ? 1.0495 1.1182 1.0292 -0.0809 0.1058  0.1298  205 ARG A NH1 
1367 N  NH2 . ARG A 194 ? 1.0452 1.1210 1.0129 -0.0811 0.1100  0.1195  205 ARG A NH2 
1368 N  N   . LYS A 195 ? 1.1144 1.2326 1.0954 -0.0751 0.1105  0.1574  206 LYS A N   
1369 C  CA  . LYS A 195 ? 1.1321 1.2530 1.1201 -0.0742 0.1106  0.1658  206 LYS A CA  
1370 C  C   . LYS A 195 ? 1.1126 1.2271 1.1057 -0.0750 0.1066  0.1695  206 LYS A C   
1371 O  O   . LYS A 195 ? 1.1213 1.2342 1.1222 -0.0746 0.1058  0.1756  206 LYS A O   
1372 C  CB  . LYS A 195 ? 1.1620 1.2942 1.1460 -0.0728 0.1130  0.1697  206 LYS A CB  
1373 C  CG  . LYS A 195 ? 1.1849 1.3235 1.1620 -0.0722 0.1170  0.1656  206 LYS A CG  
1374 C  CD  . LYS A 195 ? 1.2247 1.3723 1.2001 -0.0708 0.1204  0.1715  206 LYS A CD  
1375 C  CE  . LYS A 195 ? 1.2511 1.4040 1.2193 -0.0703 0.1248  0.1670  206 LYS A CE  
1376 N  NZ  . LYS A 195 ? 1.2935 1.4526 1.2621 -0.0691 0.1295  0.1727  206 LYS A NZ  
1377 N  N   . ALA A 196 ? 1.0883 1.1991 1.0773 -0.0760 0.1042  0.1654  207 ALA A N   
1378 C  CA  . ALA A 196 ? 1.0705 1.1747 1.0633 -0.0769 0.1008  0.1678  207 ALA A CA  
1379 C  C   . ALA A 196 ? 1.0546 1.1465 1.0517 -0.0781 0.0987  0.1671  207 ALA A C   
1380 O  O   . ALA A 196 ? 1.0479 1.1345 1.0501 -0.0786 0.0962  0.1709  207 ALA A O   
1381 C  CB  . ALA A 196 ? 1.0529 1.1565 1.0404 -0.0777 0.0996  0.1630  207 ALA A CB  
1382 N  N   . ILE A 197 ? 1.0508 1.1379 1.0460 -0.0787 0.0995  0.1622  208 ILE A N   
1383 C  CA  . ILE A 197 ? 1.0372 1.1116 1.0352 -0.0799 0.0969  0.1609  208 ILE A CA  
1384 C  C   . ILE A 197 ? 1.0489 1.1215 1.0560 -0.0795 0.0951  0.1682  208 ILE A C   
1385 O  O   . ILE A 197 ? 1.0376 1.1010 1.0470 -0.0805 0.0919  0.1695  208 ILE A O   
1386 C  CB  . ILE A 197 ? 1.0399 1.1113 1.0369 -0.0800 0.0981  0.1565  208 ILE A CB  
1387 C  CG1 . ILE A 197 ? 1.0235 1.0906 1.0116 -0.0812 0.0986  0.1482  208 ILE A CG1 
1388 C  CG2 . ILE A 197 ? 1.0367 1.0970 1.0396 -0.0807 0.0949  0.1582  208 ILE A CG2 
1389 C  CD1 . ILE A 197 ? 1.0300 1.0965 1.0165 -0.0811 0.1003  0.1435  208 ILE A CD1 
1390 N  N   . SER A 198 ? 1.0741 1.1556 1.0862 -0.0779 0.0976  0.1727  209 SER A N   
1391 C  CA  . SER A 198 ? 1.0904 1.1716 1.1127 -0.0773 0.0967  0.1795  209 SER A CA  
1392 C  C   . SER A 198 ? 1.0833 1.1620 1.1088 -0.0776 0.0939  0.1843  209 SER A C   
1393 O  O   . SER A 198 ? 1.0802 1.1504 1.1117 -0.0783 0.0907  0.1867  209 SER A O   
1394 C  CB  . SER A 198 ? 1.1214 1.2145 1.1467 -0.0755 0.1009  0.1835  209 SER A CB  
1395 O  OG  . SER A 198 ? 1.1392 1.2311 1.1753 -0.0750 0.1007  0.1888  209 SER A OG  
1396 N  N   . ASP A 199 ? 1.0819 1.1676 1.1035 -0.0772 0.0949  0.1854  210 ASP A N   
1397 C  CA  . ASP A 199 ? 1.0788 1.1637 1.1038 -0.0773 0.0927  0.1901  210 ASP A CA  
1398 C  C   . ASP A 199 ? 1.0519 1.1252 1.0745 -0.0791 0.0895  0.1863  210 ASP A C   
1399 O  O   . ASP A 199 ? 1.0489 1.1163 1.0766 -0.0797 0.0869  0.1898  210 ASP A O   
1400 C  CB  . ASP A 199 ? 1.0913 1.1872 1.1128 -0.0763 0.0943  0.1921  210 ASP A CB  
1401 C  CG  . ASP A 199 ? 1.1237 1.2304 1.1473 -0.0745 0.0976  0.1973  210 ASP A CG  
1402 O  OD1 . ASP A 199 ? 1.1322 1.2423 1.1524 -0.0741 0.1005  0.1942  210 ASP A OD1 
1403 O  OD2 . ASP A 199 ? 1.1426 1.2539 1.1713 -0.0736 0.0975  0.2044  210 ASP A OD2 
1404 N  N   . LEU A 200 ? 1.0346 1.1042 1.0491 -0.0801 0.0900  0.1789  211 LEU A N   
1405 C  CA  . LEU A 200 ? 1.0118 1.0703 1.0226 -0.0820 0.0878  0.1747  211 LEU A CA  
1406 C  C   . LEU A 200 ? 1.0059 1.0510 1.0184 -0.0833 0.0851  0.1741  211 LEU A C   
1407 O  O   . LEU A 200 ? 0.9966 1.0323 1.0096 -0.0845 0.0827  0.1745  211 LEU A O   
1408 C  CB  . LEU A 200 ? 0.9979 1.0564 1.0000 -0.0828 0.0895  0.1670  211 LEU A CB  
1409 C  CG  . LEU A 200 ? 1.0030 1.0728 1.0035 -0.0818 0.0910  0.1675  211 LEU A CG  
1410 C  CD1 . LEU A 200 ? 0.9876 1.0562 0.9807 -0.0828 0.0923  0.1598  211 LEU A CD1 
1411 C  CD2 . LEU A 200 ? 1.0067 1.0769 1.0124 -0.0818 0.0893  0.1725  211 LEU A CD2 
1412 N  N   . LYS A 201 ? 1.0144 1.0586 1.0281 -0.0829 0.0852  0.1733  212 LYS A N   
1413 C  CA  . LYS A 201 ? 1.0139 1.0453 1.0298 -0.0839 0.0818  0.1730  212 LYS A CA  
1414 C  C   . LYS A 201 ? 1.0242 1.0539 1.0487 -0.0837 0.0793  0.1798  212 LYS A C   
1415 O  O   . LYS A 201 ? 1.0169 1.0352 1.0406 -0.0851 0.0762  0.1797  212 LYS A O   
1416 C  CB  . LYS A 201 ? 1.0257 1.0579 1.0438 -0.0833 0.0823  0.1717  212 LYS A CB  
1417 C  CG  . LYS A 201 ? 1.0322 1.0526 1.0553 -0.0840 0.0779  0.1730  212 LYS A CG  
1418 C  CD  . LYS A 201 ? 1.0320 1.0441 1.0506 -0.0847 0.0768  0.1672  212 LYS A CD  
1419 C  CE  . LYS A 201 ? 1.0477 1.0514 1.0743 -0.0848 0.0723  0.1697  212 LYS A CE  
1420 N  NZ  . LYS A 201 ? 1.0717 1.0862 1.1100 -0.0829 0.0742  0.1743  212 LYS A NZ  
1421 N  N   . ALA A 202 ? 1.0432 1.0842 1.0755 -0.0819 0.0809  0.1859  213 ALA A N   
1422 C  CA  . ALA A 202 ? 1.0561 1.0976 1.0978 -0.0814 0.0791  0.1930  213 ALA A CA  
1423 C  C   . ALA A 202 ? 1.0434 1.0805 1.0833 -0.0824 0.0775  0.1937  213 ALA A C   
1424 O  O   . ALA A 202 ? 1.0415 1.0681 1.0840 -0.0835 0.0741  0.1949  213 ALA A O   
1425 C  CB  . ALA A 202 ? 1.0787 1.1342 1.1267 -0.0794 0.0823  0.1988  213 ALA A CB  
1426 N  N   . ALA A 203 ? 1.0366 1.0810 1.0720 -0.0821 0.0799  0.1926  214 ALA A N   
1427 C  CA  . ALA A 203 ? 1.0271 1.0683 1.0621 -0.0830 0.0788  0.1931  214 ALA A CA  
1428 C  C   . ALA A 203 ? 1.0116 1.0364 1.0426 -0.0853 0.0760  0.1890  214 ALA A C   
1429 O  O   . ALA A 203 ? 1.0127 1.0314 1.0475 -0.0860 0.0739  0.1918  214 ALA A O   
1430 C  CB  . ALA A 203 ? 1.0206 1.0699 1.0501 -0.0827 0.0813  0.1904  214 ALA A CB  
1431 N  N   . SER A 204 ? 0.9999 1.0171 1.0230 -0.0864 0.0761  0.1824  215 SER A N   
1432 C  CA  . SER A 204 ? 0.9888 0.9894 1.0061 -0.0886 0.0738  0.1782  215 SER A CA  
1433 C  C   . SER A 204 ? 1.0004 0.9921 1.0232 -0.0889 0.0696  0.1819  215 SER A C   
1434 O  O   . SER A 204 ? 0.9984 0.9794 1.0210 -0.0903 0.0672  0.1826  215 SER A O   
1435 C  CB  . SER A 204 ? 0.9784 0.9732 0.9859 -0.0897 0.0749  0.1707  215 SER A CB  
1436 O  OG  . SER A 204 ? 0.9884 0.9828 0.9976 -0.0890 0.0736  0.1709  215 SER A OG  
1437 N  N   . LYS A 205 ? 1.0146 1.0105 1.0426 -0.0877 0.0689  0.1842  216 LYS A N   
1438 C  CA  . LYS A 205 ? 1.0303 1.0196 1.0660 -0.0877 0.0647  0.1883  216 LYS A CA  
1439 C  C   . LYS A 205 ? 1.0379 1.0275 1.0808 -0.0876 0.0633  0.1940  216 LYS A C   
1440 O  O   . LYS A 205 ? 1.0413 1.0183 1.0839 -0.0890 0.0596  0.1942  216 LYS A O   
1441 C  CB  . LYS A 205 ? 1.0478 1.0469 1.0922 -0.0858 0.0655  0.1917  216 LYS A CB  
1442 C  CG  . LYS A 205 ? 1.0496 1.0430 1.0916 -0.0860 0.0641  0.1876  216 LYS A CG  
1443 C  CD  . LYS A 205 ? 1.0574 1.0334 1.0983 -0.0877 0.0582  0.1863  216 LYS A CD  
1444 C  CE  . LYS A 205 ? 1.0572 1.0241 1.0911 -0.0885 0.0565  0.1803  216 LYS A CE  
1445 N  NZ  . LYS A 205 ? 1.0747 1.0484 1.1177 -0.0869 0.0566  0.1818  216 LYS A NZ  
1446 N  N   . LEU A 206 ? 1.0427 1.0464 1.0912 -0.0860 0.0663  0.1985  217 LEU A N   
1447 C  CA  . LEU A 206 ? 1.0535 1.0604 1.1104 -0.0855 0.0656  0.2049  217 LEU A CA  
1448 C  C   . LEU A 206 ? 1.0430 1.0391 1.0963 -0.0873 0.0638  0.2032  217 LEU A C   
1449 O  O   . LEU A 206 ? 1.0527 1.0419 1.1115 -0.0878 0.0607  0.2065  217 LEU A O   
1450 C  CB  . LEU A 206 ? 1.0599 1.0831 1.1199 -0.0837 0.0695  0.2086  217 LEU A CB  
1451 C  CG  . LEU A 206 ? 1.0833 1.1186 1.1519 -0.0816 0.0713  0.2146  217 LEU A CG  
1452 C  CD1 . LEU A 206 ? 1.1012 1.1326 1.1807 -0.0815 0.0683  0.2203  217 LEU A CD1 
1453 C  CD2 . LEU A 206 ? 1.0854 1.1238 1.1513 -0.0811 0.0731  0.2115  217 LEU A CD2 
1454 N  N   . LYS A 207 ? 1.0253 1.0199 1.0696 -0.0882 0.0661  0.1979  218 LYS A N   
1455 C  CA  . LYS A 207 ? 1.0177 1.0035 1.0592 -0.0899 0.0656  0.1962  218 LYS A CA  
1456 C  C   . LYS A 207 ? 1.0136 0.9807 1.0473 -0.0922 0.0628  0.1914  218 LYS A C   
1457 O  O   . LYS A 207 ? 1.0153 0.9717 1.0473 -0.0938 0.0616  0.1908  218 LYS A O   
1458 C  CB  . LYS A 207 ? 1.0034 0.9947 1.0396 -0.0901 0.0693  0.1923  218 LYS A CB  
1459 C  CG  . LYS A 207 ? 1.0103 1.0192 1.0515 -0.0879 0.0718  0.1961  218 LYS A CG  
1460 C  CD  . LYS A 207 ? 0.9987 1.0096 1.0366 -0.0885 0.0742  0.1925  218 LYS A CD  
1461 C  CE  . LYS A 207 ? 0.9959 1.0210 1.0323 -0.0870 0.0768  0.1918  218 LYS A CE  
1462 N  NZ  . LYS A 207 ? 0.9926 1.0207 1.0289 -0.0873 0.0782  0.1897  218 LYS A NZ  
1463 N  N   . ASN A 208 ? 1.0106 0.9734 1.0390 -0.0925 0.0618  0.1880  219 ASN A N   
1464 C  CA  . ASN A 208 ? 1.0115 0.9564 1.0328 -0.0944 0.0581  0.1844  219 ASN A CA  
1465 C  C   . ASN A 208 ? 1.0008 0.9318 1.0096 -0.0969 0.0593  0.1778  219 ASN A C   
1466 O  O   . ASN A 208 ? 0.9969 0.9164 0.9957 -0.0983 0.0583  0.1726  219 ASN A O   
1467 C  CB  . ASN A 208 ? 1.0297 0.9682 1.0589 -0.0945 0.0533  0.1896  219 ASN A CB  
1468 C  CG  . ASN A 208 ? 1.0348 0.9549 1.0568 -0.0963 0.0485  0.1863  219 ASN A CG  
1469 O  OD1 . ASN A 208 ? 1.0271 0.9392 1.0385 -0.0975 0.0487  0.1806  219 ASN A OD1 
1470 N  ND2 . ASN A 208 ? 1.0502 0.9625 1.0776 -0.0968 0.0439  0.1899  219 ASN A ND2 
1471 N  N   . ASP A 209 ? 0.9991 0.9306 1.0085 -0.0976 0.0616  0.1780  220 ASP A N   
1472 C  CA  . ASP A 209 ? 0.9931 0.9116 0.9915 -0.1000 0.0636  0.1718  220 ASP A CA  
1473 C  C   . ASP A 209 ? 0.9769 0.9050 0.9748 -0.0998 0.0689  0.1691  220 ASP A C   
1474 O  O   . ASP A 209 ? 0.9706 0.8901 0.9634 -0.1017 0.0712  0.1653  220 ASP A O   
1475 C  CB  . ASP A 209 ? 1.0069 0.9115 1.0046 -0.1018 0.0614  0.1729  220 ASP A CB  
1476 C  CG  . ASP A 209 ? 1.0048 0.9189 1.0132 -0.1009 0.0628  0.1778  220 ASP A CG  
1477 O  OD1 . ASP A 209 ? 0.9928 0.9240 1.0088 -0.0988 0.0651  0.1805  220 ASP A OD1 
1478 O  OD2 . ASP A 209 ? 1.0173 0.9216 1.0265 -0.1022 0.0615  0.1789  220 ASP A OD2 
1479 N  N   . ASN A 210 ? 0.9730 0.9182 0.9763 -0.0976 0.0707  0.1709  221 ASN A N   
1480 C  CA  . ASN A 210 ? 0.9619 0.9162 0.9650 -0.0973 0.0749  0.1682  221 ASN A CA  
1481 C  C   . ASN A 210 ? 0.9508 0.9013 0.9438 -0.0984 0.0775  0.1608  221 ASN A C   
1482 O  O   . ASN A 210 ? 0.9484 0.9052 0.9397 -0.0973 0.0776  0.1598  221 ASN A O   
1483 C  CB  . ASN A 210 ? 0.9636 0.9373 0.9758 -0.0947 0.0758  0.1731  221 ASN A CB  
1484 C  CG  . ASN A 210 ? 0.9584 0.9404 0.9711 -0.0945 0.0792  0.1706  221 ASN A CG  
1485 O  OD1 . ASN A 210 ? 0.9645 0.9463 0.9705 -0.0951 0.0816  0.1646  221 ASN A OD1 
1486 N  ND2 . ASN A 210 ? 0.9490 0.9381 0.9702 -0.0936 0.0791  0.1752  221 ASN A ND2 
1487 N  N   . THR A 211 ? 0.9459 0.8861 0.9326 -0.1005 0.0800  0.1556  222 THR A N   
1488 C  CA  . THR A 211 ? 0.9372 0.8718 0.9141 -0.1018 0.0828  0.1483  222 THR A CA  
1489 C  C   . THR A 211 ? 0.9289 0.8803 0.9087 -0.1000 0.0851  0.1472  222 THR A C   
1490 O  O   . THR A 211 ? 0.9255 0.8784 0.9006 -0.0996 0.0851  0.1446  222 THR A O   
1491 C  CB  . THR A 211 ? 0.9369 0.8588 0.9085 -0.1044 0.0859  0.1435  222 THR A CB  
1492 O  OG1 . THR A 211 ? 0.9319 0.8446 0.8926 -0.1061 0.0885  0.1364  222 THR A OG1 
1493 C  CG2 . THR A 211 ? 0.9353 0.8681 0.9154 -0.1038 0.0889  0.1441  222 THR A CG2 
1494 N  N   . GLU A 212 ? 0.9284 0.8924 0.9160 -0.0987 0.0865  0.1495  223 GLU A N   
1495 C  CA  . GLU A 212 ? 0.9243 0.9031 0.9136 -0.0972 0.0885  0.1479  223 GLU A CA  
1496 C  C   . GLU A 212 ? 0.9288 0.9192 0.9204 -0.0949 0.0867  0.1517  223 GLU A C   
1497 O  O   . GLU A 212 ? 0.9268 0.9265 0.9165 -0.0939 0.0882  0.1492  223 GLU A O   
1498 C  CB  . GLU A 212 ? 0.9270 0.9151 0.9240 -0.0965 0.0898  0.1494  223 GLU A CB  
1499 C  CG  . GLU A 212 ? 0.9277 0.9317 0.9271 -0.0948 0.0910  0.1483  223 GLU A CG  
1500 C  CD  . GLU A 212 ? 0.9197 0.9210 0.9126 -0.0961 0.0941  0.1399  223 GLU A CD  
1501 O  OE1 . GLU A 212 ? 0.9154 0.9033 0.9038 -0.0984 0.0963  0.1349  223 GLU A OE1 
1502 O  OE2 . GLU A 212 ? 0.9203 0.9327 0.9124 -0.0947 0.0946  0.1383  223 GLU A OE2 
1503 N  N   . ALA A 213 ? 0.9369 0.9258 0.9322 -0.0942 0.0837  0.1573  224 ALA A N   
1504 C  CA  . ALA A 213 ? 0.9446 0.9442 0.9432 -0.0921 0.0827  0.1611  224 ALA A CA  
1505 C  C   . ALA A 213 ? 0.9403 0.9348 0.9315 -0.0926 0.0829  0.1563  224 ALA A C   
1506 O  O   . ALA A 213 ? 0.9434 0.9481 0.9347 -0.0911 0.0840  0.1561  224 ALA A O   
1507 C  CB  . ALA A 213 ? 0.9552 0.9549 0.9613 -0.0912 0.0798  0.1683  224 ALA A CB  
1508 N  N   . PHE A 214 ? 0.9358 0.9140 0.9202 -0.0947 0.0820  0.1524  225 PHE A N   
1509 C  CA  . PHE A 214 ? 0.9338 0.9054 0.9112 -0.0953 0.0816  0.1480  225 PHE A CA  
1510 C  C   . PHE A 214 ? 0.9242 0.8989 0.8954 -0.0957 0.0851  0.1414  225 PHE A C   
1511 O  O   . PHE A 214 ? 0.9239 0.9036 0.8932 -0.0949 0.0858  0.1393  225 PHE A O   
1512 C  CB  . PHE A 214 ? 0.9359 0.8882 0.9069 -0.0975 0.0791  0.1460  225 PHE A CB  
1513 C  CG  . PHE A 214 ? 0.9482 0.8967 0.9244 -0.0970 0.0748  0.1515  225 PHE A CG  
1514 C  CD1 . PHE A 214 ? 0.9565 0.9061 0.9343 -0.0960 0.0725  0.1524  225 PHE A CD1 
1515 C  CD2 . PHE A 214 ? 0.9533 0.8977 0.9342 -0.0974 0.0728  0.1559  225 PHE A CD2 
1516 C  CE1 . PHE A 214 ? 0.9701 0.9167 0.9545 -0.0955 0.0682  0.1576  225 PHE A CE1 
1517 C  CE2 . PHE A 214 ? 0.9666 0.9079 0.9535 -0.0968 0.0685  0.1611  225 PHE A CE2 
1518 C  CZ  . PHE A 214 ? 0.9751 0.9175 0.9640 -0.0959 0.0661  0.1620  225 PHE A CZ  
1519 N  N   . TYR A 215 ? 0.9179 0.8894 0.8865 -0.0970 0.0875  0.1380  226 TYR A N   
1520 C  CA  . TYR A 215 ? 0.9104 0.8876 0.8757 -0.0971 0.0910  0.1323  226 TYR A CA  
1521 C  C   . TYR A 215 ? 0.9143 0.9096 0.8848 -0.0946 0.0912  0.1350  226 TYR A C   
1522 O  O   . TYR A 215 ? 0.9138 0.9128 0.8809 -0.0940 0.0921  0.1320  226 TYR A O   
1523 C  CB  . TYR A 215 ? 0.9060 0.8819 0.8728 -0.0982 0.0932  0.1305  226 TYR A CB  
1524 C  CG  . TYR A 215 ? 0.9001 0.8765 0.8625 -0.0992 0.0968  0.1233  226 TYR A CG  
1525 C  CD1 . TYR A 215 ? 0.8969 0.8601 0.8500 -0.1012 0.0985  0.1170  226 TYR A CD1 
1526 C  CD2 . TYR A 215 ? 0.9003 0.8898 0.8682 -0.0981 0.0984  0.1228  226 TYR A CD2 
1527 C  CE1 . TYR A 215 ? 0.8932 0.8565 0.8429 -0.1022 0.1021  0.1104  226 TYR A CE1 
1528 C  CE2 . TYR A 215 ? 0.8967 0.8867 0.8617 -0.0990 0.1015  0.1160  226 TYR A CE2 
1529 C  CZ  . TYR A 215 ? 0.8927 0.8697 0.8489 -0.1010 0.1036  0.1097  226 TYR A CZ  
1530 O  OH  . TYR A 215 ? 0.8908 0.8680 0.8447 -0.1020 0.1071  0.1029  226 TYR A OH  
1531 N  N   . LYS A 216 ? 0.9210 0.9269 0.8994 -0.0930 0.0905  0.1408  227 LYS A N   
1532 C  CA  . LYS A 216 ? 0.9287 0.9512 0.9106 -0.0908 0.0911  0.1431  227 LYS A CA  
1533 C  C   . LYS A 216 ? 0.9338 0.9596 0.9130 -0.0898 0.0913  0.1423  227 LYS A C   
1534 O  O   . LYS A 216 ? 0.9349 0.9682 0.9110 -0.0892 0.0932  0.1386  227 LYS A O   
1535 C  CB  . LYS A 216 ? 0.9399 0.9715 0.9302 -0.0892 0.0896  0.1509  227 LYS A CB  
1536 C  CG  . LYS A 216 ? 0.9397 0.9757 0.9336 -0.0893 0.0902  0.1510  227 LYS A CG  
1537 C  CD  . LYS A 216 ? 0.9405 0.9859 0.9317 -0.0887 0.0920  0.1463  227 LYS A CD  
1538 C  CE  . LYS A 216 ? 0.9572 1.0180 0.9502 -0.0863 0.0916  0.1505  227 LYS A CE  
1539 N  NZ  . LYS A 216 ? 0.9585 1.0251 0.9456 -0.0859 0.0933  0.1447  227 LYS A NZ  
1540 N  N   . ILE A 217 ? 0.9384 0.9583 0.9192 -0.0898 0.0893  0.1454  228 ILE A N   
1541 C  CA  . ILE A 217 ? 0.9459 0.9690 0.9258 -0.0888 0.0895  0.1449  228 ILE A CA  
1542 C  C   . ILE A 217 ? 0.9375 0.9520 0.9094 -0.0902 0.0905  0.1374  228 ILE A C   
1543 O  O   . ILE A 217 ? 0.9398 0.9614 0.9093 -0.0894 0.0925  0.1342  228 ILE A O   
1544 C  CB  . ILE A 217 ? 0.9565 0.9776 0.9427 -0.0881 0.0869  0.1508  228 ILE A CB  
1545 C  CG1 . ILE A 217 ? 0.9635 0.9862 0.9489 -0.0874 0.0874  0.1490  228 ILE A CG1 
1546 C  CG2 . ILE A 217 ? 0.9513 0.9569 0.9369 -0.0899 0.0839  0.1514  228 ILE A CG2 
1547 C  CD1 . ILE A 217 ? 0.9813 1.0080 0.9748 -0.0860 0.0862  0.1550  228 ILE A CD1 
1548 N  N   . SER A 218 ? 0.9300 0.9289 0.8973 -0.0923 0.0891  0.1346  229 SER A N   
1549 C  CA  . SER A 218 ? 0.9246 0.9140 0.8834 -0.0938 0.0901  0.1276  229 SER A CA  
1550 C  C   . SER A 218 ? 0.9195 0.9175 0.8753 -0.0936 0.0937  0.1223  229 SER A C   
1551 O  O   . SER A 218 ? 0.9220 0.9228 0.8747 -0.0932 0.0950  0.1184  229 SER A O   
1552 C  CB  . SER A 218 ? 0.9187 0.8903 0.8715 -0.0963 0.0891  0.1251  229 SER A CB  
1553 O  OG  . SER A 218 ? 0.9163 0.8784 0.8603 -0.0978 0.0904  0.1183  229 SER A OG  
1554 N  N   . THR A 219 ? 0.9144 0.9169 0.8719 -0.0937 0.0951  0.1223  230 THR A N   
1555 C  CA  . THR A 219 ? 0.9117 0.9237 0.8680 -0.0934 0.0978  0.1181  230 THR A CA  
1556 C  C   . THR A 219 ? 0.9214 0.9472 0.8793 -0.0912 0.0984  0.1190  230 THR A C   
1557 O  O   . THR A 219 ? 0.9212 0.9494 0.8748 -0.0913 0.1003  0.1135  230 THR A O   
1558 C  CB  . THR A 219 ? 0.9100 0.9272 0.8711 -0.0933 0.0982  0.1201  230 THR A CB  
1559 O  OG1 . THR A 219 ? 0.9020 0.9058 0.8602 -0.0956 0.0991  0.1166  230 THR A OG1 
1560 C  CG2 . THR A 219 ? 0.9120 0.9425 0.8741 -0.0922 0.0998  0.1174  230 THR A CG2 
1561 N  N   . LEU A 220 ? 0.9321 0.9664 0.8958 -0.0894 0.0971  0.1258  231 LEU A N   
1562 C  CA  . LEU A 220 ? 0.9459 0.9926 0.9108 -0.0875 0.0981  0.1272  231 LEU A CA  
1563 C  C   . LEU A 220 ? 0.9497 0.9925 0.9117 -0.0876 0.0987  0.1241  231 LEU A C   
1564 O  O   . LEU A 220 ? 0.9535 1.0019 0.9120 -0.0872 0.1008  0.1195  231 LEU A O   
1565 C  CB  . LEU A 220 ? 0.9597 1.0148 0.9314 -0.0857 0.0970  0.1354  231 LEU A CB  
1566 C  CG  . LEU A 220 ? 0.9781 1.0457 0.9498 -0.0839 0.0989  0.1364  231 LEU A CG  
1567 C  CD1 . LEU A 220 ? 0.9821 1.0599 0.9504 -0.0833 0.1004  0.1335  231 LEU A CD1 
1568 C  CD2 . LEU A 220 ? 0.9954 1.0692 0.9737 -0.0823 0.0983  0.1445  231 LEU A CD2 
1569 N  N   . TYR A 221 ? 0.9509 0.9845 0.9149 -0.0880 0.0965  0.1265  232 TYR A N   
1570 C  CA  . TYR A 221 ? 0.9557 0.9843 0.9178 -0.0882 0.0965  0.1235  232 TYR A CA  
1571 C  C   . TYR A 221 ? 0.9477 0.9730 0.9023 -0.0893 0.0986  0.1154  232 TYR A C   
1572 O  O   . TYR A 221 ? 0.9556 0.9862 0.9088 -0.0886 0.1004  0.1122  232 TYR A O   
1573 C  CB  . TYR A 221 ? 0.9541 0.9681 0.9168 -0.0893 0.0931  0.1250  232 TYR A CB  
1574 C  CG  . TYR A 221 ? 0.9676 0.9835 0.9387 -0.0881 0.0908  0.1320  232 TYR A CG  
1575 C  CD1 . TYR A 221 ? 0.9843 1.0107 0.9609 -0.0863 0.0922  0.1344  232 TYR A CD1 
1576 C  CD2 . TYR A 221 ? 0.9658 0.9728 0.9396 -0.0889 0.0875  0.1361  232 TYR A CD2 
1577 C  CE1 . TYR A 221 ? 0.9990 1.0272 0.9845 -0.0852 0.0906  0.1408  232 TYR A CE1 
1578 C  CE2 . TYR A 221 ? 0.9796 0.9884 0.9621 -0.0878 0.0853  0.1424  232 TYR A CE2 
1579 C  CZ  . TYR A 221 ? 0.9961 1.0156 0.9847 -0.0860 0.0869  0.1448  232 TYR A CZ  
1580 O  OH  . TYR A 221 ? 1.0117 1.0325 1.0099 -0.0850 0.0850  0.1511  232 TYR A OH  
1581 N  N   . TYR A 222 ? 0.9340 0.9507 0.8842 -0.0911 0.0986  0.1121  233 TYR A N   
1582 C  CA  . TYR A 222 ? 0.9272 0.9398 0.8706 -0.0924 0.1009  0.1045  233 TYR A CA  
1583 C  C   . TYR A 222 ? 0.9320 0.9587 0.8753 -0.0912 0.1036  0.1016  233 TYR A C   
1584 O  O   . TYR A 222 ? 0.9350 0.9620 0.8748 -0.0913 0.1052  0.0964  233 TYR A O   
1585 C  CB  . TYR A 222 ? 0.9154 0.9180 0.8556 -0.0944 0.1012  0.1023  233 TYR A CB  
1586 C  CG  . TYR A 222 ? 0.9101 0.9057 0.8433 -0.0962 0.1037  0.0943  233 TYR A CG  
1587 C  CD1 . TYR A 222 ? 0.9078 0.9120 0.8410 -0.0960 0.1064  0.0901  233 TYR A CD1 
1588 C  CD2 . TYR A 222 ? 0.9101 0.8902 0.8370 -0.0980 0.1033  0.0911  233 TYR A CD2 
1589 C  CE1 . TYR A 222 ? 0.9047 0.9025 0.8324 -0.0976 0.1090  0.0828  233 TYR A CE1 
1590 C  CE2 . TYR A 222 ? 0.9078 0.8809 0.8282 -0.0996 0.1060  0.0840  233 TYR A CE2 
1591 C  CZ  . TYR A 222 ? 0.9047 0.8868 0.8259 -0.0995 0.1091  0.0797  233 TYR A CZ  
1592 O  OH  . TYR A 222 ? 0.9041 0.8788 0.8195 -0.1012 0.1120  0.0726  233 TYR A OH  
1593 N  N   . GLN A 223 ? 0.9347 0.9725 0.8816 -0.0900 0.1038  0.1047  234 GLN A N   
1594 C  CA  . GLN A 223 ? 0.9432 0.9945 0.8894 -0.0888 0.1057  0.1022  234 GLN A CA  
1595 C  C   . GLN A 223 ? 0.9582 1.0161 0.9043 -0.0874 0.1068  0.1023  234 GLN A C   
1596 O  O   . GLN A 223 ? 0.9663 1.0309 0.9093 -0.0869 0.1088  0.0977  234 GLN A O   
1597 C  CB  . GLN A 223 ? 0.9499 1.0128 0.9003 -0.0874 0.1050  0.1073  234 GLN A CB  
1598 C  CG  . GLN A 223 ? 0.9400 0.9984 0.8943 -0.0881 0.1032  0.1112  234 GLN A CG  
1599 C  CD  . GLN A 223 ? 0.9369 0.9974 0.8914 -0.0888 0.1037  0.1077  234 GLN A CD  
1600 O  OE1 . GLN A 223 ? 0.9415 1.0066 0.8930 -0.0888 0.1051  0.1020  234 GLN A OE1 
1601 N  NE2 . GLN A 223 ? 0.9309 0.9876 0.8894 -0.0894 0.1024  0.1108  234 GLN A NE2 
1602 N  N   . LEU A 224 ? 0.9643 1.0205 0.9141 -0.0867 0.1056  0.1075  235 LEU A N   
1603 C  CA  . LEU A 224 ? 0.9815 1.0443 0.9325 -0.0853 0.1070  0.1079  235 LEU A CA  
1604 C  C   . LEU A 224 ? 0.9793 1.0323 0.9282 -0.0863 0.1071  0.1034  235 LEU A C   
1605 O  O   . LEU A 224 ? 0.9936 1.0502 0.9443 -0.0853 0.1083  0.1032  235 LEU A O   
1606 C  CB  . LEU A 224 ? 0.9942 1.0621 0.9518 -0.0839 0.1062  0.1159  235 LEU A CB  
1607 C  CG  . LEU A 224 ? 1.0006 1.0777 0.9609 -0.0828 0.1059  0.1218  235 LEU A CG  
1608 C  CD1 . LEU A 224 ? 1.0186 1.1008 0.9850 -0.0813 0.1062  0.1286  235 LEU A CD1 
1609 C  CD2 . LEU A 224 ? 1.0106 1.0989 0.9667 -0.0820 0.1077  0.1193  235 LEU A CD2 
1610 N  N   . GLY A 225 ? 0.9637 1.0041 0.9088 -0.0882 0.1059  0.0997  236 GLY A N   
1611 C  CA  . GLY A 225 ? 0.9633 0.9928 0.9052 -0.0893 0.1056  0.0952  236 GLY A CA  
1612 C  C   . GLY A 225 ? 0.9702 0.9915 0.9161 -0.0893 0.1026  0.0994  236 GLY A C   
1613 O  O   . GLY A 225 ? 0.9743 0.9864 0.9183 -0.0900 0.1016  0.0964  236 GLY A O   
1614 N  N   . ASP A 226 ? 0.9739 0.9984 0.9259 -0.0884 0.1009  0.1064  237 ASP A N   
1615 C  CA  . ASP A 226 ? 0.9792 0.9944 0.9355 -0.0886 0.0973  0.1105  237 ASP A CA  
1616 C  C   . ASP A 226 ? 0.9662 0.9649 0.9167 -0.0908 0.0946  0.1087  237 ASP A C   
1617 O  O   . ASP A 226 ? 0.9613 0.9551 0.9133 -0.0913 0.0924  0.1129  237 ASP A O   
1618 C  CB  . ASP A 226 ? 0.9872 1.0104 0.9514 -0.0871 0.0965  0.1182  237 ASP A CB  
1619 C  CG  . ASP A 226 ? 1.0068 1.0439 0.9763 -0.0851 0.0994  0.1201  237 ASP A CG  
1620 O  OD1 . ASP A 226 ? 1.0157 1.0535 0.9844 -0.0849 0.1009  0.1161  237 ASP A OD1 
1621 O  OD2 . ASP A 226 ? 1.0155 1.0624 0.9896 -0.0838 0.1003  0.1256  237 ASP A OD2 
1622 N  N   . HIS A 227 ? 0.9627 0.9528 0.9061 -0.0922 0.0952  0.1024  238 HIS A N   
1623 C  CA  . HIS A 227 ? 0.9523 0.9273 0.8880 -0.0945 0.0941  0.0995  238 HIS A CA  
1624 C  C   . HIS A 227 ? 0.9584 0.9187 0.8938 -0.0954 0.0894  0.1026  238 HIS A C   
1625 O  O   . HIS A 227 ? 0.9519 0.9009 0.8826 -0.0971 0.0880  0.1028  238 HIS A O   
1626 C  CB  . HIS A 227 ? 0.9509 0.9207 0.8791 -0.0957 0.0964  0.0920  238 HIS A CB  
1627 C  CG  . HIS A 227 ? 0.9650 0.9316 0.8938 -0.0953 0.0952  0.0901  238 HIS A CG  
1628 N  ND1 . HIS A 227 ? 0.9744 0.9264 0.9015 -0.0962 0.0910  0.0910  238 HIS A ND1 
1629 C  CD2 . HIS A 227 ? 0.9734 0.9493 0.9044 -0.0941 0.0975  0.0872  238 HIS A CD2 
1630 C  CE1 . HIS A 227 ? 0.9879 0.9405 0.9170 -0.0955 0.0906  0.0889  238 HIS A CE1 
1631 N  NE2 . HIS A 227 ? 0.9872 0.9543 0.9187 -0.0942 0.0948  0.0865  238 HIS A NE2 
1632 N  N   . GLU A 228 ? 0.9733 0.9333 0.9141 -0.0944 0.0868  0.1048  239 GLU A N   
1633 C  CA  . GLU A 228 ? 0.9823 0.9282 0.9234 -0.0952 0.0814  0.1078  239 GLU A CA  
1634 C  C   . GLU A 228 ? 0.9789 0.9266 0.9251 -0.0949 0.0797  0.1140  239 GLU A C   
1635 O  O   . GLU A 228 ? 0.9762 0.9111 0.9176 -0.0966 0.0772  0.1147  239 GLU A O   
1636 C  CB  . GLU A 228 ? 1.0014 0.9484 0.9498 -0.0940 0.0789  0.1092  239 GLU A CB  
1637 C  CG  . GLU A 228 ? 1.0149 0.9443 0.9617 -0.0951 0.0726  0.1106  239 GLU A CG  
1638 C  CD  . GLU A 228 ? 1.0362 0.9677 0.9930 -0.0937 0.0696  0.1128  239 GLU A CD  
1639 O  OE1 . GLU A 228 ? 1.0412 0.9843 1.0030 -0.0923 0.0730  0.1110  239 GLU A OE1 
1640 O  OE2 . GLU A 228 ? 1.0501 0.9715 1.0104 -0.0940 0.0638  0.1161  239 GLU A OE2 
1641 N  N   . LEU A 229 ? 0.9813 0.9446 0.9369 -0.0929 0.0813  0.1184  240 LEU A N   
1642 C  CA  . LEU A 229 ? 0.9804 0.9467 0.9420 -0.0924 0.0798  0.1247  240 LEU A CA  
1643 C  C   . LEU A 229 ? 0.9643 0.9263 0.9195 -0.0938 0.0810  0.1235  240 LEU A C   
1644 O  O   . LEU A 229 ? 0.9639 0.9149 0.9175 -0.0951 0.0781  0.1256  240 LEU A O   
1645 C  CB  . LEU A 229 ? 0.9876 0.9718 0.9590 -0.0900 0.0822  0.1292  240 LEU A CB  
1646 C  CG  . LEU A 229 ? 1.0074 0.9957 0.9869 -0.0886 0.0814  0.1310  240 LEU A CG  
1647 C  CD1 . LEU A 229 ? 1.0118 1.0105 0.9903 -0.0875 0.0859  0.1268  240 LEU A CD1 
1648 C  CD2 . LEU A 229 ? 1.0201 1.0166 1.0104 -0.0870 0.0809  0.1383  240 LEU A CD2 
1649 N  N   . SER A 230 ? 0.9532 0.9233 0.9048 -0.0938 0.0853  0.1197  241 SER A N   
1650 C  CA  . SER A 230 ? 0.9395 0.9065 0.8862 -0.0951 0.0871  0.1179  241 SER A CA  
1651 C  C   . SER A 230 ? 0.9379 0.8854 0.8770 -0.0976 0.0848  0.1161  241 SER A C   
1652 O  O   . SER A 230 ? 0.9338 0.8771 0.8733 -0.0984 0.0841  0.1186  241 SER A O   
1653 C  CB  . SER A 230 ? 0.9313 0.9051 0.8735 -0.0953 0.0914  0.1120  241 SER A CB  
1654 O  OG  . SER A 230 ? 0.9211 0.8913 0.8597 -0.0967 0.0932  0.1099  241 SER A OG  
1655 N  N   . LEU A 231 ? 0.9436 0.8791 0.8758 -0.0988 0.0836  0.1120  242 LEU A N   
1656 C  CA  . LEU A 231 ? 0.9474 0.8627 0.8705 -0.1013 0.0812  0.1101  242 LEU A CA  
1657 C  C   . LEU A 231 ? 0.9566 0.8643 0.8831 -0.1014 0.0763  0.1158  242 LEU A C   
1658 O  O   . LEU A 231 ? 0.9550 0.8529 0.8772 -0.1030 0.0759  0.1163  242 LEU A O   
1659 C  CB  . LEU A 231 ? 0.9558 0.8604 0.8714 -0.1023 0.0802  0.1053  242 LEU A CB  
1660 C  CG  . LEU A 231 ? 0.9658 0.8479 0.8693 -0.1049 0.0779  0.1022  242 LEU A CG  
1661 C  CD1 . LEU A 231 ? 0.9585 0.8313 0.8534 -0.1072 0.0812  0.0993  242 LEU A CD1 
1662 C  CD2 . LEU A 231 ? 0.9752 0.8519 0.8729 -0.1054 0.0781  0.0972  242 LEU A CD2 
1663 N  N   . SER A 232 ? 0.9678 0.8802 0.9027 -0.0998 0.0727  0.1202  243 SER A N   
1664 C  CA  . SER A 232 ? 0.9784 0.8837 0.9176 -0.0999 0.0677  0.1256  243 SER A CA  
1665 C  C   . SER A 232 ? 0.9698 0.8815 0.9139 -0.0996 0.0690  0.1297  243 SER A C   
1666 O  O   . SER A 232 ? 0.9748 0.8755 0.9170 -0.1008 0.0662  0.1319  243 SER A O   
1667 C  CB  . SER A 232 ? 0.9940 0.9045 0.9435 -0.0980 0.0640  0.1297  243 SER A CB  
1668 O  OG  . SER A 232 ? 0.9902 0.9197 0.9507 -0.0957 0.0668  0.1336  243 SER A OG  
1669 N  N   . GLU A 233 ? 0.9593 0.8882 0.9091 -0.0980 0.0732  0.1307  244 GLU A N   
1670 C  CA  . GLU A 233 ? 0.9525 0.8882 0.9071 -0.0977 0.0746  0.1344  244 GLU A CA  
1671 C  C   . GLU A 233 ? 0.9436 0.8686 0.8900 -0.0999 0.0764  0.1310  244 GLU A C   
1672 O  O   . GLU A 233 ? 0.9453 0.8644 0.8928 -0.1007 0.0749  0.1339  244 GLU A O   
1673 C  CB  . GLU A 233 ? 0.9473 0.9029 0.9085 -0.0955 0.0783  0.1359  244 GLU A CB  
1674 C  CG  . GLU A 233 ? 0.9600 0.9267 0.9304 -0.0933 0.0773  0.1402  244 GLU A CG  
1675 C  CD  . GLU A 233 ? 0.9724 0.9354 0.9506 -0.0928 0.0730  0.1465  244 GLU A CD  
1676 O  OE1 . GLU A 233 ? 0.9707 0.9272 0.9493 -0.0937 0.0712  0.1491  244 GLU A OE1 
1677 O  OE2 . GLU A 233 ? 0.9861 0.9528 0.9707 -0.0916 0.0716  0.1488  244 GLU A OE2 
1678 N  N   . VAL A 234 ? 0.9360 0.8583 0.8744 -0.1010 0.0798  0.1247  245 VAL A N   
1679 C  CA  . VAL A 234 ? 0.9296 0.8428 0.8613 -0.1032 0.0825  0.1212  245 VAL A CA  
1680 C  C   . VAL A 234 ? 0.9406 0.8323 0.8635 -0.1055 0.0795  0.1203  245 VAL A C   
1681 O  O   . VAL A 234 ? 0.9412 0.8235 0.8599 -0.1073 0.0808  0.1194  245 VAL A O   
1682 C  CB  . VAL A 234 ? 0.9209 0.8376 0.8475 -0.1037 0.0873  0.1146  245 VAL A CB  
1683 C  CG1 . VAL A 234 ? 0.9273 0.8346 0.8457 -0.1045 0.0866  0.1101  245 VAL A CG1 
1684 C  CG2 . VAL A 234 ? 0.9157 0.8256 0.8381 -0.1057 0.0909  0.1113  245 VAL A CG2 
1685 N  N   . ARG A 235 ? 0.9523 0.8361 0.8726 -0.1055 0.0752  0.1208  246 ARG A N   
1686 C  CA  . ARG A 235 ? 0.9674 0.8310 0.8799 -0.1075 0.0710  0.1211  246 ARG A CA  
1687 C  C   . ARG A 235 ? 0.9710 0.8345 0.8900 -0.1073 0.0686  0.1267  246 ARG A C   
1688 O  O   . ARG A 235 ? 0.9776 0.8269 0.8899 -0.1094 0.0681  0.1260  246 ARG A O   
1689 C  CB  . ARG A 235 ? 0.9819 0.8400 0.8942 -0.1070 0.0657  0.1219  246 ARG A CB  
1690 C  CG  . ARG A 235 ? 0.9842 0.8363 0.8876 -0.1078 0.0669  0.1162  246 ARG A CG  
1691 C  CD  . ARG A 235 ? 1.0016 0.8481 0.9065 -0.1071 0.0609  0.1177  246 ARG A CD  
1692 N  NE  . ARG A 235 ? 1.0210 0.8476 0.9187 -0.1089 0.0553  0.1190  246 ARG A NE  
1693 C  CZ  . ARG A 235 ? 1.0332 0.8406 0.9159 -0.1115 0.0548  0.1146  246 ARG A CZ  
1694 N  NH1 . ARG A 235 ? 1.0261 0.8331 0.9013 -0.1123 0.0599  0.1090  246 ARG A NH1 
1695 N  NH2 . ARG A 235 ? 1.0546 0.8429 0.9294 -0.1132 0.0495  0.1157  246 ARG A NH2 
1696 N  N   . GLU A 236 ? 0.9687 0.8480 0.9007 -0.1048 0.0672  0.1322  247 GLU A N   
1697 C  CA  . GLU A 236 ? 0.9721 0.8549 0.9125 -0.1042 0.0654  0.1380  247 GLU A CA  
1698 C  C   . GLU A 236 ? 0.9630 0.8462 0.9021 -0.1052 0.0696  0.1369  247 GLU A C   
1699 O  O   . GLU A 236 ? 0.9706 0.8434 0.9080 -0.1066 0.0681  0.1384  247 GLU A O   
1700 C  CB  . GLU A 236 ? 0.9714 0.8737 0.9256 -0.1012 0.0652  0.1433  247 GLU A CB  
1701 C  CG  . GLU A 236 ? 0.9862 0.8875 0.9456 -0.1002 0.0604  0.1463  247 GLU A CG  
1702 C  CD  . GLU A 236 ? 1.0012 0.8904 0.9623 -0.1010 0.0549  0.1500  247 GLU A CD  
1703 O  OE1 . GLU A 236 ? 0.9984 0.8835 0.9590 -0.1020 0.0553  0.1515  247 GLU A OE1 
1704 O  OE2 . GLU A 236 ? 1.0178 0.9012 0.9812 -0.1007 0.0500  0.1513  247 GLU A OE2 
1705 N  N   . CYS A 237 ? 0.9489 0.8438 0.8891 -0.1046 0.0746  0.1343  248 CYS A N   
1706 C  CA  . CYS A 237 ? 0.9414 0.8384 0.8828 -0.1053 0.0783  0.1336  248 CYS A CA  
1707 C  C   . CYS A 237 ? 0.9492 0.8252 0.8795 -0.1084 0.0785  0.1300  248 CYS A C   
1708 O  O   . CYS A 237 ? 0.9537 0.8240 0.8855 -0.1093 0.0783  0.1320  248 CYS A O   
1709 C  CB  . CYS A 237 ? 0.9283 0.8369 0.8700 -0.1048 0.0834  0.1295  248 CYS A CB  
1710 S  SG  . CYS A 237 ? 0.9248 0.8319 0.8674 -0.1063 0.0878  0.1275  248 CYS A SG  
1711 N  N   . LEU A 238 ? 0.9532 0.8171 0.8722 -0.1099 0.0789  0.1247  249 LEU A N   
1712 C  CA  . LEU A 238 ? 0.9641 0.8070 0.8702 -0.1130 0.0798  0.1206  249 LEU A CA  
1713 C  C   . LEU A 238 ? 0.9822 0.8102 0.8849 -0.1140 0.0743  0.1239  249 LEU A C   
1714 O  O   . LEU A 238 ? 0.9920 0.8066 0.8887 -0.1161 0.0752  0.1229  249 LEU A O   
1715 C  CB  . LEU A 238 ? 0.9661 0.8004 0.8609 -0.1143 0.0814  0.1145  249 LEU A CB  
1716 C  CG  . LEU A 238 ? 0.9535 0.7949 0.8475 -0.1146 0.0882  0.1092  249 LEU A CG  
1717 C  CD1 . LEU A 238 ? 0.9555 0.7927 0.8412 -0.1151 0.0890  0.1042  249 LEU A CD1 
1718 C  CD2 . LEU A 238 ? 0.9576 0.7876 0.8459 -0.1172 0.0929  0.1058  249 LEU A CD2 
1719 N  N   . LYS A 239 ? 0.9890 0.8191 0.8959 -0.1125 0.0685  0.1277  250 LYS A N   
1720 C  CA  . LYS A 239 ? 1.0080 0.8251 0.9133 -0.1133 0.0624  0.1311  250 LYS A CA  
1721 C  C   . LYS A 239 ? 1.0077 0.8279 0.9204 -0.1132 0.0631  0.1350  250 LYS A C   
1722 O  O   . LYS A 239 ? 1.0234 0.8286 0.9308 -0.1150 0.0606  0.1356  250 LYS A O   
1723 C  CB  . LYS A 239 ? 1.0145 0.8377 0.9275 -0.1112 0.0566  0.1350  250 LYS A CB  
1724 C  CG  . LYS A 239 ? 1.0364 0.8474 0.9498 -0.1117 0.0493  0.1388  250 LYS A CG  
1725 C  CD  . LYS A 239 ? 1.0387 0.8637 0.9671 -0.1088 0.0451  0.1444  250 LYS A CD  
1726 C  CE  . LYS A 239 ? 1.0537 0.8760 0.9905 -0.1085 0.0397  0.1503  250 LYS A CE  
1727 N  NZ  . LYS A 239 ? 1.0518 0.8929 1.0059 -0.1055 0.0386  0.1560  250 LYS A NZ  
1728 N  N   . LEU A 240 ? 0.9918 0.8311 0.9163 -0.1113 0.0666  0.1374  251 LEU A N   
1729 C  CA  . LEU A 240 ? 0.9920 0.8354 0.9243 -0.1112 0.0676  0.1410  251 LEU A CA  
1730 C  C   . LEU A 240 ? 0.9916 0.8252 0.9161 -0.1136 0.0729  0.1362  251 LEU A C   
1731 O  O   . LEU A 240 ? 1.0004 0.8269 0.9256 -0.1148 0.0730  0.1376  251 LEU A O   
1732 C  CB  . LEU A 240 ? 0.9785 0.8451 0.9254 -0.1084 0.0695  0.1453  251 LEU A CB  
1733 C  CG  . LEU A 240 ? 0.9819 0.8604 0.9403 -0.1058 0.0653  0.1517  251 LEU A CG  
1734 C  CD1 . LEU A 240 ? 0.9700 0.8699 0.9396 -0.1034 0.0683  0.1549  251 LEU A CD1 
1735 C  CD2 . LEU A 240 ? 0.9980 0.8686 0.9603 -0.1062 0.0610  0.1562  251 LEU A CD2 
1736 N  N   . ASP A 241 ? 0.9824 0.8162 0.9005 -0.1144 0.0775  0.1306  252 ASP A N   
1737 C  CA  . ASP A 241 ? 0.9828 0.8090 0.8955 -0.1166 0.0833  0.1259  252 ASP A CA  
1738 C  C   . ASP A 241 ? 0.9829 0.7990 0.8827 -0.1184 0.0870  0.1188  252 ASP A C   
1739 O  O   . ASP A 241 ? 0.9709 0.7979 0.8725 -0.1173 0.0890  0.1166  252 ASP A O   
1740 C  CB  . ASP A 241 ? 0.9698 0.8139 0.8955 -0.1150 0.0870  0.1277  252 ASP A CB  
1741 C  CG  . ASP A 241 ? 0.9705 0.8086 0.8927 -0.1171 0.0935  0.1224  252 ASP A CG  
1742 O  OD1 . ASP A 241 ? 0.9849 0.8031 0.8946 -0.1200 0.0954  0.1182  252 ASP A OD1 
1743 O  OD2 . ASP A 241 ? 0.9592 0.8121 0.8912 -0.1159 0.0968  0.1224  252 ASP A OD2 
1744 N  N   . GLN A 242 ? 0.9995 0.7939 0.8857 -0.1214 0.0879  0.1153  253 GLN A N   
1745 C  CA  . GLN A 242 ? 1.0056 0.7872 0.8778 -0.1235 0.0910  0.1088  253 GLN A CA  
1746 C  C   . GLN A 242 ? 0.9957 0.7834 0.8697 -0.1242 0.0988  0.1039  253 GLN A C   
1747 O  O   . GLN A 242 ? 0.9951 0.7789 0.8614 -0.1251 0.1018  0.0988  253 GLN A O   
1748 C  CB  . GLN A 242 ? 1.0322 0.7877 0.8883 -0.1268 0.0904  0.1064  253 GLN A CB  
1749 C  CG  . GLN A 242 ? 1.0471 0.7928 0.8980 -0.1266 0.0822  0.1098  253 GLN A CG  
1750 C  CD  . GLN A 242 ? 1.0415 0.7922 0.8911 -0.1252 0.0792  0.1091  253 GLN A CD  
1751 O  OE1 . GLN A 242 ? 1.0506 0.7897 0.8875 -0.1269 0.0813  0.1041  253 GLN A OE1 
1752 N  NE2 . GLN A 242 ? 1.0283 0.7961 0.8913 -0.1221 0.0747  0.1141  253 GLN A NE2 
1753 N  N   . ASP A 243 ? 0.9903 0.7874 0.8749 -0.1237 0.1018  0.1053  254 ASP A N   
1754 C  CA  . ASP A 243 ? 0.9884 0.7863 0.8739 -0.1250 0.1092  0.1002  254 ASP A CA  
1755 C  C   . ASP A 243 ? 0.9687 0.7897 0.8682 -0.1225 0.1111  0.1007  254 ASP A C   
1756 O  O   . ASP A 243 ? 0.9676 0.7909 0.8690 -0.1234 0.1170  0.0959  254 ASP A O   
1757 C  CB  . ASP A 243 ? 1.0026 0.7906 0.8886 -0.1269 0.1122  0.1003  254 ASP A CB  
1758 C  CG  . ASP A 243 ? 1.0268 0.7891 0.8958 -0.1301 0.1125  0.0976  254 ASP A CG  
1759 O  OD1 . ASP A 243 ? 1.0336 0.7844 0.8893 -0.1314 0.1125  0.0940  254 ASP A OD1 
1760 O  OD2 . ASP A 243 ? 1.0414 0.7945 0.9100 -0.1314 0.1128  0.0991  254 ASP A OD2 
1761 N  N   . HIS A 244 ? 0.9559 0.7934 0.8652 -0.1194 0.1060  0.1064  255 HIS A N   
1762 C  CA  . HIS A 244 ? 0.9404 0.7996 0.8611 -0.1169 0.1069  0.1071  255 HIS A CA  
1763 C  C   . HIS A 244 ? 0.9365 0.7948 0.8513 -0.1178 0.1113  0.1002  255 HIS A C   
1764 O  O   . HIS A 244 ? 0.9369 0.7891 0.8427 -0.1182 0.1100  0.0980  255 HIS A O   
1765 C  CB  . HIS A 244 ? 0.9330 0.8058 0.8598 -0.1139 0.1013  0.1128  255 HIS A CB  
1766 C  CG  . HIS A 244 ? 0.9227 0.8172 0.8629 -0.1112 0.1013  0.1162  255 HIS A CG  
1767 N  ND1 . HIS A 244 ? 0.9232 0.8282 0.8733 -0.1091 0.0975  0.1234  255 HIS A ND1 
1768 C  CD2 . HIS A 244 ? 0.9143 0.8215 0.8596 -0.1104 0.1044  0.1134  255 HIS A CD2 
1769 C  CE1 . HIS A 244 ? 0.9167 0.8395 0.8763 -0.1071 0.0983  0.1251  255 HIS A CE1 
1770 N  NE2 . HIS A 244 ? 0.9113 0.8358 0.8683 -0.1078 0.1023  0.1190  255 HIS A NE2 
1771 N  N   . LYS A 245 ? 0.9352 0.7984 0.8554 -0.1184 0.1166  0.0966  256 LYS A N   
1772 C  CA  . LYS A 245 ? 0.9344 0.7955 0.8498 -0.1196 0.1215  0.0895  256 LYS A CA  
1773 C  C   . LYS A 245 ? 0.9212 0.7995 0.8411 -0.1170 0.1195  0.0896  256 LYS A C   
1774 O  O   . LYS A 245 ? 0.9191 0.7970 0.8346 -0.1176 0.1224  0.0841  256 LYS A O   
1775 C  CB  . LYS A 245 ? 0.9394 0.8006 0.8609 -0.1210 0.1275  0.0855  256 LYS A CB  
1776 C  CG  . LYS A 245 ? 0.9578 0.7966 0.8688 -0.1246 0.1324  0.0812  256 LYS A CG  
1777 C  CD  . LYS A 245 ? 0.9656 0.8044 0.8841 -0.1260 0.1392  0.0770  256 LYS A CD  
1778 C  CE  . LYS A 245 ? 0.9759 0.8111 0.9007 -0.1265 0.1394  0.0805  256 LYS A CE  
1779 N  NZ  . LYS A 245 ? 0.9811 0.8237 0.9190 -0.1268 0.1446  0.0777  256 LYS A NZ  
1780 N  N   . ARG A 246 ? 0.9145 0.8076 0.8430 -0.1143 0.1149  0.0958  257 ARG A N   
1781 C  CA  . ARG A 246 ? 0.9051 0.8160 0.8392 -0.1118 0.1135  0.0963  257 ARG A CA  
1782 C  C   . ARG A 246 ? 0.9027 0.8140 0.8322 -0.1106 0.1093  0.0989  257 ARG A C   
1783 O  O   . ARG A 246 ? 0.8982 0.8173 0.8267 -0.1095 0.1093  0.0968  257 ARG A O   
1784 C  CB  . ARG A 246 ? 0.9024 0.8305 0.8497 -0.1095 0.1121  0.1011  257 ARG A CB  
1785 C  CG  . ARG A 246 ? 0.8983 0.8421 0.8513 -0.1080 0.1133  0.0987  257 ARG A CG  
1786 C  CD  . ARG A 246 ? 0.9007 0.8580 0.8660 -0.1064 0.1124  0.1025  257 ARG A CD  
1787 N  NE  . ARG A 246 ? 0.9014 0.8677 0.8713 -0.1041 0.1078  0.1104  257 ARG A NE  
1788 C  CZ  . ARG A 246 ? 0.9054 0.8708 0.8811 -0.1039 0.1061  0.1158  257 ARG A CZ  
1789 N  NH1 . ARG A 246 ? 0.9093 0.8653 0.8869 -0.1058 0.1087  0.1140  257 ARG A NH1 
1790 N  NH2 . ARG A 246 ? 0.9076 0.8813 0.8873 -0.1018 0.1021  0.1228  257 ARG A NH2 
1791 N  N   . CYS A 247 ? 0.9078 0.8107 0.8350 -0.1108 0.1056  0.1034  258 CYS A N   
1792 C  CA  . CYS A 247 ? 0.9090 0.8104 0.8326 -0.1098 0.1013  0.1058  258 CYS A CA  
1793 C  C   . CYS A 247 ? 0.9139 0.8007 0.8251 -0.1118 0.1027  0.1000  258 CYS A C   
1794 O  O   . CYS A 247 ? 0.9120 0.8031 0.8212 -0.1109 0.1017  0.0986  258 CYS A O   
1795 C  CB  . CYS A 247 ? 0.9162 0.8114 0.8412 -0.1096 0.0967  0.1119  258 CYS A CB  
1796 S  SG  . CYS A 247 ? 0.9122 0.8277 0.8522 -0.1066 0.0944  0.1196  258 CYS A SG  
1797 N  N   . PHE A 248 ? 0.9225 0.7919 0.8253 -0.1146 0.1052  0.0966  259 PHE A N   
1798 C  CA  . PHE A 248 ? 0.9310 0.7844 0.8207 -0.1169 0.1071  0.0909  259 PHE A CA  
1799 C  C   . PHE A 248 ? 0.9235 0.7863 0.8140 -0.1164 0.1106  0.0858  259 PHE A C   
1800 O  O   . PHE A 248 ? 0.9254 0.7860 0.8104 -0.1162 0.1094  0.0838  259 PHE A O   
1801 C  CB  . PHE A 248 ? 0.9431 0.7787 0.8250 -0.1200 0.1109  0.0877  259 PHE A CB  
1802 C  CG  . PHE A 248 ? 0.9595 0.7734 0.8255 -0.1225 0.1109  0.0842  259 PHE A CG  
1803 C  CD1 . PHE A 248 ? 0.9710 0.7730 0.8305 -0.1229 0.1051  0.0877  259 PHE A CD1 
1804 C  CD2 . PHE A 248 ? 0.9663 0.7710 0.8240 -0.1247 0.1166  0.0774  259 PHE A CD2 
1805 C  CE1 . PHE A 248 ? 0.9901 0.7710 0.8339 -0.1253 0.1044  0.0846  259 PHE A CE1 
1806 C  CE2 . PHE A 248 ? 0.9852 0.7686 0.8269 -0.1272 0.1167  0.0742  259 PHE A CE2 
1807 C  CZ  . PHE A 248 ? 0.9977 0.7689 0.8320 -0.1275 0.1104  0.0779  259 PHE A CZ  
1808 N  N   . ALA A 249 ? 0.9167 0.7901 0.8148 -0.1161 0.1147  0.0839  260 ALA A N   
1809 C  CA  . ALA A 249 ? 0.9109 0.7944 0.8112 -0.1155 0.1180  0.0789  260 ALA A CA  
1810 C  C   . ALA A 249 ? 0.9050 0.8008 0.8073 -0.1131 0.1148  0.0802  260 ALA A C   
1811 O  O   . ALA A 249 ? 0.9065 0.8005 0.8035 -0.1135 0.1160  0.0757  260 ALA A O   
1812 C  CB  . ALA A 249 ? 0.9054 0.8025 0.8170 -0.1147 0.1205  0.0789  260 ALA A CB  
1813 N  N   . HIS A 250 ? 0.9002 0.8083 0.8105 -0.1107 0.1108  0.0864  261 HIS A N   
1814 C  CA  . HIS A 250 ? 0.8976 0.8173 0.8106 -0.1084 0.1080  0.0884  261 HIS A CA  
1815 C  C   . HIS A 250 ? 0.9046 0.8122 0.8096 -0.1090 0.1052  0.0883  261 HIS A C   
1816 O  O   . HIS A 250 ? 0.9053 0.8182 0.8095 -0.1080 0.1045  0.0868  261 HIS A O   
1817 C  CB  . HIS A 250 ? 0.8953 0.8280 0.8180 -0.1061 0.1047  0.0957  261 HIS A CB  
1818 C  CG  . HIS A 250 ? 0.8961 0.8401 0.8220 -0.1038 0.1021  0.0984  261 HIS A CG  
1819 N  ND1 . HIS A 250 ? 0.8952 0.8485 0.8207 -0.1028 0.1039  0.0945  261 HIS A ND1 
1820 C  CD2 . HIS A 250 ? 0.9002 0.8472 0.8299 -0.1023 0.0982  0.1042  261 HIS A CD2 
1821 C  CE1 . HIS A 250 ? 0.8989 0.8606 0.8277 -0.1008 0.1015  0.0980  261 HIS A CE1 
1822 N  NE2 . HIS A 250 ? 0.9021 0.8603 0.8338 -0.1005 0.0981  0.1039  261 HIS A NE2 
1823 N  N   . TYR A 251 ? 0.9123 0.8037 0.8115 -0.1107 0.1033  0.0900  262 TYR A N   
1824 C  CA  . TYR A 251 ? 0.9230 0.8012 0.8146 -0.1114 0.0994  0.0905  262 TYR A CA  
1825 C  C   . TYR A 251 ? 0.9295 0.7970 0.8108 -0.1131 0.1019  0.0839  262 TYR A C   
1826 O  O   . TYR A 251 ? 0.9347 0.8020 0.8141 -0.1124 0.0995  0.0833  262 TYR A O   
1827 C  CB  . TYR A 251 ? 0.9323 0.7956 0.8201 -0.1128 0.0964  0.0939  262 TYR A CB  
1828 C  CG  . TYR A 251 ? 0.9489 0.7932 0.8256 -0.1143 0.0928  0.0931  262 TYR A CG  
1829 C  CD1 . TYR A 251 ? 0.9553 0.8011 0.8349 -0.1128 0.0871  0.0968  262 TYR A CD1 
1830 C  CD2 . TYR A 251 ? 0.9613 0.7857 0.8249 -0.1174 0.0949  0.0888  262 TYR A CD2 
1831 C  CE1 . TYR A 251 ? 0.9733 0.8015 0.8434 -0.1142 0.0829  0.0962  262 TYR A CE1 
1832 C  CE2 . TYR A 251 ? 0.9802 0.7863 0.8327 -0.1188 0.0910  0.0882  262 TYR A CE2 
1833 C  CZ  . TYR A 251 ? 0.9859 0.7941 0.8419 -0.1172 0.0847  0.0920  262 TYR A CZ  
1834 O  OH  . TYR A 251 ? 1.0078 0.7971 0.8529 -0.1186 0.0802  0.0914  262 TYR A OH  
1835 N  N   . LYS A 252 ? 0.9311 0.7901 0.8065 -0.1153 0.1069  0.0789  263 LYS A N   
1836 C  CA  . LYS A 252 ? 0.9387 0.7881 0.8047 -0.1170 0.1099  0.0724  263 LYS A CA  
1837 C  C   . LYS A 252 ? 0.9314 0.7968 0.8031 -0.1148 0.1100  0.0709  263 LYS A C   
1838 O  O   . LYS A 252 ? 0.9392 0.7992 0.8051 -0.1152 0.1095  0.0679  263 LYS A O   
1839 C  CB  . LYS A 252 ? 0.9400 0.7838 0.8027 -0.1192 0.1165  0.0669  263 LYS A CB  
1840 C  CG  . LYS A 252 ? 0.9456 0.7786 0.8063 -0.1211 0.1183  0.0681  263 LYS A CG  
1841 C  CD  . LYS A 252 ? 0.9664 0.7741 0.8115 -0.1243 0.1189  0.0658  263 LYS A CD  
1842 C  CE  . LYS A 252 ? 0.9762 0.7738 0.8137 -0.1269 0.1261  0.0584  263 LYS A CE  
1843 N  NZ  . LYS A 252 ? 1.0013 0.7728 0.8212 -0.1300 0.1268  0.0560  263 LYS A NZ  
1844 N  N   . GLN A 253 ? 0.9187 0.8036 0.8017 -0.1126 0.1104  0.0731  264 GLN A N   
1845 C  CA  . GLN A 253 ? 0.9136 0.8144 0.8018 -0.1107 0.1113  0.0711  264 GLN A CA  
1846 C  C   . GLN A 253 ? 0.9180 0.8223 0.8074 -0.1090 0.1071  0.0740  264 GLN A C   
1847 O  O   . GLN A 253 ? 0.9243 0.8256 0.8094 -0.1091 0.1074  0.0702  264 GLN A O   
1848 C  CB  . GLN A 253 ? 0.9033 0.8232 0.8024 -0.1088 0.1124  0.0731  264 GLN A CB  
1849 C  CG  . GLN A 253 ? 0.9008 0.8377 0.8048 -0.1067 0.1130  0.0714  264 GLN A CG  
1850 C  CD  . GLN A 253 ? 0.9033 0.8381 0.8030 -0.1079 0.1171  0.0637  264 GLN A CD  
1851 O  OE1 . GLN A 253 ? 0.9070 0.8274 0.8001 -0.1104 0.1199  0.0596  264 GLN A OE1 
1852 N  NE2 . GLN A 253 ? 0.9035 0.8523 0.8069 -0.1062 0.1177  0.0616  264 GLN A NE2 
1853 N  N   . VAL A 254 ? 0.9164 0.8271 0.8125 -0.1073 0.1033  0.0806  265 VAL A N   
1854 C  CA  . VAL A 254 ? 0.9226 0.8381 0.8221 -0.1055 0.0995  0.0837  265 VAL A CA  
1855 C  C   . VAL A 254 ? 0.9356 0.8336 0.8264 -0.1070 0.0971  0.0817  265 VAL A C   
1856 O  O   . VAL A 254 ? 0.9426 0.8428 0.8336 -0.1061 0.0961  0.0803  265 VAL A O   
1857 C  CB  . VAL A 254 ? 0.9227 0.8451 0.8305 -0.1038 0.0959  0.0913  265 VAL A CB  
1858 C  CG1 . VAL A 254 ? 0.9155 0.8572 0.8321 -0.1017 0.0977  0.0935  265 VAL A CG1 
1859 C  CG2 . VAL A 254 ? 0.9234 0.8328 0.8284 -0.1054 0.0941  0.0940  265 VAL A CG2 
1860 N  N   . LYS A 255 ? 0.9415 0.8217 0.8241 -0.1093 0.0962  0.0815  266 LYS A N   
1861 C  CA  . LYS A 255 ? 0.9579 0.8202 0.8313 -0.1108 0.0930  0.0802  266 LYS A CA  
1862 C  C   . LYS A 255 ? 0.9617 0.8232 0.8304 -0.1112 0.0958  0.0741  266 LYS A C   
1863 O  O   . LYS A 255 ? 0.9702 0.8337 0.8405 -0.1101 0.0933  0.0740  266 LYS A O   
1864 C  CB  . LYS A 255 ? 0.9661 0.8087 0.8292 -0.1135 0.0930  0.0796  266 LYS A CB  
1865 C  CG  . LYS A 255 ? 0.9874 0.8096 0.8400 -0.1151 0.0884  0.0795  266 LYS A CG  
1866 C  CD  . LYS A 255 ? 0.9972 0.8039 0.8437 -0.1169 0.0860  0.0823  266 LYS A CD  
1867 C  CE  . LYS A 255 ? 1.0021 0.7931 0.8362 -0.1200 0.0909  0.0777  266 LYS A CE  
1868 N  NZ  . LYS A 255 ? 1.0262 0.7946 0.8444 -0.1225 0.0896  0.0743  266 LYS A NZ  
1869 N  N   . LYS A 256 ? 0.9563 0.8160 0.8204 -0.1127 0.1012  0.0690  267 LYS A N   
1870 C  CA  . LYS A 256 ? 0.9602 0.8190 0.8199 -0.1134 0.1048  0.0626  267 LYS A CA  
1871 C  C   . LYS A 256 ? 0.9569 0.8325 0.8248 -0.1109 0.1042  0.0625  267 LYS A C   
1872 O  O   . LYS A 256 ? 0.9671 0.8390 0.8316 -0.1110 0.1040  0.0592  267 LYS A O   
1873 C  CB  . LYS A 256 ? 0.9518 0.8132 0.8108 -0.1146 0.1110  0.0582  267 LYS A CB  
1874 C  CG  . LYS A 256 ? 0.9545 0.8180 0.8112 -0.1152 0.1153  0.0514  267 LYS A CG  
1875 C  CD  . LYS A 256 ? 0.9478 0.8138 0.8057 -0.1164 0.1211  0.0476  267 LYS A CD  
1876 C  CE  . LYS A 256 ? 0.9521 0.8199 0.8084 -0.1171 0.1257  0.0406  267 LYS A CE  
1877 N  NZ  . LYS A 256 ? 0.9664 0.8143 0.8115 -0.1203 0.1295  0.0360  267 LYS A NZ  
1878 N  N   . LEU A 257 ? 0.9452 0.8387 0.8235 -0.1086 0.1041  0.0661  268 LEU A N   
1879 C  CA  . LEU A 257 ? 0.9438 0.8544 0.8295 -0.1063 0.1048  0.0654  268 LEU A CA  
1880 C  C   . LEU A 257 ? 0.9546 0.8659 0.8440 -0.1048 0.1003  0.0691  268 LEU A C   
1881 O  O   . LEU A 257 ? 0.9615 0.8789 0.8531 -0.1037 0.1007  0.0668  268 LEU A O   
1882 C  CB  . LEU A 257 ? 0.9318 0.8604 0.8259 -0.1046 0.1067  0.0676  268 LEU A CB  
1883 C  CG  . LEU A 257 ? 0.9320 0.8772 0.8309 -0.1029 0.1090  0.0649  268 LEU A CG  
1884 C  CD1 . LEU A 257 ? 0.9232 0.8794 0.8255 -0.1026 0.1119  0.0637  268 LEU A CD1 
1885 C  CD2 . LEU A 257 ? 0.9372 0.8936 0.8435 -0.1004 0.1064  0.0701  268 LEU A CD2 
1886 N  N   . ASN A 258 ? 0.9580 0.8628 0.8487 -0.1048 0.0961  0.0746  269 ASN A N   
1887 C  CA  . ASN A 258 ? 0.9710 0.8747 0.8661 -0.1035 0.0914  0.0781  269 ASN A CA  
1888 C  C   . ASN A 258 ? 0.9871 0.8744 0.8740 -0.1050 0.0893  0.0745  269 ASN A C   
1889 O  O   . ASN A 258 ? 0.9985 0.8888 0.8887 -0.1039 0.0880  0.0735  269 ASN A O   
1890 C  CB  . ASN A 258 ? 0.9722 0.8716 0.8705 -0.1034 0.0872  0.0845  269 ASN A CB  
1891 C  CG  . ASN A 258 ? 0.9881 0.8853 0.8919 -0.1022 0.0820  0.0883  269 ASN A CG  
1892 O  OD1 . ASN A 258 ? 0.9861 0.8974 0.8994 -0.1000 0.0823  0.0901  269 ASN A OD1 
1893 N  ND2 . ASN A 258 ? 1.0070 0.8861 0.9048 -0.1037 0.0771  0.0893  269 ASN A ND2 
1894 N  N   . LYS A 259 ? 0.9904 0.8601 0.8663 -0.1076 0.0891  0.0726  270 LYS A N   
1895 C  CA  . LYS A 259 ? 1.0090 0.8604 0.8747 -0.1093 0.0871  0.0693  270 LYS A CA  
1896 C  C   . LYS A 259 ? 1.0137 0.8707 0.8799 -0.1088 0.0898  0.0641  270 LYS A C   
1897 O  O   . LYS A 259 ? 1.0316 0.8797 0.8950 -0.1090 0.0867  0.0629  270 LYS A O   
1898 C  CB  . LYS A 259 ? 1.0112 0.8452 0.8640 -0.1123 0.0891  0.0665  270 LYS A CB  
1899 C  CG  . LYS A 259 ? 1.0353 0.8473 0.8765 -0.1143 0.0852  0.0654  270 LYS A CG  
1900 C  CD  . LYS A 259 ? 1.0416 0.8358 0.8687 -0.1174 0.0883  0.0621  270 LYS A CD  
1901 C  CE  . LYS A 259 ? 1.0716 0.8419 0.8856 -0.1194 0.0835  0.0616  270 LYS A CE  
1902 N  NZ  . LYS A 259 ? 1.0865 0.8356 0.8838 -0.1228 0.0866  0.0581  270 LYS A NZ  
1903 N  N   . LEU A 260 ? 0.9991 0.8709 0.8691 -0.1081 0.0952  0.0612  271 LEU A N   
1904 C  CA  . LEU A 260 ? 1.0028 0.8798 0.8724 -0.1078 0.0986  0.0555  271 LEU A CA  
1905 C  C   . LEU A 260 ? 1.0081 0.8991 0.8878 -0.1053 0.0972  0.0569  271 LEU A C   
1906 O  O   . LEU A 260 ? 1.0232 0.9108 0.9022 -0.1051 0.0965  0.0540  271 LEU A O   
1907 C  CB  . LEU A 260 ? 0.9873 0.8739 0.8570 -0.1082 0.1046  0.0516  271 LEU A CB  
1908 C  CG  . LEU A 260 ? 0.9907 0.8619 0.8495 -0.1111 0.1079  0.0468  271 LEU A CG  
1909 C  CD1 . LEU A 260 ? 0.9761 0.8579 0.8376 -0.1113 0.1134  0.0437  271 LEU A CD1 
1910 C  CD2 . LEU A 260 ? 1.0088 0.8689 0.8605 -0.1123 0.1084  0.0418  271 LEU A CD2 
1911 N  N   . ILE A 261 ? 0.9981 0.9042 0.8872 -0.1033 0.0971  0.0613  272 ILE A N   
1912 C  CA  . ILE A 261 ? 1.0050 0.9250 0.9040 -0.1009 0.0966  0.0631  272 ILE A CA  
1913 C  C   . ILE A 261 ? 1.0227 0.9339 0.9247 -0.1005 0.0910  0.0666  272 ILE A C   
1914 O  O   . ILE A 261 ? 1.0371 0.9523 0.9444 -0.0993 0.0904  0.0656  272 ILE A O   
1915 C  CB  . ILE A 261 ? 0.9937 0.9304 0.9008 -0.0991 0.0979  0.0675  272 ILE A CB  
1916 C  CG1 . ILE A 261 ? 0.9781 0.9229 0.8827 -0.0995 0.1025  0.0644  272 ILE A CG1 
1917 C  CG2 . ILE A 261 ? 1.0044 0.9553 0.9207 -0.0967 0.0985  0.0686  272 ILE A CG2 
1918 C  CD1 . ILE A 261 ? 0.9701 0.9291 0.8812 -0.0980 0.1033  0.0690  272 ILE A CD1 
1919 N  N   . GLU A 262 ? 1.0239 0.9227 0.9230 -0.1015 0.0867  0.0706  273 GLU A N   
1920 C  CA  . GLU A 262 ? 1.0436 0.9331 0.9459 -0.1012 0.0805  0.0739  273 GLU A CA  
1921 C  C   . GLU A 262 ? 1.0621 0.9375 0.9569 -0.1025 0.0790  0.0693  273 GLU A C   
1922 O  O   . GLU A 262 ? 1.0818 0.9551 0.9818 -0.1016 0.0754  0.0698  273 GLU A O   
1923 C  CB  . GLU A 262 ? 1.0430 0.9217 0.9432 -0.1021 0.0758  0.0790  273 GLU A CB  
1924 C  CG  . GLU A 262 ? 1.0520 0.9364 0.9645 -0.1002 0.0713  0.0854  273 GLU A CG  
1925 C  CD  . GLU A 262 ? 1.0518 0.9264 0.9628 -0.1011 0.0668  0.0905  273 GLU A CD  
1926 O  OE1 . GLU A 262 ? 1.0648 0.9200 0.9658 -0.1031 0.0627  0.0898  273 GLU A OE1 
1927 O  OE2 . GLU A 262 ? 1.0409 0.9267 0.9605 -0.0997 0.0672  0.0954  273 GLU A OE2 
1928 N  N   . SER A 263 ? 1.0574 0.9236 0.9407 -0.1046 0.0819  0.0646  274 SER A N   
1929 C  CA  . SER A 263 ? 1.0753 0.9285 0.9506 -0.1059 0.0813  0.0599  274 SER A CA  
1930 C  C   . SER A 263 ? 1.0797 0.9456 0.9618 -0.1044 0.0844  0.0561  274 SER A C   
1931 O  O   . SER A 263 ? 1.1004 0.9618 0.9851 -0.1039 0.0813  0.0554  274 SER A O   
1932 C  CB  . SER A 263 ? 1.0689 0.9112 0.9311 -0.1085 0.0852  0.0557  274 SER A CB  
1933 O  OG  . SER A 263 ? 1.0908 0.9162 0.9432 -0.1102 0.0837  0.0521  274 SER A OG  
1934 N  N   . ALA A 264 ? 1.0623 0.9442 0.9475 -0.1036 0.0903  0.0537  275 ALA A N   
1935 C  CA  . ALA A 264 ? 1.0665 0.9617 0.9578 -0.1021 0.0939  0.0498  275 ALA A CA  
1936 C  C   . ALA A 264 ? 1.0829 0.9847 0.9854 -0.1000 0.0908  0.0527  275 ALA A C   
1937 O  O   . ALA A 264 ? 1.1016 1.0001 1.0055 -0.0998 0.0900  0.0498  275 ALA A O   
1938 C  CB  . ALA A 264 ? 1.0467 0.9593 0.9409 -0.1013 0.0995  0.0482  275 ALA A CB  
1939 N  N   . GLU A 265 ? 1.0783 0.9887 0.9892 -0.0985 0.0892  0.0585  276 GLU A N   
1940 C  CA  . GLU A 265 ? 1.0966 1.0127 1.0192 -0.0966 0.0865  0.0617  276 GLU A CA  
1941 C  C   . GLU A 265 ? 1.1214 1.0217 1.0436 -0.0972 0.0807  0.0616  276 GLU A C   
1942 O  O   . GLU A 265 ? 1.1410 1.0451 1.0715 -0.0959 0.0800  0.0607  276 GLU A O   
1943 C  CB  . GLU A 265 ? 1.0907 1.0136 1.0212 -0.0954 0.0846  0.0686  276 GLU A CB  
1944 C  CG  . GLU A 265 ? 1.0733 1.0142 1.0071 -0.0942 0.0899  0.0695  276 GLU A CG  
1945 C  CD  . GLU A 265 ? 1.0791 1.0344 1.0176 -0.0927 0.0949  0.0657  276 GLU A CD  
1946 O  OE1 . GLU A 265 ? 1.1003 1.0560 1.0455 -0.0918 0.0940  0.0649  276 GLU A OE1 
1947 O  OE2 . GLU A 265 ? 1.0641 1.0303 0.9999 -0.0925 0.0996  0.0635  276 GLU A OE2 
1948 N  N   . GLU A 266 ? 1.1234 1.0054 1.0359 -0.0992 0.0763  0.0625  277 GLU A N   
1949 C  CA  . GLU A 266 ? 1.1502 1.0164 1.0617 -0.0998 0.0698  0.0628  277 GLU A CA  
1950 C  C   . GLU A 266 ? 1.1649 1.0272 1.0726 -0.1003 0.0717  0.0568  277 GLU A C   
1951 O  O   . GLU A 266 ? 1.1916 1.0483 1.1041 -0.0997 0.0677  0.0565  277 GLU A O   
1952 C  CB  . GLU A 266 ? 1.1522 0.9987 1.0522 -0.1019 0.0648  0.0649  277 GLU A CB  
1953 C  CG  . GLU A 266 ? 1.1837 1.0143 1.0842 -0.1022 0.0566  0.0667  277 GLU A CG  
1954 C  CD  . GLU A 266 ? 1.1886 0.9995 1.0772 -0.1043 0.0513  0.0692  277 GLU A CD  
1955 O  OE1 . GLU A 266 ? 1.1657 0.9768 1.0469 -0.1054 0.0548  0.0694  277 GLU A OE1 
1956 O  OE2 . GLU A 266 ? 1.2171 1.0124 1.1038 -0.1048 0.0436  0.0708  277 GLU A OE2 
1957 N  N   . LEU A 267 ? 1.1494 1.0149 1.0492 -0.1013 0.0778  0.0519  278 LEU A N   
1958 C  CA  . LEU A 267 ? 1.1624 1.0252 1.0586 -0.1018 0.0804  0.0458  278 LEU A CA  
1959 C  C   . LEU A 267 ? 1.1695 1.0497 1.0783 -0.0995 0.0836  0.0440  278 LEU A C   
1960 O  O   . LEU A 267 ? 1.1903 1.0676 1.1003 -0.0994 0.0836  0.0401  278 LEU A O   
1961 C  CB  . LEU A 267 ? 1.1460 1.0062 1.0305 -0.1037 0.0858  0.0410  278 LEU A CB  
1962 C  CG  . LEU A 267 ? 1.1442 0.9855 1.0157 -0.1061 0.0832  0.0425  278 LEU A CG  
1963 C  CD1 . LEU A 267 ? 1.1187 0.9644 0.9844 -0.1072 0.0887  0.0410  278 LEU A CD1 
1964 C  CD2 . LEU A 267 ? 1.1706 0.9919 1.0314 -0.1081 0.0807  0.0394  278 LEU A CD2 
1965 N  N   . ILE A 268 ? 1.1550 1.0526 1.0729 -0.0977 0.0863  0.0467  279 ILE A N   
1966 C  CA  . ILE A 268 ? 1.1654 1.0790 1.0947 -0.0956 0.0896  0.0454  279 ILE A CA  
1967 C  C   . ILE A 268 ? 1.1919 1.1028 1.1325 -0.0943 0.0846  0.0487  279 ILE A C   
1968 O  O   . ILE A 268 ? 1.2105 1.1295 1.1603 -0.0929 0.0865  0.0467  279 ILE A O   
1969 C  CB  . ILE A 268 ? 1.1473 1.0804 1.0812 -0.0942 0.0950  0.0467  279 ILE A CB  
1970 C  CG1 . ILE A 268 ? 1.1469 1.0840 1.0874 -0.0932 0.0923  0.0539  279 ILE A CG1 
1971 C  CG2 . ILE A 268 ? 1.1215 1.0565 1.0453 -0.0955 0.0991  0.0435  279 ILE A CG2 
1972 C  CD1 . ILE A 268 ? 1.1696 1.1173 1.1248 -0.0910 0.0922  0.0570  279 ILE A CD1 
1973 N  N   . ARG A 269 ? 1.1959 1.0949 1.1359 -0.0949 0.0782  0.0537  280 ARG A N   
1974 C  CA  . ARG A 269 ? 1.2242 1.1181 1.1749 -0.0939 0.0722  0.0569  280 ARG A CA  
1975 C  C   . ARG A 269 ? 1.2507 1.1294 1.1974 -0.0949 0.0682  0.0534  280 ARG A C   
1976 O  O   . ARG A 269 ? 1.2793 1.1566 1.2367 -0.0938 0.0647  0.0540  280 ARG A O   
1977 C  CB  . ARG A 269 ? 1.2234 1.1099 1.1753 -0.0941 0.0662  0.0633  280 ARG A CB  
1978 C  CG  . ARG A 269 ? 1.2524 1.1408 1.2205 -0.0924 0.0615  0.0673  280 ARG A CG  
1979 C  CD  . ARG A 269 ? 1.2505 1.1362 1.2223 -0.0923 0.0567  0.0739  280 ARG A CD  
1980 N  NE  . ARG A 269 ? 1.2190 1.1150 1.1866 -0.0923 0.0617  0.0757  280 ARG A NE  
1981 C  CZ  . ARG A 269 ? 1.1978 1.0850 1.1530 -0.0940 0.0606  0.0766  280 ARG A CZ  
1982 N  NH1 . ARG A 269 ? 1.2051 1.0724 1.1497 -0.0959 0.0548  0.0761  280 ARG A NH1 
1983 N  NH2 . ARG A 269 ? 1.1720 1.0701 1.1254 -0.0938 0.0653  0.0781  280 ARG A NH2 
1984 N  N   . ASP A 270 ? 1.2437 1.1105 1.1754 -0.0970 0.0688  0.0499  281 ASP A N   
1985 C  CA  . ASP A 270 ? 1.2694 1.1214 1.1959 -0.0981 0.0656  0.0463  281 ASP A CA  
1986 C  C   . ASP A 270 ? 1.2752 1.1353 1.2023 -0.0978 0.0717  0.0399  281 ASP A C   
1987 O  O   . ASP A 270 ? 1.3053 1.1542 1.2283 -0.0987 0.0699  0.0364  281 ASP A O   
1988 C  CB  . ASP A 270 ? 1.2671 1.0984 1.1766 -0.1007 0.0619  0.0464  281 ASP A CB  
1989 C  CG  . ASP A 270 ? 1.2725 1.0932 1.1818 -0.1010 0.0544  0.0525  281 ASP A CG  
1990 O  OD1 . ASP A 270 ? 1.2910 1.1139 1.2133 -0.0994 0.0494  0.0560  281 ASP A OD1 
1991 O  OD2 . ASP A 270 ? 1.2601 1.0703 1.1568 -0.1028 0.0536  0.0538  281 ASP A OD2 
1992 N  N   . GLY A 271 ? 1.2493 1.1286 1.1816 -0.0966 0.0788  0.0383  282 GLY A N   
1993 C  CA  . GLY A 271 ? 1.2557 1.1437 1.1882 -0.0963 0.0850  0.0319  282 GLY A CA  
1994 C  C   . GLY A 271 ? 1.2450 1.1237 1.1629 -0.0985 0.0876  0.0270  282 GLY A C   
1995 O  O   . GLY A 271 ? 1.2541 1.1343 1.1710 -0.0987 0.0910  0.0214  282 GLY A O   
1996 N  N   . ARG A 272 ? 1.2273 1.0963 1.1341 -0.1002 0.0863  0.0290  283 ARG A N   
1997 C  CA  . ARG A 272 ? 1.2162 1.0772 1.1097 -0.1024 0.0897  0.0245  283 ARG A CA  
1998 C  C   . ARG A 272 ? 1.1891 1.0671 1.0834 -0.1019 0.0966  0.0226  283 ARG A C   
1999 O  O   . ARG A 272 ? 1.1675 1.0439 1.0550 -0.1030 0.0980  0.0237  283 ARG A O   
2000 C  CB  . ARG A 272 ? 1.2133 1.0551 1.0947 -0.1045 0.0854  0.0275  283 ARG A CB  
2001 C  CG  . ARG A 272 ? 1.2442 1.0689 1.1247 -0.1049 0.0774  0.0301  283 ARG A CG  
2002 C  CD  . ARG A 272 ? 1.2441 1.0492 1.1114 -0.1071 0.0731  0.0330  283 ARG A CD  
2003 N  NE  . ARG A 272 ? 1.2419 1.0373 1.0946 -0.1096 0.0776  0.0288  283 ARG A NE  
2004 C  CZ  . ARG A 272 ? 1.2438 1.0230 1.0829 -0.1118 0.0763  0.0301  283 ARG A CZ  
2005 N  NH1 . ARG A 272 ? 1.2483 1.0191 1.0861 -0.1120 0.0701  0.0357  283 ARG A NH1 
2006 N  NH2 . ARG A 272 ? 1.2430 1.0141 1.0700 -0.1141 0.0814  0.0258  283 ARG A NH2 
2007 N  N   . TYR A 273 ? 1.1932 1.0871 1.0961 -0.1003 0.1007  0.0194  284 TYR A N   
2008 C  CA  . TYR A 273 ? 1.1728 1.0851 1.0784 -0.0993 0.1065  0.0180  284 TYR A CA  
2009 C  C   . TYR A 273 ? 1.1551 1.0656 1.0510 -0.1011 0.1106  0.0139  284 TYR A C   
2010 O  O   . TYR A 273 ? 1.1329 1.0494 1.0270 -0.1012 0.1122  0.0159  284 TYR A O   
2011 C  CB  . TYR A 273 ? 1.1882 1.1148 1.1032 -0.0975 0.1099  0.0145  284 TYR A CB  
2012 C  CG  . TYR A 273 ? 1.2057 1.1358 1.1321 -0.0957 0.1067  0.0188  284 TYR A CG  
2013 C  CD1 . TYR A 273 ? 1.1945 1.1349 1.1274 -0.0942 0.1064  0.0243  284 TYR A CD1 
2014 C  CD2 . TYR A 273 ? 1.2357 1.1581 1.1670 -0.0954 0.1038  0.0176  284 TYR A CD2 
2015 C  CE1 . TYR A 273 ? 1.2126 1.1560 1.1570 -0.0926 0.1037  0.0284  284 TYR A CE1 
2016 C  CE2 . TYR A 273 ? 1.2542 1.1797 1.1975 -0.0937 0.1008  0.0215  284 TYR A CE2 
2017 C  CZ  . TYR A 273 ? 1.2423 1.1783 1.1923 -0.0924 0.1009  0.0268  284 TYR A CZ  
2018 O  OH  . TYR A 273 ? 1.2622 1.2012 1.2249 -0.0908 0.0984  0.0307  284 TYR A OH  
2019 N  N   . THR A 274 ? 1.1678 1.0695 1.0578 -0.1025 0.1122  0.0083  285 THR A N   
2020 C  CA  . THR A 274 ? 1.1569 1.0552 1.0381 -0.1044 0.1163  0.0040  285 THR A CA  
2021 C  C   . THR A 274 ? 1.1394 1.0272 1.0129 -0.1060 0.1145  0.0079  285 THR A C   
2022 O  O   . THR A 274 ? 1.1205 1.0130 0.9912 -0.1067 0.1181  0.0066  285 THR A O   
2023 C  CB  . THR A 274 ? 1.1781 1.0641 1.0534 -0.1060 0.1174  -0.0015 285 THR A CB  
2024 O  OG1 . THR A 274 ? 1.2086 1.0756 1.0787 -0.1071 0.1120  0.0013  285 THR A OG1 
2025 C  CG2 . THR A 274 ? 1.1758 1.0724 1.0590 -0.1045 0.1196  -0.0058 285 THR A CG2 
2026 N  N   . ASP A 275 ? 1.1479 1.0216 1.0185 -0.1065 0.1090  0.0125  286 ASP A N   
2027 C  CA  . ASP A 275 ? 1.1355 0.9982 0.9984 -0.1080 0.1071  0.0162  286 ASP A CA  
2028 C  C   . ASP A 275 ? 1.1124 0.9887 0.9816 -0.1066 0.1071  0.0209  286 ASP A C   
2029 O  O   . ASP A 275 ? 1.0942 0.9703 0.9592 -0.1076 0.1092  0.0215  286 ASP A O   
2030 C  CB  . ASP A 275 ? 1.1553 0.9993 1.0133 -0.1089 0.1005  0.0199  286 ASP A CB  
2031 C  CG  . ASP A 275 ? 1.1794 1.0061 1.0275 -0.1109 0.1004  0.0159  286 ASP A CG  
2032 O  OD1 . ASP A 275 ? 1.1782 1.0086 1.0245 -0.1115 0.1059  0.0101  286 ASP A OD1 
2033 O  OD2 . ASP A 275 ? 1.2015 1.0106 1.0435 -0.1118 0.0948  0.0184  286 ASP A OD2 
2034 N  N   . ALA A 276 ? 1.1155 1.0033 0.9954 -0.1043 0.1049  0.0243  287 ALA A N   
2035 C  CA  . ALA A 276 ? 1.0973 0.9997 0.9841 -0.1027 0.1054  0.0287  287 ALA A CA  
2036 C  C   . ALA A 276 ? 1.0794 0.9959 0.9664 -0.1025 0.1113  0.0251  287 ALA A C   
2037 O  O   . ALA A 276 ? 1.0607 0.9816 0.9471 -0.1026 0.1121  0.0277  287 ALA A O   
2038 C  CB  . ALA A 276 ? 1.1088 1.0220 1.0072 -0.1003 0.1035  0.0318  287 ALA A CB  
2039 N  N   . THR A 277 ? 1.0872 1.0099 0.9750 -0.1023 0.1150  0.0191  288 THR A N   
2040 C  CA  . THR A 277 ? 1.0741 1.0101 0.9625 -0.1020 0.1200  0.0153  288 THR A CA  
2041 C  C   . THR A 277 ? 1.0594 0.9874 0.9402 -0.1041 0.1217  0.0140  288 THR A C   
2042 O  O   . THR A 277 ? 1.0429 0.9803 0.9252 -0.1038 0.1235  0.0149  288 THR A O   
2043 C  CB  . THR A 277 ? 1.0877 1.0287 0.9771 -0.1019 0.1234  0.0084  288 THR A CB  
2044 O  OG1 . THR A 277 ? 1.1050 1.0524 1.0017 -0.1000 0.1223  0.0093  288 THR A OG1 
2045 C  CG2 . THR A 277 ? 1.0771 1.0331 0.9681 -0.1014 0.1277  0.0050  288 THR A CG2 
2046 N  N   . SER A 278 ? 1.0684 0.9784 0.9410 -0.1063 0.1211  0.0119  289 SER A N   
2047 C  CA  . SER A 278 ? 1.0588 0.9593 0.9238 -0.1086 0.1234  0.0104  289 SER A CA  
2048 C  C   . SER A 278 ? 1.0425 0.9433 0.9081 -0.1084 0.1212  0.0165  289 SER A C   
2049 O  O   . SER A 278 ? 1.0263 0.9339 0.8930 -0.1087 0.1238  0.0163  289 SER A O   
2050 C  CB  . SER A 278 ? 1.0762 0.9553 0.9312 -0.1110 0.1227  0.0083  289 SER A CB  
2051 O  OG  . SER A 278 ? 1.0697 0.9408 0.9178 -0.1133 0.1264  0.0057  289 SER A OG  
2052 N  N   . LYS A 279 ? 1.0484 0.9421 0.9142 -0.1080 0.1162  0.0219  290 LYS A N   
2053 C  CA  . LYS A 279 ? 1.0358 0.9282 0.9021 -0.1079 0.1136  0.0279  290 LYS A CA  
2054 C  C   . LYS A 279 ? 1.0177 0.9294 0.8918 -0.1062 0.1158  0.0294  290 LYS A C   
2055 O  O   . LYS A 279 ? 1.0039 0.9160 0.8764 -0.1071 0.1175  0.0300  290 LYS A O   
2056 C  CB  . LYS A 279 ? 1.0467 0.9334 0.9154 -0.1070 0.1076  0.0335  290 LYS A CB  
2057 C  CG  . LYS A 279 ? 1.0632 0.9271 0.9219 -0.1091 0.1041  0.0337  290 LYS A CG  
2058 C  CD  . LYS A 279 ? 1.0554 0.9091 0.9087 -0.1104 0.1019  0.0380  290 LYS A CD  
2059 C  CE  . LYS A 279 ? 1.0711 0.9011 0.9102 -0.1134 0.1014  0.0360  290 LYS A CE  
2060 N  NZ  . LYS A 279 ? 1.0672 0.8862 0.9014 -0.1145 0.0982  0.0408  290 LYS A NZ  
2061 N  N   . TYR A 280 ? 1.0205 0.9478 0.9028 -0.1039 0.1160  0.0298  291 TYR A N   
2062 C  CA  . TYR A 280 ? 1.0083 0.9537 0.8974 -0.1021 0.1174  0.0321  291 TYR A CA  
2063 C  C   . TYR A 280 ? 0.9981 0.9511 0.8862 -0.1027 0.1217  0.0277  291 TYR A C   
2064 O  O   . TYR A 280 ? 0.9874 0.9525 0.8797 -0.1016 0.1223  0.0300  291 TYR A O   
2065 C  CB  . TYR A 280 ? 1.0194 0.9784 0.9161 -0.0998 0.1173  0.0329  291 TYR A CB  
2066 C  CG  . TYR A 280 ? 1.0217 0.9831 0.9245 -0.0983 0.1136  0.0401  291 TYR A CG  
2067 C  CD1 . TYR A 280 ? 1.0090 0.9769 0.9147 -0.0976 0.1128  0.0455  291 TYR A CD1 
2068 C  CD2 . TYR A 280 ? 1.0387 0.9958 0.9450 -0.0976 0.1109  0.0414  291 TYR A CD2 
2069 C  CE1 . TYR A 280 ? 1.0129 0.9830 0.9249 -0.0962 0.1095  0.0521  291 TYR A CE1 
2070 C  CE2 . TYR A 280 ? 1.0432 1.0024 0.9564 -0.0962 0.1075  0.0479  291 TYR A CE2 
2071 C  CZ  . TYR A 280 ? 1.0301 0.9957 0.9459 -0.0956 0.1070  0.0532  291 TYR A CZ  
2072 O  OH  . TYR A 280 ? 1.0363 1.0039 0.9594 -0.0943 0.1039  0.0594  291 TYR A OH  
2073 N  N   . GLU A 281 ? 1.0040 0.9494 0.8868 -0.1044 0.1244  0.0214  292 GLU A N   
2074 C  CA  . GLU A 281 ? 0.9977 0.9492 0.8804 -0.1051 0.1283  0.0168  292 GLU A CA  
2075 C  C   . GLU A 281 ? 0.9863 0.9287 0.8655 -0.1069 0.1290  0.0180  292 GLU A C   
2076 O  O   . GLU A 281 ? 0.9774 0.9275 0.8594 -0.1069 0.1311  0.0167  292 GLU A O   
2077 C  CB  . GLU A 281 ? 1.0091 0.9574 0.8890 -0.1061 0.1315  0.0093  292 GLU A CB  
2078 C  CG  . GLU A 281 ? 1.0076 0.9734 0.8934 -0.1041 0.1328  0.0064  292 GLU A CG  
2079 C  CD  . GLU A 281 ? 1.0262 0.9886 0.9099 -0.1048 0.1353  -0.0004 292 GLU A CD  
2080 O  OE1 . GLU A 281 ? 1.0407 0.9886 0.9186 -0.1070 0.1367  -0.0035 292 GLU A OE1 
2081 O  OE2 . GLU A 281 ? 1.0286 1.0022 0.9162 -0.1032 0.1360  -0.0027 292 GLU A OE2 
2082 N  N   . SER A 282 ? 0.9890 0.9147 0.8622 -0.1083 0.1269  0.0206  293 SER A N   
2083 C  CA  . SER A 282 ? 0.9807 0.8964 0.8501 -0.1101 0.1273  0.0225  293 SER A CA  
2084 C  C   . SER A 282 ? 0.9680 0.8934 0.8435 -0.1084 0.1244  0.0292  293 SER A C   
2085 O  O   . SER A 282 ? 0.9579 0.8837 0.8344 -0.1090 0.1253  0.0308  293 SER A O   
2086 C  CB  . SER A 282 ? 0.9919 0.8856 0.8515 -0.1123 0.1258  0.0229  293 SER A CB  
2087 O  OG  . SER A 282 ? 1.0080 0.8934 0.8623 -0.1134 0.1276  0.0174  293 SER A OG  
2088 N  N   . VAL A 283 ? 0.9701 0.9039 0.8505 -0.1062 0.1212  0.0332  294 VAL A N   
2089 C  CA  . VAL A 283 ? 0.9601 0.9038 0.8468 -0.1046 0.1189  0.0396  294 VAL A CA  
2090 C  C   . VAL A 283 ? 0.9516 0.9109 0.8433 -0.1036 0.1215  0.0384  294 VAL A C   
2091 O  O   . VAL A 283 ? 0.9414 0.9023 0.8349 -0.1039 0.1215  0.0412  294 VAL A O   
2092 C  CB  . VAL A 283 ? 0.9671 0.9174 0.8590 -0.1025 0.1157  0.0441  294 VAL A CB  
2093 C  CG1 . VAL A 283 ? 0.9585 0.9205 0.8571 -0.1007 0.1141  0.0505  294 VAL A CG1 
2094 C  CG2 . VAL A 283 ? 0.9778 0.9115 0.8654 -0.1034 0.1120  0.0458  294 VAL A CG2 
2095 N  N   . MSE A 284 ? 0.9579 0.9279 0.8516 -0.1027 0.1237  0.0339  295 MSE A N   
2096 C  CA  . MSE A 284 ? 0.9538 0.9386 0.8520 -0.1018 0.1256  0.0324  295 MSE A CA  
2097 C  C   . MSE A 284 ? 0.9469 0.9264 0.8438 -0.1036 0.1279  0.0294  295 MSE A C   
2098 O  O   . MSE A 284 ? 0.9415 0.9297 0.8428 -0.1031 0.1280  0.0309  295 MSE A O   
2099 C  CB  . MSE A 284 ? 0.9650 0.9597 0.8643 -0.1008 0.1275  0.0271  295 MSE A CB  
2100 C  CG  . MSE A 284 ? 0.9725 0.9796 0.8758 -0.0984 0.1259  0.0308  295 MSE A CG  
2101 SE SE  . MSE A 284 ? 0.9914 1.0030 0.8938 -0.0978 0.1282  0.0239  295 MSE A SE  
2102 C  CE  . MSE A 284 ? 0.9936 1.0165 0.8966 -0.0980 0.1312  0.0168  295 MSE A CE  
2103 N  N   . LYS A 285 ? 0.9502 0.9149 0.8411 -0.1059 0.1299  0.0250  296 LYS A N   
2104 C  CA  . LYS A 285 ? 0.9475 0.9043 0.8366 -0.1081 0.1330  0.0217  296 LYS A CA  
2105 C  C   . LYS A 285 ? 0.9378 0.8894 0.8274 -0.1086 0.1316  0.0270  296 LYS A C   
2106 O  O   . LYS A 285 ? 0.9330 0.8880 0.8264 -0.1091 0.1333  0.0264  296 LYS A O   
2107 C  CB  . LYS A 285 ? 0.9577 0.8975 0.8388 -0.1104 0.1353  0.0168  296 LYS A CB  
2108 C  CG  . LYS A 285 ? 0.9630 0.9021 0.8443 -0.1119 0.1401  0.0095  296 LYS A CG  
2109 C  CD  . LYS A 285 ? 0.9689 0.9228 0.8549 -0.1103 0.1407  0.0053  296 LYS A CD  
2110 C  CE  . LYS A 285 ? 0.9738 0.9297 0.8624 -0.1116 0.1448  -0.0014 296 LYS A CE  
2111 N  NZ  . LYS A 285 ? 0.9674 0.9345 0.8635 -0.1109 0.1446  -0.0001 296 LYS A NZ  
2112 N  N   . THR A 286 ? 0.9365 0.8800 0.8231 -0.1085 0.1284  0.0323  297 THR A N   
2113 C  CA  . THR A 286 ? 0.9291 0.8666 0.8159 -0.1092 0.1272  0.0371  297 THR A CA  
2114 C  C   . THR A 286 ? 0.9204 0.8743 0.8160 -0.1071 0.1254  0.0419  297 THR A C   
2115 O  O   . THR A 286 ? 0.9146 0.8682 0.8129 -0.1077 0.1263  0.0431  297 THR A O   
2116 C  CB  . THR A 286 ? 0.9326 0.8546 0.8132 -0.1101 0.1239  0.0414  297 THR A CB  
2117 O  OG1 . THR A 286 ? 0.9309 0.8615 0.8162 -0.1078 0.1197  0.0471  297 THR A OG1 
2118 C  CG2 . THR A 286 ? 0.9456 0.8515 0.8170 -0.1119 0.1247  0.0373  297 THR A CG2 
2119 N  N   . GLU A 287 ? 0.9219 0.8897 0.8219 -0.1046 0.1233  0.0444  298 GLU A N   
2120 C  CA  . GLU A 287 ? 0.9177 0.9004 0.8250 -0.1026 0.1217  0.0491  298 GLU A CA  
2121 C  C   . GLU A 287 ? 0.9235 0.9228 0.8348 -0.1010 0.1227  0.0464  298 GLU A C   
2122 O  O   . GLU A 287 ? 0.9295 0.9389 0.8427 -0.0990 0.1212  0.0489  298 GLU A O   
2123 C  CB  . GLU A 287 ? 0.9169 0.9007 0.8262 -0.1012 0.1180  0.0566  298 GLU A CB  
2124 C  CG  . GLU A 287 ? 0.9149 0.9136 0.8314 -0.0991 0.1163  0.0623  298 GLU A CG  
2125 C  CD  . GLU A 287 ? 0.9103 0.9134 0.8302 -0.0995 0.1175  0.0616  298 GLU A CD  
2126 O  OE1 . GLU A 287 ? 0.9044 0.8973 0.8237 -0.1012 0.1179  0.0623  298 GLU A OE1 
2127 O  OE2 . GLU A 287 ? 0.9151 0.9316 0.8384 -0.0982 0.1181  0.0601  298 GLU A OE2 
2128 N  N   . PRO A 288 ? 0.9243 0.9261 0.8368 -0.1018 0.1252  0.0412  299 PRO A N   
2129 C  CA  . PRO A 288 ? 0.9329 0.9480 0.8479 -0.1006 0.1261  0.0370  299 PRO A CA  
2130 C  C   . PRO A 288 ? 0.9363 0.9671 0.8572 -0.0986 0.1240  0.0409  299 PRO A C   
2131 O  O   . PRO A 288 ? 0.9473 0.9901 0.8692 -0.0972 0.1238  0.0388  299 PRO A O   
2132 C  CB  . PRO A 288 ? 0.9338 0.9426 0.8483 -0.1027 0.1295  0.0299  299 PRO A CB  
2133 C  CG  . PRO A 288 ? 0.9260 0.9198 0.8387 -0.1048 0.1304  0.0316  299 PRO A CG  
2134 C  CD  . PRO A 288 ? 0.9187 0.9113 0.8315 -0.1039 0.1272  0.0394  299 PRO A CD  
2135 N  N   . SER A 289 ? 0.9293 0.9596 0.8536 -0.0985 0.1224  0.0464  300 SER A N   
2136 C  CA  . SER A 289 ? 0.9341 0.9780 0.8637 -0.0966 0.1200  0.0510  300 SER A CA  
2137 C  C   . SER A 289 ? 0.9420 0.9956 0.8711 -0.0943 0.1180  0.0559  300 SER A C   
2138 O  O   . SER A 289 ? 0.9550 1.0212 0.8849 -0.0928 0.1174  0.0554  300 SER A O   
2139 C  CB  . SER A 289 ? 0.9254 0.9651 0.8590 -0.0971 0.1188  0.0559  300 SER A CB  
2140 O  OG  . SER A 289 ? 0.9186 0.9464 0.8518 -0.0995 0.1214  0.0515  300 SER A OG  
2141 N  N   . ILE A 290 ? 0.9371 0.9847 0.8649 -0.0942 0.1171  0.0606  301 ILE A N   
2142 C  CA  . ILE A 290 ? 0.9464 1.0030 0.8754 -0.0920 0.1155  0.0663  301 ILE A CA  
2143 C  C   . ILE A 290 ? 0.9591 1.0206 0.8851 -0.0911 0.1169  0.0630  301 ILE A C   
2144 O  O   . ILE A 290 ? 0.9569 1.0096 0.8800 -0.0921 0.1180  0.0596  301 ILE A O   
2145 C  CB  . ILE A 290 ? 0.9395 0.9881 0.8697 -0.0921 0.1138  0.0726  301 ILE A CB  
2146 C  CG1 . ILE A 290 ? 0.9310 0.9761 0.8645 -0.0928 0.1125  0.0763  301 ILE A CG1 
2147 C  CG2 . ILE A 290 ? 0.9519 1.0093 0.8842 -0.0900 0.1129  0.0781  301 ILE A CG2 
2148 C  CD1 . ILE A 290 ? 0.9251 0.9637 0.8604 -0.0928 0.1104  0.0830  301 ILE A CD1 
2149 N  N   . ALA A 291 ? 0.9748 1.0498 0.9013 -0.0893 0.1168  0.0640  302 ALA A N   
2150 C  CA  . ALA A 291 ? 0.9901 1.0702 0.9136 -0.0886 0.1186  0.0599  302 ALA A CA  
2151 C  C   . ALA A 291 ? 0.9915 1.0659 0.9150 -0.0884 0.1191  0.0619  302 ALA A C   
2152 O  O   . ALA A 291 ? 0.9951 1.0645 0.9163 -0.0891 0.1206  0.0569  302 ALA A O   
2153 C  CB  . ALA A 291 ? 1.0105 1.1051 0.9337 -0.0867 0.1184  0.0616  302 ALA A CB  
2154 N  N   . GLU A 292 ? 0.9904 1.0651 0.9172 -0.0876 0.1176  0.0693  303 GLU A N   
2155 C  CA  . GLU A 292 ? 0.9960 1.0662 0.9245 -0.0872 0.1176  0.0718  303 GLU A CA  
2156 C  C   . GLU A 292 ? 0.9876 1.0438 0.9139 -0.0889 0.1176  0.0675  303 GLU A C   
2157 O  O   . GLU A 292 ? 0.9978 1.0516 0.9248 -0.0886 0.1181  0.0666  303 GLU A O   
2158 C  CB  . GLU A 292 ? 0.9936 1.0634 0.9268 -0.0865 0.1155  0.0802  303 GLU A CB  
2159 C  CG  . GLU A 292 ? 0.9945 1.0549 0.9305 -0.0868 0.1143  0.0828  303 GLU A CG  
2160 C  CD  . GLU A 292 ? 1.0158 1.0818 0.9544 -0.0854 0.1160  0.0832  303 GLU A CD  
2161 O  OE1 . GLU A 292 ? 1.0313 1.1086 0.9686 -0.0842 0.1185  0.0817  303 GLU A OE1 
2162 O  OE2 . GLU A 292 ? 1.0197 1.0782 0.9616 -0.0856 0.1147  0.0849  303 GLU A OE2 
2163 N  N   . TYR A 293 ? 0.9716 1.0185 0.8954 -0.0907 0.1171  0.0647  304 TYR A N   
2164 C  CA  . TYR A 293 ? 0.9663 0.9986 0.8867 -0.0925 0.1171  0.0609  304 TYR A CA  
2165 C  C   . TYR A 293 ? 0.9734 1.0056 0.8904 -0.0930 0.1195  0.0534  304 TYR A C   
2166 O  O   . TYR A 293 ? 0.9780 1.0013 0.8934 -0.0936 0.1193  0.0513  304 TYR A O   
2167 C  CB  . TYR A 293 ? 0.9508 0.9709 0.8688 -0.0945 0.1162  0.0607  304 TYR A CB  
2168 C  CG  . TYR A 293 ? 0.9446 0.9602 0.8654 -0.0943 0.1134  0.0679  304 TYR A CG  
2169 C  CD1 . TYR A 293 ? 0.9486 0.9553 0.8697 -0.0944 0.1111  0.0708  304 TYR A CD1 
2170 C  CD2 . TYR A 293 ? 0.9366 0.9575 0.8605 -0.0940 0.1127  0.0719  304 TYR A CD2 
2171 C  CE1 . TYR A 293 ? 0.9440 0.9469 0.8683 -0.0942 0.1082  0.0774  304 TYR A CE1 
2172 C  CE2 . TYR A 293 ? 0.9318 0.9491 0.8588 -0.0938 0.1101  0.0786  304 TYR A CE2 
2173 C  CZ  . TYR A 293 ? 0.9355 0.9438 0.8626 -0.0939 0.1079  0.0813  304 TYR A CZ  
2174 O  OH  . TYR A 293 ? 0.9316 0.9367 0.8623 -0.0937 0.1052  0.0878  304 TYR A OH  
2175 N  N   . THR A 294 ? 0.9760 1.0173 0.8922 -0.0927 0.1214  0.0492  305 THR A N   
2176 C  CA  . THR A 294 ? 0.9855 1.0279 0.8990 -0.0931 0.1238  0.0418  305 THR A CA  
2177 C  C   . THR A 294 ? 1.0035 1.0537 0.9186 -0.0914 0.1245  0.0424  305 THR A C   
2178 O  O   . THR A 294 ? 1.0119 1.0581 0.9257 -0.0917 0.1258  0.0381  305 THR A O   
2179 C  CB  . THR A 294 ? 0.9871 1.0369 0.8999 -0.0933 0.1253  0.0367  305 THR A CB  
2180 O  OG1 . THR A 294 ? 0.9943 1.0585 0.9093 -0.0915 0.1246  0.0399  305 THR A OG1 
2181 C  CG2 . THR A 294 ? 0.9717 1.0136 0.8842 -0.0951 0.1252  0.0359  305 THR A CG2 
2182 N  N   . VAL A 295 ? 1.0115 1.0721 0.9296 -0.0896 0.1240  0.0479  306 VAL A N   
2183 C  CA  . VAL A 295 ? 1.0325 1.1014 0.9522 -0.0880 0.1255  0.0484  306 VAL A CA  
2184 C  C   . VAL A 295 ? 1.0360 1.0967 0.9586 -0.0880 0.1248  0.0502  306 VAL A C   
2185 O  O   . VAL A 295 ? 1.0500 1.1096 0.9724 -0.0880 0.1264  0.0460  306 VAL A O   
2186 C  CB  . VAL A 295 ? 1.0435 1.1244 0.9653 -0.0862 0.1253  0.0544  306 VAL A CB  
2187 C  CG1 . VAL A 295 ? 1.0691 1.1580 0.9919 -0.0847 0.1279  0.0541  306 VAL A CG1 
2188 C  CG2 . VAL A 295 ? 1.0428 1.1317 0.9619 -0.0861 0.1252  0.0528  306 VAL A CG2 
2189 N  N   . ARG A 296 ? 1.0252 1.0798 0.9508 -0.0881 0.1222  0.0564  307 ARG A N   
2190 C  CA  . ARG A 296 ? 1.0322 1.0785 0.9611 -0.0882 0.1207  0.0584  307 ARG A CA  
2191 C  C   . ARG A 296 ? 1.0284 1.0620 0.9537 -0.0898 0.1203  0.0528  307 ARG A C   
2192 O  O   . ARG A 296 ? 1.0406 1.0699 0.9681 -0.0896 0.1200  0.0517  307 ARG A O   
2193 C  CB  . ARG A 296 ? 1.0242 1.0651 0.9567 -0.0882 0.1174  0.0657  307 ARG A CB  
2194 C  CG  . ARG A 296 ? 1.0355 1.0873 0.9739 -0.0863 0.1178  0.0722  307 ARG A CG  
2195 C  CD  . ARG A 296 ? 1.0603 1.1194 1.0023 -0.0849 0.1205  0.0710  307 ARG A CD  
2196 N  NE  . ARG A 296 ? 1.0748 1.1475 1.0192 -0.0832 0.1229  0.0749  307 ARG A NE  
2197 C  CZ  . ARG A 296 ? 1.0824 1.1654 1.0222 -0.0827 0.1251  0.0731  307 ARG A CZ  
2198 N  NH1 . ARG A 296 ? 1.0753 1.1574 1.0091 -0.0837 0.1253  0.0673  307 ARG A NH1 
2199 N  NH2 . ARG A 296 ? 1.1000 1.1938 1.0412 -0.0812 0.1271  0.0773  307 ARG A NH2 
2200 N  N   . SER A 297 ? 1.0139 1.0411 0.9338 -0.0915 0.1203  0.0494  308 SER A N   
2201 C  CA  . SER A 297 ? 1.0121 1.0267 0.9275 -0.0932 0.1204  0.0438  308 SER A CA  
2202 C  C   . SER A 297 ? 1.0277 1.0480 0.9431 -0.0927 0.1232  0.0379  308 SER A C   
2203 O  O   . SER A 297 ? 1.0383 1.0513 0.9541 -0.0930 0.1227  0.0359  308 SER A O   
2204 C  CB  . SER A 297 ? 0.9961 1.0042 0.9061 -0.0951 0.1210  0.0409  308 SER A CB  
2205 O  OG  . SER A 297 ? 0.9844 0.9830 0.8937 -0.0960 0.1184  0.0458  308 SER A OG  
2206 N  N   . LYS A 298 ? 1.0320 1.0652 0.9471 -0.0918 0.1259  0.0352  309 LYS A N   
2207 C  CA  . LYS A 298 ? 1.0496 1.0892 0.9645 -0.0913 0.1287  0.0293  309 LYS A CA  
2208 C  C   . LYS A 298 ? 1.0693 1.1119 0.9890 -0.0899 0.1291  0.0311  309 LYS A C   
2209 O  O   . LYS A 298 ? 1.0823 1.1208 1.0024 -0.0901 0.1300  0.0268  309 LYS A O   
2210 C  CB  . LYS A 298 ? 1.0534 1.1062 0.9668 -0.0906 0.1309  0.0265  309 LYS A CB  
2211 C  CG  . LYS A 298 ? 1.0406 1.0888 0.9501 -0.0923 0.1314  0.0214  309 LYS A CG  
2212 C  CD  . LYS A 298 ? 1.0508 1.1108 0.9591 -0.0918 0.1333  0.0165  309 LYS A CD  
2213 C  CE  . LYS A 298 ? 1.0384 1.0951 0.9450 -0.0933 0.1334  0.0131  309 LYS A CE  
2214 N  NZ  . LYS A 298 ? 1.0519 1.1170 0.9576 -0.0932 0.1351  0.0062  309 LYS A NZ  
2215 N  N   . GLU A 299 ? 1.0730 1.1222 0.9972 -0.0885 0.1283  0.0376  310 GLU A N   
2216 C  CA  . GLU A 299 ? 1.0938 1.1458 1.0241 -0.0871 0.1290  0.0398  310 GLU A CA  
2217 C  C   . GLU A 299 ? 1.0976 1.1362 1.0296 -0.0880 0.1270  0.0381  310 GLU A C   
2218 O  O   . GLU A 299 ? 1.1175 1.1568 1.0520 -0.0876 0.1287  0.0343  310 GLU A O   
2219 C  CB  . GLU A 299 ? 1.0955 1.1523 1.0309 -0.0859 0.1278  0.0479  310 GLU A CB  
2220 C  CG  . GLU A 299 ? 1.1186 1.1763 1.0621 -0.0847 0.1282  0.0506  310 GLU A CG  
2221 C  CD  . GLU A 299 ? 1.1206 1.1824 1.0700 -0.0836 0.1272  0.0587  310 GLU A CD  
2222 O  OE1 . GLU A 299 ? 1.1127 1.1822 1.0599 -0.0831 0.1278  0.0621  310 GLU A OE1 
2223 O  OE2 . GLU A 299 ? 1.1325 1.1899 1.0895 -0.0831 0.1257  0.0618  310 GLU A OE2 
2224 N  N   . ARG A 300 ? 1.0809 1.1069 1.0110 -0.0893 0.1233  0.0407  311 ARG A N   
2225 C  CA  . ARG A 300 ? 1.0867 1.0987 1.0178 -0.0902 0.1202  0.0405  311 ARG A CA  
2226 C  C   . ARG A 300 ? 1.0929 1.0988 1.0195 -0.0914 0.1217  0.0330  311 ARG A C   
2227 O  O   . ARG A 300 ? 1.1100 1.1089 1.0389 -0.0915 0.1205  0.0313  311 ARG A O   
2228 C  CB  . ARG A 300 ? 1.0695 1.0690 0.9976 -0.0915 0.1160  0.0447  311 ARG A CB  
2229 C  CG  . ARG A 300 ? 1.0668 1.0703 1.0005 -0.0904 0.1139  0.0525  311 ARG A CG  
2230 C  CD  . ARG A 300 ? 1.0894 1.0980 1.0326 -0.0887 0.1137  0.0552  311 ARG A CD  
2231 N  NE  . ARG A 300 ? 1.0982 1.0934 1.0446 -0.0893 0.1090  0.0571  311 ARG A NE  
2232 C  CZ  . ARG A 300 ? 1.1215 1.1172 1.0763 -0.0882 0.1084  0.0575  311 ARG A CZ  
2233 N  NH1 . ARG A 300 ? 1.1385 1.1472 1.0988 -0.0867 0.1128  0.0558  311 ARG A NH1 
2234 N  NH2 . ARG A 300 ? 1.1306 1.1133 1.0882 -0.0887 0.1033  0.0593  311 ARG A NH2 
2235 N  N   . ILE A 301 ? 1.0812 1.0897 1.0017 -0.0923 0.1241  0.0286  312 ILE A N   
2236 C  CA  . ILE A 301 ? 1.0870 1.0906 1.0031 -0.0934 0.1261  0.0213  312 ILE A CA  
2237 C  C   . ILE A 301 ? 1.1094 1.1230 1.0301 -0.0920 0.1289  0.0178  312 ILE A C   
2238 O  O   . ILE A 301 ? 1.1246 1.1320 1.0465 -0.0923 0.1289  0.0145  312 ILE A O   
2239 C  CB  . ILE A 301 ? 1.0720 1.0777 0.9823 -0.0946 0.1282  0.0175  312 ILE A CB  
2240 C  CG1 . ILE A 301 ? 1.0535 1.0460 0.9589 -0.0964 0.1258  0.0199  312 ILE A CG1 
2241 C  CG2 . ILE A 301 ? 1.0828 1.0877 0.9904 -0.0953 0.1311  0.0095  312 ILE A CG2 
2242 C  CD1 . ILE A 301 ? 1.0369 1.0334 0.9393 -0.0971 0.1274  0.0189  312 ILE A CD1 
2243 N  N   . CYS A 302 ? 1.1143 1.1431 1.0374 -0.0905 0.1315  0.0186  313 CYS A N   
2244 C  CA  . CYS A 302 ? 1.1391 1.1777 1.0665 -0.0891 0.1346  0.0158  313 CYS A CA  
2245 C  C   . CYS A 302 ? 1.1555 1.1884 1.0899 -0.0884 0.1330  0.0183  313 CYS A C   
2246 O  O   . CYS A 302 ? 1.1742 1.2071 1.1115 -0.0882 0.1347  0.0140  313 CYS A O   
2247 C  CB  . CYS A 302 ? 1.1463 1.2004 1.0746 -0.0875 0.1371  0.0181  313 CYS A CB  
2248 S  SG  . CYS A 302 ? 1.1827 1.2475 1.1179 -0.0855 0.1410  0.0176  313 CYS A SG  
2249 N  N   . HIS A 303 ? 1.1496 1.1775 1.0874 -0.0883 0.1295  0.0250  314 HIS A N   
2250 C  CA  . HIS A 303 ? 1.1655 1.1862 1.1107 -0.0878 0.1269  0.0276  314 HIS A CA  
2251 C  C   . HIS A 303 ? 1.1698 1.1756 1.1122 -0.0893 0.1243  0.0238  314 HIS A C   
2252 O  O   . HIS A 303 ? 1.1927 1.1956 1.1409 -0.0889 0.1239  0.0222  314 HIS A O   
2253 C  CB  . HIS A 303 ? 1.1559 1.1735 1.1047 -0.0875 0.1231  0.0356  314 HIS A CB  
2254 C  CG  . HIS A 303 ? 1.1732 1.1836 1.1307 -0.0870 0.1197  0.0387  314 HIS A CG  
2255 N  ND1 . HIS A 303 ? 1.1925 1.2113 1.1604 -0.0853 0.1209  0.0425  314 HIS A ND1 
2256 C  CD2 . HIS A 303 ? 1.1765 1.1717 1.1342 -0.0880 0.1149  0.0389  314 HIS A CD2 
2257 C  CE1 . HIS A 303 ? 1.2062 1.2157 1.1814 -0.0852 0.1168  0.0447  314 HIS A CE1 
2258 N  NE2 . HIS A 303 ? 1.1973 1.1923 1.1660 -0.0868 0.1127  0.0426  314 HIS A NE2 
2259 N  N   . CYS A 304 ? 1.1504 1.1466 1.0841 -0.0911 0.1228  0.0223  315 CYS A N   
2260 C  CA  . CYS A 304 ? 1.1558 1.1358 1.0848 -0.0928 0.1203  0.0191  315 CYS A CA  
2261 C  C   . CYS A 304 ? 1.1743 1.1550 1.1033 -0.0930 0.1233  0.0119  315 CYS A C   
2262 O  O   . CYS A 304 ? 1.1934 1.1637 1.1239 -0.0934 0.1210  0.0105  315 CYS A O   
2263 C  CB  . CYS A 304 ? 1.1336 1.1039 1.0525 -0.0948 0.1195  0.0186  315 CYS A CB  
2264 S  SG  . CYS A 304 ? 1.1215 1.0785 1.0385 -0.0957 0.1137  0.0258  315 CYS A SG  
2265 N  N   . PHE A 305 ? 1.1701 1.1625 1.0973 -0.0926 0.1280  0.0074  316 PHE A N   
2266 C  CA  . PHE A 305 ? 1.1880 1.1829 1.1156 -0.0927 0.1312  0.0003  316 PHE A CA  
2267 C  C   . PHE A 305 ? 1.2154 1.2163 1.1526 -0.0910 0.1321  0.0005  316 PHE A C   
2268 O  O   . PHE A 305 ? 1.2361 1.2306 1.1763 -0.0912 0.1316  -0.0026 316 PHE A O   
2269 C  CB  . PHE A 305 ? 1.1801 1.1867 1.1038 -0.0927 0.1356  -0.0041 316 PHE A CB  
2270 C  CG  . PHE A 305 ? 1.1596 1.1594 1.0751 -0.0945 0.1354  -0.0062 316 PHE A CG  
2271 C  CD1 . PHE A 305 ? 1.1596 1.1439 1.0704 -0.0964 0.1341  -0.0089 316 PHE A CD1 
2272 C  CD2 . PHE A 305 ? 1.1433 1.1517 1.0560 -0.0945 0.1368  -0.0056 316 PHE A CD2 
2273 C  CE1 . PHE A 305 ? 1.1437 1.1213 1.0473 -0.0983 0.1348  -0.0110 316 PHE A CE1 
2274 C  CE2 . PHE A 305 ? 1.1268 1.1290 1.0333 -0.0963 0.1370  -0.0077 316 PHE A CE2 
2275 C  CZ  . PHE A 305 ? 1.1270 1.1138 1.0290 -0.0982 0.1364  -0.0105 316 PHE A CZ  
2276 N  N   . SER A 306 ? 1.2174 1.2303 1.1599 -0.0893 0.1334  0.0046  317 SER A N   
2277 C  CA  . SER A 306 ? 1.2449 1.2648 1.1974 -0.0876 0.1351  0.0054  317 SER A CA  
2278 C  C   . SER A 306 ? 1.2611 1.2692 1.2205 -0.0877 0.1309  0.0074  317 SER A C   
2279 O  O   . SER A 306 ? 1.2866 1.2940 1.2516 -0.0873 0.1321  0.0036  317 SER A O   
2280 C  CB  . SER A 306 ? 1.2437 1.2754 1.1999 -0.0862 0.1366  0.0109  317 SER A CB  
2281 O  OG  . SER A 306 ? 1.2741 1.3149 1.2388 -0.0846 0.1403  0.0101  317 SER A OG  
2282 N  N   . LYS A 307 ? 1.2487 1.2470 1.2080 -0.0882 0.1257  0.0131  318 LYS A N   
2283 C  CA  . LYS A 307 ? 1.2666 1.2533 1.2326 -0.0882 0.1208  0.0153  318 LYS A CA  
2284 C  C   . LYS A 307 ? 1.2744 1.2470 1.2348 -0.0897 0.1186  0.0106  318 LYS A C   
2285 O  O   . LYS A 307 ? 1.2967 1.2596 1.2625 -0.0897 0.1147  0.0112  318 LYS A O   
2286 C  CB  . LYS A 307 ? 1.2528 1.2324 1.2197 -0.0883 0.1154  0.0228  318 LYS A CB  
2287 C  CG  . LYS A 307 ? 1.2474 1.2399 1.2205 -0.0868 0.1173  0.0281  318 LYS A CG  
2288 C  CD  . LYS A 307 ? 1.2771 1.2734 1.2648 -0.0851 0.1168  0.0313  318 LYS A CD  
2289 C  CE  . LYS A 307 ? 1.2728 1.2832 1.2654 -0.0837 0.1202  0.0358  318 LYS A CE  
2290 N  NZ  . LYS A 307 ? 1.3042 1.3203 1.3118 -0.0821 0.1213  0.0387  318 LYS A NZ  
2291 N  N   . ASP A 308 ? 1.2585 1.2300 1.2085 -0.0911 0.1211  0.0061  319 ASP A N   
2292 C  CA  . ASP A 308 ? 1.2662 1.2243 1.2097 -0.0927 0.1198  0.0014  319 ASP A CA  
2293 C  C   . ASP A 308 ? 1.2887 1.2528 1.2353 -0.0923 0.1241  -0.0055 319 ASP A C   
2294 O  O   . ASP A 308 ? 1.3022 1.2562 1.2445 -0.0936 0.1237  -0.0099 319 ASP A O   
2295 C  CB  . ASP A 308 ? 1.2410 1.1927 1.1720 -0.0947 0.1202  0.0001  319 ASP A CB  
2296 C  CG  . ASP A 308 ? 1.2468 1.1791 1.1701 -0.0967 0.1168  -0.0014 319 ASP A CG  
2297 O  OD1 . ASP A 308 ? 1.2723 1.1965 1.1999 -0.0965 0.1139  -0.0018 319 ASP A OD1 
2298 O  OD2 . ASP A 308 ? 1.2285 1.1531 1.1415 -0.0985 0.1172  -0.0022 319 ASP A OD2 
2299 N  N   . GLU A 309 ? 1.2948 1.2750 1.2486 -0.0906 0.1286  -0.0066 320 GLU A N   
2300 C  CA  . GLU A 309 ? 1.3199 1.3071 1.2777 -0.0900 0.1331  -0.0131 320 GLU A CA  
2301 C  C   . GLU A 309 ? 1.3102 1.2997 1.2589 -0.0912 0.1367  -0.0196 320 GLU A C   
2302 O  O   . GLU A 309 ? 1.3310 1.3193 1.2801 -0.0916 0.1390  -0.0258 320 GLU A O   
2303 C  CB  . GLU A 309 ? 1.3482 1.3249 1.3126 -0.0900 0.1302  -0.0146 320 GLU A CB  
2304 C  CG  . GLU A 309 ? 1.3635 1.3374 1.3387 -0.0888 0.1260  -0.0086 320 GLU A CG  
2305 C  CD  . GLU A 309 ? 1.3947 1.3552 1.3752 -0.0891 0.1216  -0.0097 320 GLU A CD  
2306 O  OE1 . GLU A 309 ? 1.3961 1.3423 1.3679 -0.0908 0.1185  -0.0114 320 GLU A OE1 
2307 O  OE2 . GLU A 309 ? 1.4207 1.3845 1.4142 -0.0877 0.1214  -0.0088 320 GLU A OE2 
2308 N  N   . LYS A 310 ? 1.2807 1.2731 1.2217 -0.0919 0.1372  -0.0181 321 LYS A N   
2309 C  CA  . LYS A 310 ? 1.2709 1.2672 1.2047 -0.0929 0.1407  -0.0240 321 LYS A CA  
2310 C  C   . LYS A 310 ? 1.2684 1.2822 1.2031 -0.0915 0.1445  -0.0242 321 LYS A C   
2311 O  O   . LYS A 310 ? 1.2461 1.2640 1.1769 -0.0916 0.1440  -0.0208 321 LYS A O   
2312 C  CB  . LYS A 310 ? 1.2450 1.2303 1.1696 -0.0948 0.1384  -0.0227 321 LYS A CB  
2313 C  CG  . LYS A 310 ? 1.2492 1.2158 1.1716 -0.0961 0.1338  -0.0204 321 LYS A CG  
2314 C  CD  . LYS A 310 ? 1.2332 1.1876 1.1453 -0.0984 0.1337  -0.0226 321 LYS A CD  
2315 C  CE  . LYS A 310 ? 1.2451 1.1799 1.1530 -0.0998 0.1286  -0.0193 321 LYS A CE  
2316 N  NZ  . LYS A 310 ? 1.2258 1.1498 1.1233 -0.1019 0.1281  -0.0183 321 LYS A NZ  
2317 N  N   . PRO A 311 ? 1.2942 1.3181 1.2340 -0.0903 0.1483  -0.0281 322 PRO A N   
2318 C  CA  . PRO A 311 ? 1.2993 1.3387 1.2401 -0.0889 0.1516  -0.0273 322 PRO A CA  
2319 C  C   . PRO A 311 ? 1.2860 1.3331 1.2192 -0.0894 0.1537  -0.0308 322 PRO A C   
2320 O  O   . PRO A 311 ? 1.2778 1.3342 1.2091 -0.0886 0.1542  -0.0275 322 PRO A O   
2321 C  CB  . PRO A 311 ? 1.3347 1.3802 1.2825 -0.0877 0.1553  -0.0314 322 PRO A CB  
2322 C  CG  . PRO A 311 ? 1.3452 1.3785 1.2958 -0.0886 0.1536  -0.0348 322 PRO A CG  
2323 C  CD  . PRO A 311 ? 1.3205 1.3414 1.2637 -0.0905 0.1501  -0.0343 322 PRO A CD  
2324 N  N   . VAL A 312 ? 1.2856 1.3287 1.2147 -0.0907 0.1546  -0.0372 323 VAL A N   
2325 C  CA  . VAL A 312 ? 1.2771 1.3279 1.2005 -0.0911 0.1563  -0.0411 323 VAL A CA  
2326 C  C   . VAL A 312 ? 1.2473 1.2978 1.1666 -0.0915 0.1538  -0.0358 323 VAL A C   
2327 O  O   . VAL A 312 ? 1.2441 1.3054 1.1613 -0.0907 0.1546  -0.0346 323 VAL A O   
2328 C  CB  . VAL A 312 ? 1.2798 1.3245 1.2002 -0.0927 0.1574  -0.0484 323 VAL A CB  
2329 C  CG1 . VAL A 312 ? 1.2759 1.3312 1.1925 -0.0927 0.1595  -0.0532 323 VAL A CG1 
2330 C  CG2 . VAL A 312 ? 1.3100 1.3521 1.2351 -0.0925 0.1592  -0.0531 323 VAL A CG2 
2331 N  N   . GLU A 313 ? 1.2282 1.2656 1.1461 -0.0927 0.1507  -0.0325 324 GLU A N   
2332 C  CA  . GLU A 313 ? 1.2000 1.2351 1.1142 -0.0934 0.1483  -0.0276 324 GLU A CA  
2333 C  C   . GLU A 313 ? 1.1957 1.2374 1.1129 -0.0918 0.1469  -0.0202 324 GLU A C   
2334 O  O   . GLU A 313 ? 1.1815 1.2304 1.0967 -0.0914 0.1466  -0.0172 324 GLU A O   
2335 C  CB  . GLU A 313 ? 1.1856 1.2038 1.0969 -0.0952 0.1456  -0.0261 324 GLU A CB  
2336 C  CG  . GLU A 313 ? 1.1913 1.2008 1.0992 -0.0969 0.1471  -0.0330 324 GLU A CG  
2337 C  CD  . GLU A 313 ? 1.2167 1.2212 1.1278 -0.0968 0.1477  -0.0365 324 GLU A CD  
2338 O  OE1 . GLU A 313 ? 1.2316 1.2420 1.1486 -0.0952 0.1477  -0.0346 324 GLU A OE1 
2339 O  OE2 . GLU A 313 ? 1.2239 1.2183 1.1321 -0.0984 0.1484  -0.0411 324 GLU A OE2 
2340 N  N   . ALA A 314 ? 1.2099 1.2492 1.1327 -0.0909 0.1462  -0.0173 325 ALA A N   
2341 C  CA  . ALA A 314 ? 1.2119 1.2578 1.1391 -0.0893 0.1456  -0.0106 325 ALA A CA  
2342 C  C   . ALA A 314 ? 1.2189 1.2803 1.1444 -0.0881 0.1486  -0.0113 325 ALA A C   
2343 O  O   . ALA A 314 ? 1.2039 1.2703 1.1276 -0.0877 0.1476  -0.0066 325 ALA A O   
2344 C  CB  . ALA A 314 ? 1.2353 1.2789 1.1704 -0.0884 0.1456  -0.0094 325 ALA A CB  
2345 N  N   . ILE A 315 ? 1.2432 1.3118 1.1687 -0.0877 0.1522  -0.0174 326 ILE A N   
2346 C  CA  . ILE A 315 ? 1.2556 1.3381 1.1783 -0.0866 0.1550  -0.0185 326 ILE A CA  
2347 C  C   . ILE A 315 ? 1.2341 1.3191 1.1506 -0.0873 0.1533  -0.0184 326 ILE A C   
2348 O  O   . ILE A 315 ? 1.2315 1.3243 1.1461 -0.0864 0.1530  -0.0141 326 ILE A O   
2349 C  CB  . ILE A 315 ? 1.2850 1.3732 1.2077 -0.0863 0.1589  -0.0260 326 ILE A CB  
2350 C  CG1 . ILE A 315 ? 1.3118 1.4011 1.2417 -0.0851 0.1612  -0.0247 326 ILE A CG1 
2351 C  CG2 . ILE A 315 ? 1.2967 1.3974 1.2137 -0.0856 0.1609  -0.0281 326 ILE A CG2 
2352 C  CD1 . ILE A 315 ? 1.3362 1.4238 1.2689 -0.0853 0.1639  -0.0318 326 ILE A CD1 
2353 N  N   . ARG A 316 ? 1.2207 1.2986 1.1345 -0.0889 0.1524  -0.0230 327 ARG A N   
2354 C  CA  . ARG A 316 ? 1.2037 1.2839 1.1130 -0.0896 0.1511  -0.0239 327 ARG A CA  
2355 C  C   . ARG A 316 ? 1.1824 1.2633 1.0914 -0.0893 0.1484  -0.0160 327 ARG A C   
2356 O  O   . ARG A 316 ? 1.1816 1.2711 1.0881 -0.0887 0.1480  -0.0146 327 ARG A O   
2357 C  CB  . ARG A 316 ? 1.1921 1.2616 1.0998 -0.0916 0.1507  -0.0289 327 ARG A CB  
2358 C  CG  . ARG A 316 ? 1.1739 1.2442 1.0786 -0.0925 0.1495  -0.0296 327 ARG A CG  
2359 C  CD  . ARG A 316 ? 1.1701 1.2320 1.0736 -0.0944 0.1504  -0.0360 327 ARG A CD  
2360 N  NE  . ARG A 316 ? 1.1604 1.2069 1.0637 -0.0958 0.1498  -0.0351 327 ARG A NE  
2361 C  CZ  . ARG A 316 ? 1.1390 1.1758 1.0411 -0.0968 0.1476  -0.0301 327 ARG A CZ  
2362 N  NH1 . ARG A 316 ? 1.1227 1.1638 1.0244 -0.0964 0.1459  -0.0252 327 ARG A NH1 
2363 N  NH2 . ARG A 316 ? 1.1365 1.1585 1.0371 -0.0981 0.1470  -0.0300 327 ARG A NH2 
2364 N  N   . VAL A 317 ? 1.1680 1.2395 1.0796 -0.0896 0.1464  -0.0108 328 VAL A N   
2365 C  CA  . VAL A 317 ? 1.1461 1.2158 1.0577 -0.0895 0.1436  -0.0036 328 VAL A CA  
2366 C  C   . VAL A 317 ? 1.1554 1.2350 1.0693 -0.0877 0.1438  0.0025  328 VAL A C   
2367 O  O   . VAL A 317 ? 1.1479 1.2345 1.0599 -0.0871 0.1430  0.0058  328 VAL A O   
2368 C  CB  . VAL A 317 ? 1.1298 1.1842 1.0423 -0.0908 0.1410  -0.0007 328 VAL A CB  
2369 C  CG1 . VAL A 317 ? 1.1103 1.1631 1.0237 -0.0906 0.1381  0.0071  328 VAL A CG1 
2370 C  CG2 . VAL A 317 ? 1.1204 1.1650 1.0289 -0.0928 0.1411  -0.0062 328 VAL A CG2 
2371 N  N   . CYS A 318 ? 1.1741 1.2542 1.0925 -0.0867 0.1451  0.0041  329 CYS A N   
2372 C  CA  . CYS A 318 ? 1.1869 1.2766 1.1079 -0.0850 0.1464  0.0094  329 CYS A CA  
2373 C  C   . CYS A 318 ? 1.2016 1.3040 1.1176 -0.0842 0.1484  0.0078  329 CYS A C   
2374 O  O   . CYS A 318 ? 1.2058 1.3149 1.1212 -0.0832 0.1483  0.0133  329 CYS A O   
2375 C  CB  . CYS A 318 ? 1.2114 1.3013 1.1383 -0.0841 0.1488  0.0090  329 CYS A CB  
2376 S  SG  . CYS A 318 ? 1.2088 1.2833 1.1403 -0.0853 0.1464  0.0073  329 CYS A SG  
2377 N  N   . SER A 319 ? 1.2120 1.3173 1.1242 -0.0846 0.1500  0.0004  330 SER A N   
2378 C  CA  . SER A 319 ? 1.2275 1.3436 1.1340 -0.0840 0.1509  -0.0015 330 SER A CA  
2379 C  C   . SER A 319 ? 1.2069 1.3245 1.1109 -0.0842 0.1475  0.0025  330 SER A C   
2380 O  O   . SER A 319 ? 1.2184 1.3444 1.1198 -0.0832 0.1473  0.0065  330 SER A O   
2381 C  CB  . SER A 319 ? 1.2409 1.3579 1.1444 -0.0848 0.1523  -0.0107 330 SER A CB  
2382 O  OG  . SER A 319 ? 1.2583 1.3725 1.1653 -0.0847 0.1552  -0.0142 330 SER A OG  
2383 N  N   . GLU A 320 ? 1.1792 1.2882 1.0839 -0.0857 0.1451  0.0015  331 GLU A N   
2384 C  CA  . GLU A 320 ? 1.1585 1.2675 1.0621 -0.0860 0.1420  0.0053  331 GLU A CA  
2385 C  C   . GLU A 320 ? 1.1522 1.2623 1.0582 -0.0850 0.1408  0.0143  331 GLU A C   
2386 O  O   . GLU A 320 ? 1.1515 1.2677 1.0560 -0.0844 0.1392  0.0185  331 GLU A O   
2387 C  CB  . GLU A 320 ? 1.1326 1.2299 1.0372 -0.0879 0.1405  0.0031  331 GLU A CB  
2388 C  CG  . GLU A 320 ? 1.1162 1.2144 1.0199 -0.0886 0.1382  0.0036  331 GLU A CG  
2389 C  CD  . GLU A 320 ? 1.1010 1.1896 1.0047 -0.0906 0.1383  -0.0020 331 GLU A CD  
2390 O  OE1 . GLU A 320 ? 1.0981 1.1761 1.0022 -0.0917 0.1393  -0.0039 331 GLU A OE1 
2391 O  OE2 . GLU A 320 ? 1.0944 1.1857 0.9979 -0.0912 0.1375  -0.0045 331 GLU A OE2 
2392 N  N   . VAL A 321 ? 1.1498 1.2539 1.0600 -0.0849 0.1413  0.0173  332 VAL A N   
2393 C  CA  . VAL A 321 ? 1.1451 1.2489 1.0589 -0.0841 0.1400  0.0257  332 VAL A CA  
2394 C  C   . VAL A 321 ? 1.1717 1.2874 1.0843 -0.0824 0.1420  0.0291  332 VAL A C   
2395 O  O   . VAL A 321 ? 1.1693 1.2893 1.0812 -0.0818 0.1405  0.0348  332 VAL A O   
2396 C  CB  . VAL A 321 ? 1.1411 1.2352 1.0605 -0.0844 0.1396  0.0278  332 VAL A CB  
2397 C  CG1 . VAL A 321 ? 1.1448 1.2409 1.0689 -0.0832 0.1390  0.0362  332 VAL A CG1 
2398 C  CG2 . VAL A 321 ? 1.1151 1.1959 1.0341 -0.0861 0.1369  0.0265  332 VAL A CG2 
2399 N  N   . LEU A 322 ? 1.1995 1.3200 1.1115 -0.0817 0.1456  0.0255  333 LEU A N   
2400 C  CA  . LEU A 322 ? 1.2303 1.3614 1.1402 -0.0802 0.1484  0.0282  333 LEU A CA  
2401 C  C   . LEU A 322 ? 1.2372 1.3762 1.1396 -0.0800 0.1472  0.0273  333 LEU A C   
2402 O  O   . LEU A 322 ? 1.2568 1.4030 1.1563 -0.0789 0.1478  0.0319  333 LEU A O   
2403 C  CB  . LEU A 322 ? 1.2607 1.3943 1.1717 -0.0797 0.1529  0.0239  333 LEU A CB  
2404 C  CG  . LEU A 322 ? 1.2603 1.3856 1.1799 -0.0799 0.1533  0.0249  333 LEU A CG  
2405 C  CD1 . LEU A 322 ? 1.2947 1.4217 1.2160 -0.0796 0.1575  0.0193  333 LEU A CD1 
2406 C  CD2 . LEU A 322 ? 1.2557 1.3804 1.1813 -0.0791 0.1529  0.0333  333 LEU A CD2 
2407 N  N   . GLN A 323 ? 1.2232 1.3605 1.1227 -0.0810 0.1454  0.0215  334 GLN A N   
2408 C  CA  . GLN A 323 ? 1.2284 1.3721 1.1225 -0.0808 0.1431  0.0210  334 GLN A CA  
2409 C  C   . GLN A 323 ? 1.2112 1.3548 1.1069 -0.0805 0.1399  0.0290  334 GLN A C   
2410 O  O   . GLN A 323 ? 1.2280 1.3790 1.1196 -0.0797 0.1388  0.0321  334 GLN A O   
2411 C  CB  . GLN A 323 ? 1.2186 1.3598 1.1112 -0.0821 0.1416  0.0133  334 GLN A CB  
2412 C  CG  . GLN A 323 ? 1.2451 1.3893 1.1346 -0.0821 0.1445  0.0052  334 GLN A CG  
2413 C  CD  . GLN A 323 ? 1.2429 1.3877 1.1302 -0.0831 0.1428  -0.0021 334 GLN A CD  
2414 O  OE1 . GLN A 323 ? 1.2154 1.3534 1.1060 -0.0844 0.1409  -0.0037 334 GLN A OE1 
2415 N  NE2 . GLN A 323 ? 1.2747 1.4271 1.1565 -0.0826 0.1436  -0.0069 334 GLN A NE2 
2416 N  N   . MSE A 324 ? 1.1804 1.3154 1.0818 -0.0813 0.1383  0.0325  335 MSE A N   
2417 C  CA  . MSE A 324 ? 1.1651 1.2996 1.0685 -0.0811 0.1354  0.0400  335 MSE A CA  
2418 C  C   . MSE A 324 ? 1.1790 1.3161 1.0850 -0.0798 0.1369  0.0475  335 MSE A C   
2419 O  O   . MSE A 324 ? 1.1822 1.3231 1.0882 -0.0791 0.1354  0.0540  335 MSE A O   
2420 C  CB  . MSE A 324 ? 1.1304 1.2540 1.0379 -0.0825 0.1330  0.0403  335 MSE A CB  
2421 C  CG  . MSE A 324 ? 1.1192 1.2388 1.0251 -0.0839 0.1325  0.0327  335 MSE A CG  
2422 SE SE  . MSE A 324 ? 1.0829 1.1854 0.9927 -0.0861 0.1311  0.0321  335 MSE A SE  
2423 C  CE  . MSE A 324 ? 1.0926 1.1895 1.0058 -0.0856 0.1329  0.0344  335 MSE A CE  
2424 N  N   . GLU A 325 ? 1.1893 1.3242 1.0982 -0.0796 0.1399  0.0465  336 GLU A N   
2425 C  CA  . GLU A 325 ? 1.2065 1.3436 1.1193 -0.0785 0.1419  0.0528  336 GLU A CA  
2426 C  C   . GLU A 325 ? 1.2369 1.3775 1.1493 -0.0779 0.1467  0.0489  336 GLU A C   
2427 O  O   . GLU A 325 ? 1.2319 1.3663 1.1488 -0.0784 0.1477  0.0455  336 GLU A O   
2428 C  CB  . GLU A 325 ? 1.1832 1.3108 1.1038 -0.0790 0.1400  0.0571  336 GLU A CB  
2429 C  CG  . GLU A 325 ? 1.1538 1.2761 1.0750 -0.0798 0.1356  0.0604  336 GLU A CG  
2430 C  CD  . GLU A 325 ? 1.1351 1.2475 1.0631 -0.0804 0.1335  0.0645  336 GLU A CD  
2431 O  OE1 . GLU A 325 ? 1.1440 1.2527 1.0764 -0.0803 0.1349  0.0639  336 GLU A OE1 
2432 O  OE2 . GLU A 325 ? 1.1138 1.2219 1.0428 -0.0810 0.1303  0.0682  336 GLU A OE2 
2433 N  N   . PRO A 326 ? 1.2716 1.4214 1.1781 -0.0769 0.1496  0.0490  337 PRO A N   
2434 C  CA  . PRO A 326 ? 1.3034 1.4563 1.2091 -0.0765 0.1545  0.0445  337 PRO A CA  
2435 C  C   . PRO A 326 ? 1.3178 1.4691 1.2317 -0.0758 0.1576  0.0492  337 PRO A C   
2436 O  O   . PRO A 326 ? 1.3428 1.4946 1.2594 -0.0756 0.1617  0.0457  337 PRO A O   
2437 C  CB  . PRO A 326 ? 1.3371 1.4995 1.2329 -0.0757 0.1564  0.0438  337 PRO A CB  
2438 C  CG  . PRO A 326 ? 1.3253 1.4891 1.2168 -0.0759 0.1514  0.0465  337 PRO A CG  
2439 C  CD  . PRO A 326 ? 1.2857 1.4431 1.1854 -0.0762 0.1484  0.0525  337 PRO A CD  
2440 N  N   . ASP A 327 ? 1.3025 1.4519 1.2212 -0.0756 0.1554  0.0569  338 ASP A N   
2441 C  CA  . ASP A 327 ? 1.3169 1.4652 1.2442 -0.0749 0.1578  0.0624  338 ASP A CA  
2442 C  C   . ASP A 327 ? 1.2886 1.4269 1.2257 -0.0756 0.1546  0.0634  338 ASP A C   
2443 O  O   . ASP A 327 ? 1.2966 1.4326 1.2425 -0.0751 0.1551  0.0685  338 ASP A O   
2444 C  CB  . ASP A 327 ? 1.3260 1.4792 1.2524 -0.0740 0.1578  0.0708  338 ASP A CB  
2445 C  CG  . ASP A 327 ? 1.2886 1.4371 1.2172 -0.0745 0.1520  0.0756  338 ASP A CG  
2446 O  OD1 . ASP A 327 ? 1.2616 1.4071 1.1862 -0.0754 0.1482  0.0720  338 ASP A OD1 
2447 O  OD2 . ASP A 327 ? 1.2880 1.4356 1.2228 -0.0740 0.1515  0.0828  338 ASP A OD2 
2448 N  N   . ASN A 328 ? 1.2586 1.3901 1.1939 -0.0767 0.1512  0.0583  339 ASN A N   
2449 C  CA  . ASN A 328 ? 1.2350 1.3557 1.1776 -0.0775 0.1478  0.0591  339 ASN A CA  
2450 C  C   . ASN A 328 ? 1.2533 1.3705 1.2034 -0.0774 0.1502  0.0562  339 ASN A C   
2451 O  O   . ASN A 328 ? 1.2537 1.3677 1.2023 -0.0780 0.1507  0.0492  339 ASN A O   
2452 C  CB  . ASN A 328 ? 1.2014 1.3147 1.1396 -0.0790 0.1437  0.0553  339 ASN A CB  
2453 C  CG  . ASN A 328 ? 1.1772 1.2785 1.1211 -0.0799 0.1395  0.0581  339 ASN A CG  
2454 O  OD1 . ASN A 328 ? 1.1857 1.2819 1.1368 -0.0797 0.1394  0.0587  339 ASN A OD1 
2455 N  ND2 . ASN A 328 ? 1.1496 1.2462 1.0905 -0.0808 0.1357  0.0600  339 ASN A ND2 
2456 N  N   . VAL A 329 ? 1.2704 1.3884 1.2294 -0.0765 0.1515  0.0618  340 VAL A N   
2457 C  CA  . VAL A 329 ? 1.2943 1.4097 1.2628 -0.0761 0.1538  0.0604  340 VAL A CA  
2458 C  C   . VAL A 329 ? 1.2794 1.3842 1.2505 -0.0772 0.1504  0.0554  340 VAL A C   
2459 O  O   . VAL A 329 ? 1.2974 1.4025 1.2691 -0.0772 0.1531  0.0494  340 VAL A O   
2460 C  CB  . VAL A 329 ? 1.3069 1.4218 1.2862 -0.0753 0.1536  0.0680  340 VAL A CB  
2461 C  CG1 . VAL A 329 ? 1.3292 1.4409 1.3204 -0.0749 0.1554  0.0666  340 VAL A CG1 
2462 C  CG2 . VAL A 329 ? 1.3322 1.4575 1.3089 -0.0743 0.1579  0.0727  340 VAL A CG2 
2463 N  N   . ASN A 330 ? 1.2492 1.3442 1.2212 -0.0781 0.1447  0.0579  341 ASN A N   
2464 C  CA  . ASN A 330 ? 1.2369 1.3203 1.2094 -0.0792 0.1411  0.0535  341 ASN A CA  
2465 C  C   . ASN A 330 ? 1.2360 1.3203 1.2006 -0.0799 0.1431  0.0454  341 ASN A C   
2466 O  O   . ASN A 330 ? 1.2507 1.3315 1.2183 -0.0801 0.1440  0.0404  341 ASN A O   
2467 C  CB  . ASN A 330 ? 1.2044 1.2777 1.1744 -0.0804 0.1352  0.0568  341 ASN A CB  
2468 C  CG  . ASN A 330 ? 1.2036 1.2738 1.1822 -0.0799 0.1324  0.0642  341 ASN A CG  
2469 O  OD1 . ASN A 330 ? 1.2031 1.2648 1.1893 -0.0800 0.1295  0.0650  341 ASN A OD1 
2470 N  ND2 . ASN A 330 ? 1.2058 1.2828 1.1838 -0.0793 0.1331  0.0698  341 ASN A ND2 
2471 N  N   . ALA A 331 ? 1.2205 1.3097 1.1759 -0.0803 0.1435  0.0440  342 ALA A N   
2472 C  CA  . ALA A 331 ? 1.2189 1.3094 1.1668 -0.0810 0.1450  0.0365  342 ALA A CA  
2473 C  C   . ALA A 331 ? 1.2531 1.3506 1.2027 -0.0802 0.1502  0.0316  342 ALA A C   
2474 O  O   . ALA A 331 ? 1.2610 1.3542 1.2110 -0.0807 0.1508  0.0255  342 ALA A O   
2475 C  CB  . ALA A 331 ? 1.2057 1.3024 1.1453 -0.0812 0.1448  0.0366  342 ALA A CB  
2476 N  N   . LEU A 332 ? 1.2758 1.3836 1.2262 -0.0789 0.1541  0.0344  343 LEU A N   
2477 C  CA  . LEU A 332 ? 1.3133 1.4276 1.2656 -0.0781 0.1597  0.0304  343 LEU A CA  
2478 C  C   . LEU A 332 ? 1.3253 1.4324 1.2874 -0.0782 0.1597  0.0281  343 LEU A C   
2479 O  O   . LEU A 332 ? 1.3382 1.4446 1.2995 -0.0785 0.1616  0.0212  343 LEU A O   
2480 C  CB  . LEU A 332 ? 1.3390 1.4630 1.2924 -0.0768 0.1639  0.0353  343 LEU A CB  
2481 C  CG  . LEU A 332 ? 1.3402 1.4720 1.2840 -0.0765 0.1640  0.0381  343 LEU A CG  
2482 C  CD1 . LEU A 332 ? 1.3440 1.4802 1.2918 -0.0754 0.1657  0.0462  343 LEU A CD1 
2483 C  CD2 . LEU A 332 ? 1.3746 1.5144 1.3088 -0.0763 0.1678  0.0322  343 LEU A CD2 
2484 N  N   . LYS A 333 ? 1.3216 1.4231 1.2929 -0.0779 0.1570  0.0338  344 LYS A N   
2485 C  CA  . LYS A 333 ? 1.3377 1.4323 1.3200 -0.0778 0.1563  0.0328  344 LYS A CA  
2486 C  C   . LYS A 333 ? 1.3262 1.4112 1.3064 -0.0790 0.1533  0.0268  344 LYS A C   
2487 O  O   . LYS A 333 ? 1.3492 1.4328 1.3345 -0.0789 0.1553  0.0221  344 LYS A O   
2488 C  CB  . LYS A 333 ? 1.3305 1.4189 1.3218 -0.0776 0.1522  0.0401  344 LYS A CB  
2489 C  CG  . LYS A 333 ? 1.3574 1.4536 1.3572 -0.0763 0.1560  0.0455  344 LYS A CG  
2490 C  CD  . LYS A 333 ? 1.3477 1.4374 1.3567 -0.0761 0.1511  0.0528  344 LYS A CD  
2491 C  CE  . LYS A 333 ? 1.3599 1.4396 1.3805 -0.0763 0.1475  0.0520  344 LYS A CE  
2492 N  NZ  . LYS A 333 ? 1.3516 1.4248 1.3812 -0.0761 0.1423  0.0591  344 LYS A NZ  
2493 N  N   . ASP A 334 ? 1.2926 1.3706 1.2655 -0.0802 0.1487  0.0272  345 ASP A N   
2494 C  CA  . ASP A 334 ? 1.2812 1.3484 1.2513 -0.0816 0.1457  0.0222  345 ASP A CA  
2495 C  C   . ASP A 334 ? 1.2920 1.3644 1.2564 -0.0818 0.1498  0.0142  345 ASP A C   
2496 O  O   . ASP A 334 ? 1.3063 1.3738 1.2734 -0.0822 0.1502  0.0092  345 ASP A O   
2497 C  CB  . ASP A 334 ? 1.2454 1.3037 1.2087 -0.0829 0.1406  0.0247  345 ASP A CB  
2498 C  CG  . ASP A 334 ? 1.2373 1.2876 1.2065 -0.0829 0.1358  0.0318  345 ASP A CG  
2499 O  OD1 . ASP A 334 ? 1.2423 1.2992 1.2165 -0.0818 0.1366  0.0375  345 ASP A OD1 
2500 O  OD2 . ASP A 334 ? 1.2281 1.2653 1.1968 -0.0840 0.1312  0.0317  345 ASP A OD2 
2501 N  N   . ARG A 335 ? 1.2884 1.3705 1.2451 -0.0816 0.1525  0.0130  346 ARG A N   
2502 C  CA  . ARG A 335 ? 1.3014 1.3892 1.2525 -0.0818 0.1562  0.0054  346 ARG A CA  
2503 C  C   . ARG A 335 ? 1.3405 1.4339 1.2977 -0.0808 0.1612  0.0021  346 ARG A C   
2504 O  O   . ARG A 335 ? 1.3549 1.4492 1.3105 -0.0811 0.1636  -0.0049 346 ARG A O   
2505 C  CB  . ARG A 335 ? 1.2942 1.3918 1.2364 -0.0816 0.1577  0.0053  346 ARG A CB  
2506 C  CG  . ARG A 335 ? 1.3098 1.4115 1.2459 -0.0821 0.1603  -0.0029 346 ARG A CG  
2507 C  CD  . ARG A 335 ? 1.3031 1.4129 1.2305 -0.0820 0.1605  -0.0033 346 ARG A CD  
2508 N  NE  . ARG A 335 ? 1.3285 1.4489 1.2548 -0.0806 0.1638  -0.0003 346 ARG A NE  
2509 C  CZ  . ARG A 335 ? 1.3355 1.4646 1.2538 -0.0803 0.1647  -0.0010 346 ARG A CZ  
2510 N  NH1 . ARG A 335 ? 1.3180 1.4468 1.2300 -0.0812 0.1623  -0.0048 346 ARG A NH1 
2511 N  NH2 . ARG A 335 ? 1.3628 1.5002 1.2793 -0.0791 0.1680  0.0021  346 ARG A NH2 
2512 N  N   . ALA A 336 ? 1.3597 1.4571 1.3243 -0.0796 0.1631  0.0071  347 ALA A N   
2513 C  CA  . ALA A 336 ? 1.3987 1.5002 1.3709 -0.0787 0.1680  0.0044  347 ALA A CA  
2514 C  C   . ALA A 336 ? 1.4040 1.4953 1.3837 -0.0792 0.1657  0.0011  347 ALA A C   
2515 O  O   . ALA A 336 ? 1.4250 1.5172 1.4051 -0.0794 0.1686  -0.0056 347 ALA A O   
2516 C  CB  . ALA A 336 ? 1.4179 1.5241 1.3977 -0.0775 0.1701  0.0110  347 ALA A CB  
2517 N  N   . GLU A 337 ? 1.3865 1.4676 1.3715 -0.0796 0.1601  0.0057  348 GLU A N   
2518 C  CA  . GLU A 337 ? 1.3931 1.4632 1.3850 -0.0801 0.1570  0.0033  348 GLU A CA  
2519 C  C   . GLU A 337 ? 1.3863 1.4519 1.3708 -0.0813 0.1567  -0.0040 348 GLU A C   
2520 O  O   . GLU A 337 ? 1.4053 1.4644 1.3949 -0.0816 0.1561  -0.0079 348 GLU A O   
2521 C  CB  . GLU A 337 ? 1.3722 1.4307 1.3679 -0.0806 0.1501  0.0094  348 GLU A CB  
2522 C  CG  . GLU A 337 ? 1.3913 1.4391 1.3968 -0.0807 0.1466  0.0083  348 GLU A CG  
2523 C  CD  . GLU A 337 ? 1.3715 1.4049 1.3770 -0.0816 0.1387  0.0130  348 GLU A CD  
2524 O  OE1 . GLU A 337 ? 1.3467 1.3797 1.3495 -0.0817 0.1361  0.0189  348 GLU A OE1 
2525 O  OE2 . GLU A 337 ? 1.3836 1.4055 1.3914 -0.0823 0.1348  0.0108  348 GLU A OE2 
2526 N  N   . ALA A 338 ? 1.3614 1.4305 1.3345 -0.0820 0.1572  -0.0060 349 ALA A N   
2527 C  CA  . ALA A 338 ? 1.3541 1.4197 1.3198 -0.0833 0.1573  -0.0130 349 ALA A CA  
2528 C  C   . ALA A 338 ? 1.3846 1.4595 1.3500 -0.0827 0.1631  -0.0198 349 ALA A C   
2529 O  O   . ALA A 338 ? 1.3986 1.4694 1.3654 -0.0832 0.1639  -0.0258 349 ALA A O   
2530 C  CB  . ALA A 338 ? 1.3218 1.3875 1.2768 -0.0842 0.1554  -0.0122 349 ALA A CB  
2531 N  N   . TYR A 339 ? 1.3970 1.4841 1.3602 -0.0817 0.1671  -0.0188 350 TYR A N   
2532 C  CA  . TYR A 339 ? 1.4312 1.5275 1.3935 -0.0811 0.1730  -0.0247 350 TYR A CA  
2533 C  C   . TYR A 339 ? 1.4620 1.5553 1.4355 -0.0806 0.1752  -0.0272 350 TYR A C   
2534 O  O   . TYR A 339 ? 1.4841 1.5792 1.4577 -0.0807 0.1784  -0.0343 350 TYR A O   
2535 C  CB  . TYR A 339 ? 1.4462 1.5543 1.4054 -0.0800 0.1769  -0.0215 350 TYR A CB  
2536 C  CG  . TYR A 339 ? 1.4285 1.5425 1.3757 -0.0803 0.1762  -0.0217 350 TYR A CG  
2537 C  CD1 . TYR A 339 ? 1.4269 1.5428 1.3665 -0.0811 0.1768  -0.0290 350 TYR A CD1 
2538 C  CD2 . TYR A 339 ? 1.4162 1.5340 1.3603 -0.0799 0.1748  -0.0147 350 TYR A CD2 
2539 C  CE1 . TYR A 339 ? 1.4138 1.5352 1.3434 -0.0814 0.1756  -0.0292 350 TYR A CE1 
2540 C  CE2 . TYR A 339 ? 1.4032 1.5265 1.3370 -0.0801 0.1738  -0.0147 350 TYR A CE2 
2541 C  CZ  . TYR A 339 ? 1.4025 1.5275 1.3293 -0.0808 0.1740  -0.0220 350 TYR A CZ  
2542 O  OH  . TYR A 339 ? 1.3923 1.5225 1.3101 -0.0810 0.1725  -0.0222 350 TYR A OH  
2543 N  N   . LEU A 340 ? 1.4648 1.5533 1.4483 -0.0801 0.1730  -0.0215 351 LEU A N   
2544 C  CA  . LEU A 340 ? 1.4949 1.5795 1.4909 -0.0796 0.1741  -0.0232 351 LEU A CA  
2545 C  C   . LEU A 340 ? 1.4939 1.5693 1.4898 -0.0806 0.1718  -0.0291 351 LEU A C   
2546 O  O   . LEU A 340 ? 1.5232 1.6006 1.5232 -0.0804 0.1755  -0.0351 351 LEU A O   
2547 C  CB  . LEU A 340 ? 1.4932 1.5718 1.4997 -0.0790 0.1702  -0.0157 351 LEU A CB  
2548 C  CG  . LEU A 340 ? 1.5076 1.5941 1.5190 -0.0778 0.1729  -0.0094 351 LEU A CG  
2549 C  CD1 . LEU A 340 ? 1.5086 1.5874 1.5325 -0.0774 0.1683  -0.0033 351 LEU A CD1 
2550 C  CD2 . LEU A 340 ? 1.5518 1.6490 1.5671 -0.0768 0.1811  -0.0126 351 LEU A CD2 
2551 N  N   . ILE A 341 ? 1.4616 1.5267 1.4524 -0.0818 0.1659  -0.0275 352 ILE A N   
2552 C  CA  . ILE A 341 ? 1.4605 1.5151 1.4503 -0.0829 0.1633  -0.0323 352 ILE A CA  
2553 C  C   . ILE A 341 ? 1.4700 1.5300 1.4528 -0.0835 0.1674  -0.0406 352 ILE A C   
2554 O  O   . ILE A 341 ? 1.4802 1.5339 1.4638 -0.0842 0.1671  -0.0459 352 ILE A O   
2555 C  CB  . ILE A 341 ? 1.4238 1.4660 1.4073 -0.0843 0.1567  -0.0287 352 ILE A CB  
2556 C  CG1 . ILE A 341 ? 1.4135 1.4527 1.4019 -0.0837 0.1528  -0.0201 352 ILE A CG1 
2557 C  CG2 . ILE A 341 ? 1.4282 1.4569 1.4127 -0.0854 0.1535  -0.0322 352 ILE A CG2 
2558 C  CD1 . ILE A 341 ? 1.3762 1.4081 1.3557 -0.0849 0.1480  -0.0159 352 ILE A CD1 
2559 N  N   . GLU A 342 ? 1.4689 1.5404 1.4448 -0.0831 0.1711  -0.0415 353 GLU A N   
2560 C  CA  . GLU A 342 ? 1.4811 1.5591 1.4506 -0.0835 0.1751  -0.0492 353 GLU A CA  
2561 C  C   . GLU A 342 ? 1.5224 1.6109 1.4965 -0.0823 0.1814  -0.0525 353 GLU A C   
2562 O  O   . GLU A 342 ? 1.5434 1.6372 1.5136 -0.0824 0.1852  -0.0596 353 GLU A O   
2563 C  CB  . GLU A 342 ? 1.4545 1.5377 1.4126 -0.0840 0.1744  -0.0485 353 GLU A CB  
2564 C  CG  . GLU A 342 ? 1.4213 1.4946 1.3736 -0.0856 0.1699  -0.0490 353 GLU A CG  
2565 C  CD  . GLU A 342 ? 1.4317 1.4999 1.3834 -0.0867 0.1707  -0.0569 353 GLU A CD  
2566 O  OE1 . GLU A 342 ? 1.4603 1.5358 1.4124 -0.0863 0.1750  -0.0632 353 GLU A OE1 
2567 O  OE2 . GLU A 342 ? 1.4133 1.4696 1.3636 -0.0880 0.1672  -0.0568 353 GLU A OE2 
2568 N  N   . GLU A 343 ? 1.5357 1.6265 1.5183 -0.0811 0.1827  -0.0474 354 GLU A N   
2569 C  CA  . GLU A 343 ? 1.5775 1.6774 1.5658 -0.0799 0.1894  -0.0495 354 GLU A CA  
2570 C  C   . GLU A 343 ? 1.5853 1.6969 1.5631 -0.0796 0.1938  -0.0507 354 GLU A C   
2571 O  O   . GLU A 343 ? 1.6196 1.7379 1.5958 -0.0793 0.1993  -0.0567 354 GLU A O   
2572 C  CB  . GLU A 343 ? 1.6113 1.7087 1.6062 -0.0800 0.1920  -0.0569 354 GLU A CB  
2573 C  CG  . GLU A 343 ? 1.6080 1.6930 1.6129 -0.0803 0.1872  -0.0557 354 GLU A CG  
2574 C  CD  . GLU A 343 ? 1.6253 1.7058 1.6321 -0.0810 0.1880  -0.0636 354 GLU A CD  
2575 O  OE1 . GLU A 343 ? 1.6194 1.7039 1.6173 -0.0817 0.1902  -0.0697 354 GLU A OE1 
2576 O  OE2 . GLU A 343 ? 1.6467 1.7194 1.6644 -0.0809 0.1860  -0.0637 354 GLU A OE2 
2577 N  N   . MSE A 344 ? 1.5562 1.6700 1.5270 -0.0796 0.1912  -0.0449 355 MSE A N   
2578 C  CA  . MSE A 344 ? 1.5630 1.6872 1.5232 -0.0792 0.1943  -0.0451 355 MSE A CA  
2579 C  C   . MSE A 344 ? 1.5773 1.7070 1.5401 -0.0781 0.1969  -0.0381 355 MSE A C   
2580 O  O   . MSE A 344 ? 1.5543 1.6849 1.5129 -0.0780 0.1940  -0.0317 355 MSE A O   
2581 C  CB  . MSE A 344 ? 1.5243 1.6475 1.4739 -0.0801 0.1895  -0.0443 355 MSE A CB  
2582 C  CG  . MSE A 344 ? 1.5042 1.6187 1.4533 -0.0814 0.1856  -0.0488 355 MSE A CG  
2583 SE SE  . MSE A 344 ? 1.4846 1.6033 1.4195 -0.0824 0.1836  -0.0528 355 MSE A SE  
2584 C  CE  . MSE A 344 ? 1.4879 1.5964 1.4258 -0.0839 0.1822  -0.0611 355 MSE A CE  
2585 N  N   . TYR A 345 ? 1.6179 1.7511 1.5881 -0.0773 0.2028  -0.0395 356 TYR A N   
2586 C  CA  . TYR A 345 ? 1.6356 1.7720 1.6126 -0.0763 0.2057  -0.0328 356 TYR A CA  
2587 C  C   . TYR A 345 ? 1.6438 1.7889 1.6098 -0.0758 0.2087  -0.0297 356 TYR A C   
2588 O  O   . TYR A 345 ? 1.6303 1.7762 1.5976 -0.0754 0.2074  -0.0221 356 TYR A O   
2589 C  CB  . TYR A 345 ? 1.6816 1.8187 1.6710 -0.0756 0.2116  -0.0359 356 TYR A CB  
2590 C  CG  . TYR A 345 ? 1.6781 1.8061 1.6777 -0.0761 0.2081  -0.0394 356 TYR A CG  
2591 C  CD1 . TYR A 345 ? 1.6600 1.7799 1.6712 -0.0759 0.2031  -0.0341 356 TYR A CD1 
2592 C  CD2 . TYR A 345 ? 1.6952 1.8227 1.6925 -0.0766 0.2098  -0.0480 356 TYR A CD2 
2593 C  CE1 . TYR A 345 ? 1.6611 1.7725 1.6815 -0.0762 0.2001  -0.0369 356 TYR A CE1 
2594 C  CE2 . TYR A 345 ? 1.6953 1.8146 1.7023 -0.0769 0.2072  -0.0510 356 TYR A CE2 
2595 C  CZ  . TYR A 345 ? 1.6787 1.7898 1.6970 -0.0767 0.2022  -0.0453 356 TYR A CZ  
2596 O  OH  . TYR A 345 ? 1.6818 1.7841 1.7091 -0.0770 0.1991  -0.0478 356 TYR A OH  
2597 N  N   . ASP A 346 ? 1.6675 1.8186 1.6223 -0.0760 0.2121  -0.0356 357 ASP A N   
2598 C  CA  . ASP A 346 ? 1.6794 1.8383 1.6214 -0.0757 0.2144  -0.0335 357 ASP A CA  
2599 C  C   . ASP A 346 ? 1.6340 1.7917 1.5706 -0.0759 0.2078  -0.0270 357 ASP A C   
2600 O  O   . ASP A 346 ? 1.6373 1.7995 1.5688 -0.0754 0.2088  -0.0212 357 ASP A O   
2601 C  CB  . ASP A 346 ? 1.7031 1.8668 1.6332 -0.0762 0.2167  -0.0418 357 ASP A CB  
2602 C  CG  . ASP A 346 ? 1.7294 1.9011 1.6463 -0.0758 0.2206  -0.0404 357 ASP A CG  
2603 O  OD1 . ASP A 346 ? 1.7100 1.8835 1.6234 -0.0754 0.2189  -0.0329 357 ASP A OD1 
2604 O  OD2 . ASP A 346 ? 1.7717 1.9475 1.6811 -0.0759 0.2251  -0.0470 357 ASP A OD2 
2605 N  N   . GLU A 347 ? 1.5939 1.7451 1.5316 -0.0768 0.2015  -0.0281 358 GLU A N   
2606 C  CA  . GLU A 347 ? 1.5498 1.6985 1.4833 -0.0771 0.1952  -0.0226 358 GLU A CA  
2607 C  C   . GLU A 347 ? 1.5333 1.6772 1.4770 -0.0767 0.1929  -0.0145 358 GLU A C   
2608 O  O   . GLU A 347 ? 1.5224 1.6688 1.4637 -0.0763 0.1917  -0.0076 358 GLU A O   
2609 C  CB  . GLU A 347 ? 1.5177 1.6605 1.4487 -0.0783 0.1901  -0.0273 358 GLU A CB  
2610 C  CG  . GLU A 347 ? 1.5276 1.6752 1.4484 -0.0788 0.1912  -0.0351 358 GLU A CG  
2611 C  CD  . GLU A 347 ? 1.5651 1.7127 1.4891 -0.0789 0.1956  -0.0433 358 GLU A CD  
2612 O  OE1 . GLU A 347 ? 1.5903 1.7372 1.5232 -0.0783 0.1997  -0.0429 358 GLU A OE1 
2613 O  OE2 . GLU A 347 ? 1.5709 1.7194 1.4890 -0.0796 0.1951  -0.0503 358 GLU A OE2 
2614 N  N   . ALA A 348 ? 1.5344 1.6713 1.4897 -0.0768 0.1922  -0.0154 359 ALA A N   
2615 C  CA  . ALA A 348 ? 1.5206 1.6518 1.4869 -0.0765 0.1894  -0.0084 359 ALA A CA  
2616 C  C   . ALA A 348 ? 1.5471 1.6844 1.5170 -0.0754 0.1937  -0.0023 359 ALA A C   
2617 O  O   . ALA A 348 ? 1.5286 1.6647 1.5005 -0.0752 0.1907  0.0050  359 ALA A O   
2618 C  CB  . ALA A 348 ? 1.5265 1.6501 1.5048 -0.0766 0.1887  -0.0112 359 ALA A CB  
2619 N  N   . ILE A 349 ? 1.5924 1.7362 1.5633 -0.0748 0.2010  -0.0054 360 ILE A N   
2620 C  CA  . ILE A 349 ? 1.6232 1.7729 1.5964 -0.0738 0.2062  0.0000  360 ILE A CA  
2621 C  C   . ILE A 349 ? 1.6092 1.7640 1.5694 -0.0738 0.2049  0.0043  360 ILE A C   
2622 O  O   . ILE A 349 ? 1.5995 1.7544 1.5626 -0.0734 0.2035  0.0120  360 ILE A O   
2623 C  CB  . ILE A 349 ? 1.6801 1.8353 1.6559 -0.0733 0.2153  -0.0046 360 ILE A CB  
2624 C  CG1 . ILE A 349 ? 1.6962 1.8570 1.6572 -0.0737 0.2184  -0.0116 360 ILE A CG1 
2625 C  CG2 . ILE A 349 ? 1.6963 1.8463 1.6879 -0.0732 0.2162  -0.0079 360 ILE A CG2 
2626 C  CD1 . ILE A 349 ? 1.7545 1.9218 1.7131 -0.0732 0.2279  -0.0144 360 ILE A CD1 
2627 N  N   . GLN A 350 ? 1.6086 1.7671 1.5551 -0.0742 0.2047  -0.0004 361 GLN A N   
2628 C  CA  . GLN A 350 ? 1.6011 1.7646 1.5348 -0.0742 0.2033  0.0030  361 GLN A CA  
2629 C  C   . GLN A 350 ? 1.5573 1.7169 1.4941 -0.0742 0.1970  0.0107  361 GLN A C   
2630 O  O   . GLN A 350 ? 1.5595 1.7226 1.4933 -0.0737 0.1973  0.0173  361 GLN A O   
2631 C  CB  . GLN A 350 ? 1.5960 1.7617 1.5170 -0.0748 0.2012  -0.0036 361 GLN A CB  
2632 C  CG  . GLN A 350 ? 1.5938 1.7654 1.5011 -0.0747 0.2000  -0.0006 361 GLN A CG  
2633 C  CD  . GLN A 350 ? 1.6097 1.7848 1.5045 -0.0752 0.1995  -0.0082 361 GLN A CD  
2634 O  OE1 . GLN A 350 ? 1.5897 1.7614 1.4853 -0.0759 0.1964  -0.0141 361 GLN A OE1 
2635 N  NE2 . GLN A 350 ? 1.6484 1.8300 1.5314 -0.0747 0.2024  -0.0078 361 GLN A NE2 
2636 N  N   . ASP A 351 ? 1.5203 1.6720 1.4630 -0.0749 0.1914  0.0097  362 ASP A N   
2637 C  CA  . ASP A 351 ? 1.4786 1.6246 1.4248 -0.0752 0.1852  0.0161  362 ASP A CA  
2638 C  C   . ASP A 351 ? 1.4856 1.6306 1.4429 -0.0744 0.1861  0.0237  362 ASP A C   
2639 O  O   . ASP A 351 ? 1.4738 1.6206 1.4292 -0.0741 0.1845  0.0305  362 ASP A O   
2640 C  CB  . ASP A 351 ? 1.4491 1.5858 1.3988 -0.0762 0.1799  0.0125  362 ASP A CB  
2641 C  CG  . ASP A 351 ? 1.4198 1.5565 1.3587 -0.0771 0.1772  0.0073  362 ASP A CG  
2642 O  OD1 . ASP A 351 ? 1.4282 1.5725 1.3573 -0.0769 0.1790  0.0060  362 ASP A OD1 
2643 O  OD2 . ASP A 351 ? 1.3906 1.5195 1.3308 -0.0781 0.1733  0.0044  362 ASP A OD2 
2644 N  N   . TYR A 352 ? 1.5066 1.6485 1.4759 -0.0741 0.1886  0.0224  363 TYR A N   
2645 C  CA  . TYR A 352 ? 1.5179 1.6590 1.4996 -0.0734 0.1898  0.0291  363 TYR A CA  
2646 C  C   . TYR A 352 ? 1.5481 1.6978 1.5258 -0.0726 0.1955  0.0334  363 TYR A C   
2647 O  O   . TYR A 352 ? 1.5435 1.6935 1.5259 -0.0721 0.1947  0.0409  363 TYR A O   
2648 C  CB  . TYR A 352 ? 1.5449 1.6827 1.5403 -0.0731 0.1926  0.0260  363 TYR A CB  
2649 C  CG  . TYR A 352 ? 1.5199 1.6476 1.5216 -0.0738 0.1864  0.0235  363 TYR A CG  
2650 C  CD1 . TYR A 352 ? 1.4822 1.6021 1.4872 -0.0742 0.1792  0.0287  363 TYR A CD1 
2651 C  CD2 . TYR A 352 ? 1.5373 1.6626 1.5414 -0.0741 0.1878  0.0160  363 TYR A CD2 
2652 C  CE1 . TYR A 352 ? 1.4633 1.5726 1.4726 -0.0750 0.1734  0.0265  363 TYR A CE1 
2653 C  CE2 . TYR A 352 ? 1.5178 1.6329 1.5269 -0.0748 0.1820  0.0139  363 TYR A CE2 
2654 C  CZ  . TYR A 352 ? 1.4814 1.5883 1.4926 -0.0752 0.1748  0.0192  363 TYR A CZ  
2655 O  OH  . TYR A 352 ? 1.4657 1.5613 1.4803 -0.0760 0.1690  0.0173  363 TYR A OH  
2656 N  N   . GLU A 353 ? 1.5812 1.7376 1.5497 -0.0725 0.2013  0.0286  364 GLU A N   
2657 C  CA  . GLU A 353 ? 1.6160 1.7800 1.5774 -0.0718 0.2071  0.0319  364 GLU A CA  
2658 C  C   . GLU A 353 ? 1.5899 1.7559 1.5415 -0.0719 0.2027  0.0377  364 GLU A C   
2659 O  O   . GLU A 353 ? 1.6057 1.7753 1.5569 -0.0713 0.2053  0.0442  364 GLU A O   
2660 C  CB  . GLU A 353 ? 1.6551 1.8246 1.6066 -0.0719 0.2133  0.0247  364 GLU A CB  
2661 C  CG  . GLU A 353 ? 1.6983 1.8677 1.6604 -0.0716 0.2202  0.0204  364 GLU A CG  
2662 C  CD  . GLU A 353 ? 1.7328 1.9064 1.6850 -0.0719 0.2256  0.0121  364 GLU A CD  
2663 O  OE1 . GLU A 353 ? 1.7180 1.8939 1.6557 -0.0723 0.2231  0.0089  364 GLU A OE1 
2664 O  OE2 . GLU A 353 ? 1.7766 1.9511 1.7363 -0.0716 0.2324  0.0086  364 GLU A OE2 
2665 N  N   . THR A 354 ? 1.5518 1.7152 1.4962 -0.0726 0.1963  0.0354  365 THR A N   
2666 C  CA  . THR A 354 ? 1.5237 1.6881 1.4608 -0.0726 0.1914  0.0408  365 THR A CA  
2667 C  C   . THR A 354 ? 1.4970 1.6563 1.4452 -0.0725 0.1875  0.0484  365 THR A C   
2668 O  O   . THR A 354 ? 1.4972 1.6589 1.4439 -0.0720 0.1870  0.0554  365 THR A O   
2669 C  CB  . THR A 354 ? 1.4916 1.6545 1.4190 -0.0735 0.1859  0.0359  365 THR A CB  
2670 O  OG1 . THR A 354 ? 1.5172 1.6838 1.4368 -0.0736 0.1894  0.0278  365 THR A OG1 
2671 C  CG2 . THR A 354 ? 1.4769 1.6432 1.3949 -0.0733 0.1824  0.0409  365 THR A CG2 
2672 N  N   . ALA A 355 ? 1.4777 1.6294 1.4367 -0.0729 0.1846  0.0470  366 ALA A N   
2673 C  CA  . ALA A 355 ? 1.4564 1.6023 1.4265 -0.0728 0.1806  0.0536  366 ALA A CA  
2674 C  C   . ALA A 355 ? 1.4920 1.6413 1.4716 -0.0718 0.1857  0.0592  366 ALA A C   
2675 O  O   . ALA A 355 ? 1.4823 1.6301 1.4675 -0.0716 0.1833  0.0665  366 ALA A O   
2676 C  CB  . ALA A 355 ? 1.4345 1.5710 1.4131 -0.0734 0.1764  0.0503  366 ALA A CB  
2677 N  N   . GLN A 356 ? 1.5350 1.6887 1.5166 -0.0714 0.1929  0.0557  367 GLN A N   
2678 C  CA  . GLN A 356 ? 1.5774 1.7352 1.5671 -0.0706 0.1994  0.0601  367 GLN A CA  
2679 C  C   . GLN A 356 ? 1.5844 1.7475 1.5660 -0.0702 0.2006  0.0670  367 GLN A C   
2680 O  O   . GLN A 356 ? 1.5939 1.7568 1.5843 -0.0697 0.2011  0.0741  367 GLN A O   
2681 C  CB  . GLN A 356 ? 1.6252 1.7875 1.6144 -0.0703 0.2078  0.0541  367 GLN A CB  
2682 C  CG  . GLN A 356 ? 1.6759 1.8419 1.6747 -0.0696 0.2159  0.0577  367 GLN A CG  
2683 C  CD  . GLN A 356 ? 1.6729 1.8336 1.6921 -0.0693 0.2142  0.0611  367 GLN A CD  
2684 O  OE1 . GLN A 356 ? 1.6762 1.8327 1.7055 -0.0694 0.2134  0.0565  367 GLN A OE1 
2685 N  NE2 . GLN A 356 ? 1.6688 1.8296 1.6943 -0.0689 0.2133  0.0692  367 GLN A NE2 
2686 N  N   . GLU A 357 ? 1.5813 1.7488 1.5466 -0.0704 0.2006  0.0648  368 GLU A N   
2687 C  CA  . GLU A 357 ? 1.5906 1.7628 1.5464 -0.0700 0.2010  0.0709  368 GLU A CA  
2688 C  C   . GLU A 357 ? 1.5535 1.7220 1.5146 -0.0700 0.1943  0.0781  368 GLU A C   
2689 O  O   . GLU A 357 ? 1.5686 1.7403 1.5268 -0.0696 0.1949  0.0850  368 GLU A O   
2690 C  CB  . GLU A 357 ? 1.5900 1.7662 1.5280 -0.0703 0.2001  0.0666  368 GLU A CB  
2691 C  CG  . GLU A 357 ? 1.6288 1.8110 1.5555 -0.0698 0.2026  0.0719  368 GLU A CG  
2692 C  CD  . GLU A 357 ? 1.6400 1.8263 1.5491 -0.0700 0.2021  0.0671  368 GLU A CD  
2693 O  OE1 . GLU A 357 ? 1.6039 1.7882 1.5095 -0.0706 0.1973  0.0613  368 GLU A OE1 
2694 O  OE2 . GLU A 357 ? 1.6884 1.8794 1.5870 -0.0697 0.2066  0.0693  368 GLU A OE2 
2695 N  N   . HIS A 358 ? 1.5083 1.6696 1.4770 -0.0706 0.1881  0.0767  369 HIS A N   
2696 C  CA  . HIS A 358 ? 1.4718 1.6285 1.4453 -0.0708 0.1815  0.0828  369 HIS A CA  
2697 C  C   . HIS A 358 ? 1.4729 1.6243 1.4633 -0.0705 0.1806  0.0870  369 HIS A C   
2698 O  O   . HIS A 358 ? 1.4651 1.6159 1.4605 -0.0702 0.1788  0.0943  369 HIS A O   
2699 C  CB  . HIS A 358 ? 1.4257 1.5774 1.3926 -0.0717 0.1745  0.0791  369 HIS A CB  
2700 C  CG  . HIS A 358 ? 1.4244 1.5815 1.3760 -0.0718 0.1745  0.0763  369 HIS A CG  
2701 N  ND1 . HIS A 358 ? 1.4551 1.6176 1.3985 -0.0717 0.1795  0.0707  369 HIS A ND1 
2702 C  CD2 . HIS A 358 ? 1.3989 1.5566 1.3424 -0.0721 0.1698  0.0783  369 HIS A CD2 
2703 C  CE1 . HIS A 358 ? 1.4480 1.6142 1.3787 -0.0719 0.1774  0.0693  369 HIS A CE1 
2704 N  NE2 . HIS A 358 ? 1.4147 1.5782 1.3458 -0.0721 0.1717  0.0739  369 HIS A NE2 
2705 N  N   . ASN A 359 ? 1.4848 1.6324 1.4846 -0.0706 0.1817  0.0826  370 ASN A N   
2706 C  CA  . ASN A 359 ? 1.4969 1.6404 1.5140 -0.0703 0.1814  0.0863  370 ASN A CA  
2707 C  C   . ASN A 359 ? 1.5470 1.6943 1.5732 -0.0696 0.1894  0.0846  370 ASN A C   
2708 O  O   . ASN A 359 ? 1.5613 1.7082 1.5882 -0.0698 0.1918  0.0777  370 ASN A O   
2709 C  CB  . ASN A 359 ? 1.4653 1.5985 1.4893 -0.0710 0.1739  0.0845  370 ASN A CB  
2710 C  CG  . ASN A 359 ? 1.4256 1.5536 1.4488 -0.0714 0.1666  0.0900  370 ASN A CG  
2711 O  OD1 . ASN A 359 ? 1.4094 1.5407 1.4219 -0.0715 0.1656  0.0923  370 ASN A OD1 
2712 N  ND2 . ASN A 359 ? 1.4121 1.5314 1.4467 -0.0716 0.1613  0.0920  370 ASN A ND2 
2713 N  N   . GLU A 360 ? 1.5752 1.7262 1.6090 -0.0689 0.1936  0.0908  371 GLU A N   
2714 C  CA  . GLU A 360 ? 1.6288 1.7843 1.6709 -0.0683 0.2026  0.0901  371 GLU A CA  
2715 C  C   . GLU A 360 ? 1.6440 1.7942 1.7049 -0.0682 0.2020  0.0879  371 GLU A C   
2716 O  O   . GLU A 360 ? 1.6795 1.8318 1.7450 -0.0680 0.2082  0.0830  371 GLU A O   
2717 C  CB  . GLU A 360 ? 1.6579 1.8183 1.7024 -0.0677 0.2076  0.0978  371 GLU A CB  
2718 C  CG  . GLU A 360 ? 1.6639 1.8305 1.6896 -0.0677 0.2100  0.0998  371 GLU A CG  
2719 C  CD  . GLU A 360 ? 1.6991 1.8710 1.7126 -0.0678 0.2173  0.0936  371 GLU A CD  
2720 O  OE1 . GLU A 360 ? 1.7500 1.9251 1.7688 -0.0674 0.2261  0.0931  371 GLU A OE1 
2721 O  OE2 . GLU A 360 ? 1.6773 1.8499 1.6761 -0.0682 0.2143  0.0890  371 GLU A OE2 
2722 N  N   . ASN A 361 ? 1.6197 1.7628 1.6913 -0.0683 0.1944  0.0915  372 ASN A N   
2723 C  CA  . ASN A 361 ? 1.6383 1.7760 1.7294 -0.0681 0.1929  0.0908  372 ASN A CA  
2724 C  C   . ASN A 361 ? 1.6044 1.7322 1.6980 -0.0687 0.1839  0.0872  372 ASN A C   
2725 O  O   . ASN A 361 ? 1.6233 1.7462 1.7323 -0.0685 0.1823  0.0857  372 ASN A O   
2726 C  CB  . ASN A 361 ? 1.6594 1.7969 1.7661 -0.0675 0.1931  0.0986  372 ASN A CB  
2727 C  CG  . ASN A 361 ? 1.7147 1.8593 1.8309 -0.0668 0.2039  0.0996  372 ASN A CG  
2728 O  OD1 . ASN A 361 ? 1.7400 1.8897 1.8496 -0.0667 0.2115  0.0947  372 ASN A OD1 
2729 N  ND2 . ASN A 361 ? 1.7363 1.8807 1.8682 -0.0663 0.2047  0.1059  372 ASN A ND2 
2730 N  N   . ASP A 362 ? 1.5580 1.6825 1.6369 -0.0695 0.1781  0.0857  373 ASP A N   
2731 C  CA  . ASP A 362 ? 1.5255 1.6399 1.6042 -0.0703 0.1699  0.0822  373 ASP A CA  
2732 C  C   . ASP A 362 ? 1.5459 1.6581 1.6316 -0.0702 0.1719  0.0752  373 ASP A C   
2733 O  O   . ASP A 362 ? 1.5568 1.6741 1.6343 -0.0703 0.1773  0.0695  373 ASP A O   
2734 C  CB  . ASP A 362 ? 1.4820 1.5948 1.5421 -0.0712 0.1661  0.0800  373 ASP A CB  
2735 C  CG  . ASP A 362 ? 1.4523 1.5545 1.5104 -0.0721 0.1590  0.0754  373 ASP A CG  
2736 O  OD1 . ASP A 362 ? 1.4675 1.5637 1.5374 -0.0721 0.1570  0.0735  373 ASP A OD1 
2737 O  OD2 . ASP A 362 ? 1.4167 1.5162 1.4615 -0.0730 0.1554  0.0736  373 ASP A OD2 
2738 N  N   . GLN A 363 ? 1.5517 1.6560 1.6525 -0.0701 0.1670  0.0759  374 GLN A N   
2739 C  CA  . GLN A 363 ? 1.5742 1.6750 1.6845 -0.0700 0.1676  0.0701  374 GLN A CA  
2740 C  C   . GLN A 363 ? 1.5497 1.6474 1.6468 -0.0709 0.1660  0.0629  374 GLN A C   
2741 O  O   . GLN A 363 ? 1.5719 1.6728 1.6698 -0.0707 0.1712  0.0569  374 GLN A O   
2742 C  CB  . GLN A 363 ? 1.5800 1.6706 1.7067 -0.0699 0.1600  0.0727  374 GLN A CB  
2743 C  CG  . GLN A 363 ? 1.5978 1.6904 1.7395 -0.0692 0.1604  0.0800  374 GLN A CG  
2744 C  CD  . GLN A 363 ? 1.5829 1.6639 1.7353 -0.0694 0.1500  0.0837  374 GLN A CD  
2745 O  OE1 . GLN A 363 ? 1.5435 1.6149 1.6864 -0.0704 0.1418  0.0829  374 GLN A OE1 
2746 N  NE2 . GLN A 363 ? 1.6173 1.6988 1.7894 -0.0686 0.1503  0.0878  374 GLN A NE2 
2747 N  N   . GLN A 364 ? 1.5059 1.5969 1.5914 -0.0718 0.1590  0.0634  375 GLN A N   
2748 C  CA  . GLN A 364 ? 1.4808 1.5682 1.5530 -0.0728 0.1573  0.0571  375 GLN A CA  
2749 C  C   . GLN A 364 ? 1.4915 1.5896 1.5528 -0.0726 0.1652  0.0524  375 GLN A C   
2750 O  O   . GLN A 364 ? 1.4991 1.5969 1.5578 -0.0729 0.1672  0.0456  375 GLN A O   
2751 C  CB  . GLN A 364 ? 1.4346 1.5147 1.4953 -0.0739 0.1499  0.0592  375 GLN A CB  
2752 C  CG  . GLN A 364 ? 1.4199 1.4859 1.4865 -0.0745 0.1409  0.0608  375 GLN A CG  
2753 C  CD  . GLN A 364 ? 1.4179 1.4802 1.4895 -0.0744 0.1359  0.0687  375 GLN A CD  
2754 O  OE1 . GLN A 364 ? 1.4386 1.5078 1.5198 -0.0734 0.1392  0.0734  375 GLN A OE1 
2755 N  NE2 . GLN A 364 ? 1.3954 1.4465 1.4605 -0.0756 0.1282  0.0701  375 GLN A NE2 
2756 N  N   . ILE A 365 ? 1.4951 1.6020 1.5499 -0.0722 0.1695  0.0560  376 ILE A N   
2757 C  CA  . ILE A 365 ? 1.5103 1.6268 1.5538 -0.0721 0.1767  0.0517  376 ILE A CA  
2758 C  C   . ILE A 365 ? 1.5604 1.6824 1.6133 -0.0713 0.1847  0.0484  376 ILE A C   
2759 O  O   . ILE A 365 ? 1.5747 1.6995 1.6222 -0.0714 0.1886  0.0416  376 ILE A O   
2760 C  CB  . ILE A 365 ? 1.5051 1.6293 1.5384 -0.0718 0.1790  0.0565  376 ILE A CB  
2761 C  CG1 . ILE A 365 ? 1.4594 1.5781 1.4861 -0.0725 0.1714  0.0607  376 ILE A CG1 
2762 C  CG2 . ILE A 365 ? 1.5160 1.6480 1.5348 -0.0719 0.1844  0.0513  376 ILE A CG2 
2763 C  CD1 . ILE A 365 ? 1.4531 1.5790 1.4702 -0.0723 0.1730  0.0655  376 ILE A CD1 
2764 N  N   . ARG A 366 ? 1.5889 1.7124 1.6563 -0.0705 0.1874  0.0532  377 ARG A N   
2765 C  CA  . ARG A 366 ? 1.6401 1.7684 1.7182 -0.0698 0.1955  0.0504  377 ARG A CA  
2766 C  C   . ARG A 366 ? 1.6502 1.7732 1.7352 -0.0700 0.1941  0.0436  377 ARG A C   
2767 O  O   . ARG A 366 ? 1.6825 1.8099 1.7651 -0.0699 0.2004  0.0374  377 ARG A O   
2768 C  CB  . ARG A 366 ? 1.6670 1.7962 1.7623 -0.0690 0.1974  0.0570  377 ARG A CB  
2769 C  CG  . ARG A 366 ? 1.6926 1.8303 1.7830 -0.0685 0.2040  0.0623  377 ARG A CG  
2770 C  CD  . ARG A 366 ? 1.7124 1.8491 1.8193 -0.0679 0.2036  0.0699  377 ARG A CD  
2771 N  NE  . ARG A 366 ? 1.7410 1.8738 1.8692 -0.0675 0.2036  0.0686  377 ARG A NE  
2772 C  CZ  . ARG A 366 ? 1.7236 1.8481 1.8651 -0.0675 0.1953  0.0714  377 ARG A CZ  
2773 N  NH1 . ARG A 366 ? 1.6770 1.7960 1.8126 -0.0679 0.1867  0.0757  377 ARG A NH1 
2774 N  NH2 . ARG A 366 ? 1.7554 1.8768 1.9163 -0.0670 0.1956  0.0698  377 ARG A NH2 
2775 N  N   . GLU A 367 ? 1.6247 1.7376 1.7172 -0.0703 0.1856  0.0446  378 GLU A N   
2776 C  CA  . GLU A 367 ? 1.6365 1.7428 1.7365 -0.0705 0.1831  0.0388  378 GLU A CA  
2777 C  C   . GLU A 367 ? 1.6206 1.7265 1.7054 -0.0713 0.1831  0.0317  378 GLU A C   
2778 O  O   . GLU A 367 ? 1.6446 1.7484 1.7335 -0.0714 0.1844  0.0255  378 GLU A O   
2779 C  CB  . GLU A 367 ? 1.6181 1.7126 1.7274 -0.0708 0.1731  0.0422  378 GLU A CB  
2780 C  CG  . GLU A 367 ? 1.6429 1.7369 1.7713 -0.0699 0.1727  0.0480  378 GLU A CG  
2781 C  CD  . GLU A 367 ? 1.6287 1.7104 1.7650 -0.0702 0.1621  0.0513  378 GLU A CD  
2782 O  OE1 . GLU A 367 ? 1.6034 1.6762 1.7359 -0.0709 0.1563  0.0474  378 GLU A OE1 
2783 O  OE2 . GLU A 367 ? 1.6458 1.7264 1.7918 -0.0698 0.1594  0.0578  378 GLU A OE2 
2784 N  N   . GLY A 368 ? 1.5820 1.6898 1.6500 -0.0719 0.1815  0.0327  379 GLY A N   
2785 C  CA  . GLY A 368 ? 1.5661 1.6747 1.6191 -0.0727 0.1819  0.0262  379 GLY A CA  
2786 C  C   . GLY A 368 ? 1.6045 1.7215 1.6561 -0.0723 0.1908  0.0201  379 GLY A C   
2787 O  O   . GLY A 368 ? 1.6164 1.7310 1.6688 -0.0726 0.1914  0.0134  379 GLY A O   
2788 N  N   . LEU A 369 ? 1.6267 1.7529 1.6759 -0.0717 0.1977  0.0226  380 LEU A N   
2789 C  CA  . LEU A 369 ? 1.6690 1.8033 1.7151 -0.0714 0.2068  0.0172  380 LEU A CA  
2790 C  C   . LEU A 369 ? 1.7091 1.8416 1.7709 -0.0710 0.2104  0.0130  380 LEU A C   
2791 O  O   . LEU A 369 ? 1.7280 1.8615 1.7870 -0.0712 0.2135  0.0056  380 LEU A O   
2792 C  CB  . LEU A 369 ? 1.6932 1.8361 1.7364 -0.0707 0.2136  0.0219  380 LEU A CB  
2793 C  CG  . LEU A 369 ? 1.6781 1.8265 1.7025 -0.0710 0.2139  0.0237  380 LEU A CG  
2794 C  CD1 . LEU A 369 ? 1.6779 1.8278 1.6874 -0.0717 0.2136  0.0162  380 LEU A CD1 
2795 C  CD2 . LEU A 369 ? 1.6286 1.7733 1.6512 -0.0712 0.2064  0.0309  380 LEU A CD2 
2796 N  N   . GLU A 370 ? 1.7237 1.8536 1.8029 -0.0703 0.2099  0.0177  381 GLU A N   
2797 C  CA  . GLU A 370 ? 1.7675 1.8963 1.8643 -0.0698 0.2137  0.0145  381 GLU A CA  
2798 C  C   . GLU A 370 ? 1.7593 1.8807 1.8583 -0.0703 0.2088  0.0083  381 GLU A C   
2799 O  O   . GLU A 370 ? 1.7942 1.9171 1.8992 -0.0701 0.2138  0.0022  381 GLU A O   
2800 C  CB  . GLU A 370 ? 1.7811 1.9072 1.8969 -0.0691 0.2120  0.0211  381 GLU A CB  
2801 C  CG  . GLU A 370 ? 1.8070 1.9409 1.9235 -0.0685 0.2188  0.0268  381 GLU A CG  
2802 C  CD  . GLU A 370 ? 1.8344 1.9660 1.9720 -0.0678 0.2180  0.0328  381 GLU A CD  
2803 O  OE1 . GLU A 370 ? 1.8135 1.9366 1.9605 -0.0678 0.2089  0.0352  381 GLU A OE1 
2804 O  OE2 . GLU A 370 ? 1.8796 2.0176 2.0244 -0.0672 0.2266  0.0350  381 GLU A OE2 
2805 N  N   . LYS A 371 ? 1.7153 1.8285 1.8089 -0.0710 0.1993  0.0099  382 LYS A N   
2806 C  CA  . LYS A 371 ? 1.7056 1.8108 1.7988 -0.0716 0.1944  0.0043  382 LYS A CA  
2807 C  C   . LYS A 371 ? 1.7053 1.8152 1.7833 -0.0722 0.1984  -0.0029 382 LYS A C   
2808 O  O   . LYS A 371 ? 1.7275 1.8355 1.8087 -0.0724 0.2000  -0.0095 382 LYS A O   
2809 C  CB  . LYS A 371 ? 1.6599 1.7544 1.7495 -0.0724 0.1837  0.0081  382 LYS A CB  
2810 C  CG  . LYS A 371 ? 1.6506 1.7352 1.7397 -0.0731 0.1782  0.0029  382 LYS A CG  
2811 C  CD  . LYS A 371 ? 1.6179 1.6903 1.7042 -0.0739 0.1679  0.0072  382 LYS A CD  
2812 C  CE  . LYS A 371 ? 1.6028 1.6658 1.6817 -0.0751 0.1633  0.0018  382 LYS A CE  
2813 N  NZ  . LYS A 371 ? 1.6392 1.6961 1.7316 -0.0748 0.1620  -0.0018 382 LYS A NZ  
2814 N  N   . ALA A 372 ? 1.6828 1.7986 1.7448 -0.0725 0.2000  -0.0018 383 ALA A N   
2815 C  CA  . ALA A 372 ? 1.6802 1.8001 1.7269 -0.0732 0.2027  -0.0084 383 ALA A CA  
2816 C  C   . ALA A 372 ? 1.7308 1.8589 1.7785 -0.0727 0.2124  -0.0138 383 ALA A C   
2817 O  O   . ALA A 372 ? 1.7473 1.8751 1.7934 -0.0730 0.2144  -0.0212 383 ALA A O   
2818 C  CB  . ALA A 372 ? 1.6468 1.7704 1.6772 -0.0736 0.2009  -0.0052 383 ALA A CB  
2819 N  N   . GLN A 373 ? 1.7576 1.8927 1.8078 -0.0719 0.2187  -0.0100 384 GLN A N   
2820 C  CA  . GLN A 373 ? 1.8104 1.9530 1.8605 -0.0716 0.2288  -0.0146 384 GLN A CA  
2821 C  C   . GLN A 373 ? 1.8465 1.9864 1.9129 -0.0712 0.2318  -0.0197 384 GLN A C   
2822 O  O   . GLN A 373 ? 1.8799 2.0235 1.9437 -0.0713 0.2380  -0.0267 384 GLN A O   
2823 C  CB  . GLN A 373 ? 1.8356 1.9848 1.8863 -0.0709 0.2349  -0.0088 384 GLN A CB  
2824 C  CG  . GLN A 373 ? 1.8139 1.9681 1.8454 -0.0712 0.2345  -0.0059 384 GLN A CG  
2825 C  CD  . GLN A 373 ? 1.8303 1.9890 1.8631 -0.0706 0.2387  0.0015  384 GLN A CD  
2826 O  OE1 . GLN A 373 ? 1.8371 2.0023 1.8573 -0.0706 0.2445  0.0016  384 GLN A OE1 
2827 N  NE2 . GLN A 373 ? 1.8395 1.9944 1.8872 -0.0701 0.2357  0.0079  384 GLN A NE2 
2828 N  N   . ARG A 374 ? 1.8412 1.9743 1.9244 -0.0709 0.2269  -0.0160 385 ARG A N   
2829 C  CA  . ARG A 374 ? 1.8717 2.0006 1.9714 -0.0706 0.2277  -0.0204 385 ARG A CA  
2830 C  C   . ARG A 374 ? 1.8640 1.9901 1.9559 -0.0713 0.2259  -0.0284 385 ARG A C   
2831 O  O   . ARG A 374 ? 1.9033 2.0323 1.9985 -0.0713 0.2322  -0.0352 385 ARG A O   
2832 C  CB  . ARG A 374 ? 1.8569 1.9771 1.9728 -0.0703 0.2197  -0.0150 385 ARG A CB  
2833 C  CG  . ARG A 374 ? 1.8830 1.9968 2.0147 -0.0701 0.2179  -0.0196 385 ARG A CG  
2834 C  CD  . ARG A 374 ? 1.8711 1.9756 2.0176 -0.0698 0.2090  -0.0141 385 ARG A CD  
2835 N  NE  . ARG A 374 ? 1.8154 1.9124 1.9501 -0.0706 0.1992  -0.0106 385 ARG A NE  
2836 C  CZ  . ARG A 374 ? 1.7973 1.8838 1.9399 -0.0707 0.1898  -0.0066 385 ARG A CZ  
2837 N  NH1 . ARG A 374 ? 1.8302 1.9126 1.9935 -0.0699 0.1882  -0.0055 385 ARG A NH1 
2838 N  NH2 . ARG A 374 ? 1.7499 1.8296 1.8799 -0.0716 0.1819  -0.0039 385 ARG A NH2 
2839 N  N   . LEU A 375 ? 1.8152 1.9355 1.8965 -0.0721 0.2177  -0.0277 386 LEU A N   
2840 C  CA  . LEU A 375 ? 1.8039 1.9207 1.8774 -0.0730 0.2153  -0.0348 386 LEU A CA  
2841 C  C   . LEU A 375 ? 1.8178 1.9429 1.8762 -0.0733 0.2217  -0.0408 386 LEU A C   
2842 O  O   . LEU A 375 ? 1.8331 1.9573 1.8887 -0.0738 0.2229  -0.0483 386 LEU A O   
2843 C  CB  . LEU A 375 ? 1.7494 1.8575 1.8149 -0.0739 0.2054  -0.0320 386 LEU A CB  
2844 C  CG  . LEU A 375 ? 1.7395 1.8358 1.8173 -0.0740 0.1979  -0.0304 386 LEU A CG  
2845 C  CD1 . LEU A 375 ? 1.7318 1.8249 1.8212 -0.0733 0.1941  -0.0221 386 LEU A CD1 
2846 C  CD2 . LEU A 375 ? 1.6987 1.7867 1.7647 -0.0752 0.1906  -0.0317 386 LEU A CD2 
2847 N  N   . LEU A 376 ? 1.8151 1.9479 1.8638 -0.0731 0.2257  -0.0376 387 LEU A N   
2848 C  CA  . LEU A 376 ? 1.8295 1.9700 1.8626 -0.0734 0.2313  -0.0428 387 LEU A CA  
2849 C  C   . LEU A 376 ? 1.8857 2.0303 1.9245 -0.0731 0.2401  -0.0498 387 LEU A C   
2850 O  O   . LEU A 376 ? 1.8961 2.0427 1.9261 -0.0737 0.2422  -0.0572 387 LEU A O   
2851 C  CB  . LEU A 376 ? 1.8247 1.9719 1.8473 -0.0732 0.2336  -0.0370 387 LEU A CB  
2852 C  CG  . LEU A 376 ? 1.8411 1.9963 1.8455 -0.0734 0.2385  -0.0403 387 LEU A CG  
2853 C  CD1 . LEU A 376 ? 1.9032 2.0644 1.9097 -0.0729 0.2491  -0.0435 387 LEU A CD1 
2854 C  CD2 . LEU A 376 ? 1.8229 1.9773 1.8148 -0.0743 0.2351  -0.0472 387 LEU A CD2 
2855 N  N   . LYS A 377 ? 1.9236 2.0692 1.9776 -0.0723 0.2452  -0.0476 388 LYS A N   
2856 C  CA  . LYS A 377 ? 1.9813 2.1305 2.0427 -0.0721 0.2542  -0.0539 388 LYS A CA  
2857 C  C   . LYS A 377 ? 1.9876 2.1310 2.0579 -0.0723 0.2516  -0.0605 388 LYS A C   
2858 O  O   . LYS A 377 ? 2.0124 2.1582 2.0765 -0.0727 0.2556  -0.0684 388 LYS A O   
2859 C  CB  . LYS A 377 ? 2.0218 2.1731 2.0990 -0.0712 0.2604  -0.0497 388 LYS A CB  
2860 C  CG  . LYS A 377 ? 2.0433 2.2022 2.1101 -0.0710 0.2677  -0.0463 388 LYS A CG  
2861 C  CD  . LYS A 377 ? 2.0924 2.2531 2.1761 -0.0702 0.2747  -0.0424 388 LYS A CD  
2862 C  CE  . LYS A 377 ? 2.1531 2.3159 2.2470 -0.0701 0.2845  -0.0496 388 LYS A CE  
2863 N  NZ  . LYS A 377 ? 2.1872 2.3568 2.2649 -0.0705 0.2942  -0.0540 388 LYS A NZ  
2864 N  N   . GLN A 378 ? 1.9664 2.1017 2.0505 -0.0721 0.2445  -0.0572 389 GLN A N   
2865 C  CA  . GLN A 378 ? 1.9737 2.1023 2.0667 -0.0724 0.2411  -0.0627 389 GLN A CA  
2866 C  C   . GLN A 378 ? 1.9491 2.0764 2.0264 -0.0734 0.2382  -0.0686 389 GLN A C   
2867 O  O   . GLN A 378 ? 1.9651 2.0889 2.0468 -0.0737 0.2379  -0.0750 389 GLN A O   
2868 C  CB  . GLN A 378 ? 1.9537 2.0725 2.0602 -0.0721 0.2322  -0.0572 389 GLN A CB  
2869 C  CG  . GLN A 378 ? 1.9911 2.1100 2.1186 -0.0711 0.2349  -0.0534 389 GLN A CG  
2870 C  CD  . GLN A 378 ? 1.9874 2.0956 2.1312 -0.0709 0.2266  -0.0512 389 GLN A CD  
2871 O  OE1 . GLN A 378 ? 1.9475 2.0476 2.0854 -0.0715 0.2174  -0.0490 389 GLN A OE1 
2872 N  NE2 . GLN A 378 ? 2.0323 2.1403 2.1968 -0.0700 0.2299  -0.0519 389 GLN A NE2 
2873 N  N   . SER A 379 ? 1.9124 2.0426 1.9722 -0.0739 0.2360  -0.0665 390 SER A N   
2874 C  CA  . SER A 379 ? 1.8897 2.0196 1.9346 -0.0749 0.2335  -0.0720 390 SER A CA  
2875 C  C   . SER A 379 ? 1.9284 2.0665 1.9645 -0.0750 0.2417  -0.0793 390 SER A C   
2876 O  O   . SER A 379 ? 1.9365 2.0737 1.9691 -0.0756 0.2421  -0.0868 390 SER A O   
2877 C  CB  . SER A 379 ? 1.8366 1.9659 1.8676 -0.0754 0.2273  -0.0668 390 SER A CB  
2878 O  OG  . SER A 379 ? 1.8424 1.9800 1.8637 -0.0751 0.2316  -0.0638 390 SER A OG  
2879 N  N   . GLN A 380 ? 1.9547 2.1004 1.9870 -0.0745 0.2483  -0.0770 391 GLN A N   
2880 C  CA  . GLN A 380 ? 1.9983 2.1515 2.0200 -0.0746 0.2564  -0.0833 391 GLN A CA  
2881 C  C   . GLN A 380 ? 2.0481 2.2012 2.0804 -0.0745 0.2627  -0.0911 391 GLN A C   
2882 O  O   . GLN A 380 ? 2.0647 2.2196 2.0891 -0.0751 0.2646  -0.0991 391 GLN A O   
2883 C  CB  . GLN A 380 ? 2.0232 2.1831 2.0396 -0.0741 0.2626  -0.0784 391 GLN A CB  
2884 C  CG  . GLN A 380 ? 1.9835 2.1455 1.9847 -0.0743 0.2579  -0.0724 391 GLN A CG  
2885 C  CD  . GLN A 380 ? 2.0171 2.1857 2.0108 -0.0739 0.2647  -0.0687 391 GLN A CD  
2886 O  OE1 . GLN A 380 ? 2.0051 2.1737 2.0071 -0.0733 0.2658  -0.0614 391 GLN A OE1 
2887 N  NE2 . GLN A 380 ? 2.0625 2.2364 2.0404 -0.0743 0.2694  -0.0737 391 GLN A NE2 
2888 N  N   . LYS A 381 ? 2.0737 2.2249 2.1246 -0.0738 0.2657  -0.0891 392 LYS A N   
2889 C  CA  . LYS A 381 ? 2.1206 2.2709 2.1848 -0.0736 0.2710  -0.0960 392 LYS A CA  
2890 C  C   . LYS A 381 ? 2.0969 2.2396 2.1661 -0.0741 0.2638  -0.0998 392 LYS A C   
2891 O  O   . LYS A 381 ? 2.0647 2.2002 2.1433 -0.0739 0.2562  -0.0950 392 LYS A O   
2892 C  CB  . LYS A 381 ? 2.1559 2.3058 2.2402 -0.0727 0.2757  -0.0925 392 LYS A CB  
2893 C  CG  . LYS A 381 ? 2.1219 2.2651 2.2200 -0.0722 0.2676  -0.0847 392 LYS A CG  
2894 C  CD  . LYS A 381 ? 2.1581 2.2966 2.2794 -0.0716 0.2682  -0.0866 392 LYS A CD  
2895 C  CE  . LYS A 381 ? 2.1247 2.2545 2.2573 -0.0713 0.2579  -0.0800 392 LYS A CE  
2896 N  NZ  . LYS A 381 ? 2.1527 2.2763 2.3055 -0.0709 0.2560  -0.0829 392 LYS A NZ  
2897 N  N   . ARG A 382 ? 2.1149 2.2589 2.1771 -0.0747 0.2660  -0.1085 393 ARG A N   
2898 C  CA  . ARG A 382 ? 2.0971 2.2341 2.1627 -0.0753 0.2600  -0.1127 393 ARG A CA  
2899 C  C   . ARG A 382 ? 2.1257 2.2569 2.2131 -0.0747 0.2600  -0.1135 393 ARG A C   
2900 O  O   . ARG A 382 ? 2.1773 2.3117 2.2769 -0.0740 0.2672  -0.1146 393 ARG A O   
2901 C  CB  . ARG A 382 ? 2.1111 2.2512 2.1644 -0.0761 0.2627  -0.1220 393 ARG A CB  
2902 C  CG  . ARG A 382 ? 2.1729 2.3200 2.2258 -0.0759 0.2734  -0.1287 393 ARG A CG  
2903 C  CD  . ARG A 382 ? 2.1868 2.3365 2.2262 -0.0768 0.2745  -0.1375 393 ARG A CD  
2904 N  NE  . ARG A 382 ? 2.2482 2.4052 2.2805 -0.0768 0.2842  -0.1431 393 ARG A NE  
2905 C  CZ  . ARG A 382 ? 2.2743 2.4344 2.2951 -0.0775 0.2868  -0.1514 393 ARG A CZ  
2906 N  NH1 . ARG A 382 ? 2.2430 2.3999 2.2589 -0.0783 0.2806  -0.1554 393 ARG A NH1 
2907 N  NH2 . ARG A 382 ? 2.3352 2.5012 2.3491 -0.0776 0.2957  -0.1560 393 ARG A NH2 
2908 N  N   . ASP A 383 ? 2.0934 2.2156 2.1855 -0.0750 0.2517  -0.1127 394 ASP A N   
2909 C  CA  . ASP A 383 ? 2.1160 2.2312 2.2280 -0.0745 0.2495  -0.1129 394 ASP A CA  
2910 C  C   . ASP A 383 ? 2.1484 2.2620 2.2629 -0.0750 0.2519  -0.1222 394 ASP A C   
2911 O  O   . ASP A 383 ? 2.1372 2.2523 2.2373 -0.0759 0.2516  -0.1273 394 ASP A O   
2912 C  CB  . ASP A 383 ? 2.0699 2.1749 2.1846 -0.0747 0.2386  -0.1061 394 ASP A CB  
2913 C  CG  . ASP A 383 ? 2.0937 2.1907 2.2294 -0.0741 0.2354  -0.1046 394 ASP A CG  
2914 O  OD1 . ASP A 383 ? 2.1265 2.2262 2.2768 -0.0730 0.2391  -0.1019 394 ASP A OD1 
2915 O  OD2 . ASP A 383 ? 2.0813 2.1691 2.2190 -0.0746 0.2289  -0.1061 394 ASP A OD2 
2916 N  N   . TYR A 384 ? 2.1905 2.3014 2.3242 -0.0743 0.2541  -0.1246 395 TYR A N   
2917 C  CA  . TYR A 384 ? 2.2247 2.3340 2.3637 -0.0746 0.2568  -0.1334 395 TYR A CA  
2918 C  C   . TYR A 384 ? 2.2056 2.3032 2.3508 -0.0750 0.2476  -0.1327 395 TYR A C   
2919 O  O   . TYR A 384 ? 2.2009 2.2955 2.3397 -0.0758 0.2460  -0.1385 395 TYR A O   
2920 C  CB  . TYR A 384 ? 2.2905 2.4038 2.4469 -0.0737 0.2655  -0.1371 395 TYR A CB  
2921 C  CG  . TYR A 384 ? 2.3140 2.4377 2.4643 -0.0734 0.2752  -0.1373 395 TYR A CG  
2922 C  CD1 . TYR A 384 ? 2.3219 2.4527 2.4554 -0.0741 0.2814  -0.1436 395 TYR A CD1 
2923 C  CD2 . TYR A 384 ? 2.3305 2.4565 2.4914 -0.0725 0.2780  -0.1310 395 TYR A CD2 
2924 C  CE1 . TYR A 384 ? 2.3486 2.4878 2.4746 -0.0740 0.2901  -0.1436 395 TYR A CE1 
2925 C  CE2 . TYR A 384 ? 2.3569 2.4917 2.5113 -0.0724 0.2873  -0.1309 395 TYR A CE2 
2926 C  CZ  . TYR A 384 ? 2.3662 2.5073 2.5025 -0.0731 0.2932  -0.1372 395 TYR A CZ  
2927 O  OH  . TYR A 384 ? 2.3959 2.5447 2.5242 -0.0731 0.3023  -0.1370 395 TYR A OH  
2928 N  N   . TYR A 385 ? 2.1969 2.2876 2.3544 -0.0744 0.2414  -0.1255 396 TYR A N   
2929 C  CA  . TYR A 385 ? 2.1758 2.2541 2.3369 -0.0748 0.2314  -0.1230 396 TYR A CA  
2930 C  C   . TYR A 385 ? 2.1199 2.1949 2.2605 -0.0760 0.2258  -0.1217 396 TYR A C   
2931 O  O   . TYR A 385 ? 2.1041 2.1692 2.2422 -0.0768 0.2193  -0.1223 396 TYR A O   
2932 C  CB  . TYR A 385 ? 2.1731 2.2453 2.3482 -0.0739 0.2255  -0.1146 396 TYR A CB  
2933 C  CG  . TYR A 385 ? 2.2307 2.3044 2.4291 -0.0726 0.2298  -0.1154 396 TYR A CG  
2934 C  CD1 . TYR A 385 ? 2.2557 2.3395 2.4602 -0.0718 0.2382  -0.1144 396 TYR A CD1 
2935 C  CD2 . TYR A 385 ? 2.2628 2.3275 2.4777 -0.0723 0.2253  -0.1169 396 TYR A CD2 
2936 C  CE1 . TYR A 385 ? 2.3109 2.3961 2.5380 -0.0707 0.2427  -0.1153 396 TYR A CE1 
2937 C  CE2 . TYR A 385 ? 2.3179 2.3842 2.5560 -0.0711 0.2291  -0.1177 396 TYR A CE2 
2938 C  CZ  . TYR A 385 ? 2.3415 2.4181 2.5859 -0.0703 0.2380  -0.1169 396 TYR A CZ  
2939 O  OH  . TYR A 385 ? 2.3984 2.4766 2.6668 -0.0692 0.2423  -0.1179 396 TYR A OH  
2940 N  N   . LYS A 386 ? 2.0935 2.1764 2.2195 -0.0762 0.2286  -0.1198 397 LYS A N   
2941 C  CA  . LYS A 386 ? 2.0434 2.1254 2.1499 -0.0774 0.2247  -0.1192 397 LYS A CA  
2942 C  C   . LYS A 386 ? 2.0473 2.1271 2.1472 -0.0785 0.2251  -0.1274 397 LYS A C   
2943 O  O   . LYS A 386 ? 2.0115 2.0846 2.1014 -0.0796 0.2193  -0.1269 397 LYS A O   
2944 C  CB  . LYS A 386 ? 2.0322 2.1253 2.1259 -0.0773 0.2296  -0.1179 397 LYS A CB  
2945 C  CG  . LYS A 386 ? 1.9816 2.0746 2.0566 -0.0783 0.2253  -0.1158 397 LYS A CG  
2946 C  CD  . LYS A 386 ? 1.9832 2.0878 2.0459 -0.0782 0.2309  -0.1160 397 LYS A CD  
2947 C  CE  . LYS A 386 ? 1.9322 2.0368 1.9781 -0.0790 0.2261  -0.1130 397 LYS A CE  
2948 N  NZ  . LYS A 386 ? 1.8901 1.9895 1.9371 -0.0788 0.2198  -0.1035 397 LYS A NZ  
2949 N  N   . ILE A 387 ? 2.0932 2.1785 2.1991 -0.0782 0.2323  -0.1350 398 ILE A N   
2950 C  CA  . ILE A 387 ? 2.1050 2.1893 2.2065 -0.0791 0.2337  -0.1436 398 ILE A CA  
2951 C  C   . ILE A 387 ? 2.1122 2.1840 2.2230 -0.0794 0.2277  -0.1441 398 ILE A C   
2952 O  O   . ILE A 387 ? 2.0954 2.1622 2.1986 -0.0806 0.2250  -0.1480 398 ILE A O   
2953 C  CB  . ILE A 387 ? 2.1552 2.2487 2.2612 -0.0786 0.2434  -0.1515 398 ILE A CB  
2954 C  CG1 . ILE A 387 ? 2.1454 2.2501 2.2440 -0.0781 0.2498  -0.1499 398 ILE A CG1 
2955 C  CG2 . ILE A 387 ? 2.1733 2.2671 2.2717 -0.0797 0.2450  -0.1606 398 ILE A CG2 
2956 C  CD1 . ILE A 387 ? 2.1499 2.2595 2.2272 -0.0789 0.2485  -0.1493 398 ILE A CD1 
2957 N  N   . LEU A 388 ? 2.1398 2.2062 2.2672 -0.0785 0.2254  -0.1401 399 LEU A N   
2958 C  CA  . LEU A 388 ? 2.1378 2.1909 2.2742 -0.0787 0.2183  -0.1389 399 LEU A CA  
2959 C  C   . LEU A 388 ? 2.1280 2.1750 2.2766 -0.0778 0.2128  -0.1305 399 LEU A C   
2960 O  O   . LEU A 388 ? 2.0880 2.1266 2.2304 -0.0783 0.2049  -0.1240 399 LEU A O   
2961 C  CB  . LEU A 388 ? 2.1873 2.2397 2.3359 -0.0785 0.2222  -0.1467 399 LEU A CB  
2962 C  CG  . LEU A 388 ? 2.1890 2.2418 2.3275 -0.0797 0.2244  -0.1549 399 LEU A CG  
2963 C  CD1 . LEU A 388 ? 2.1562 2.2136 2.3074 -0.0792 0.2316  -0.1633 399 LEU A CD1 
2964 C  CD2 . LEU A 388 ? 2.2451 2.2848 2.3781 -0.0809 0.2164  -0.1535 399 LEU A CD2 
2965 N  N   . GLY A 389 ? 2.1659 2.2171 2.3320 -0.0765 0.2171  -0.1309 400 GLY A N   
2966 C  CA  . GLY A 389 ? 2.1628 2.2095 2.3439 -0.0755 0.2126  -0.1237 400 GLY A CA  
2967 C  C   . GLY A 389 ? 2.1572 2.1884 2.3414 -0.0758 0.2017  -0.1191 400 GLY A C   
2968 O  O   . GLY A 389 ? 2.1190 2.1449 2.3006 -0.0758 0.1951  -0.1114 400 GLY A O   
2969 N  N   . VAL A 390 ? 2.1971 2.2207 2.3865 -0.0762 0.1997  -0.1240 401 VAL A N   
2970 C  CA  . VAL A 390 ? 2.2017 2.2092 2.3942 -0.0766 0.1894  -0.1204 401 VAL A CA  
2971 C  C   . VAL A 390 ? 2.2069 2.2092 2.4132 -0.0755 0.1831  -0.1124 401 VAL A C   
2972 O  O   . VAL A 390 ? 2.1807 2.1705 2.3828 -0.0760 0.1735  -0.1064 401 VAL A O   
2973 C  CB  . VAL A 390 ? 2.2535 2.2548 2.4553 -0.0768 0.1894  -0.1269 401 VAL A CB  
2974 C  CG1 . VAL A 390 ? 2.2720 2.2552 2.4754 -0.0773 0.1781  -0.1227 401 VAL A CG1 
2975 C  CG2 . VAL A 390 ? 2.2435 2.2500 2.4317 -0.0779 0.1954  -0.1350 401 VAL A CG2 
2976 N  N   . LYS A 391 ? 2.2424 2.2540 2.4648 -0.0741 0.1889  -0.1125 402 LYS A N   
2977 C  CA  . LYS A 391 ? 2.2534 2.2625 2.4906 -0.0730 0.1844  -0.1053 402 LYS A CA  
2978 C  C   . LYS A 391 ? 2.2517 2.2751 2.4915 -0.0722 0.1928  -0.1040 402 LYS A C   
2979 O  O   . LYS A 391 ? 2.2718 2.3064 2.5135 -0.0719 0.2030  -0.1100 402 LYS A O   
2980 C  CB  . LYS A 391 ? 2.3118 2.3141 2.5727 -0.0720 0.1813  -0.1065 402 LYS A CB  
2981 C  CG  . LYS A 391 ? 2.3409 2.3454 2.6239 -0.0704 0.1805  -0.1017 402 LYS A CG  
2982 C  CD  . LYS A 391 ? 2.3083 2.3031 2.5897 -0.0704 0.1696  -0.0924 402 LYS A CD  
2983 C  CE  . LYS A 391 ? 2.3349 2.3320 2.6401 -0.0689 0.1690  -0.0881 402 LYS A CE  
2984 N  NZ  . LYS A 391 ? 2.2913 2.2877 2.5909 -0.0688 0.1642  -0.0798 402 LYS A NZ  
2985 N  N   . ARG A 392 ? 2.2278 2.2502 2.4664 -0.0719 0.1884  -0.0960 403 ARG A N   
2986 C  CA  . ARG A 392 ? 2.2348 2.2688 2.4798 -0.0709 0.1952  -0.0934 403 ARG A CA  
2987 C  C   . ARG A 392 ? 2.2995 2.3358 2.5710 -0.0696 0.1991  -0.0955 403 ARG A C   
2988 O  O   . ARG A 392 ? 2.3254 2.3524 2.6141 -0.0689 0.1914  -0.0921 403 ARG A O   
2989 C  CB  . ARG A 392 ? 2.2012 2.2311 2.4428 -0.0709 0.1878  -0.0840 403 ARG A CB  
2990 C  CG  . ARG A 392 ? 2.2058 2.2459 2.4575 -0.0698 0.1938  -0.0802 403 ARG A CG  
2991 C  CD  . ARG A 392 ? 2.1796 2.2335 2.4174 -0.0701 0.2049  -0.0838 403 ARG A CD  
2992 N  NE  . ARG A 392 ? 2.2031 2.2669 2.4522 -0.0691 0.2126  -0.0816 403 ARG A NE  
2993 C  CZ  . ARG A 392 ? 2.1983 2.2739 2.4380 -0.0692 0.2228  -0.0841 403 ARG A CZ  
2994 N  NH1 . ARG A 392 ? 2.1702 2.2495 2.3898 -0.0702 0.2261  -0.0892 403 ARG A NH1 
2995 N  NH2 . ARG A 392 ? 2.2247 2.3080 2.4753 -0.0683 0.2298  -0.0818 403 ARG A NH2 
2996 N  N   . ASN A 393 ? 2.3281 2.3763 2.6033 -0.0692 0.2109  -0.1016 404 ASN A N   
2997 C  CA  . ASN A 393 ? 2.3929 2.4435 2.6924 -0.0681 0.2162  -0.1055 404 ASN A CA  
2998 C  C   . ASN A 393 ? 2.4110 2.4526 2.7163 -0.0684 0.2118  -0.1107 404 ASN A C   
2999 O  O   . ASN A 393 ? 2.4457 2.4793 2.7710 -0.0676 0.2061  -0.1093 404 ASN A O   
3000 C  CB  . ASN A 393 ? 2.4229 2.4716 2.7438 -0.0669 0.2128  -0.0988 404 ASN A CB  
3001 C  CG  . ASN A 393 ? 2.4919 2.5474 2.8373 -0.0658 0.2219  -0.1026 404 ASN A CG  
3002 O  OD1 . ASN A 393 ? 2.5305 2.5821 2.8913 -0.0653 0.2217  -0.1074 404 ASN A OD1 
3003 N  ND2 . ASN A 393 ? 2.5100 2.5753 2.8595 -0.0653 0.2301  -0.1005 404 ASN A ND2 
3004 N  N   . ALA A 394 ? 2.3882 2.4308 2.6760 -0.0695 0.2143  -0.1166 405 ALA A N   
3005 C  CA  . ALA A 394 ? 2.4097 2.4443 2.7002 -0.0699 0.2111  -0.1220 405 ALA A CA  
3006 C  C   . ALA A 394 ? 2.4768 2.5160 2.7881 -0.0690 0.2189  -0.1288 405 ALA A C   
3007 O  O   . ALA A 394 ? 2.4979 2.5489 2.8132 -0.0686 0.2298  -0.1321 405 ALA A O   
3008 C  CB  . ALA A 394 ? 2.3746 2.4099 2.6411 -0.0714 0.2124  -0.1265 405 ALA A CB  
3009 N  N   . LYS A 395 ? 2.5131 2.5427 2.8373 -0.0688 0.2134  -0.1309 406 LYS A N   
3010 C  CA  . LYS A 395 ? 2.5787 2.6114 2.9237 -0.0680 0.2199  -0.1377 406 LYS A CA  
3011 C  C   . LYS A 395 ? 2.5833 2.6246 2.9168 -0.0688 0.2303  -0.1471 406 LYS A C   
3012 O  O   . LYS A 395 ? 2.5450 2.5837 2.8586 -0.0700 0.2280  -0.1493 406 LYS A O   
3013 C  CB  . LYS A 395 ? 2.6129 2.6319 2.9724 -0.0677 0.2101  -0.1372 406 LYS A CB  
3014 C  CG  . LYS A 395 ? 2.6858 2.7064 3.0700 -0.0667 0.2153  -0.1435 406 LYS A CG  
3015 C  CD  . LYS A 395 ? 2.7229 2.7460 3.1336 -0.0652 0.2164  -0.1400 406 LYS A CD  
3016 C  CE  . LYS A 395 ? 2.7946 2.8178 3.2312 -0.0642 0.2205  -0.1462 406 LYS A CE  
3017 N  NZ  . LYS A 395 ? 2.8271 2.8567 3.2912 -0.0627 0.2260  -0.1446 406 LYS A NZ  
3018 N  N   . LYS A 396 ? 2.6319 2.6831 2.9783 -0.0681 0.2416  -0.1526 407 LYS A N   
3019 C  CA  . LYS A 396 ? 2.6416 2.7024 2.9774 -0.0688 0.2528  -0.1615 407 LYS A CA  
3020 C  C   . LYS A 396 ? 2.6453 2.7013 2.9748 -0.0696 0.2513  -0.1685 407 LYS A C   
3021 O  O   . LYS A 396 ? 2.6187 2.6811 2.9323 -0.0705 0.2578  -0.1748 407 LYS A O   
3022 C  CB  . LYS A 396 ? 2.7030 2.7732 3.0567 -0.0679 0.2649  -0.1661 407 LYS A CB  
3023 C  CG  . LYS A 396 ? 2.6914 2.7711 3.0402 -0.0676 0.2717  -0.1623 407 LYS A CG  
3024 C  CD  . LYS A 396 ? 2.7572 2.8459 3.1217 -0.0670 0.2850  -0.1676 407 LYS A CD  
3025 C  CE  . LYS A 396 ? 2.7452 2.8424 3.1039 -0.0668 0.2918  -0.1633 407 LYS A CE  
3026 N  NZ  . LYS A 396 ? 2.8132 2.9182 3.1878 -0.0663 0.3053  -0.1680 407 LYS A NZ  
3027 N  N   . GLN A 397 ? 2.6812 2.7257 3.0233 -0.0694 0.2427  -0.1674 408 GLN A N   
3028 C  CA  . GLN A 397 ? 2.6904 2.7286 3.0282 -0.0702 0.2404  -0.1733 408 GLN A CA  
3029 C  C   . GLN A 397 ? 2.6285 2.6591 2.9427 -0.0715 0.2321  -0.1703 408 GLN A C   
3030 O  O   . GLN A 397 ? 2.6173 2.6485 2.9181 -0.0726 0.2343  -0.1762 408 GLN A O   
3031 C  CB  . GLN A 397 ? 2.7413 2.7700 3.1035 -0.0693 0.2350  -0.1735 408 GLN A CB  
3032 C  CG  . GLN A 397 ? 2.7652 2.7899 3.1289 -0.0698 0.2360  -0.1814 408 GLN A CG  
3033 C  CD  . GLN A 397 ? 2.8021 2.8152 3.1877 -0.0690 0.2283  -0.1801 408 GLN A CD  
3034 O  OE1 . GLN A 397 ? 2.8123 2.8228 3.2168 -0.0678 0.2246  -0.1751 408 GLN A OE1 
3035 N  NE2 . GLN A 397 ? 2.8268 2.8325 3.2102 -0.0697 0.2255  -0.1847 408 GLN A NE2 
3036 N  N   . GLU A 398 ? 2.5911 2.6145 2.9010 -0.0715 0.2228  -0.1612 409 GLU A N   
3037 C  CA  . GLU A 398 ? 2.5321 2.5479 2.8198 -0.0729 0.2149  -0.1573 409 GLU A CA  
3038 C  C   . GLU A 398 ? 2.4870 2.5128 2.7520 -0.0739 0.2211  -0.1598 409 GLU A C   
3039 O  O   . GLU A 398 ? 2.4517 2.4736 2.6990 -0.0752 0.2184  -0.1611 409 GLU A O   
3040 C  CB  . GLU A 398 ? 2.5032 2.5107 2.7917 -0.0725 0.2050  -0.1471 409 GLU A CB  
3041 C  CG  . GLU A 398 ? 2.5250 2.5163 2.8236 -0.0724 0.1937  -0.1434 409 GLU A CG  
3042 C  CD  . GLU A 398 ? 2.5957 2.5859 2.9224 -0.0709 0.1944  -0.1454 409 GLU A CD  
3043 O  OE1 . GLU A 398 ? 2.6207 2.6217 2.9616 -0.0698 0.2021  -0.1468 409 GLU A OE1 
3044 O  OE2 . GLU A 398 ? 2.6261 2.6041 2.9609 -0.0709 0.1871  -0.1456 409 GLU A OE2 
3045 N  N   . ILE A 399 ? 2.4913 2.5295 2.7576 -0.0732 0.2295  -0.1602 410 ILE A N   
3046 C  CA  . ILE A 399 ? 2.4552 2.5041 2.7018 -0.0739 0.2360  -0.1626 410 ILE A CA  
3047 C  C   . ILE A 399 ? 2.4741 2.5265 2.7121 -0.0749 0.2416  -0.1722 410 ILE A C   
3048 O  O   . ILE A 399 ? 2.4371 2.4890 2.6559 -0.0761 0.2398  -0.1735 410 ILE A O   
3049 C  CB  . ILE A 399 ? 2.4621 2.5230 2.7148 -0.0730 0.2449  -0.1619 410 ILE A CB  
3050 C  CG1 . ILE A 399 ? 2.4364 2.4945 2.6954 -0.0722 0.2393  -0.1520 410 ILE A CG1 
3051 C  CG2 . ILE A 399 ? 2.4349 2.5068 2.6672 -0.0737 0.2523  -0.1655 410 ILE A CG2 
3052 C  CD1 . ILE A 399 ? 2.4609 2.5284 2.7328 -0.0711 0.2475  -0.1508 410 ILE A CD1 
3053 N  N   . ILE A 400 ? 2.5334 2.5891 2.7867 -0.0743 0.2482  -0.1791 411 ILE A N   
3054 C  CA  . ILE A 400 ? 2.5600 2.6192 2.8078 -0.0751 0.2541  -0.1889 411 ILE A CA  
3055 C  C   . ILE A 400 ? 2.5310 2.5804 2.7681 -0.0763 0.2467  -0.1900 411 ILE A C   
3056 O  O   . ILE A 400 ? 2.5150 2.5679 2.7367 -0.0774 0.2494  -0.1954 411 ILE A O   
3057 C  CB  . ILE A 400 ? 2.6326 2.6938 2.9022 -0.0742 0.2606  -0.1955 411 ILE A CB  
3058 C  CG1 . ILE A 400 ? 2.6638 2.7295 2.9514 -0.0728 0.2648  -0.1920 411 ILE A CG1 
3059 C  CG2 . ILE A 400 ? 2.6630 2.7324 2.9253 -0.0749 0.2701  -0.2059 411 ILE A CG2 
3060 C  CD1 . ILE A 400 ? 2.6665 2.7451 2.9464 -0.0727 0.2751  -0.1934 411 ILE A CD1 
3061 N  N   . LYS A 401 ? 2.5265 2.5632 2.7715 -0.0762 0.2372  -0.1846 412 LYS A N   
3062 C  CA  . LYS A 401 ? 2.5025 2.5276 2.7387 -0.0774 0.2299  -0.1848 412 LYS A CA  
3063 C  C   . LYS A 401 ? 2.4455 2.4724 2.6573 -0.0789 0.2290  -0.1846 412 LYS A C   
3064 O  O   . LYS A 401 ? 2.4457 2.4733 2.6485 -0.0799 0.2314  -0.1912 412 LYS A O   
3065 C  CB  . LYS A 401 ? 2.4958 2.5065 2.7406 -0.0771 0.2190  -0.1768 412 LYS A CB  
3066 C  CG  . LYS A 401 ? 2.4626 2.4598 2.6954 -0.0785 0.2110  -0.1757 412 LYS A CG  
3067 C  CD  . LYS A 401 ? 2.5034 2.4939 2.7465 -0.0787 0.2110  -0.1820 412 LYS A CD  
3068 C  CE  . LYS A 401 ? 2.4757 2.4519 2.7063 -0.0803 0.2035  -0.1805 412 LYS A CE  
3069 N  NZ  . LYS A 401 ? 2.5222 2.4899 2.7640 -0.0804 0.2022  -0.1852 412 LYS A NZ  
3070 N  N   . ALA A 402 ? 2.3990 2.4267 2.6010 -0.0789 0.2256  -0.1771 413 ALA A N   
3071 C  CA  . ALA A 402 ? 2.3437 2.3732 2.5237 -0.0801 0.2243  -0.1761 413 ALA A CA  
3072 C  C   . ALA A 402 ? 2.3467 2.3906 2.5171 -0.0803 0.2334  -0.1824 413 ALA A C   
3073 O  O   . ALA A 402 ? 2.3208 2.3666 2.4752 -0.0815 0.2338  -0.1854 413 ALA A O   
3074 C  CB  . ALA A 402 ? 2.2990 2.3250 2.4725 -0.0800 0.2181  -0.1662 413 ALA A CB  
3075 N  N   . TYR A 403 ? 2.3818 2.4353 2.5622 -0.0792 0.2408  -0.1845 414 TYR A N   
3076 C  CA  . TYR A 403 ? 2.3977 2.4640 2.5696 -0.0793 0.2498  -0.1910 414 TYR A CA  
3077 C  C   . TYR A 403 ? 2.4201 2.4871 2.5883 -0.0802 0.2530  -0.2007 414 TYR A C   
3078 O  O   . TYR A 403 ? 2.4001 2.4728 2.5526 -0.0811 0.2553  -0.2046 414 TYR A O   
3079 C  CB  . TYR A 403 ? 2.4453 2.5200 2.6305 -0.0780 0.2577  -0.1921 414 TYR A CB  
3080 C  CG  . TYR A 403 ? 2.4799 2.5657 2.6589 -0.0782 0.2678  -0.2008 414 TYR A CG  
3081 C  CD1 . TYR A 403 ? 2.4559 2.5499 2.6159 -0.0787 0.2705  -0.2010 414 TYR A CD1 
3082 C  CD2 . TYR A 403 ? 2.5398 2.6275 2.7316 -0.0779 0.2742  -0.2088 414 TYR A CD2 
3083 C  CE1 . TYR A 403 ? 2.4902 2.5936 2.6433 -0.0790 0.2793  -0.2090 414 TYR A CE1 
3084 C  CE2 . TYR A 403 ? 2.5750 2.6723 2.7603 -0.0782 0.2835  -0.2170 414 TYR A CE2 
3085 C  CZ  . TYR A 403 ? 2.5496 2.6545 2.7149 -0.0788 0.2858  -0.2170 414 TYR A CZ  
3086 O  OH  . TYR A 403 ? 2.5859 2.6994 2.7434 -0.0791 0.2944  -0.2251 414 TYR A OH  
3087 N  N   . ARG A 404 ? 2.4630 2.5241 2.6464 -0.0800 0.2530  -0.2046 415 ARG A N   
3088 C  CA  . ARG A 404 ? 2.4893 2.5502 2.6716 -0.0808 0.2560  -0.2140 415 ARG A CA  
3089 C  C   . ARG A 404 ? 2.4429 2.4996 2.6077 -0.0824 0.2512  -0.2144 415 ARG A C   
3090 O  O   . ARG A 404 ? 2.4446 2.5075 2.5988 -0.0832 0.2552  -0.2212 415 ARG A O   
3091 C  CB  . ARG A 404 ? 2.5318 2.5839 2.7332 -0.0804 0.2542  -0.2161 415 ARG A CB  
3092 C  CG  . ARG A 404 ? 2.5824 2.6384 2.8041 -0.0789 0.2594  -0.2168 415 ARG A CG  
3093 C  CD  . ARG A 404 ? 2.6345 2.7019 2.8579 -0.0788 0.2705  -0.2262 415 ARG A CD  
3094 N  NE  . ARG A 404 ? 2.6823 2.7538 2.9242 -0.0774 0.2762  -0.2261 415 ARG A NE  
3095 C  CZ  . ARG A 404 ? 2.7365 2.8171 2.9832 -0.0771 0.2866  -0.2334 415 ARG A CZ  
3096 N  NH1 . ARG A 404 ? 2.7444 2.8310 2.9783 -0.0780 0.2921  -0.2416 415 ARG A NH1 
3097 N  NH2 . ARG A 404 ? 2.7782 2.8615 3.0428 -0.0758 0.2916  -0.2326 415 ARG A NH2 
3098 N  N   . LYS A 405 ? 2.4051 2.4510 2.5670 -0.0828 0.2425  -0.2070 416 LYS A N   
3099 C  CA  . LYS A 405 ? 2.3579 2.3989 2.5035 -0.0843 0.2379  -0.2062 416 LYS A CA  
3100 C  C   . LYS A 405 ? 2.3201 2.3711 2.4491 -0.0847 0.2401  -0.2055 416 LYS A C   
3101 O  O   . LYS A 405 ? 2.3101 2.3646 2.4277 -0.0858 0.2418  -0.2108 416 LYS A O   
3102 C  CB  . LYS A 405 ? 2.3262 2.3532 2.4713 -0.0847 0.2286  -0.1976 416 LYS A CB  
3103 C  CG  . LYS A 405 ? 2.3588 2.3729 2.5153 -0.0849 0.2246  -0.1986 416 LYS A CG  
3104 C  CD  . LYS A 405 ? 2.3260 2.3252 2.4757 -0.0858 0.2153  -0.1911 416 LYS A CD  
3105 C  CE  . LYS A 405 ? 2.3077 2.3042 2.4591 -0.0849 0.2102  -0.1812 416 LYS A CE  
3106 N  NZ  . LYS A 405 ? 2.3555 2.3513 2.5267 -0.0833 0.2099  -0.1794 416 LYS A NZ  
3107 N  N   . LEU A 406 ? 2.3017 2.3573 2.4301 -0.0838 0.2401  -0.1989 417 LEU A N   
3108 C  CA  . LEU A 406 ? 2.2662 2.3305 2.3790 -0.0840 0.2414  -0.1969 417 LEU A CA  
3109 C  C   . LEU A 406 ? 2.2961 2.3733 2.4047 -0.0838 0.2499  -0.2047 417 LEU A C   
3110 O  O   . LEU A 406 ? 2.2710 2.3549 2.3648 -0.0844 0.2509  -0.2056 417 LEU A O   
3111 C  CB  . LEU A 406 ? 2.2452 2.3096 2.3586 -0.0831 0.2385  -0.1872 417 LEU A CB  
3112 C  CG  . LEU A 406 ? 2.2038 2.2567 2.3120 -0.0838 0.2293  -0.1793 417 LEU A CG  
3113 C  CD1 . LEU A 406 ? 2.2063 2.2527 2.3279 -0.0827 0.2253  -0.1716 417 LEU A CD1 
3114 C  CD2 . LEU A 406 ? 2.1474 2.2055 2.2381 -0.0843 0.2279  -0.1752 417 LEU A CD2 
3115 N  N   . ALA A 407 ? 2.3515 2.4315 2.4729 -0.0831 0.2558  -0.2102 418 ALA A N   
3116 C  CA  . ALA A 407 ? 2.3866 2.4767 2.5040 -0.0832 0.2639  -0.2191 418 ALA A CA  
3117 C  C   . ALA A 407 ? 2.3927 2.4807 2.5039 -0.0845 0.2632  -0.2269 418 ALA A C   
3118 O  O   . ALA A 407 ? 2.3913 2.4865 2.4898 -0.0852 0.2660  -0.2321 418 ALA A O   
3119 C  CB  . ALA A 407 ? 2.4453 2.5383 2.5791 -0.0821 0.2707  -0.2228 418 ALA A CB  
3120 N  N   . LEU A 408 ? 2.3986 2.4764 2.5188 -0.0849 0.2591  -0.2275 419 LEU A N   
3121 C  CA  . LEU A 408 ? 2.4008 2.4746 2.5158 -0.0863 0.2576  -0.2337 419 LEU A CA  
3122 C  C   . LEU A 408 ? 2.3456 2.4190 2.4437 -0.0874 0.2530  -0.2307 419 LEU A C   
3123 O  O   . LEU A 408 ? 2.3429 2.4203 2.4316 -0.0884 0.2544  -0.2370 419 LEU A O   
3124 C  CB  . LEU A 408 ? 2.4169 2.4780 2.5441 -0.0866 0.2533  -0.2331 419 LEU A CB  
3125 C  CG  . LEU A 408 ? 2.4151 2.4673 2.5352 -0.0882 0.2486  -0.2348 419 LEU A CG  
3126 C  CD1 . LEU A 408 ? 2.4718 2.5277 2.5922 -0.0890 0.2534  -0.2460 419 LEU A CD1 
3127 C  CD2 . LEU A 408 ? 2.3973 2.4348 2.5261 -0.0883 0.2421  -0.2292 419 LEU A CD2 
3128 N  N   . GLN A 409 ? 2.3014 2.3700 2.3963 -0.0873 0.2474  -0.2211 420 GLN A N   
3129 C  CA  . GLN A 409 ? 2.2473 2.3139 2.3277 -0.0883 0.2425  -0.2172 420 GLN A CA  
3130 C  C   . GLN A 409 ? 2.2291 2.3076 2.2964 -0.0882 0.2453  -0.2180 420 GLN A C   
3131 O  O   . GLN A 409 ? 2.2114 2.2921 2.2677 -0.0893 0.2443  -0.2214 420 GLN A O   
3132 C  CB  . GLN A 409 ? 2.2079 2.2651 2.2893 -0.0881 0.2358  -0.2068 420 GLN A CB  
3133 C  CG  . GLN A 409 ? 2.2125 2.2551 2.2998 -0.0889 0.2308  -0.2055 420 GLN A CG  
3134 C  CD  . GLN A 409 ? 2.1944 2.2276 2.2882 -0.0882 0.2252  -0.1962 420 GLN A CD  
3135 O  OE1 . GLN A 409 ? 2.1864 2.2245 2.2840 -0.0870 0.2257  -0.1912 420 GLN A OE1 
3136 N  NE2 . GLN A 409 ? 2.1870 2.2063 2.2822 -0.0891 0.2197  -0.1938 420 GLN A NE2 
3137 N  N   . TRP A 410 ? 2.2359 2.3217 2.3047 -0.0870 0.2486  -0.2151 421 TRP A N   
3138 C  CA  . TRP A 410 ? 2.2185 2.3145 2.2739 -0.0869 0.2505  -0.2142 421 TRP A CA  
3139 C  C   . TRP A 410 ? 2.2622 2.3686 2.3128 -0.0868 0.2573  -0.2232 421 TRP A C   
3140 O  O   . TRP A 410 ? 2.2597 2.3747 2.3004 -0.0865 0.2598  -0.2223 421 TRP A O   
3141 C  CB  . TRP A 410 ? 2.1973 2.2952 2.2537 -0.0857 0.2498  -0.2050 421 TRP A CB  
3142 C  CG  . TRP A 410 ? 2.1434 2.2323 2.1982 -0.0860 0.2421  -0.1961 421 TRP A CG  
3143 C  CD1 . TRP A 410 ? 2.1344 2.2149 2.1995 -0.0856 0.2386  -0.1903 421 TRP A CD1 
3144 C  CD2 . TRP A 410 ? 2.0944 2.1829 2.1356 -0.0869 0.2375  -0.1924 421 TRP A CD2 
3145 N  NE1 . TRP A 410 ? 2.0822 2.1569 2.1399 -0.0861 0.2322  -0.1829 421 TRP A NE1 
3146 C  CE2 . TRP A 410 ? 2.0577 2.1369 2.1016 -0.0869 0.2317  -0.1847 421 TRP A CE2 
3147 C  CE3 . TRP A 410 ? 2.0809 2.1769 2.1079 -0.0875 0.2380  -0.1952 421 TRP A CE3 
3148 C  CZ2 . TRP A 410 ? 2.0073 2.0835 2.0406 -0.0877 0.2266  -0.1794 421 TRP A CZ2 
3149 C  CZ3 . TRP A 410 ? 2.0305 2.1235 2.0480 -0.0883 0.2325  -0.1899 421 TRP A CZ3 
3150 C  CH2 . TRP A 410 ? 1.9944 2.0771 2.0153 -0.0884 0.2270  -0.1820 421 TRP A CH2 
3151 N  N   . HIS A 411 ? 2.3038 2.4089 2.3607 -0.0873 0.2603  -0.2318 422 HIS A N   
3152 C  CA  . HIS A 411 ? 2.3459 2.4600 2.3972 -0.0874 0.2663  -0.2409 422 HIS A CA  
3153 C  C   . HIS A 411 ? 2.3255 2.4419 2.3633 -0.0887 0.2635  -0.2452 422 HIS A C   
3154 O  O   . HIS A 411 ? 2.3101 2.4199 2.3496 -0.0897 0.2598  -0.2471 422 HIS A O   
3155 C  CB  . HIS A 411 ? 2.4032 2.5162 2.4673 -0.0873 0.2715  -0.2488 422 HIS A CB  
3156 C  CG  . HIS A 411 ? 2.4500 2.5719 2.5081 -0.0874 0.2781  -0.2581 422 HIS A CG  
3157 N  ND1 . HIS A 411 ? 2.4748 2.6047 2.5281 -0.0867 0.2838  -0.2580 422 HIS A ND1 
3158 C  CD2 . HIS A 411 ? 2.4788 2.6024 2.5340 -0.0884 0.2798  -0.2678 422 HIS A CD2 
3159 C  CE1 . HIS A 411 ? 2.5175 2.6532 2.5643 -0.0871 0.2887  -0.2673 422 HIS A CE1 
3160 N  NE2 . HIS A 411 ? 2.5201 2.6525 2.5684 -0.0881 0.2862  -0.2734 422 HIS A NE2 
3161 N  N   . PRO A 412 ? 2.3285 2.4539 2.3532 -0.0887 0.2654  -0.2468 423 PRO A N   
3162 C  CA  . PRO A 412 ? 2.3149 2.4441 2.3263 -0.0897 0.2627  -0.2509 423 PRO A CA  
3163 C  C   . PRO A 412 ? 2.3342 2.4605 2.3485 -0.0909 0.2623  -0.2598 423 PRO A C   
3164 O  O   . PRO A 412 ? 2.3149 2.4418 2.3210 -0.0919 0.2585  -0.2620 423 PRO A O   
3165 C  CB  . PRO A 412 ? 2.3487 2.4880 2.3499 -0.0892 0.2677  -0.2543 423 PRO A CB  
3166 C  CG  . PRO A 412 ? 2.3424 2.4826 2.3470 -0.0880 0.2700  -0.2463 423 PRO A CG  
3167 C  CD  . PRO A 412 ? 2.3467 2.4790 2.3686 -0.0875 0.2701  -0.2437 423 PRO A CD  
3168 N  N   . ASP A 413 ? 2.3733 2.4963 2.4001 -0.0908 0.2660  -0.2649 424 ASP A N   
3169 C  CA  . ASP A 413 ? 2.3940 2.5135 2.4252 -0.0919 0.2659  -0.2732 424 ASP A CA  
3170 C  C   . ASP A 413 ? 2.3510 2.4612 2.3839 -0.0929 0.2597  -0.2694 424 ASP A C   
3171 O  O   . ASP A 413 ? 2.3581 2.4665 2.3898 -0.0941 0.2583  -0.2753 424 ASP A O   
3172 C  CB  . ASP A 413 ? 2.4466 2.5635 2.4922 -0.0914 0.2709  -0.2783 424 ASP A CB  
3173 C  CG  . ASP A 413 ? 2.5036 2.6291 2.5469 -0.0911 0.2779  -0.2867 424 ASP A CG  
3174 O  OD1 . ASP A 413 ? 2.5052 2.6381 2.5348 -0.0915 0.2783  -0.2900 424 ASP A OD1 
3175 O  OD2 . ASP A 413 ? 2.5509 2.6754 2.6059 -0.0905 0.2830  -0.2899 424 ASP A OD2 
3176 N  N   . ASN A 414 ? 2.3113 2.4153 2.3472 -0.0924 0.2561  -0.2597 425 ASN A N   
3177 C  CA  . ASN A 414 ? 2.2770 2.3701 2.3155 -0.0934 0.2508  -0.2555 425 ASN A CA  
3178 C  C   . ASN A 414 ? 2.2398 2.3325 2.2674 -0.0947 0.2465  -0.2550 425 ASN A C   
3179 O  O   . ASN A 414 ? 2.2402 2.3242 2.2698 -0.0959 0.2436  -0.2552 425 ASN A O   
3180 C  CB  . ASN A 414 ? 2.2481 2.3344 2.2918 -0.0926 0.2480  -0.2453 425 ASN A CB  
3181 C  CG  . ASN A 414 ? 2.2865 2.3698 2.3445 -0.0916 0.2511  -0.2460 425 ASN A CG  
3182 O  OD1 . ASN A 414 ? 2.3103 2.3856 2.3773 -0.0920 0.2507  -0.2489 425 ASN A OD1 
3183 N  ND2 . ASN A 414 ? 2.2955 2.3849 2.3560 -0.0902 0.2543  -0.2433 425 ASN A ND2 
3184 N  N   . PHE A 415 ? 2.2121 2.3140 2.2286 -0.0944 0.2462  -0.2545 426 PHE A N   
3185 C  CA  . PHE A 415 ? 2.1779 2.2805 2.1847 -0.0955 0.2421  -0.2540 426 PHE A CA  
3186 C  C   . PHE A 415 ? 2.2055 2.3187 2.2039 -0.0957 0.2437  -0.2615 426 PHE A C   
3187 O  O   . PHE A 415 ? 2.2449 2.3657 2.2413 -0.0948 0.2477  -0.2647 426 PHE A O   
3188 C  CB  . PHE A 415 ? 2.1279 2.2294 2.1286 -0.0951 0.2381  -0.2436 426 PHE A CB  
3189 C  CG  . PHE A 415 ? 2.1368 2.2442 2.1363 -0.0935 0.2403  -0.2387 426 PHE A CG  
3190 C  CD1 . PHE A 415 ? 2.1579 2.2762 2.1487 -0.0929 0.2425  -0.2411 426 PHE A CD1 
3191 C  CD2 . PHE A 415 ? 2.1302 2.2318 2.1374 -0.0927 0.2400  -0.2316 426 PHE A CD2 
3192 C  CE1 . PHE A 415 ? 2.1705 2.2937 2.1601 -0.0916 0.2452  -0.2365 426 PHE A CE1 
3193 C  CE2 . PHE A 415 ? 2.1417 2.2487 2.1490 -0.0913 0.2424  -0.2272 426 PHE A CE2 
3194 C  CZ  . PHE A 415 ? 2.1614 2.2792 2.1597 -0.0908 0.2453  -0.2297 426 PHE A CZ  
3195 N  N   . GLN A 416 ? 2.1879 2.3013 2.1811 -0.0969 0.2404  -0.2641 427 GLN A N   
3196 C  CA  . GLN A 416 ? 2.2185 2.3405 2.2051 -0.0973 0.2411  -0.2725 427 GLN A CA  
3197 C  C   . GLN A 416 ? 2.2073 2.3381 2.1814 -0.0967 0.2391  -0.2696 427 GLN A C   
3198 O  O   . GLN A 416 ? 2.2463 2.3851 2.2146 -0.0961 0.2416  -0.2745 427 GLN A O   
3199 C  CB  . GLN A 416 ? 2.2212 2.3395 2.2103 -0.0989 0.2390  -0.2785 427 GLN A CB  
3200 C  CG  . GLN A 416 ? 2.2557 2.3822 2.2401 -0.0993 0.2396  -0.2885 427 GLN A CG  
3201 C  CD  . GLN A 416 ? 2.2968 2.4197 2.2899 -0.1004 0.2417  -0.2978 427 GLN A CD  
3202 O  OE1 . GLN A 416 ? 2.2880 2.4016 2.2890 -0.1013 0.2413  -0.2967 427 GLN A OE1 
3203 N  NE2 . GLN A 416 ? 2.3442 2.4741 2.3352 -0.1005 0.2439  -0.3071 427 GLN A NE2 
3204 N  N   . ASN A 417 ? 2.1573 2.2864 2.1269 -0.0968 0.2346  -0.2617 428 ASN A N   
3205 C  CA  . ASN A 417 ? 2.1479 2.2850 2.1057 -0.0964 0.2320  -0.2596 428 ASN A CA  
3206 C  C   . ASN A 417 ? 2.1549 2.2973 2.1070 -0.0949 0.2341  -0.2541 428 ASN A C   
3207 O  O   . ASN A 417 ? 2.1398 2.2783 2.0969 -0.0941 0.2356  -0.2476 428 ASN A O   
3208 C  CB  . ASN A 417 ? 2.0965 2.2306 2.0517 -0.0972 0.2265  -0.2545 428 ASN A CB  
3209 C  CG  . ASN A 417 ? 2.0953 2.2260 2.0546 -0.0987 0.2248  -0.2612 428 ASN A CG  
3210 O  OD1 . ASN A 417 ? 2.1343 2.2642 2.0991 -0.0993 0.2275  -0.2693 428 ASN A OD1 
3211 N  ND2 . ASN A 417 ? 2.0525 2.1811 2.0098 -0.0996 0.2204  -0.2578 428 ASN A ND2 
3212 N  N   . GLU A 418 ? 2.1795 2.3306 2.1209 -0.0945 0.2340  -0.2569 429 GLU A N   
3213 C  CA  . GLU A 418 ? 2.1985 2.3555 2.1327 -0.0932 0.2371  -0.2537 429 GLU A CA  
3214 C  C   . GLU A 418 ? 2.1532 2.3088 2.0857 -0.0924 0.2351  -0.2423 429 GLU A C   
3215 O  O   . GLU A 418 ? 2.1601 2.3155 2.0953 -0.0915 0.2388  -0.2378 429 GLU A O   
3216 C  CB  . GLU A 418 ? 2.2299 2.3953 2.1508 -0.0932 0.2361  -0.2587 429 GLU A CB  
3217 C  CG  . GLU A 418 ? 2.2729 2.4400 2.1939 -0.0942 0.2364  -0.2703 429 GLU A CG  
3218 C  CD  . GLU A 418 ? 2.2478 2.4136 2.1697 -0.0954 0.2302  -0.2724 429 GLU A CD  
3219 O  OE1 . GLU A 418 ? 2.1985 2.3576 2.1287 -0.0959 0.2281  -0.2684 429 GLU A OE1 
3220 O  OE2 . GLU A 418 ? 2.2802 2.4512 2.1944 -0.0958 0.2275  -0.2783 429 GLU A OE2 
3221 N  N   . GLU A 419 ? 2.1094 2.2642 2.0380 -0.0929 0.2293  -0.2377 430 GLU A N   
3222 C  CA  . GLU A 419 ? 2.0635 2.2170 1.9897 -0.0923 0.2267  -0.2270 430 GLU A CA  
3223 C  C   . GLU A 419 ? 2.0438 2.1902 1.9803 -0.0918 0.2288  -0.2212 430 GLU A C   
3224 O  O   . GLU A 419 ? 2.0363 2.1839 1.9723 -0.0908 0.2303  -0.2144 430 GLU A O   
3225 C  CB  . GLU A 419 ? 2.0217 2.1732 1.9455 -0.0931 0.2205  -0.2243 430 GLU A CB  
3226 C  CG  . GLU A 419 ? 2.0247 2.1840 1.9368 -0.0930 0.2171  -0.2248 430 GLU A CG  
3227 C  CD  . GLU A 419 ? 1.9855 2.1466 1.8917 -0.0921 0.2149  -0.2146 430 GLU A CD  
3228 O  OE1 . GLU A 419 ? 1.9402 2.0965 1.8494 -0.0925 0.2112  -0.2084 430 GLU A OE1 
3229 O  OE2 . GLU A 419 ? 2.0020 2.1689 1.9003 -0.0911 0.2170  -0.2127 430 GLU A OE2 
3230 N  N   . GLU A 420 ? 2.0393 2.1781 1.9854 -0.0927 0.2286  -0.2241 431 GLU A N   
3231 C  CA  . GLU A 420 ? 2.0295 2.1602 1.9860 -0.0924 0.2299  -0.2198 431 GLU A CA  
3232 C  C   . GLU A 420 ? 2.0745 2.2084 2.0355 -0.0913 0.2358  -0.2221 431 GLU A C   
3233 O  O   . GLU A 420 ? 2.0688 2.2006 2.0348 -0.0904 0.2371  -0.2158 431 GLU A O   
3234 C  CB  . GLU A 420 ? 2.0256 2.1476 1.9901 -0.0937 0.2288  -0.2239 431 GLU A CB  
3235 C  CG  . GLU A 420 ? 1.9899 2.1080 1.9510 -0.0950 0.2239  -0.2230 431 GLU A CG  
3236 C  CD  . GLU A 420 ? 2.0096 2.1344 1.9650 -0.0957 0.2232  -0.2310 431 GLU A CD  
3237 O  OE1 . GLU A 420 ? 2.0464 2.1805 1.9950 -0.0950 0.2246  -0.2341 431 GLU A OE1 
3238 O  OE2 . GLU A 420 ? 1.9918 2.1120 1.9493 -0.0971 0.2211  -0.2342 431 GLU A OE2 
3239 N  N   . LYS A 421 ? 2.1213 2.2601 2.0809 -0.0915 0.2394  -0.2314 432 LYS A N   
3240 C  CA  . LYS A 421 ? 2.1711 2.3125 2.1354 -0.0908 0.2457  -0.2355 432 LYS A CA  
3241 C  C   . LYS A 421 ? 2.1785 2.3253 2.1380 -0.0895 0.2485  -0.2296 432 LYS A C   
3242 O  O   . LYS A 421 ? 2.1817 2.3259 2.1498 -0.0887 0.2511  -0.2251 432 LYS A O   
3243 C  CB  . LYS A 421 ? 2.2217 2.3679 2.1829 -0.0913 0.2486  -0.2468 432 LYS A CB  
3244 C  CG  . LYS A 421 ? 2.2758 2.4222 2.2454 -0.0909 0.2553  -0.2530 432 LYS A CG  
3245 C  CD  . LYS A 421 ? 2.3075 2.4521 2.2820 -0.0920 0.2562  -0.2633 432 LYS A CD  
3246 C  CE  . LYS A 421 ? 2.3173 2.4679 2.2803 -0.0928 0.2546  -0.2706 432 LYS A CE  
3247 N  NZ  . LYS A 421 ? 2.3631 2.5220 2.3157 -0.0922 0.2587  -0.2741 432 LYS A NZ  
3248 N  N   . LYS A 422 ? 2.1853 2.3392 2.1314 -0.0894 0.2476  -0.2293 433 LYS A N   
3249 C  CA  . LYS A 422 ? 2.1927 2.3518 2.1321 -0.0883 0.2501  -0.2235 433 LYS A CA  
3250 C  C   . LYS A 422 ? 2.1529 2.3073 2.0998 -0.0876 0.2488  -0.2132 433 LYS A C   
3251 O  O   . LYS A 422 ? 2.1695 2.3261 2.1181 -0.0866 0.2530  -0.2092 433 LYS A O   
3252 C  CB  . LYS A 422 ? 2.1828 2.3477 2.1066 -0.0885 0.2463  -0.2225 433 LYS A CB  
3253 C  CG  . LYS A 422 ? 2.2059 2.3760 2.1207 -0.0875 0.2486  -0.2165 433 LYS A CG  
3254 C  CD  . LYS A 422 ? 2.2148 2.3913 2.1132 -0.0877 0.2461  -0.2186 433 LYS A CD  
3255 C  CE  . LYS A 422 ? 2.2739 2.4547 2.1654 -0.0879 0.2511  -0.2283 433 LYS A CE  
3256 N  NZ  . LYS A 422 ? 2.2792 2.4655 2.1537 -0.0882 0.2482  -0.2310 433 LYS A NZ  
3257 N  N   . LYS A 423 ? 2.1036 2.2513 2.0554 -0.0882 0.2433  -0.2093 434 LYS A N   
3258 C  CA  . LYS A 423 ? 2.0643 2.2066 2.0222 -0.0876 0.2408  -0.1995 434 LYS A CA  
3259 C  C   . LYS A 423 ? 2.0816 2.2180 2.0542 -0.0872 0.2437  -0.1990 434 LYS A C   
3260 O  O   . LYS A 423 ? 2.0697 2.2045 2.0478 -0.0863 0.2443  -0.1920 434 LYS A O   
3261 C  CB  . LYS A 423 ? 2.0111 2.1477 1.9670 -0.0885 0.2339  -0.1954 434 LYS A CB  
3262 C  CG  . LYS A 423 ? 1.9846 2.1268 1.9276 -0.0887 0.2303  -0.1930 434 LYS A CG  
3263 C  CD  . LYS A 423 ? 1.9766 2.1231 1.9151 -0.0875 0.2310  -0.1848 434 LYS A CD  
3264 C  CE  . LYS A 423 ? 1.9859 2.1409 1.9104 -0.0874 0.2304  -0.1857 434 LYS A CE  
3265 N  NZ  . LYS A 423 ? 2.0136 2.1733 1.9337 -0.0862 0.2333  -0.1794 434 LYS A NZ  
3266 N  N   . ALA A 424 ? 2.1120 2.2451 2.0915 -0.0878 0.2453  -0.2066 435 ALA A N   
3267 C  CA  . ALA A 424 ? 2.1352 2.2629 2.1292 -0.0873 0.2481  -0.2072 435 ALA A CA  
3268 C  C   . ALA A 424 ? 2.1844 2.3183 2.1816 -0.0863 0.2554  -0.2096 435 ALA A C   
3269 O  O   . ALA A 424 ? 2.1959 2.3269 2.2049 -0.0855 0.2576  -0.2064 435 ALA A O   
3270 C  CB  . ALA A 424 ? 2.1520 2.2744 2.1520 -0.0883 0.2477  -0.2146 435 ALA A CB  
3271 N  N   . GLU A 425 ? 2.2159 2.3580 2.2028 -0.0864 0.2591  -0.2154 436 GLU A N   
3272 C  CA  . GLU A 425 ? 2.2683 2.4163 2.2557 -0.0856 0.2668  -0.2179 436 GLU A CA  
3273 C  C   . GLU A 425 ? 2.2545 2.4026 2.2458 -0.0845 0.2677  -0.2084 436 GLU A C   
3274 O  O   . GLU A 425 ? 2.2889 2.4370 2.2909 -0.0837 0.2731  -0.2083 436 GLU A O   
3275 C  CB  . GLU A 425 ? 2.2964 2.4525 2.2676 -0.0858 0.2692  -0.2228 436 GLU A CB  
3276 C  CG  . GLU A 425 ? 2.3242 2.4818 2.2924 -0.0868 0.2705  -0.2339 436 GLU A CG  
3277 C  CD  . GLU A 425 ? 2.3486 2.5138 2.3001 -0.0870 0.2721  -0.2383 436 GLU A CD  
3278 O  OE1 . GLU A 425 ? 2.3701 2.5396 2.3148 -0.0863 0.2764  -0.2354 436 GLU A OE1 
3279 O  OE2 . GLU A 425 ? 2.3488 2.5151 2.2935 -0.0879 0.2691  -0.2446 436 GLU A OE2 
3280 N  N   . LYS A 426 ? 2.2051 2.3533 2.1885 -0.0844 0.2625  -0.2007 437 LYS A N   
3281 C  CA  . LYS A 426 ? 2.1863 2.3345 2.1725 -0.0835 0.2625  -0.1911 437 LYS A CA  
3282 C  C   . LYS A 426 ? 2.1805 2.3213 2.1842 -0.0830 0.2615  -0.1872 437 LYS A C   
3283 O  O   . LYS A 426 ? 2.2012 2.3427 2.2132 -0.0820 0.2650  -0.1830 437 LYS A O   
3284 C  CB  . LYS A 426 ? 2.1308 2.2796 2.1062 -0.0837 0.2561  -0.1840 437 LYS A CB  
3285 C  CG  . LYS A 426 ? 2.1320 2.2879 2.0900 -0.0841 0.2559  -0.1871 437 LYS A CG  
3286 C  CD  . LYS A 426 ? 2.1815 2.3447 2.1327 -0.0835 0.2632  -0.1888 437 LYS A CD  
3287 C  CE  . LYS A 426 ? 2.1830 2.3474 2.1356 -0.0825 0.2648  -0.1794 437 LYS A CE  
3288 N  NZ  . LYS A 426 ? 2.2483 2.4185 2.1963 -0.0820 0.2733  -0.1816 437 LYS A NZ  
3289 N  N   . LYS A 427 ? 2.1557 2.2889 2.1651 -0.0837 0.2565  -0.1887 438 LYS A N   
3290 C  CA  . LYS A 427 ? 2.1517 2.2765 2.1772 -0.0833 0.2547  -0.1856 438 LYS A CA  
3291 C  C   . LYS A 427 ? 2.2099 2.3356 2.2477 -0.0828 0.2613  -0.1919 438 LYS A C   
3292 O  O   . LYS A 427 ? 2.2240 2.3465 2.2758 -0.0820 0.2625  -0.1884 438 LYS A O   
3293 C  CB  . LYS A 427 ? 2.1160 2.2317 2.1422 -0.0844 0.2479  -0.1858 438 LYS A CB  
3294 C  CG  . LYS A 427 ? 2.0582 2.1714 2.0741 -0.0849 0.2412  -0.1791 438 LYS A CG  
3295 C  CD  . LYS A 427 ? 2.0280 2.1366 2.0497 -0.0842 0.2378  -0.1689 438 LYS A CD  
3296 C  CE  . LYS A 427 ? 1.9749 2.0833 1.9852 -0.0846 0.2325  -0.1623 438 LYS A CE  
3297 N  NZ  . LYS A 427 ? 1.9446 2.0458 1.9499 -0.0860 0.2271  -0.1635 438 LYS A NZ  
3298 N  N   . PHE A 428 ? 2.2457 2.3758 2.2787 -0.0834 0.2656  -0.2013 439 PHE A N   
3299 C  CA  . PHE A 428 ? 2.3047 2.4361 2.3487 -0.0830 0.2725  -0.2084 439 PHE A CA  
3300 C  C   . PHE A 428 ? 2.3425 2.4802 2.3889 -0.0820 0.2799  -0.2069 439 PHE A C   
3301 O  O   . PHE A 428 ? 2.3715 2.5071 2.4335 -0.0812 0.2834  -0.2062 439 PHE A O   
3302 C  CB  . PHE A 428 ? 2.3337 2.4680 2.3707 -0.0839 0.2750  -0.2190 439 PHE A CB  
3303 C  CG  . PHE A 428 ? 2.3844 2.5163 2.4351 -0.0839 0.2794  -0.2264 439 PHE A CG  
3304 C  CD1 . PHE A 428 ? 2.3758 2.4989 2.4373 -0.0843 0.2749  -0.2271 439 PHE A CD1 
3305 C  CD2 . PHE A 428 ? 2.4437 2.5816 2.4964 -0.0835 0.2881  -0.2328 439 PHE A CD2 
3306 C  CE1 . PHE A 428 ? 2.4245 2.5452 2.4992 -0.0842 0.2787  -0.2338 439 PHE A CE1 
3307 C  CE2 . PHE A 428 ? 2.4923 2.6279 2.5584 -0.0835 0.2923  -0.2399 439 PHE A CE2 
3308 C  CZ  . PHE A 428 ? 2.4822 2.6094 2.5597 -0.0838 0.2874  -0.2403 439 PHE A CZ  
3309 N  N   . ILE A 429 ? 2.3444 2.4894 2.3756 -0.0821 0.2823  -0.2064 440 ILE A N   
3310 C  CA  . ILE A 429 ? 2.3775 2.5281 2.4082 -0.0812 0.2892  -0.2036 440 ILE A CA  
3311 C  C   . ILE A 429 ? 2.3612 2.5077 2.4073 -0.0802 0.2882  -0.1952 440 ILE A C   
3312 O  O   . ILE A 429 ? 2.4026 2.5509 2.4594 -0.0795 0.2950  -0.1953 440 ILE A O   
3313 C  CB  . ILE A 429 ? 2.3637 2.5204 2.3747 -0.0814 0.2886  -0.2004 440 ILE A CB  
3314 C  CG1 . ILE A 429 ? 2.3866 2.5479 2.3825 -0.0823 0.2906  -0.2094 440 ILE A CG1 
3315 C  CG2 . ILE A 429 ? 2.3964 2.5574 2.4073 -0.0806 0.2949  -0.1954 440 ILE A CG2 
3316 C  CD1 . ILE A 429 ? 2.3592 2.5245 2.3356 -0.0827 0.2863  -0.2067 440 ILE A CD1 
3317 N  N   . ASP A 430 ? 2.3033 2.4441 2.3509 -0.0803 0.2796  -0.1882 441 ASP A N   
3318 C  CA  . ASP A 430 ? 2.2826 2.4191 2.3428 -0.0794 0.2771  -0.1794 441 ASP A CA  
3319 C  C   . ASP A 430 ? 2.3022 2.4312 2.3823 -0.0791 0.2758  -0.1805 441 ASP A C   
3320 O  O   . ASP A 430 ? 2.3270 2.4555 2.4218 -0.0781 0.2787  -0.1774 441 ASP A O   
3321 C  CB  . ASP A 430 ? 2.2166 2.3497 2.2684 -0.0797 0.2684  -0.1711 441 ASP A CB  
3322 C  CG  . ASP A 430 ? 2.1971 2.3373 2.2298 -0.0800 0.2688  -0.1696 441 ASP A CG  
3323 O  OD1 . ASP A 430 ? 2.2374 2.3849 2.2643 -0.0797 0.2761  -0.1722 441 ASP A OD1 
3324 O  OD2 . ASP A 430 ? 2.1450 2.2830 2.1684 -0.0805 0.2619  -0.1659 441 ASP A OD2 
3325 N  N   . ILE A 431 ? 2.2935 2.4166 2.3746 -0.0798 0.2713  -0.1847 442 ILE A N   
3326 C  CA  . ILE A 431 ? 2.3143 2.4293 2.4136 -0.0795 0.2692  -0.1856 442 ILE A CA  
3327 C  C   . ILE A 431 ? 2.3801 2.4986 2.4942 -0.0787 0.2778  -0.1904 442 ILE A C   
3328 O  O   . ILE A 431 ? 2.4000 2.5142 2.5316 -0.0779 0.2773  -0.1871 442 ILE A O   
3329 C  CB  . ILE A 431 ? 2.3030 2.4111 2.4003 -0.0806 0.2643  -0.1906 442 ILE A CB  
3330 C  CG1 . ILE A 431 ? 2.3250 2.4392 2.4123 -0.0814 0.2692  -0.2005 442 ILE A CG1 
3331 C  CG2 . ILE A 431 ? 2.2416 2.3434 2.3294 -0.0813 0.2553  -0.1844 442 ILE A CG2 
3332 C  CD1 . ILE A 431 ? 2.3852 2.4987 2.4851 -0.0813 0.2744  -0.2091 442 ILE A CD1 
3333 N  N   . ALA A 432 ? 2.4158 2.5418 2.5225 -0.0790 0.2855  -0.1982 443 ALA A N   
3334 C  CA  . ALA A 432 ? 2.4813 2.6111 2.6002 -0.0784 0.2949  -0.2036 443 ALA A CA  
3335 C  C   . ALA A 432 ? 2.4957 2.6303 2.6180 -0.0775 0.3001  -0.1979 443 ALA A C   
3336 O  O   . ALA A 432 ? 2.5420 2.6766 2.6817 -0.0767 0.3054  -0.1984 443 ALA A O   
3337 C  CB  . ALA A 432 ? 2.5137 2.6493 2.6218 -0.0792 0.3013  -0.2138 443 ALA A CB  
3338 N  N   . ALA A 433 ? 2.4580 2.5965 2.5645 -0.0776 0.2986  -0.1925 444 ALA A N   
3339 C  CA  . ALA A 433 ? 2.4674 2.6102 2.5756 -0.0769 0.3032  -0.1864 444 ALA A CA  
3340 C  C   . ALA A 433 ? 2.4650 2.6023 2.5945 -0.0759 0.3002  -0.1799 444 ALA A C   
3341 O  O   . ALA A 433 ? 2.5082 2.6480 2.6500 -0.0751 0.3068  -0.1785 444 ALA A O   
3342 C  CB  . ALA A 433 ? 2.4193 2.5654 2.5085 -0.0772 0.2996  -0.1804 444 ALA A CB  
3343 N  N   . ALA A 434 ? 2.4186 2.5478 2.5524 -0.0760 0.2902  -0.1760 445 ALA A N   
3344 C  CA  . ALA A 434 ? 2.4146 2.5370 2.5682 -0.0751 0.2856  -0.1700 445 ALA A CA  
3345 C  C   . ALA A 434 ? 2.4772 2.5989 2.6524 -0.0744 0.2916  -0.1750 445 ALA A C   
3346 O  O   . ALA A 434 ? 2.4965 2.6184 2.6877 -0.0735 0.2942  -0.1709 445 ALA A O   
3347 C  CB  . ALA A 434 ? 2.3637 2.4763 2.5161 -0.0756 0.2742  -0.1669 445 ALA A CB  
3348 N  N   . LYS A 435 ? 2.5108 2.6321 2.6869 -0.0749 0.2943  -0.1839 446 LYS A N   
3349 C  CA  . LYS A 435 ? 2.5724 2.6922 2.7695 -0.0744 0.2993  -0.1893 446 LYS A CA  
3350 C  C   . LYS A 435 ? 2.6216 2.7480 2.8289 -0.0736 0.3100  -0.1899 446 LYS A C   
3351 O  O   . LYS A 435 ? 2.6416 2.7655 2.8696 -0.0726 0.3102  -0.1861 446 LYS A O   
3352 C  CB  . LYS A 435 ? 2.6030 2.7231 2.7960 -0.0752 0.3022  -0.1998 446 LYS A CB  
3353 C  CG  . LYS A 435 ? 2.5629 2.6764 2.7461 -0.0761 0.2930  -0.2005 446 LYS A CG  
3354 C  CD  . LYS A 435 ? 2.5267 2.6295 2.7210 -0.0757 0.2826  -0.1934 446 LYS A CD  
3355 C  CE  . LYS A 435 ? 2.5702 2.6672 2.7876 -0.0751 0.2826  -0.1963 446 LYS A CE  
3356 N  NZ  . LYS A 435 ? 2.5353 2.6209 2.7603 -0.0749 0.2714  -0.1895 446 LYS A NZ  
3357 N  N   . GLU A 436 ? 2.6432 2.7777 2.8358 -0.0741 0.3188  -0.1945 447 GLU A N   
3358 C  CA  . GLU A 436 ? 2.6990 2.8398 2.8982 -0.0736 0.3306  -0.1961 447 GLU A CA  
3359 C  C   . GLU A 436 ? 2.6805 2.8223 2.8853 -0.0729 0.3302  -0.1864 447 GLU A C   
3360 O  O   . GLU A 436 ? 2.7261 2.8701 2.9469 -0.0722 0.3377  -0.1859 447 GLU A O   
3361 C  CB  . GLU A 436 ? 2.7229 2.8711 2.9007 -0.0745 0.3388  -0.2026 447 GLU A CB  
3362 C  CG  . GLU A 436 ? 2.7979 2.9515 2.9820 -0.0744 0.3526  -0.2073 447 GLU A CG  
3363 C  CD  . GLU A 436 ? 2.8221 2.9819 2.9825 -0.0754 0.3602  -0.2133 447 GLU A CD  
3364 O  OE1 . GLU A 436 ? 2.7810 2.9417 2.9202 -0.0761 0.3544  -0.2130 447 GLU A OE1 
3365 O  OE2 . GLU A 436 ? 2.8867 3.0501 3.0497 -0.0755 0.3720  -0.2183 447 GLU A OE2 
3366 N  N   . VAL A 437 ? 2.6150 2.7551 2.8073 -0.0730 0.3214  -0.1788 448 VAL A N   
3367 C  CA  . VAL A 437 ? 2.5925 2.7338 2.7873 -0.0724 0.3205  -0.1694 448 VAL A CA  
3368 C  C   . VAL A 437 ? 2.5854 2.7197 2.8031 -0.0714 0.3134  -0.1630 448 VAL A C   
3369 O  O   . VAL A 437 ? 2.5839 2.7190 2.8098 -0.0707 0.3138  -0.1558 448 VAL A O   
3370 C  CB  . VAL A 437 ? 2.5292 2.6723 2.6999 -0.0730 0.3150  -0.1641 448 VAL A CB  
3371 C  CG1 . VAL A 437 ? 2.5063 2.6502 2.6802 -0.0723 0.3136  -0.1541 448 VAL A CG1 
3372 C  CG2 . VAL A 437 ? 2.5447 2.6950 2.6936 -0.0738 0.3224  -0.1699 448 VAL A CG2 
3373 N  N   . LEU A 438 ? 2.5894 2.7165 2.8178 -0.0714 0.3068  -0.1654 449 LEU A N   
3374 C  CA  . LEU A 438 ? 2.5864 2.7059 2.8356 -0.0705 0.2990  -0.1594 449 LEU A CA  
3375 C  C   . LEU A 438 ? 2.6479 2.7658 2.9242 -0.0696 0.3037  -0.1633 449 LEU A C   
3376 O  O   . LEU A 438 ? 2.6618 2.7769 2.9580 -0.0687 0.3015  -0.1579 449 LEU A O   
3377 C  CB  . LEU A 438 ? 2.5238 2.6341 2.7666 -0.0709 0.2858  -0.1563 449 LEU A CB  
3378 C  CG  . LEU A 438 ? 2.4943 2.5995 2.7322 -0.0717 0.2820  -0.1627 449 LEU A CG  
3379 C  CD1 . LEU A 438 ? 2.5353 2.6340 2.7978 -0.0710 0.2807  -0.1661 449 LEU A CD1 
3380 C  CD2 . LEU A 438 ? 2.4252 2.5240 2.6464 -0.0725 0.2708  -0.1576 449 LEU A CD2 
3381 N  N   . SER A 439 ? 2.6869 2.8067 2.9646 -0.0700 0.3101  -0.1727 450 SER A N   
3382 C  CA  . SER A 439 ? 2.7524 2.8712 3.0559 -0.0692 0.3154  -0.1774 450 SER A CA  
3383 C  C   . SER A 439 ? 2.8057 2.9316 3.1202 -0.0687 0.3273  -0.1772 450 SER A C   
3384 O  O   . SER A 439 ? 2.8085 2.9411 3.1067 -0.0691 0.3336  -0.1760 450 SER A O   
3385 C  CB  . SER A 439 ? 2.7815 2.9005 3.0824 -0.0699 0.3194  -0.1879 450 SER A CB  
3386 O  OG  . SER A 439 ? 2.7930 2.9203 3.0757 -0.0707 0.3295  -0.1938 450 SER A OG  
3387 N  N   . ASP A 440 ? 2.8495 2.9735 3.1920 -0.0677 0.3301  -0.1783 451 ASP A N   
3388 C  CA  . ASP A 440 ? 2.9098 3.0393 3.2678 -0.0672 0.3415  -0.1787 451 ASP A CA  
3389 C  C   . ASP A 440 ? 2.8847 3.0163 3.2426 -0.0667 0.3409  -0.1692 451 ASP A C   
3390 O  O   . ASP A 440 ? 2.8267 2.9529 3.1837 -0.0664 0.3289  -0.1616 451 ASP A O   
3391 C  CB  . ASP A 440 ? 2.9662 3.1033 3.3111 -0.0680 0.3554  -0.1876 451 ASP A CB  
3392 C  CG  . ASP A 440 ? 2.9727 3.1081 3.3139 -0.0686 0.3556  -0.1970 451 ASP A CG  
3393 O  OD1 . ASP A 440 ? 2.9699 3.0986 3.3281 -0.0681 0.3484  -0.1979 451 ASP A OD1 
3394 O  OD2 . ASP A 440 ? 2.9865 3.1269 3.3074 -0.0696 0.3628  -0.2035 451 ASP A OD2 
3395 N  N   . PRO A 441 ? 2.9286 3.0675 3.2876 -0.0667 0.3536  -0.1695 452 PRO A N   
3396 C  CA  . PRO A 441 ? 2.9091 3.0499 3.2706 -0.0663 0.3534  -0.1604 452 PRO A CA  
3397 C  C   . PRO A 441 ? 2.8322 2.9717 3.1706 -0.0667 0.3434  -0.1529 452 PRO A C   
3398 O  O   . PRO A 441 ? 2.8042 2.9414 3.1497 -0.0661 0.3370  -0.1443 452 PRO A O   
3399 C  CB  . PRO A 441 ? 2.9670 3.1158 3.3228 -0.0668 0.3697  -0.1639 452 PRO A CB  
3400 C  CG  . PRO A 441 ? 3.0341 3.1838 3.4010 -0.0669 0.3786  -0.1740 452 PRO A CG  
3401 C  CD  . PRO A 441 ? 3.0032 3.1479 3.3629 -0.0672 0.3686  -0.1781 452 PRO A CD  
3402 N  N   . GLU A 442 ? 2.8009 2.9418 3.1128 -0.0677 0.3420  -0.1564 453 GLU A N   
3403 C  CA  . GLU A 442 ? 2.7285 2.8684 3.0176 -0.0682 0.3331  -0.1502 453 GLU A CA  
3404 C  C   . GLU A 442 ? 2.6775 2.8087 2.9739 -0.0678 0.3180  -0.1443 453 GLU A C   
3405 O  O   . GLU A 442 ? 2.6966 2.8219 3.0111 -0.0673 0.3136  -0.1467 453 GLU A O   
3406 C  CB  . GLU A 442 ? 2.7146 2.8575 2.9765 -0.0693 0.3346  -0.1564 453 GLU A CB  
3407 C  CG  . GLU A 442 ? 2.7253 2.8764 2.9725 -0.0699 0.3477  -0.1604 453 GLU A CG  
3408 C  CD  . GLU A 442 ? 2.7988 2.9525 3.0604 -0.0699 0.3600  -0.1687 453 GLU A CD  
3409 O  OE1 . GLU A 442 ? 2.8420 2.9917 3.1208 -0.0695 0.3581  -0.1734 453 GLU A OE1 
3410 O  OE2 . GLU A 442 ? 2.8165 2.9760 3.0700 -0.0703 0.3717  -0.1710 453 GLU A OE2 
3411 N  N   . MSE A 443 ? 2.6151 2.7450 2.8967 -0.0680 0.3103  -0.1367 454 MSE A N   
3412 C  CA  . MSE A 443 ? 2.5611 2.6822 2.8450 -0.0678 0.2959  -0.1301 454 MSE A CA  
3413 C  C   . MSE A 443 ? 2.5500 2.6693 2.8514 -0.0668 0.2926  -0.1213 454 MSE A C   
3414 O  O   . MSE A 443 ? 2.4940 2.6083 2.7897 -0.0668 0.2825  -0.1142 454 MSE A O   
3415 C  CB  . MSE A 443 ? 2.5732 2.6862 2.8675 -0.0677 0.2889  -0.1344 454 MSE A CB  
3416 C  CG  . MSE A 443 ? 2.5139 2.6164 2.8074 -0.0678 0.2740  -0.1280 454 MSE A CG  
3417 SE SE  . MSE A 443 ? 2.5501 2.6414 2.8509 -0.0680 0.2654  -0.1338 454 MSE A SE  
3418 C  CE  . MSE A 443 ? 2.5390 2.6312 2.8046 -0.0697 0.2631  -0.1372 454 MSE A CE  
3419 N  N   . ARG A 444 ? 2.6080 2.7307 2.9313 -0.0660 0.3015  -0.1228 455 ARG A N   
3420 C  CA  . ARG A 444 ? 2.6093 2.7319 2.9510 -0.0651 0.3011  -0.1154 455 ARG A CA  
3421 C  C   . ARG A 444 ? 2.6778 2.8041 3.0447 -0.0644 0.3121  -0.1193 455 ARG A C   
3422 O  O   . ARG A 444 ? 2.6904 2.8240 3.0517 -0.0648 0.3251  -0.1246 455 ARG A O   
3423 C  CB  . ARG A 444 ? 2.5842 2.6970 2.9375 -0.0646 0.2863  -0.1085 455 ARG A CB  
3424 C  CG  . ARG A 444 ? 2.5531 2.6640 2.8899 -0.0649 0.2780  -0.1003 455 ARG A CG  
3425 C  CD  . ARG A 444 ? 2.5196 2.6390 2.8518 -0.0648 0.2867  -0.0959 455 ARG A CD  
3426 N  NE  . ARG A 444 ? 2.4586 2.5785 2.7669 -0.0654 0.2813  -0.0901 455 ARG A NE  
3427 C  CZ  . ARG A 444 ? 2.4102 2.5343 2.6922 -0.0664 0.2842  -0.0930 455 ARG A CZ  
3428 N  NH1 . ARG A 444 ? 2.4174 2.5456 2.6923 -0.0669 0.2922  -0.1018 455 ARG A NH1 
3429 N  NH2 . ARG A 444 ? 2.3554 2.4789 2.6186 -0.0669 0.2777  -0.0870 455 ARG A NH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   12  ?   ?   ?   A . n 
A 1 2   HIS 2   13  ?   ?   ?   A . n 
A 1 3   HIS 3   14  ?   ?   ?   A . n 
A 1 4   HIS 4   15  ?   ?   ?   A . n 
A 1 5   HIS 5   16  ?   ?   ?   A . n 
A 1 6   HIS 6   17  ?   ?   ?   A . n 
A 1 7   HIS 7   18  ?   ?   ?   A . n 
A 1 8   SER 8   19  ?   ?   ?   A . n 
A 1 9   SER 9   20  ?   ?   ?   A . n 
A 1 10  GLY 10  21  ?   ?   ?   A . n 
A 1 11  VAL 11  22  ?   ?   ?   A . n 
A 1 12  ASP 12  23  ?   ?   ?   A . n 
A 1 13  LEU 13  24  ?   ?   ?   A . n 
A 1 14  GLY 14  25  ?   ?   ?   A . n 
A 1 15  THR 15  26  ?   ?   ?   A . n 
A 1 16  GLU 16  27  ?   ?   ?   A . n 
A 1 17  ASN 17  28  ?   ?   ?   A . n 
A 1 18  LEU 18  29  ?   ?   ?   A . n 
A 1 19  TYR 19  30  ?   ?   ?   A . n 
A 1 20  PHE 20  31  ?   ?   ?   A . n 
A 1 21  GLN 21  32  32  GLN GLN A . n 
A 1 22  SER 22  33  33  SER SER A . n 
A 1 23  MSE 23  34  34  MSE MSE A . n 
A 1 24  ALA 24  35  35  ALA ALA A . n 
A 1 25  ASP 25  36  36  ASP ASP A . n 
A 1 26  VAL 26  37  37  VAL VAL A . n 
A 1 27  GLU 27  38  38  GLU GLU A . n 
A 1 28  LYS 28  39  39  LYS LYS A . n 
A 1 29  HIS 29  40  40  HIS HIS A . n 
A 1 30  LEU 30  41  41  LEU LEU A . n 
A 1 31  GLU 31  42  42  GLU GLU A . n 
A 1 32  LEU 32  43  43  LEU LEU A . n 
A 1 33  GLY 33  44  44  GLY GLY A . n 
A 1 34  LYS 34  45  45  LYS LYS A . n 
A 1 35  LYS 35  46  46  LYS LYS A . n 
A 1 36  LEU 36  47  47  LEU LEU A . n 
A 1 37  LEU 37  48  48  LEU LEU A . n 
A 1 38  ALA 38  49  49  ALA ALA A . n 
A 1 39  ALA 39  50  50  ALA ALA A . n 
A 1 40  GLY 40  51  51  GLY GLY A . n 
A 1 41  GLN 41  52  52  GLN GLN A . n 
A 1 42  LEU 42  53  53  LEU LEU A . n 
A 1 43  ALA 43  54  54  ALA ALA A . n 
A 1 44  ASP 44  55  55  ASP ASP A . n 
A 1 45  ALA 45  56  56  ALA ALA A . n 
A 1 46  LEU 46  57  57  LEU LEU A . n 
A 1 47  SER 47  58  58  SER SER A . n 
A 1 48  GLN 48  59  59  GLN GLN A . n 
A 1 49  PHE 49  60  60  PHE PHE A . n 
A 1 50  HIS 50  61  61  HIS HIS A . n 
A 1 51  ALA 51  62  62  ALA ALA A . n 
A 1 52  ALA 52  63  63  ALA ALA A . n 
A 1 53  VAL 53  64  64  VAL VAL A . n 
A 1 54  ASP 54  65  65  ASP ASP A . n 
A 1 55  GLY 55  66  66  GLY GLY A . n 
A 1 56  ASP 56  67  67  ASP ASP A . n 
A 1 57  PRO 57  68  68  PRO PRO A . n 
A 1 58  ASP 58  69  69  ASP ASP A . n 
A 1 59  ASN 59  70  70  ASN ASN A . n 
A 1 60  TYR 60  71  71  TYR TYR A . n 
A 1 61  ILE 61  72  72  ILE ILE A . n 
A 1 62  ALA 62  73  73  ALA ALA A . n 
A 1 63  TYR 63  74  74  TYR TYR A . n 
A 1 64  TYR 64  75  75  TYR TYR A . n 
A 1 65  ARG 65  76  76  ARG ARG A . n 
A 1 66  ARG 66  77  77  ARG ARG A . n 
A 1 67  ALA 67  78  78  ALA ALA A . n 
A 1 68  THR 68  79  79  THR THR A . n 
A 1 69  VAL 69  80  80  VAL VAL A . n 
A 1 70  PHE 70  81  81  PHE PHE A . n 
A 1 71  LEU 71  82  82  LEU LEU A . n 
A 1 72  ALA 72  83  83  ALA ALA A . n 
A 1 73  MSE 73  84  84  MSE MSE A . n 
A 1 74  GLY 74  85  85  GLY GLY A . n 
A 1 75  LYS 75  86  86  LYS LYS A . n 
A 1 76  SER 76  87  87  SER SER A . n 
A 1 77  LYS 77  88  88  LYS LYS A . n 
A 1 78  ALA 78  89  89  ALA ALA A . n 
A 1 79  ALA 79  90  90  ALA ALA A . n 
A 1 80  LEU 80  91  91  LEU LEU A . n 
A 1 81  PRO 81  92  92  PRO PRO A . n 
A 1 82  ASP 82  93  93  ASP ASP A . n 
A 1 83  LEU 83  94  94  LEU LEU A . n 
A 1 84  THR 84  95  95  THR THR A . n 
A 1 85  LYS 85  96  96  LYS LYS A . n 
A 1 86  VAL 86  97  97  VAL VAL A . n 
A 1 87  ILE 87  98  98  ILE ILE A . n 
A 1 88  GLN 88  99  99  GLN GLN A . n 
A 1 89  LEU 89  100 100 LEU LEU A . n 
A 1 90  LYS 90  101 101 LYS LYS A . n 
A 1 91  MSE 91  102 102 MSE MSE A . n 
A 1 92  ASP 92  103 103 ASP ASP A . n 
A 1 93  PHE 93  104 104 PHE PHE A . n 
A 1 94  THR 94  105 105 THR THR A . n 
A 1 95  ALA 95  106 106 ALA ALA A . n 
A 1 96  ALA 96  107 107 ALA ALA A . n 
A 1 97  ARG 97  108 108 ARG ARG A . n 
A 1 98  LEU 98  109 109 LEU LEU A . n 
A 1 99  GLN 99  110 110 GLN GLN A . n 
A 1 100 ARG 100 111 111 ARG ARG A . n 
A 1 101 GLY 101 112 112 GLY GLY A . n 
A 1 102 HIS 102 113 113 HIS HIS A . n 
A 1 103 LEU 103 114 114 LEU LEU A . n 
A 1 104 LEU 104 115 115 LEU LEU A . n 
A 1 105 LEU 105 116 116 LEU LEU A . n 
A 1 106 LYS 106 117 117 LYS LYS A . n 
A 1 107 GLN 107 118 118 GLN GLN A . n 
A 1 108 GLY 108 119 119 GLY GLY A . n 
A 1 109 LYS 109 120 120 LYS LYS A . n 
A 1 110 LEU 110 121 121 LEU LEU A . n 
A 1 111 ASP 111 122 122 ASP ASP A . n 
A 1 112 GLU 112 123 123 GLU GLU A . n 
A 1 113 ALA 113 124 124 ALA ALA A . n 
A 1 114 GLU 114 125 125 GLU GLU A . n 
A 1 115 ASP 115 126 126 ASP ASP A . n 
A 1 116 ASP 116 127 127 ASP ASP A . n 
A 1 117 PHE 117 128 128 PHE PHE A . n 
A 1 118 LYS 118 129 129 LYS LYS A . n 
A 1 119 LYS 119 130 130 LYS LYS A . n 
A 1 120 VAL 120 131 131 VAL VAL A . n 
A 1 121 LEU 121 132 132 LEU LEU A . n 
A 1 122 LYS 122 133 133 LYS LYS A . n 
A 1 123 SER 123 134 134 SER SER A . n 
A 1 124 ASN 124 135 135 ASN ASN A . n 
A 1 125 PRO 125 136 136 PRO PRO A . n 
A 1 126 SER 126 137 137 SER SER A . n 
A 1 127 GLU 127 138 138 GLU GLU A . n 
A 1 128 ASN 128 139 139 ASN ASN A . n 
A 1 129 GLU 129 140 140 GLU GLU A . n 
A 1 130 GLU 130 141 141 GLU GLU A . n 
A 1 131 LYS 131 142 142 LYS LYS A . n 
A 1 132 GLU 132 143 143 GLU GLU A . n 
A 1 133 ALA 133 144 144 ALA ALA A . n 
A 1 134 GLN 134 145 145 GLN GLN A . n 
A 1 135 SER 135 146 146 SER SER A . n 
A 1 136 GLN 136 147 147 GLN GLN A . n 
A 1 137 LEU 137 148 148 LEU LEU A . n 
A 1 138 ILE 138 149 149 ILE ILE A . n 
A 1 139 LYS 139 150 150 LYS LYS A . n 
A 1 140 SER 140 151 151 SER SER A . n 
A 1 141 ASP 141 152 152 ASP ASP A . n 
A 1 142 GLU 142 153 153 GLU GLU A . n 
A 1 143 MSE 143 154 154 MSE MSE A . n 
A 1 144 GLN 144 155 155 GLN GLN A . n 
A 1 145 ARG 145 156 156 ARG ARG A . n 
A 1 146 LEU 146 157 157 LEU LEU A . n 
A 1 147 ARG 147 158 158 ARG ARG A . n 
A 1 148 SER 148 159 159 SER SER A . n 
A 1 149 GLN 149 160 160 GLN GLN A . n 
A 1 150 ALA 150 161 161 ALA ALA A . n 
A 1 151 LEU 151 162 162 LEU LEU A . n 
A 1 152 ASN 152 163 163 ASN ASN A . n 
A 1 153 ALA 153 164 164 ALA ALA A . n 
A 1 154 PHE 154 165 165 PHE PHE A . n 
A 1 155 GLY 155 166 166 GLY GLY A . n 
A 1 156 SER 156 167 167 SER SER A . n 
A 1 157 GLY 157 168 168 GLY GLY A . n 
A 1 158 ASP 158 169 169 ASP ASP A . n 
A 1 159 TYR 159 170 170 TYR TYR A . n 
A 1 160 THR 160 171 171 THR THR A . n 
A 1 161 ALA 161 172 172 ALA ALA A . n 
A 1 162 ALA 162 173 173 ALA ALA A . n 
A 1 163 ILE 163 174 174 ILE ILE A . n 
A 1 164 ALA 164 175 175 ALA ALA A . n 
A 1 165 PHE 165 176 176 PHE PHE A . n 
A 1 166 LEU 166 177 177 LEU LEU A . n 
A 1 167 ASP 167 178 178 ASP ASP A . n 
A 1 168 LYS 168 179 179 LYS LYS A . n 
A 1 169 ILE 169 180 180 ILE ILE A . n 
A 1 170 LEU 170 181 181 LEU LEU A . n 
A 1 171 GLU 171 182 182 GLU GLU A . n 
A 1 172 VAL 172 183 183 VAL VAL A . n 
A 1 173 CYS 173 184 184 CYS CYS A . n 
A 1 174 VAL 174 185 185 VAL VAL A . n 
A 1 175 TRP 175 186 186 TRP TRP A . n 
A 1 176 ASP 176 187 187 ASP ASP A . n 
A 1 177 ALA 177 188 188 ALA ALA A . n 
A 1 178 GLU 178 189 189 GLU GLU A . n 
A 1 179 LEU 179 190 190 LEU LEU A . n 
A 1 180 ARG 180 191 191 ARG ARG A . n 
A 1 181 GLU 181 192 192 GLU GLU A . n 
A 1 182 LEU 182 193 193 LEU LEU A . n 
A 1 183 ARG 183 194 194 ARG ARG A . n 
A 1 184 ALA 184 195 195 ALA ALA A . n 
A 1 185 GLU 185 196 196 GLU GLU A . n 
A 1 186 CYS 186 197 197 CYS CYS A . n 
A 1 187 PHE 187 198 198 PHE PHE A . n 
A 1 188 ILE 188 199 199 ILE ILE A . n 
A 1 189 LYS 189 200 200 LYS LYS A . n 
A 1 190 GLU 190 201 201 GLU GLU A . n 
A 1 191 GLY 191 202 202 GLY GLY A . n 
A 1 192 GLU 192 203 203 GLU GLU A . n 
A 1 193 PRO 193 204 204 PRO PRO A . n 
A 1 194 ARG 194 205 205 ARG ARG A . n 
A 1 195 LYS 195 206 206 LYS LYS A . n 
A 1 196 ALA 196 207 207 ALA ALA A . n 
A 1 197 ILE 197 208 208 ILE ILE A . n 
A 1 198 SER 198 209 209 SER SER A . n 
A 1 199 ASP 199 210 210 ASP ASP A . n 
A 1 200 LEU 200 211 211 LEU LEU A . n 
A 1 201 LYS 201 212 212 LYS LYS A . n 
A 1 202 ALA 202 213 213 ALA ALA A . n 
A 1 203 ALA 203 214 214 ALA ALA A . n 
A 1 204 SER 204 215 215 SER SER A . n 
A 1 205 LYS 205 216 216 LYS LYS A . n 
A 1 206 LEU 206 217 217 LEU LEU A . n 
A 1 207 LYS 207 218 218 LYS LYS A . n 
A 1 208 ASN 208 219 219 ASN ASN A . n 
A 1 209 ASP 209 220 220 ASP ASP A . n 
A 1 210 ASN 210 221 221 ASN ASN A . n 
A 1 211 THR 211 222 222 THR THR A . n 
A 1 212 GLU 212 223 223 GLU GLU A . n 
A 1 213 ALA 213 224 224 ALA ALA A . n 
A 1 214 PHE 214 225 225 PHE PHE A . n 
A 1 215 TYR 215 226 226 TYR TYR A . n 
A 1 216 LYS 216 227 227 LYS LYS A . n 
A 1 217 ILE 217 228 228 ILE ILE A . n 
A 1 218 SER 218 229 229 SER SER A . n 
A 1 219 THR 219 230 230 THR THR A . n 
A 1 220 LEU 220 231 231 LEU LEU A . n 
A 1 221 TYR 221 232 232 TYR TYR A . n 
A 1 222 TYR 222 233 233 TYR TYR A . n 
A 1 223 GLN 223 234 234 GLN GLN A . n 
A 1 224 LEU 224 235 235 LEU LEU A . n 
A 1 225 GLY 225 236 236 GLY GLY A . n 
A 1 226 ASP 226 237 237 ASP ASP A . n 
A 1 227 HIS 227 238 238 HIS HIS A . n 
A 1 228 GLU 228 239 239 GLU GLU A . n 
A 1 229 LEU 229 240 240 LEU LEU A . n 
A 1 230 SER 230 241 241 SER SER A . n 
A 1 231 LEU 231 242 242 LEU LEU A . n 
A 1 232 SER 232 243 243 SER SER A . n 
A 1 233 GLU 233 244 244 GLU GLU A . n 
A 1 234 VAL 234 245 245 VAL VAL A . n 
A 1 235 ARG 235 246 246 ARG ARG A . n 
A 1 236 GLU 236 247 247 GLU GLU A . n 
A 1 237 CYS 237 248 248 CYS CYS A . n 
A 1 238 LEU 238 249 249 LEU LEU A . n 
A 1 239 LYS 239 250 250 LYS LYS A . n 
A 1 240 LEU 240 251 251 LEU LEU A . n 
A 1 241 ASP 241 252 252 ASP ASP A . n 
A 1 242 GLN 242 253 253 GLN GLN A . n 
A 1 243 ASP 243 254 254 ASP ASP A . n 
A 1 244 HIS 244 255 255 HIS HIS A . n 
A 1 245 LYS 245 256 256 LYS LYS A . n 
A 1 246 ARG 246 257 257 ARG ARG A . n 
A 1 247 CYS 247 258 258 CYS CYS A . n 
A 1 248 PHE 248 259 259 PHE PHE A . n 
A 1 249 ALA 249 260 260 ALA ALA A . n 
A 1 250 HIS 250 261 261 HIS HIS A . n 
A 1 251 TYR 251 262 262 TYR TYR A . n 
A 1 252 LYS 252 263 263 LYS LYS A . n 
A 1 253 GLN 253 264 264 GLN GLN A . n 
A 1 254 VAL 254 265 265 VAL VAL A . n 
A 1 255 LYS 255 266 266 LYS LYS A . n 
A 1 256 LYS 256 267 267 LYS LYS A . n 
A 1 257 LEU 257 268 268 LEU LEU A . n 
A 1 258 ASN 258 269 269 ASN ASN A . n 
A 1 259 LYS 259 270 270 LYS LYS A . n 
A 1 260 LEU 260 271 271 LEU LEU A . n 
A 1 261 ILE 261 272 272 ILE ILE A . n 
A 1 262 GLU 262 273 273 GLU GLU A . n 
A 1 263 SER 263 274 274 SER SER A . n 
A 1 264 ALA 264 275 275 ALA ALA A . n 
A 1 265 GLU 265 276 276 GLU GLU A . n 
A 1 266 GLU 266 277 277 GLU GLU A . n 
A 1 267 LEU 267 278 278 LEU LEU A . n 
A 1 268 ILE 268 279 279 ILE ILE A . n 
A 1 269 ARG 269 280 280 ARG ARG A . n 
A 1 270 ASP 270 281 281 ASP ASP A . n 
A 1 271 GLY 271 282 282 GLY GLY A . n 
A 1 272 ARG 272 283 283 ARG ARG A . n 
A 1 273 TYR 273 284 284 TYR TYR A . n 
A 1 274 THR 274 285 285 THR THR A . n 
A 1 275 ASP 275 286 286 ASP ASP A . n 
A 1 276 ALA 276 287 287 ALA ALA A . n 
A 1 277 THR 277 288 288 THR THR A . n 
A 1 278 SER 278 289 289 SER SER A . n 
A 1 279 LYS 279 290 290 LYS LYS A . n 
A 1 280 TYR 280 291 291 TYR TYR A . n 
A 1 281 GLU 281 292 292 GLU GLU A . n 
A 1 282 SER 282 293 293 SER SER A . n 
A 1 283 VAL 283 294 294 VAL VAL A . n 
A 1 284 MSE 284 295 295 MSE MSE A . n 
A 1 285 LYS 285 296 296 LYS LYS A . n 
A 1 286 THR 286 297 297 THR THR A . n 
A 1 287 GLU 287 298 298 GLU GLU A . n 
A 1 288 PRO 288 299 299 PRO PRO A . n 
A 1 289 SER 289 300 300 SER SER A . n 
A 1 290 ILE 290 301 301 ILE ILE A . n 
A 1 291 ALA 291 302 302 ALA ALA A . n 
A 1 292 GLU 292 303 303 GLU GLU A . n 
A 1 293 TYR 293 304 304 TYR TYR A . n 
A 1 294 THR 294 305 305 THR THR A . n 
A 1 295 VAL 295 306 306 VAL VAL A . n 
A 1 296 ARG 296 307 307 ARG ARG A . n 
A 1 297 SER 297 308 308 SER SER A . n 
A 1 298 LYS 298 309 309 LYS LYS A . n 
A 1 299 GLU 299 310 310 GLU GLU A . n 
A 1 300 ARG 300 311 311 ARG ARG A . n 
A 1 301 ILE 301 312 312 ILE ILE A . n 
A 1 302 CYS 302 313 313 CYS CYS A . n 
A 1 303 HIS 303 314 314 HIS HIS A . n 
A 1 304 CYS 304 315 315 CYS CYS A . n 
A 1 305 PHE 305 316 316 PHE PHE A . n 
A 1 306 SER 306 317 317 SER SER A . n 
A 1 307 LYS 307 318 318 LYS LYS A . n 
A 1 308 ASP 308 319 319 ASP ASP A . n 
A 1 309 GLU 309 320 320 GLU GLU A . n 
A 1 310 LYS 310 321 321 LYS LYS A . n 
A 1 311 PRO 311 322 322 PRO PRO A . n 
A 1 312 VAL 312 323 323 VAL VAL A . n 
A 1 313 GLU 313 324 324 GLU GLU A . n 
A 1 314 ALA 314 325 325 ALA ALA A . n 
A 1 315 ILE 315 326 326 ILE ILE A . n 
A 1 316 ARG 316 327 327 ARG ARG A . n 
A 1 317 VAL 317 328 328 VAL VAL A . n 
A 1 318 CYS 318 329 329 CYS CYS A . n 
A 1 319 SER 319 330 330 SER SER A . n 
A 1 320 GLU 320 331 331 GLU GLU A . n 
A 1 321 VAL 321 332 332 VAL VAL A . n 
A 1 322 LEU 322 333 333 LEU LEU A . n 
A 1 323 GLN 323 334 334 GLN GLN A . n 
A 1 324 MSE 324 335 335 MSE MSE A . n 
A 1 325 GLU 325 336 336 GLU GLU A . n 
A 1 326 PRO 326 337 337 PRO PRO A . n 
A 1 327 ASP 327 338 338 ASP ASP A . n 
A 1 328 ASN 328 339 339 ASN ASN A . n 
A 1 329 VAL 329 340 340 VAL VAL A . n 
A 1 330 ASN 330 341 341 ASN ASN A . n 
A 1 331 ALA 331 342 342 ALA ALA A . n 
A 1 332 LEU 332 343 343 LEU LEU A . n 
A 1 333 LYS 333 344 344 LYS LYS A . n 
A 1 334 ASP 334 345 345 ASP ASP A . n 
A 1 335 ARG 335 346 346 ARG ARG A . n 
A 1 336 ALA 336 347 347 ALA ALA A . n 
A 1 337 GLU 337 348 348 GLU GLU A . n 
A 1 338 ALA 338 349 349 ALA ALA A . n 
A 1 339 TYR 339 350 350 TYR TYR A . n 
A 1 340 LEU 340 351 351 LEU LEU A . n 
A 1 341 ILE 341 352 352 ILE ILE A . n 
A 1 342 GLU 342 353 353 GLU GLU A . n 
A 1 343 GLU 343 354 354 GLU GLU A . n 
A 1 344 MSE 344 355 355 MSE MSE A . n 
A 1 345 TYR 345 356 356 TYR TYR A . n 
A 1 346 ASP 346 357 357 ASP ASP A . n 
A 1 347 GLU 347 358 358 GLU GLU A . n 
A 1 348 ALA 348 359 359 ALA ALA A . n 
A 1 349 ILE 349 360 360 ILE ILE A . n 
A 1 350 GLN 350 361 361 GLN GLN A . n 
A 1 351 ASP 351 362 362 ASP ASP A . n 
A 1 352 TYR 352 363 363 TYR TYR A . n 
A 1 353 GLU 353 364 364 GLU GLU A . n 
A 1 354 THR 354 365 365 THR THR A . n 
A 1 355 ALA 355 366 366 ALA ALA A . n 
A 1 356 GLN 356 367 367 GLN GLN A . n 
A 1 357 GLU 357 368 368 GLU GLU A . n 
A 1 358 HIS 358 369 369 HIS HIS A . n 
A 1 359 ASN 359 370 370 ASN ASN A . n 
A 1 360 GLU 360 371 371 GLU GLU A . n 
A 1 361 ASN 361 372 372 ASN ASN A . n 
A 1 362 ASP 362 373 373 ASP ASP A . n 
A 1 363 GLN 363 374 374 GLN GLN A . n 
A 1 364 GLN 364 375 375 GLN GLN A . n 
A 1 365 ILE 365 376 376 ILE ILE A . n 
A 1 366 ARG 366 377 377 ARG ARG A . n 
A 1 367 GLU 367 378 378 GLU GLU A . n 
A 1 368 GLY 368 379 379 GLY GLY A . n 
A 1 369 LEU 369 380 380 LEU LEU A . n 
A 1 370 GLU 370 381 381 GLU GLU A . n 
A 1 371 LYS 371 382 382 LYS LYS A . n 
A 1 372 ALA 372 383 383 ALA ALA A . n 
A 1 373 GLN 373 384 384 GLN GLN A . n 
A 1 374 ARG 374 385 385 ARG ARG A . n 
A 1 375 LEU 375 386 386 LEU LEU A . n 
A 1 376 LEU 376 387 387 LEU LEU A . n 
A 1 377 LYS 377 388 388 LYS LYS A . n 
A 1 378 GLN 378 389 389 GLN GLN A . n 
A 1 379 SER 379 390 390 SER SER A . n 
A 1 380 GLN 380 391 391 GLN GLN A . n 
A 1 381 LYS 381 392 392 LYS LYS A . n 
A 1 382 ARG 382 393 393 ARG ARG A . n 
A 1 383 ASP 383 394 394 ASP ASP A . n 
A 1 384 TYR 384 395 395 TYR TYR A . n 
A 1 385 TYR 385 396 396 TYR TYR A . n 
A 1 386 LYS 386 397 397 LYS LYS A . n 
A 1 387 ILE 387 398 398 ILE ILE A . n 
A 1 388 LEU 388 399 399 LEU LEU A . n 
A 1 389 GLY 389 400 400 GLY GLY A . n 
A 1 390 VAL 390 401 401 VAL VAL A . n 
A 1 391 LYS 391 402 402 LYS LYS A . n 
A 1 392 ARG 392 403 403 ARG ARG A . n 
A 1 393 ASN 393 404 404 ASN ASN A . n 
A 1 394 ALA 394 405 405 ALA ALA A . n 
A 1 395 LYS 395 406 406 LYS LYS A . n 
A 1 396 LYS 396 407 407 LYS LYS A . n 
A 1 397 GLN 397 408 408 GLN GLN A . n 
A 1 398 GLU 398 409 409 GLU GLU A . n 
A 1 399 ILE 399 410 410 ILE ILE A . n 
A 1 400 ILE 400 411 411 ILE ILE A . n 
A 1 401 LYS 401 412 412 LYS LYS A . n 
A 1 402 ALA 402 413 413 ALA ALA A . n 
A 1 403 TYR 403 414 414 TYR TYR A . n 
A 1 404 ARG 404 415 415 ARG ARG A . n 
A 1 405 LYS 405 416 416 LYS LYS A . n 
A 1 406 LEU 406 417 417 LEU LEU A . n 
A 1 407 ALA 407 418 418 ALA ALA A . n 
A 1 408 LEU 408 419 419 LEU LEU A . n 
A 1 409 GLN 409 420 420 GLN GLN A . n 
A 1 410 TRP 410 421 421 TRP TRP A . n 
A 1 411 HIS 411 422 422 HIS HIS A . n 
A 1 412 PRO 412 423 423 PRO PRO A . n 
A 1 413 ASP 413 424 424 ASP ASP A . n 
A 1 414 ASN 414 425 425 ASN ASN A . n 
A 1 415 PHE 415 426 426 PHE PHE A . n 
A 1 416 GLN 416 427 427 GLN GLN A . n 
A 1 417 ASN 417 428 428 ASN ASN A . n 
A 1 418 GLU 418 429 429 GLU GLU A . n 
A 1 419 GLU 419 430 430 GLU GLU A . n 
A 1 420 GLU 420 431 431 GLU GLU A . n 
A 1 421 LYS 421 432 432 LYS LYS A . n 
A 1 422 LYS 422 433 433 LYS LYS A . n 
A 1 423 LYS 423 434 434 LYS LYS A . n 
A 1 424 ALA 424 435 435 ALA ALA A . n 
A 1 425 GLU 425 436 436 GLU GLU A . n 
A 1 426 LYS 426 437 437 LYS LYS A . n 
A 1 427 LYS 427 438 438 LYS LYS A . n 
A 1 428 PHE 428 439 439 PHE PHE A . n 
A 1 429 ILE 429 440 440 ILE ILE A . n 
A 1 430 ASP 430 441 441 ASP ASP A . n 
A 1 431 ILE 431 442 442 ILE ILE A . n 
A 1 432 ALA 432 443 443 ALA ALA A . n 
A 1 433 ALA 433 444 444 ALA ALA A . n 
A 1 434 ALA 434 445 445 ALA ALA A . n 
A 1 435 LYS 435 446 446 LYS LYS A . n 
A 1 436 GLU 436 447 447 GLU GLU A . n 
A 1 437 VAL 437 448 448 VAL VAL A . n 
A 1 438 LEU 438 449 449 LEU LEU A . n 
A 1 439 SER 439 450 450 SER SER A . n 
A 1 440 ASP 440 451 451 ASP ASP A . n 
A 1 441 PRO 441 452 452 PRO PRO A . n 
A 1 442 GLU 442 453 453 GLU GLU A . n 
A 1 443 MSE 443 454 454 MSE MSE A . n 
A 1 444 ARG 444 455 455 ARG ARG A . n 
A 1 445 LYS 445 456 ?   ?   ?   A . n 
A 1 446 LYS 446 457 ?   ?   ?   A . n 
A 1 447 PHE 447 458 ?   ?   ?   A . n 
A 1 448 ASP 448 459 ?   ?   ?   A . n 
A 1 449 ASP 449 460 ?   ?   ?   A . n 
A 1 450 GLY 450 461 ?   ?   ?   A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 23  A MSE 34  ? MET SELENOMETHIONINE 
2 A MSE 73  A MSE 84  ? MET SELENOMETHIONINE 
3 A MSE 91  A MSE 102 ? MET SELENOMETHIONINE 
4 A MSE 143 A MSE 154 ? MET SELENOMETHIONINE 
5 A MSE 284 A MSE 295 ? MET SELENOMETHIONINE 
6 A MSE 324 A MSE 335 ? MET SELENOMETHIONINE 
7 A MSE 344 A MSE 355 ? MET SELENOMETHIONINE 
8 A MSE 443 A MSE 454 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 software_defined_assembly PISA trimeric  3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A 
2 1,2,3 A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 6820  ? 
2 MORE         -19.8 ? 
2 'SSA (A^2)'  67440 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
1.0000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_455 -y-1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 -124.6200000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038  0.0000000000 -62.3100000000  -0.8660254038 
-0.5000000000 0.0000000000 -107.9240858196 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2011-08-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -34.6234 
_pdbx_refine_tls.origin_y         -32.9860 
_pdbx_refine_tls.origin_z         -22.5066 
_pdbx_refine_tls.T[1][1]          0.3079 
_pdbx_refine_tls.T[2][2]          0.3633 
_pdbx_refine_tls.T[3][3]          0.3016 
_pdbx_refine_tls.T[1][2]          -0.0805 
_pdbx_refine_tls.T[1][3]          0.1064 
_pdbx_refine_tls.T[2][3]          0.1218 
_pdbx_refine_tls.L[1][1]          0.2456 
_pdbx_refine_tls.L[2][2]          0.7900 
_pdbx_refine_tls.L[3][3]          0.0340 
_pdbx_refine_tls.L[1][2]          0.0587 
_pdbx_refine_tls.L[1][3]          -0.0135 
_pdbx_refine_tls.L[2][3]          0.0719 
_pdbx_refine_tls.S[1][1]          -0.0013 
_pdbx_refine_tls.S[1][2]          0.2734 
_pdbx_refine_tls.S[1][3]          0.0402 
_pdbx_refine_tls.S[2][1]          0.0171 
_pdbx_refine_tls.S[2][2]          -0.0606 
_pdbx_refine_tls.S[2][3]          -0.2108 
_pdbx_refine_tls.S[3][1]          0.0336 
_pdbx_refine_tls.S[3][2]          -0.0127 
_pdbx_refine_tls.S[3][3]          0.0619 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     32 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     455 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0110 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHASER phasing          .        ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   PHE 
_pdbx_validate_close_contact.auth_seq_id_1    81 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   MSE 
_pdbx_validate_close_contact.auth_seq_id_2    84 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CE2 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_1             421 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            TRP 
_pdbx_validate_rmsd_bond.auth_seq_id_2             421 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.317 
_pdbx_validate_rmsd_bond.bond_target_value         1.409 
_pdbx_validate_rmsd_bond.bond_deviation            -0.092 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              455 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              455 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              455 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                116.95 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MSE A 34  ? ? -91.39  32.70   
2  1 LEU A 53  ? ? 60.76   -73.99  
3  1 LYS A 101 ? ? -113.34 71.54   
4  1 PHE A 104 ? ? -58.93  101.26  
5  1 GLU A 138 ? ? 39.72   -145.05 
6  1 CYS A 184 ? ? -102.99 78.92   
7  1 GLU A 203 ? ? -118.66 67.29   
8  1 ASN A 219 ? ? 68.19   -44.41  
9  1 ASP A 237 ? ? -68.31  65.57   
10 1 MSE A 355 ? ? -110.13 75.44   
11 1 LEU A 399 ? ? -148.72 -74.14  
12 1 PRO A 423 ? ? -41.18  -18.81  
13 1 ASP A 451 ? ? 63.35   -149.71 
14 1 MSE A 454 ? ? 99.36   -34.76  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MSE 12  ? A MSE 1   
2  1 Y 1 A HIS 13  ? A HIS 2   
3  1 Y 1 A HIS 14  ? A HIS 3   
4  1 Y 1 A HIS 15  ? A HIS 4   
5  1 Y 1 A HIS 16  ? A HIS 5   
6  1 Y 1 A HIS 17  ? A HIS 6   
7  1 Y 1 A HIS 18  ? A HIS 7   
8  1 Y 1 A SER 19  ? A SER 8   
9  1 Y 1 A SER 20  ? A SER 9   
10 1 Y 1 A GLY 21  ? A GLY 10  
11 1 Y 1 A VAL 22  ? A VAL 11  
12 1 Y 1 A ASP 23  ? A ASP 12  
13 1 Y 1 A LEU 24  ? A LEU 13  
14 1 Y 1 A GLY 25  ? A GLY 14  
15 1 Y 1 A THR 26  ? A THR 15  
16 1 Y 1 A GLU 27  ? A GLU 16  
17 1 Y 1 A ASN 28  ? A ASN 17  
18 1 Y 1 A LEU 29  ? A LEU 18  
19 1 Y 1 A TYR 30  ? A TYR 19  
20 1 Y 1 A PHE 31  ? A PHE 20  
21 1 Y 1 A LYS 456 ? A LYS 445 
22 1 Y 1 A LYS 457 ? A LYS 446 
23 1 Y 1 A PHE 458 ? A PHE 447 
24 1 Y 1 A ASP 459 ? A ASP 448 
25 1 Y 1 A ASP 460 ? A ASP 449 
26 1 Y 1 A GLY 461 ? A GLY 450 
#