data_2Y92
# 
_entry.id   2Y92 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y92         
PDBE  EBI-47358    
WWPDB D_1290047358 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y92 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Valkov, E.'   1 
'Stamp, A.'    2 
'Martin, J.L.' 3 
'Kobe, B.'     4 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of Toll-Like Receptor Adaptor Mal/Tirap Reveals the Molecular Basis for Signal Transduction and Disease Protection.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                14879 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21873236 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1104780108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Valkov, E.'   1  
primary 'Stamp, A.'    2  
primary 'Dimaio, F.'   3  
primary 'Baker, D.'    4  
primary 'Verstak, B.'  5  
primary 'Roversi, P.'  6  
primary 'Kellie, S.'   7  
primary 'Sweet, M.J.'  8  
primary 'Mansell, A.'  9  
primary 'Gay, N.J.'    10 
primary 'Martin, J.L.' 11 
primary 'Kobe, B.'     12 
# 
_cell.entry_id           2Y92 
_cell.length_a           88.146 
_cell.length_b           88.146 
_cell.length_c           78.793 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y92 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TOLL/INTERLEUKIN-1 RECEPTOR DOMAIN-CONTAINING ADAPTER PROTEIN,' 15913.106 1 ? ? 'TIR DOMAIN, RESIDUES 79-221' 
'C91 AND C157 MODIFIED BY DITHIOTHREITOL (DTT)' 
2 non-polymer syn 2,3-DIHYDROXY-1,4-DITHIOBUTANE                                   154.251   1 ? ? ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TIR DOMAIN-CONTAINING ADAPTER PROTEIN, ADAPTOR PROTEIN WYATT, MYD88 ADAPTER-LIKE PROTEIN, MAL' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
CKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW
CKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   SER n 
1 4   SER n 
1 5   ARG n 
1 6   TRP n 
1 7   SER n 
1 8   LYS n 
1 9   ASP n 
1 10  TYR n 
1 11  ASP n 
1 12  VAL n 
1 13  CYS n 
1 14  VAL n 
1 15  CYS n 
1 16  HIS n 
1 17  SER n 
1 18  GLU n 
1 19  GLU n 
1 20  ASP n 
1 21  LEU n 
1 22  VAL n 
1 23  ALA n 
1 24  ALA n 
1 25  GLN n 
1 26  ASP n 
1 27  LEU n 
1 28  VAL n 
1 29  SER n 
1 30  TYR n 
1 31  LEU n 
1 32  GLU n 
1 33  GLY n 
1 34  SER n 
1 35  THR n 
1 36  ALA n 
1 37  SER n 
1 38  LEU n 
1 39  ARG n 
1 40  CYS n 
1 41  PHE n 
1 42  LEU n 
1 43  GLN n 
1 44  LEU n 
1 45  ARG n 
1 46  ASP n 
1 47  ALA n 
1 48  THR n 
1 49  PRO n 
1 50  GLY n 
1 51  GLY n 
1 52  ALA n 
1 53  ILE n 
1 54  VAL n 
1 55  SER n 
1 56  GLU n 
1 57  LEU n 
1 58  CYS n 
1 59  GLN n 
1 60  ALA n 
1 61  LEU n 
1 62  SER n 
1 63  SER n 
1 64  SER n 
1 65  HIS n 
1 66  CYS n 
1 67  ARG n 
1 68  VAL n 
1 69  LEU n 
1 70  LEU n 
1 71  ILE n 
1 72  THR n 
1 73  PRO n 
1 74  GLY n 
1 75  PHE n 
1 76  LEU n 
1 77  GLN n 
1 78  ASP n 
1 79  PRO n 
1 80  TRP n 
1 81  CYS n 
1 82  LYS n 
1 83  TYR n 
1 84  GLN n 
1 85  MET n 
1 86  LEU n 
1 87  GLN n 
1 88  ALA n 
1 89  LEU n 
1 90  THR n 
1 91  GLU n 
1 92  ALA n 
1 93  PRO n 
1 94  GLY n 
1 95  ALA n 
1 96  GLU n 
1 97  GLY n 
1 98  CYS n 
1 99  THR n 
1 100 ILE n 
1 101 PRO n 
1 102 LEU n 
1 103 LEU n 
1 104 SER n 
1 105 GLY n 
1 106 LEU n 
1 107 SER n 
1 108 ARG n 
1 109 ALA n 
1 110 ALA n 
1 111 TYR n 
1 112 PRO n 
1 113 PRO n 
1 114 GLU n 
1 115 LEU n 
1 116 ARG n 
1 117 PHE n 
1 118 MET n 
1 119 TYR n 
1 120 TYR n 
1 121 VAL n 
1 122 ASP n 
1 123 GLY n 
1 124 ARG n 
1 125 GLY n 
1 126 PRO n 
1 127 ASP n 
1 128 GLY n 
1 129 GLY n 
1 130 PHE n 
1 131 ARG n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 GLU n 
1 136 ALA n 
1 137 VAL n 
1 138 MET n 
1 139 ARG n 
1 140 TYR n 
1 141 LEU n 
1 142 GLN n 
1 143 THR n 
1 144 LEU n 
1 145 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TIRAP_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P58753 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2Y92 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 145 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P58753 
_struct_ref_seq.db_align_beg                  79 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  221 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       79 
_struct_ref_seq.pdbx_auth_seq_align_end       221 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2Y92 GLY A 1 ? UNP P58753 ? ? 'expression tag' 77 1 
1 2Y92 PRO A 2 ? UNP P58753 ? ? 'expression tag' 78 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                        ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                       ?                  'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                       ?                  'C3 H7 N O2 S'   121.158 
DTT non-polymer         . 2,3-DIHYDROXY-1,4-DITHIOBUTANE 1,4-DITHIOTHREITOL 'C4 H10 O2 S2'   154.251 
GLN 'L-peptide linking' y GLUTAMINE                      ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                        ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                      ?                  'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                     ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                        ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                         ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                     ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                  ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                        ?                  'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                         ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                      ?                  'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                     ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                       ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                         ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Y92 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.81 
_exptl_crystal.density_percent_sol   77 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0722 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_wavelength             1.0722 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y92 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   6390 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.50 
_reflns.B_iso_Wilson_estimate        112.82 
_reflns.pdbx_redundancy              13.7 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.01 
_reflns_shell.d_res_low              3.37 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y92 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     6390 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.88 
_refine.ls_d_res_high                            3.01 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2310 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2300 
_refine.ls_R_factor_R_free                       0.2506 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.79 
_refine.ls_number_reflns_R_free                  306 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9201 
_refine.correlation_coeff_Fo_to_Fc_free          0.8969 
_refine.B_iso_mean                               94.99 
_refine.aniso_B[1][1]                            0.9298 
_refine.aniso_B[2][2]                            0.9298 
_refine.aniso_B[3][3]                            -1.8596 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'IDEAL-DIST CONTACT TERM CONTACT SETUP. ALL ATOMS HAVE CCP4 ATOM TYPE FROM LIBRARY' 
_refine.pdbx_starting_model                      'PDB ENTRY 2Z5V' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2Y92 
_refine_analyze.Luzzati_coordinate_error_obs    0.753 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        981 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               989 
_refine_hist.d_res_high                       3.01 
_refine_hist.d_res_low                        48.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.007 ? 2.00  1012 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.89  ? 2.00  1371 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  345  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  22   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  145  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 1005 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           1.56  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           19.86 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  126  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  1050 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.d_res_high                       3.01 
_refine_ls_shell.d_res_low                        3.37 
_refine_ls_shell.number_reflns_R_work             1661 
_refine_ls_shell.R_factor_R_work                  0.2712 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2857 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.60 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                1741 
_refine_ls_shell.R_factor_all                     0.2718 
# 
_struct.entry_id                  2Y92 
_struct.title                     'Crystal structure of MAL adaptor protein' 
_struct.pdbx_descriptor           'TOLL/INTERLEUKIN-1 RECEPTOR DOMAIN-CONTAINING ADAPTER PROTEIN,' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y92 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNE SYSTEM, TOLL-LIKE RECEPTOR SIGNALING, INNATE IMMUNITY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 21  ? GLU A 32  ? LEU A 97  GLU A 108 1 ? 12 
HELX_P HELX_P2 2 PRO A 73  ? GLN A 77  ? PRO A 149 GLN A 153 1 ? 5  
HELX_P HELX_P3 3 PRO A 79  ? LEU A 89  ? PRO A 155 LEU A 165 1 ? 11 
HELX_P HELX_P4 4 PHE A 130 ? THR A 143 ? PHE A 206 THR A 219 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 89  A CYS 134 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 98 SG ? ? A CYS 142 A CYS 174 1_555 ? ? ? ? ? ? ? 2.035 ? 
covale1 covale ? ? A CYS 15 SG ? ? ? 1_555 B DTT .  S4 ? ? A CYS 91  A DTT 300 1_555 ? ? ? ? ? ? ? 1.594 ? 
covale2 covale ? ? A CYS 81 SG ? ? ? 1_555 B DTT .  S1 ? ? A CYS 157 A DTT 300 1_555 ? ? ? ? ? ? ? 1.802 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1 ? 1 ? 
2 ? 1 ? 
3 ? 1 ? 
4 ? 1 ? 
5 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1 1 TYR A 10  ? CYS A 15  ? TYR A 86  CYS A 91  
2 1 SER A 55  ? LEU A 57  ? SER A 131 LEU A 133 
3 1 SER A 64  ? ILE A 71  ? SER A 140 ILE A 147 
4 1 THR A 99  ? LEU A 103 ? THR A 175 LEU A 179 
5 1 VAL A 121 ? ASP A 122 ? VAL A 197 ASP A 198 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE DTT A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 CYS A 15 ? CYS A 91  . ? 1_555 ? 
2 AC1 5 HIS A 16 ? HIS A 92  . ? 1_555 ? 
3 AC1 5 ARG A 67 ? ARG A 143 . ? 1_555 ? 
4 AC1 5 CYS A 81 ? CYS A 157 . ? 1_555 ? 
5 AC1 5 GLN A 84 ? GLN A 160 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y92 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y92 
_atom_sites.fract_transf_matrix[1][1]   0.011345 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011345 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012691 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . SER A 1 3   ? -25.953 42.917 -15.572 1.00 109.54 ? 79  SER A N   1 
ATOM   2   C CA  . SER A 1 3   ? -26.713 44.160 -15.694 1.00 115.64 ? 79  SER A CA  1 
ATOM   3   C C   . SER A 1 3   ? -26.168 45.267 -14.785 1.00 117.61 ? 79  SER A C   1 
ATOM   4   O O   . SER A 1 3   ? -26.164 46.434 -15.183 1.00 122.58 ? 79  SER A O   1 
ATOM   5   C CB  . SER A 1 3   ? -28.192 43.917 -15.408 1.00 123.04 ? 79  SER A CB  1 
ATOM   6   O OG  . SER A 1 3   ? -28.771 43.063 -16.381 1.00 135.57 ? 79  SER A OG  1 
ATOM   7   N N   . SER A 1 4   ? -25.724 44.899 -13.567 1.00 107.36 ? 80  SER A N   1 
ATOM   8   C CA  . SER A 1 4   ? -25.165 45.815 -12.568 1.00 105.44 ? 80  SER A CA  1 
ATOM   9   C C   . SER A 1 4   ? -24.125 45.097 -11.712 1.00 102.17 ? 80  SER A C   1 
ATOM   10  O O   . SER A 1 4   ? -24.321 43.931 -11.368 1.00 98.41  ? 80  SER A O   1 
ATOM   11  C CB  . SER A 1 4   ? -26.270 46.380 -11.680 1.00 111.64 ? 80  SER A CB  1 
ATOM   12  O OG  . SER A 1 4   ? -25.759 47.296 -10.725 1.00 119.50 ? 80  SER A OG  1 
ATOM   13  N N   . ARG A 1 5   ? -23.028 45.796 -11.361 1.00 97.14  ? 81  ARG A N   1 
ATOM   14  C CA  . ARG A 1 5   ? -21.952 45.245 -10.530 1.00 90.92  ? 81  ARG A CA  1 
ATOM   15  C C   . ARG A 1 5   ? -22.414 45.056 -9.077  1.00 92.44  ? 81  ARG A C   1 
ATOM   16  O O   . ARG A 1 5   ? -21.960 44.131 -8.402  1.00 87.58  ? 81  ARG A O   1 
ATOM   17  C CB  . ARG A 1 5   ? -20.699 46.137 -10.594 1.00 91.67  ? 81  ARG A CB  1 
ATOM   18  C CG  . ARG A 1 5   ? -19.422 45.432 -10.149 1.00 96.26  ? 81  ARG A CG  1 
ATOM   19  C CD  . ARG A 1 5   ? -18.240 46.373 -10.062 1.00 106.84 ? 81  ARG A CD  1 
ATOM   20  N NE  . ARG A 1 5   ? -17.102 45.742 -9.391  1.00 109.30 ? 81  ARG A NE  1 
ATOM   21  C CZ  . ARG A 1 5   ? -15.906 46.303 -9.243  1.00 124.58 ? 81  ARG A CZ  1 
ATOM   22  N NH1 . ARG A 1 5   ? -15.670 47.518 -9.726  1.00 119.82 ? 81  ARG A NH1 1 
ATOM   23  N NH2 . ARG A 1 5   ? -14.935 45.653 -8.616  1.00 106.55 ? 81  ARG A NH2 1 
ATOM   24  N N   . TRP A 1 6   ? -23.328 45.923 -8.611  1.00 92.90  ? 82  TRP A N   1 
ATOM   25  C CA  . TRP A 1 6   ? -23.871 45.895 -7.253  1.00 92.40  ? 82  TRP A CA  1 
ATOM   26  C C   . TRP A 1 6   ? -24.990 44.858 -7.032  1.00 96.17  ? 82  TRP A C   1 
ATOM   27  O O   . TRP A 1 6   ? -25.411 44.657 -5.890  1.00 95.71  ? 82  TRP A O   1 
ATOM   28  C CB  . TRP A 1 6   ? -24.300 47.310 -6.824  1.00 96.46  ? 82  TRP A CB  1 
ATOM   29  C CG  . TRP A 1 6   ? -23.169 48.219 -6.418  1.00 97.75  ? 82  TRP A CG  1 
ATOM   30  C CD1 . TRP A 1 6   ? -21.831 47.960 -6.497  1.00 97.07  ? 82  TRP A CD1 1 
ATOM   31  C CD2 . TRP A 1 6   ? -23.290 49.536 -5.862  1.00 102.81 ? 82  TRP A CD2 1 
ATOM   32  N NE1 . TRP A 1 6   ? -21.111 49.032 -6.026  1.00 99.35  ? 82  TRP A NE1 1 
ATOM   33  C CE2 . TRP A 1 6   ? -21.981 50.014 -5.627  1.00 106.22 ? 82  TRP A CE2 1 
ATOM   34  C CE3 . TRP A 1 6   ? -24.380 50.361 -5.534  1.00 109.82 ? 82  TRP A CE3 1 
ATOM   35  C CZ2 . TRP A 1 6   ? -21.733 51.279 -5.082  1.00 110.78 ? 82  TRP A CZ2 1 
ATOM   36  C CZ3 . TRP A 1 6   ? -24.132 51.615 -4.999  1.00 116.29 ? 82  TRP A CZ3 1 
ATOM   37  C CH2 . TRP A 1 6   ? -22.823 52.057 -4.764  1.00 116.42 ? 82  TRP A CH2 1 
ATOM   38  N N   . SER A 1 7   ? -25.449 44.187 -8.113  1.00 93.67  ? 83  SER A N   1 
ATOM   39  C CA  . SER A 1 7   ? -26.498 43.159 -8.063  1.00 94.56  ? 83  SER A CA  1 
ATOM   40  C C   . SER A 1 7   ? -26.042 41.915 -7.290  1.00 94.07  ? 83  SER A C   1 
ATOM   41  O O   . SER A 1 7   ? -26.841 41.322 -6.562  1.00 95.31  ? 83  SER A O   1 
ATOM   42  C CB  . SER A 1 7   ? -26.945 42.775 -9.470  1.00 100.50 ? 83  SER A CB  1 
ATOM   43  O OG  . SER A 1 7   ? -25.909 42.124 -10.188 1.00 105.58 ? 83  SER A OG  1 
ATOM   44  N N   . LYS A 1 8   ? -24.760 41.532 -7.450  1.00 85.79  ? 84  LYS A N   1 
ATOM   45  C CA  . LYS A 1 8   ? -24.139 40.391 -6.775  1.00 81.61  ? 84  LYS A CA  1 
ATOM   46  C C   . LYS A 1 8   ? -23.117 40.888 -5.752  1.00 83.47  ? 84  LYS A C   1 
ATOM   47  O O   . LYS A 1 8   ? -22.338 41.796 -6.052  1.00 82.55  ? 84  LYS A O   1 
ATOM   48  C CB  . LYS A 1 8   ? -23.487 39.444 -7.792  1.00 81.31  ? 84  LYS A CB  1 
ATOM   49  C CG  . LYS A 1 8   ? -24.481 38.512 -8.472  1.00 95.17  ? 84  LYS A CG  1 
ATOM   50  C CD  . LYS A 1 8   ? -23.944 37.985 -9.794  1.00 102.61 ? 84  LYS A CD  1 
ATOM   51  C CE  . LYS A 1 8   ? -24.710 36.791 -10.308 1.00 114.62 ? 84  LYS A CE  1 
ATOM   52  N NZ  . LYS A 1 8   ? -26.041 37.168 -10.854 1.00 129.17 ? 84  LYS A NZ  1 
ATOM   53  N N   . ASP A 1 9   ? -23.129 40.295 -4.543  1.00 79.92  ? 85  ASP A N   1 
ATOM   54  C CA  . ASP A 1 9   ? -22.253 40.661 -3.424  1.00 78.76  ? 85  ASP A CA  1 
ATOM   55  C C   . ASP A 1 9   ? -20.755 40.378 -3.614  1.00 79.36  ? 85  ASP A C   1 
ATOM   56  O O   . ASP A 1 9   ? -19.934 40.937 -2.881  1.00 78.93  ? 85  ASP A O   1 
ATOM   57  C CB  . ASP A 1 9   ? -22.789 40.101 -2.094  1.00 82.52  ? 85  ASP A CB  1 
ATOM   58  C CG  . ASP A 1 9   ? -24.059 40.770 -1.588  1.00 96.63  ? 85  ASP A CG  1 
ATOM   59  O OD1 . ASP A 1 9   ? -24.576 41.679 -2.282  1.00 98.67  ? 85  ASP A OD1 1 
ATOM   60  O OD2 . ASP A 1 9   ? -24.535 40.389 -0.499  1.00 105.42 ? 85  ASP A OD2 1 
ATOM   61  N N   . TYR A 1 10  ? -20.399 39.540 -4.601  1.00 73.99  ? 86  TYR A N   1 
ATOM   62  C CA  . TYR A 1 10  ? -19.010 39.205 -4.914  1.00 71.13  ? 86  TYR A CA  1 
ATOM   63  C C   . TYR A 1 10  ? -18.712 39.350 -6.401  1.00 75.52  ? 86  TYR A C   1 
ATOM   64  O O   . TYR A 1 10  ? -19.613 39.207 -7.228  1.00 76.56  ? 86  TYR A O   1 
ATOM   65  C CB  . TYR A 1 10  ? -18.655 37.794 -4.416  1.00 70.61  ? 86  TYR A CB  1 
ATOM   66  C CG  . TYR A 1 10  ? -18.482 37.713 -2.915  1.00 73.21  ? 86  TYR A CG  1 
ATOM   67  C CD1 . TYR A 1 10  ? -17.280 38.073 -2.313  1.00 74.62  ? 86  TYR A CD1 1 
ATOM   68  C CD2 . TYR A 1 10  ? -19.518 37.276 -2.096  1.00 76.45  ? 86  TYR A CD2 1 
ATOM   69  C CE1 . TYR A 1 10  ? -17.116 38.010 -0.929  1.00 77.32  ? 86  TYR A CE1 1 
ATOM   70  C CE2 . TYR A 1 10  ? -19.364 37.202 -0.712  1.00 79.37  ? 86  TYR A CE2 1 
ATOM   71  C CZ  . TYR A 1 10  ? -18.157 37.561 -0.134  1.00 85.93  ? 86  TYR A CZ  1 
ATOM   72  O OH  . TYR A 1 10  ? -17.999 37.492 1.229   1.00 89.46  ? 86  TYR A OH  1 
ATOM   73  N N   . ASP A 1 11  ? -17.451 39.654 -6.738  1.00 71.99  ? 87  ASP A N   1 
ATOM   74  C CA  . ASP A 1 11  ? -17.010 39.809 -8.124  1.00 72.85  ? 87  ASP A CA  1 
ATOM   75  C C   . ASP A 1 11  ? -16.476 38.487 -8.677  1.00 76.18  ? 87  ASP A C   1 
ATOM   76  O O   . ASP A 1 11  ? -16.841 38.103 -9.787  1.00 76.71  ? 87  ASP A O   1 
ATOM   77  C CB  . ASP A 1 11  ? -15.960 40.931 -8.252  1.00 76.04  ? 87  ASP A CB  1 
ATOM   78  C CG  . ASP A 1 11  ? -16.464 42.320 -7.898  1.00 88.13  ? 87  ASP A CG  1 
ATOM   79  O OD1 . ASP A 1 11  ? -17.552 42.703 -8.386  1.00 95.69  ? 87  ASP A OD1 1 
ATOM   80  O OD2 . ASP A 1 11  ? -15.759 43.034 -7.157  1.00 89.70  ? 87  ASP A OD2 1 
ATOM   81  N N   . VAL A 1 12  ? -15.612 37.795 -7.900  1.00 72.02  ? 88  VAL A N   1 
ATOM   82  C CA  . VAL A 1 12  ? -15.003 36.515 -8.282  1.00 71.35  ? 88  VAL A CA  1 
ATOM   83  C C   . VAL A 1 12  ? -15.286 35.412 -7.260  1.00 76.11  ? 88  VAL A C   1 
ATOM   84  O O   . VAL A 1 12  ? -15.451 35.684 -6.069  1.00 76.00  ? 88  VAL A O   1 
ATOM   85  C CB  . VAL A 1 12  ? -13.480 36.590 -8.598  1.00 75.27  ? 88  VAL A CB  1 
ATOM   86  C CG1 . VAL A 1 12  ? -13.110 35.630 -9.719  1.00 75.49  ? 88  VAL A CG1 1 
ATOM   87  C CG2 . VAL A 1 12  ? -13.032 38.000 -8.946  1.00 77.10  ? 88  VAL A CG2 1 
ATOM   88  N N   . CYS A 1 13  ? -15.306 34.162 -7.743  1.00 73.82  ? 89  CYS A N   1 
ATOM   89  C CA  . CYS A 1 13  ? -15.514 32.941 -6.974  1.00 74.38  ? 89  CYS A CA  1 
ATOM   90  C C   . CYS A 1 13  ? -14.462 31.941 -7.440  1.00 77.32  ? 89  CYS A C   1 
ATOM   91  O O   . CYS A 1 13  ? -14.252 31.807 -8.646  1.00 77.29  ? 89  CYS A O   1 
ATOM   92  C CB  . CYS A 1 13  ? -16.924 32.409 -7.207  1.00 77.07  ? 89  CYS A CB  1 
ATOM   93  S SG  . CYS A 1 13  ? -17.489 31.220 -5.966  1.00 83.49  ? 89  CYS A SG  1 
ATOM   94  N N   . VAL A 1 14  ? -13.795 31.248 -6.503  1.00 73.57  ? 90  VAL A N   1 
ATOM   95  C CA  . VAL A 1 14  ? -12.773 30.259 -6.863  1.00 73.81  ? 90  VAL A CA  1 
ATOM   96  C C   . VAL A 1 14  ? -13.230 28.830 -6.518  1.00 79.77  ? 90  VAL A C   1 
ATOM   97  O O   . VAL A 1 14  ? -13.209 28.432 -5.350  1.00 80.53  ? 90  VAL A O   1 
ATOM   98  C CB  . VAL A 1 14  ? -11.348 30.607 -6.337  1.00 77.12  ? 90  VAL A CB  1 
ATOM   99  C CG1 . VAL A 1 14  ? -10.324 29.560 -6.770  1.00 78.36  ? 90  VAL A CG1 1 
ATOM   100 C CG2 . VAL A 1 14  ? -10.910 31.992 -6.804  1.00 75.84  ? 90  VAL A CG2 1 
ATOM   101 N N   . CYS A 1 15  ? -13.664 28.073 -7.547  1.00 77.86  ? 91  CYS A N   1 
ATOM   102 C CA  . CYS A 1 15  ? -14.114 26.687 -7.408  1.00 81.22  ? 91  CYS A CA  1 
ATOM   103 C C   . CYS A 1 15  ? -12.914 25.747 -7.498  1.00 85.90  ? 91  CYS A C   1 
ATOM   104 O O   . CYS A 1 15  ? -12.199 25.745 -8.502  1.00 85.17  ? 91  CYS A O   1 
ATOM   105 C CB  . CYS A 1 15  ? -15.189 26.344 -8.437  1.00 83.88  ? 91  CYS A CB  1 
ATOM   106 S SG  . CYS A 1 15  ? -15.923 24.698 -8.224  1.00 93.67  ? 91  CYS A SG  1 
ATOM   107 N N   . HIS A 1 16  ? -12.682 24.974 -6.426  1.00 84.50  ? 92  HIS A N   1 
ATOM   108 C CA  . HIS A 1 16  ? -11.542 24.065 -6.305  1.00 86.59  ? 92  HIS A CA  1 
ATOM   109 C C   . HIS A 1 16  ? -11.883 22.788 -5.527  1.00 95.06  ? 92  HIS A C   1 
ATOM   110 O O   . HIS A 1 16  ? -12.836 22.775 -4.744  1.00 95.99  ? 92  HIS A O   1 
ATOM   111 C CB  . HIS A 1 16  ? -10.390 24.801 -5.592  1.00 85.64  ? 92  HIS A CB  1 
ATOM   112 C CG  . HIS A 1 16  ? -10.673 25.089 -4.147  1.00 89.72  ? 92  HIS A CG  1 
ATOM   113 N ND1 . HIS A 1 16  ? -11.589 26.054 -3.768  1.00 89.34  ? 92  HIS A ND1 1 
ATOM   114 C CD2 . HIS A 1 16  ? -10.161 24.513 -3.036  1.00 94.94  ? 92  HIS A CD2 1 
ATOM   115 C CE1 . HIS A 1 16  ? -11.609 26.029 -2.446  1.00 90.94  ? 92  HIS A CE1 1 
ATOM   116 N NE2 . HIS A 1 16  ? -10.762 25.122 -1.961  1.00 94.79  ? 92  HIS A NE2 1 
ATOM   117 N N   . SER A 1 17  ? -11.068 21.733 -5.716  1.00 94.85  ? 93  SER A N   1 
ATOM   118 C CA  . SER A 1 17  ? -11.198 20.467 -4.993  1.00 100.65 ? 93  SER A CA  1 
ATOM   119 C C   . SER A 1 17  ? -10.476 20.603 -3.643  1.00 105.35 ? 93  SER A C   1 
ATOM   120 O O   . SER A 1 17  ? -9.637  21.494 -3.493  1.00 101.14 ? 93  SER A O   1 
ATOM   121 C CB  . SER A 1 17  ? -10.607 19.318 -5.805  1.00 108.40 ? 93  SER A CB  1 
ATOM   122 O OG  . SER A 1 17  ? -9.229  19.510 -6.076  1.00 116.36 ? 93  SER A OG  1 
ATOM   123 N N   . GLU A 1 18  ? -10.792 19.719 -2.671  1.00 107.91 ? 94  GLU A N   1 
ATOM   124 C CA  . GLU A 1 18  ? -10.211 19.712 -1.317  1.00 110.76 ? 94  GLU A CA  1 
ATOM   125 C C   . GLU A 1 18  ? -8.673  19.748 -1.250  1.00 114.27 ? 94  GLU A C   1 
ATOM   126 O O   . GLU A 1 18  ? -8.120  20.311 -0.302  1.00 113.94 ? 94  GLU A O   1 
ATOM   127 C CB  . GLU A 1 18  ? -10.784 18.566 -0.456  1.00 120.41 ? 94  GLU A CB  1 
ATOM   128 C CG  . GLU A 1 18  ? -10.562 17.165 -1.010  1.00 137.15 ? 94  GLU A CG  1 
ATOM   129 C CD  . GLU A 1 18  ? -10.808 16.036 -0.027  1.00 167.26 ? 94  GLU A CD  1 
ATOM   130 O OE1 . GLU A 1 18  ? -11.951 15.911 0.470   1.00 164.62 ? 94  GLU A OE1 1 
ATOM   131 O OE2 . GLU A 1 18  ? -9.855  15.270 0.242   1.00 165.49 ? 94  GLU A OE2 1 
ATOM   132 N N   . GLU A 1 19  ? -7.997  19.162 -2.256  1.00 111.21 ? 95  GLU A N   1 
ATOM   133 C CA  . GLU A 1 19  ? -6.536  19.089 -2.352  1.00 112.05 ? 95  GLU A CA  1 
ATOM   134 C C   . GLU A 1 19  ? -5.867  20.441 -2.635  1.00 109.78 ? 95  GLU A C   1 
ATOM   135 O O   . GLU A 1 19  ? -4.807  20.717 -2.073  1.00 110.81 ? 95  GLU A O   1 
ATOM   136 C CB  . GLU A 1 19  ? -6.109  18.057 -3.411  1.00 116.56 ? 95  GLU A CB  1 
ATOM   137 C CG  . GLU A 1 19  ? -6.500  16.624 -3.083  1.00 134.75 ? 95  GLU A CG  1 
ATOM   138 C CD  . GLU A 1 19  ? -5.994  15.555 -4.035  1.00 159.47 ? 95  GLU A CD  1 
ATOM   139 O OE1 . GLU A 1 19  ? -5.880  15.832 -5.251  1.00 148.65 ? 95  GLU A OE1 1 
ATOM   140 O OE2 . GLU A 1 19  ? -5.745  14.422 -3.564  1.00 161.59 ? 95  GLU A OE2 1 
ATOM   141 N N   . ASP A 1 20  ? -6.473  21.268 -3.512  1.00 100.48 ? 96  ASP A N   1 
ATOM   142 C CA  . ASP A 1 20  ? -5.926  22.567 -3.921  1.00 95.40  ? 96  ASP A CA  1 
ATOM   143 C C   . ASP A 1 20  ? -6.506  23.753 -3.135  1.00 95.61  ? 96  ASP A C   1 
ATOM   144 O O   . ASP A 1 20  ? -6.853  24.778 -3.728  1.00 90.64  ? 96  ASP A O   1 
ATOM   145 C CB  . ASP A 1 20  ? -6.083  22.780 -5.441  1.00 94.47  ? 96  ASP A CB  1 
ATOM   146 C CG  . ASP A 1 20  ? -6.009  21.517 -6.269  1.00 108.25 ? 96  ASP A CG  1 
ATOM   147 O OD1 . ASP A 1 20  ? -4.884  21.025 -6.502  1.00 111.78 ? 96  ASP A OD1 1 
ATOM   148 O OD2 . ASP A 1 20  ? -7.076  21.022 -6.687  1.00 114.70 ? 96  ASP A OD2 1 
ATOM   149 N N   . LEU A 1 21  ? -6.584  23.623 -1.798  1.00 95.16  ? 97  LEU A N   1 
ATOM   150 C CA  . LEU A 1 21  ? -7.099  24.674 -0.916  1.00 93.17  ? 97  LEU A CA  1 
ATOM   151 C C   . LEU A 1 21  ? -6.123  25.857 -0.825  1.00 95.01  ? 97  LEU A C   1 
ATOM   152 O O   . LEU A 1 21  ? -6.564  27.005 -0.897  1.00 91.02  ? 97  LEU A O   1 
ATOM   153 C CB  . LEU A 1 21  ? -7.423  24.102 0.482   1.00 98.53  ? 97  LEU A CB  1 
ATOM   154 C CG  . LEU A 1 21  ? -8.000  25.064 1.535   1.00 103.11 ? 97  LEU A CG  1 
ATOM   155 C CD1 . LEU A 1 21  ? -9.474  25.364 1.279   1.00 100.57 ? 97  LEU A CD1 1 
ATOM   156 C CD2 . LEU A 1 21  ? -7.829  24.500 2.930   1.00 112.82 ? 97  LEU A CD2 1 
ATOM   157 N N   . VAL A 1 22  ? -4.810  25.572 -0.690  1.00 94.76  ? 98  VAL A N   1 
ATOM   158 C CA  . VAL A 1 22  ? -3.735  26.570 -0.583  1.00 94.66  ? 98  VAL A CA  1 
ATOM   159 C C   . VAL A 1 22  ? -3.631  27.413 -1.867  1.00 94.77  ? 98  VAL A C   1 
ATOM   160 O O   . VAL A 1 22  ? -3.594  28.643 -1.782  1.00 92.73  ? 98  VAL A O   1 
ATOM   161 C CB  . VAL A 1 22  ? -2.371  25.939 -0.171  1.00 104.09 ? 98  VAL A CB  1 
ATOM   162 C CG1 . VAL A 1 22  ? -1.307  27.010 0.063   1.00 105.07 ? 98  VAL A CG1 1 
ATOM   163 C CG2 . VAL A 1 22  ? -2.517  25.059 1.069   1.00 109.26 ? 98  VAL A CG2 1 
ATOM   164 N N   . ALA A 1 23  ? -3.616  26.749 -3.046  1.00 90.74  ? 99  ALA A N   1 
ATOM   165 C CA  . ALA A 1 23  ? -3.534  27.387 -4.365  1.00 87.95  ? 99  ALA A CA  1 
ATOM   166 C C   . ALA A 1 23  ? -4.729  28.308 -4.645  1.00 88.18  ? 99  ALA A C   1 
ATOM   167 O O   . ALA A 1 23  ? -4.551  29.363 -5.256  1.00 86.54  ? 99  ALA A O   1 
ATOM   168 C CB  . ALA A 1 23  ? -3.418  26.330 -5.452  1.00 89.89  ? 99  ALA A CB  1 
ATOM   169 N N   . ALA A 1 24  ? -5.936  27.912 -4.182  1.00 83.64  ? 100 ALA A N   1 
ATOM   170 C CA  . ALA A 1 24  ? -7.172  28.683 -4.333  1.00 80.04  ? 100 ALA A CA  1 
ATOM   171 C C   . ALA A 1 24  ? -7.148  29.933 -3.453  1.00 82.77  ? 100 ALA A C   1 
ATOM   172 O O   . ALA A 1 24  ? -7.634  30.981 -3.879  1.00 80.20  ? 100 ALA A O   1 
ATOM   173 C CB  . ALA A 1 24  ? -8.373  27.820 -3.984  1.00 81.28  ? 100 ALA A CB  1 
ATOM   174 N N   . GLN A 1 25  ? -6.575  29.818 -2.234  1.00 81.70  ? 101 GLN A N   1 
ATOM   175 C CA  . GLN A 1 25  ? -6.435  30.914 -1.269  1.00 82.16  ? 101 GLN A CA  1 
ATOM   176 C C   . GLN A 1 25  ? -5.450  31.966 -1.779  1.00 85.68  ? 101 GLN A C   1 
ATOM   177 O O   . GLN A 1 25  ? -5.673  33.161 -1.569  1.00 84.55  ? 101 GLN A O   1 
ATOM   178 C CB  . GLN A 1 25  ? -5.991  30.380 0.102   1.00 87.90  ? 101 GLN A CB  1 
ATOM   179 C CG  . GLN A 1 25  ? -7.124  29.754 0.911   1.00 104.08 ? 101 GLN A CG  1 
ATOM   180 C CD  . GLN A 1 25  ? -6.625  29.003 2.122   1.00 129.39 ? 101 GLN A CD  1 
ATOM   181 O OE1 . GLN A 1 25  ? -5.859  28.037 2.021   1.00 127.89 ? 101 GLN A OE1 1 
ATOM   182 N NE2 . GLN A 1 25  ? -7.084  29.405 3.296   1.00 124.46 ? 101 GLN A NE2 1 
ATOM   183 N N   . ASP A 1 26  ? -4.371  31.517 -2.461  1.00 83.68  ? 102 ASP A N   1 
ATOM   184 C CA  . ASP A 1 26  ? -3.342  32.373 -3.056  1.00 84.86  ? 102 ASP A CA  1 
ATOM   185 C C   . ASP A 1 26  ? -3.917  33.185 -4.218  1.00 85.40  ? 102 ASP A C   1 
ATOM   186 O O   . ASP A 1 26  ? -3.533  34.341 -4.405  1.00 86.07  ? 102 ASP A O   1 
ATOM   187 C CB  . ASP A 1 26  ? -2.135  31.539 -3.524  1.00 89.88  ? 102 ASP A CB  1 
ATOM   188 C CG  . ASP A 1 26  ? -1.337  30.873 -2.413  1.00 105.48 ? 102 ASP A CG  1 
ATOM   189 O OD1 . ASP A 1 26  ? -1.398  31.357 -1.257  1.00 107.62 ? 102 ASP A OD1 1 
ATOM   190 O OD2 . ASP A 1 26  ? -0.620  29.891 -2.705  1.00 114.42 ? 102 ASP A OD2 1 
ATOM   191 N N   . LEU A 1 27  ? -4.849  32.579 -4.981  1.00 78.84  ? 103 LEU A N   1 
ATOM   192 C CA  . LEU A 1 27  ? -5.535  33.211 -6.106  1.00 76.52  ? 103 LEU A CA  1 
ATOM   193 C C   . LEU A 1 27  ? -6.510  34.284 -5.606  1.00 79.08  ? 103 LEU A C   1 
ATOM   194 O O   . LEU A 1 27  ? -6.568  35.364 -6.198  1.00 79.26  ? 103 LEU A O   1 
ATOM   195 C CB  . LEU A 1 27  ? -6.247  32.147 -6.971  1.00 75.01  ? 103 LEU A CB  1 
ATOM   196 C CG  . LEU A 1 27  ? -7.103  32.612 -8.164  1.00 78.25  ? 103 LEU A CG  1 
ATOM   197 C CD1 . LEU A 1 27  ? -6.307  33.458 -9.145  1.00 80.54  ? 103 LEU A CD1 1 
ATOM   198 C CD2 . LEU A 1 27  ? -7.699  31.431 -8.886  1.00 80.17  ? 103 LEU A CD2 1 
ATOM   199 N N   . VAL A 1 28  ? -7.252  33.995 -4.511  1.00 74.52  ? 104 VAL A N   1 
ATOM   200 C CA  . VAL A 1 28  ? -8.201  34.928 -3.889  1.00 73.47  ? 104 VAL A CA  1 
ATOM   201 C C   . VAL A 1 28  ? -7.443  36.176 -3.418  1.00 80.10  ? 104 VAL A C   1 
ATOM   202 O O   . VAL A 1 28  ? -7.852  37.290 -3.748  1.00 80.03  ? 104 VAL A O   1 
ATOM   203 C CB  . VAL A 1 28  ? -9.043  34.254 -2.765  1.00 77.10  ? 104 VAL A CB  1 
ATOM   204 C CG1 . VAL A 1 28  ? -9.740  35.282 -1.874  1.00 77.57  ? 104 VAL A CG1 1 
ATOM   205 C CG2 . VAL A 1 28  ? -10.065 33.291 -3.356  1.00 75.28  ? 104 VAL A CG2 1 
ATOM   206 N N   . SER A 1 29  ? -6.302  35.977 -2.720  1.00 79.40  ? 105 SER A N   1 
ATOM   207 C CA  . SER A 1 29  ? -5.439  37.049 -2.217  1.00 82.82  ? 105 SER A CA  1 
ATOM   208 C C   . SER A 1 29  ? -4.749  37.839 -3.341  1.00 88.21  ? 105 SER A C   1 
ATOM   209 O O   . SER A 1 29  ? -4.381  38.994 -3.127  1.00 91.10  ? 105 SER A O   1 
ATOM   210 C CB  . SER A 1 29  ? -4.416  36.503 -1.226  1.00 89.95  ? 105 SER A CB  1 
ATOM   211 O OG  . SER A 1 29  ? -3.561  35.547 -1.830  1.00 100.02 ? 105 SER A OG  1 
ATOM   212 N N   . TYR A 1 30  ? -4.585  37.224 -4.532  1.00 83.37  ? 106 TYR A N   1 
ATOM   213 C CA  . TYR A 1 30  ? -3.986  37.866 -5.706  1.00 85.48  ? 106 TYR A CA  1 
ATOM   214 C C   . TYR A 1 30  ? -5.009  38.810 -6.350  1.00 88.98  ? 106 TYR A C   1 
ATOM   215 O O   . TYR A 1 30  ? -4.668  39.951 -6.667  1.00 91.91  ? 106 TYR A O   1 
ATOM   216 C CB  . TYR A 1 30  ? -3.502  36.809 -6.725  1.00 86.18  ? 106 TYR A CB  1 
ATOM   217 C CG  . TYR A 1 30  ? -2.759  37.376 -7.918  1.00 91.18  ? 106 TYR A CG  1 
ATOM   218 C CD1 . TYR A 1 30  ? -3.445  37.821 -9.046  1.00 91.51  ? 106 TYR A CD1 1 
ATOM   219 C CD2 . TYR A 1 30  ? -1.369  37.427 -7.939  1.00 97.88  ? 106 TYR A CD2 1 
ATOM   220 C CE1 . TYR A 1 30  ? -2.767  38.345 -10.145 1.00 96.95  ? 106 TYR A CE1 1 
ATOM   221 C CE2 . TYR A 1 30  ? -0.679  37.933 -9.041  1.00 103.12 ? 106 TYR A CE2 1 
ATOM   222 C CZ  . TYR A 1 30  ? -1.384  38.390 -10.143 1.00 108.75 ? 106 TYR A CZ  1 
ATOM   223 O OH  . TYR A 1 30  ? -0.713  38.892 -11.232 1.00 114.81 ? 106 TYR A OH  1 
ATOM   224 N N   . LEU A 1 31  ? -6.249  38.317 -6.561  1.00 82.33  ? 107 LEU A N   1 
ATOM   225 C CA  . LEU A 1 31  ? -7.357  39.050 -7.181  1.00 81.69  ? 107 LEU A CA  1 
ATOM   226 C C   . LEU A 1 31  ? -7.782  40.281 -6.375  1.00 88.08  ? 107 LEU A C   1 
ATOM   227 O O   . LEU A 1 31  ? -7.972  41.347 -6.963  1.00 90.26  ? 107 LEU A O   1 
ATOM   228 C CB  . LEU A 1 31  ? -8.562  38.122 -7.422  1.00 78.06  ? 107 LEU A CB  1 
ATOM   229 C CG  . LEU A 1 31  ? -8.422  37.045 -8.501  1.00 81.93  ? 107 LEU A CG  1 
ATOM   230 C CD1 . LEU A 1 31  ? -9.289  35.845 -8.181  1.00 79.23  ? 107 LEU A CD1 1 
ATOM   231 C CD2 . LEU A 1 31  ? -8.783  37.585 -9.869  1.00 85.95  ? 107 LEU A CD2 1 
ATOM   232 N N   . GLU A 1 32  ? -7.920  40.142 -5.041  1.00 84.77  ? 108 GLU A N   1 
ATOM   233 C CA  . GLU A 1 32  ? -8.312  41.248 -4.160  1.00 87.11  ? 108 GLU A CA  1 
ATOM   234 C C   . GLU A 1 32  ? -7.144  42.179 -3.795  1.00 96.85  ? 108 GLU A C   1 
ATOM   235 O O   . GLU A 1 32  ? -7.350  43.385 -3.645  1.00 99.55  ? 108 GLU A O   1 
ATOM   236 C CB  . GLU A 1 32  ? -9.079  40.750 -2.912  1.00 86.92  ? 108 GLU A CB  1 
ATOM   237 C CG  . GLU A 1 32  ? -8.261  39.938 -1.913  1.00 97.52  ? 108 GLU A CG  1 
ATOM   238 C CD  . GLU A 1 32  ? -9.017  39.220 -0.808  1.00 116.14 ? 108 GLU A CD  1 
ATOM   239 O OE1 . GLU A 1 32  ? -10.263 39.327 -0.752  1.00 110.54 ? 108 GLU A OE1 1 
ATOM   240 O OE2 . GLU A 1 32  ? -8.349  38.549 0.012   1.00 110.76 ? 108 GLU A OE2 1 
ATOM   241 N N   . GLY A 1 33  ? -5.944  41.609 -3.669  1.00 95.61  ? 109 GLY A N   1 
ATOM   242 C CA  . GLY A 1 33  ? -4.729  42.333 -3.313  1.00 101.40 ? 109 GLY A CA  1 
ATOM   243 C C   . GLY A 1 33  ? -4.047  42.997 -4.490  1.00 109.94 ? 109 GLY A C   1 
ATOM   244 O O   . GLY A 1 33  ? -3.305  42.345 -5.231  1.00 109.98 ? 109 GLY A O   1 
ATOM   245 N N   . SER A 1 34  ? -4.293  44.309 -4.658  1.00 110.73 ? 110 SER A N   1 
ATOM   246 C CA  . SER A 1 34  ? -3.719  45.127 -5.727  1.00 115.86 ? 110 SER A CA  1 
ATOM   247 C C   . SER A 1 34  ? -2.681  46.102 -5.163  1.00 127.57 ? 110 SER A C   1 
ATOM   248 O O   . SER A 1 34  ? -2.961  46.808 -4.187  1.00 129.16 ? 110 SER A O   1 
ATOM   249 C CB  . SER A 1 34  ? -4.816  45.882 -6.473  1.00 119.45 ? 110 SER A CB  1 
ATOM   250 O OG  . SER A 1 34  ? -5.770  44.993 -7.031  1.00 122.39 ? 110 SER A OG  1 
ATOM   251 N N   . THR A 1 35  ? -1.480  46.127 -5.772  1.00 129.24 ? 111 THR A N   1 
ATOM   252 C CA  . THR A 1 35  ? -0.371  46.992 -5.362  1.00 137.66 ? 111 THR A CA  1 
ATOM   253 C C   . THR A 1 35  ? -0.614  48.440 -5.777  1.00 147.83 ? 111 THR A C   1 
ATOM   254 O O   . THR A 1 35  ? 0.280   49.275 -5.655  1.00 156.02 ? 111 THR A O   1 
ATOM   255 N N   . THR A 1 48  ? -21.728 52.864 -12.540 1.00 156.27 ? 124 THR A N   1 
ATOM   256 C CA  . THR A 1 48  ? -20.345 52.684 -12.980 1.00 154.79 ? 124 THR A CA  1 
ATOM   257 C C   . THR A 1 48  ? -19.404 52.627 -11.745 1.00 153.69 ? 124 THR A C   1 
ATOM   258 O O   . THR A 1 48  ? -18.724 53.617 -11.457 1.00 157.93 ? 124 THR A O   1 
ATOM   259 C CB  . THR A 1 48  ? -19.967 53.769 -14.021 1.00 172.88 ? 124 THR A CB  1 
ATOM   260 O OG1 . THR A 1 48  ? -21.077 54.025 -14.886 1.00 178.19 ? 124 THR A OG1 1 
ATOM   261 C CG2 . THR A 1 48  ? -18.744 53.389 -14.847 1.00 171.94 ? 124 THR A CG2 1 
ATOM   262 N N   . PRO A 1 49  ? -19.353 51.495 -10.992 1.00 141.85 ? 125 PRO A N   1 
ATOM   263 C CA  . PRO A 1 49  ? -18.491 51.449 -9.798  1.00 138.04 ? 125 PRO A CA  1 
ATOM   264 C C   . PRO A 1 49  ? -17.013 51.208 -10.099 1.00 140.01 ? 125 PRO A C   1 
ATOM   265 O O   . PRO A 1 49  ? -16.650 50.195 -10.702 1.00 135.49 ? 125 PRO A O   1 
ATOM   266 C CB  . PRO A 1 49  ? -19.111 50.330 -8.941  1.00 132.94 ? 125 PRO A CB  1 
ATOM   267 C CG  . PRO A 1 49  ? -20.294 49.801 -9.731  1.00 137.50 ? 125 PRO A CG  1 
ATOM   268 C CD  . PRO A 1 49  ? -20.091 50.228 -11.146 1.00 137.96 ? 125 PRO A CD  1 
ATOM   269 N N   . GLY A 1 50  ? -16.181 52.155 -9.668  1.00 140.35 ? 126 GLY A N   1 
ATOM   270 C CA  . GLY A 1 50  ? -14.734 52.110 -9.839  1.00 140.48 ? 126 GLY A CA  1 
ATOM   271 C C   . GLY A 1 50  ? -14.019 51.675 -8.578  1.00 138.97 ? 126 GLY A C   1 
ATOM   272 O O   . GLY A 1 50  ? -13.224 52.436 -8.017  1.00 142.80 ? 126 GLY A O   1 
ATOM   273 N N   . GLY A 1 51  ? -14.318 50.454 -8.135  1.00 127.12 ? 127 GLY A N   1 
ATOM   274 C CA  . GLY A 1 51  ? -13.741 49.859 -6.935  1.00 122.44 ? 127 GLY A CA  1 
ATOM   275 C C   . GLY A 1 51  ? -12.892 48.630 -7.197  1.00 120.38 ? 127 GLY A C   1 
ATOM   276 O O   . GLY A 1 51  ? -12.817 48.147 -8.332  1.00 119.09 ? 127 GLY A O   1 
ATOM   277 N N   . ALA A 1 52  ? -12.249 48.117 -6.134  1.00 113.65 ? 128 ALA A N   1 
ATOM   278 C CA  . ALA A 1 52  ? -11.385 46.937 -6.181  1.00 108.97 ? 128 ALA A CA  1 
ATOM   279 C C   . ALA A 1 52  ? -12.183 45.636 -6.336  1.00 105.91 ? 128 ALA A C   1 
ATOM   280 O O   . ALA A 1 52  ? -13.390 45.612 -6.081  1.00 104.43 ? 128 ALA A O   1 
ATOM   281 C CB  . ALA A 1 52  ? -10.516 46.877 -4.933  1.00 110.22 ? 128 ALA A CB  1 
ATOM   282 N N   . ILE A 1 53  ? -11.498 44.557 -6.758  1.00 98.59  ? 129 ILE A N   1 
ATOM   283 C CA  . ILE A 1 53  ? -12.068 43.224 -6.961  1.00 93.26  ? 129 ILE A CA  1 
ATOM   284 C C   . ILE A 1 53  ? -12.423 42.574 -5.609  1.00 93.65  ? 129 ILE A C   1 
ATOM   285 O O   . ILE A 1 53  ? -11.564 42.462 -4.730  1.00 93.59  ? 129 ILE A O   1 
ATOM   286 C CB  . ILE A 1 53  ? -11.105 42.364 -7.834  1.00 95.38  ? 129 ILE A CB  1 
ATOM   287 C CG1 . ILE A 1 53  ? -11.153 42.800 -9.315  1.00 98.60  ? 129 ILE A CG1 1 
ATOM   288 C CG2 . ILE A 1 53  ? -11.370 40.861 -7.693  1.00 91.99  ? 129 ILE A CG2 1 
ATOM   289 C CD1 . ILE A 1 53  ? -9.868  42.540 -10.103 1.00 107.63 ? 129 ILE A CD1 1 
ATOM   290 N N   . VAL A 1 54  ? -13.694 42.164 -5.455  1.00 87.99  ? 130 VAL A N   1 
ATOM   291 C CA  . VAL A 1 54  ? -14.214 41.517 -4.245  1.00 86.11  ? 130 VAL A CA  1 
ATOM   292 C C   . VAL A 1 54  ? -14.224 40.001 -4.498  1.00 86.49  ? 130 VAL A C   1 
ATOM   293 O O   . VAL A 1 54  ? -15.096 39.498 -5.211  1.00 85.05  ? 130 VAL A O   1 
ATOM   294 C CB  . VAL A 1 54  ? -15.607 42.078 -3.827  1.00 91.36  ? 130 VAL A CB  1 
ATOM   295 C CG1 . VAL A 1 54  ? -16.066 41.495 -2.496  1.00 91.12  ? 130 VAL A CG1 1 
ATOM   296 C CG2 . VAL A 1 54  ? -15.595 43.603 -3.757  1.00 94.98  ? 130 VAL A CG2 1 
ATOM   297 N N   . SER A 1 55  ? -13.223 39.287 -3.945  1.00 82.03  ? 131 SER A N   1 
ATOM   298 C CA  . SER A 1 55  ? -13.054 37.843 -4.131  1.00 79.72  ? 131 SER A CA  1 
ATOM   299 C C   . SER A 1 55  ? -13.502 36.978 -2.959  1.00 83.16  ? 131 SER A C   1 
ATOM   300 O O   . SER A 1 55  ? -13.558 37.447 -1.822  1.00 84.73  ? 131 SER A O   1 
ATOM   301 C CB  . SER A 1 55  ? -11.619 37.518 -4.525  1.00 83.27  ? 131 SER A CB  1 
ATOM   302 O OG  . SER A 1 55  ? -11.382 37.955 -5.851  1.00 93.10  ? 131 SER A OG  1 
ATOM   303 N N   . GLU A 1 56  ? -13.818 35.701 -3.252  1.00 78.10  ? 132 GLU A N   1 
ATOM   304 C CA  . GLU A 1 56  ? -14.294 34.709 -2.288  1.00 78.92  ? 132 GLU A CA  1 
ATOM   305 C C   . GLU A 1 56  ? -13.984 33.292 -2.775  1.00 81.78  ? 132 GLU A C   1 
ATOM   306 O O   . GLU A 1 56  ? -13.873 33.055 -3.979  1.00 80.11  ? 132 GLU A O   1 
ATOM   307 C CB  . GLU A 1 56  ? -15.821 34.852 -2.120  1.00 81.45  ? 132 GLU A CB  1 
ATOM   308 C CG  . GLU A 1 56  ? -16.411 34.181 -0.887  1.00 94.90  ? 132 GLU A CG  1 
ATOM   309 C CD  . GLU A 1 56  ? -17.891 33.850 -0.957  1.00 116.97 ? 132 GLU A CD  1 
ATOM   310 O OE1 . GLU A 1 56  ? -18.382 33.499 -2.055  1.00 107.65 ? 132 GLU A OE1 1 
ATOM   311 O OE2 . GLU A 1 56  ? -18.553 33.896 0.105   1.00 114.76 ? 132 GLU A OE2 1 
ATOM   312 N N   . LEU A 1 57  ? -13.885 32.349 -1.828  1.00 79.79  ? 133 LEU A N   1 
ATOM   313 C CA  . LEU A 1 57  ? -13.707 30.926 -2.080  1.00 80.30  ? 133 LEU A CA  1 
ATOM   314 C C   . LEU A 1 57  ? -15.128 30.381 -2.316  1.00 85.33  ? 133 LEU A C   1 
ATOM   315 O O   . LEU A 1 57  ? -16.027 30.682 -1.526  1.00 86.75  ? 133 LEU A O   1 
ATOM   316 C CB  . LEU A 1 57  ? -13.071 30.277 -0.836  1.00 83.41  ? 133 LEU A CB  1 
ATOM   317 C CG  . LEU A 1 57  ? -11.885 29.342 -1.057  1.00 88.73  ? 133 LEU A CG  1 
ATOM   318 C CD1 . LEU A 1 57  ? -10.613 30.112 -1.385  1.00 87.01  ? 133 LEU A CD1 1 
ATOM   319 C CD2 . LEU A 1 57  ? -11.638 28.499 0.176   1.00 95.78  ? 133 LEU A CD2 1 
ATOM   320 N N   . CYS A 1 58  ? -15.346 29.646 -3.428  1.00 81.75  ? 134 CYS A N   1 
ATOM   321 C CA  . CYS A 1 58  ? -16.658 29.099 -3.810  1.00 83.72  ? 134 CYS A CA  1 
ATOM   322 C C   . CYS A 1 58  ? -17.343 28.258 -2.739  1.00 92.71  ? 134 CYS A C   1 
ATOM   323 O O   . CYS A 1 58  ? -16.769 27.286 -2.243  1.00 94.77  ? 134 CYS A O   1 
ATOM   324 C CB  . CYS A 1 58  ? -16.600 28.365 -5.148  1.00 83.99  ? 134 CYS A CB  1 
ATOM   325 S SG  . CYS A 1 58  ? -16.769 29.429 -6.611  1.00 85.07  ? 134 CYS A SG  1 
ATOM   326 N N   . GLN A 1 59  ? -18.579 28.649 -2.395  1.00 91.63  ? 135 GLN A N   1 
ATOM   327 C CA  . GLN A 1 59  ? -19.423 27.990 -1.398  1.00 97.07  ? 135 GLN A CA  1 
ATOM   328 C C   . GLN A 1 59  ? -20.794 27.665 -2.000  1.00 104.22 ? 135 GLN A C   1 
ATOM   329 O O   . GLN A 1 59  ? -21.106 28.128 -3.102  1.00 101.29 ? 135 GLN A O   1 
ATOM   330 C CB  . GLN A 1 59  ? -19.582 28.888 -0.156  1.00 99.51  ? 135 GLN A CB  1 
ATOM   331 C CG  . GLN A 1 59  ? -18.328 28.990 0.705   1.00 116.24 ? 135 GLN A CG  1 
ATOM   332 C CD  . GLN A 1 59  ? -18.543 29.903 1.883   1.00 140.75 ? 135 GLN A CD  1 
ATOM   333 O OE1 . GLN A 1 59  ? -18.489 31.132 1.767   1.00 134.13 ? 135 GLN A OE1 1 
ATOM   334 N NE2 . GLN A 1 59  ? -18.794 29.321 3.046   1.00 139.51 ? 135 GLN A NE2 1 
ATOM   335 N N   . ALA A 1 60  ? -21.608 26.866 -1.281  1.00 107.42 ? 136 ALA A N   1 
ATOM   336 C CA  . ALA A 1 60  ? -22.957 26.495 -1.710  1.00 111.99 ? 136 ALA A CA  1 
ATOM   337 C C   . ALA A 1 60  ? -23.860 27.731 -1.662  1.00 115.66 ? 136 ALA A C   1 
ATOM   338 O O   . ALA A 1 60  ? -23.883 28.439 -0.649  1.00 115.66 ? 136 ALA A O   1 
ATOM   339 C CB  . ALA A 1 60  ? -23.510 25.395 -0.816  1.00 120.69 ? 136 ALA A CB  1 
ATOM   340 N N   . LEU A 1 61  ? -24.549 28.019 -2.789  1.00 111.87 ? 137 LEU A N   1 
ATOM   341 C CA  . LEU A 1 61  ? -25.445 29.169 -2.989  1.00 111.67 ? 137 LEU A CA  1 
ATOM   342 C C   . LEU A 1 61  ? -24.743 30.546 -2.962  1.00 109.21 ? 137 LEU A C   1 
ATOM   343 O O   . LEU A 1 61  ? -25.413 31.575 -2.830  1.00 109.52 ? 137 LEU A O   1 
ATOM   344 C CB  . LEU A 1 61  ? -26.692 29.121 -2.060  1.00 118.74 ? 137 LEU A CB  1 
ATOM   345 C CG  . LEU A 1 61  ? -28.032 28.598 -2.632  1.00 130.07 ? 137 LEU A CG  1 
ATOM   346 C CD1 . LEU A 1 61  ? -28.613 29.531 -3.693  1.00 128.85 ? 137 LEU A CD1 1 
ATOM   347 C CD2 . LEU A 1 61  ? -27.941 27.148 -3.110  1.00 135.85 ? 137 LEU A CD2 1 
ATOM   348 N N   . SER A 1 62  ? -23.402 30.566 -3.129  1.00 100.42 ? 138 SER A N   1 
ATOM   349 C CA  . SER A 1 62  ? -22.618 31.803 -3.161  1.00 95.38  ? 138 SER A CA  1 
ATOM   350 C C   . SER A 1 62  ? -22.688 32.413 -4.564  1.00 95.99  ? 138 SER A C   1 
ATOM   351 O O   . SER A 1 62  ? -22.250 31.782 -5.531  1.00 94.64  ? 138 SER A O   1 
ATOM   352 C CB  . SER A 1 62  ? -21.172 31.547 -2.739  1.00 96.08  ? 138 SER A CB  1 
ATOM   353 O OG  . SER A 1 62  ? -20.487 30.707 -3.654  1.00 103.14 ? 138 SER A OG  1 
ATOM   354 N N   . SER A 1 63  ? -23.277 33.619 -4.674  1.00 91.69  ? 139 SER A N   1 
ATOM   355 C CA  . SER A 1 63  ? -23.446 34.318 -5.949  1.00 90.24  ? 139 SER A CA  1 
ATOM   356 C C   . SER A 1 63  ? -22.352 35.351 -6.210  1.00 88.50  ? 139 SER A C   1 
ATOM   357 O O   . SER A 1 63  ? -22.037 36.165 -5.336  1.00 87.21  ? 139 SER A O   1 
ATOM   358 C CB  . SER A 1 63  ? -24.828 34.959 -6.038  1.00 98.37  ? 139 SER A CB  1 
ATOM   359 O OG  . SER A 1 63  ? -25.009 35.948 -5.038  1.00 108.79 ? 139 SER A OG  1 
ATOM   360 N N   . SER A 1 64  ? -21.777 35.305 -7.426  1.00 82.12  ? 140 SER A N   1 
ATOM   361 C CA  . SER A 1 64  ? -20.720 36.201 -7.902  1.00 78.76  ? 140 SER A CA  1 
ATOM   362 C C   . SER A 1 64  ? -20.814 36.385 -9.420  1.00 82.25  ? 140 SER A C   1 
ATOM   363 O O   . SER A 1 64  ? -21.411 35.546 -10.100 1.00 83.93  ? 140 SER A O   1 
ATOM   364 C CB  . SER A 1 64  ? -19.346 35.656 -7.525  1.00 78.92  ? 140 SER A CB  1 
ATOM   365 O OG  . SER A 1 64  ? -19.078 34.456 -8.229  1.00 86.85  ? 140 SER A OG  1 
ATOM   366 N N   . HIS A 1 65  ? -20.222 37.476 -9.947  1.00 77.31  ? 141 HIS A N   1 
ATOM   367 C CA  . HIS A 1 65  ? -20.223 37.784 -11.381 1.00 78.98  ? 141 HIS A CA  1 
ATOM   368 C C   . HIS A 1 65  ? -19.380 36.794 -12.186 1.00 80.91  ? 141 HIS A C   1 
ATOM   369 O O   . HIS A 1 65  ? -19.852 36.278 -13.201 1.00 83.06  ? 141 HIS A O   1 
ATOM   370 C CB  . HIS A 1 65  ? -19.772 39.231 -11.639 1.00 81.01  ? 141 HIS A CB  1 
ATOM   371 C CG  . HIS A 1 65  ? -20.680 40.255 -11.036 1.00 86.25  ? 141 HIS A CG  1 
ATOM   372 N ND1 . HIS A 1 65  ? -21.920 40.526 -11.580 1.00 91.92  ? 141 HIS A ND1 1 
ATOM   373 C CD2 . HIS A 1 65  ? -20.500 41.035 -9.946  1.00 87.12  ? 141 HIS A CD2 1 
ATOM   374 C CE1 . HIS A 1 65  ? -22.454 41.455 -10.807 1.00 92.70  ? 141 HIS A CE1 1 
ATOM   375 N NE2 . HIS A 1 65  ? -21.636 41.794 -9.812  1.00 90.29  ? 141 HIS A NE2 1 
ATOM   376 N N   . CYS A 1 66  ? -18.148 36.517 -11.719 1.00 73.88  ? 142 CYS A N   1 
ATOM   377 C CA  . CYS A 1 66  ? -17.215 35.591 -12.358 1.00 72.97  ? 142 CYS A CA  1 
ATOM   378 C C   . CYS A 1 66  ? -16.924 34.374 -11.488 1.00 73.39  ? 142 CYS A C   1 
ATOM   379 O O   . CYS A 1 66  ? -16.843 34.492 -10.265 1.00 70.82  ? 142 CYS A O   1 
ATOM   380 C CB  . CYS A 1 66  ? -15.930 36.307 -12.762 1.00 73.54  ? 142 CYS A CB  1 
ATOM   381 S SG  . CYS A 1 66  ? -16.146 37.525 -14.085 1.00 82.30  ? 142 CYS A SG  1 
ATOM   382 N N   . ARG A 1 67  ? -16.760 33.208 -12.126 1.00 60.76  ? 143 ARG A N   1 
ATOM   383 C CA  . ARG A 1 67  ? -16.451 31.954 -11.447 1.00 60.92  ? 143 ARG A CA  1 
ATOM   384 C C   . ARG A 1 67  ? -15.178 31.370 -12.052 1.00 65.14  ? 143 ARG A C   1 
ATOM   385 O O   . ARG A 1 67  ? -15.129 31.107 -13.255 1.00 65.07  ? 143 ARG A O   1 
ATOM   386 C CB  . ARG A 1 67  ? -17.630 30.970 -11.553 1.00 61.08  ? 143 ARG A CB  1 
ATOM   387 C CG  . ARG A 1 67  ? -17.650 29.910 -10.461 1.00 71.36  ? 143 ARG A CG  1 
ATOM   388 C CD  . ARG A 1 67  ? -18.919 29.084 -10.517 1.00 82.19  ? 143 ARG A CD  1 
ATOM   389 N NE  . ARG A 1 67  ? -19.049 28.196 -9.360  1.00 92.66  ? 143 ARG A NE  1 
ATOM   390 C CZ  . ARG A 1 67  ? -19.760 28.475 -8.271  1.00 107.52 ? 143 ARG A CZ  1 
ATOM   391 N NH1 . ARG A 1 67  ? -20.412 29.627 -8.172  1.00 94.47  ? 143 ARG A NH1 1 
ATOM   392 N NH2 . ARG A 1 67  ? -19.818 27.607 -7.270  1.00 95.22  ? 143 ARG A NH2 1 
ATOM   393 N N   . VAL A 1 68  ? -14.133 31.219 -11.227 1.00 61.62  ? 144 VAL A N   1 
ATOM   394 C CA  . VAL A 1 68  ? -12.845 30.674 -11.654 1.00 61.74  ? 144 VAL A CA  1 
ATOM   395 C C   . VAL A 1 68  ? -12.752 29.207 -11.249 1.00 66.26  ? 144 VAL A C   1 
ATOM   396 O O   . VAL A 1 68  ? -12.822 28.886 -10.061 1.00 65.86  ? 144 VAL A O   1 
ATOM   397 C CB  . VAL A 1 68  ? -11.625 31.516 -11.181 1.00 65.17  ? 144 VAL A CB  1 
ATOM   398 C CG1 . VAL A 1 68  ? -10.305 30.860 -11.581 1.00 65.47  ? 144 VAL A CG1 1 
ATOM   399 C CG2 . VAL A 1 68  ? -11.691 32.933 -11.736 1.00 64.53  ? 144 VAL A CG2 1 
ATOM   400 N N   . LEU A 1 69  ? -12.612 28.322 -12.244 1.00 63.36  ? 145 LEU A N   1 
ATOM   401 C CA  . LEU A 1 69  ? -12.487 26.887 -12.021 1.00 63.90  ? 145 LEU A CA  1 
ATOM   402 C C   . LEU A 1 69  ? -11.007 26.519 -11.999 1.00 68.82  ? 145 LEU A C   1 
ATOM   403 O O   . LEU A 1 69  ? -10.333 26.588 -13.030 1.00 68.49  ? 145 LEU A O   1 
ATOM   404 C CB  . LEU A 1 69  ? -13.245 26.087 -13.100 1.00 64.03  ? 145 LEU A CB  1 
ATOM   405 C CG  . LEU A 1 69  ? -14.754 26.319 -13.198 1.00 68.22  ? 145 LEU A CG  1 
ATOM   406 C CD1 . LEU A 1 69  ? -15.239 26.081 -14.602 1.00 68.17  ? 145 LEU A CD1 1 
ATOM   407 C CD2 . LEU A 1 69  ? -15.521 25.443 -12.216 1.00 71.23  ? 145 LEU A CD2 1 
ATOM   408 N N   . LEU A 1 70  ? -10.492 26.180 -10.809 1.00 66.28  ? 146 LEU A N   1 
ATOM   409 C CA  . LEU A 1 70  ? -9.094  25.801 -10.621 1.00 66.97  ? 146 LEU A CA  1 
ATOM   410 C C   . LEU A 1 70  ? -8.919  24.326 -11.020 1.00 72.47  ? 146 LEU A C   1 
ATOM   411 O O   . LEU A 1 70  ? -8.947  23.429 -10.168 1.00 72.42  ? 146 LEU A O   1 
ATOM   412 C CB  . LEU A 1 70  ? -8.651  26.084 -9.166  1.00 66.89  ? 146 LEU A CB  1 
ATOM   413 C CG  . LEU A 1 70  ? -7.151  26.016 -8.846  1.00 71.97  ? 146 LEU A CG  1 
ATOM   414 C CD1 . LEU A 1 70  ? -6.394  27.198 -9.435  1.00 71.80  ? 146 LEU A CD1 1 
ATOM   415 C CD2 . LEU A 1 70  ? -6.926  25.987 -7.349  1.00 74.48  ? 146 LEU A CD2 1 
ATOM   416 N N   . ILE A 1 71  ? -8.793  24.087 -12.342 1.00 69.80  ? 147 ILE A N   1 
ATOM   417 C CA  . ILE A 1 71  ? -8.639  22.752 -12.924 1.00 70.38  ? 147 ILE A CA  1 
ATOM   418 C C   . ILE A 1 71  ? -7.211  22.240 -12.732 1.00 76.11  ? 147 ILE A C   1 
ATOM   419 O O   . ILE A 1 71  ? -6.264  22.760 -13.325 1.00 75.84  ? 147 ILE A O   1 
ATOM   420 C CB  . ILE A 1 71  ? -9.155  22.663 -14.390 1.00 73.15  ? 147 ILE A CB  1 
ATOM   421 C CG1 . ILE A 1 71  ? -10.639 23.092 -14.477 1.00 72.60  ? 147 ILE A CG1 1 
ATOM   422 C CG2 . ILE A 1 71  ? -8.954  21.246 -14.961 1.00 74.43  ? 147 ILE A CG2 1 
ATOM   423 C CD1 . ILE A 1 71  ? -11.095 23.576 -15.831 1.00 77.92  ? 147 ILE A CD1 1 
ATOM   424 N N   . THR A 1 72  ? -7.080  21.225 -11.874 1.00 73.97  ? 148 THR A N   1 
ATOM   425 C CA  . THR A 1 72  ? -5.831  20.564 -11.489 1.00 74.82  ? 148 THR A CA  1 
ATOM   426 C C   . THR A 1 72  ? -6.021  19.038 -11.654 1.00 80.16  ? 148 THR A C   1 
ATOM   427 O O   . THR A 1 72  ? -7.165  18.623 -11.863 1.00 79.55  ? 148 THR A O   1 
ATOM   428 C CB  . THR A 1 72  ? -5.514  20.916 -10.019 1.00 83.67  ? 148 THR A CB  1 
ATOM   429 O OG1 . THR A 1 72  ? -6.652  20.607 -9.213  1.00 83.76  ? 148 THR A OG1 1 
ATOM   430 C CG2 . THR A 1 72  ? -5.100  22.376 -9.827  1.00 81.62  ? 148 THR A CG2 1 
ATOM   431 N N   . PRO A 1 73  ? -4.971  18.170 -11.536 1.00 78.09  ? 149 PRO A N   1 
ATOM   432 C CA  . PRO A 1 73  ? -5.210  16.715 -11.657 1.00 78.62  ? 149 PRO A CA  1 
ATOM   433 C C   . PRO A 1 73  ? -6.222  16.175 -10.638 1.00 82.92  ? 149 PRO A C   1 
ATOM   434 O O   . PRO A 1 73  ? -6.999  15.280 -10.971 1.00 82.76  ? 149 PRO A O   1 
ATOM   435 C CB  . PRO A 1 73  ? -3.817  16.106 -11.458 1.00 80.95  ? 149 PRO A CB  1 
ATOM   436 C CG  . PRO A 1 73  ? -2.871  17.202 -11.791 1.00 85.13  ? 149 PRO A CG  1 
ATOM   437 C CD  . PRO A 1 73  ? -3.538  18.446 -11.301 1.00 79.95  ? 149 PRO A CD  1 
ATOM   438 N N   . GLY A 1 74  ? -6.227  16.758 -9.436  1.00 79.42  ? 150 GLY A N   1 
ATOM   439 C CA  . GLY A 1 74  ? -7.147  16.411 -8.358  1.00 79.54  ? 150 GLY A CA  1 
ATOM   440 C C   . GLY A 1 74  ? -8.588  16.786 -8.651  1.00 83.21  ? 150 GLY A C   1 
ATOM   441 O O   . GLY A 1 74  ? -9.507  16.074 -8.234  1.00 83.31  ? 150 GLY A O   1 
ATOM   442 N N   . PHE A 1 75  ? -8.791  17.912 -9.375  1.00 78.94  ? 151 PHE A N   1 
ATOM   443 C CA  . PHE A 1 75  ? -10.100 18.434 -9.789  1.00 78.18  ? 151 PHE A CA  1 
ATOM   444 C C   . PHE A 1 75  ? -10.756 17.467 -10.782 1.00 82.76  ? 151 PHE A C   1 
ATOM   445 O O   . PHE A 1 75  ? -11.944 17.172 -10.652 1.00 82.42  ? 151 PHE A O   1 
ATOM   446 C CB  . PHE A 1 75  ? -9.938  19.836 -10.418 1.00 79.11  ? 151 PHE A CB  1 
ATOM   447 C CG  . PHE A 1 75  ? -11.207 20.575 -10.786 1.00 79.91  ? 151 PHE A CG  1 
ATOM   448 C CD1 . PHE A 1 75  ? -11.808 20.387 -12.026 1.00 81.63  ? 151 PHE A CD1 1 
ATOM   449 C CD2 . PHE A 1 75  ? -11.762 21.510 -9.921  1.00 82.58  ? 151 PHE A CD2 1 
ATOM   450 C CE1 . PHE A 1 75  ? -12.971 21.082 -12.372 1.00 83.77  ? 151 PHE A CE1 1 
ATOM   451 C CE2 . PHE A 1 75  ? -12.922 22.211 -10.271 1.00 82.85  ? 151 PHE A CE2 1 
ATOM   452 C CZ  . PHE A 1 75  ? -13.518 21.993 -11.494 1.00 81.54  ? 151 PHE A CZ  1 
ATOM   453 N N   . LEU A 1 76  ? -9.976  16.970 -11.761 1.00 79.80  ? 152 LEU A N   1 
ATOM   454 C CA  . LEU A 1 76  ? -10.452 16.039 -12.788 1.00 79.76  ? 152 LEU A CA  1 
ATOM   455 C C   . LEU A 1 76  ? -10.725 14.640 -12.231 1.00 84.84  ? 152 LEU A C   1 
ATOM   456 O O   . LEU A 1 76  ? -11.584 13.935 -12.762 1.00 84.49  ? 152 LEU A O   1 
ATOM   457 C CB  . LEU A 1 76  ? -9.481  15.982 -13.981 1.00 79.75  ? 152 LEU A CB  1 
ATOM   458 C CG  . LEU A 1 76  ? -9.243  17.294 -14.746 1.00 83.89  ? 152 LEU A CG  1 
ATOM   459 C CD1 . LEU A 1 76  ? -8.001  17.204 -15.592 1.00 84.36  ? 152 LEU A CD1 1 
ATOM   460 C CD2 . LEU A 1 76  ? -10.438 17.669 -15.620 1.00 85.66  ? 152 LEU A CD2 1 
ATOM   461 N N   . GLN A 1 77  ? -10.011 14.249 -11.155 1.00 82.29  ? 153 GLN A N   1 
ATOM   462 C CA  . GLN A 1 77  ? -10.177 12.954 -10.485 1.00 82.98  ? 153 GLN A CA  1 
ATOM   463 C C   . GLN A 1 77  ? -11.516 12.867 -9.745  1.00 86.70  ? 153 GLN A C   1 
ATOM   464 O O   . GLN A 1 77  ? -12.096 11.784 -9.668  1.00 86.77  ? 153 GLN A O   1 
ATOM   465 C CB  . GLN A 1 77  ? -9.013  12.681 -9.522  1.00 85.04  ? 153 GLN A CB  1 
ATOM   466 C CG  . GLN A 1 77  ? -7.782  12.106 -10.207 1.00 103.55 ? 153 GLN A CG  1 
ATOM   467 C CD  . GLN A 1 77  ? -6.648  11.910 -9.236  1.00 126.86 ? 153 GLN A CD  1 
ATOM   468 O OE1 . GLN A 1 77  ? -5.912  12.845 -8.903  1.00 122.70 ? 153 GLN A OE1 1 
ATOM   469 N NE2 . GLN A 1 77  ? -6.480  10.685 -8.762  1.00 120.97 ? 153 GLN A NE2 1 
ATOM   470 N N   . ASP A 1 78  ? -12.001 14.006 -9.209  1.00 102.86 ? 154 ASP A N   1 
ATOM   471 C CA  . ASP A 1 78  ? -13.269 14.092 -8.486  1.00 101.84 ? 154 ASP A CA  1 
ATOM   472 C C   . ASP A 1 78  ? -14.438 14.274 -9.470  1.00 101.87 ? 154 ASP A C   1 
ATOM   473 O O   . ASP A 1 78  ? -14.449 15.260 -10.213 1.00 98.73  ? 154 ASP A O   1 
ATOM   474 C CB  . ASP A 1 78  ? -13.232 15.227 -7.439  1.00 103.44 ? 154 ASP A CB  1 
ATOM   475 C CG  . ASP A 1 78  ? -14.470 15.344 -6.560  1.00 113.40 ? 154 ASP A CG  1 
ATOM   476 O OD1 . ASP A 1 78  ? -14.995 14.295 -6.125  1.00 121.77 ? 154 ASP A OD1 1 
ATOM   477 O OD2 . ASP A 1 78  ? -14.894 16.485 -6.283  1.00 111.84 ? 154 ASP A OD2 1 
ATOM   478 N N   . PRO A 1 79  ? -15.424 13.340 -9.497  1.00 98.58  ? 155 PRO A N   1 
ATOM   479 C CA  . PRO A 1 79  ? -16.556 13.489 -10.432 1.00 95.48  ? 155 PRO A CA  1 
ATOM   480 C C   . PRO A 1 79  ? -17.490 14.663 -10.124 1.00 97.09  ? 155 PRO A C   1 
ATOM   481 O O   . PRO A 1 79  ? -18.169 15.143 -11.032 1.00 94.32  ? 155 PRO A O   1 
ATOM   482 C CB  . PRO A 1 79  ? -17.282 12.146 -10.330 1.00 98.70  ? 155 PRO A CB  1 
ATOM   483 C CG  . PRO A 1 79  ? -16.944 11.634 -8.984  1.00 106.52 ? 155 PRO A CG  1 
ATOM   484 C CD  . PRO A 1 79  ? -15.551 12.105 -8.694  1.00 103.46 ? 155 PRO A CD  1 
ATOM   485 N N   . TRP A 1 80  ? -17.526 15.121 -8.853  1.00 94.83  ? 156 TRP A N   1 
ATOM   486 C CA  . TRP A 1 80  ? -18.358 16.246 -8.419  1.00 93.30  ? 156 TRP A CA  1 
ATOM   487 C C   . TRP A 1 80  ? -17.850 17.576 -8.978  1.00 95.50  ? 156 TRP A C   1 
ATOM   488 O O   . TRP A 1 80  ? -18.664 18.418 -9.361  1.00 93.51  ? 156 TRP A O   1 
ATOM   489 C CB  . TRP A 1 80  ? -18.490 16.292 -6.887  1.00 94.14  ? 156 TRP A CB  1 
ATOM   490 C CG  . TRP A 1 80  ? -19.365 17.403 -6.380  1.00 93.96  ? 156 TRP A CG  1 
ATOM   491 C CD1 . TRP A 1 80  ? -18.964 18.515 -5.701  1.00 96.78  ? 156 TRP A CD1 1 
ATOM   492 C CD2 . TRP A 1 80  ? -20.784 17.530 -6.558  1.00 92.84  ? 156 TRP A CD2 1 
ATOM   493 N NE1 . TRP A 1 80  ? -20.047 19.317 -5.422  1.00 95.39  ? 156 TRP A NE1 1 
ATOM   494 C CE2 . TRP A 1 80  ? -21.177 18.738 -5.941  1.00 96.37  ? 156 TRP A CE2 1 
ATOM   495 C CE3 . TRP A 1 80  ? -21.766 16.735 -7.174  1.00 93.78  ? 156 TRP A CE3 1 
ATOM   496 C CZ2 . TRP A 1 80  ? -22.508 19.171 -5.920  1.00 95.26  ? 156 TRP A CZ2 1 
ATOM   497 C CZ3 . TRP A 1 80  ? -23.085 17.161 -7.148  1.00 94.72  ? 156 TRP A CZ3 1 
ATOM   498 C CH2 . TRP A 1 80  ? -23.445 18.368 -6.532  1.00 95.24  ? 156 TRP A CH2 1 
ATOM   499 N N   . CYS A 1 81  ? -16.512 17.752 -9.041  1.00 92.70  ? 157 CYS A N   1 
ATOM   500 C CA  . CYS A 1 81  ? -15.862 18.950 -9.582  1.00 90.98  ? 157 CYS A CA  1 
ATOM   501 C C   . CYS A 1 81  ? -16.159 19.108 -11.072 1.00 92.81  ? 157 CYS A C   1 
ATOM   502 O O   . CYS A 1 81  ? -16.365 20.230 -11.537 1.00 90.96  ? 157 CYS A O   1 
ATOM   503 C CB  . CYS A 1 81  ? -14.362 18.930 -9.309  1.00 92.76  ? 157 CYS A CB  1 
ATOM   504 S SG  . CYS A 1 81  ? -13.910 19.362 -7.610  1.00 98.75  ? 157 CYS A SG  1 
ATOM   505 N N   . LYS A 1 82  ? -16.203 17.978 -11.809 1.00 89.77  ? 158 LYS A N   1 
ATOM   506 C CA  . LYS A 1 82  ? -16.522 17.933 -13.237 1.00 88.47  ? 158 LYS A CA  1 
ATOM   507 C C   . LYS A 1 82  ? -17.987 18.310 -13.480 1.00 91.48  ? 158 LYS A C   1 
ATOM   508 O O   . LYS A 1 82  ? -18.289 18.945 -14.493 1.00 90.32  ? 158 LYS A O   1 
ATOM   509 C CB  . LYS A 1 82  ? -16.202 16.554 -13.825 1.00 91.88  ? 158 LYS A CB  1 
ATOM   510 C CG  . LYS A 1 82  ? -14.735 16.387 -14.189 1.00 106.54 ? 158 LYS A CG  1 
ATOM   511 C CD  . LYS A 1 82  ? -14.469 15.025 -14.787 1.00 117.62 ? 158 LYS A CD  1 
ATOM   512 C CE  . LYS A 1 82  ? -13.159 14.965 -15.526 1.00 129.98 ? 158 LYS A CE  1 
ATOM   513 N NZ  . LYS A 1 82  ? -12.845 13.581 -15.963 1.00 141.49 ? 158 LYS A NZ  1 
ATOM   514 N N   . TYR A 1 83  ? -18.884 17.941 -12.537 1.00 88.60  ? 159 TYR A N   1 
ATOM   515 C CA  . TYR A 1 83  ? -20.310 18.273 -12.581 1.00 88.00  ? 159 TYR A CA  1 
ATOM   516 C C   . TYR A 1 83  ? -20.488 19.772 -12.321 1.00 91.75  ? 159 TYR A C   1 
ATOM   517 O O   . TYR A 1 83  ? -21.240 20.426 -13.045 1.00 91.13  ? 159 TYR A O   1 
ATOM   518 C CB  . TYR A 1 83  ? -21.112 17.433 -11.563 1.00 90.02  ? 159 TYR A CB  1 
ATOM   519 C CG  . TYR A 1 83  ? -22.585 17.785 -11.492 1.00 91.40  ? 159 TYR A CG  1 
ATOM   520 C CD1 . TYR A 1 83  ? -23.472 17.361 -12.477 1.00 93.03  ? 159 TYR A CD1 1 
ATOM   521 C CD2 . TYR A 1 83  ? -23.094 18.534 -10.434 1.00 92.58  ? 159 TYR A CD2 1 
ATOM   522 C CE1 . TYR A 1 83  ? -24.826 17.692 -12.424 1.00 94.04  ? 159 TYR A CE1 1 
ATOM   523 C CE2 . TYR A 1 83  ? -24.448 18.862 -10.365 1.00 93.79  ? 159 TYR A CE2 1 
ATOM   524 C CZ  . TYR A 1 83  ? -25.310 18.440 -11.365 1.00 101.07 ? 159 TYR A CZ  1 
ATOM   525 O OH  . TYR A 1 83  ? -26.644 18.760 -11.304 1.00 102.86 ? 159 TYR A OH  1 
ATOM   526 N N   . GLN A 1 84  ? -19.773 20.313 -11.305 1.00 88.76  ? 160 GLN A N   1 
ATOM   527 C CA  . GLN A 1 84  ? -19.791 21.732 -10.931 1.00 88.32  ? 160 GLN A CA  1 
ATOM   528 C C   . GLN A 1 84  ? -19.252 22.622 -12.057 1.00 92.03  ? 160 GLN A C   1 
ATOM   529 O O   . GLN A 1 84  ? -19.689 23.766 -12.185 1.00 91.65  ? 160 GLN A O   1 
ATOM   530 C CB  . GLN A 1 84  ? -19.026 21.978 -9.616  1.00 90.12  ? 160 GLN A CB  1 
ATOM   531 C CG  . GLN A 1 84  ? -19.719 21.436 -8.363  1.00 103.61 ? 160 GLN A CG  1 
ATOM   532 C CD  . GLN A 1 84  ? -20.971 22.195 -8.001  1.00 121.21 ? 160 GLN A CD  1 
ATOM   533 O OE1 . GLN A 1 84  ? -20.922 23.304 -7.461  1.00 117.18 ? 160 GLN A OE1 1 
ATOM   534 N NE2 . GLN A 1 84  ? -22.123 21.605 -8.280  1.00 112.56 ? 160 GLN A NE2 1 
ATOM   535 N N   . MET A 1 85  ? -18.324 22.082 -12.881 1.00 88.84  ? 161 MET A N   1 
ATOM   536 C CA  . MET A 1 85  ? -17.740 22.745 -14.051 1.00 88.61  ? 161 MET A CA  1 
ATOM   537 C C   . MET A 1 85  ? -18.834 22.930 -15.114 1.00 92.89  ? 161 MET A C   1 
ATOM   538 O O   . MET A 1 85  ? -18.927 24.002 -15.715 1.00 92.81  ? 161 MET A O   1 
ATOM   539 C CB  . MET A 1 85  ? -16.564 21.914 -14.603 1.00 91.15  ? 161 MET A CB  1 
ATOM   540 C CG  . MET A 1 85  ? -15.857 22.547 -15.794 1.00 94.94  ? 161 MET A CG  1 
ATOM   541 S SD  . MET A 1 85  ? -14.342 21.689 -16.294 1.00 99.81  ? 161 MET A SD  1 
ATOM   542 C CE  . MET A 1 85  ? -15.029 20.268 -17.149 1.00 97.13  ? 161 MET A CE  1 
ATOM   543 N N   . LEU A 1 86  ? -19.672 21.891 -15.315 1.00 89.82  ? 162 LEU A N   1 
ATOM   544 C CA  . LEU A 1 86  ? -20.794 21.896 -16.255 1.00 90.45  ? 162 LEU A CA  1 
ATOM   545 C C   . LEU A 1 86  ? -21.908 22.836 -15.791 1.00 94.98  ? 162 LEU A C   1 
ATOM   546 O O   . LEU A 1 86  ? -22.532 23.494 -16.625 1.00 95.80  ? 162 LEU A O   1 
ATOM   547 C CB  . LEU A 1 86  ? -21.334 20.471 -16.455 1.00 90.61  ? 162 LEU A CB  1 
ATOM   548 C CG  . LEU A 1 86  ? -20.944 19.780 -17.762 1.00 95.71  ? 162 LEU A CG  1 
ATOM   549 C CD1 . LEU A 1 86  ? -19.484 19.333 -17.751 1.00 95.60  ? 162 LEU A CD1 1 
ATOM   550 C CD2 . LEU A 1 86  ? -21.834 18.589 -18.021 1.00 98.35  ? 162 LEU A CD2 1 
ATOM   551 N N   . GLN A 1 87  ? -22.141 22.910 -14.463 1.00 91.21  ? 163 GLN A N   1 
ATOM   552 C CA  . GLN A 1 87  ? -23.145 23.788 -13.850 1.00 91.97  ? 163 GLN A CA  1 
ATOM   553 C C   . GLN A 1 87  ? -22.728 25.256 -13.974 1.00 96.45  ? 163 GLN A C   1 
ATOM   554 O O   . GLN A 1 87  ? -23.588 26.124 -14.131 1.00 97.56  ? 163 GLN A O   1 
ATOM   555 C CB  . GLN A 1 87  ? -23.378 23.422 -12.371 1.00 93.07  ? 163 GLN A CB  1 
ATOM   556 C CG  . GLN A 1 87  ? -24.004 22.046 -12.138 1.00 107.13 ? 163 GLN A CG  1 
ATOM   557 C CD  . GLN A 1 87  ? -25.434 21.952 -12.608 1.00 127.57 ? 163 GLN A CD  1 
ATOM   558 O OE1 . GLN A 1 87  ? -26.361 22.457 -11.967 1.00 124.61 ? 163 GLN A OE1 1 
ATOM   559 N NE2 . GLN A 1 87  ? -25.644 21.285 -13.733 1.00 119.22 ? 163 GLN A NE2 1 
ATOM   560 N N   . ALA A 1 88  ? -21.404 25.523 -13.910 1.00 92.10  ? 164 ALA A N   1 
ATOM   561 C CA  . ALA A 1 88  ? -20.814 26.858 -14.036 1.00 92.18  ? 164 ALA A CA  1 
ATOM   562 C C   . ALA A 1 88  ? -20.888 27.368 -15.479 1.00 97.35  ? 164 ALA A C   1 
ATOM   563 O O   . ALA A 1 88  ? -21.133 28.556 -15.692 1.00 98.39  ? 164 ALA A O   1 
ATOM   564 C CB  . ALA A 1 88  ? -19.368 26.837 -13.565 1.00 91.52  ? 164 ALA A CB  1 
ATOM   565 N N   . LEU A 1 89  ? -20.688 26.467 -16.464 1.00 93.79  ? 165 LEU A N   1 
ATOM   566 C CA  . LEU A 1 89  ? -20.725 26.790 -17.893 1.00 95.26  ? 165 LEU A CA  1 
ATOM   567 C C   . LEU A 1 89  ? -22.152 26.933 -18.454 1.00 102.50 ? 165 LEU A C   1 
ATOM   568 O O   . LEU A 1 89  ? -22.318 27.405 -19.581 1.00 104.40 ? 165 LEU A O   1 
ATOM   569 C CB  . LEU A 1 89  ? -19.892 25.780 -18.707 1.00 94.34  ? 165 LEU A CB  1 
ATOM   570 C CG  . LEU A 1 89  ? -18.368 25.895 -18.562 1.00 97.51  ? 165 LEU A CG  1 
ATOM   571 C CD1 . LEU A 1 89  ? -17.690 24.578 -18.855 1.00 96.69  ? 165 LEU A CD1 1 
ATOM   572 C CD2 . LEU A 1 89  ? -17.801 26.992 -19.453 1.00 101.08 ? 165 LEU A CD2 1 
ATOM   573 N N   . THR A 1 90  ? -23.173 26.557 -17.655 1.00 99.66  ? 166 THR A N   1 
ATOM   574 C CA  . THR A 1 90  ? -24.590 26.642 -18.017 1.00 102.17 ? 166 THR A CA  1 
ATOM   575 C C   . THR A 1 90  ? -25.128 28.057 -17.750 1.00 108.93 ? 166 THR A C   1 
ATOM   576 O O   . THR A 1 90  ? -25.322 28.440 -16.592 1.00 107.78 ? 166 THR A O   1 
ATOM   577 C CB  . THR A 1 90  ? -25.382 25.503 -17.341 1.00 109.54 ? 166 THR A CB  1 
ATOM   578 O OG1 . THR A 1 90  ? -24.850 24.253 -17.781 1.00 108.37 ? 166 THR A OG1 1 
ATOM   579 C CG2 . THR A 1 90  ? -26.879 25.556 -17.640 1.00 110.34 ? 166 THR A CG2 1 
ATOM   580 N N   . GLU A 1 91  ? -25.354 28.824 -18.843 1.00 109.15 ? 167 GLU A N   1 
ATOM   581 C CA  . GLU A 1 91  ? -25.853 30.208 -18.875 1.00 112.48 ? 167 GLU A CA  1 
ATOM   582 C C   . GLU A 1 91  ? -25.011 31.170 -18.029 1.00 115.00 ? 167 GLU A C   1 
ATOM   583 O O   . GLU A 1 91  ? -24.156 31.872 -18.564 1.00 115.08 ? 167 GLU A O   1 
ATOM   584 C CB  . GLU A 1 91  ? -27.351 30.284 -18.515 1.00 116.46 ? 167 GLU A CB  1 
ATOM   585 C CG  . GLU A 1 91  ? -28.018 31.587 -18.934 1.00 132.66 ? 167 GLU A CG  1 
ATOM   586 C CD  . GLU A 1 91  ? -29.522 31.673 -18.752 1.00 157.78 ? 167 GLU A CD  1 
ATOM   587 O OE1 . GLU A 1 91  ? -30.041 31.155 -17.736 1.00 150.07 ? 167 GLU A OE1 1 
ATOM   588 O OE2 . GLU A 1 91  ? -30.179 32.308 -19.609 1.00 156.61 ? 167 GLU A OE2 1 
ATOM   589 N N   . GLU A 1 96  ? -21.916 35.864 -23.235 1.00 111.07 ? 172 GLU A N   1 
ATOM   590 C CA  . GLU A 1 96  ? -22.871 35.680 -22.145 1.00 109.72 ? 172 GLU A CA  1 
ATOM   591 C C   . GLU A 1 96  ? -22.245 34.929 -20.969 1.00 107.36 ? 172 GLU A C   1 
ATOM   592 O O   . GLU A 1 96  ? -21.745 33.812 -21.140 1.00 104.09 ? 172 GLU A O   1 
ATOM   593 C CB  . GLU A 1 96  ? -24.140 34.961 -22.640 1.00 113.60 ? 172 GLU A CB  1 
ATOM   594 C CG  . GLU A 1 96  ? -25.119 35.870 -23.364 1.00 131.71 ? 172 GLU A CG  1 
ATOM   595 C CD  . GLU A 1 96  ? -26.313 35.179 -23.999 1.00 156.38 ? 172 GLU A CD  1 
ATOM   596 O OE1 . GLU A 1 96  ? -26.965 34.355 -23.316 1.00 150.39 ? 172 GLU A OE1 1 
ATOM   597 O OE2 . GLU A 1 96  ? -26.618 35.492 -25.172 1.00 155.50 ? 172 GLU A OE2 1 
ATOM   598 N N   . GLY A 1 97  ? -22.274 35.562 -19.796 1.00 102.12 ? 173 GLY A N   1 
ATOM   599 C CA  . GLY A 1 97  ? -21.735 35.012 -18.555 1.00 96.82  ? 173 GLY A CA  1 
ATOM   600 C C   . GLY A 1 97  ? -20.236 35.169 -18.387 1.00 96.68  ? 173 GLY A C   1 
ATOM   601 O O   . GLY A 1 97  ? -19.541 35.606 -19.310 1.00 97.43  ? 173 GLY A O   1 
ATOM   602 N N   . CYS A 1 98  ? -19.732 34.808 -17.192 1.00 88.89  ? 174 CYS A N   1 
ATOM   603 C CA  . CYS A 1 98  ? -18.311 34.875 -16.851 1.00 85.65  ? 174 CYS A CA  1 
ATOM   604 C C   . CYS A 1 98  ? -17.856 33.624 -16.094 1.00 85.53  ? 174 CYS A C   1 
ATOM   605 O O   . CYS A 1 98  ? -18.126 33.477 -14.899 1.00 83.86  ? 174 CYS A O   1 
ATOM   606 C CB  . CYS A 1 98  ? -17.988 36.153 -16.082 1.00 86.10  ? 174 CYS A CB  1 
ATOM   607 S SG  . CYS A 1 98  ? -16.219 36.416 -15.790 1.00 87.36  ? 174 CYS A SG  1 
ATOM   608 N N   . THR A 1 99  ? -17.188 32.712 -16.815 1.00 80.64  ? 175 THR A N   1 
ATOM   609 C CA  . THR A 1 99  ? -16.652 31.460 -16.284 1.00 77.83  ? 175 THR A CA  1 
ATOM   610 C C   . THR A 1 99  ? -15.228 31.321 -16.821 1.00 80.92  ? 175 THR A C   1 
ATOM   611 O O   . THR A 1 99  ? -15.042 31.127 -18.025 1.00 81.57  ? 175 THR A O   1 
ATOM   612 C CB  . THR A 1 99  ? -17.591 30.282 -16.618 1.00 84.20  ? 175 THR A CB  1 
ATOM   613 O OG1 . THR A 1 99  ? -18.903 30.575 -16.135 1.00 84.38  ? 175 THR A OG1 1 
ATOM   614 C CG2 . THR A 1 99  ? -17.120 28.967 -16.019 1.00 79.94  ? 175 THR A CG2 1 
ATOM   615 N N   . ILE A 1 100 ? -14.227 31.482 -15.935 1.00 76.01  ? 176 ILE A N   1 
ATOM   616 C CA  . ILE A 1 100 ? -12.814 31.433 -16.314 1.00 75.27  ? 176 ILE A CA  1 
ATOM   617 C C   . ILE A 1 100 ? -12.109 30.146 -15.840 1.00 78.48  ? 176 ILE A C   1 
ATOM   618 O O   . ILE A 1 100 ? -11.688 30.064 -14.685 1.00 77.45  ? 176 ILE A O   1 
ATOM   619 C CB  . ILE A 1 100 ? -12.037 32.732 -15.937 1.00 78.14  ? 176 ILE A CB  1 
ATOM   620 C CG1 . ILE A 1 100 ? -12.829 34.004 -16.302 1.00 80.18  ? 176 ILE A CG1 1 
ATOM   621 C CG2 . ILE A 1 100 ? -10.651 32.750 -16.587 1.00 78.79  ? 176 ILE A CG2 1 
ATOM   622 C CD1 . ILE A 1 100 ? -12.760 35.086 -15.264 1.00 86.22  ? 176 ILE A CD1 1 
ATOM   623 N N   . PRO A 1 101 ? -11.925 29.150 -16.732 1.00 75.51  ? 177 PRO A N   1 
ATOM   624 C CA  . PRO A 1 101 ? -11.226 27.923 -16.325 1.00 74.81  ? 177 PRO A CA  1 
ATOM   625 C C   . PRO A 1 101 ? -9.707  28.113 -16.323 1.00 78.89  ? 177 PRO A C   1 
ATOM   626 O O   . PRO A 1 101 ? -9.123  28.460 -17.353 1.00 79.25  ? 177 PRO A O   1 
ATOM   627 C CB  . PRO A 1 101 ? -11.679 26.889 -17.373 1.00 77.09  ? 177 PRO A CB  1 
ATOM   628 C CG  . PRO A 1 101 ? -12.656 27.613 -18.282 1.00 82.43  ? 177 PRO A CG  1 
ATOM   629 C CD  . PRO A 1 101 ? -12.357 29.062 -18.136 1.00 78.31  ? 177 PRO A CD  1 
ATOM   630 N N   . LEU A 1 102 ? -9.074  27.918 -15.153 1.00 75.00  ? 178 LEU A N   1 
ATOM   631 C CA  . LEU A 1 102 ? -7.624  28.032 -14.978 1.00 75.09  ? 178 LEU A CA  1 
ATOM   632 C C   . LEU A 1 102 ? -7.039  26.625 -14.848 1.00 80.17  ? 178 LEU A C   1 
ATOM   633 O O   . LEU A 1 102 ? -7.456  25.865 -13.970 1.00 80.10  ? 178 LEU A O   1 
ATOM   634 C CB  . LEU A 1 102 ? -7.285  28.913 -13.752 1.00 74.68  ? 178 LEU A CB  1 
ATOM   635 C CG  . LEU A 1 102 ? -5.805  29.074 -13.352 1.00 80.01  ? 178 LEU A CG  1 
ATOM   636 C CD1 . LEU A 1 102 ? -4.997  29.787 -14.427 1.00 80.31  ? 178 LEU A CD1 1 
ATOM   637 C CD2 . LEU A 1 102 ? -5.682  29.841 -12.056 1.00 82.12  ? 178 LEU A CD2 1 
ATOM   638 N N   . LEU A 1 103 ? -6.099  26.273 -15.743 1.00 77.59  ? 179 LEU A N   1 
ATOM   639 C CA  . LEU A 1 103 ? -5.482  24.944 -15.772 1.00 78.83  ? 179 LEU A CA  1 
ATOM   640 C C   . LEU A 1 103 ? -4.026  24.954 -15.324 1.00 83.99  ? 179 LEU A C   1 
ATOM   641 O O   . LEU A 1 103 ? -3.155  25.439 -16.048 1.00 83.97  ? 179 LEU A O   1 
ATOM   642 C CB  . LEU A 1 103 ? -5.651  24.278 -17.149 1.00 79.28  ? 179 LEU A CB  1 
ATOM   643 C CG  . LEU A 1 103 ? -7.089  23.975 -17.554 1.00 83.05  ? 179 LEU A CG  1 
ATOM   644 C CD1 . LEU A 1 103 ? -7.599  24.996 -18.538 1.00 82.55  ? 179 LEU A CD1 1 
ATOM   645 C CD2 . LEU A 1 103 ? -7.213  22.591 -18.127 1.00 86.58  ? 179 LEU A CD2 1 
ATOM   646 N N   . SER A 1 104 ? -3.772  24.414 -14.120 1.00 79.51  ? 180 SER A N   1 
ATOM   647 C CA  . SER A 1 104 ? -2.442  24.355 -13.515 1.00 80.41  ? 180 SER A CA  1 
ATOM   648 C C   . SER A 1 104 ? -2.093  22.966 -12.983 1.00 86.13  ? 180 SER A C   1 
ATOM   649 O O   . SER A 1 104 ? -2.972  22.244 -12.508 1.00 87.02  ? 180 SER A O   1 
ATOM   650 C CB  . SER A 1 104 ? -2.325  25.385 -12.394 1.00 83.94  ? 180 SER A CB  1 
ATOM   651 O OG  . SER A 1 104 ? -3.265  25.137 -11.361 1.00 93.40  ? 180 SER A OG  1 
ATOM   652 N N   . GLY A 1 105 ? -0.808  22.627 -13.055 1.00 83.20  ? 181 GLY A N   1 
ATOM   653 C CA  . GLY A 1 105 ? -0.264  21.367 -12.561 1.00 85.77  ? 181 GLY A CA  1 
ATOM   654 C C   . GLY A 1 105 ? -0.492  20.147 -13.430 1.00 89.91  ? 181 GLY A C   1 
ATOM   655 O O   . GLY A 1 105 ? -0.299  19.023 -12.958 1.00 92.72  ? 181 GLY A O   1 
ATOM   656 N N   . LEU A 1 106 ? -0.891  20.347 -14.701 1.00 83.66  ? 182 LEU A N   1 
ATOM   657 C CA  . LEU A 1 106 ? -1.120  19.240 -15.635 1.00 84.52  ? 182 LEU A CA  1 
ATOM   658 C C   . LEU A 1 106 ? -0.703  19.552 -17.077 1.00 85.89  ? 182 LEU A C   1 
ATOM   659 O O   . LEU A 1 106 ? -0.728  20.714 -17.490 1.00 82.86  ? 182 LEU A O   1 
ATOM   660 C CB  . LEU A 1 106 ? -2.562  18.688 -15.547 1.00 85.16  ? 182 LEU A CB  1 
ATOM   661 C CG  . LEU A 1 106 ? -3.700  19.532 -16.128 1.00 86.97  ? 182 LEU A CG  1 
ATOM   662 C CD1 . LEU A 1 106 ? -4.740  18.647 -16.775 1.00 88.32  ? 182 LEU A CD1 1 
ATOM   663 C CD2 . LEU A 1 106 ? -4.344  20.409 -15.066 1.00 88.27  ? 182 LEU A CD2 1 
ATOM   664 N N   . SER A 1 107 ? -0.306  18.504 -17.827 1.00 83.71  ? 183 SER A N   1 
ATOM   665 C CA  . SER A 1 107 ? 0.125   18.581 -19.227 1.00 82.35  ? 183 SER A CA  1 
ATOM   666 C C   . SER A 1 107 ? -1.043  18.959 -20.137 1.00 83.09  ? 183 SER A C   1 
ATOM   667 O O   . SER A 1 107 ? -2.173  18.552 -19.871 1.00 83.09  ? 183 SER A O   1 
ATOM   668 C CB  . SER A 1 107 ? 0.714   17.243 -19.667 1.00 89.20  ? 183 SER A CB  1 
ATOM   669 O OG  . SER A 1 107 ? 1.136   17.260 -21.022 1.00 97.91  ? 183 SER A OG  1 
ATOM   670 N N   . ARG A 1 108 ? -0.761  19.713 -21.223 1.00 77.17  ? 184 ARG A N   1 
ATOM   671 C CA  . ARG A 1 108 ? -1.756  20.159 -22.210 1.00 75.15  ? 184 ARG A CA  1 
ATOM   672 C C   . ARG A 1 108 ? -2.523  19.003 -22.872 1.00 81.04  ? 184 ARG A C   1 
ATOM   673 O O   . ARG A 1 108 ? -3.680  19.181 -23.248 1.00 79.72  ? 184 ARG A O   1 
ATOM   674 C CB  . ARG A 1 108 ? -1.119  21.071 -23.267 1.00 73.14  ? 184 ARG A CB  1 
ATOM   675 C CG  . ARG A 1 108 ? -0.927  22.505 -22.806 1.00 78.88  ? 184 ARG A CG  1 
ATOM   676 C CD  . ARG A 1 108 ? 0.046   23.231 -23.706 1.00 85.57  ? 184 ARG A CD  1 
ATOM   677 N NE  . ARG A 1 108 ? -0.586  24.287 -24.494 1.00 89.89  ? 184 ARG A NE  1 
ATOM   678 C CZ  . ARG A 1 108 ? -0.041  24.843 -25.572 1.00 103.10 ? 184 ARG A CZ  1 
ATOM   679 N NH1 . ARG A 1 108 ? 1.141   24.432 -26.015 1.00 88.45  ? 184 ARG A NH1 1 
ATOM   680 N NH2 . ARG A 1 108 ? -0.681  25.803 -26.225 1.00 92.70  ? 184 ARG A NH2 1 
ATOM   681 N N   . ALA A 1 109 ? -1.887  17.821 -22.990 1.00 80.72  ? 185 ALA A N   1 
ATOM   682 C CA  . ALA A 1 109 ? -2.496  16.616 -23.554 1.00 83.21  ? 185 ALA A CA  1 
ATOM   683 C C   . ALA A 1 109 ? -3.546  16.041 -22.594 1.00 89.02  ? 185 ALA A C   1 
ATOM   684 O O   . ALA A 1 109 ? -4.508  15.414 -23.044 1.00 90.18  ? 185 ALA A O   1 
ATOM   685 C CB  . ALA A 1 109 ? -1.424  15.577 -23.840 1.00 86.95  ? 185 ALA A CB  1 
ATOM   686 N N   . ALA A 1 110 ? -3.360  16.267 -21.275 1.00 85.69  ? 186 ALA A N   1 
ATOM   687 C CA  . ALA A 1 110 ? -4.255  15.808 -20.210 1.00 87.15  ? 186 ALA A CA  1 
ATOM   688 C C   . ALA A 1 110 ? -5.440  16.760 -19.962 1.00 88.54  ? 186 ALA A C   1 
ATOM   689 O O   . ALA A 1 110 ? -6.357  16.399 -19.218 1.00 89.75  ? 186 ALA A O   1 
ATOM   690 C CB  . ALA A 1 110 ? -3.469  15.590 -18.925 1.00 89.42  ? 186 ALA A CB  1 
ATOM   691 N N   . TYR A 1 111 ? -5.426  17.963 -20.590 1.00 81.66  ? 187 TYR A N   1 
ATOM   692 C CA  . TYR A 1 111 ? -6.485  18.982 -20.488 1.00 79.13  ? 187 TYR A CA  1 
ATOM   693 C C   . TYR A 1 111 ? -7.814  18.408 -21.023 1.00 85.21  ? 187 TYR A C   1 
ATOM   694 O O   . TYR A 1 111 ? -7.775  17.688 -22.029 1.00 86.24  ? 187 TYR A O   1 
ATOM   695 C CB  . TYR A 1 111 ? -6.126  20.232 -21.328 1.00 77.15  ? 187 TYR A CB  1 
ATOM   696 C CG  . TYR A 1 111 ? -5.102  21.201 -20.762 1.00 76.91  ? 187 TYR A CG  1 
ATOM   697 C CD1 . TYR A 1 111 ? -4.349  20.880 -19.635 1.00 78.53  ? 187 TYR A CD1 1 
ATOM   698 C CD2 . TYR A 1 111 ? -4.884  22.440 -21.358 1.00 76.80  ? 187 TYR A CD2 1 
ATOM   699 C CE1 . TYR A 1 111 ? -3.407  21.767 -19.116 1.00 78.30  ? 187 TYR A CE1 1 
ATOM   700 C CE2 . TYR A 1 111 ? -3.948  23.337 -20.845 1.00 76.36  ? 187 TYR A CE2 1 
ATOM   701 C CZ  . TYR A 1 111 ? -3.209  22.994 -19.725 1.00 83.19  ? 187 TYR A CZ  1 
ATOM   702 O OH  . TYR A 1 111 ? -2.280  23.868 -19.213 1.00 82.95  ? 187 TYR A OH  1 
ATOM   703 N N   . PRO A 1 112 ? -8.991  18.707 -20.402 1.00 82.10  ? 188 PRO A N   1 
ATOM   704 C CA  . PRO A 1 112 ? -10.256 18.174 -20.947 1.00 83.72  ? 188 PRO A CA  1 
ATOM   705 C C   . PRO A 1 112 ? -10.505 18.656 -22.383 1.00 86.63  ? 188 PRO A C   1 
ATOM   706 O O   . PRO A 1 112 ? -10.348 19.850 -22.655 1.00 83.37  ? 188 PRO A O   1 
ATOM   707 C CB  . PRO A 1 112 ? -11.325 18.651 -19.956 1.00 85.23  ? 188 PRO A CB  1 
ATOM   708 C CG  . PRO A 1 112 ? -10.703 19.733 -19.191 1.00 87.01  ? 188 PRO A CG  1 
ATOM   709 C CD  . PRO A 1 112 ? -9.224  19.534 -19.201 1.00 82.31  ? 188 PRO A CD  1 
ATOM   710 N N   . PRO A 1 113 ? -10.817 17.729 -23.324 1.00 85.91  ? 189 PRO A N   1 
ATOM   711 C CA  . PRO A 1 113 ? -10.969 18.119 -24.743 1.00 85.22  ? 189 PRO A CA  1 
ATOM   712 C C   . PRO A 1 113 ? -12.011 19.178 -25.105 1.00 88.37  ? 189 PRO A C   1 
ATOM   713 O O   . PRO A 1 113 ? -11.927 19.748 -26.195 1.00 87.20  ? 189 PRO A O   1 
ATOM   714 C CB  . PRO A 1 113 ? -11.214 16.788 -25.460 1.00 90.35  ? 189 PRO A CB  1 
ATOM   715 C CG  . PRO A 1 113 ? -11.656 15.855 -24.407 1.00 97.30  ? 189 PRO A CG  1 
ATOM   716 C CD  . PRO A 1 113 ? -10.975 16.271 -23.153 1.00 91.19  ? 189 PRO A CD  1 
ATOM   717 N N   . GLU A 1 114 ? -12.971 19.455 -24.203 1.00 85.29  ? 190 GLU A N   1 
ATOM   718 C CA  . GLU A 1 114 ? -14.021 20.462 -24.398 1.00 84.30  ? 190 GLU A CA  1 
ATOM   719 C C   . GLU A 1 114 ? -13.427 21.874 -24.505 1.00 85.57  ? 190 GLU A C   1 
ATOM   720 O O   . GLU A 1 114 ? -13.929 22.692 -25.277 1.00 84.84  ? 190 GLU A O   1 
ATOM   721 C CB  . GLU A 1 114 ? -15.047 20.421 -23.246 1.00 86.59  ? 190 GLU A CB  1 
ATOM   722 C CG  . GLU A 1 114 ? -15.839 19.125 -23.147 1.00 100.71 ? 190 GLU A CG  1 
ATOM   723 C CD  . GLU A 1 114 ? -15.271 18.033 -22.256 1.00 122.49 ? 190 GLU A CD  1 
ATOM   724 O OE1 . GLU A 1 114 ? -14.081 18.116 -21.873 1.00 112.51 ? 190 GLU A OE1 1 
ATOM   725 O OE2 . GLU A 1 114 ? -16.022 17.078 -21.951 1.00 120.87 ? 190 GLU A OE2 1 
ATOM   726 N N   . LEU A 1 115 ? -12.342 22.139 -23.748 1.00 80.71  ? 191 LEU A N   1 
ATOM   727 C CA  . LEU A 1 115 ? -11.659 23.433 -23.682 1.00 78.44  ? 191 LEU A CA  1 
ATOM   728 C C   . LEU A 1 115 ? -10.947 23.908 -24.956 1.00 82.16  ? 191 LEU A C   1 
ATOM   729 O O   . LEU A 1 115 ? -10.463 25.042 -24.987 1.00 80.69  ? 191 LEU A O   1 
ATOM   730 C CB  . LEU A 1 115 ? -10.747 23.523 -22.444 1.00 77.59  ? 191 LEU A CB  1 
ATOM   731 C CG  . LEU A 1 115 ? -11.463 23.622 -21.094 1.00 82.44  ? 191 LEU A CG  1 
ATOM   732 C CD1 . LEU A 1 115 ? -10.532 23.291 -19.970 1.00 82.55  ? 191 LEU A CD1 1 
ATOM   733 C CD2 . LEU A 1 115 ? -12.055 25.002 -20.873 1.00 83.84  ? 191 LEU A CD2 1 
ATOM   734 N N   . ARG A 1 116 ? -10.907 23.069 -26.010 1.00 79.97  ? 192 ARG A N   1 
ATOM   735 C CA  . ARG A 1 116 ? -10.300 23.422 -27.297 1.00 79.63  ? 192 ARG A CA  1 
ATOM   736 C C   . ARG A 1 116 ? -11.119 24.529 -27.970 1.00 83.79  ? 192 ARG A C   1 
ATOM   737 O O   . ARG A 1 116 ? -10.552 25.502 -28.462 1.00 83.14  ? 192 ARG A O   1 
ATOM   738 C CB  . ARG A 1 116 ? -10.234 22.198 -28.232 1.00 81.26  ? 192 ARG A CB  1 
ATOM   739 C CG  . ARG A 1 116 ? -9.231  21.127 -27.828 1.00 91.80  ? 192 ARG A CG  1 
ATOM   740 C CD  . ARG A 1 116 ? -9.235  19.975 -28.814 1.00 105.00 ? 192 ARG A CD  1 
ATOM   741 N NE  . ARG A 1 116 ? -8.525  18.803 -28.297 1.00 116.13 ? 192 ARG A NE  1 
ATOM   742 C CZ  . ARG A 1 116 ? -7.263  18.497 -28.584 1.00 130.69 ? 192 ARG A CZ  1 
ATOM   743 N NH1 . ARG A 1 116 ? -6.548  19.277 -29.388 1.00 117.54 ? 192 ARG A NH1 1 
ATOM   744 N NH2 . ARG A 1 116 ? -6.705  17.409 -28.069 1.00 117.93 ? 192 ARG A NH2 1 
ATOM   745 N N   . PHE A 1 117 ? -12.456 24.393 -27.940 1.00 81.37  ? 193 PHE A N   1 
ATOM   746 C CA  . PHE A 1 117 ? -13.418 25.294 -28.578 1.00 81.98  ? 193 PHE A CA  1 
ATOM   747 C C   . PHE A 1 117 ? -13.952 26.426 -27.679 1.00 85.71  ? 193 PHE A C   1 
ATOM   748 O O   . PHE A 1 117 ? -14.856 27.156 -28.095 1.00 86.45  ? 193 PHE A O   1 
ATOM   749 C CB  . PHE A 1 117 ? -14.562 24.476 -29.216 1.00 85.90  ? 193 PHE A CB  1 
ATOM   750 C CG  . PHE A 1 117 ? -14.098 23.226 -29.931 1.00 88.63  ? 193 PHE A CG  1 
ATOM   751 C CD1 . PHE A 1 117 ? -13.605 23.289 -31.228 1.00 92.37  ? 193 PHE A CD1 1 
ATOM   752 C CD2 . PHE A 1 117 ? -14.132 21.990 -29.296 1.00 91.66  ? 193 PHE A CD2 1 
ATOM   753 C CE1 . PHE A 1 117 ? -13.158 22.137 -31.880 1.00 94.62  ? 193 PHE A CE1 1 
ATOM   754 C CE2 . PHE A 1 117 ? -13.678 20.840 -29.947 1.00 96.07  ? 193 PHE A CE2 1 
ATOM   755 C CZ  . PHE A 1 117 ? -13.202 20.920 -31.237 1.00 94.63  ? 193 PHE A CZ  1 
ATOM   756 N N   . MET A 1 118 ? -13.378 26.593 -26.471 1.00 81.24  ? 194 MET A N   1 
ATOM   757 C CA  . MET A 1 118 ? -13.785 27.645 -25.532 1.00 80.77  ? 194 MET A CA  1 
ATOM   758 C C   . MET A 1 118 ? -12.603 28.326 -24.820 1.00 83.21  ? 194 MET A C   1 
ATOM   759 O O   . MET A 1 118 ? -11.481 27.819 -24.876 1.00 82.22  ? 194 MET A O   1 
ATOM   760 C CB  . MET A 1 118 ? -14.869 27.151 -24.551 1.00 83.85  ? 194 MET A CB  1 
ATOM   761 C CG  . MET A 1 118 ? -14.423 26.028 -23.638 1.00 87.44  ? 194 MET A CG  1 
ATOM   762 S SD  . MET A 1 118 ? -15.743 25.464 -22.540 1.00 93.27  ? 194 MET A SD  1 
ATOM   763 C CE  . MET A 1 118 ? -16.420 24.167 -23.504 1.00 92.24  ? 194 MET A CE  1 
ATOM   764 N N   . TYR A 1 119 ? -12.858 29.485 -24.172 1.00 79.44  ? 195 TYR A N   1 
ATOM   765 C CA  . TYR A 1 119 ? -11.843 30.266 -23.462 1.00 78.18  ? 195 TYR A CA  1 
ATOM   766 C C   . TYR A 1 119 ? -11.329 29.565 -22.210 1.00 80.51  ? 195 TYR A C   1 
ATOM   767 O O   . TYR A 1 119 ? -12.119 29.051 -21.418 1.00 80.51  ? 195 TYR A O   1 
ATOM   768 C CB  . TYR A 1 119 ? -12.361 31.679 -23.119 1.00 80.15  ? 195 TYR A CB  1 
ATOM   769 C CG  . TYR A 1 119 ? -11.322 32.576 -22.475 1.00 81.73  ? 195 TYR A CG  1 
ATOM   770 C CD1 . TYR A 1 119 ? -10.332 33.189 -23.239 1.00 84.51  ? 195 TYR A CD1 1 
ATOM   771 C CD2 . TYR A 1 119 ? -11.336 32.823 -21.105 1.00 81.92  ? 195 TYR A CD2 1 
ATOM   772 C CE1 . TYR A 1 119 ? -9.369  34.009 -22.652 1.00 85.80  ? 195 TYR A CE1 1 
ATOM   773 C CE2 . TYR A 1 119 ? -10.379 33.642 -20.508 1.00 82.91  ? 195 TYR A CE2 1 
ATOM   774 C CZ  . TYR A 1 119 ? -9.398  34.235 -21.286 1.00 91.45  ? 195 TYR A CZ  1 
ATOM   775 O OH  . TYR A 1 119 ? -8.452  35.048 -20.709 1.00 93.41  ? 195 TYR A OH  1 
ATOM   776 N N   . TYR A 1 120 ? -9.999  29.564 -22.039 1.00 75.78  ? 196 TYR A N   1 
ATOM   777 C CA  . TYR A 1 120 ? -9.299  28.995 -20.889 1.00 74.77  ? 196 TYR A CA  1 
ATOM   778 C C   . TYR A 1 120 ? -7.978  29.729 -20.647 1.00 78.33  ? 196 TYR A C   1 
ATOM   779 O O   . TYR A 1 120 ? -7.440  30.351 -21.568 1.00 78.16  ? 196 TYR A O   1 
ATOM   780 C CB  . TYR A 1 120 ? -9.101  27.467 -21.030 1.00 76.01  ? 196 TYR A CB  1 
ATOM   781 C CG  . TYR A 1 120 ? -8.014  27.030 -21.992 1.00 77.78  ? 196 TYR A CG  1 
ATOM   782 C CD1 . TYR A 1 120 ? -8.295  26.803 -23.335 1.00 79.15  ? 196 TYR A CD1 1 
ATOM   783 C CD2 . TYR A 1 120 ? -6.720  26.777 -21.545 1.00 79.54  ? 196 TYR A CD2 1 
ATOM   784 C CE1 . TYR A 1 120 ? -7.306  26.371 -24.218 1.00 80.46  ? 196 TYR A CE1 1 
ATOM   785 C CE2 . TYR A 1 120 ? -5.722  26.349 -22.418 1.00 80.52  ? 196 TYR A CE2 1 
ATOM   786 C CZ  . TYR A 1 120 ? -6.020  26.144 -23.755 1.00 87.64  ? 196 TYR A CZ  1 
ATOM   787 O OH  . TYR A 1 120 ? -5.040  25.719 -24.621 1.00 89.60  ? 196 TYR A OH  1 
ATOM   788 N N   . VAL A 1 121 ? -7.461  29.657 -19.411 1.00 74.69  ? 197 VAL A N   1 
ATOM   789 C CA  . VAL A 1 121 ? -6.197  30.291 -19.033 1.00 74.67  ? 197 VAL A CA  1 
ATOM   790 C C   . VAL A 1 121 ? -5.190  29.210 -18.621 1.00 79.15  ? 197 VAL A C   1 
ATOM   791 O O   . VAL A 1 121 ? -5.480  28.394 -17.741 1.00 79.02  ? 197 VAL A O   1 
ATOM   792 C CB  . VAL A 1 121 ? -6.380  31.392 -17.950 1.00 78.63  ? 197 VAL A CB  1 
ATOM   793 C CG1 . VAL A 1 121 ? -5.037  31.952 -17.492 1.00 79.05  ? 197 VAL A CG1 1 
ATOM   794 C CG2 . VAL A 1 121 ? -7.283  32.518 -18.451 1.00 78.91  ? 197 VAL A CG2 1 
ATOM   795 N N   . ASP A 1 122 ? -4.018  29.204 -19.277 1.00 76.22  ? 198 ASP A N   1 
ATOM   796 C CA  . ASP A 1 122 ? -2.944  28.252 -19.006 1.00 76.66  ? 198 ASP A CA  1 
ATOM   797 C C   . ASP A 1 122 ? -2.131  28.717 -17.795 1.00 81.38  ? 198 ASP A C   1 
ATOM   798 O O   . ASP A 1 122 ? -1.729  29.883 -17.729 1.00 81.32  ? 198 ASP A O   1 
ATOM   799 C CB  . ASP A 1 122 ? -2.041  28.093 -20.242 1.00 78.95  ? 198 ASP A CB  1 
ATOM   800 C CG  . ASP A 1 122 ? -1.415  26.720 -20.380 1.00 88.88  ? 198 ASP A CG  1 
ATOM   801 O OD1 . ASP A 1 122 ? -0.523  26.390 -19.568 1.00 90.09  ? 198 ASP A OD1 1 
ATOM   802 O OD2 . ASP A 1 122 ? -1.805  25.982 -21.310 1.00 94.59  ? 198 ASP A OD2 1 
ATOM   803 N N   . GLY A 1 123 ? -1.901  27.798 -16.857 1.00 78.63  ? 199 GLY A N   1 
ATOM   804 C CA  . GLY A 1 123 ? -1.148  28.050 -15.631 1.00 79.46  ? 199 GLY A CA  1 
ATOM   805 C C   . GLY A 1 123 ? 0.346   28.232 -15.824 1.00 84.87  ? 199 GLY A C   1 
ATOM   806 O O   . GLY A 1 123 ? 1.059   28.517 -14.859 1.00 85.68  ? 199 GLY A O   1 
ATOM   807 N N   . ARG A 1 124 ? 0.833   28.061 -17.068 1.00 81.54  ? 200 ARG A N   1 
ATOM   808 C CA  . ARG A 1 124 ? 2.242   28.211 -17.435 1.00 82.71  ? 200 ARG A CA  1 
ATOM   809 C C   . ARG A 1 124 ? 2.590   29.648 -17.874 1.00 87.71  ? 200 ARG A C   1 
ATOM   810 O O   . ARG A 1 124 ? 3.752   29.932 -18.181 1.00 89.03  ? 200 ARG A O   1 
ATOM   811 C CB  . ARG A 1 124 ? 2.633   27.177 -18.505 1.00 82.28  ? 200 ARG A CB  1 
ATOM   812 C CG  . ARG A 1 124 ? 2.937   25.799 -17.931 1.00 90.40  ? 200 ARG A CG  1 
ATOM   813 C CD  . ARG A 1 124 ? 3.219   24.782 -19.017 1.00 96.90  ? 200 ARG A CD  1 
ATOM   814 N NE  . ARG A 1 124 ? 2.006   24.085 -19.446 1.00 102.07 ? 200 ARG A NE  1 
ATOM   815 C CZ  . ARG A 1 124 ? 1.606   22.911 -18.967 1.00 116.62 ? 200 ARG A CZ  1 
ATOM   816 N NH1 . ARG A 1 124 ? 2.319   22.285 -18.040 1.00 104.63 ? 200 ARG A NH1 1 
ATOM   817 N NH2 . ARG A 1 124 ? 0.490   22.353 -19.415 1.00 104.54 ? 200 ARG A NH2 1 
ATOM   818 N N   . GLY A 1 125 ? 1.591   30.534 -17.865 1.00 83.58  ? 201 GLY A N   1 
ATOM   819 C CA  . GLY A 1 125 ? 1.742   31.939 -18.232 1.00 84.47  ? 201 GLY A CA  1 
ATOM   820 C C   . GLY A 1 125 ? 2.224   32.828 -17.096 1.00 90.01  ? 201 GLY A C   1 
ATOM   821 O O   . GLY A 1 125 ? 2.674   32.311 -16.066 1.00 89.96  ? 201 GLY A O   1 
ATOM   822 N N   . PRO A 1 126 ? 2.145   34.181 -17.245 1.00 87.99  ? 202 PRO A N   1 
ATOM   823 C CA  . PRO A 1 126 ? 2.614   35.077 -16.164 1.00 89.56  ? 202 PRO A CA  1 
ATOM   824 C C   . PRO A 1 126 ? 1.845   34.928 -14.851 1.00 92.44  ? 202 PRO A C   1 
ATOM   825 O O   . PRO A 1 126 ? 0.618   34.792 -14.862 1.00 90.31  ? 202 PRO A O   1 
ATOM   826 C CB  . PRO A 1 126 ? 2.447   36.483 -16.755 1.00 93.13  ? 202 PRO A CB  1 
ATOM   827 C CG  . PRO A 1 126 ? 2.319   36.284 -18.222 1.00 97.25  ? 202 PRO A CG  1 
ATOM   828 C CD  . PRO A 1 126 ? 1.659   34.957 -18.403 1.00 89.95  ? 202 PRO A CD  1 
ATOM   829 N N   . ASP A 1 127 ? 2.591   34.927 -13.721 1.00 90.33  ? 203 ASP A N   1 
ATOM   830 C CA  . ASP A 1 127 ? 2.106   34.777 -12.340 1.00 89.89  ? 203 ASP A CA  1 
ATOM   831 C C   . ASP A 1 127 ? 1.329   33.463 -12.093 1.00 90.78  ? 203 ASP A C   1 
ATOM   832 O O   . ASP A 1 127 ? 0.514   33.383 -11.171 1.00 89.87  ? 203 ASP A O   1 
ATOM   833 C CB  . ASP A 1 127 ? 1.319   36.024 -11.869 1.00 92.67  ? 203 ASP A CB  1 
ATOM   834 C CG  . ASP A 1 127 ? 2.103   37.323 -11.920 1.00 107.19 ? 203 ASP A CG  1 
ATOM   835 O OD1 . ASP A 1 127 ? 3.172   37.400 -11.271 1.00 109.95 ? 203 ASP A OD1 1 
ATOM   836 O OD2 . ASP A 1 127 ? 1.630   38.276 -12.576 1.00 114.34 ? 203 ASP A OD2 1 
ATOM   837 N N   . GLY A 1 128 ? 1.626   32.444 -12.900 1.00 85.73  ? 204 GLY A N   1 
ATOM   838 C CA  . GLY A 1 128 ? 0.979   31.139 -12.829 1.00 83.81  ? 204 GLY A CA  1 
ATOM   839 C C   . GLY A 1 128 ? -0.440  31.148 -13.364 1.00 84.52  ? 204 GLY A C   1 
ATOM   840 O O   . GLY A 1 128 ? -1.276  30.353 -12.925 1.00 83.18  ? 204 GLY A O   1 
ATOM   841 N N   . GLY A 1 129 ? -0.702  32.052 -14.310 1.00 80.04  ? 205 GLY A N   1 
ATOM   842 C CA  . GLY A 1 129 ? -2.008  32.241 -14.932 1.00 78.22  ? 205 GLY A CA  1 
ATOM   843 C C   . GLY A 1 129 ? -2.919  33.176 -14.159 1.00 81.28  ? 205 GLY A C   1 
ATOM   844 O O   . GLY A 1 129 ? -4.039  33.448 -14.599 1.00 80.28  ? 205 GLY A O   1 
ATOM   845 N N   . PHE A 1 130 ? -2.441  33.679 -13.001 1.00 78.14  ? 206 PHE A N   1 
ATOM   846 C CA  . PHE A 1 130 ? -3.179  34.578 -12.109 1.00 78.14  ? 206 PHE A CA  1 
ATOM   847 C C   . PHE A 1 130 ? -3.388  35.968 -12.714 1.00 82.98  ? 206 PHE A C   1 
ATOM   848 O O   . PHE A 1 130 ? -4.390  36.616 -12.410 1.00 82.75  ? 206 PHE A O   1 
ATOM   849 C CB  . PHE A 1 130 ? -2.491  34.678 -10.732 1.00 81.05  ? 206 PHE A CB  1 
ATOM   850 C CG  . PHE A 1 130 ? -2.568  33.489 -9.790  1.00 82.01  ? 206 PHE A CG  1 
ATOM   851 C CD1 . PHE A 1 130 ? -3.034  32.253 -10.230 1.00 83.68  ? 206 PHE A CD1 1 
ATOM   852 C CD2 . PHE A 1 130 ? -2.149  33.600 -8.471  1.00 85.45  ? 206 PHE A CD2 1 
ATOM   853 C CE1 . PHE A 1 130 ? -3.098  31.160 -9.361  1.00 84.97  ? 206 PHE A CE1 1 
ATOM   854 C CE2 . PHE A 1 130 ? -2.208  32.504 -7.604  1.00 88.52  ? 206 PHE A CE2 1 
ATOM   855 C CZ  . PHE A 1 130 ? -2.684  31.293 -8.054  1.00 85.55  ? 206 PHE A CZ  1 
ATOM   856 N N   . ARG A 1 131 ? -2.446  36.423 -13.565 1.00 80.66  ? 207 ARG A N   1 
ATOM   857 C CA  . ARG A 1 131 ? -2.512  37.724 -14.233 1.00 82.39  ? 207 ARG A CA  1 
ATOM   858 C C   . ARG A 1 131 ? -3.619  37.743 -15.296 1.00 85.56  ? 207 ARG A C   1 
ATOM   859 O O   . ARG A 1 131 ? -4.404  38.692 -15.328 1.00 86.31  ? 207 ARG A O   1 
ATOM   860 C CB  . ARG A 1 131 ? -1.146  38.095 -14.843 1.00 84.55  ? 207 ARG A CB  1 
ATOM   861 C CG  . ARG A 1 131 ? -1.061  39.527 -15.373 1.00 97.32  ? 207 ARG A CG  1 
ATOM   862 C CD  . ARG A 1 131 ? 0.297   39.836 -15.972 1.00 110.04 ? 207 ARG A CD  1 
ATOM   863 N NE  . ARG A 1 131 ? 1.306   40.088 -14.942 1.00 122.49 ? 207 ARG A NE  1 
ATOM   864 C CZ  . ARG A 1 131 ? 2.586   40.350 -15.188 1.00 140.51 ? 207 ARG A CZ  1 
ATOM   865 N NH1 . ARG A 1 131 ? 3.034   40.396 -16.437 1.00 128.50 ? 207 ARG A NH1 1 
ATOM   866 N NH2 . ARG A 1 131 ? 3.429   40.567 -14.187 1.00 130.34 ? 207 ARG A NH2 1 
ATOM   867 N N   . GLN A 1 132 ? -3.683  36.695 -16.149 1.00 80.58  ? 208 GLN A N   1 
ATOM   868 C CA  . GLN A 1 132 ? -4.679  36.572 -17.222 1.00 79.80  ? 208 GLN A CA  1 
ATOM   869 C C   . GLN A 1 132 ? -6.099  36.398 -16.691 1.00 82.41  ? 208 GLN A C   1 
ATOM   870 O O   . GLN A 1 132 ? -7.031  36.908 -17.316 1.00 82.66  ? 208 GLN A O   1 
ATOM   871 C CB  . GLN A 1 132 ? -4.334  35.447 -18.212 1.00 79.99  ? 208 GLN A CB  1 
ATOM   872 C CG  . GLN A 1 132 ? -2.973  35.579 -18.890 1.00 99.81  ? 208 GLN A CG  1 
ATOM   873 C CD  . GLN A 1 132 ? -1.928  34.749 -18.189 1.00 120.89 ? 208 GLN A CD  1 
ATOM   874 O OE1 . GLN A 1 132 ? -1.462  35.081 -17.091 1.00 117.02 ? 208 GLN A OE1 1 
ATOM   875 N NE2 . GLN A 1 132 ? -1.535  33.646 -18.811 1.00 112.82 ? 208 GLN A NE2 1 
ATOM   876 N N   . VAL A 1 133 ? -6.270  35.686 -15.549 1.00 77.59  ? 209 VAL A N   1 
ATOM   877 C CA  . VAL A 1 133 ? -7.592  35.494 -14.933 1.00 76.82  ? 209 VAL A CA  1 
ATOM   878 C C   . VAL A 1 133 ? -8.111  36.806 -14.333 1.00 82.05  ? 209 VAL A C   1 
ATOM   879 O O   . VAL A 1 133 ? -9.306  37.081 -14.431 1.00 82.06  ? 209 VAL A O   1 
ATOM   880 C CB  . VAL A 1 133 ? -7.735  34.280 -13.961 1.00 79.71  ? 209 VAL A CB  1 
ATOM   881 C CG1 . VAL A 1 133 ? -7.430  32.959 -14.655 1.00 78.40  ? 209 VAL A CG1 1 
ATOM   882 C CG2 . VAL A 1 133 ? -6.891  34.438 -12.705 1.00 80.25  ? 209 VAL A CG2 1 
ATOM   883 N N   . LYS A 1 134 ? -7.201  37.625 -13.752 1.00 79.79  ? 210 LYS A N   1 
ATOM   884 C CA  . LYS A 1 134 ? -7.520  38.925 -13.158 1.00 81.75  ? 210 LYS A CA  1 
ATOM   885 C C   . LYS A 1 134 ? -7.957  39.909 -14.244 1.00 87.43  ? 210 LYS A C   1 
ATOM   886 O O   . LYS A 1 134 ? -8.923  40.646 -14.037 1.00 88.71  ? 210 LYS A O   1 
ATOM   887 C CB  . LYS A 1 134 ? -6.330  39.474 -12.353 1.00 85.82  ? 210 LYS A CB  1 
ATOM   888 C CG  . LYS A 1 134 ? -6.716  40.566 -11.360 1.00 101.44 ? 210 LYS A CG  1 
ATOM   889 C CD  . LYS A 1 134 ? -5.524  41.058 -10.556 1.00 112.20 ? 210 LYS A CD  1 
ATOM   890 C CE  . LYS A 1 134 ? -5.917  42.140 -9.581  1.00 123.69 ? 210 LYS A CE  1 
ATOM   891 N NZ  . LYS A 1 134 ? -4.762  42.593 -8.764  1.00 134.19 ? 210 LYS A NZ  1 
ATOM   892 N N   . GLU A 1 135 ? -7.267  39.891 -15.406 1.00 83.95  ? 211 GLU A N   1 
ATOM   893 C CA  . GLU A 1 135 ? -7.575  40.730 -16.569 1.00 85.79  ? 211 GLU A CA  1 
ATOM   894 C C   . GLU A 1 135 ? -8.941  40.353 -17.147 1.00 88.55  ? 211 GLU A C   1 
ATOM   895 O O   . GLU A 1 135 ? -9.704  41.242 -17.522 1.00 90.42  ? 211 GLU A O   1 
ATOM   896 C CB  . GLU A 1 135 ? -6.482  40.609 -17.645 1.00 87.59  ? 211 GLU A CB  1 
ATOM   897 C CG  . GLU A 1 135 ? -5.194  41.339 -17.307 1.00 100.61 ? 211 GLU A CG  1 
ATOM   898 C CD  . GLU A 1 135 ? -4.082  41.168 -18.324 1.00 121.76 ? 211 GLU A CD  1 
ATOM   899 O OE1 . GLU A 1 135 ? -3.575  40.032 -18.473 1.00 112.06 ? 211 GLU A OE1 1 
ATOM   900 O OE2 . GLU A 1 135 ? -3.714  42.174 -18.973 1.00 122.83 ? 211 GLU A OE2 1 
ATOM   901 N N   . ALA A 1 136 ? -9.256  39.037 -17.178 1.00 82.05  ? 212 ALA A N   1 
ATOM   902 C CA  . ALA A 1 136 ? -10.526 38.487 -17.662 1.00 80.87  ? 212 ALA A CA  1 
ATOM   903 C C   . ALA A 1 136 ? -11.699 38.939 -16.785 1.00 85.07  ? 212 ALA A C   1 
ATOM   904 O O   . ALA A 1 136 ? -12.781 39.203 -17.310 1.00 85.50  ? 212 ALA A O   1 
ATOM   905 C CB  . ALA A 1 136 ? -10.456 36.968 -17.710 1.00 78.94  ? 212 ALA A CB  1 
ATOM   906 N N   . VAL A 1 137 ? -11.472 39.043 -15.454 1.00 81.46  ? 213 VAL A N   1 
ATOM   907 C CA  . VAL A 1 137 ? -12.460 39.505 -14.472 1.00 82.37  ? 213 VAL A CA  1 
ATOM   908 C C   . VAL A 1 137 ? -12.716 40.997 -14.719 1.00 89.72  ? 213 VAL A C   1 
ATOM   909 O O   . VAL A 1 137 ? -13.872 41.406 -14.847 1.00 90.82  ? 213 VAL A O   1 
ATOM   910 C CB  . VAL A 1 137 ? -12.007 39.222 -13.009 1.00 85.53  ? 213 VAL A CB  1 
ATOM   911 C CG1 . VAL A 1 137 ? -12.842 40.004 -11.998 1.00 87.20  ? 213 VAL A CG1 1 
ATOM   912 C CG2 . VAL A 1 137 ? -12.053 37.732 -12.694 1.00 82.93  ? 213 VAL A CG2 1 
ATOM   913 N N   . MET A 1 138 ? -11.626 41.788 -14.819 1.00 87.90  ? 214 MET A N   1 
ATOM   914 C CA  . MET A 1 138 ? -11.644 43.230 -15.065 1.00 91.71  ? 214 MET A CA  1 
ATOM   915 C C   . MET A 1 138 ? -12.358 43.594 -16.368 1.00 97.17  ? 214 MET A C   1 
ATOM   916 O O   . MET A 1 138 ? -13.051 44.610 -16.405 1.00 100.15 ? 214 MET A O   1 
ATOM   917 C CB  . MET A 1 138 ? -10.223 43.810 -15.027 1.00 95.72  ? 214 MET A CB  1 
ATOM   918 C CG  . MET A 1 138 ? -9.660  43.920 -13.623 1.00 99.61  ? 214 MET A CG  1 
ATOM   919 S SD  . MET A 1 138 ? -8.062  44.768 -13.532 1.00 107.00 ? 214 MET A SD  1 
ATOM   920 C CE  . MET A 1 138 ? -6.952  43.432 -13.926 1.00 100.09 ? 214 MET A CE  1 
ATOM   921 N N   . ARG A 1 139 ? -12.220 42.749 -17.416 1.00 91.65  ? 215 ARG A N   1 
ATOM   922 C CA  . ARG A 1 139 ? -12.872 42.918 -18.721 1.00 92.84  ? 215 ARG A CA  1 
ATOM   923 C C   . ARG A 1 139 ? -14.395 42.805 -18.589 1.00 96.69  ? 215 ARG A C   1 
ATOM   924 O O   . ARG A 1 139 ? -15.118 43.622 -19.161 1.00 99.67  ? 215 ARG A O   1 
ATOM   925 C CB  . ARG A 1 139 ? -12.369 41.866 -19.725 1.00 91.03  ? 215 ARG A CB  1 
ATOM   926 C CG  . ARG A 1 139 ? -11.049 42.204 -20.399 1.00 104.31 ? 215 ARG A CG  1 
ATOM   927 C CD  . ARG A 1 139 ? -10.641 41.099 -21.355 1.00 114.83 ? 215 ARG A CD  1 
ATOM   928 N NE  . ARG A 1 139 ? -9.289  40.608 -21.083 1.00 125.57 ? 215 ARG A NE  1 
ATOM   929 C CZ  . ARG A 1 139 ? -8.919  39.334 -21.176 1.00 138.95 ? 215 ARG A CZ  1 
ATOM   930 N NH1 . ARG A 1 139 ? -9.797  38.402 -21.528 1.00 124.72 ? 215 ARG A NH1 1 
ATOM   931 N NH2 . ARG A 1 139 ? -7.668  38.980 -20.911 1.00 126.13 ? 215 ARG A NH2 1 
ATOM   932 N N   . TYR A 1 140 ? -14.873 41.793 -17.831 1.00 89.93  ? 216 TYR A N   1 
ATOM   933 C CA  . TYR A 1 140 ? -16.293 41.522 -17.602 1.00 89.83  ? 216 TYR A CA  1 
ATOM   934 C C   . TYR A 1 140 ? -16.979 42.593 -16.754 1.00 97.13  ? 216 TYR A C   1 
ATOM   935 O O   . TYR A 1 140 ? -18.138 42.916 -17.019 1.00 98.85  ? 216 TYR A O   1 
ATOM   936 C CB  . TYR A 1 140 ? -16.492 40.123 -16.990 1.00 87.34  ? 216 TYR A CB  1 
ATOM   937 C CG  . TYR A 1 140 ? -17.942 39.714 -16.840 1.00 89.17  ? 216 TYR A CG  1 
ATOM   938 C CD1 . TYR A 1 140 ? -18.668 39.232 -17.925 1.00 91.40  ? 216 TYR A CD1 1 
ATOM   939 C CD2 . TYR A 1 140 ? -18.585 39.793 -15.608 1.00 90.24  ? 216 TYR A CD2 1 
ATOM   940 C CE1 . TYR A 1 140 ? -20.002 38.851 -17.792 1.00 92.99  ? 216 TYR A CE1 1 
ATOM   941 C CE2 . TYR A 1 140 ? -19.920 39.417 -15.463 1.00 91.91  ? 216 TYR A CE2 1 
ATOM   942 C CZ  . TYR A 1 140 ? -20.625 38.946 -16.558 1.00 99.64  ? 216 TYR A CZ  1 
ATOM   943 O OH  . TYR A 1 140 ? -21.938 38.570 -16.420 1.00 101.88 ? 216 TYR A OH  1 
ATOM   944 N N   . LEU A 1 141 ? -16.274 43.133 -15.738 1.00 94.45  ? 217 LEU A N   1 
ATOM   945 C CA  . LEU A 1 141 ? -16.800 44.161 -14.831 1.00 97.31  ? 217 LEU A CA  1 
ATOM   946 C C   . LEU A 1 141 ? -17.146 45.484 -15.530 1.00 106.37 ? 217 LEU A C   1 
ATOM   947 O O   . LEU A 1 141 ? -17.997 46.225 -15.031 1.00 108.83 ? 217 LEU A O   1 
ATOM   948 C CB  . LEU A 1 141 ? -15.855 44.401 -13.636 1.00 96.95  ? 217 LEU A CB  1 
ATOM   949 C CG  . LEU A 1 141 ? -15.648 43.237 -12.653 1.00 98.04  ? 217 LEU A CG  1 
ATOM   950 C CD1 . LEU A 1 141 ? -14.431 43.475 -11.788 1.00 98.06  ? 217 LEU A CD1 1 
ATOM   951 C CD2 . LEU A 1 141 ? -16.876 43.005 -11.778 1.00 100.75 ? 217 LEU A CD2 1 
ATOM   952 N N   . GLN A 1 142 ? -16.509 45.766 -16.688 1.00 104.53 ? 218 GLN A N   1 
ATOM   953 C CA  . GLN A 1 142 ? -16.749 46.972 -17.491 1.00 109.63 ? 218 GLN A CA  1 
ATOM   954 C C   . GLN A 1 142 ? -18.131 46.935 -18.152 1.00 115.54 ? 218 GLN A C   1 
ATOM   955 O O   . GLN A 1 142 ? -18.744 47.986 -18.347 1.00 119.88 ? 218 GLN A O   1 
ATOM   956 C CB  . GLN A 1 142 ? -15.660 47.160 -18.569 1.00 111.90 ? 218 GLN A CB  1 
ATOM   957 C CG  . GLN A 1 142 ? -14.212 47.194 -18.065 1.00 128.57 ? 218 GLN A CG  1 
ATOM   958 C CD  . GLN A 1 142 ? -13.953 48.222 -16.989 1.00 153.35 ? 218 GLN A CD  1 
ATOM   959 O OE1 . GLN A 1 142 ? -14.030 49.435 -17.215 1.00 154.90 ? 218 GLN A OE1 1 
ATOM   960 N NE2 . GLN A 1 142 ? -13.624 47.754 -15.794 1.00 142.97 ? 218 GLN A NE2 1 
ATOM   961 N N   . THR A 1 143 ? -18.611 45.723 -18.495 1.00 108.92 ? 219 THR A N   1 
ATOM   962 C CA  . THR A 1 143 ? -19.909 45.476 -19.134 1.00 110.07 ? 219 THR A CA  1 
ATOM   963 C C   . THR A 1 143 ? -21.077 45.753 -18.171 1.00 115.69 ? 219 THR A C   1 
ATOM   964 O O   . THR A 1 143 ? -22.162 46.130 -18.621 1.00 118.45 ? 219 THR A O   1 
ATOM   965 C CB  . THR A 1 143 ? -19.964 44.041 -19.700 1.00 114.68 ? 219 THR A CB  1 
ATOM   966 O OG1 . THR A 1 143 ? -18.667 43.643 -20.154 1.00 111.41 ? 219 THR A OG1 1 
ATOM   967 C CG2 . THR A 1 143 ? -20.975 43.891 -20.833 1.00 115.90 ? 219 THR A CG2 1 
ATOM   968 N N   . LEU A 1 144 ? -20.852 45.568 -16.857 1.00 110.45 ? 220 LEU A N   1 
ATOM   969 C CA  . LEU A 1 144 ? -21.860 45.766 -15.810 1.00 111.59 ? 220 LEU A CA  1 
ATOM   970 C C   . LEU A 1 144 ? -22.052 47.246 -15.467 1.00 120.37 ? 220 LEU A C   1 
ATOM   971 O O   . LEU A 1 144 ? -21.067 47.962 -15.264 1.00 120.94 ? 220 LEU A O   1 
ATOM   972 C CB  . LEU A 1 144 ? -21.499 44.968 -14.539 1.00 108.03 ? 220 LEU A CB  1 
ATOM   973 C CG  . LEU A 1 144 ? -21.149 43.483 -14.706 1.00 108.07 ? 220 LEU A CG  1 
ATOM   974 C CD1 . LEU A 1 144 ? -20.319 42.993 -13.543 1.00 105.60 ? 220 LEU A CD1 1 
ATOM   975 C CD2 . LEU A 1 144 ? -22.397 42.625 -14.873 1.00 110.04 ? 220 LEU A CD2 1 
ATOM   976 N N   . SER A 1 145 ? -23.332 47.685 -15.382 1.00 120.39 ? 221 SER A N   1 
ATOM   977 C CA  . SER A 1 145 ? -23.790 49.047 -15.058 1.00 157.72 ? 221 SER A CA  1 
ATOM   978 C C   . SER A 1 145 ? -23.005 50.179 -15.719 1.00 191.19 ? 221 SER A C   1 
ATOM   979 O O   . SER A 1 145 ? -23.325 50.579 -16.837 1.00 156.02 ? 221 SER A O   1 
ATOM   980 C CB  . SER A 1 145 ? -23.886 49.256 -13.549 1.00 161.32 ? 221 SER A CB  1 
ATOM   981 O OG  . SER A 1 145 ? -22.663 48.978 -12.889 1.00 166.84 ? 221 SER A OG  1 
HETATM 982 S S1  . DTT B 2 .   ? -14.698 20.755 -6.781  1.00 97.75  ? 300 DTT A S1  1 
HETATM 983 C C1  . DTT B 2 .   ? -16.046 21.198 -5.656  1.00 91.68  ? 300 DTT A C1  1 
HETATM 984 C C2  . DTT B 2 .   ? -16.201 22.726 -5.548  1.00 144.18 ? 300 DTT A C2  1 
HETATM 985 O O2  . DTT B 2 .   ? -15.798 23.222 -4.285  1.00 135.40 ? 300 DTT A O2  1 
HETATM 986 C C3  . DTT B 2 .   ? -17.630 23.173 -5.906  1.00 144.26 ? 300 DTT A C3  1 
HETATM 987 O O3  . DTT B 2 .   ? -18.537 22.727 -4.916  1.00 116.54 ? 300 DTT A O3  1 
HETATM 988 C C4  . DTT B 2 .   ? -17.696 24.707 -6.054  1.00 230.89 ? 300 DTT A C4  1 
HETATM 989 S S4  . DTT B 2 .   ? -17.295 25.327 -7.712  1.00 95.62  ? 300 DTT A S4  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . SER A 3   ? 1.4727 1.4638 1.2255 0.5078  -0.3855 -0.0526 79  SER A N   
2   C CA  . SER A 3   ? 1.5653 1.5188 1.3096 0.5775  -0.4191 -0.0375 79  SER A CA  
3   C C   . SER A 3   ? 1.6260 1.4744 1.3681 0.5640  -0.3753 -0.0031 79  SER A C   
4   O O   . SER A 3   ? 1.7430 1.4936 1.4209 0.6131  -0.3892 0.0413  79  SER A O   
5   C CB  . SER A 3   ? 1.5752 1.6518 1.4478 0.6117  -0.4635 -0.1045 79  SER A CB  
6   O OG  . SER A 3   ? 1.7012 1.8700 1.5799 0.6347  -0.5182 -0.1423 79  SER A OG  
7   N N   . SER A 4   ? 1.4678 1.3327 1.2787 0.5007  -0.3259 -0.0251 80  SER A N   
8   C CA  . SER A 4   ? 1.4683 1.2492 1.2889 0.4821  -0.2873 -0.0109 80  SER A CA  
9   C C   . SER A 4   ? 1.4194 1.2069 1.2556 0.4052  -0.2356 -0.0174 80  SER A C   
10  O O   . SER A 4   ? 1.3242 1.2036 1.2113 0.3725  -0.2274 -0.0502 80  SER A O   
11  C CB  . SER A 4   ? 1.5012 1.3248 1.4157 0.5192  -0.2995 -0.0559 80  SER A CB  
12  O OG  . SER A 4   ? 1.6260 1.3676 1.5469 0.5078  -0.2686 -0.0533 80  SER A OG  
13  N N   . ARG A 5   ? 1.4010 1.0895 1.2003 0.3778  -0.2032 0.0127  81  ARG A N   
14  C CA  . ARG A 5   ? 1.3168 1.0084 1.1294 0.3130  -0.1617 0.0049  81  ARG A CA  
15  C C   . ARG A 5   ? 1.2910 1.0419 1.1792 0.3018  -0.1476 -0.0451 81  ARG A C   
16  O O   . ARG A 5   ? 1.2080 1.0060 1.1138 0.2587  -0.1237 -0.0601 81  ARG A O   
17  C CB  . ARG A 5   ? 1.3783 0.9565 1.1484 0.2889  -0.1362 0.0433  81  ARG A CB  
18  C CG  . ARG A 5   ? 1.4309 1.0221 1.2045 0.2264  -0.1020 0.0407  81  ARG A CG  
19  C CD  . ARG A 5   ? 1.6001 1.0945 1.3649 0.1977  -0.0768 0.0660  81  ARG A CD  
20  N NE  . ARG A 5   ? 1.6124 1.1373 1.4033 0.1444  -0.0521 0.0475  81  ARG A NE  
21  C CZ  . ARG A 5   ? 1.8192 1.2884 1.6257 0.1072  -0.0289 0.0576  81  ARG A CZ  
22  N NH1 . ARG A 5   ? 1.7953 1.1631 1.5943 0.1105  -0.0200 0.0921  81  ARG A NH1 
23  N NH2 . ARG A 5   ? 1.5661 1.0795 1.4028 0.0669  -0.0154 0.0336  81  ARG A NH2 
24  N N   . TRP A 6   ? 1.2847 1.0333 1.2119 0.3460  -0.1615 -0.0694 82  TRP A N   
25  C CA  . TRP A 6   ? 1.2375 1.0461 1.2272 0.3465  -0.1437 -0.1183 82  TRP A CA  
26  C C   . TRP A 6   ? 1.2194 1.1591 1.2757 0.3486  -0.1421 -0.1490 82  TRP A C   
27  O O   . TRP A 6   ? 1.1776 1.1789 1.2799 0.3426  -0.1149 -0.1826 82  TRP A O   
28  C CB  . TRP A 6   ? 1.3028 1.0515 1.3106 0.3953  -0.1555 -0.1384 82  TRP A CB  
29  C CG  . TRP A 6   ? 1.3675 1.0020 1.3443 0.3756  -0.1434 -0.1306 82  TRP A CG  
30  C CD1 . TRP A 6   ? 1.3870 0.9748 1.3264 0.3214  -0.1246 -0.1048 82  TRP A CD1 
31  C CD2 . TRP A 6   ? 1.4507 1.0080 1.4476 0.4098  -0.1515 -0.1571 82  TRP A CD2 
32  N NE1 . TRP A 6   ? 1.4469 0.9381 1.3900 0.3147  -0.1207 -0.1144 82  TRP A NE1 
33  C CE2 . TRP A 6   ? 1.5323 0.9960 1.5078 0.3680  -0.1379 -0.1472 82  TRP A CE2 
34  C CE3 . TRP A 6   ? 1.5238 1.0844 1.5646 0.4738  -0.1704 -0.1947 82  TRP A CE3 
35  C CZ2 . TRP A 6   ? 1.6150 0.9809 1.6131 0.3838  -0.1445 -0.1751 82  TRP A CZ2 
36  C CZ3 . TRP A 6   ? 1.6351 1.0944 1.6889 0.4955  -0.1765 -0.2209 82  TRP A CZ3 
37  C CH2 . TRP A 6   ? 1.6765 1.0369 1.7100 0.4486  -0.1642 -0.2125 82  TRP A CH2 
38  N N   . SER A 7   ? 1.1707 1.1549 1.2334 0.3555  -0.1688 -0.1391 83  SER A N   
39  C CA  . SER A 7   ? 1.1130 1.2208 1.2590 0.3502  -0.1711 -0.1711 83  SER A CA  
40  C C   . SER A 7   ? 1.0870 1.2367 1.2504 0.2873  -0.1286 -0.1730 83  SER A C   
41  O O   . SER A 7   ? 1.0470 1.2857 1.2887 0.2747  -0.1042 -0.1992 83  SER A O   
42  C CB  . SER A 7   ? 1.1803 1.3158 1.3226 0.3734  -0.2192 -0.1673 83  SER A CB  
43  O OG  . SER A 7   ? 1.2839 1.3748 1.3529 0.3394  -0.2183 -0.1368 83  SER A OG  
44  N N   . LYS A 8   ? 1.0271 1.1123 1.1203 0.2501  -0.1174 -0.1426 84  LYS A N   
45  C CA  . LYS A 8   ? 0.9679 1.0710 1.0618 0.1979  -0.0835 -0.1371 84  LYS A CA  
46  C C   . LYS A 8   ? 1.0278 1.0728 1.0710 0.1839  -0.0572 -0.1283 84  LYS A C   
47  O O   . LYS A 8   ? 1.0582 1.0262 1.0522 0.1932  -0.0683 -0.1149 84  LYS A O   
48  C CB  . LYS A 8   ? 0.9783 1.0675 1.0436 0.1731  -0.0983 -0.1204 84  LYS A CB  
49  C CG  . LYS A 8   ? 1.1051 1.2716 1.2394 0.1726  -0.1201 -0.1443 84  LYS A CG  
50  C CD  . LYS A 8   ? 1.2218 1.3668 1.3101 0.1719  -0.1505 -0.1379 84  LYS A CD  
51  C CE  . LYS A 8   ? 1.3241 1.5422 1.4885 0.1588  -0.1712 -0.1721 84  LYS A CE  
52  N NZ  . LYS A 8   ? 1.4644 1.7522 1.6912 0.1990  -0.2117 -0.2054 84  LYS A NZ  
53  N N   . ASP A 9   ? 0.9660 1.0484 1.0221 0.1623  -0.0224 -0.1360 85  ASP A N   
54  C CA  . ASP A 9   ? 0.9800 1.0255 0.9870 0.1552  -0.0031 -0.1380 85  ASP A CA  
55  C C   . ASP A 9   ? 1.0250 1.0113 0.9790 0.1272  -0.0092 -0.1170 85  ASP A C   
56  O O   . ASP A 9   ? 1.0427 0.9933 0.9629 0.1267  -0.0070 -0.1264 85  ASP A O   
57  C CB  . ASP A 9   ? 1.0024 1.1107 1.0222 0.1497  0.0366  -0.1481 85  ASP A CB  
58  C CG  . ASP A 9   ? 1.1455 1.3128 1.2132 0.1847  0.0510  -0.1798 85  ASP A CG  
59  O OD1 . ASP A 9   ? 1.1651 1.3217 1.2622 0.2179  0.0227  -0.1962 85  ASP A OD1 
60  O OD2 . ASP A 9   ? 1.2359 1.4607 1.3090 0.1827  0.0924  -0.1864 85  ASP A OD2 
61  N N   . TYR A 10  ? 0.9582 0.9409 0.9121 0.1068  -0.0194 -0.0964 86  TYR A N   
62  C CA  . TYR A 10  ? 0.9484 0.8892 0.8651 0.0834  -0.0231 -0.0800 86  TYR A CA  
63  C C   . TYR A 10  ? 1.0178 0.9309 0.9208 0.0856  -0.0415 -0.0644 86  TYR A C   
64  O O   . TYR A 10  ? 1.0172 0.9549 0.9369 0.1016  -0.0566 -0.0659 86  TYR A O   
65  C CB  . TYR A 10  ? 0.9332 0.8989 0.8509 0.0584  -0.0091 -0.0712 86  TYR A CB  
66  C CG  . TYR A 10  ? 0.9700 0.9456 0.8659 0.0589  0.0101  -0.0757 86  TYR A CG  
67  C CD1 . TYR A 10  ? 1.0105 0.9565 0.8681 0.0578  0.0031  -0.0817 86  TYR A CD1 
68  C CD2 . TYR A 10  ? 0.9899 1.0112 0.9035 0.0621  0.0359  -0.0756 86  TYR A CD2 
69  C CE1 . TYR A 10  ? 1.0524 1.0114 0.8740 0.0674  0.0135  -0.0900 86  TYR A CE1 
70  C CE2 . TYR A 10  ? 1.0375 1.0691 0.9093 0.0691  0.0573  -0.0753 86  TYR A CE2 
71  C CZ  . TYR A 10  ? 1.1494 1.1484 0.9672 0.0753  0.0420  -0.0834 86  TYR A CZ  
72  O OH  . TYR A 10  ? 1.2081 1.2211 0.9699 0.0907  0.0560  -0.0871 86  TYR A OH  
73  N N   . ASP A 11  ? 0.9979 0.8665 0.8710 0.0717  -0.0396 -0.0516 87  ASP A N   
74  C CA  . ASP A 11  ? 1.0270 0.8692 0.8719 0.0732  -0.0457 -0.0305 87  ASP A CA  
75  C C   . ASP A 11  ? 1.0608 0.9325 0.9013 0.0564  -0.0442 -0.0298 87  ASP A C   
76  O O   . ASP A 11  ? 1.0683 0.9538 0.8926 0.0686  -0.0565 -0.0271 87  ASP A O   
77  C CB  . ASP A 11  ? 1.0936 0.8741 0.9216 0.0637  -0.0348 -0.0152 87  ASP A CB  
78  C CG  . ASP A 11  ? 1.2610 0.9924 1.0953 0.0838  -0.0402 -0.0173 87  ASP A CG  
79  O OD1 . ASP A 11  ? 1.3603 1.0882 1.1874 0.1171  -0.0555 -0.0117 87  ASP A OD1 
80  O OD2 . ASP A 11  ? 1.2865 0.9833 1.1384 0.0695  -0.0333 -0.0296 87  ASP A OD2 
81  N N   . VAL A 12  ? 1.0009 0.8818 0.8536 0.0346  -0.0338 -0.0366 88  VAL A N   
82  C CA  . VAL A 12  ? 0.9847 0.8857 0.8406 0.0227  -0.0336 -0.0400 88  VAL A CA  
83  C C   . VAL A 12  ? 1.0295 0.9507 0.9115 0.0144  -0.0326 -0.0477 88  VAL A C   
84  O O   . VAL A 12  ? 1.0277 0.9487 0.9111 0.0144  -0.0256 -0.0475 88  VAL A O   
85  C CB  . VAL A 12  ? 1.0409 0.9312 0.8877 0.0096  -0.0221 -0.0358 88  VAL A CB  
86  C CG1 . VAL A 12  ? 1.0408 0.9503 0.8773 0.0121  -0.0227 -0.0405 88  VAL A CG1 
87  C CG2 . VAL A 12  ? 1.0802 0.9358 0.9136 0.0066  -0.0102 -0.0206 88  VAL A CG2 
88  N N   . CYS A 13  ? 0.9912 0.9248 0.8889 0.0093  -0.0382 -0.0538 89  CYS A N   
89  C CA  . CYS A 13  ? 0.9885 0.9247 0.9130 -0.0009 -0.0345 -0.0526 89  CYS A CA  
90  C C   . CYS A 13  ? 1.0289 0.9543 0.9548 -0.0026 -0.0412 -0.0595 89  CYS A C   
91  O O   . CYS A 13  ? 1.0272 0.9607 0.9488 0.0032  -0.0500 -0.0749 89  CYS A O   
92  C CB  . CYS A 13  ? 1.0001 0.9591 0.9693 -0.0057 -0.0372 -0.0610 89  CYS A CB  
93  S SG  . CYS A 13  ? 1.0697 1.0241 1.0786 -0.0257 -0.0156 -0.0442 89  CYS A SG  
94  N N   . VAL A 14  ? 0.9868 0.8956 0.9129 -0.0040 -0.0385 -0.0495 90  VAL A N   
95  C CA  . VAL A 14  ? 0.9902 0.8883 0.9259 0.0018  -0.0480 -0.0594 90  VAL A CA  
96  C C   . VAL A 14  ? 1.0659 0.9335 1.0315 -0.0029 -0.0504 -0.0526 90  VAL A C   
97  O O   . VAL A 14  ? 1.0873 0.9302 1.0422 -0.0020 -0.0435 -0.0256 90  VAL A O   
98  C CB  . VAL A 14  ? 1.0350 0.9388 0.9562 0.0115  -0.0513 -0.0597 90  VAL A CB  
99  C CG1 . VAL A 14  ? 1.0442 0.9465 0.9866 0.0243  -0.0621 -0.0756 90  VAL A CG1 
100 C CG2 . VAL A 14  ? 1.0149 0.9405 0.9260 0.0068  -0.0436 -0.0666 90  VAL A CG2 
101 N N   . CYS A 15  ? 1.0305 0.8964 1.0314 -0.0068 -0.0605 -0.0774 91  CYS A N   
102 C CA  . CYS A 15  ? 1.0700 0.8973 1.1187 -0.0167 -0.0642 -0.0782 91  CYS A CA  
103 C C   . CYS A 15  ? 1.1393 0.9338 1.1907 0.0024  -0.0776 -0.0877 91  CYS A C   
104 O O   . CYS A 15  ? 1.1237 0.9407 1.1717 0.0185  -0.0896 -0.1229 91  CYS A O   
105 C CB  . CYS A 15  ? 1.0811 0.9259 1.1800 -0.0290 -0.0764 -0.1134 91  CYS A CB  
106 S SG  . CYS A 15  ? 1.1933 0.9852 1.3804 -0.0538 -0.0780 -0.1186 91  CYS A SG  
107 N N   . HIS A 16  ? 1.1386 0.8813 1.1906 0.0055  -0.0736 -0.0540 92  HIS A N   
108 C CA  . HIS A 16  ? 1.1767 0.8814 1.2320 0.0324  -0.0906 -0.0575 92  HIS A CA  
109 C C   . HIS A 16  ? 1.3045 0.9248 1.3825 0.0290  -0.0875 -0.0219 92  HIS A C   
110 O O   . HIS A 16  ? 1.3246 0.9231 1.3996 0.0050  -0.0629 0.0193  92  HIS A O   
111 C CB  . HIS A 16  ? 1.1712 0.9046 1.1782 0.0568  -0.0956 -0.0443 92  HIS A CB  
112 C CG  . HIS A 16  ? 1.2449 0.9595 1.2046 0.0568  -0.0847 0.0049  92  HIS A CG  
113 N ND1 . HIS A 16  ? 1.2385 0.9810 1.1752 0.0357  -0.0631 0.0191  92  HIS A ND1 
114 C CD2 . HIS A 16  ? 1.3368 1.0090 1.2614 0.0821  -0.0935 0.0406  92  HIS A CD2 
115 C CE1 . HIS A 16  ? 1.2827 1.0037 1.1689 0.0469  -0.0556 0.0594  92  HIS A CE1 
116 N NE2 . HIS A 16  ? 1.3512 1.0285 1.2218 0.0757  -0.0744 0.0767  92  HIS A NE2 
117 N N   . SER A 17  ? 1.3107 0.8818 1.4115 0.0552  -0.1088 -0.0350 93  SER A N   
118 C CA  . SER A 17  ? 1.4117 0.8820 1.5305 0.0590  -0.1083 0.0050  93  SER A CA  
119 C C   . SER A 17  ? 1.5032 0.9523 1.5473 0.0908  -0.1098 0.0616  93  SER A C   
120 O O   . SER A 17  ? 1.4414 0.9572 1.4443 0.1141  -0.1227 0.0476  93  SER A O   
121 C CB  . SER A 17  ? 1.5071 0.9288 1.6828 0.0821  -0.1365 -0.0395 93  SER A CB  
122 O OG  . SER A 17  ? 1.6002 1.0643 1.7565 0.1281  -0.1605 -0.0708 93  SER A OG  
123 N N   . GLU A 18  ? 1.5726 0.9282 1.5993 0.0928  -0.0973 0.1249  94  GLU A N   
124 C CA  . GLU A 18  ? 1.6488 0.9736 1.5860 0.1309  -0.1014 0.1859  94  GLU A CA  
125 C C   . GLU A 18  ? 1.6929 1.0431 1.6059 0.1913  -0.1488 0.1599  94  GLU A C   
126 O O   . GLU A 18  ? 1.7034 1.0844 1.5413 0.2226  -0.1617 0.1826  94  GLU A O   
127 C CB  . GLU A 18  ? 1.8170 1.0192 1.7390 0.1259  -0.0770 0.2644  94  GLU A CB  
128 C CG  . GLU A 18  ? 2.0393 1.1366 2.0353 0.1345  -0.0954 0.2563  94  GLU A CG  
129 C CD  . GLU A 18  ? 2.4772 1.4341 2.4437 0.1427  -0.0761 0.3464  94  GLU A CD  
130 O OE1 . GLU A 18  ? 2.4545 1.3764 2.4238 0.0941  -0.0228 0.4018  94  GLU A OE1 
131 O OE2 . GLU A 18  ? 2.4876 1.3693 2.4310 0.1993  -0.1122 0.3637  94  GLU A OE2 
132 N N   . GLU A 19  ? 1.6321 0.9791 1.6143 0.2095  -0.1758 0.1052  95  GLU A N   
133 C CA  . GLU A 19  ? 1.6284 1.0118 1.6171 0.2666  -0.2182 0.0694  95  GLU A CA  
134 C C   . GLU A 19  ? 1.5571 1.0717 1.5424 0.2658  -0.2235 0.0226  95  GLU A C   
135 O O   . GLU A 19  ? 1.5620 1.1197 1.5288 0.3076  -0.2538 0.0157  95  GLU A O   
136 C CB  . GLU A 19  ? 1.6702 1.0174 1.7411 0.2856  -0.2376 0.0177  95  GLU A CB  
137 C CG  . GLU A 19  ? 1.9435 1.1445 2.0319 0.2959  -0.2418 0.0599  95  GLU A CG  
138 C CD  . GLU A 19  ? 2.2443 1.3993 2.4155 0.3249  -0.2682 0.0013  95  GLU A CD  
139 O OE1 . GLU A 19  ? 2.0644 1.2960 2.2875 0.3138  -0.2677 -0.0768 95  GLU A OE1 
140 O OE2 . GLU A 19  ? 2.3083 1.3443 2.4873 0.3617  -0.2884 0.0349  95  GLU A OE2 
141 N N   . ASP A 20  ? 1.4114 0.9866 1.4199 0.2196  -0.1964 -0.0100 96  ASP A N   
142 C CA  . ASP A 20  ? 1.3091 0.9933 1.3223 0.2104  -0.1929 -0.0492 96  ASP A CA  
143 C C   . ASP A 20  ? 1.3205 1.0347 1.2775 0.1850  -0.1759 -0.0207 96  ASP A C   
144 O O   . ASP A 20  ? 1.2370 1.0052 1.2018 0.1532  -0.1558 -0.0417 96  ASP A O   
145 C CB  . ASP A 20  ? 1.2662 0.9953 1.3279 0.1869  -0.1758 -0.1013 96  ASP A CB  
146 C CG  . ASP A 20  ? 1.4399 1.1226 1.5506 0.2042  -0.1866 -0.1327 96  ASP A CG  
147 O OD1 . ASP A 20  ? 1.4668 1.1685 1.6118 0.2455  -0.2073 -0.1655 96  ASP A OD1 
148 O OD2 . ASP A 20  ? 1.5341 1.1661 1.6580 0.1779  -0.1765 -0.1312 96  ASP A OD2 
149 N N   . LEU A 21  ? 1.3483 1.0251 1.2421 0.2049  -0.1849 0.0265  97  LEU A N   
150 C CA  . LEU A 21  ? 1.3344 1.0388 1.1667 0.1908  -0.1713 0.0478  97  LEU A CA  
151 C C   . LEU A 21  ? 1.3252 1.1178 1.1669 0.1999  -0.1924 0.0042  97  LEU A C   
152 O O   . LEU A 21  ? 1.2635 1.0955 1.0994 0.1706  -0.1743 -0.0086 97  LEU A O   
153 C CB  . LEU A 21  ? 1.4520 1.0920 1.1998 0.2167  -0.1723 0.1112  97  LEU A CB  
154 C CG  . LEU A 21  ? 1.5275 1.1942 1.1961 0.2118  -0.1561 0.1325  97  LEU A CG  
155 C CD1 . LEU A 21  ? 1.4947 1.1540 1.1726 0.1620  -0.1052 0.1499  97  LEU A CD1 
156 C CD2 . LEU A 21  ? 1.7002 1.3189 1.2675 0.2580  -0.1689 0.1877  97  LEU A CD2 
157 N N   . VAL A 22  ? 1.3030 1.1260 1.1715 0.2400  -0.2312 -0.0218 98  VAL A N   
158 C CA  . VAL A 22  ? 1.2596 1.1729 1.1642 0.2474  -0.2549 -0.0702 98  VAL A CA  
159 C C   . VAL A 22  ? 1.2177 1.1883 1.1948 0.2036  -0.2248 -0.1103 98  VAL A C   
160 O O   . VAL A 22  ? 1.1742 1.1893 1.1598 0.1784  -0.2169 -0.1290 98  VAL A O   
161 C CB  . VAL A 22  ? 1.3595 1.3016 1.2937 0.3043  -0.3062 -0.0926 98  VAL A CB  
162 C CG1 . VAL A 22  ? 1.3194 1.3650 1.3076 0.3068  -0.3329 -0.1482 98  VAL A CG1 
163 C CG2 . VAL A 22  ? 1.4797 1.3496 1.3221 0.3550  -0.3360 -0.0407 98  VAL A CG2 
164 N N   . ALA A 23  ? 1.1544 1.1170 1.1765 0.1971  -0.2074 -0.1221 99  ALA A N   
165 C CA  . ALA A 23  ? 1.0868 1.0976 1.1574 0.1637  -0.1746 -0.1520 99  ALA A CA  
166 C C   . ALA A 23  ? 1.1086 1.1010 1.1410 0.1216  -0.1429 -0.1321 99  ALA A C   
167 O O   . ALA A 23  ? 1.0663 1.1011 1.1208 0.0953  -0.1214 -0.1477 99  ALA A O   
168 C CB  . ALA A 23  ? 1.1046 1.1027 1.2081 0.1763  -0.1671 -0.1697 99  ALA A CB  
169 N N   . ALA A 24  ? 1.0893 1.0186 1.0701 0.1164  -0.1385 -0.0959 100 ALA A N   
170 C CA  . ALA A 24  ? 1.0580 0.9739 1.0094 0.0845  -0.1133 -0.0791 100 ALA A CA  
171 C C   . ALA A 24  ? 1.0933 1.0318 1.0200 0.0778  -0.1153 -0.0784 100 ALA A C   
172 O O   . ALA A 24  ? 1.0566 1.0066 0.9839 0.0538  -0.0967 -0.0827 100 ALA A O   
173 C CB  . ALA A 24  ? 1.1027 0.9583 1.0273 0.0809  -0.1059 -0.0455 100 ALA A CB  
174 N N   . GLN A 25  ? 1.0868 1.0286 0.9891 0.1043  -0.1420 -0.0759 101 GLN A N   
175 C CA  . GLN A 25  ? 1.0927 1.0589 0.9703 0.1063  -0.1541 -0.0883 101 GLN A CA  
176 C C   . GLN A 25  ? 1.0962 1.1178 1.0414 0.0888  -0.1579 -0.1313 101 GLN A C   
177 O O   . GLN A 25  ? 1.0788 1.1083 1.0251 0.0702  -0.1521 -0.1452 101 GLN A O   
178 C CB  . GLN A 25  ? 1.1849 1.1451 1.0096 0.1487  -0.1889 -0.0787 101 GLN A CB  
179 C CG  . GLN A 25  ? 1.4365 1.3403 1.1778 0.1593  -0.1724 -0.0273 101 GLN A CG  
180 C CD  . GLN A 25  ? 1.7861 1.6711 1.4591 0.2087  -0.2042 -0.0043 101 GLN A CD  
181 O OE1 . GLN A 25  ? 1.7664 1.6361 1.4567 0.2367  -0.2291 0.0016  101 GLN A OE1 
182 N NE2 . GLN A 25  ? 1.7532 1.6363 1.3394 0.2267  -0.2038 0.0107  101 GLN A NE2 
183 N N   . ASP A 26  ? 1.0372 1.0960 1.0464 0.0938  -0.1640 -0.1532 102 ASP A N   
184 C CA  . ASP A 26  ? 1.0044 1.1238 1.0962 0.0717  -0.1566 -0.1905 102 ASP A CA  
185 C C   . ASP A 26  ? 1.0134 1.1190 1.1125 0.0319  -0.1110 -0.1784 102 ASP A C   
186 O O   . ASP A 26  ? 1.0004 1.1266 1.1431 0.0037  -0.0973 -0.1939 102 ASP A O   
187 C CB  . ASP A 26  ? 1.0282 1.1990 1.1877 0.0920  -0.1671 -0.2154 102 ASP A CB  
188 C CG  . ASP A 26  ? 1.2163 1.4105 1.3809 0.1389  -0.2206 -0.2328 102 ASP A CG  
189 O OD1 . ASP A 26  ? 1.2557 1.4488 1.3844 0.1509  -0.2518 -0.2384 102 ASP A OD1 
190 O OD2 . ASP A 26  ? 1.3096 1.5258 1.5120 0.1693  -0.2344 -0.2447 102 ASP A OD2 
191 N N   . LEU A 27  ? 0.9571 1.0242 1.0144 0.0315  -0.0907 -0.1512 103 LEU A N   
192 C CA  . LEU A 27  ? 0.9379 0.9883 0.9811 0.0065  -0.0556 -0.1359 103 LEU A CA  
193 C C   . LEU A 27  ? 0.9941 1.0085 1.0022 -0.0070 -0.0527 -0.1212 103 LEU A C   
194 O O   . LEU A 27  ? 0.9954 1.0028 1.0134 -0.0287 -0.0310 -0.1167 103 LEU A O   
195 C CB  . LEU A 27  ? 0.9360 0.9644 0.9496 0.0176  -0.0482 -0.1242 103 LEU A CB  
196 C CG  . LEU A 27  ? 0.9924 1.0059 0.9748 0.0044  -0.0230 -0.1104 103 LEU A CG  
197 C CD1 . LEU A 27  ? 1.0049 1.0495 1.0058 -0.0113 0.0087  -0.1127 103 LEU A CD1 
198 C CD2 . LEU A 27  ? 1.0264 1.0277 0.9918 0.0194  -0.0283 -0.1154 103 LEU A CD2 
199 N N   . VAL A 28  ? 0.9584 0.9484 0.9248 0.0085  -0.0715 -0.1123 104 VAL A N   
200 C CA  . VAL A 28  ? 0.9642 0.9291 0.8984 0.0041  -0.0692 -0.1061 104 VAL A CA  
201 C C   . VAL A 28  ? 1.0323 1.0104 1.0007 -0.0072 -0.0778 -0.1347 104 VAL A C   
202 O O   . VAL A 28  ? 1.0373 0.9915 1.0121 -0.0234 -0.0635 -0.1337 104 VAL A O   
203 C CB  . VAL A 28  ? 1.0330 0.9813 0.9151 0.0248  -0.0787 -0.0904 104 VAL A CB  
204 C CG1 . VAL A 28  ? 1.0516 0.9919 0.9040 0.0283  -0.0782 -0.0977 104 VAL A CG1 
205 C CG2 . VAL A 28  ? 1.0207 0.9484 0.8911 0.0229  -0.0634 -0.0642 104 VAL A CG2 
206 N N   . SER A 29  ? 1.0008 1.0157 1.0004 0.0023  -0.1042 -0.1631 105 SER A N   
207 C CA  . SER A 29  ? 1.0181 1.0565 1.0723 -0.0104 -0.1206 -0.2038 105 SER A CA  
208 C C   . SER A 29  ? 1.0570 1.1046 1.1899 -0.0493 -0.0906 -0.2083 105 SER A C   
209 O O   . SER A 29  ? 1.0781 1.1208 1.2626 -0.0724 -0.0919 -0.2338 105 SER A O   
210 C CB  . SER A 29  ? 1.0863 1.1736 1.1577 0.0162  -0.1641 -0.2372 105 SER A CB  
211 O OG  . SER A 29  ? 1.1873 1.3118 1.3013 0.0224  -0.1638 -0.2358 105 SER A OG  
212 N N   . TYR A 30  ? 0.9897 1.0476 1.1303 -0.0563 -0.0610 -0.1838 106 TYR A N   
213 C CA  . TYR A 30  ? 0.9948 1.0624 1.1905 -0.0903 -0.0200 -0.1757 106 TYR A CA  
214 C C   . TYR A 30  ? 1.0767 1.0768 1.2272 -0.1046 0.0075  -0.1401 106 TYR A C   
215 O O   . TYR A 30  ? 1.1065 1.0845 1.3012 -0.1353 0.0304  -0.1366 106 TYR A O   
216 C CB  . TYR A 30  ? 0.9884 1.0963 1.1899 -0.0819 0.0015  -0.1665 106 TYR A CB  
217 C CG  . TYR A 30  ? 1.0268 1.1594 1.2784 -0.1135 0.0527  -0.1565 106 TYR A CG  
218 C CD1 . TYR A 30  ? 1.0652 1.1535 1.2582 -0.1226 0.0920  -0.1139 106 TYR A CD1 
219 C CD2 . TYR A 30  ? 1.0520 1.2585 1.4083 -0.1308 0.0638  -0.1881 106 TYR A CD2 
220 C CE1 . TYR A 30  ? 1.1185 1.2252 1.3402 -0.1493 0.1472  -0.0943 106 TYR A CE1 
221 C CE2 . TYR A 30  ? 1.0926 1.3279 1.4978 -0.1635 0.1234  -0.1735 106 TYR A CE2 
222 C CZ  . TYR A 30  ? 1.2074 1.3881 1.5365 -0.1727 0.1682  -0.1222 106 TYR A CZ  
223 O OH  . TYR A 30  ? 1.2659 1.4705 1.6259 -0.2025 0.2345  -0.0979 106 TYR A OH  
224 N N   . LEU A 31  ? 1.0299 0.9971 1.1009 -0.0816 0.0044  -0.1139 107 LEU A N   
225 C CA  . LEU A 31  ? 1.0567 0.9677 1.0793 -0.0817 0.0205  -0.0822 107 LEU A CA  
226 C C   . LEU A 31  ? 1.1495 1.0157 1.1814 -0.0865 0.0089  -0.0931 107 LEU A C   
227 O O   . LEU A 31  ? 1.1926 1.0091 1.2278 -0.0998 0.0287  -0.0726 107 LEU A O   
228 C CB  . LEU A 31  ? 1.0337 0.9393 0.9928 -0.0547 0.0106  -0.0665 107 LEU A CB  
229 C CG  . LEU A 31  ? 1.0797 1.0122 1.0210 -0.0464 0.0215  -0.0583 107 LEU A CG  
230 C CD1 . LEU A 31  ? 1.0524 0.9895 0.9685 -0.0257 -0.0003 -0.0627 107 LEU A CD1 
231 C CD2 . LEU A 31  ? 1.1508 1.0623 1.0526 -0.0463 0.0465  -0.0298 107 LEU A CD2 
232 N N   . GLU A 32  ? 1.1037 0.9831 1.1342 -0.0717 -0.0228 -0.1251 108 GLU A N   
233 C CA  . GLU A 32  ? 1.1430 0.9873 1.1795 -0.0688 -0.0380 -0.1495 108 GLU A CA  
234 C C   . GLU A 32  ? 1.2389 1.0838 1.3573 -0.0971 -0.0450 -0.1873 108 GLU A C   
235 O O   . GLU A 32  ? 1.2823 1.0746 1.4256 -0.1073 -0.0447 -0.1997 108 GLU A O   
236 C CB  . GLU A 32  ? 1.1522 1.0134 1.1369 -0.0360 -0.0631 -0.1676 108 GLU A CB  
237 C CG  . GLU A 32  ? 1.2696 1.1816 1.2540 -0.0235 -0.0904 -0.1948 108 GLU A CG  
238 C CD  . GLU A 32  ? 1.5249 1.4506 1.4373 0.0108  -0.1038 -0.1935 108 GLU A CD  
239 O OE1 . GLU A 32  ? 1.4737 1.3798 1.3466 0.0221  -0.0882 -0.1763 108 GLU A OE1 
240 O OE2 . GLU A 32  ? 1.4510 1.4099 1.3474 0.0284  -0.1285 -0.2082 108 GLU A OE2 
241 N N   . GLY A 33  ? 1.1860 1.0906 1.3562 -0.1084 -0.0531 -0.2090 109 GLY A N   
242 C CA  . GLY A 33  ? 1.2176 1.1454 1.4897 -0.1382 -0.0636 -0.2544 109 GLY A CA  
243 C C   . GLY A 33  ? 1.3064 1.2178 1.6531 -0.1849 -0.0166 -0.2297 109 GLY A C   
244 O O   . GLY A 33  ? 1.2799 1.2425 1.6564 -0.1968 0.0084  -0.2148 109 GLY A O   
245 N N   . SER A 34  ? 1.3314 1.1679 1.7079 -0.2097 -0.0012 -0.2242 110 SER A N   
246 C CA  . SER A 34  ? 1.3869 1.1859 1.8294 -0.2576 0.0513  -0.1896 110 SER A CA  
247 C C   . SER A 34  ? 1.4872 1.2895 2.0703 -0.3033 0.0430  -0.2441 110 SER A C   
248 O O   . SER A 34  ? 1.5130 1.2792 2.1151 -0.2962 0.0025  -0.2935 110 SER A O   
249 C CB  . SER A 34  ? 1.4915 1.1854 1.8615 -0.2499 0.0776  -0.1310 110 SER A CB  
250 O OG  . SER A 34  ? 1.5642 1.2657 1.8203 -0.2094 0.0800  -0.0900 110 SER A OG  
251 N N   . THR A 35  ? 1.4563 1.3092 2.1452 -0.3498 0.0818  -0.2415 111 THR A N   
252 C CA  . THR A 35  ? 1.5015 1.3733 2.3555 -0.4038 0.0797  -0.2962 111 THR A CA  
253 C C   . THR A 35  ? 1.6573 1.4050 2.5547 -0.4466 0.1161  -0.2658 111 THR A C   
254 O O   . THR A 35  ? 1.7116 1.4558 2.7607 -0.5043 0.1289  -0.2998 111 THR A O   
255 N N   . THR A 48  ? 2.4403 1.4075 2.0898 0.5030  -0.2006 0.2265  124 THR A N   
256 C CA  . THR A 48  ? 2.4509 1.3713 2.0589 0.4334  -0.1503 0.2774  124 THR A CA  
257 C C   . THR A 48  ? 2.4036 1.3359 2.1002 0.3601  -0.1172 0.2245  124 THR A C   
258 O O   . THR A 48  ? 2.4849 1.2998 2.2161 0.3334  -0.0967 0.2369  124 THR A O   
259 C CB  . THR A 48  ? 2.7612 1.5163 2.2913 0.4523  -0.1355 0.3731  124 THR A CB  
260 O OG1 . THR A 48  ? 2.8586 1.5971 2.3148 0.5421  -0.1838 0.4067  124 THR A OG1 
261 C CG2 . THR A 48  ? 2.7766 1.5151 2.2413 0.3943  -0.0809 0.4376  124 THR A CG2 
262 N N   . PRO A 49  ? 2.1951 1.2634 1.9311 0.3287  -0.1144 0.1645  125 PRO A N   
263 C CA  . PRO A 49  ? 2.1182 1.2013 1.9252 0.2713  -0.0921 0.1130  125 PRO A CA  
264 C C   . PRO A 49  ? 2.1509 1.2143 1.9545 0.2010  -0.0502 0.1441  125 PRO A C   
265 O O   . PRO A 49  ? 2.0835 1.2184 1.8463 0.1811  -0.0355 0.1656  125 PRO A O   
266 C CB  . PRO A 49  ? 1.9956 1.2244 1.8312 0.2755  -0.1050 0.0494  125 PRO A CB  
267 C CG  . PRO A 49  ? 2.0442 1.3365 1.8438 0.3276  -0.1327 0.0637  125 PRO A CG  
268 C CD  . PRO A 49  ? 2.1034 1.3125 1.8260 0.3457  -0.1338 0.1390  125 PRO A CD  
269 N N   . GLY A 50  ? 2.1682 1.1380 2.0263 0.1649  -0.0324 0.1393  126 GLY A N   
270 C CA  . GLY A 50  ? 2.1662 1.1183 2.0529 0.0942  0.0091  0.1595  126 GLY A CA  
271 C C   . GLY A 50  ? 2.0964 1.1240 2.0600 0.0517  0.0061  0.0824  126 GLY A C   
272 O O   . GLY A 50  ? 2.1386 1.1085 2.1786 0.0135  0.0136  0.0546  126 GLY A O   
273 N N   . GLY A 51  ? 1.9107 1.0643 1.8549 0.0605  -0.0076 0.0475  127 GLY A N   
274 C CA  . GLY A 51  ? 1.8083 1.0437 1.8003 0.0332  -0.0152 -0.0192 127 GLY A CA  
275 C C   . GLY A 51  ? 1.7557 1.0803 1.7378 -0.0018 0.0029  -0.0091 127 GLY A C   
276 O O   . GLY A 51  ? 1.7520 1.0859 1.6868 -0.0038 0.0229  0.0444  127 GLY A O   
277 N N   . ALA A 52  ? 1.6351 1.0260 1.6569 -0.0229 -0.0073 -0.0640 128 ALA A N   
278 C CA  . ALA A 52  ? 1.5468 1.0230 1.5706 -0.0498 0.0027  -0.0651 128 ALA A CA  
279 C C   . ALA A 52  ? 1.5035 1.0543 1.4662 -0.0215 -0.0044 -0.0543 128 ALA A C   
280 O O   . ALA A 52  ? 1.4926 1.0494 1.4260 0.0154  -0.0197 -0.0607 128 ALA A O   
281 C CB  . ALA A 52  ? 1.5297 1.0472 1.6110 -0.0699 -0.0160 -0.1289 128 ALA A CB  
282 N N   . ILE A 53  ? 1.3938 1.0029 1.3494 -0.0397 0.0077  -0.0420 129 ILE A N   
283 C CA  . ILE A 53  ? 1.3191 0.9919 1.2324 -0.0213 0.0018  -0.0350 129 ILE A CA  
284 C C   . ILE A 53  ? 1.3071 1.0292 1.2222 -0.0081 -0.0186 -0.0741 129 ILE A C   
285 O O   . ILE A 53  ? 1.2902 1.0342 1.2316 -0.0212 -0.0269 -0.1045 129 ILE A O   
286 C CB  . ILE A 53  ? 1.3344 1.0437 1.2459 -0.0423 0.0215  -0.0159 129 ILE A CB  
287 C CG1 . ILE A 53  ? 1.4010 1.0711 1.2744 -0.0409 0.0461  0.0328  129 ILE A CG1 
288 C CG2 . ILE A 53  ? 1.2767 1.0502 1.1685 -0.0301 0.0098  -0.0263 129 ILE A CG2 
289 C CD1 . ILE A 53  ? 1.5032 1.1951 1.3912 -0.0700 0.0806  0.0495  129 ILE A CD1 
290 N N   . VAL A 54  ? 1.2374 0.9804 1.1253 0.0193  -0.0256 -0.0724 130 VAL A N   
291 C CA  . VAL A 54  ? 1.2012 0.9899 1.0808 0.0328  -0.0327 -0.0968 130 VAL A CA  
292 C C   . VAL A 54  ? 1.1947 1.0290 1.0626 0.0264  -0.0284 -0.0805 130 VAL A C   
293 O O   . VAL A 54  ? 1.1728 1.0215 1.0372 0.0341  -0.0264 -0.0649 130 VAL A O   
294 C CB  . VAL A 54  ? 1.2687 1.0579 1.1446 0.0635  -0.0347 -0.1088 130 VAL A CB  
295 C CG1 . VAL A 54  ? 1.2539 1.0930 1.1154 0.0756  -0.0300 -0.1305 130 VAL A CG1 
296 C CG2 . VAL A 54  ? 1.3298 1.0570 1.2219 0.0742  -0.0421 -0.1253 130 VAL A CG2 
297 N N   . SER A 55  ? 1.1311 0.9860 0.9997 0.0147  -0.0319 -0.0883 131 SER A N   
298 C CA  . SER A 55  ? 1.0944 0.9773 0.9573 0.0105  -0.0304 -0.0746 131 SER A CA  
299 C C   . SER A 55  ? 1.1379 1.0426 0.9792 0.0214  -0.0295 -0.0735 131 SER A C   
300 O O   . SER A 55  ? 1.1635 1.0725 0.9834 0.0340  -0.0323 -0.0891 131 SER A O   
301 C CB  . SER A 55  ? 1.1311 1.0203 1.0126 -0.0039 -0.0339 -0.0780 131 SER A CB  
302 O OG  . SER A 55  ? 1.2569 1.1320 1.1485 -0.0149 -0.0217 -0.0652 131 SER A OG  
303 N N   . GLU A 56  ? 1.0695 0.9841 0.9139 0.0175  -0.0240 -0.0550 132 GLU A N   
304 C CA  . GLU A 56  ? 1.0831 1.0061 0.9093 0.0226  -0.0141 -0.0394 132 GLU A CA  
305 C C   . GLU A 56  ? 1.1174 1.0306 0.9594 0.0142  -0.0165 -0.0235 132 GLU A C   
306 O O   . GLU A 56  ? 1.0872 0.9993 0.9574 0.0058  -0.0225 -0.0300 132 GLU A O   
307 C CB  . GLU A 56  ? 1.1048 1.0464 0.9436 0.0237  0.0068  -0.0342 132 GLU A CB  
308 C CG  . GLU A 56  ? 1.2791 1.2332 1.0935 0.0281  0.0316  -0.0143 132 GLU A CG  
309 C CD  . GLU A 56  ? 1.5339 1.5181 1.3924 0.0179  0.0600  -0.0052 132 GLU A CD  
310 O OE1 . GLU A 56  ? 1.3946 1.3856 1.3101 0.0034  0.0526  -0.0103 132 GLU A OE1 
311 O OE2 . GLU A 56  ? 1.5049 1.5128 1.3428 0.0255  0.0903  0.0042  132 GLU A OE2 
312 N N   . LEU A 57  ? 1.1040 1.0058 0.9219 0.0207  -0.0114 -0.0023 133 LEU A N   
313 C CA  . LEU A 57  ? 1.1131 0.9896 0.9482 0.0158  -0.0126 0.0161  133 LEU A CA  
314 C C   . LEU A 57  ? 1.1634 1.0411 1.0377 -0.0041 0.0116  0.0295  133 LEU A C   
315 O O   . LEU A 57  ? 1.1797 1.0738 1.0428 -0.0059 0.0369  0.0431  133 LEU A O   
316 C CB  . LEU A 57  ? 1.1773 1.0311 0.9608 0.0365  -0.0169 0.0413  133 LEU A CB  
317 C CG  . LEU A 57  ? 1.2506 1.0798 1.0411 0.0508  -0.0425 0.0418  133 LEU A CG  
318 C CD1 . LEU A 57  ? 1.2142 1.0762 1.0156 0.0617  -0.0699 0.0045  133 LEU A CD1 
319 C CD2 . LEU A 57  ? 1.3709 1.1641 1.1042 0.0757  -0.0443 0.0808  133 LEU A CD2 
320 N N   . CYS A 58  ? 1.1030 0.9728 1.0302 -0.0182 0.0034  0.0176  134 CYS A N   
321 C CA  . CYS A 58  ? 1.1040 0.9839 1.0933 -0.0406 0.0177  0.0166  134 CYS A CA  
322 C C   . CYS A 58  ? 1.2205 1.0803 1.2216 -0.0559 0.0517  0.0554  134 CYS A C   
323 O O   . CYS A 58  ? 1.2699 1.0780 1.2528 -0.0536 0.0544  0.0839  134 CYS A O   
324 C CB  . CYS A 58  ? 1.0930 0.9658 1.1324 -0.0479 -0.0058 -0.0132 134 CYS A CB  
325 S SG  . CYS A 58  ? 1.0921 1.0095 1.1306 -0.0364 -0.0303 -0.0537 134 CYS A SG  
326 N N   . GLN A 59  ? 1.1822 1.0837 1.2154 -0.0693 0.0804  0.0587  135 GLN A N   
327 C CA  . GLN A 59  ? 1.2459 1.1436 1.2987 -0.0894 0.1279  0.0985  135 GLN A CA  
328 C C   . GLN A 59  ? 1.2830 1.2239 1.4531 -0.1230 0.1427  0.0785  135 GLN A C   
329 O O   . GLN A 59  ? 1.2175 1.1968 1.4342 -0.1201 0.1097  0.0316  135 GLN A O   
330 C CB  . GLN A 59  ? 1.2917 1.2192 1.2700 -0.0686 0.1576  0.1175  135 GLN A CB  
331 C CG  . GLN A 59  ? 1.5536 1.4416 1.4215 -0.0364 0.1442  0.1388  135 GLN A CG  
332 C CD  . GLN A 59  ? 1.8772 1.8008 1.6699 -0.0118 0.1677  0.1438  135 GLN A CD  
333 O OE1 . GLN A 59  ? 1.7854 1.7449 1.5661 0.0057  0.1499  0.1038  135 GLN A OE1 
334 N NE2 . GLN A 59  ? 1.8850 1.7945 1.6211 -0.0074 0.2097  0.1934  135 GLN A NE2 
335 N N   . ALA A 60  ? 1.3084 1.2452 1.5279 -0.1539 0.1924  0.1147  136 ALA A N   
336 C CA  . ALA A 60  ? 1.3035 1.2926 1.6589 -0.1926 0.2119  0.0936  136 ALA A CA  
337 C C   . ALA A 60  ? 1.3102 1.3967 1.6875 -0.1781 0.2206  0.0634  136 ALA A C   
338 O O   . ALA A 60  ? 1.3273 1.4348 1.6326 -0.1574 0.2538  0.0865  136 ALA A O   
339 C CB  . ALA A 60  ? 1.4091 1.3658 1.8109 -0.2329 0.2750  0.1495  136 ALA A CB  
340 N N   . LEU A 61  ? 1.2123 1.3568 1.6814 -0.1805 0.1838  0.0067  137 LEU A N   
341 C CA  . LEU A 61  ? 1.1673 1.4027 1.6728 -0.1588 0.1774  -0.0305 137 LEU A CA  
342 C C   . LEU A 61  ? 1.1780 1.4039 1.5677 -0.1084 0.1510  -0.0376 137 LEU A C   
343 O O   . LEU A 61  ? 1.1576 1.4432 1.5603 -0.0837 0.1538  -0.0590 137 LEU A O   
344 C CB  . LEU A 61  ? 1.2034 1.5150 1.7932 -0.1818 0.2436  -0.0176 137 LEU A CB  
345 C CG  . LEU A 61  ? 1.2584 1.6538 2.0300 -0.2185 0.2475  -0.0570 137 LEU A CG  
346 C CD1 . LEU A 61  ? 1.2010 1.6726 2.0224 -0.1827 0.1865  -0.1238 137 LEU A CD1 
347 C CD2 . LEU A 61  ? 1.3220 1.6643 2.1755 -0.2683 0.2410  -0.0545 137 LEU A CD2 
348 N N   . SER A 62  ? 1.1244 1.2763 1.4149 -0.0934 0.1242  -0.0241 138 SER A N   
349 C CA  . SER A 62  ? 1.0976 1.2315 1.2947 -0.0552 0.0997  -0.0315 138 SER A CA  
350 C C   . SER A 62  ? 1.0959 1.2420 1.3094 -0.0362 0.0496  -0.0684 138 SER A C   
351 O O   . SER A 62  ? 1.0844 1.2065 1.3049 -0.0436 0.0203  -0.0791 138 SER A O   
352 C CB  . SER A 62  ? 1.1609 1.2249 1.2649 -0.0500 0.0944  -0.0050 138 SER A CB  
353 O OG  . SER A 62  ? 1.2599 1.2846 1.3745 -0.0607 0.0658  -0.0100 138 SER A OG  
354 N N   . SER A 63  ? 1.0286 1.2109 1.2445 -0.0070 0.0402  -0.0877 139 SER A N   
355 C CA  . SER A 63  ? 1.0076 1.1969 1.2244 0.0202  -0.0062 -0.1134 139 SER A CA  
356 C C   . SER A 63  ? 1.0376 1.1659 1.1591 0.0443  -0.0231 -0.1016 139 SER A C   
357 O O   . SER A 63  ? 1.0411 1.1497 1.1227 0.0555  -0.0060 -0.0935 139 SER A O   
358 C CB  . SER A 63  ? 1.0617 1.3242 1.3517 0.0425  -0.0121 -0.1412 139 SER A CB  
359 O OG  . SER A 63  ? 1.1993 1.4684 1.4657 0.0636  0.0138  -0.1373 139 SER A OG  
360 N N   . SER A 64  ? 0.9769 1.0776 1.0656 0.0515  -0.0545 -0.1038 140 SER A N   
361 C CA  . SER A 64  ? 0.9793 1.0236 0.9897 0.0672  -0.0648 -0.0884 140 SER A CA  
362 C C   . SER A 64  ? 1.0326 1.0749 1.0178 0.0900  -0.0988 -0.0942 140 SER A C   
363 O O   . SER A 64  ? 1.0278 1.1103 1.0508 0.0894  -0.1199 -0.1172 140 SER A O   
364 C CB  . SER A 64  ? 1.0070 1.0122 0.9793 0.0439  -0.0493 -0.0725 140 SER A CB  
365 O OG  . SER A 64  ? 1.1013 1.1121 1.0866 0.0303  -0.0592 -0.0799 140 SER A OG  
366 N N   . HIS A 65  ? 1.0077 1.0015 0.9280 0.1104  -0.1038 -0.0737 141 HIS A N   
367 C CA  . HIS A 65  ? 1.0502 1.0325 0.9181 0.1390  -0.1301 -0.0668 141 HIS A CA  
368 C C   . HIS A 65  ? 1.0846 1.0691 0.9207 0.1250  -0.1303 -0.0707 141 HIS A C   
369 O O   . HIS A 65  ? 1.1041 1.1208 0.9311 0.1442  -0.1599 -0.0917 141 HIS A O   
370 C CB  . HIS A 65  ? 1.1187 1.0339 0.9254 0.1599  -0.1243 -0.0323 141 HIS A CB  
371 C CG  . HIS A 65  ? 1.1776 1.0855 1.0139 0.1859  -0.1322 -0.0359 141 HIS A CG  
372 N ND1 . HIS A 65  ? 1.2323 1.1743 1.0859 0.2288  -0.1676 -0.0496 141 HIS A ND1 
373 C CD2 . HIS A 65  ? 1.1933 1.0691 1.0478 0.1792  -0.1126 -0.0352 141 HIS A CD2 
374 C CE1 . HIS A 65  ? 1.2362 1.1648 1.1212 0.2474  -0.1646 -0.0546 141 HIS A CE1 
375 N NE2 . HIS A 65  ? 1.2204 1.1070 1.1034 0.2186  -0.1315 -0.0479 141 HIS A NE2 
376 N N   . CYS A 66  ? 1.0086 0.9659 0.8326 0.0962  -0.1014 -0.0581 142 CYS A N   
377 C CA  . CYS A 66  ? 1.0030 0.9644 0.8050 0.0855  -0.0967 -0.0656 142 CYS A CA  
378 C C   . CYS A 66  ? 0.9858 0.9596 0.8433 0.0570  -0.0881 -0.0827 142 CYS A C   
379 O O   . CYS A 66  ? 0.9476 0.9113 0.8319 0.0407  -0.0720 -0.0728 142 CYS A O   
380 C CB  . CYS A 66  ? 1.0417 0.9660 0.7866 0.0824  -0.0705 -0.0361 142 CYS A CB  
381 S SG  . CYS A 66  ? 1.1919 1.0859 0.8495 0.1186  -0.0745 -0.0024 142 CYS A SG  
382 N N   . ARG A 67  ? 0.8482 0.7131 0.7475 -0.0282 -0.0888 -0.0035 143 ARG A N   
383 C CA  . ARG A 67  ? 0.8392 0.7166 0.7588 -0.0244 -0.0656 0.0122  143 ARG A CA  
384 C C   . ARG A 67  ? 0.8950 0.7598 0.8204 -0.0233 -0.0464 0.0300  143 ARG A C   
385 O O   . ARG A 67  ? 0.9060 0.7458 0.8207 -0.0262 -0.0379 0.0253  143 ARG A O   
386 C CB  . ARG A 67  ? 0.8445 0.7139 0.7624 -0.0262 -0.0545 -0.0009 143 ARG A CB  
387 C CG  . ARG A 67  ? 0.9623 0.8513 0.8978 -0.0247 -0.0404 0.0117  143 ARG A CG  
388 C CD  . ARG A 67  ? 1.1024 0.9858 1.0347 -0.0283 -0.0327 -0.0029 143 ARG A CD  
389 N NE  . ARG A 67  ? 1.2242 1.1275 1.1691 -0.0300 -0.0231 0.0082  143 ARG A NE  
390 C CZ  . ARG A 67  ? 1.4021 1.3336 1.3497 -0.0335 -0.0329 0.0010  143 ARG A CZ  
391 N NH1 . ARG A 67  ? 1.2343 1.1800 1.1750 -0.0342 -0.0548 -0.0188 143 ARG A NH1 
392 N NH2 . ARG A 67  ? 1.2386 1.1846 1.1948 -0.0367 -0.0229 0.0126  143 ARG A NH2 
393 N N   . VAL A 68  ? 0.8387 0.7213 0.7813 -0.0184 -0.0410 0.0482  144 VAL A N   
394 C CA  . VAL A 68  ? 0.8400 0.7155 0.7903 -0.0169 -0.0248 0.0621  144 VAL A CA  
395 C C   . VAL A 68  ? 0.8927 0.7684 0.8564 -0.0136 -0.0066 0.0696  144 VAL A C   
396 O O   . VAL A 68  ? 0.8789 0.7699 0.8535 -0.0099 -0.0069 0.0762  144 VAL A O   
397 C CB  . VAL A 68  ? 0.8760 0.7654 0.8346 -0.0131 -0.0319 0.0739  144 VAL A CB  
398 C CG1 . VAL A 68  ? 0.8787 0.7629 0.8462 -0.0118 -0.0144 0.0838  144 VAL A CG1 
399 C CG2 . VAL A 68  ? 0.8748 0.7601 0.8170 -0.0182 -0.0521 0.0671  144 VAL A CG2 
400 N N   . LEU A 69  ? 0.8622 0.7207 0.8245 -0.0149 0.0073  0.0683  145 LEU A N   
401 C CA  . LEU A 69  ? 0.8661 0.7221 0.8399 -0.0119 0.0210  0.0747  145 LEU A CA  
402 C C   . LEU A 69  ? 0.9235 0.7828 0.9087 -0.0081 0.0280  0.0847  145 LEU A C   
403 O O   . LEU A 69  ? 0.9219 0.7752 0.9054 -0.0094 0.0325  0.0827  145 LEU A O   
404 C CB  . LEU A 69  ? 0.8755 0.7132 0.8444 -0.0129 0.0289  0.0660  145 LEU A CB  
405 C CG  . LEU A 69  ? 0.9346 0.7653 0.8923 -0.0157 0.0234  0.0516  145 LEU A CG  
406 C CD1 . LEU A 69  ? 0.9441 0.7519 0.8939 -0.0147 0.0284  0.0403  145 LEU A CD1 
407 C CD2 . LEU A 69  ? 0.9678 0.8064 0.9320 -0.0164 0.0267  0.0536  145 LEU A CD2 
408 N N   . LEU A 70  ? 0.8844 0.7535 0.8806 -0.0035 0.0279  0.0937  146 LEU A N   
409 C CA  . LEU A 70  ? 0.8889 0.7596 0.8962 0.0016  0.0328  0.0996  146 LEU A CA  
410 C C   . LEU A 70  ? 0.9602 0.8206 0.9728 0.0027  0.0408  0.0988  146 LEU A C   
411 O O   . LEU A 70  ? 0.9591 0.8162 0.9761 0.0051  0.0407  0.1034  146 LEU A O   
412 C CB  . LEU A 70  ? 0.8816 0.7626 0.8974 0.0081  0.0276  0.1074  146 LEU A CB  
413 C CG  . LEU A 70  ? 0.9419 0.8237 0.9689 0.0155  0.0302  0.1102  146 LEU A CG  
414 C CD1 . LEU A 70  ? 0.9372 0.8265 0.9644 0.0150  0.0279  0.1084  146 LEU A CD1 
415 C CD2 . LEU A 70  ? 0.9698 0.8554 1.0047 0.0240  0.0259  0.1172  146 LEU A CD2 
416 N N   . ILE A 71  ? 0.9287 0.7836 0.9398 0.0007  0.0457  0.0926  147 ILE A N   
417 C CA  . ILE A 71  ? 0.9358 0.7843 0.9541 0.0032  0.0501  0.0904  147 ILE A CA  
418 C C   . ILE A 71  ? 1.0028 0.8565 1.0324 0.0078  0.0500  0.0896  147 ILE A C   
419 O O   . ILE A 71  ? 0.9960 0.8577 1.0281 0.0070  0.0524  0.0849  147 ILE A O   
420 C CB  . ILE A 71  ? 0.9742 0.8165 0.9887 0.0017  0.0542  0.0831  147 ILE A CB  
421 C CG1 . ILE A 71  ? 0.9744 0.8072 0.9770 -0.0014 0.0528  0.0798  147 ILE A CG1 
422 C CG2 . ILE A 71  ? 0.9872 0.8271 1.0136 0.0071  0.0557  0.0812  147 ILE A CG2 
423 C CD1 . ILE A 71  ? 1.0483 0.8708 1.0415 -0.0031 0.0549  0.0707  147 ILE A CD1 
424 N N   . THR A 72  ? 0.9760 0.8239 1.0106 0.0116  0.0462  0.0927  148 THR A N   
425 C CA  . THR A 72  ? 0.9839 0.8313 1.0275 0.0170  0.0424  0.0887  148 THR A CA  
426 C C   . THR A 72  ? 1.0534 0.8914 1.1008 0.0192  0.0363  0.0868  148 THR A C   
427 O O   . THR A 72  ? 1.0490 0.8812 1.0923 0.0165  0.0368  0.0914  148 THR A O   
428 C CB  . THR A 72  ? 1.0978 0.9413 1.1399 0.0203  0.0390  0.0944  148 THR A CB  
429 O OG1 . THR A 72  ? 1.1041 0.9400 1.1385 0.0172  0.0368  0.1031  148 THR A OG1 
430 C CG2 . THR A 72  ? 1.0679 0.9227 1.1105 0.0212  0.0416  0.0959  148 THR A CG2 
431 N N   . PRO A 73  ? 1.0254 0.8611 1.0804 0.0243  0.0283  0.0788  149 PRO A N   
432 C CA  . PRO A 73  ? 1.0344 0.8606 1.0923 0.0265  0.0174  0.0772  149 PRO A CA  
433 C C   . PRO A 73  ? 1.0984 0.9070 1.1452 0.0225  0.0134  0.0890  149 PRO A C   
434 O O   . PRO A 73  ? 1.0984 0.9010 1.1452 0.0212  0.0087  0.0923  149 PRO A O   
435 C CB  . PRO A 73  ? 1.0618 0.8871 1.1268 0.0325  0.0062  0.0637  149 PRO A CB  
436 C CG  . PRO A 73  ? 1.1078 0.9490 1.1778 0.0332  0.0152  0.0557  149 PRO A CG  
437 C CD  . PRO A 73  ? 1.0452 0.8861 1.1065 0.0288  0.0264  0.0685  149 PRO A CD  
438 N N   . GLY A 74  ? 1.0589 0.8614 1.0972 0.0205  0.0154  0.0954  150 GLY A N   
439 C CA  . GLY A 74  ? 1.0689 0.8583 1.0949 0.0146  0.0131  0.1064  150 GLY A CA  
440 C C   . GLY A 74  ? 1.1146 0.9110 1.1360 0.0076  0.0215  0.1130  150 GLY A C   
441 O O   . GLY A 74  ? 1.1215 0.9088 1.1350 0.0013  0.0189  0.1193  150 GLY A O   
442 N N   . PHE A 75  ? 1.0544 0.8656 1.0792 0.0081  0.0305  0.1098  151 PHE A N   
443 C CA  . PHE A 75  ? 1.0447 0.8613 1.0645 0.0029  0.0370  0.1106  151 PHE A CA  
444 C C   . PHE A 75  ? 1.1037 0.9136 1.1273 0.0035  0.0370  0.1080  151 PHE A C   
445 O O   . PHE A 75  ? 1.1027 0.9083 1.1207 -0.0013 0.0388  0.1101  151 PHE A O   
446 C CB  . PHE A 75  ? 1.0522 0.8811 1.0726 0.0039  0.0422  0.1055  151 PHE A CB  
447 C CG  . PHE A 75  ? 1.0638 0.8958 1.0765 -0.0008 0.0455  0.1020  151 PHE A CG  
448 C CD1 . PHE A 75  ? 1.0876 0.9137 1.1003 -0.0001 0.0492  0.0951  151 PHE A CD1 
449 C CD2 . PHE A 75  ? 1.0969 0.9379 1.1029 -0.0045 0.0431  0.1033  151 PHE A CD2 
450 C CE1 . PHE A 75  ? 1.1182 0.9427 1.1221 -0.0035 0.0506  0.0879  151 PHE A CE1 
451 C CE2 . PHE A 75  ? 1.1020 0.9459 1.1001 -0.0086 0.0428  0.0955  151 PHE A CE2 
452 C CZ  . PHE A 75  ? 1.0896 0.9230 1.0855 -0.0083 0.0466  0.0870  151 PHE A CZ  
453 N N   . LEU A 76  ? 1.0622 0.8733 1.0965 0.0103  0.0344  0.1024  152 LEU A N   
454 C CA  . LEU A 76  ? 1.0601 0.8676 1.1027 0.0147  0.0324  0.0997  152 LEU A CA  
455 C C   . LEU A 76  ? 1.1286 0.9239 1.1711 0.0139  0.0214  0.1056  152 LEU A C   
456 O O   . LEU A 76  ? 1.1244 0.9146 1.1710 0.0158  0.0203  0.1067  152 LEU A O   
457 C CB  . LEU A 76  ? 1.0523 0.8701 1.1078 0.0224  0.0312  0.0910  152 LEU A CB  
458 C CG  . LEU A 76  ? 1.1022 0.9298 1.1554 0.0212  0.0413  0.0854  152 LEU A CG  
459 C CD1 . LEU A 76  ? 1.0998 0.9412 1.1643 0.0257  0.0395  0.0769  152 LEU A CD1 
460 C CD2 . LEU A 76  ? 1.1279 0.9496 1.1771 0.0214  0.0486  0.0830  152 LEU A CD2 
461 N N   . GLN A 77  ? 1.1006 0.8887 1.1375 0.0114  0.0124  0.1089  153 GLN A N   
462 C CA  . GLN A 77  ? 1.1166 0.8884 1.1479 0.0083  -0.0012 0.1147  153 GLN A CA  
463 C C   . GLN A 77  ? 1.1706 0.9349 1.1886 -0.0027 0.0038  0.1243  153 GLN A C   
464 O O   . GLN A 77  ? 1.1763 0.9292 1.1915 -0.0061 -0.0045 0.1294  153 GLN A O   
465 C CB  . GLN A 77  ? 1.1482 0.9097 1.1735 0.0085  -0.0128 0.1130  153 GLN A CB  
466 C CG  . GLN A 77  ? 1.3771 1.1419 1.4153 0.0184  -0.0259 0.1005  153 GLN A CG  
467 C CD  . GLN A 77  ? 1.6794 1.4306 1.7103 0.0197  -0.0376 0.0946  153 GLN A CD  
468 O OE1 . GLN A 77  ? 1.6246 1.3814 1.6560 0.0222  -0.0296 0.0898  153 GLN A OE1 
469 N NE2 . GLN A 77  ? 1.6141 1.3446 1.6374 0.0186  -0.0582 0.0938  153 GLN A NE2 
470 N N   . ASP A 78  ? 1.3896 1.0564 1.4621 -0.1853 -0.0084 0.1236  154 ASP A N   
471 C CA  . ASP A 78  ? 1.4156 1.0549 1.3989 -0.2052 0.0041  0.1384  154 ASP A CA  
472 C C   . ASP A 78  ? 1.4114 1.0705 1.3888 -0.2186 0.0490  0.1112  154 ASP A C   
473 O O   . ASP A 78  ? 1.3526 1.0533 1.3455 -0.2204 0.0603  0.0896  154 ASP A O   
474 C CB  . ASP A 78  ? 1.4518 1.1024 1.3760 -0.2177 -0.0143 0.1480  154 ASP A CB  
475 C CG  . ASP A 78  ? 1.6163 1.2373 1.4552 -0.2489 -0.0011 0.1548  154 ASP A CG  
476 O OD1 . ASP A 78  ? 1.7532 1.3201 1.5534 -0.2587 0.0005  0.1697  154 ASP A OD1 
477 O OD2 . ASP A 78  ? 1.5956 1.2448 1.4090 -0.2669 0.0101  0.1412  154 ASP A OD2 
478 N N   . PRO A 79  ? 1.3881 1.0168 1.3406 -0.2286 0.0746  0.1108  155 PRO A N   
479 C CA  . PRO A 79  ? 1.3403 0.9965 1.2908 -0.2406 0.1150  0.0815  155 PRO A CA  
480 C C   . PRO A 79  ? 1.3718 1.0440 1.2731 -0.2545 0.1193  0.0687  155 PRO A C   
481 O O   . PRO A 79  ? 1.3202 1.0280 1.2357 -0.2576 0.1391  0.0458  155 PRO A O   
482 C CB  . PRO A 79  ? 1.3998 1.0173 1.3329 -0.2481 0.1430  0.0807  155 PRO A CB  
483 C CG  . PRO A 79  ? 1.5365 1.0902 1.4204 -0.2488 0.1144  0.1133  155 PRO A CG  
484 C CD  . PRO A 79  ? 1.4810 1.0470 1.4029 -0.2304 0.0688  0.1352  155 PRO A CD  
485 N N   . TRP A 80  ? 1.3688 1.0165 1.2179 -0.2663 0.1002  0.0824  156 TRP A N   
486 C CA  . TRP A 80  ? 1.3545 1.0178 1.1725 -0.2854 0.1069  0.0657  156 TRP A CA  
487 C C   . TRP A 80  ? 1.3537 1.0655 1.2092 -0.2739 0.0990  0.0602  156 TRP A C   
488 O O   . TRP A 80  ? 1.3181 1.0541 1.1808 -0.2793 0.1121  0.0400  156 TRP A O   
489 C CB  . TRP A 80  ? 1.3995 1.0243 1.1529 -0.3141 0.0950  0.0776  156 TRP A CB  
490 C CG  . TRP A 80  ? 1.3968 1.0397 1.1334 -0.3429 0.1087  0.0521  156 TRP A CG  
491 C CD1 . TRP A 80  ? 1.4243 1.0919 1.1610 -0.3575 0.0989  0.0555  156 TRP A CD1 
492 C CD2 . TRP A 80  ? 1.3836 1.0278 1.1161 -0.3615 0.1380  0.0126  156 TRP A CD2 
493 N NE1 . TRP A 80  ? 1.4014 1.0827 1.1404 -0.3863 0.1216  0.0217  156 TRP A NE1 
494 C CE2 . TRP A 80  ? 1.4188 1.0853 1.1575 -0.3876 0.1426  -0.0064 156 TRP A CE2 
495 C CE3 . TRP A 80  ? 1.3997 1.0331 1.1304 -0.3599 0.1637  -0.0138 156 TRP A CE3 
496 C CZ2 . TRP A 80  ? 1.3973 1.0723 1.1499 -0.4103 0.1669  -0.0522 156 TRP A CZ2 
497 C CZ3 . TRP A 80  ? 1.4068 1.0509 1.1414 -0.3809 0.1869  -0.0599 156 TRP A CZ3 
498 C CH2 . TRP A 80  ? 1.4017 1.0650 1.1519 -0.4048 0.1860  -0.0794 156 TRP A CH2 
499 N N   . CYS A 81  ? 1.3057 1.0289 1.1875 -0.2578 0.0778  0.0750  157 CYS A N   
500 C CA  . CYS A 81  ? 1.2622 1.0230 1.1717 -0.2486 0.0749  0.0660  157 CYS A CA  
501 C C   . CYS A 81  ? 1.2684 1.0494 1.2084 -0.2424 0.0907  0.0483  157 CYS A C   
502 O O   . CYS A 81  ? 1.2379 1.0387 1.1795 -0.2433 0.0955  0.0386  157 CYS A O   
503 C CB  . CYS A 81  ? 1.2756 1.0422 1.2065 -0.2352 0.0520  0.0753  157 CYS A CB  
504 S SG  . CYS A 81  ? 1.3658 1.1306 1.2556 -0.2485 0.0306  0.0948  157 CYS A SG  
505 N N   . LYS A 82  ? 1.2244 0.9991 1.1875 -0.2401 0.1000  0.0450  158 LYS A N   
506 C CA  . LYS A 82  ? 1.1922 0.9894 1.1797 -0.2447 0.1171  0.0282  158 LYS A CA  
507 C C   . LYS A 82  ? 1.2342 1.0423 1.1993 -0.2515 0.1293  0.0190  158 LYS A C   
508 O O   . LYS A 82  ? 1.2101 1.0402 1.1817 -0.2548 0.1312  0.0107  158 LYS A O   
509 C CB  . LYS A 82  ? 1.2233 1.0178 1.2501 -0.2478 0.1313  0.0233  158 LYS A CB  
510 C CG  . LYS A 82  ? 1.3907 1.1890 1.4683 -0.2450 0.1218  0.0165  158 LYS A CG  
511 C CD  . LYS A 82  ? 1.5113 1.3105 1.6471 -0.2527 0.1411  0.0066  158 LYS A CD  
512 C CE  . LYS A 82  ? 1.6407 1.4539 1.8438 -0.2613 0.1403  -0.0175 158 LYS A CE  
513 N NZ  . LYS A 82  ? 1.7605 1.5752 2.0404 -0.2706 0.1612  -0.0296 158 LYS A NZ  
514 N N   . TYR A 83  ? 1.2130 1.0027 1.1507 -0.2565 0.1355  0.0177  159 TYR A N   
515 C CA  . TYR A 83  ? 1.2059 1.0058 1.1320 -0.2639 0.1469  -0.0019 159 TYR A CA  
516 C C   . TYR A 83  ? 1.2482 1.0602 1.1778 -0.2629 0.1331  -0.0033 159 TYR A C   
517 O O   . TYR A 83  ? 1.2276 1.0612 1.1739 -0.2596 0.1314  -0.0146 159 TYR A O   
518 C CB  . TYR A 83  ? 1.2531 1.0217 1.1454 -0.2780 0.1623  -0.0133 159 TYR A CB  
519 C CG  . TYR A 83  ? 1.2683 1.0478 1.1568 -0.2892 0.1761  -0.0471 159 TYR A CG  
520 C CD1 . TYR A 83  ? 1.2741 1.0814 1.1792 -0.2865 0.1938  -0.0710 159 TYR A CD1 
521 C CD2 . TYR A 83  ? 1.2914 1.0588 1.1672 -0.3066 0.1734  -0.0613 159 TYR A CD2 
522 C CE1 . TYR A 83  ? 1.2795 1.1017 1.1919 -0.2941 0.2032  -0.1093 159 TYR A CE1 
523 C CE2 . TYR A 83  ? 1.2985 1.0775 1.1876 -0.3190 0.1864  -0.1027 159 TYR A CE2 
524 C CZ  . TYR A 83  ? 1.3752 1.1811 1.2840 -0.3093 0.1987  -0.1273 159 TYR A CZ  
525 O OH  . TYR A 83  ? 1.3849 1.2066 1.3166 -0.3189 0.2084  -0.1749 159 TYR A OH  
526 N N   . GLN A 84  ? 1.2180 1.0184 1.1361 -0.2663 0.1232  0.0088  160 GLN A N   
527 C CA  . GLN A 84  ? 1.2045 1.0185 1.1328 -0.2692 0.1187  0.0064  160 GLN A CA  
528 C C   . GLN A 84  ? 1.2399 1.0702 1.1867 -0.2541 0.1113  0.0120  160 GLN A C   
529 O O   . GLN A 84  ? 1.2264 1.0664 1.1894 -0.2527 0.1102  0.0071  160 GLN A O   
530 C CB  . GLN A 84  ? 1.2362 1.0425 1.1454 -0.2821 0.1154  0.0168  160 GLN A CB  
531 C CG  . GLN A 84  ? 1.4252 1.2085 1.3028 -0.3112 0.1229  0.0088  160 GLN A CG  
532 C CD  . GLN A 84  ? 1.6388 1.4320 1.5348 -0.3336 0.1388  -0.0220 160 GLN A CD  
533 O OE1 . GLN A 84  ? 1.5741 1.3869 1.4912 -0.3484 0.1451  -0.0290 160 GLN A OE1 
534 N NE2 . GLN A 84  ? 1.5322 1.3155 1.4289 -0.3387 0.1494  -0.0469 160 GLN A NE2 
535 N N   . MET A 85  ? 1.2001 1.0288 1.1464 -0.2470 0.1077  0.0191  161 MET A N   
536 C CA  . MET A 85  ? 1.1945 1.0283 1.1440 -0.2438 0.1039  0.0190  161 MET A CA  
537 C C   . MET A 85  ? 1.2448 1.0875 1.1972 -0.2453 0.1006  0.0161  161 MET A C   
538 O O   . MET A 85  ? 1.2462 1.0862 1.1939 -0.2433 0.0917  0.0202  161 MET A O   
539 C CB  . MET A 85  ? 1.2253 1.0556 1.1825 -0.2469 0.1057  0.0156  161 MET A CB  
540 C CG  . MET A 85  ? 1.2759 1.1041 1.2273 -0.2562 0.1065  0.0062  161 MET A CG  
541 S SD  . MET A 85  ? 1.3291 1.1552 1.3081 -0.2679 0.1131  -0.0144 161 MET A SD  
542 C CE  . MET A 85  ? 1.2820 1.1216 1.2868 -0.2839 0.1258  -0.0175 161 MET A CE  
543 N N   . LEU A 86  ? 1.2005 1.0531 1.1590 -0.2490 0.1076  0.0087  162 LEU A N   
544 C CA  . LEU A 86  ? 1.2002 1.0720 1.1645 -0.2508 0.1039  0.0020  162 LEU A CA  
545 C C   . LEU A 86  ? 1.2506 1.1263 1.2317 -0.2416 0.0926  -0.0050 162 LEU A C   
546 O O   . LEU A 86  ? 1.2546 1.1405 1.2449 -0.2365 0.0750  -0.0022 162 LEU A O   
547 C CB  . LEU A 86  ? 1.1956 1.0825 1.1646 -0.2589 0.1239  -0.0119 162 LEU A CB  
548 C CG  . LEU A 86  ? 1.2526 1.1591 1.2249 -0.2758 0.1343  -0.0131 162 LEU A CG  
549 C CD1 . LEU A 86  ? 1.2537 1.1446 1.2339 -0.2837 0.1420  -0.0088 162 LEU A CD1 
550 C CD2 . LEU A 86  ? 1.2740 1.2066 1.2562 -0.2842 0.1599  -0.0320 162 LEU A CD2 
551 N N   . GLN A 87  ? 1.2034 1.0701 1.1920 -0.2434 0.1014  -0.0153 163 GLN A N   
552 C CA  . GLN A 87  ? 1.2005 1.0723 1.2216 -0.2432 0.0978  -0.0325 163 GLN A CA  
553 C C   . GLN A 87  ? 1.2529 1.1204 1.2912 -0.2348 0.0853  -0.0175 163 GLN A C   
554 O O   . GLN A 87  ? 1.2509 1.1256 1.3304 -0.2278 0.0734  -0.0258 163 GLN A O   
555 C CB  . GLN A 87  ? 1.2197 1.0801 1.2365 -0.2624 0.1167  -0.0518 163 GLN A CB  
556 C CG  . GLN A 87  ? 1.4076 1.2608 1.4020 -0.2737 0.1336  -0.0727 163 GLN A CG  
557 C CD  . GLN A 87  ? 1.6497 1.5236 1.6737 -0.2723 0.1361  -0.1081 163 GLN A CD  
558 O OE1 . GLN A 87  ? 1.6003 1.4771 1.6570 -0.2844 0.1406  -0.1424 163 GLN A OE1 
559 N NE2 . GLN A 87  ? 1.5390 1.4325 1.5584 -0.2616 0.1356  -0.1064 163 GLN A NE2 
560 N N   . ALA A 88  ? 1.2108 1.0660 1.2224 -0.2352 0.0893  0.0009  164 ALA A N   
561 C CA  . ALA A 88  ? 1.2133 1.0598 1.2292 -0.2299 0.0872  0.0120  164 ALA A CA  
562 C C   . ALA A 88  ? 1.2875 1.1213 1.2900 -0.2208 0.0663  0.0274  164 ALA A C   
563 O O   . ALA A 88  ? 1.2988 1.1212 1.3185 -0.2129 0.0575  0.0348  164 ALA A O   
564 C CB  . ALA A 88  ? 1.2165 1.0571 1.2037 -0.2351 0.1010  0.0174  164 ALA A CB  
565 N N   . LEU A 89  ? 1.2525 1.0867 1.2245 -0.2265 0.0596  0.0322  165 LEU A N   
566 C CA  . LEU A 89  ? 1.2845 1.1061 1.2290 -0.2308 0.0395  0.0468  165 LEU A CA  
567 C C   . LEU A 89  ? 1.3623 1.1994 1.3327 -0.2213 0.0131  0.0497  165 LEU A C   
568 O O   . LEU A 89  ? 1.3989 1.2229 1.3449 -0.2248 -0.0122 0.0680  165 LEU A O   
569 C CB  . LEU A 89  ? 1.2841 1.1068 1.1937 -0.2524 0.0491  0.0437  165 LEU A CB  
570 C CG  . LEU A 89  ? 1.3390 1.1411 1.2250 -0.2631 0.0664  0.0369  165 LEU A CG  
571 C CD1 . LEU A 89  ? 1.3232 1.1381 1.2125 -0.2810 0.0817  0.0224  165 LEU A CD1 
572 C CD2 . LEU A 89  ? 1.4113 1.1766 1.2525 -0.2757 0.0595  0.0436  165 LEU A CD2 
573 N N   . THR A 90  ? 1.3023 1.1648 1.3197 -0.2123 0.0176  0.0289  166 THR A N   
574 C CA  . THR A 90  ? 1.3130 1.1981 1.3709 -0.2011 -0.0056 0.0184  166 THR A CA  
575 C C   . THR A 90  ? 1.3857 1.2575 1.4956 -0.1836 -0.0268 0.0226  166 THR A C   
576 O O   . THR A 90  ? 1.3546 1.2289 1.5115 -0.1834 -0.0087 0.0019  166 THR A O   
577 C CB  . THR A 90  ? 1.3888 1.3035 1.4696 -0.2058 0.0161  -0.0175 166 THR A CB  
578 O OG1 . THR A 90  ? 1.3853 1.3090 1.4234 -0.2207 0.0355  -0.0162 166 THR A OG1 
579 C CG2 . THR A 90  ? 1.3723 1.3169 1.5032 -0.1946 -0.0038 -0.0424 166 THR A CG2 
580 N N   . GLU A 91  ? 1.3966 1.2525 1.4983 -0.1737 -0.0646 0.0500  167 GLU A N   
581 C CA  . GLU A 91  ? 1.4287 1.2636 1.5815 -0.1537 -0.0928 0.0627  167 GLU A CA  
582 C C   . GLU A 91  ? 1.4669 1.2734 1.6290 -0.1550 -0.0650 0.0663  167 GLU A C   
583 O O   . GLU A 91  ? 1.4987 1.2645 1.6093 -0.1575 -0.0676 0.0945  167 GLU A O   
584 C CB  . GLU A 91  ? 1.4355 1.3044 1.6850 -0.1366 -0.1117 0.0310  167 GLU A CB  
585 C CG  . GLU A 91  ? 1.6262 1.4756 1.9386 -0.1117 -0.1561 0.0490  167 GLU A CG  
586 C CD  . GLU A 91  ? 1.8957 1.7817 2.3174 -0.0931 -0.1829 0.0121  167 GLU A CD  
587 O OE1 . GLU A 91  ? 1.7691 1.6875 2.2453 -0.1038 -0.1502 -0.0416 167 GLU A OE1 
588 O OE2 . GLU A 91  ? 1.8727 1.7510 2.3268 -0.0697 -0.2382 0.0346  167 GLU A OE2 
589 N N   . GLU A 96  ? 1.6637 1.1219 1.4345 -0.1932 -0.1632 0.2530  172 GLU A N   
590 C CA  . GLU A 96  ? 1.5809 1.1059 1.4820 -0.1595 -0.1604 0.2321  172 GLU A CA  
591 C C   . GLU A 96  ? 1.5243 1.1021 1.4527 -0.1673 -0.1023 0.1891  172 GLU A C   
592 O O   . GLU A 96  ? 1.4901 1.0924 1.3723 -0.1890 -0.0883 0.1743  172 GLU A O   
593 C CB  . GLU A 96  ? 1.6016 1.1709 1.5438 -0.1479 -0.2115 0.2384  172 GLU A CB  
594 C CG  . GLU A 96  ? 1.8329 1.3675 1.8041 -0.1238 -0.2773 0.2771  172 GLU A CG  
595 C CD  . GLU A 96  ? 2.1192 1.7012 2.1212 -0.1145 -0.3318 0.2817  172 GLU A CD  
596 O OE1 . GLU A 96  ? 1.9934 1.6477 2.0729 -0.1043 -0.3164 0.2411  172 GLU A OE1 
597 O OE2 . GLU A 96  ? 2.1392 1.6845 2.0846 -0.1196 -0.3898 0.3244  172 GLU A OE2 
598 N N   . GLY A 97  ? 1.4265 1.0209 1.4326 -0.1528 -0.0694 0.1701  173 GLY A N   
599 C CA  . GLY A 97  ? 1.3343 0.9764 1.3680 -0.1622 -0.0186 0.1336  173 GLY A CA  
600 C C   . GLY A 97  ? 1.3635 0.9847 1.3254 -0.1816 0.0255  0.1234  173 GLY A C   
601 O O   . GLY A 97  ? 1.4191 0.9845 1.2983 -0.1934 0.0220  0.1382  173 GLY A O   
602 N N   . CYS A 98  ? 1.2406 0.9058 1.2312 -0.1885 0.0668  0.0942  174 CYS A N   
603 C CA  . CYS A 98  ? 1.2182 0.8795 1.1565 -0.2043 0.1090  0.0759  174 CYS A CA  
604 C C   . CYS A 98  ? 1.2000 0.9093 1.1404 -0.2137 0.1225  0.0546  174 CYS A C   
605 O O   . CYS A 98  ? 1.1461 0.8984 1.1417 -0.2148 0.1402  0.0405  174 CYS A O   
606 C CB  . CYS A 98  ? 1.2126 0.8731 1.1858 -0.2031 0.1508  0.0651  174 CYS A CB  
607 S SG  . CYS A 98  ? 1.2526 0.9091 1.1576 -0.2213 0.2049  0.0356  174 CYS A SG  
608 N N   . THR A 99  ? 1.1613 0.8599 1.0429 -0.2250 0.1133  0.0519  175 THR A N   
609 C CA  . THR A 99  ? 1.1139 0.8471 0.9963 -0.2319 0.1209  0.0355  175 THR A CA  
610 C C   . THR A 99  ? 1.1791 0.8910 1.0047 -0.2481 0.1367  0.0165  175 THR A C   
611 O O   . THR A 99  ? 1.2138 0.8927 0.9929 -0.2637 0.1237  0.0184  175 THR A O   
612 C CB  . THR A 99  ? 1.1834 0.9339 1.0821 -0.2299 0.0931  0.0446  175 THR A CB  
613 O OG1 . THR A 99  ? 1.1613 0.9287 1.1162 -0.2172 0.0816  0.0505  175 THR A OG1 
614 C CG2 . THR A 99  ? 1.1181 0.8966 1.0226 -0.2352 0.1012  0.0315  175 THR A CG2 
615 N N   . ILE A 100 ? 1.1084 0.8408 0.9390 -0.2492 0.1661  -0.0066 176 ILE A N   
616 C CA  . ILE A 100 ? 1.1176 0.8352 0.9070 -0.2639 0.1850  -0.0378 176 ILE A CA  
617 C C   . ILE A 100 ? 1.1391 0.8905 0.9525 -0.2646 0.1805  -0.0550 176 ILE A C   
618 O O   . ILE A 100 ? 1.1046 0.8929 0.9451 -0.2561 0.1911  -0.0631 176 ILE A O   
619 C CB  . ILE A 100 ? 1.1634 0.8723 0.9332 -0.2659 0.2242  -0.0599 176 ILE A CB  
620 C CG1 . ILE A 100 ? 1.2050 0.8767 0.9648 -0.2614 0.2280  -0.0374 176 ILE A CG1 
621 C CG2 . ILE A 100 ? 1.1973 0.8799 0.9163 -0.2860 0.2447  -0.1027 176 ILE A CG2 
622 C CD1 . ILE A 100 ? 1.2617 0.9588 1.0555 -0.2550 0.2669  -0.0458 176 ILE A CD1 
623 N N   . PRO A 101 ? 1.1078 0.8474 0.9139 -0.2780 0.1655  -0.0616 177 PRO A N   
624 C CA  . PRO A 101 ? 1.0779 0.8447 0.9200 -0.2768 0.1605  -0.0780 177 PRO A CA  
625 C C   . PRO A 101 ? 1.1312 0.8973 0.9690 -0.2863 0.1803  -0.1245 177 PRO A C   
626 O O   . PRO A 101 ? 1.1588 0.8911 0.9610 -0.3119 0.1940  -0.1549 177 PRO A O   
627 C CB  . PRO A 101 ? 1.1085 0.8657 0.9551 -0.2929 0.1453  -0.0722 177 PRO A CB  
628 C CG  . PRO A 101 ? 1.1990 0.9280 1.0048 -0.3021 0.1373  -0.0499 177 PRO A CG  
629 C CD  . PRO A 101 ? 1.1672 0.8710 0.9375 -0.2989 0.1525  -0.0540 177 PRO A CD  
630 N N   . LEU A 102 ? 1.0588 0.8616 0.9292 -0.2697 0.1816  -0.1335 178 LEU A N   
631 C CA  . LEU A 102 ? 1.0525 0.8676 0.9328 -0.2733 0.1968  -0.1828 178 LEU A CA  
632 C C   . LEU A 102 ? 1.0913 0.9242 1.0305 -0.2681 0.1730  -0.1943 178 LEU A C   
633 O O   . LEU A 102 ? 1.0730 0.9280 1.0425 -0.2494 0.1489  -0.1601 178 LEU A O   
634 C CB  . LEU A 102 ? 1.0360 0.8873 0.9140 -0.2598 0.2149  -0.1863 178 LEU A CB  
635 C CG  . LEU A 102 ? 1.0892 0.9686 0.9821 -0.2589 0.2305  -0.2401 178 LEU A CG  
636 C CD1 . LEU A 102 ? 1.1183 0.9608 0.9725 -0.2821 0.2642  -0.2975 178 LEU A CD1 
637 C CD2 . LEU A 102 ? 1.0999 1.0278 0.9924 -0.2497 0.2482  -0.2350 178 LEU A CD2 
638 N N   . LEU A 103 ? 1.0577 0.8758 1.0145 -0.2891 0.1810  -0.2446 179 LEU A N   
639 C CA  . LEU A 103 ? 1.0437 0.8761 1.0756 -0.2872 0.1614  -0.2632 179 LEU A CA  
640 C C   . LEU A 103 ? 1.0858 0.9425 1.1629 -0.2802 0.1629  -0.3192 179 LEU A C   
641 O O   . LEU A 103 ? 1.0931 0.9354 1.1621 -0.3062 0.1893  -0.3833 179 LEU A O   
642 C CB  . LEU A 103 ? 1.0540 0.8597 1.0987 -0.3230 0.1684  -0.2811 179 LEU A CB  
643 C CG  . LEU A 103 ? 1.1145 0.9092 1.1317 -0.3266 0.1607  -0.2271 179 LEU A CG  
644 C CD1 . LEU A 103 ? 1.1460 0.9058 1.0849 -0.3547 0.1775  -0.2259 179 LEU A CD1 
645 C CD2 . LEU A 103 ? 1.1365 0.9379 1.2153 -0.3421 0.1558  -0.2305 179 LEU A CD2 
646 N N   . SER A 104 ? 1.0083 0.9253 1.0873 -0.0403 0.1156  0.0547  180 SER A N   
647 C CA  . SER A 104 ? 1.0133 0.9662 1.0758 -0.0118 0.1097  0.0365  180 SER A CA  
648 C C   . SER A 104 ? 1.1041 1.0267 1.1420 0.0231  0.1047  0.0494  180 SER A C   
649 O O   . SER A 104 ? 1.1346 1.0085 1.1635 0.0248  0.1113  0.0805  180 SER A O   
650 C CB  . SER A 104 ? 1.0441 1.0404 1.1046 -0.0067 0.1163  0.0324  180 SER A CB  
651 O OG  . SER A 104 ? 1.1721 1.1516 1.2249 0.0013  0.1234  0.0622  180 SER A OG  
652 N N   . GLY A 105 ? 1.0614 1.0139 1.0861 0.0509  0.0939  0.0248  181 GLY A N   
653 C CA  . GLY A 105 ? 1.1131 1.0384 1.1075 0.0948  0.0866  0.0333  181 GLY A CA  
654 C C   . GLY A 105 ? 1.1883 1.0455 1.1823 0.0963  0.0801  0.0386  181 GLY A C   
655 O O   . GLY A 105 ? 1.2498 1.0580 1.2152 0.1315  0.0768  0.0546  181 GLY A O   
656 N N   . LEU A 106 ? 1.1004 0.9536 1.1249 0.0605  0.0785  0.0244  182 LEU A N   
657 C CA  . LEU A 106 ? 1.1263 0.9260 1.1589 0.0582  0.0721  0.0203  182 LEU A CA  
658 C C   . LEU A 106 ? 1.1195 0.9640 1.1801 0.0388  0.0617  -0.0158 182 LEU A C   
659 O O   . LEU A 106 ? 1.0580 0.9549 1.1355 0.0116  0.0655  -0.0255 182 LEU A O   
660 C CB  . LEU A 106 ? 1.1560 0.8837 1.1962 0.0325  0.0863  0.0525  182 LEU A CB  
661 C CG  . LEU A 106 ? 1.1620 0.9087 1.2339 -0.0139 0.0965  0.0557  182 LEU A CG  
662 C CD1 . LEU A 106 ? 1.1908 0.8843 1.2808 -0.0387 0.1030  0.0611  182 LEU A CD1 
663 C CD2 . LEU A 106 ? 1.1750 0.9387 1.2400 -0.0224 0.1090  0.0802  182 LEU A CD2 
664 N N   . SER A 107 ? 1.0982 0.9209 1.1617 0.0546  0.0488  -0.0355 183 SER A N   
665 C CA  . SER A 107 ? 1.0561 0.9271 1.1458 0.0412  0.0370  -0.0719 183 SER A CA  
666 C C   . SER A 107 ? 1.0550 0.9238 1.1782 -0.0038 0.0466  -0.0656 183 SER A C   
667 O O   . SER A 107 ? 1.0725 0.8834 1.2010 -0.0182 0.0582  -0.0415 183 SER A O   
668 C CB  . SER A 107 ? 1.1541 0.9959 1.2390 0.0744  0.0202  -0.0949 183 SER A CB  
669 O OG  . SER A 107 ? 1.2360 1.1357 1.3484 0.0633  0.0074  -0.1334 183 SER A OG  
670 N N   . ARG A 108 ? 0.9503 0.8876 1.0941 -0.0250 0.0423  -0.0880 184 ARG A N   
671 C CA  . ARG A 108 ? 0.9102 0.8625 1.0825 -0.0608 0.0495  -0.0847 184 ARG A CA  
672 C C   . ARG A 108 ? 0.9892 0.9047 1.1851 -0.0659 0.0477  -0.0933 184 ARG A C   
673 O O   . ARG A 108 ? 0.9676 0.8785 1.1827 -0.0920 0.0584  -0.0830 184 ARG A O   
674 C CB  . ARG A 108 ? 0.8544 0.8875 1.0370 -0.0765 0.0446  -0.1057 184 ARG A CB  
675 C CG  . ARG A 108 ? 0.9237 0.9815 1.0917 -0.0916 0.0555  -0.0911 184 ARG A CG  
676 C CD  . ARG A 108 ? 0.9833 1.1150 1.1529 -0.1050 0.0512  -0.1140 184 ARG A CD  
677 N NE  . ARG A 108 ? 1.0299 1.1790 1.2066 -0.1352 0.0620  -0.0985 184 ARG A NE  
678 C CZ  . ARG A 108 ? 1.1762 1.3851 1.3562 -0.1529 0.0609  -0.1112 184 ARG A CZ  
679 N NH1 . ARG A 108 ? 0.9709 1.2379 1.1520 -0.1462 0.0488  -0.1442 184 ARG A NH1 
680 N NH2 . ARG A 108 ? 1.0429 1.2569 1.2223 -0.1752 0.0719  -0.0903 184 ARG A NH2 
681 N N   . ALA A 109 ? 0.9943 0.8847 1.1883 -0.0394 0.0345  -0.1154 185 ALA A N   
682 C CA  . ALA A 109 ? 1.0330 0.8785 1.2501 -0.0432 0.0330  -0.1298 185 ALA A CA  
683 C C   . ALA A 109 ? 1.1408 0.8942 1.3475 -0.0523 0.0504  -0.0967 185 ALA A C   
684 O O   . ALA A 109 ? 1.1568 0.8806 1.3889 -0.0758 0.0589  -0.1025 185 ALA A O   
685 C CB  . ALA A 109 ? 1.0847 0.9217 1.2973 -0.0067 0.0128  -0.1633 185 ALA A CB  
686 N N   . ALA A 110 ? 1.1227 0.8400 1.2932 -0.0357 0.0569  -0.0642 186 ALA A N   
687 C CA  . ALA A 110 ? 1.1733 0.8115 1.3265 -0.0432 0.0746  -0.0273 186 ALA A CA  
688 C C   . ALA A 110 ? 1.1789 0.8423 1.3430 -0.0794 0.0920  -0.0041 186 ALA A C   
689 O O   . ALA A 110 ? 1.2140 0.8261 1.3701 -0.0943 0.1082  0.0229  186 ALA A O   
690 C CB  . ALA A 110 ? 1.2295 0.8308 1.3373 -0.0029 0.0723  -0.0043 186 ALA A CB  
691 N N   . TYR A 111 ? 1.0604 0.8019 1.2402 -0.0927 0.0888  -0.0146 187 TYR A N   
692 C CA  . TYR A 111 ? 1.0154 0.7871 1.2040 -0.1195 0.1016  0.0026  187 TYR A CA  
693 C C   . TYR A 111 ? 1.0875 0.8466 1.3034 -0.1500 0.1129  -0.0019 187 TYR A C   
694 O O   . TYR A 111 ? 1.0907 0.8549 1.3313 -0.1557 0.1072  -0.0304 187 TYR A O   
695 C CB  . TYR A 111 ? 0.9622 0.8085 1.1605 -0.1248 0.0949  -0.0108 187 TYR A CB  
696 C CG  . TYR A 111 ? 0.9581 0.8305 1.1337 -0.1091 0.0905  -0.0067 187 TYR A CG  
697 C CD1 . TYR A 111 ? 0.9959 0.8423 1.1456 -0.0835 0.0883  0.0013  187 TYR A CD1 
698 C CD2 . TYR A 111 ? 0.9383 0.8626 1.1173 -0.1201 0.0899  -0.0117 187 TYR A CD2 
699 C CE1 . TYR A 111 ? 0.9864 0.8691 1.1196 -0.0713 0.0856  -0.0026 187 TYR A CE1 
700 C CE2 . TYR A 111 ? 0.9312 0.8780 1.0922 -0.1126 0.0890  -0.0128 187 TYR A CE2 
701 C CZ  . TYR A 111 ? 1.0295 0.9611 1.1705 -0.0893 0.0867  -0.0116 187 TYR A CZ  
702 O OH  . TYR A 111 ? 1.0196 0.9852 1.1469 -0.0838 0.0870  -0.0200 187 TYR A OH  
703 N N   . PRO A 112 ? 1.0505 0.8038 1.2652 -0.1704 0.1287  0.0201  188 PRO A N   
704 C CA  . PRO A 112 ? 1.0603 0.8174 1.3031 -0.2024 0.1407  0.0087  188 PRO A CA  
705 C C   . PRO A 112 ? 1.0617 0.8942 1.3358 -0.2113 0.1339  -0.0211 188 PRO A C   
706 O O   . PRO A 112 ? 1.0052 0.8892 1.2735 -0.2027 0.1282  -0.0164 188 PRO A O   
707 C CB  . PRO A 112 ? 1.0828 0.8414 1.3141 -0.2178 0.1563  0.0361  188 PRO A CB  
708 C CG  . PRO A 112 ? 1.1088 0.8829 1.3142 -0.1941 0.1499  0.0562  188 PRO A CG  
709 C CD  . PRO A 112 ? 1.0607 0.8155 1.2513 -0.1654 0.1358  0.0503  188 PRO A CD  
710 N N   . PRO A 113 ? 1.0400 0.8784 1.3459 -0.2265 0.1345  -0.0527 189 PRO A N   
711 C CA  . PRO A 113 ? 0.9933 0.9157 1.3291 -0.2300 0.1269  -0.0831 189 PRO A CA  
712 C C   . PRO A 113 ? 1.0072 1.0015 1.3489 -0.2392 0.1333  -0.0784 189 PRO A C   
713 O O   . PRO A 113 ? 0.9648 1.0295 1.3188 -0.2323 0.1253  -0.0935 189 PRO A O   
714 C CB  . PRO A 113 ? 1.0503 0.9610 1.4216 -0.2461 0.1289  -0.1206 189 PRO A CB  
715 C CG  . PRO A 113 ? 1.1721 0.9922 1.5326 -0.2623 0.1444  -0.1051 189 PRO A CG  
716 C CD  . PRO A 113 ? 1.1272 0.8947 1.4428 -0.2395 0.1422  -0.0637 189 PRO A CD  
717 N N   . GLU A 114 ? 0.9764 0.9575 1.3067 -0.2514 0.1469  -0.0571 190 GLU A N   
718 C CA  . GLU A 114 ? 0.9418 0.9886 1.2725 -0.2537 0.1518  -0.0529 190 GLU A CA  
719 C C   . GLU A 114 ? 0.9589 1.0280 1.2643 -0.2274 0.1412  -0.0331 190 GLU A C   
720 O O   . GLU A 114 ? 0.9284 1.0593 1.2359 -0.2197 0.1392  -0.0371 190 GLU A O   
721 C CB  . GLU A 114 ? 0.9807 1.0081 1.3014 -0.2702 0.1671  -0.0352 190 GLU A CB  
722 C CG  . GLU A 114 ? 1.1579 1.1664 1.5023 -0.3054 0.1833  -0.0538 190 GLU A CG  
723 C CD  . GLU A 114 ? 1.4713 1.3801 1.8028 -0.3141 0.1898  -0.0384 190 GLU A CD  
724 O OE1 . GLU A 114 ? 1.3688 1.2293 1.6769 -0.2877 0.1782  -0.0204 190 GLU A OE1 
725 O OE2 . GLU A 114 ? 1.4566 1.3364 1.7996 -0.3475 0.2077  -0.0451 190 GLU A OE2 
726 N N   . LEU A 115 ? 0.9226 0.9412 1.2029 -0.2135 0.1355  -0.0131 191 LEU A N   
727 C CA  . LEU A 115 ? 0.8995 0.9256 1.1554 -0.1952 0.1287  0.0039  191 LEU A CA  
728 C C   . LEU A 115 ? 0.9312 1.0003 1.1904 -0.1876 0.1192  -0.0077 191 LEU A C   
729 O O   . LEU A 115 ? 0.9185 0.9911 1.1561 -0.1781 0.1170  0.0071  191 LEU A O   
730 C CB  . LEU A 115 ? 0.9146 0.8869 1.1464 -0.1853 0.1275  0.0218  191 LEU A CB  
731 C CG  . LEU A 115 ? 0.9892 0.9350 1.2082 -0.1873 0.1370  0.0423  191 LEU A CG  
732 C CD1 . LEU A 115 ? 1.0123 0.9122 1.2122 -0.1759 0.1359  0.0546  191 LEU A CD1 
733 C CD2 . LEU A 115 ? 1.0023 0.9741 1.2092 -0.1798 0.1386  0.0544  191 LEU A CD2 
734 N N   . ARG A 116 ? 0.8828 0.9866 1.1691 -0.1937 0.1148  -0.0351 192 ARG A N   
735 C CA  . ARG A 116 ? 0.8578 1.0178 1.1498 -0.1876 0.1061  -0.0478 192 ARG A CA  
736 C C   . ARG A 116 ? 0.8964 1.1079 1.1795 -0.1808 0.1099  -0.0356 192 ARG A C   
737 O O   . ARG A 116 ? 0.8899 1.1170 1.1522 -0.1724 0.1072  -0.0213 192 ARG A O   
738 C CB  . ARG A 116 ? 0.8546 1.0496 1.1831 -0.1942 0.1003  -0.0854 192 ARG A CB  
739 C CG  . ARG A 116 ? 1.0028 1.1490 1.3363 -0.1923 0.0927  -0.1004 192 ARG A CG  
740 C CD  . ARG A 116 ? 1.1456 1.3260 1.5178 -0.1971 0.0862  -0.1423 192 ARG A CD  
741 N NE  . ARG A 116 ? 1.3073 1.4227 1.6824 -0.1921 0.0802  -0.1566 192 ARG A NE  
742 C CZ  . ARG A 116 ? 1.4905 1.6122 1.8628 -0.1751 0.0648  -0.1735 192 ARG A CZ  
743 N NH1 . ARG A 116 ? 1.3014 1.4950 1.6695 -0.1682 0.0554  -0.1781 192 ARG A NH1 
744 N NH2 . ARG A 116 ? 1.3512 1.4080 1.7217 -0.1638 0.0589  -0.1856 192 ARG A NH2 
745 N N   . PHE A 117 ? 0.8537 1.0895 1.1487 -0.1840 0.1172  -0.0406 193 PHE A N   
746 C CA  . PHE A 117 ? 0.8452 1.1382 1.1316 -0.1705 0.1199  -0.0336 193 PHE A CA  
747 C C   . PHE A 117 ? 0.9145 1.1737 1.1682 -0.1576 0.1244  -0.0037 193 PHE A C   
748 O O   . PHE A 117 ? 0.9135 1.2151 1.1561 -0.1404 0.1259  0.0019  193 PHE A O   
749 C CB  . PHE A 117 ? 0.8597 1.2224 1.1815 -0.1788 0.1242  -0.0666 193 PHE A CB  
750 C CG  . PHE A 117 ? 0.8735 1.2602 1.2337 -0.1939 0.1202  -0.1030 193 PHE A CG  
751 C CD1 . PHE A 117 ? 0.8946 1.3490 1.2659 -0.1841 0.1119  -0.1183 193 PHE A CD1 
752 C CD2 . PHE A 117 ? 0.9201 1.2591 1.3033 -0.2166 0.1250  -0.1215 193 PHE A CD2 
753 C CE1 . PHE A 117 ? 0.9016 1.3826 1.3111 -0.1954 0.1062  -0.1572 193 PHE A CE1 
754 C CE2 . PHE A 117 ? 0.9605 1.3113 1.3783 -0.2274 0.1204  -0.1577 193 PHE A CE2 
755 C CZ  . PHE A 117 ? 0.9122 1.3378 1.3455 -0.2160 0.1100  -0.1783 193 PHE A CZ  
756 N N   . MET A 118 ? 0.8867 1.0755 1.1244 -0.1616 0.1256  0.0132  194 MET A N   
757 C CA  . MET A 118 ? 0.9006 1.0573 1.1112 -0.1493 0.1287  0.0365  194 MET A CA  
758 C C   . MET A 118 ? 0.9591 1.0561 1.1466 -0.1477 0.1273  0.0543  194 MET A C   
759 O O   . MET A 118 ? 0.9501 1.0311 1.1429 -0.1572 0.1241  0.0476  194 MET A O   
760 C CB  . MET A 118 ? 0.9361 1.0933 1.1567 -0.1570 0.1350  0.0318  194 MET A CB  
761 C CG  . MET A 118 ? 0.9921 1.1052 1.2250 -0.1770 0.1386  0.0281  194 MET A CG  
762 S SD  . MET A 118 ? 1.0613 1.1802 1.3023 -0.1922 0.1498  0.0266  194 MET A SD  
763 C CE  . MET A 118 ? 1.0211 1.1844 1.2990 -0.2168 0.1562  -0.0060 194 MET A CE  
764 N N   . TYR A 119 ? 0.9284 0.9984 1.0914 -0.1343 0.1293  0.0723  195 TYR A N   
765 C CA  . TYR A 119 ? 0.9358 0.9554 1.0794 -0.1346 0.1302  0.0837  195 TYR A CA  
766 C C   . TYR A 119 ? 0.9713 0.9645 1.1234 -0.1435 0.1309  0.0785  195 TYR A C   
767 O O   . TYR A 119 ? 0.9674 0.9635 1.1279 -0.1438 0.1331  0.0780  195 TYR A O   
768 C CB  . TYR A 119 ? 0.9772 0.9729 1.0952 -0.1165 0.1323  0.0995  195 TYR A CB  
769 C CG  . TYR A 119 ? 1.0197 0.9649 1.1209 -0.1207 0.1356  0.1056  195 TYR A CG  
770 C CD1 . TYR A 119 ? 1.0656 0.9937 1.1518 -0.1300 0.1390  0.1115  195 TYR A CD1 
771 C CD2 . TYR A 119 ? 1.0296 0.9518 1.1311 -0.1179 0.1368  0.1030  195 TYR A CD2 
772 C CE1 . TYR A 119 ? 1.1001 0.9864 1.1736 -0.1403 0.1448  0.1113  195 TYR A CE1 
773 C CE2 . TYR A 119 ? 1.0580 0.9435 1.1488 -0.1235 0.1409  0.1012  195 TYR A CE2 
774 C CZ  . TYR A 119 ? 1.1771 1.0430 1.2546 -0.1366 0.1456  0.1039  195 TYR A CZ  
775 O OH  . TYR A 119 ? 1.2153 1.0491 1.2848 -0.1481 0.1524  0.0969  195 TYR A OH  
776 N N   . TYR A 120 ? 0.9194 0.8932 1.0669 -0.1501 0.1297  0.0747  196 TYR A N   
777 C CA  . TYR A 120 ? 0.9125 0.8664 1.0618 -0.1514 0.1295  0.0701  196 TYR A CA  
778 C C   . TYR A 120 ? 0.9659 0.9082 1.1022 -0.1541 0.1302  0.0651  196 TYR A C   
779 O O   . TYR A 120 ? 0.9640 0.9127 1.0931 -0.1619 0.1310  0.0637  196 TYR A O   
780 C CB  . TYR A 120 ? 0.9212 0.8797 1.0870 -0.1561 0.1259  0.0593  196 TYR A CB  
781 C CG  . TYR A 120 ? 0.9365 0.9111 1.1078 -0.1601 0.1191  0.0433  196 TYR A CG  
782 C CD1 . TYR A 120 ? 0.9383 0.9462 1.1229 -0.1656 0.1161  0.0345  196 TYR A CD1 
783 C CD2 . TYR A 120 ? 0.9632 0.9314 1.1274 -0.1558 0.1150  0.0332  196 TYR A CD2 
784 C CE1 . TYR A 120 ? 0.9439 0.9777 1.1356 -0.1685 0.1086  0.0166  196 TYR A CE1 
785 C CE2 . TYR A 120 ? 0.9653 0.9593 1.1349 -0.1577 0.1072  0.0141  196 TYR A CE2 
786 C CZ  . TYR A 120 ? 1.0399 1.0660 1.2239 -0.1649 0.1037  0.0061  196 TYR A CZ  
787 O OH  . TYR A 120 ? 1.0504 1.1126 1.2415 -0.1660 0.0949  -0.0157 196 TYR A OH  
788 N N   . VAL A 121 ? 0.9244 0.8562 1.0573 -0.1488 0.1313  0.0614  197 VAL A N   
789 C CA  . VAL A 121 ? 0.9266 0.8598 1.0508 -0.1526 0.1333  0.0488  197 VAL A CA  
790 C C   . VAL A 121 ? 0.9773 0.9262 1.1039 -0.1456 0.1277  0.0345  197 VAL A C   
791 O O   . VAL A 121 ? 0.9778 0.9197 1.1051 -0.1319 0.1262  0.0402  197 VAL A O   
792 C CB  . VAL A 121 ? 0.9835 0.9030 1.1011 -0.1483 0.1395  0.0499  197 VAL A CB  
793 C CG1 . VAL A 121 ? 0.9867 0.9170 1.1000 -0.1558 0.1436  0.0292  197 VAL A CG1 
794 C CG2 . VAL A 121 ? 0.9972 0.8938 1.1072 -0.1494 0.1434  0.0626  197 VAL A CG2 
795 N N   . ASP A 122 ? 0.9332 0.9050 1.0579 -0.1534 0.1249  0.0165  198 ASP A N   
796 C CA  . ASP A 122 ? 0.9316 0.9260 1.0552 -0.1410 0.1172  -0.0023 198 ASP A CA  
797 C C   . ASP A 122 ? 0.9885 1.0003 1.1032 -0.1325 0.1209  -0.0158 198 ASP A C   
798 O O   . ASP A 122 ? 0.9851 1.0071 1.0976 -0.1490 0.1292  -0.0258 198 ASP A O   
799 C CB  . ASP A 122 ? 0.9482 0.9768 1.0748 -0.1522 0.1115  -0.0215 198 ASP A CB  
800 C CG  . ASP A 122 ? 1.0675 1.1122 1.1972 -0.1329 0.0985  -0.0382 198 ASP A CG  
801 O OD1 . ASP A 122 ? 1.0806 1.1421 1.2003 -0.1144 0.0945  -0.0535 198 ASP A OD1 
802 O OD2 . ASP A 122 ? 1.1361 1.1797 1.2780 -0.1337 0.0919  -0.0388 198 ASP A OD2 
803 N N   . GLY A 123 ? 0.9546 0.9695 1.0633 -0.1066 0.1158  -0.0165 199 GLY A N   
804 C CA  . GLY A 123 ? 0.9579 1.0034 1.0579 -0.0903 0.1180  -0.0308 199 GLY A CA  
805 C C   . GLY A 123 ? 1.0092 1.1100 1.1053 -0.0911 0.1154  -0.0668 199 GLY A C   
806 O O   . GLY A 123 ? 1.0077 1.1492 1.0985 -0.0784 0.1179  -0.0864 199 GLY A O   
807 N N   . ARG A 124 ? 0.9614 1.0756 1.0610 -0.1059 0.1103  -0.0793 200 ARG A N   
808 C CA  . ARG A 124 ? 0.9560 1.1339 1.0527 -0.1118 0.1076  -0.1167 200 ARG A CA  
809 C C   . ARG A 124 ? 1.0121 1.2069 1.1134 -0.1541 0.1224  -0.1297 200 ARG A C   
810 O O   . ARG A 124 ? 1.0098 1.2634 1.1095 -0.1690 0.1243  -0.1630 200 ARG A O   
811 C CB  . ARG A 124 ? 0.9452 1.1380 1.0430 -0.1031 0.0932  -0.1264 200 ARG A CB  
812 C CG  . ARG A 124 ? 1.0524 1.2435 1.1389 -0.0571 0.0787  -0.1305 200 ARG A CG  
813 C CD  . ARG A 124 ? 1.1310 1.3287 1.2219 -0.0473 0.0634  -0.1430 200 ARG A CD  
814 N NE  . ARG A 124 ? 1.2155 1.3460 1.3167 -0.0481 0.0618  -0.1142 200 ARG A NE  
815 C CZ  . ARG A 124 ? 1.4194 1.4988 1.5129 -0.0183 0.0555  -0.1002 200 ARG A CZ  
816 N NH1 . ARG A 124 ? 1.2736 1.3572 1.3446 0.0217  0.0486  -0.1073 200 ARG A NH1 
817 N NH2 . ARG A 124 ? 1.2802 1.3049 1.3869 -0.0281 0.0574  -0.0794 200 ARG A NH2 
818 N N   . GLY A 125 ? 0.9760 1.1189 1.0809 -0.1724 0.1332  -0.1046 201 GLY A N   
819 C CA  . GLY A 125 ? 0.9906 1.1238 1.0951 -0.2106 0.1492  -0.1092 201 GLY A CA  
820 C C   . GLY A 125 ? 1.0539 1.2051 1.1611 -0.2177 0.1610  -0.1335 201 GLY A C   
821 O O   . GLY A 125 ? 1.0386 1.2321 1.1473 -0.1910 0.1556  -0.1524 201 GLY A O   
822 N N   . PRO A 126 ? 1.0390 1.1583 1.1459 -0.2518 0.1779  -0.1347 202 PRO A N   
823 C CA  . PRO A 126 ? 1.0501 1.1880 1.1649 -0.2621 0.1906  -0.1654 202 PRO A CA  
824 C C   . PRO A 126 ? 1.0862 1.2171 1.2090 -0.2276 0.1852  -0.1586 202 PRO A C   
825 O O   . PRO A 126 ? 1.0772 1.1560 1.1982 -0.2115 0.1794  -0.1234 202 PRO A O   
826 C CB  . PRO A 126 ? 1.1167 1.1952 1.2265 -0.3043 0.2095  -0.1591 202 PRO A CB  
827 C CG  . PRO A 126 ? 1.1811 1.2369 1.2769 -0.3194 0.2078  -0.1321 202 PRO A CG  
828 C CD  . PRO A 126 ? 1.0853 1.1495 1.1829 -0.2807 0.1870  -0.1093 202 PRO A CD  
829 N N   . ASP A 127 ? 1.0348 1.2309 1.1663 -0.2155 0.1870  -0.1950 203 ASP A N   
830 C CA  . ASP A 127 ? 1.0202 1.2358 1.1594 -0.1816 0.1828  -0.1958 203 ASP A CA  
831 C C   . ASP A 127 ? 1.0386 1.2425 1.1679 -0.1402 0.1667  -0.1586 203 ASP A C   
832 O O   . ASP A 127 ? 1.0282 1.2260 1.1604 -0.1175 0.1642  -0.1431 203 ASP A O   
833 C CB  . ASP A 127 ? 1.0666 1.2367 1.2176 -0.1953 0.1933  -0.1952 203 ASP A CB  
834 C CG  . ASP A 127 ? 1.2459 1.4198 1.4073 -0.2370 0.2122  -0.2356 203 ASP A CG  
835 O OD1 . ASP A 127 ? 1.2505 1.5041 1.4229 -0.2410 0.2181  -0.2821 203 ASP A OD1 
836 O OD2 . ASP A 127 ? 1.3632 1.4605 1.5207 -0.2649 0.2222  -0.2218 203 ASP A OD2 
837 N N   . GLY A 128 ? 0.9785 1.1825 1.0964 -0.1327 0.1568  -0.1476 204 GLY A N   
838 C CA  . GLY A 128 ? 0.9651 1.1465 1.0728 -0.1002 0.1439  -0.1147 204 GLY A CA  
839 C C   . GLY A 128 ? 0.9967 1.1079 1.1066 -0.1086 0.1434  -0.0755 204 GLY A C   
840 O O   . GLY A 128 ? 0.9881 1.0785 1.0938 -0.0872 0.1382  -0.0485 204 GLY A O   
841 N N   . GLY A 129 ? 0.9496 1.0279 1.0638 -0.1399 0.1501  -0.0727 205 GLY A N   
842 C CA  . GLY A 129 ? 0.9449 0.9675 1.0598 -0.1464 0.1500  -0.0407 205 GLY A CA  
843 C C   . GLY A 129 ? 0.9893 0.9901 1.1090 -0.1438 0.1556  -0.0340 205 GLY A C   
844 O O   . GLY A 129 ? 0.9900 0.9520 1.1084 -0.1450 0.1551  -0.0112 205 GLY A O   
845 N N   . PHE A 130 ? 0.9361 0.9705 1.0622 -0.1375 0.1602  -0.0580 206 PHE A N   
846 C CA  . PHE A 130 ? 0.9359 0.9626 1.0704 -0.1316 0.1641  -0.0608 206 PHE A CA  
847 C C   . PHE A 130 ? 1.0140 0.9904 1.1486 -0.1555 0.1731  -0.0658 206 PHE A C   
848 O O   . PHE A 130 ? 1.0198 0.9678 1.1565 -0.1468 0.1725  -0.0571 206 PHE A O   
849 C CB  . PHE A 130 ? 0.9483 1.0387 1.0926 -0.1169 0.1664  -0.0912 206 PHE A CB  
850 C CG  . PHE A 130 ? 0.9474 1.0822 1.0864 -0.0835 0.1586  -0.0793 206 PHE A CG  
851 C CD1 . PHE A 130 ? 0.9809 1.0917 1.1068 -0.0724 0.1511  -0.0459 206 PHE A CD1 
852 C CD2 . PHE A 130 ? 0.9668 1.1671 1.1127 -0.0632 0.1601  -0.1020 206 PHE A CD2 
853 C CE1 . PHE A 130 ? 0.9920 1.1291 1.1072 -0.0429 0.1467  -0.0302 206 PHE A CE1 
854 C CE2 . PHE A 130 ? 0.9972 1.2351 1.1313 -0.0295 0.1544  -0.0849 206 PHE A CE2 
855 C CZ  . PHE A 130 ? 0.9784 1.1773 1.0948 -0.0203 0.1484  -0.0467 206 PHE A CZ  
856 N N   . ARG A 131 ? 0.9902 0.9551 1.1196 -0.1847 0.1817  -0.0794 207 ARG A N   
857 C CA  . ARG A 131 ? 1.0344 0.9395 1.1567 -0.2110 0.1936  -0.0795 207 ARG A CA  
858 C C   . ARG A 131 ? 1.0986 0.9474 1.2049 -0.2049 0.1889  -0.0396 207 ARG A C   
859 O O   . ARG A 131 ? 1.1281 0.9242 1.2272 -0.2003 0.1919  -0.0297 207 ARG A O   
860 C CB  . ARG A 131 ? 1.0587 0.9762 1.1776 -0.2485 0.2066  -0.1037 207 ARG A CB  
861 C CG  . ARG A 131 ? 1.2468 1.0955 1.3555 -0.2816 0.2241  -0.1057 207 ARG A CG  
862 C CD  . ARG A 131 ? 1.4025 1.2713 1.5072 -0.3257 0.2397  -0.1298 207 ARG A CD  
863 N NE  . ARG A 131 ? 1.5330 1.4630 1.6582 -0.3393 0.2485  -0.1819 207 ARG A NE  
864 C CZ  . ARG A 131 ? 1.7466 1.7180 1.8741 -0.3790 0.2633  -0.2167 207 ARG A CZ  
865 N NH1 . ARG A 131 ? 1.6058 1.5616 1.7149 -0.4108 0.2709  -0.2020 207 ARG A NH1 
866 N NH2 . ARG A 131 ? 1.5880 1.6276 1.7367 -0.3875 0.2709  -0.2691 207 ARG A NH2 
867 N N   . GLN A 132 ? 1.0321 0.8965 1.1330 -0.2015 0.1808  -0.0202 208 GLN A N   
868 C CA  . GLN A 132 ? 1.0373 0.8688 1.1261 -0.1945 0.1760  0.0126  208 GLN A CA  
869 C C   . GLN A 132 ? 1.0713 0.8966 1.1635 -0.1656 0.1673  0.0285  208 GLN A C   
870 O O   . GLN A 132 ? 1.0897 0.8812 1.1696 -0.1569 0.1664  0.0480  208 GLN A O   
871 C CB  . GLN A 132 ? 1.0295 0.8915 1.1182 -0.1990 0.1695  0.0202  208 GLN A CB  
872 C CG  . GLN A 132 ? 1.2756 1.1569 1.3597 -0.2277 0.1766  0.0037  208 GLN A CG  
873 C CD  . GLN A 132 ? 1.5195 1.4582 1.6156 -0.2248 0.1721  -0.0251 208 GLN A CD  
874 O OE1 . GLN A 132 ? 1.4624 1.4184 1.5653 -0.2232 0.1764  -0.0481 208 GLN A OE1 
875 N NE2 . GLN A 132 ? 1.4046 1.3786 1.5033 -0.2202 0.1624  -0.0270 208 GLN A NE2 
876 N N   . VAL A 133 ? 0.9928 0.8563 1.0990 -0.1496 0.1614  0.0204  209 VAL A N   
877 C CA  . VAL A 133 ? 0.9794 0.8496 1.0897 -0.1266 0.1547  0.0327  209 VAL A CA  
878 C C   . VAL A 133 ? 1.0542 0.9003 1.1632 -0.1170 0.1570  0.0238  209 VAL A C   
879 O O   . VAL A 133 ? 1.0595 0.8952 1.1634 -0.0997 0.1518  0.0361  209 VAL A O   
880 C CB  . VAL A 133 ? 0.9977 0.9126 1.1182 -0.1139 0.1496  0.0341  209 VAL A CB  
881 C CG1 . VAL A 133 ? 0.9787 0.9018 1.0985 -0.1193 0.1462  0.0443  209 VAL A CG1 
882 C CG2 . VAL A 133 ? 0.9910 0.9389 1.1192 -0.1089 0.1523  0.0114  209 VAL A CG2 
883 N N   . LYS A 134 ? 1.0256 0.8660 1.1399 -0.1280 0.1648  -0.0020 210 LYS A N   
884 C CA  . LYS A 134 ? 1.0595 0.8710 1.1758 -0.1211 0.1680  -0.0182 210 LYS A CA  
885 C C   . LYS A 134 ? 1.1642 0.9002 1.2576 -0.1236 0.1719  -0.0015 210 LYS A C   
886 O O   . LYS A 134 ? 1.1917 0.9000 1.2789 -0.1008 0.1672  0.0009  210 LYS A O   
887 C CB  . LYS A 134 ? 1.1002 0.9292 1.2313 -0.1379 0.1778  -0.0558 210 LYS A CB  
888 C CG  . LYS A 134 ? 1.2966 1.1177 1.4401 -0.1256 0.1787  -0.0817 210 LYS A CG  
889 C CD  . LYS A 134 ? 1.4160 1.2679 1.5793 -0.1444 0.1897  -0.1260 210 LYS A CD  
890 C CE  . LYS A 134 ? 1.5574 1.4045 1.7378 -0.1319 0.1901  -0.1575 210 LYS A CE  
891 N NZ  . LYS A 134 ? 1.6676 1.5584 1.8726 -0.1514 0.2019  -0.2079 210 LYS A NZ  
892 N N   . GLU A 135 ? 1.1345 0.8421 1.2130 -0.1476 0.1798  0.0111  211 GLU A N   
893 C CA  . GLU A 135 ? 1.1908 0.8280 1.2408 -0.1501 0.1854  0.0344  211 GLU A CA  
894 C C   . GLU A 135 ? 1.2279 0.8710 1.2659 -0.1183 0.1730  0.0621  211 GLU A C   
895 O O   . GLU A 135 ? 1.2759 0.8680 1.2915 -0.0978 0.1722  0.0759  211 GLU A O   
896 C CB  . GLU A 135 ? 1.2206 0.8485 1.2590 -0.1848 0.1966  0.0415  211 GLU A CB  
897 C CG  . GLU A 135 ? 1.3898 1.0002 1.4327 -0.2213 0.2134  0.0132  211 GLU A CG  
898 C CD  . GLU A 135 ? 1.6585 1.2768 1.6911 -0.2587 0.2246  0.0163  211 GLU A CD  
899 O OE1 . GLU A 135 ? 1.5084 1.1955 1.5539 -0.2620 0.2173  0.0101  211 GLU A OE1 
900 O OE2 . GLU A 135 ? 1.7009 1.2553 1.7108 -0.2845 0.2411  0.0250  211 GLU A OE2 
901 N N   . ALA A 136 ? 1.1197 0.8257 1.1721 -0.1130 0.1639  0.0675  212 ALA A N   
902 C CA  . ALA A 136 ? 1.0977 0.8291 1.1459 -0.0890 0.1537  0.0857  212 ALA A CA  
903 C C   . ALA A 136 ? 1.1475 0.8872 1.1977 -0.0583 0.1455  0.0792  212 ALA A C   
904 O O   . ALA A 136 ? 1.1584 0.8967 1.1935 -0.0330 0.1393  0.0914  212 ALA A O   
905 C CB  . ALA A 136 ? 1.0473 0.8375 1.1147 -0.0979 0.1491  0.0860  212 ALA A CB  
906 N N   . VAL A 137 ? 1.0893 0.8479 1.1579 -0.0581 0.1449  0.0572  213 VAL A N   
907 C CA  . VAL A 137 ? 1.0923 0.8708 1.1667 -0.0303 0.1367  0.0447  213 VAL A CA  
908 C C   . VAL A 137 ? 1.2159 0.9242 1.2690 -0.0119 0.1372  0.0419  213 VAL A C   
909 O O   . VAL A 137 ? 1.2341 0.9428 1.2740 0.0212  0.1277  0.0463  213 VAL A O   
910 C CB  . VAL A 137 ? 1.1082 0.9335 1.2082 -0.0352 0.1369  0.0212  213 VAL A CB  
911 C CG1 . VAL A 137 ? 1.1211 0.9643 1.2278 -0.0074 0.1289  0.0019  213 VAL A CG1 
912 C CG2 . VAL A 137 ? 1.0504 0.9375 1.1633 -0.0437 0.1352  0.0305  213 VAL A CG2 
913 N N   . MET A 138 ? 1.2148 0.8623 1.2628 -0.0336 0.1492  0.0336  214 MET A N   
914 C CA  . MET A 138 ? 1.3001 0.8591 1.3253 -0.0241 0.1545  0.0318  214 MET A CA  
915 C C   . MET A 138 ? 1.3985 0.9084 1.3850 -0.0021 0.1525  0.0655  214 MET A C   
916 O O   . MET A 138 ? 1.4621 0.9172 1.4258 0.0305  0.1482  0.0675  214 MET A O   
917 C CB  . MET A 138 ? 1.3662 0.8758 1.3948 -0.0643 0.1725  0.0165  214 MET A CB  
918 C CG  . MET A 138 ? 1.3906 0.9405 1.4538 -0.0742 0.1744  -0.0254 214 MET A CG  
919 S SD  . MET A 138 ? 1.4986 0.9984 1.5684 -0.1231 0.1978  -0.0546 214 MET A SD  
920 C CE  . MET A 138 ? 1.3835 0.9559 1.4636 -0.1566 0.2025  -0.0494 214 MET A CE  
921 N N   . ARG A 139 ? 1.3226 0.8581 1.3016 -0.0152 0.1544  0.0901  215 ARG A N   
922 C CA  . ARG A 139 ? 1.3568 0.8695 1.3012 0.0068  0.1523  0.1220  215 ARG A CA  
923 C C   . ARG A 139 ? 1.3916 0.9507 1.3314 0.0544  0.1356  0.1217  215 ARG A C   
924 O O   . ARG A 139 ? 1.4550 0.9722 1.3597 0.0918  0.1315  0.1368  215 ARG A O   
925 C CB  . ARG A 139 ? 1.3181 0.8737 1.2667 -0.0191 0.1563  0.1385  215 ARG A CB  
926 C CG  . ARG A 139 ? 1.5070 1.0131 1.4431 -0.0579 0.1729  0.1483  215 ARG A CG  
927 C CD  . ARG A 139 ? 1.6184 1.1824 1.5623 -0.0775 0.1731  0.1590  215 ARG A CD  
928 N NE  . ARG A 139 ? 1.7408 1.3237 1.7066 -0.1200 0.1812  0.1411  215 ARG A NE  
929 C CZ  . ARG A 139 ? 1.8789 1.5308 1.8698 -0.1335 0.1758  0.1318  215 ARG A CZ  
930 N NH1 . ARG A 139 ? 1.6779 1.3824 1.6786 -0.1143 0.1645  0.1378  215 ARG A NH1 
931 N NH2 . ARG A 139 ? 1.7055 1.3752 1.7115 -0.1654 0.1819  0.1132  215 ARG A NH2 
932 N N   . TYR A 140 ? 1.2658 0.9130 1.2382 0.0533  0.1268  0.1044  216 TYR A N   
933 C CA  . TYR A 140 ? 1.2418 0.9550 1.2161 0.0892  0.1127  0.0977  216 TYR A CA  
934 C C   . TYR A 140 ? 1.3439 1.0366 1.3100 0.1270  0.1030  0.0794  216 TYR A C   
935 O O   . TYR A 140 ? 1.3644 1.0798 1.3114 0.1698  0.0914  0.0796  216 TYR A O   
936 C CB  . TYR A 140 ? 1.1680 0.9726 1.1781 0.0677  0.1105  0.0862  216 TYR A CB  
937 C CG  . TYR A 140 ? 1.1632 1.0477 1.1771 0.0941  0.0996  0.0776  216 TYR A CG  
938 C CD1 . TYR A 140 ? 1.1810 1.1064 1.1852 0.1042  0.0975  0.0874  216 TYR A CD1 
939 C CD2 . TYR A 140 ? 1.1560 1.0876 1.1850 0.1072  0.0919  0.0560  216 TYR A CD2 
940 C CE1 . TYR A 140 ? 1.1711 1.1818 1.1805 0.1246  0.0892  0.0735  216 TYR A CE1 
941 C CE2 . TYR A 140 ? 1.1479 1.1639 1.1805 0.1271  0.0832  0.0449  216 TYR A CE2 
942 C CZ  . TYR A 140 ? 1.2360 1.2912 1.2588 0.1345  0.0824  0.0525  216 TYR A CZ  
943 O OH  . TYR A 140 ? 1.2312 1.3805 1.2592 0.1505  0.0755  0.0358  216 TYR A OH  
944 N N   . LEU A 141 ? 1.3161 0.9747 1.2979 0.1136  0.1070  0.0590  217 LEU A N   
945 C CA  . LEU A 141 ? 1.3588 0.9991 1.3395 0.1473  0.0975  0.0341  217 LEU A CA  
946 C C   . LEU A 141 ? 1.5208 1.0631 1.4576 0.1855  0.0955  0.0457  217 LEU A C   
947 O O   . LEU A 141 ? 1.5557 1.0956 1.4839 0.2299  0.0819  0.0275  217 LEU A O   
948 C CB  . LEU A 141 ? 1.3463 0.9796 1.3579 0.1209  0.1041  0.0054  217 LEU A CB  
949 C CG  . LEU A 141 ? 1.3140 1.0468 1.3643 0.0972  0.1036  -0.0084 217 LEU A CG  
950 C CD1 . LEU A 141 ? 1.3101 1.0309 1.3848 0.0687  0.1137  -0.0323 217 LEU A CD1 
951 C CD2 . LEU A 141 ? 1.3142 1.1360 1.3778 0.1277  0.0881  -0.0255 217 LEU A CD2 
952 N N   . GLN A 142 ? 1.5338 0.9976 1.4404 0.1707  0.1085  0.0769  218 GLN A N   
953 C CA  . GLN A 142 ? 1.6509 1.0081 1.5064 0.2052  0.1103  0.0986  218 GLN A CA  
954 C C   . GLN A 142 ? 1.7214 1.1221 1.5466 0.2639  0.0938  0.1122  218 GLN A C   
955 O O   . GLN A 142 ? 1.8113 1.1465 1.5970 0.3152  0.0863  0.1172  218 GLN A O   
956 C CB  . GLN A 142 ? 1.7151 0.9910 1.5457 0.1677  0.1312  0.1320  218 GLN A CB  
957 C CG  . GLN A 142 ? 1.9284 1.1704 1.7863 0.1063  0.1496  0.1163  218 GLN A CG  
958 C CD  . GLN A 142 ? 2.2594 1.4387 2.1286 0.1069  0.1523  0.0825  218 GLN A CD  
959 O OE1 . GLN A 142 ? 2.3283 1.3945 2.1625 0.1260  0.1578  0.0896  218 GLN A OE1 
960 N NE2 . GLN A 142 ? 2.0878 1.3388 2.0056 0.0867  0.1493  0.0443  218 GLN A NE2 
961 N N   . THR A 143 ? 1.5945 1.1063 1.4376 0.2574  0.0887  0.1154  219 THR A N   
962 C CA  . THR A 143 ? 1.5919 1.1758 1.4145 0.3056  0.0747  0.1208  219 THR A CA  
963 C C   . THR A 143 ? 1.6401 1.2851 1.4705 0.3508  0.0552  0.0867  219 THR A C   
964 O O   . THR A 143 ? 1.6764 1.3488 1.4753 0.4084  0.0417  0.0869  219 THR A O   
965 C CB  . THR A 143 ? 1.6077 1.2934 1.4560 0.2738  0.0783  0.1262  219 THR A CB  
966 O OG1 . THR A 143 ? 1.5772 1.2207 1.4350 0.2209  0.0951  0.1446  219 THR A OG1 
967 C CG2 . THR A 143 ? 1.6138 1.3564 1.4334 0.3159  0.0709  0.1390  219 THR A CG2 
968 N N   . LEU A 144 ? 1.5499 1.2256 1.4210 0.3275  0.0533  0.0563  220 LEU A N   
969 C CA  . LEU A 144 ? 1.5355 1.2836 1.4207 0.3630  0.0353  0.0201  220 LEU A CA  
970 C C   . LEU A 144 ? 1.6860 1.3442 1.5434 0.4130  0.0254  0.0065  220 LEU A C   
971 O O   . LEU A 144 ? 1.7300 1.2796 1.5857 0.3932  0.0365  0.0089  220 LEU A O   
972 C CB  . LEU A 144 ? 1.4485 1.2697 1.3862 0.3189  0.0383  -0.0043 220 LEU A CB  
973 C CG  . LEU A 144 ? 1.4166 1.3070 1.3826 0.2659  0.0499  0.0084  220 LEU A CG  
974 C CD1 . LEU A 144 ? 1.3658 1.2756 1.3709 0.2235  0.0575  -0.0053 220 LEU A CD1 
975 C CD2 . LEU A 144 ? 1.3997 1.4101 1.3714 0.2778  0.0419  0.0008  220 LEU A CD2 
976 N N   . SER A 145 ? 1.6764 1.3845 1.5135 0.4774  0.0045  -0.0120 221 SER A N   
977 C CA  . SER A 145 ? 2.1828 1.8197 1.9903 0.5401  -0.0106 -0.0304 221 SER A CA  
978 C C   . SER A 145 ? 2.6805 2.1392 2.4447 0.5488  0.0013  -0.0018 221 SER A C   
979 O O   . SER A 145 ? 2.2713 1.6748 1.9822 0.5876  0.0010  0.0309  221 SER A O   
980 C CB  . SER A 145 ? 2.1982 1.8837 2.0476 0.5390  -0.0211 -0.0782 221 SER A CB  
981 O OG  . SER A 145 ? 2.2643 1.9213 2.1538 0.4743  -0.0038 -0.0821 221 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   77  ?   ?   ?   A . n 
A 1 2   PRO 2   78  ?   ?   ?   A . n 
A 1 3   SER 3   79  79  SER SER A . n 
A 1 4   SER 4   80  80  SER SER A . n 
A 1 5   ARG 5   81  81  ARG ARG A . n 
A 1 6   TRP 6   82  82  TRP TRP A . n 
A 1 7   SER 7   83  83  SER SER A . n 
A 1 8   LYS 8   84  84  LYS LYS A . n 
A 1 9   ASP 9   85  85  ASP ASP A . n 
A 1 10  TYR 10  86  86  TYR TYR A . n 
A 1 11  ASP 11  87  87  ASP ASP A . n 
A 1 12  VAL 12  88  88  VAL VAL A . n 
A 1 13  CYS 13  89  89  CYS CYS A . n 
A 1 14  VAL 14  90  90  VAL VAL A . n 
A 1 15  CYS 15  91  91  CYS CYS A . n 
A 1 16  HIS 16  92  92  HIS HIS A . n 
A 1 17  SER 17  93  93  SER SER A . n 
A 1 18  GLU 18  94  94  GLU GLU A . n 
A 1 19  GLU 19  95  95  GLU GLU A . n 
A 1 20  ASP 20  96  96  ASP ASP A . n 
A 1 21  LEU 21  97  97  LEU LEU A . n 
A 1 22  VAL 22  98  98  VAL VAL A . n 
A 1 23  ALA 23  99  99  ALA ALA A . n 
A 1 24  ALA 24  100 100 ALA ALA A . n 
A 1 25  GLN 25  101 101 GLN GLN A . n 
A 1 26  ASP 26  102 102 ASP ASP A . n 
A 1 27  LEU 27  103 103 LEU LEU A . n 
A 1 28  VAL 28  104 104 VAL VAL A . n 
A 1 29  SER 29  105 105 SER SER A . n 
A 1 30  TYR 30  106 106 TYR TYR A . n 
A 1 31  LEU 31  107 107 LEU LEU A . n 
A 1 32  GLU 32  108 108 GLU GLU A . n 
A 1 33  GLY 33  109 109 GLY GLY A . n 
A 1 34  SER 34  110 110 SER SER A . n 
A 1 35  THR 35  111 111 THR THR A . n 
A 1 36  ALA 36  112 ?   ?   ?   A . n 
A 1 37  SER 37  113 ?   ?   ?   A . n 
A 1 38  LEU 38  114 ?   ?   ?   A . n 
A 1 39  ARG 39  115 ?   ?   ?   A . n 
A 1 40  CYS 40  116 ?   ?   ?   A . n 
A 1 41  PHE 41  117 ?   ?   ?   A . n 
A 1 42  LEU 42  118 ?   ?   ?   A . n 
A 1 43  GLN 43  119 ?   ?   ?   A . n 
A 1 44  LEU 44  120 ?   ?   ?   A . n 
A 1 45  ARG 45  121 ?   ?   ?   A . n 
A 1 46  ASP 46  122 ?   ?   ?   A . n 
A 1 47  ALA 47  123 ?   ?   ?   A . n 
A 1 48  THR 48  124 124 THR THR A . n 
A 1 49  PRO 49  125 125 PRO PRO A . n 
A 1 50  GLY 50  126 126 GLY GLY A . n 
A 1 51  GLY 51  127 127 GLY GLY A . n 
A 1 52  ALA 52  128 128 ALA ALA A . n 
A 1 53  ILE 53  129 129 ILE ILE A . n 
A 1 54  VAL 54  130 130 VAL VAL A . n 
A 1 55  SER 55  131 131 SER SER A . n 
A 1 56  GLU 56  132 132 GLU GLU A . n 
A 1 57  LEU 57  133 133 LEU LEU A . n 
A 1 58  CYS 58  134 134 CYS CYS A . n 
A 1 59  GLN 59  135 135 GLN GLN A . n 
A 1 60  ALA 60  136 136 ALA ALA A . n 
A 1 61  LEU 61  137 137 LEU LEU A . n 
A 1 62  SER 62  138 138 SER SER A . n 
A 1 63  SER 63  139 139 SER SER A . n 
A 1 64  SER 64  140 140 SER SER A . n 
A 1 65  HIS 65  141 141 HIS HIS A . n 
A 1 66  CYS 66  142 142 CYS CYS A . n 
A 1 67  ARG 67  143 143 ARG ARG A . n 
A 1 68  VAL 68  144 144 VAL VAL A . n 
A 1 69  LEU 69  145 145 LEU LEU A . n 
A 1 70  LEU 70  146 146 LEU LEU A . n 
A 1 71  ILE 71  147 147 ILE ILE A . n 
A 1 72  THR 72  148 148 THR THR A . n 
A 1 73  PRO 73  149 149 PRO PRO A . n 
A 1 74  GLY 74  150 150 GLY GLY A . n 
A 1 75  PHE 75  151 151 PHE PHE A . n 
A 1 76  LEU 76  152 152 LEU LEU A . n 
A 1 77  GLN 77  153 153 GLN GLN A . n 
A 1 78  ASP 78  154 154 ASP ASP A . n 
A 1 79  PRO 79  155 155 PRO PRO A . n 
A 1 80  TRP 80  156 156 TRP TRP A . n 
A 1 81  CYS 81  157 157 CYS CYS A . n 
A 1 82  LYS 82  158 158 LYS LYS A . n 
A 1 83  TYR 83  159 159 TYR TYR A . n 
A 1 84  GLN 84  160 160 GLN GLN A . n 
A 1 85  MET 85  161 161 MET MET A . n 
A 1 86  LEU 86  162 162 LEU LEU A . n 
A 1 87  GLN 87  163 163 GLN GLN A . n 
A 1 88  ALA 88  164 164 ALA ALA A . n 
A 1 89  LEU 89  165 165 LEU LEU A . n 
A 1 90  THR 90  166 166 THR THR A . n 
A 1 91  GLU 91  167 167 GLU GLU A . n 
A 1 92  ALA 92  168 ?   ?   ?   A . n 
A 1 93  PRO 93  169 ?   ?   ?   A . n 
A 1 94  GLY 94  170 ?   ?   ?   A . n 
A 1 95  ALA 95  171 ?   ?   ?   A . n 
A 1 96  GLU 96  172 172 GLU GLU A . n 
A 1 97  GLY 97  173 173 GLY GLY A . n 
A 1 98  CYS 98  174 174 CYS CYS A . n 
A 1 99  THR 99  175 175 THR THR A . n 
A 1 100 ILE 100 176 176 ILE ILE A . n 
A 1 101 PRO 101 177 177 PRO PRO A . n 
A 1 102 LEU 102 178 178 LEU LEU A . n 
A 1 103 LEU 103 179 179 LEU LEU A . n 
A 1 104 SER 104 180 180 SER SER A . n 
A 1 105 GLY 105 181 181 GLY GLY A . n 
A 1 106 LEU 106 182 182 LEU LEU A . n 
A 1 107 SER 107 183 183 SER SER A . n 
A 1 108 ARG 108 184 184 ARG ARG A . n 
A 1 109 ALA 109 185 185 ALA ALA A . n 
A 1 110 ALA 110 186 186 ALA ALA A . n 
A 1 111 TYR 111 187 187 TYR TYR A . n 
A 1 112 PRO 112 188 188 PRO PRO A . n 
A 1 113 PRO 113 189 189 PRO PRO A . n 
A 1 114 GLU 114 190 190 GLU GLU A . n 
A 1 115 LEU 115 191 191 LEU LEU A . n 
A 1 116 ARG 116 192 192 ARG ARG A . n 
A 1 117 PHE 117 193 193 PHE PHE A . n 
A 1 118 MET 118 194 194 MET MET A . n 
A 1 119 TYR 119 195 195 TYR TYR A . n 
A 1 120 TYR 120 196 196 TYR TYR A . n 
A 1 121 VAL 121 197 197 VAL VAL A . n 
A 1 122 ASP 122 198 198 ASP ASP A . n 
A 1 123 GLY 123 199 199 GLY GLY A . n 
A 1 124 ARG 124 200 200 ARG ARG A . n 
A 1 125 GLY 125 201 201 GLY GLY A . n 
A 1 126 PRO 126 202 202 PRO PRO A . n 
A 1 127 ASP 127 203 203 ASP ASP A . n 
A 1 128 GLY 128 204 204 GLY GLY A . n 
A 1 129 GLY 129 205 205 GLY GLY A . n 
A 1 130 PHE 130 206 206 PHE PHE A . n 
A 1 131 ARG 131 207 207 ARG ARG A . n 
A 1 132 GLN 132 208 208 GLN GLN A . n 
A 1 133 VAL 133 209 209 VAL VAL A . n 
A 1 134 LYS 134 210 210 LYS LYS A . n 
A 1 135 GLU 135 211 211 GLU GLU A . n 
A 1 136 ALA 136 212 212 ALA ALA A . n 
A 1 137 VAL 137 213 213 VAL VAL A . n 
A 1 138 MET 138 214 214 MET MET A . n 
A 1 139 ARG 139 215 215 ARG ARG A . n 
A 1 140 TYR 140 216 216 TYR TYR A . n 
A 1 141 LEU 141 217 217 LEU LEU A . n 
A 1 142 GLN 142 218 218 GLN GLN A . n 
A 1 143 THR 143 219 219 THR THR A . n 
A 1 144 LEU 144 220 220 LEU LEU A . n 
A 1 145 SER 145 221 221 SER SER A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          DTT 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     300 
_pdbx_nonpoly_scheme.auth_seq_num    300 
_pdbx_nonpoly_scheme.pdb_mon_id      DTT 
_pdbx_nonpoly_scheme.auth_mon_id     DTT 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2190  ? 
1 MORE         -24.1 ? 
1 'SSA (A^2)'  13840 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -39.3965000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-09-14 
2 'Structure model' 1 1 2011-10-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -14.0309 35.7406 -5.5216  -0.0674 -0.1590 -0.1965 0.0077  -0.0255 -0.0495 11.8850 10.1244 8.1053 
-3.8677 0.4111  3.2650 -0.0241 -0.1832 0.1223  0.1277  0.0854  0.0859  -0.2805 -0.1634 -0.0613 
'X-RAY DIFFRACTION' 2 ? refined -10.4433 21.9789 -11.2419 -0.0522 -0.2105 -0.0398 0.0007  0.0457  0.0982  0.0000  0.1795  0.3409 
-0.2911 2.1763  1.9497 -0.0158 -0.0887 -0.2872 0.0051  -0.0317 -0.1581 0.1772  0.0701  0.0474  
'X-RAY DIFFRACTION' 3 ? refined -18.2357 24.2582 -14.3409 0.0627  -0.1015 0.0124  -0.2405 0.0993  0.0199  4.5447  4.7934  1.9491 
5.8116  -2.5469 5.3316 -0.0395 0.0856  0.0552  -0.1347 -0.0171 0.2516  -0.0455 -0.1448 0.0566  
'X-RAY DIFFRACTION' 4 ? refined -7.8898  31.4151 -18.6201 -0.0341 -0.1231 0.0853  -0.1442 0.1384  0.0684  6.2769  0.0657  7.4493 
-1.1967 -0.6560 2.8822 -0.0526 0.0676  0.1264  -0.0260 0.3032  0.0500  -0.3581 0.0513  -0.2506 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(A79 - A142 )'  
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(A143 - A153 )' 
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? '(A154 - A179 )' 
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? '(A180 - A220 )' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER refinement       2.8.0 ? 1 
XDS    'data reduction' .     ? 2 
SCALA  'data scaling'   .     ? 3 
PHENIX phasing          .     ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     96 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -96.61 
_pdbx_validate_torsion.psi             46.05 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A THR 111 ? CB  ? A THR 35 CB  
2 1 Y 1 A THR 111 ? OG1 ? A THR 35 OG1 
3 1 Y 1 A THR 111 ? CG2 ? A THR 35 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 77  ? A GLY 1  
2  1 Y 1 A PRO 78  ? A PRO 2  
3  1 Y 1 A ALA 112 ? A ALA 36 
4  1 Y 1 A SER 113 ? A SER 37 
5  1 Y 1 A LEU 114 ? A LEU 38 
6  1 Y 1 A ARG 115 ? A ARG 39 
7  1 Y 1 A CYS 116 ? A CYS 40 
8  1 Y 1 A PHE 117 ? A PHE 41 
9  1 Y 1 A LEU 118 ? A LEU 42 
10 1 Y 1 A GLN 119 ? A GLN 43 
11 1 Y 1 A LEU 120 ? A LEU 44 
12 1 Y 1 A ARG 121 ? A ARG 45 
13 1 Y 1 A ASP 122 ? A ASP 46 
14 1 Y 1 A ALA 123 ? A ALA 47 
15 1 Y 1 A ALA 168 ? A ALA 92 
16 1 Y 1 A PRO 169 ? A PRO 93 
17 1 Y 1 A GLY 170 ? A GLY 94 
18 1 Y 1 A ALA 171 ? A ALA 95 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        2,3-DIHYDROXY-1,4-DITHIOBUTANE 
_pdbx_entity_nonpoly.comp_id     DTT 
#