data_2Y96
# 
_entry.id   2Y96 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2Y96         
PDBE  EBI-47333    
WWPDB D_1290047333 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2Y96 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-02-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lountos, G.T.' 1 
'Tropea, J.E.'  2 
'Waugh, D.S.'   3 
# 
_citation.id                        primary 
_citation.title                     'Structure of Human Dual-Specificity Phosphatase at 2.38A Resolution' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            67 
_citation.page_first                471 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21543850 
_citation.pdbx_database_id_DOI      10.1107/S090744491100970X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lountos, G.T.' 1 
primary 'Tropea, J.E.'  2 
primary 'Waugh, D.S.'   3 
# 
_cell.entry_id           2Y96 
_cell.length_a           126.012 
_cell.length_b           126.012 
_cell.length_c           125.758 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2Y96 
_symmetry.space_group_name_H-M             'P 64 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                181 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DUAL SPECIFICITY PHOSPHATASE DUPD1' 25240.379 2   '3.1.3.16, 3.1.3.48' ? 'RESIDUES 2-220' ? 
2 non-polymer syn 'SULFATE ION'                        96.063    7   ?                    ? ?                ? 
3 water       nat water                                18.015    137 ?                    ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN DUAL-SPECIFICITY PHOSPHATASE 27' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGF
THVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAY
LMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGF
THVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAY
LMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   SER n 
1 3   GLY n 
1 4   GLU n 
1 5   VAL n 
1 6   LYS n 
1 7   THR n 
1 8   SER n 
1 9   LEU n 
1 10  LYS n 
1 11  ASN n 
1 12  ALA n 
1 13  TYR n 
1 14  SER n 
1 15  SER n 
1 16  ALA n 
1 17  LYS n 
1 18  ARG n 
1 19  LEU n 
1 20  SER n 
1 21  PRO n 
1 22  LYS n 
1 23  MET n 
1 24  GLU n 
1 25  GLU n 
1 26  GLU n 
1 27  GLY n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  ASP n 
1 32  TYR n 
1 33  CYS n 
1 34  THR n 
1 35  PRO n 
1 36  GLY n 
1 37  ALA n 
1 38  PHE n 
1 39  GLU n 
1 40  LEU n 
1 41  GLU n 
1 42  ARG n 
1 43  LEU n 
1 44  PHE n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  SER n 
1 49  PRO n 
1 50  GLN n 
1 51  TYR n 
1 52  THR n 
1 53  HIS n 
1 54  VAL n 
1 55  ASN n 
1 56  GLU n 
1 57  VAL n 
1 58  TRP n 
1 59  PRO n 
1 60  LYS n 
1 61  LEU n 
1 62  TYR n 
1 63  ILE n 
1 64  GLY n 
1 65  ASP n 
1 66  GLU n 
1 67  ALA n 
1 68  THR n 
1 69  ALA n 
1 70  LEU n 
1 71  ASP n 
1 72  ARG n 
1 73  TYR n 
1 74  ARG n 
1 75  LEU n 
1 76  GLN n 
1 77  LYS n 
1 78  ALA n 
1 79  GLY n 
1 80  PHE n 
1 81  THR n 
1 82  HIS n 
1 83  VAL n 
1 84  LEU n 
1 85  ASN n 
1 86  ALA n 
1 87  ALA n 
1 88  HIS n 
1 89  GLY n 
1 90  ARG n 
1 91  TRP n 
1 92  ASN n 
1 93  VAL n 
1 94  ASP n 
1 95  THR n 
1 96  GLY n 
1 97  PRO n 
1 98  ASP n 
1 99  TYR n 
1 100 TYR n 
1 101 ARG n 
1 102 ASP n 
1 103 MET n 
1 104 ASP n 
1 105 ILE n 
1 106 GLN n 
1 107 TYR n 
1 108 HIS n 
1 109 GLY n 
1 110 VAL n 
1 111 GLU n 
1 112 ALA n 
1 113 ASP n 
1 114 ASP n 
1 115 LEU n 
1 116 PRO n 
1 117 THR n 
1 118 PHE n 
1 119 ASP n 
1 120 LEU n 
1 121 SER n 
1 122 VAL n 
1 123 PHE n 
1 124 PHE n 
1 125 TYR n 
1 126 PRO n 
1 127 ALA n 
1 128 ALA n 
1 129 ALA n 
1 130 PHE n 
1 131 ILE n 
1 132 ASP n 
1 133 ARG n 
1 134 ALA n 
1 135 LEU n 
1 136 SER n 
1 137 ASP n 
1 138 ASP n 
1 139 HIS n 
1 140 SER n 
1 141 LYS n 
1 142 ILE n 
1 143 LEU n 
1 144 VAL n 
1 145 HIS n 
1 146 CYS n 
1 147 VAL n 
1 148 MET n 
1 149 GLY n 
1 150 ARG n 
1 151 SER n 
1 152 ARG n 
1 153 SER n 
1 154 ALA n 
1 155 THR n 
1 156 LEU n 
1 157 VAL n 
1 158 LEU n 
1 159 ALA n 
1 160 TYR n 
1 161 LEU n 
1 162 MET n 
1 163 ILE n 
1 164 HIS n 
1 165 LYS n 
1 166 ASP n 
1 167 MET n 
1 168 THR n 
1 169 LEU n 
1 170 VAL n 
1 171 ASP n 
1 172 ALA n 
1 173 ILE n 
1 174 GLN n 
1 175 GLN n 
1 176 VAL n 
1 177 ALA n 
1 178 LYS n 
1 179 ASN n 
1 180 ARG n 
1 181 CYS n 
1 182 VAL n 
1 183 LEU n 
1 184 PRO n 
1 185 ASN n 
1 186 ARG n 
1 187 GLY n 
1 188 PHE n 
1 189 LEU n 
1 190 LYS n 
1 191 GLN n 
1 192 LEU n 
1 193 ARG n 
1 194 GLU n 
1 195 LEU n 
1 196 ASP n 
1 197 LYS n 
1 198 GLN n 
1 199 LEU n 
1 200 VAL n 
1 201 GLN n 
1 202 GLN n 
1 203 ARG n 
1 204 ARG n 
1 205 ARG n 
1 206 SER n 
1 207 GLN n 
1 208 ARG n 
1 209 GLN n 
1 210 ASP n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 GLU n 
1 215 ASP n 
1 216 GLY n 
1 217 ARG n 
1 218 GLU n 
1 219 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ROSETTA2 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PJT154 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DUPD1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q68J44 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2Y96 A 1 ? 219 ? Q68J44 2 ? 220 ? 2 220 
2 1 2Y96 B 1 ? 219 ? Q68J44 2 ? 220 ? 2 220 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2Y96 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   57 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10 MG/ML PROTEIN, 0.2M AMMONIUM SULFATE, 25% W/V PEG3350, ROOM TEMPERATURE, pH 6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2011-10-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2Y96 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.38 
_reflns.number_obs                   24047 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        48.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              16.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.38 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.72 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.20 
_reflns_shell.pdbx_redundancy        15.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2Y96 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22618 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.38 
_refine.ls_percent_reflns_obs                    98.98 
_refine.ls_R_factor_obs                          0.20257 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20139 
_refine.ls_R_factor_R_free                       0.22482 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1220 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.937 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2PQ5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.256 
_refine.pdbx_overall_ESU_R_Free                  0.198 
_refine.overall_SU_ML                            0.138 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             12.924 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2758 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             137 
_refine_hist.number_atoms_total               2930 
_refine_hist.d_res_high                       2.38 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.015  0.022  ? 2872 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1938 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.514  1.957  ? 3899 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.912  3.000  ? 4676 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.107  5.000  ? 341  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.410 23.014 ? 146  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.673 15.000 ? 474  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.264 15.000 ? 25   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.092  0.200  ? 416  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 3177 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 627  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.752  1.500  ? 1703 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.153  1.500  ? 684  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.448  2.000  ? 2741 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.206  3.000  ? 1169 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.482  4.500  ? 1157 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.384 
_refine_ls_shell.d_res_low                        2.446 
_refine_ls_shell.number_reflns_R_work             1596 
_refine_ls_shell.R_factor_R_work                  0.252 
_refine_ls_shell.percent_reflns_obs               97.23 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2Y96 
_struct.title                     'Structure of human dual-specificity phosphatase 27' 
_struct.pdbx_descriptor           'DUAL SPECIFICITY PHOSPHATASE DUPD1 (E.C.3.1.3.16, 3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2Y96 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 36  ? GLY A 47  ? GLY A 37  GLY A 48  1 ? 12 
HELX_P HELX_P2  2  ASP A 65  ? ASP A 71  ? ASP A 66  ASP A 72  1 ? 7  
HELX_P HELX_P3  3  ASP A 71  ? ALA A 78  ? ASP A 72  ALA A 79  1 ? 8  
HELX_P HELX_P4  4  THR A 95  ? TYR A 100 ? THR A 96  TYR A 101 1 ? 6  
HELX_P HELX_P5  5  ASP A 119 ? VAL A 122 ? ASP A 120 VAL A 123 5 ? 4  
HELX_P HELX_P6  6  PHE A 123 ? SER A 136 ? PHE A 124 SER A 137 1 ? 14 
HELX_P HELX_P7  7  SER A 151 ? LYS A 165 ? SER A 152 LYS A 166 1 ? 15 
HELX_P HELX_P8  8  THR A 168 ? LYS A 178 ? THR A 169 LYS A 179 1 ? 11 
HELX_P HELX_P9  9  ASN A 185 ? ARG A 205 ? ASN A 186 ARG A 206 1 ? 21 
HELX_P HELX_P10 10 GLY B 36  ? GLY B 47  ? GLY B 37  GLY B 48  1 ? 12 
HELX_P HELX_P11 11 ASP B 65  ? ASP B 71  ? ASP B 66  ASP B 72  1 ? 7  
HELX_P HELX_P12 12 ASP B 71  ? ALA B 78  ? ASP B 72  ALA B 79  1 ? 8  
HELX_P HELX_P13 13 GLY B 96  ? ASP B 102 ? GLY B 97  ASP B 103 1 ? 7  
HELX_P HELX_P14 14 ASP B 119 ? VAL B 122 ? ASP B 120 VAL B 123 5 ? 4  
HELX_P HELX_P15 15 PHE B 123 ? ASP B 137 ? PHE B 124 ASP B 138 1 ? 15 
HELX_P HELX_P16 16 SER B 151 ? LYS B 165 ? SER B 152 LYS B 166 1 ? 15 
HELX_P HELX_P17 17 THR B 168 ? LYS B 178 ? THR B 169 LYS B 179 1 ? 11 
HELX_P HELX_P18 18 ASN B 185 ? VAL B 200 ? ASN B 186 VAL B 201 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 48 A . ? SER 49 A PRO 49 A ? PRO 50 A 1 -16.78 
2 SER 48 B . ? SER 49 B PRO 49 B ? PRO 50 B 1 -9.52  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
BA ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 54  ? TRP A 58  ? VAL A 55  TRP A 59  
AA 2 LEU A 61  ? GLY A 64  ? LEU A 62  GLY A 65  
AA 3 ILE A 142 ? HIS A 145 ? ILE A 143 HIS A 146 
AA 4 HIS A 82  ? ASN A 85  ? HIS A 83  ASN A 86  
AA 5 GLN A 106 ? GLY A 109 ? GLN A 107 GLY A 110 
BA 1 VAL B 54  ? TRP B 58  ? VAL B 55  TRP B 59  
BA 2 LEU B 61  ? GLY B 64  ? LEU B 62  GLY B 65  
BA 3 ILE B 142 ? HIS B 145 ? ILE B 143 HIS B 146 
BA 4 HIS B 82  ? ASN B 85  ? HIS B 83  ASN B 86  
BA 5 GLN B 106 ? GLY B 109 ? GLN B 107 GLY B 110 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 57  ? N VAL A 58  O LEU A 61  ? O LEU A 62  
AA 2 3 N TYR A 62  ? N TYR A 63  O ILE A 142 ? O ILE A 143 
AA 3 4 N LEU A 143 ? N LEU A 144 O HIS A 82  ? O HIS A 83  
AA 4 5 N VAL A 83  ? N VAL A 84  O GLN A 106 ? O GLN A 107 
BA 1 2 N VAL B 57  ? N VAL B 58  O LEU B 61  ? O LEU B 62  
BA 2 3 N TYR B 62  ? N TYR B 63  O ILE B 142 ? O ILE B 143 
BA 3 4 N LEU B 143 ? N LEU B 144 O HIS B 82  ? O HIS B 83  
BA 4 5 N VAL B 83  ? N VAL B 84  O GLN B 106 ? O GLN B 107 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 1207' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1208' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 1209' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 A 1210' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1211' 
AC6 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 B 1202' 
AC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 B 1203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ASP A 114 ? ASP A 115  . ? 1_555 ? 
2  AC1 10 CYS A 146 ? CYS A 147  . ? 1_555 ? 
3  AC1 10 VAL A 147 ? VAL A 148  . ? 1_555 ? 
4  AC1 10 MET A 148 ? MET A 149  . ? 1_555 ? 
5  AC1 10 GLY A 149 ? GLY A 150  . ? 1_555 ? 
6  AC1 10 ARG A 150 ? ARG A 151  . ? 1_555 ? 
7  AC1 10 SER A 151 ? SER A 152  . ? 1_555 ? 
8  AC1 10 ARG A 152 ? ARG A 153  . ? 1_555 ? 
9  AC1 10 HOH J .   ? HOH A 2037 . ? 1_555 ? 
10 AC1 10 HOH J .   ? HOH A 2075 . ? 1_555 ? 
11 AC2 3  THR A 52  ? THR A 53   . ? 1_555 ? 
12 AC2 3  HIS A 53  ? HIS A 54   . ? 1_555 ? 
13 AC2 3  VAL A 54  ? VAL A 55   . ? 1_555 ? 
14 AC3 2  ARG A 72  ? ARG A 73   . ? 1_555 ? 
15 AC3 2  ARG A 101 ? ARG A 102  . ? 1_555 ? 
16 AC4 8  HIS A 108 ? HIS A 109  . ? 1_555 ? 
17 AC4 8  PHE A 130 ? PHE A 131  . ? 1_555 ? 
18 AC4 8  ARG A 133 ? ARG A 134  . ? 1_555 ? 
19 AC4 8  GLN A 201 ? GLN A 202  . ? 4_445 ? 
20 AC4 8  GLN A 202 ? GLN A 203  . ? 4_445 ? 
21 AC4 8  HOH J .   ? HOH A 2048 . ? 1_555 ? 
22 AC4 8  HOH J .   ? HOH A 2050 . ? 1_555 ? 
23 AC4 8  HOH J .   ? HOH A 2072 . ? 4_445 ? 
24 AC5 3  GLN A 50  ? GLN A 51   . ? 1_555 ? 
25 AC5 3  ASN A 55  ? ASN A 56   . ? 1_555 ? 
26 AC5 3  GLU A 56  ? GLU A 57   . ? 1_555 ? 
27 AC6 8  ASP B 114 ? ASP B 115  . ? 1_555 ? 
28 AC6 8  CYS B 146 ? CYS B 147  . ? 1_555 ? 
29 AC6 8  VAL B 147 ? VAL B 148  . ? 1_555 ? 
30 AC6 8  MET B 148 ? MET B 149  . ? 1_555 ? 
31 AC6 8  GLY B 149 ? GLY B 150  . ? 1_555 ? 
32 AC6 8  ARG B 150 ? ARG B 151  . ? 1_555 ? 
33 AC6 8  SER B 151 ? SER B 152  . ? 1_555 ? 
34 AC6 8  ARG B 152 ? ARG B 153  . ? 1_555 ? 
35 AC7 2  VAL B 147 ? VAL B 148  . ? 1_555 ? 
36 AC7 2  ARG B 152 ? ARG B 153  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2Y96 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2Y96 
_atom_sites.fract_transf_matrix[1][1]   0.007936 
_atom_sites.fract_transf_matrix[1][2]   0.004582 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009163 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007952 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 31  ? 0.226   -20.300 -17.635 1.00 86.87 ? 32   ASP A N   1 
ATOM   2    C CA  . ASP A 1 31  ? -0.311  -20.622 -16.276 1.00 85.59 ? 32   ASP A CA  1 
ATOM   3    C C   . ASP A 1 31  ? 0.273   -21.931 -15.643 1.00 81.95 ? 32   ASP A C   1 
ATOM   4    O O   . ASP A 1 31  ? 0.923   -21.861 -14.585 1.00 81.55 ? 32   ASP A O   1 
ATOM   5    C CB  . ASP A 1 31  ? -1.848  -20.636 -16.313 1.00 86.19 ? 32   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 31  ? -2.454  -21.225 -15.057 1.00 85.29 ? 32   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 31  ? -2.182  -20.688 -13.954 1.00 87.11 ? 32   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 31  ? -3.198  -22.227 -15.181 1.00 84.14 ? 32   ASP A OD2 1 
ATOM   9    N N   . TYR A 1 32  ? 0.050   -23.109 -16.242 1.00 79.20 ? 33   TYR A N   1 
ATOM   10   C CA  . TYR A 1 32  ? 0.738   -24.319 -15.744 1.00 75.62 ? 33   TYR A CA  1 
ATOM   11   C C   . TYR A 1 32  ? 2.222   -24.168 -16.024 1.00 75.37 ? 33   TYR A C   1 
ATOM   12   O O   . TYR A 1 32  ? 2.617   -23.765 -17.121 1.00 76.35 ? 33   TYR A O   1 
ATOM   13   C CB  . TYR A 1 32  ? 0.231   -25.611 -16.396 1.00 74.09 ? 33   TYR A CB  1 
ATOM   14   C CG  . TYR A 1 32  ? 1.152   -26.832 -16.204 1.00 70.92 ? 33   TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 32  ? 2.205   -27.077 -17.083 1.00 69.65 ? 33   TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 32  ? 0.967   -27.733 -15.145 1.00 67.81 ? 33   TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 32  ? 3.051   -28.162 -16.919 1.00 67.28 ? 33   TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 32  ? 1.811   -28.836 -14.982 1.00 64.92 ? 33   TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 32  ? 2.852   -29.039 -15.877 1.00 64.83 ? 33   TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 32  ? 3.696   -30.116 -15.757 1.00 60.00 ? 33   TYR A OH  1 
ATOM   21   N N   . CYS A 1 33  ? 3.045   -24.471 -15.030 1.00 73.43 ? 34   CYS A N   1 
ATOM   22   C CA  . CYS A 1 33  ? 4.478   -24.602 -15.272 1.00 73.03 ? 34   CYS A CA  1 
ATOM   23   C C   . CYS A 1 33  ? 4.960   -25.936 -14.705 1.00 68.94 ? 34   CYS A C   1 
ATOM   24   O O   . CYS A 1 33  ? 4.280   -26.564 -13.894 1.00 68.02 ? 34   CYS A O   1 
ATOM   25   C CB  . CYS A 1 33  ? 5.255   -23.412 -14.692 1.00 74.70 ? 34   CYS A CB  1 
ATOM   26   S SG  . CYS A 1 33  ? 4.709   -22.977 -13.026 1.00 78.49 ? 34   CYS A SG  1 
ATOM   27   N N   . THR A 1 34  ? 6.117   -26.377 -15.180 1.00 66.63 ? 35   THR A N   1 
ATOM   28   C CA  . THR A 1 34  ? 6.683   -27.640 -14.774 1.00 62.99 ? 35   THR A CA  1 
ATOM   29   C C   . THR A 1 34  ? 7.228   -27.488 -13.361 1.00 61.58 ? 35   THR A C   1 
ATOM   30   O O   . THR A 1 34  ? 8.190   -26.736 -13.158 1.00 61.63 ? 35   THR A O   1 
ATOM   31   C CB  . THR A 1 34  ? 7.846   -28.058 -15.681 1.00 62.64 ? 35   THR A CB  1 
ATOM   32   O OG1 . THR A 1 34  ? 7.430   -28.041 -17.044 1.00 61.33 ? 35   THR A OG1 1 
ATOM   33   C CG2 . THR A 1 34  ? 8.294   -29.441 -15.324 1.00 60.24 ? 35   THR A CG2 1 
ATOM   34   N N   . PRO A 1 35  ? 6.646   -28.223 -12.390 1.00 58.96 ? 36   PRO A N   1 
ATOM   35   C CA  . PRO A 1 35  ? 7.183   -28.165 -11.042 1.00 58.15 ? 36   PRO A CA  1 
ATOM   36   C C   . PRO A 1 35  ? 8.620   -28.667 -10.968 1.00 56.99 ? 36   PRO A C   1 
ATOM   37   O O   . PRO A 1 35  ? 9.065   -29.387 -11.850 1.00 56.45 ? 36   PRO A O   1 
ATOM   38   C CB  . PRO A 1 35  ? 6.257   -29.088 -10.241 1.00 56.90 ? 36   PRO A CB  1 
ATOM   39   C CG  . PRO A 1 35  ? 5.054   -29.328 -11.102 1.00 56.86 ? 36   PRO A CG  1 
ATOM   40   C CD  . PRO A 1 35  ? 5.556   -29.206 -12.504 1.00 57.93 ? 36   PRO A CD  1 
ATOM   41   N N   . GLY A 1 36  ? 9.335   -28.277 -9.918  1.00 56.78 ? 37   GLY A N   1 
ATOM   42   C CA  . GLY A 1 36  ? 10.685  -28.774 -9.650  1.00 55.18 ? 37   GLY A CA  1 
ATOM   43   C C   . GLY A 1 36  ? 10.728  -30.269 -9.336  1.00 52.87 ? 37   GLY A C   1 
ATOM   44   O O   . GLY A 1 36  ? 9.700   -30.915 -9.119  1.00 51.05 ? 37   GLY A O   1 
ATOM   45   N N   . ALA A 1 37  ? 11.947  -30.795 -9.312  1.00 51.89 ? 38   ALA A N   1 
ATOM   46   C CA  . ALA A 1 37  ? 12.200  -32.219 -9.205  1.00 50.13 ? 38   ALA A CA  1 
ATOM   47   C C   . ALA A 1 37  ? 11.631  -32.755 -7.888  1.00 49.30 ? 38   ALA A C   1 
ATOM   48   O O   . ALA A 1 37  ? 11.032  -33.833 -7.855  1.00 48.42 ? 38   ALA A O   1 
ATOM   49   C CB  . ALA A 1 37  ? 13.720  -32.507 -9.330  1.00 48.90 ? 38   ALA A CB  1 
ATOM   50   N N   . PHE A 1 38  ? 11.775  -31.979 -6.822  1.00 49.60 ? 39   PHE A N   1 
ATOM   51   C CA  . PHE A 1 38  ? 11.398  -32.444 -5.517  1.00 49.51 ? 39   PHE A CA  1 
ATOM   52   C C   . PHE A 1 38  ? 9.890   -32.728 -5.467  1.00 50.01 ? 39   PHE A C   1 
ATOM   53   O O   . PHE A 1 38  ? 9.462   -33.765 -4.928  1.00 48.11 ? 39   PHE A O   1 
ATOM   54   C CB  . PHE A 1 38  ? 11.806  -31.441 -4.438  1.00 50.28 ? 39   PHE A CB  1 
ATOM   55   C CG  . PHE A 1 38  ? 11.339  -31.825 -3.053  1.00 50.61 ? 39   PHE A CG  1 
ATOM   56   C CD1 . PHE A 1 38  ? 12.011  -32.796 -2.329  1.00 50.12 ? 39   PHE A CD1 1 
ATOM   57   C CD2 . PHE A 1 38  ? 10.225  -31.223 -2.494  1.00 50.28 ? 39   PHE A CD2 1 
ATOM   58   C CE1 . PHE A 1 38  ? 11.580  -33.157 -1.050  1.00 53.33 ? 39   PHE A CE1 1 
ATOM   59   C CE2 . PHE A 1 38  ? 9.775   -31.570 -1.216  1.00 53.22 ? 39   PHE A CE2 1 
ATOM   60   C CZ  . PHE A 1 38  ? 10.456  -32.546 -0.488  1.00 53.32 ? 39   PHE A CZ  1 
ATOM   61   N N   . GLU A 1 39  ? 9.091   -31.819 -6.042  1.00 51.23 ? 40   GLU A N   1 
ATOM   62   C CA  . GLU A 1 39  ? 7.630   -31.977 -5.983  1.00 51.45 ? 40   GLU A CA  1 
ATOM   63   C C   . GLU A 1 39  ? 7.102   -32.983 -6.997  1.00 49.53 ? 40   GLU A C   1 
ATOM   64   O O   . GLU A 1 39  ? 6.087   -33.609 -6.771  1.00 48.84 ? 40   GLU A O   1 
ATOM   65   C CB  . GLU A 1 39  ? 6.845   -30.634 -6.016  1.00 53.14 ? 40   GLU A CB  1 
ATOM   66   C CG  . GLU A 1 39  ? 7.453   -29.465 -6.743  1.00 57.47 ? 40   GLU A CG  1 
ATOM   67   C CD  . GLU A 1 39  ? 8.502   -28.652 -5.924  1.00 61.42 ? 40   GLU A CD  1 
ATOM   68   O OE1 . GLU A 1 39  ? 8.288   -28.412 -4.707  1.00 64.19 ? 40   GLU A OE1 1 
ATOM   69   O OE2 . GLU A 1 39  ? 9.526   -28.232 -6.526  1.00 61.40 ? 40   GLU A OE2 1 
ATOM   70   N N   . LEU A 1 40  ? 7.791   -33.151 -8.114  1.00 50.11 ? 41   LEU A N   1 
ATOM   71   C CA  . LEU A 1 40  ? 7.465   -34.239 -9.039  1.00 48.92 ? 41   LEU A CA  1 
ATOM   72   C C   . LEU A 1 40  ? 7.687   -35.580 -8.342  1.00 47.81 ? 41   LEU A C   1 
ATOM   73   O O   . LEU A 1 40  ? 6.888   -36.485 -8.459  1.00 46.92 ? 41   LEU A O   1 
ATOM   74   C CB  . LEU A 1 40  ? 8.304   -34.144 -10.299 1.00 49.29 ? 41   LEU A CB  1 
ATOM   75   C CG  . LEU A 1 40  ? 7.941   -32.983 -11.223 1.00 50.55 ? 41   LEU A CG  1 
ATOM   76   C CD1 . LEU A 1 40  ? 8.892   -32.940 -12.406 1.00 47.33 ? 41   LEU A CD1 1 
ATOM   77   C CD2 . LEU A 1 40  ? 6.499   -33.079 -11.666 1.00 49.90 ? 41   LEU A CD2 1 
ATOM   78   N N   . GLU A 1 41  ? 8.760   -35.689 -7.574  1.00 48.05 ? 42   GLU A N   1 
ATOM   79   C CA  . GLU A 1 41  ? 8.972   -36.890 -6.778  1.00 47.79 ? 42   GLU A CA  1 
ATOM   80   C C   . GLU A 1 41  ? 7.889   -37.165 -5.777  1.00 46.74 ? 42   GLU A C   1 
ATOM   81   O O   . GLU A 1 41  ? 7.472   -38.304 -5.622  1.00 46.90 ? 42   GLU A O   1 
ATOM   82   C CB  . GLU A 1 41  ? 10.299  -36.832 -6.069  1.00 48.07 ? 42   GLU A CB  1 
ATOM   83   C CG  . GLU A 1 41  ? 11.287  -37.708 -6.742  1.00 51.93 ? 42   GLU A CG  1 
ATOM   84   C CD  . GLU A 1 41  ? 12.535  -37.025 -6.960  1.00 55.74 ? 42   GLU A CD  1 
ATOM   85   O OE1 . GLU A 1 41  ? 12.692  -35.984 -6.288  1.00 59.46 ? 42   GLU A OE1 1 
ATOM   86   O OE2 . GLU A 1 41  ? 13.343  -37.531 -7.785  1.00 58.66 ? 42   GLU A OE2 1 
ATOM   87   N N   . ARG A 1 42  ? 7.429   -36.124 -5.100  1.00 46.58 ? 43   ARG A N   1 
ATOM   88   C CA  . ARG A 1 42  ? 6.334   -36.268 -4.173  1.00 46.60 ? 43   ARG A CA  1 
ATOM   89   C C   . ARG A 1 42  ? 5.163   -36.910 -4.903  1.00 45.19 ? 43   ARG A C   1 
ATOM   90   O O   . ARG A 1 42  ? 4.452   -37.766 -4.339  1.00 43.76 ? 43   ARG A O   1 
ATOM   91   C CB  . ARG A 1 42  ? 5.920   -34.911 -3.580  1.00 47.74 ? 43   ARG A CB  1 
ATOM   92   C CG  . ARG A 1 42  ? 4.866   -35.018 -2.505  1.00 49.53 ? 43   ARG A CG  1 
ATOM   93   C CD  . ARG A 1 42  ? 4.092   -33.728 -2.286  1.00 52.92 ? 43   ARG A CD  1 
ATOM   94   N NE  . ARG A 1 42  ? 4.869   -32.845 -1.436  1.00 56.44 ? 43   ARG A NE  1 
ATOM   95   C CZ  . ARG A 1 42  ? 5.393   -31.667 -1.797  1.00 61.67 ? 43   ARG A CZ  1 
ATOM   96   N NH1 . ARG A 1 42  ? 5.222   -31.148 -3.027  1.00 63.13 ? 43   ARG A NH1 1 
ATOM   97   N NH2 . ARG A 1 42  ? 6.099   -30.982 -0.897  1.00 62.70 ? 43   ARG A NH2 1 
ATOM   98   N N   . LEU A 1 43  ? 4.958   -36.491 -6.152  1.00 44.84 ? 44   LEU A N   1 
ATOM   99   C CA  . LEU A 1 43  ? 3.828   -36.998 -6.922  1.00 44.19 ? 44   LEU A CA  1 
ATOM   100  C C   . LEU A 1 43  ? 3.930   -38.503 -7.146  1.00 42.61 ? 44   LEU A C   1 
ATOM   101  O O   . LEU A 1 43  ? 2.957   -39.214 -6.922  1.00 42.07 ? 44   LEU A O   1 
ATOM   102  C CB  . LEU A 1 43  ? 3.655   -36.249 -8.235  1.00 45.04 ? 44   LEU A CB  1 
ATOM   103  C CG  . LEU A 1 43  ? 2.994   -34.870 -8.040  1.00 46.75 ? 44   LEU A CG  1 
ATOM   104  C CD1 . LEU A 1 43  ? 3.157   -34.060 -9.340  1.00 47.28 ? 44   LEU A CD1 1 
ATOM   105  C CD2 . LEU A 1 43  ? 1.523   -34.959 -7.634  1.00 42.79 ? 44   LEU A CD2 1 
ATOM   106  N N   . PHE A 1 44  ? 5.115   -38.991 -7.491  1.00 41.19 ? 45   PHE A N   1 
ATOM   107  C CA  . PHE A 1 44  ? 5.319   -40.426 -7.663  1.00 40.19 ? 45   PHE A CA  1 
ATOM   108  C C   . PHE A 1 44  ? 5.066   -41.221 -6.371  1.00 40.19 ? 45   PHE A C   1 
ATOM   109  O O   . PHE A 1 44  ? 4.540   -42.321 -6.411  1.00 38.60 ? 45   PHE A O   1 
ATOM   110  C CB  . PHE A 1 44  ? 6.726   -40.737 -8.187  1.00 39.45 ? 45   PHE A CB  1 
ATOM   111  C CG  . PHE A 1 44  ? 6.940   -40.338 -9.614  1.00 38.80 ? 45   PHE A CG  1 
ATOM   112  C CD1 . PHE A 1 44  ? 6.347   -41.039 -10.635 1.00 38.74 ? 45   PHE A CD1 1 
ATOM   113  C CD2 . PHE A 1 44  ? 7.763   -39.271 -9.938  1.00 40.05 ? 45   PHE A CD2 1 
ATOM   114  C CE1 . PHE A 1 44  ? 6.543   -40.672 -11.956 1.00 39.82 ? 45   PHE A CE1 1 
ATOM   115  C CE2 . PHE A 1 44  ? 7.980   -38.912 -11.241 1.00 38.24 ? 45   PHE A CE2 1 
ATOM   116  C CZ  . PHE A 1 44  ? 7.361   -39.608 -12.255 1.00 39.05 ? 45   PHE A CZ  1 
ATOM   117  N N   . TRP A 1 45  ? 5.463   -40.662 -5.240  1.00 41.12 ? 46   TRP A N   1 
ATOM   118  C CA  . TRP A 1 45  ? 5.350   -41.346 -3.944  1.00 41.29 ? 46   TRP A CA  1 
ATOM   119  C C   . TRP A 1 45  ? 3.978   -41.203 -3.323  1.00 42.21 ? 46   TRP A C   1 
ATOM   120  O O   . TRP A 1 45  ? 3.429   -42.170 -2.795  1.00 42.41 ? 46   TRP A O   1 
ATOM   121  C CB  . TRP A 1 45  ? 6.412   -40.797 -2.975  1.00 41.84 ? 46   TRP A CB  1 
ATOM   122  C CG  . TRP A 1 45  ? 7.779   -41.352 -3.237  1.00 41.21 ? 46   TRP A CG  1 
ATOM   123  C CD1 . TRP A 1 45  ? 8.807   -40.752 -3.906  1.00 42.17 ? 46   TRP A CD1 1 
ATOM   124  C CD2 . TRP A 1 45  ? 8.250   -42.637 -2.847  1.00 40.74 ? 46   TRP A CD2 1 
ATOM   125  N NE1 . TRP A 1 45  ? 9.905   -41.584 -3.940  1.00 40.49 ? 46   TRP A NE1 1 
ATOM   126  C CE2 . TRP A 1 45  ? 9.578   -42.758 -3.312  1.00 40.13 ? 46   TRP A CE2 1 
ATOM   127  C CE3 . TRP A 1 45  ? 7.673   -43.707 -2.150  1.00 41.24 ? 46   TRP A CE3 1 
ATOM   128  C CZ2 . TRP A 1 45  ? 10.339  -43.896 -3.104  1.00 40.55 ? 46   TRP A CZ2 1 
ATOM   129  C CZ3 . TRP A 1 45  ? 8.441   -44.843 -1.929  1.00 43.49 ? 46   TRP A CZ3 1 
ATOM   130  C CH2 . TRP A 1 45  ? 9.764   -44.926 -2.413  1.00 42.23 ? 46   TRP A CH2 1 
ATOM   131  N N   . LYS A 1 46  ? 3.410   -40.000 -3.379  1.00 43.29 ? 47   LYS A N   1 
ATOM   132  C CA  . LYS A 1 46  ? 2.224   -39.679 -2.572  1.00 43.74 ? 47   LYS A CA  1 
ATOM   133  C C   . LYS A 1 46  ? 0.994   -39.272 -3.364  1.00 44.31 ? 47   LYS A C   1 
ATOM   134  O O   . LYS A 1 46  ? -0.049  -39.052 -2.787  1.00 45.01 ? 47   LYS A O   1 
ATOM   135  C CB  . LYS A 1 46  ? 2.566   -38.531 -1.611  1.00 44.33 ? 47   LYS A CB  1 
ATOM   136  C CG  . LYS A 1 46  ? 3.722   -38.821 -0.677  1.00 44.04 ? 47   LYS A CG  1 
ATOM   137  C CD  . LYS A 1 46  ? 3.557   -40.148 0.038   1.00 44.64 ? 47   LYS A CD  1 
ATOM   138  C CE  . LYS A 1 46  ? 2.357   -40.149 1.017   1.00 45.64 ? 47   LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 46  ? 2.404   -41.390 1.831   1.00 45.31 ? 47   LYS A NZ  1 
ATOM   140  N N   . GLY A 1 47  ? 1.101   -39.169 -4.682  1.00 45.65 ? 48   GLY A N   1 
ATOM   141  C CA  . GLY A 1 47  ? 0.071   -38.488 -5.460  1.00 46.41 ? 48   GLY A CA  1 
ATOM   142  C C   . GLY A 1 47  ? -1.155  -39.316 -5.781  1.00 47.09 ? 48   GLY A C   1 
ATOM   143  O O   . GLY A 1 47  ? -2.170  -38.759 -6.137  1.00 47.93 ? 48   GLY A O   1 
ATOM   144  N N   . SER A 1 48  ? -1.056  -40.637 -5.673  1.00 47.67 ? 49   SER A N   1 
ATOM   145  C CA  . SER A 1 48  ? -2.098  -41.544 -6.135  1.00 48.18 ? 49   SER A CA  1 
ATOM   146  C C   . SER A 1 48  ? -2.479  -42.493 -5.023  1.00 48.93 ? 49   SER A C   1 
ATOM   147  O O   . SER A 1 48  ? -1.607  -43.065 -4.381  1.00 50.15 ? 49   SER A O   1 
ATOM   148  C CB  . SER A 1 48  ? -1.595  -42.384 -7.299  1.00 47.54 ? 49   SER A CB  1 
ATOM   149  O OG  . SER A 1 48  ? -1.253  -41.561 -8.390  1.00 49.68 ? 49   SER A OG  1 
ATOM   150  N N   . PRO A 1 49  ? -3.772  -42.615 -4.728  1.00 49.26 ? 50   PRO A N   1 
ATOM   151  C CA  . PRO A 1 49  ? -4.920  -41.751 -5.069  1.00 49.64 ? 50   PRO A CA  1 
ATOM   152  C C   . PRO A 1 49  ? -4.792  -40.413 -4.368  1.00 49.99 ? 50   PRO A C   1 
ATOM   153  O O   . PRO A 1 49  ? -4.232  -40.347 -3.290  1.00 50.21 ? 50   PRO A O   1 
ATOM   154  C CB  . PRO A 1 49  ? -6.109  -42.477 -4.458  1.00 49.54 ? 50   PRO A CB  1 
ATOM   155  C CG  . PRO A 1 49  ? -5.578  -43.813 -3.985  1.00 49.72 ? 50   PRO A CG  1 
ATOM   156  C CD  . PRO A 1 49  ? -4.124  -43.692 -3.800  1.00 49.66 ? 50   PRO A CD  1 
ATOM   157  N N   . GLN A 1 50  ? -5.336  -39.367 -4.951  1.00 50.62 ? 51   GLN A N   1 
ATOM   158  C CA  . GLN A 1 50  ? -5.360  -38.049 -4.295  1.00 51.82 ? 51   GLN A CA  1 
ATOM   159  C C   . GLN A 1 50  ? -6.576  -37.922 -3.360  1.00 51.45 ? 51   GLN A C   1 
ATOM   160  O O   . GLN A 1 50  ? -7.602  -38.561 -3.582  1.00 51.38 ? 51   GLN A O   1 
ATOM   161  C CB  . GLN A 1 50  ? -5.374  -36.948 -5.343  1.00 53.61 ? 51   GLN A CB  1 
ATOM   162  C CG  . GLN A 1 50  ? -5.627  -37.448 -6.809  1.00 54.55 ? 51   GLN A CG  1 
ATOM   163  C CD  . GLN A 1 50  ? -5.832  -36.323 -7.783  1.00 56.45 ? 51   GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 50  ? -6.479  -36.512 -8.807  1.00 57.92 ? 51   GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 50  ? -5.323  -35.129 -7.453  1.00 59.24 ? 51   GLN A NE2 1 
ATOM   166  N N   . TYR A 1 51  ? -6.445  -37.158 -2.280  1.00 50.96 ? 52   TYR A N   1 
ATOM   167  C CA  . TYR A 1 51  ? -7.584  -36.885 -1.408  1.00 49.92 ? 52   TYR A CA  1 
ATOM   168  C C   . TYR A 1 51  ? -8.086  -35.492 -1.744  1.00 49.90 ? 52   TYR A C   1 
ATOM   169  O O   . TYR A 1 51  ? -7.546  -34.496 -1.267  1.00 51.21 ? 52   TYR A O   1 
ATOM   170  C CB  . TYR A 1 51  ? -7.232  -36.997 0.087   1.00 50.35 ? 52   TYR A CB  1 
ATOM   171  C CG  . TYR A 1 51  ? -8.454  -37.060 0.971   1.00 50.13 ? 52   TYR A CG  1 
ATOM   172  C CD1 . TYR A 1 51  ? -9.067  -38.275 1.245   1.00 50.47 ? 52   TYR A CD1 1 
ATOM   173  C CD2 . TYR A 1 51  ? -9.015  -35.918 1.517   1.00 52.14 ? 52   TYR A CD2 1 
ATOM   174  C CE1 . TYR A 1 51  ? -10.204 -38.359 2.047   1.00 49.95 ? 52   TYR A CE1 1 
ATOM   175  C CE2 . TYR A 1 51  ? -10.180 -35.991 2.335   1.00 51.65 ? 52   TYR A CE2 1 
ATOM   176  C CZ  . TYR A 1 51  ? -10.768 -37.221 2.580   1.00 51.82 ? 52   TYR A CZ  1 
ATOM   177  O OH  . TYR A 1 51  ? -11.923 -37.340 3.365   1.00 55.87 ? 52   TYR A OH  1 
ATOM   178  N N   . THR A 1 52  ? -9.107  -35.437 -2.592  1.00 48.06 ? 53   THR A N   1 
ATOM   179  C CA  . THR A 1 52  ? -9.701  -34.188 -3.022  1.00 47.25 ? 53   THR A CA  1 
ATOM   180  C C   . THR A 1 52  ? -11.231 -34.271 -2.905  1.00 46.26 ? 53   THR A C   1 
ATOM   181  O O   . THR A 1 52  ? -11.799 -35.340 -2.669  1.00 44.70 ? 53   THR A O   1 
ATOM   182  C CB  . THR A 1 52  ? -9.339  -33.916 -4.498  1.00 47.56 ? 53   THR A CB  1 
ATOM   183  O OG1 . THR A 1 52  ? -9.731  -35.040 -5.282  1.00 46.04 ? 53   THR A OG1 1 
ATOM   184  C CG2 . THR A 1 52  ? -7.831  -33.657 -4.682  1.00 46.36 ? 53   THR A CG2 1 
ATOM   185  N N   . HIS A 1 53  ? -11.893 -33.142 -3.111  1.00 46.26 ? 54   HIS A N   1 
ATOM   186  C CA  . HIS A 1 53  ? -13.345 -33.069 -3.039  1.00 46.05 ? 54   HIS A CA  1 
ATOM   187  C C   . HIS A 1 53  ? -14.056 -33.931 -4.077  1.00 45.21 ? 54   HIS A C   1 
ATOM   188  O O   . HIS A 1 53  ? -14.993 -34.635 -3.738  1.00 45.08 ? 54   HIS A O   1 
ATOM   189  C CB  . HIS A 1 53  ? -13.795 -31.616 -3.119  1.00 47.11 ? 54   HIS A CB  1 
ATOM   190  C CG  . HIS A 1 53  ? -13.325 -30.807 -1.959  1.00 48.82 ? 54   HIS A CG  1 
ATOM   191  N ND1 . HIS A 1 53  ? -13.921 -30.884 -0.720  1.00 48.59 ? 54   HIS A ND1 1 
ATOM   192  C CD2 . HIS A 1 53  ? -12.281 -29.957 -1.825  1.00 50.50 ? 54   HIS A CD2 1 
ATOM   193  C CE1 . HIS A 1 53  ? -13.281 -30.090 0.122   1.00 51.30 ? 54   HIS A CE1 1 
ATOM   194  N NE2 . HIS A 1 53  ? -12.279 -29.519 -0.522  1.00 53.32 ? 54   HIS A NE2 1 
ATOM   195  N N   . VAL A 1 54  ? -13.594 -33.907 -5.315  1.00 44.64 ? 55   VAL A N   1 
ATOM   196  C CA  . VAL A 1 54  ? -14.192 -34.677 -6.382  1.00 44.09 ? 55   VAL A CA  1 
ATOM   197  C C   . VAL A 1 54  ? -13.073 -35.313 -7.239  1.00 43.67 ? 55   VAL A C   1 
ATOM   198  O O   . VAL A 1 54  ? -11.980 -34.769 -7.291  1.00 44.29 ? 55   VAL A O   1 
ATOM   199  C CB  . VAL A 1 54  ? -15.077 -33.747 -7.262  1.00 45.64 ? 55   VAL A CB  1 
ATOM   200  C CG1 . VAL A 1 54  ? -14.201 -32.681 -8.006  1.00 44.85 ? 55   VAL A CG1 1 
ATOM   201  C CG2 . VAL A 1 54  ? -15.933 -34.562 -8.273  1.00 45.04 ? 55   VAL A CG2 1 
ATOM   202  N N   . ASN A 1 55  ? -13.349 -36.464 -7.868  1.00 42.36 ? 56   ASN A N   1 
ATOM   203  C CA  . ASN A 1 55  ? -12.404 -37.161 -8.761  1.00 41.91 ? 56   ASN A CA  1 
ATOM   204  C C   . ASN A 1 55  ? -13.194 -37.843 -9.848  1.00 41.80 ? 56   ASN A C   1 
ATOM   205  O O   . ASN A 1 55  ? -14.281 -38.356 -9.600  1.00 41.44 ? 56   ASN A O   1 
ATOM   206  C CB  . ASN A 1 55  ? -11.606 -38.302 -8.075  1.00 41.39 ? 56   ASN A CB  1 
ATOM   207  C CG  . ASN A 1 55  ? -10.771 -37.840 -6.902  1.00 41.12 ? 56   ASN A CG  1 
ATOM   208  O OD1 . ASN A 1 55  ? -11.182 -38.003 -5.755  1.00 42.24 ? 56   ASN A OD1 1 
ATOM   209  N ND2 . ASN A 1 55  ? -9.614  -37.248 -7.173  1.00 37.64 ? 56   ASN A ND2 1 
ATOM   210  N N   . GLU A 1 56  ? -12.644 -37.848 -11.050 1.00 42.30 ? 57   GLU A N   1 
ATOM   211  C CA  . GLU A 1 56  ? -13.143 -38.679 -12.120 1.00 42.83 ? 57   GLU A CA  1 
ATOM   212  C C   . GLU A 1 56  ? -12.709 -40.105 -11.815 1.00 41.89 ? 57   GLU A C   1 
ATOM   213  O O   . GLU A 1 56  ? -11.524 -40.351 -11.660 1.00 42.69 ? 57   GLU A O   1 
ATOM   214  C CB  . GLU A 1 56  ? -12.529 -38.220 -13.437 1.00 43.33 ? 57   GLU A CB  1 
ATOM   215  C CG  . GLU A 1 56  ? -13.098 -38.927 -14.642 1.00 45.20 ? 57   GLU A CG  1 
ATOM   216  C CD  . GLU A 1 56  ? -12.692 -38.275 -15.961 1.00 45.66 ? 57   GLU A CD  1 
ATOM   217  O OE1 . GLU A 1 56  ? -11.580 -37.713 -16.031 1.00 46.44 ? 57   GLU A OE1 1 
ATOM   218  O OE2 . GLU A 1 56  ? -13.499 -38.301 -16.910 1.00 45.44 ? 57   GLU A OE2 1 
ATOM   219  N N   . VAL A 1 57  ? -13.648 -41.040 -11.710 1.00 41.20 ? 58   VAL A N   1 
ATOM   220  C CA  . VAL A 1 57  ? -13.306 -42.433 -11.369 1.00 40.35 ? 58   VAL A CA  1 
ATOM   221  C C   . VAL A 1 57  ? -13.564 -43.430 -12.513 1.00 41.40 ? 58   VAL A C   1 
ATOM   222  O O   . VAL A 1 57  ? -13.242 -44.632 -12.405 1.00 41.74 ? 58   VAL A O   1 
ATOM   223  C CB  . VAL A 1 57  ? -14.047 -42.890 -10.103 1.00 40.04 ? 58   VAL A CB  1 
ATOM   224  C CG1 . VAL A 1 57  ? -13.668 -41.990 -8.908  1.00 36.91 ? 58   VAL A CG1 1 
ATOM   225  C CG2 . VAL A 1 57  ? -15.571 -42.900 -10.351 1.00 39.13 ? 58   VAL A CG2 1 
ATOM   226  N N   . TRP A 1 58  ? -14.121 -42.914 -13.608 1.00 42.25 ? 59   TRP A N   1 
ATOM   227  C CA  . TRP A 1 58  ? -14.439 -43.679 -14.822 1.00 42.90 ? 59   TRP A CA  1 
ATOM   228  C C   . TRP A 1 58  ? -14.746 -42.552 -15.813 1.00 44.14 ? 59   TRP A C   1 
ATOM   229  O O   . TRP A 1 58  ? -15.061 -41.441 -15.381 1.00 44.14 ? 59   TRP A O   1 
ATOM   230  C CB  . TRP A 1 58  ? -15.628 -44.620 -14.575 1.00 42.68 ? 59   TRP A CB  1 
ATOM   231  C CG  . TRP A 1 58  ? -16.039 -45.481 -15.724 1.00 43.44 ? 59   TRP A CG  1 
ATOM   232  C CD1 . TRP A 1 58  ? -17.090 -45.272 -16.541 1.00 45.26 ? 59   TRP A CD1 1 
ATOM   233  C CD2 . TRP A 1 58  ? -15.425 -46.705 -16.164 1.00 43.39 ? 59   TRP A CD2 1 
ATOM   234  N NE1 . TRP A 1 58  ? -17.170 -46.266 -17.489 1.00 47.49 ? 59   TRP A NE1 1 
ATOM   235  C CE2 . TRP A 1 58  ? -16.158 -47.161 -17.276 1.00 46.59 ? 59   TRP A CE2 1 
ATOM   236  C CE3 . TRP A 1 58  ? -14.314 -47.430 -15.751 1.00 42.49 ? 59   TRP A CE3 1 
ATOM   237  C CZ2 . TRP A 1 58  ? -15.834 -48.319 -17.961 1.00 46.67 ? 59   TRP A CZ2 1 
ATOM   238  C CZ3 . TRP A 1 58  ? -13.988 -48.588 -16.422 1.00 45.13 ? 59   TRP A CZ3 1 
ATOM   239  C CH2 . TRP A 1 58  ? -14.743 -49.022 -17.522 1.00 46.56 ? 59   TRP A CH2 1 
ATOM   240  N N   . PRO A 1 59  ? -14.558 -42.777 -17.117 1.00 44.97 ? 60   PRO A N   1 
ATOM   241  C CA  . PRO A 1 59  ? -14.724 -41.649 -18.031 1.00 46.57 ? 60   PRO A CA  1 
ATOM   242  C C   . PRO A 1 59  ? -16.077 -40.966 -17.929 1.00 46.97 ? 60   PRO A C   1 
ATOM   243  O O   . PRO A 1 59  ? -17.109 -41.619 -18.054 1.00 47.21 ? 60   PRO A O   1 
ATOM   244  C CB  . PRO A 1 59  ? -14.535 -42.283 -19.409 1.00 47.70 ? 60   PRO A CB  1 
ATOM   245  C CG  . PRO A 1 59  ? -13.597 -43.421 -19.160 1.00 46.72 ? 60   PRO A CG  1 
ATOM   246  C CD  . PRO A 1 59  ? -13.884 -43.914 -17.761 1.00 45.56 ? 60   PRO A CD  1 
ATOM   247  N N   . LYS A 1 60  ? -16.050 -39.662 -17.669 1.00 47.51 ? 61   LYS A N   1 
ATOM   248  C CA  . LYS A 1 60  ? -17.246 -38.833 -17.531 1.00 48.32 ? 61   LYS A CA  1 
ATOM   249  C C   . LYS A 1 60  ? -18.046 -39.115 -16.267 1.00 46.98 ? 61   LYS A C   1 
ATOM   250  O O   . LYS A 1 60  ? -19.152 -38.602 -16.123 1.00 47.80 ? 61   LYS A O   1 
ATOM   251  C CB  . LYS A 1 60  ? -18.182 -38.956 -18.751 1.00 50.48 ? 61   LYS A CB  1 
ATOM   252  C CG  . LYS A 1 60  ? -17.540 -38.871 -20.167 1.00 53.69 ? 61   LYS A CG  1 
ATOM   253  C CD  . LYS A 1 60  ? -16.653 -37.643 -20.367 1.00 58.12 ? 61   LYS A CD  1 
ATOM   254  C CE  . LYS A 1 60  ? -17.453 -36.335 -20.554 1.00 62.41 ? 61   LYS A CE  1 
ATOM   255  N NZ  . LYS A 1 60  ? -18.042 -36.095 -21.937 1.00 63.13 ? 61   LYS A NZ  1 
ATOM   256  N N   . LEU A 1 61  ? -17.492 -39.907 -15.345 1.00 44.79 ? 62   LEU A N   1 
ATOM   257  C CA  . LEU A 1 61  ? -18.173 -40.273 -14.139 1.00 43.10 ? 62   LEU A CA  1 
ATOM   258  C C   . LEU A 1 61  ? -17.362 -39.768 -12.957 1.00 42.13 ? 62   LEU A C   1 
ATOM   259  O O   . LEU A 1 61  ? -16.274 -40.285 -12.721 1.00 41.83 ? 62   LEU A O   1 
ATOM   260  C CB  . LEU A 1 61  ? -18.295 -41.799 -14.074 1.00 42.34 ? 62   LEU A CB  1 
ATOM   261  C CG  . LEU A 1 61  ? -19.389 -42.399 -13.163 1.00 41.27 ? 62   LEU A CG  1 
ATOM   262  C CD1 . LEU A 1 61  ? -19.355 -43.943 -13.246 1.00 40.49 ? 62   LEU A CD1 1 
ATOM   263  C CD2 . LEU A 1 61  ? -19.266 -41.888 -11.754 1.00 38.53 ? 62   LEU A CD2 1 
ATOM   264  N N   . TYR A 1 62  ? -17.889 -38.793 -12.209 1.00 41.20 ? 63   TYR A N   1 
ATOM   265  C CA  . TYR A 1 62  ? -17.188 -38.247 -11.042 1.00 40.37 ? 63   TYR A CA  1 
ATOM   266  C C   . TYR A 1 62  ? -17.855 -38.641 -9.721  1.00 39.40 ? 63   TYR A C   1 
ATOM   267  O O   . TYR A 1 62  ? -19.085 -38.754 -9.651  1.00 39.55 ? 63   TYR A O   1 
ATOM   268  C CB  . TYR A 1 62  ? -17.106 -36.732 -11.122 1.00 41.55 ? 63   TYR A CB  1 
ATOM   269  C CG  . TYR A 1 62  ? -16.295 -36.206 -12.289 1.00 43.20 ? 63   TYR A CG  1 
ATOM   270  C CD1 . TYR A 1 62  ? -16.734 -36.370 -13.587 1.00 44.93 ? 63   TYR A CD1 1 
ATOM   271  C CD2 . TYR A 1 62  ? -15.091 -35.520 -12.089 1.00 45.43 ? 63   TYR A CD2 1 
ATOM   272  C CE1 . TYR A 1 62  ? -15.988 -35.892 -14.676 1.00 46.25 ? 63   TYR A CE1 1 
ATOM   273  C CE2 . TYR A 1 62  ? -14.343 -35.016 -13.177 1.00 46.31 ? 63   TYR A CE2 1 
ATOM   274  C CZ  . TYR A 1 62  ? -14.805 -35.219 -14.460 1.00 47.89 ? 63   TYR A CZ  1 
ATOM   275  O OH  . TYR A 1 62  ? -14.109 -34.748 -15.558 1.00 54.43 ? 63   TYR A OH  1 
ATOM   276  N N   . ILE A 1 63  ? -17.045 -38.878 -8.682  1.00 37.76 ? 64   ILE A N   1 
ATOM   277  C CA  . ILE A 1 63  ? -17.549 -39.054 -7.335  1.00 36.20 ? 64   ILE A CA  1 
ATOM   278  C C   . ILE A 1 63  ? -17.055 -37.871 -6.526  1.00 36.93 ? 64   ILE A C   1 
ATOM   279  O O   . ILE A 1 63  ? -15.854 -37.632 -6.435  1.00 37.35 ? 64   ILE A O   1 
ATOM   280  C CB  . ILE A 1 63  ? -17.069 -40.345 -6.693  1.00 35.43 ? 64   ILE A CB  1 
ATOM   281  C CG1 . ILE A 1 63  ? -17.597 -41.541 -7.470  1.00 34.21 ? 64   ILE A CG1 1 
ATOM   282  C CG2 . ILE A 1 63  ? -17.541 -40.439 -5.214  1.00 34.46 ? 64   ILE A CG2 1 
ATOM   283  C CD1 . ILE A 1 63  ? -17.195 -42.868 -6.908  1.00 33.32 ? 64   ILE A CD1 1 
ATOM   284  N N   . GLY A 1 64  ? -17.988 -37.119 -5.964  1.00 37.15 ? 65   GLY A N   1 
ATOM   285  C CA  . GLY A 1 64  ? -17.659 -35.948 -5.170  1.00 37.69 ? 65   GLY A CA  1 
ATOM   286  C C   . GLY A 1 64  ? -18.389 -35.862 -3.836  1.00 37.83 ? 65   GLY A C   1 
ATOM   287  O O   . GLY A 1 64  ? -19.167 -36.713 -3.466  1.00 35.88 ? 65   GLY A O   1 
ATOM   288  N N   . ASP A 1 65  ? -18.081 -34.803 -3.111  1.00 39.77 ? 66   ASP A N   1 
ATOM   289  C CA  . ASP A 1 65  ? -18.617 -34.567 -1.807  1.00 41.13 ? 66   ASP A CA  1 
ATOM   290  C C   . ASP A 1 65  ? -19.681 -33.449 -1.876  1.00 42.50 ? 66   ASP A C   1 
ATOM   291  O O   . ASP A 1 65  ? -20.009 -32.963 -2.955  1.00 43.03 ? 66   ASP A O   1 
ATOM   292  C CB  . ASP A 1 65  ? -17.472 -34.235 -0.863  1.00 41.48 ? 66   ASP A CB  1 
ATOM   293  C CG  . ASP A 1 65  ? -16.858 -32.889 -1.128  1.00 44.62 ? 66   ASP A CG  1 
ATOM   294  O OD1 . ASP A 1 65  ? -17.170 -32.246 -2.165  1.00 48.98 ? 66   ASP A OD1 1 
ATOM   295  O OD2 . ASP A 1 65  ? -16.026 -32.483 -0.285  1.00 46.54 ? 66   ASP A OD2 1 
ATOM   296  N N   . GLU A 1 66  ? -20.210 -33.068 -0.725  1.00 43.43 ? 67   GLU A N   1 
ATOM   297  C CA  . GLU A 1 66  ? -21.284 -32.075 -0.632  1.00 45.32 ? 67   GLU A CA  1 
ATOM   298  C C   . GLU A 1 66  ? -20.883 -30.711 -1.180  1.00 47.13 ? 67   GLU A C   1 
ATOM   299  O O   . GLU A 1 66  ? -21.660 -30.098 -1.906  1.00 49.07 ? 67   GLU A O   1 
ATOM   300  C CB  . GLU A 1 66  ? -21.759 -31.930 0.815   1.00 45.46 ? 67   GLU A CB  1 
ATOM   301  C CG  . GLU A 1 66  ? -22.893 -30.933 0.973   1.00 49.24 ? 67   GLU A CG  1 
ATOM   302  C CD  . GLU A 1 66  ? -23.413 -30.815 2.397   1.00 50.44 ? 67   GLU A CD  1 
ATOM   303  O OE1 . GLU A 1 66  ? -22.873 -31.467 3.298   1.00 51.79 ? 67   GLU A OE1 1 
ATOM   304  O OE2 . GLU A 1 66  ? -24.374 -30.054 2.618   1.00 56.72 ? 67   GLU A OE2 1 
ATOM   305  N N   . ALA A 1 67  ? -19.681 -30.235 -0.856  1.00 47.50 ? 68   ALA A N   1 
ATOM   306  C CA  . ALA A 1 67  ? -19.209 -28.944 -1.391  1.00 48.17 ? 68   ALA A CA  1 
ATOM   307  C C   . ALA A 1 67  ? -19.334 -28.922 -2.899  1.00 47.66 ? 68   ALA A C   1 
ATOM   308  O O   . ALA A 1 67  ? -19.784 -27.924 -3.480  1.00 49.56 ? 68   ALA A O   1 
ATOM   309  C CB  . ALA A 1 67  ? -17.760 -28.652 -0.973  1.00 47.90 ? 68   ALA A CB  1 
ATOM   310  N N   . THR A 1 68  ? -18.954 -30.033 -3.526  1.00 46.06 ? 69   THR A N   1 
ATOM   311  C CA  . THR A 1 68  ? -18.912 -30.144 -4.988  1.00 45.41 ? 69   THR A CA  1 
ATOM   312  C C   . THR A 1 68  ? -20.319 -30.032 -5.547  1.00 45.51 ? 69   THR A C   1 
ATOM   313  O O   . THR A 1 68  ? -20.548 -29.283 -6.488  1.00 46.71 ? 69   THR A O   1 
ATOM   314  C CB  . THR A 1 68  ? -18.210 -31.473 -5.421  1.00 44.72 ? 69   THR A CB  1 
ATOM   315  O OG1 . THR A 1 68  ? -16.938 -31.578 -4.755  1.00 45.71 ? 69   THR A OG1 1 
ATOM   316  C CG2 . THR A 1 68  ? -17.981 -31.557 -6.961  1.00 42.20 ? 69   THR A CG2 1 
ATOM   317  N N   . ALA A 1 69  ? -21.262 -30.735 -4.913  1.00 44.33 ? 70   ALA A N   1 
ATOM   318  C CA  . ALA A 1 69  ? -22.657 -30.718 -5.307  1.00 44.36 ? 70   ALA A CA  1 
ATOM   319  C C   . ALA A 1 69  ? -23.267 -29.335 -5.190  1.00 46.54 ? 70   ALA A C   1 
ATOM   320  O O   . ALA A 1 69  ? -24.140 -28.990 -5.975  1.00 47.31 ? 70   ALA A O   1 
ATOM   321  C CB  . ALA A 1 69  ? -23.447 -31.715 -4.479  1.00 42.63 ? 70   ALA A CB  1 
ATOM   322  N N   . LEU A 1 70  ? -22.792 -28.542 -4.225  1.00 48.04 ? 71   LEU A N   1 
ATOM   323  C CA  . LEU A 1 70  ? -23.383 -27.234 -3.904  1.00 50.18 ? 71   LEU A CA  1 
ATOM   324  C C   . LEU A 1 70  ? -22.888 -26.099 -4.785  1.00 52.42 ? 71   LEU A C   1 
ATOM   325  O O   . LEU A 1 70  ? -23.611 -25.158 -5.043  1.00 53.16 ? 71   LEU A O   1 
ATOM   326  C CB  . LEU A 1 70  ? -23.117 -26.870 -2.430  1.00 50.57 ? 71   LEU A CB  1 
ATOM   327  C CG  . LEU A 1 70  ? -23.918 -27.628 -1.354  1.00 49.25 ? 71   LEU A CG  1 
ATOM   328  C CD1 . LEU A 1 70  ? -23.496 -27.204 0.087   1.00 46.55 ? 71   LEU A CD1 1 
ATOM   329  C CD2 . LEU A 1 70  ? -25.405 -27.406 -1.582  1.00 51.07 ? 71   LEU A CD2 1 
ATOM   330  N N   . ASP A 1 71  ? -21.644 -26.202 -5.235  1.00 53.88 ? 72   ASP A N   1 
ATOM   331  C CA  . ASP A 1 71  ? -20.998 -25.172 -6.048  1.00 56.41 ? 72   ASP A CA  1 
ATOM   332  C C   . ASP A 1 71  ? -21.501 -25.215 -7.506  1.00 57.15 ? 72   ASP A C   1 
ATOM   333  O O   . ASP A 1 71  ? -20.915 -25.870 -8.363  1.00 56.35 ? 72   ASP A O   1 
ATOM   334  C CB  . ASP A 1 71  ? -19.480 -25.380 -5.974  1.00 56.32 ? 72   ASP A CB  1 
ATOM   335  C CG  . ASP A 1 71  ? -18.685 -24.181 -6.494  1.00 60.27 ? 72   ASP A CG  1 
ATOM   336  O OD1 . ASP A 1 71  ? -19.208 -23.352 -7.294  1.00 61.72 ? 72   ASP A OD1 1 
ATOM   337  O OD2 . ASP A 1 71  ? -17.505 -24.100 -6.082  1.00 63.93 ? 72   ASP A OD2 1 
ATOM   338  N N   . ARG A 1 72  ? -22.586 -24.498 -7.770  1.00 59.33 ? 73   ARG A N   1 
ATOM   339  C CA  . ARG A 1 72  ? -23.256 -24.550 -9.063  1.00 60.81 ? 73   ARG A CA  1 
ATOM   340  C C   . ARG A 1 72  ? -22.494 -23.833 -10.171 1.00 63.49 ? 73   ARG A C   1 
ATOM   341  O O   . ARG A 1 72  ? -22.463 -24.305 -11.312 1.00 62.92 ? 73   ARG A O   1 
ATOM   342  C CB  . ARG A 1 72  ? -24.665 -23.997 -8.948  1.00 61.70 ? 73   ARG A CB  1 
ATOM   343  C CG  . ARG A 1 72  ? -25.572 -24.936 -8.195  1.00 59.79 ? 73   ARG A CG  1 
ATOM   344  C CD  . ARG A 1 72  ? -26.894 -24.293 -7.890  1.00 61.06 ? 73   ARG A CD  1 
ATOM   345  N NE  . ARG A 1 72  ? -26.748 -23.267 -6.858  1.00 63.45 ? 73   ARG A NE  1 
ATOM   346  C CZ  . ARG A 1 72  ? -27.758 -22.679 -6.220  1.00 63.18 ? 73   ARG A CZ  1 
ATOM   347  N NH1 . ARG A 1 72  ? -29.015 -23.003 -6.499  1.00 61.69 ? 73   ARG A NH1 1 
ATOM   348  N NH2 . ARG A 1 72  ? -27.499 -21.766 -5.288  1.00 63.64 ? 73   ARG A NH2 1 
ATOM   349  N N   . TYR A 1 73  ? -21.870 -22.708 -9.839  1.00 66.55 ? 74   TYR A N   1 
ATOM   350  C CA  . TYR A 1 73  ? -21.021 -22.027 -10.804 1.00 69.78 ? 74   TYR A CA  1 
ATOM   351  C C   . TYR A 1 73  ? -19.996 -23.017 -11.367 1.00 68.69 ? 74   TYR A C   1 
ATOM   352  O O   . TYR A 1 73  ? -19.841 -23.129 -12.580 1.00 69.70 ? 74   TYR A O   1 
ATOM   353  C CB  . TYR A 1 73  ? -20.322 -20.793 -10.190 1.00 71.98 ? 74   TYR A CB  1 
ATOM   354  C CG  . TYR A 1 73  ? -19.231 -20.219 -11.085 1.00 75.29 ? 74   TYR A CG  1 
ATOM   355  C CD1 . TYR A 1 73  ? -19.532 -19.324 -12.109 1.00 79.75 ? 74   TYR A CD1 1 
ATOM   356  C CD2 . TYR A 1 73  ? -17.901 -20.608 -10.927 1.00 75.86 ? 74   TYR A CD2 1 
ATOM   357  C CE1 . TYR A 1 73  ? -18.525 -18.818 -12.948 1.00 82.39 ? 74   TYR A CE1 1 
ATOM   358  C CE2 . TYR A 1 73  ? -16.894 -20.116 -11.760 1.00 77.97 ? 74   TYR A CE2 1 
ATOM   359  C CZ  . TYR A 1 73  ? -17.212 -19.226 -12.763 1.00 81.14 ? 74   TYR A CZ  1 
ATOM   360  O OH  . TYR A 1 73  ? -16.206 -18.745 -13.569 1.00 83.01 ? 74   TYR A OH  1 
ATOM   361  N N   . ARG A 1 74  ? -19.335 -23.749 -10.476 1.00 67.70 ? 75   ARG A N   1 
ATOM   362  C CA  . ARG A 1 74  ? -18.236 -24.646 -10.834 1.00 67.00 ? 75   ARG A CA  1 
ATOM   363  C C   . ARG A 1 74  ? -18.693 -25.919 -11.540 1.00 64.87 ? 75   ARG A C   1 
ATOM   364  O O   . ARG A 1 74  ? -17.951 -26.458 -12.364 1.00 65.25 ? 75   ARG A O   1 
ATOM   365  C CB  . ARG A 1 74  ? -17.430 -25.003 -9.581  1.00 66.45 ? 75   ARG A CB  1 
ATOM   366  C CG  . ARG A 1 74  ? -16.026 -25.616 -9.846  1.00 69.98 ? 75   ARG A CG  1 
ATOM   367  C CD  . ARG A 1 74  ? -15.036 -25.337 -8.679  1.00 74.31 ? 75   ARG A CD  1 
ATOM   368  N NE  . ARG A 1 74  ? -15.003 -23.899 -8.347  1.00 80.45 ? 75   ARG A NE  1 
ATOM   369  C CZ  . ARG A 1 74  ? -14.415 -23.355 -7.273  1.00 82.95 ? 75   ARG A CZ  1 
ATOM   370  N NH1 . ARG A 1 74  ? -13.767 -24.114 -6.384  1.00 81.51 ? 75   ARG A NH1 1 
ATOM   371  N NH2 . ARG A 1 74  ? -14.472 -22.028 -7.094  1.00 85.39 ? 75   ARG A NH2 1 
ATOM   372  N N   . LEU A 1 75  ? -19.891 -26.407 -11.218 1.00 63.36 ? 76   LEU A N   1 
ATOM   373  C CA  . LEU A 1 75  ? -20.481 -27.541 -11.935 1.00 61.63 ? 76   LEU A CA  1 
ATOM   374  C C   . LEU A 1 75  ? -20.803 -27.117 -13.364 1.00 63.37 ? 76   LEU A C   1 
ATOM   375  O O   . LEU A 1 75  ? -20.483 -27.825 -14.306 1.00 62.29 ? 76   LEU A O   1 
ATOM   376  C CB  . LEU A 1 75  ? -21.764 -28.051 -11.258 1.00 60.49 ? 76   LEU A CB  1 
ATOM   377  C CG  . LEU A 1 75  ? -21.728 -28.777 -9.900  1.00 58.66 ? 76   LEU A CG  1 
ATOM   378  C CD1 . LEU A 1 75  ? -23.153 -29.075 -9.434  1.00 56.35 ? 76   LEU A CD1 1 
ATOM   379  C CD2 . LEU A 1 75  ? -20.907 -30.056 -9.959  1.00 54.51 ? 76   LEU A CD2 1 
ATOM   380  N N   . GLN A 1 76  ? -21.424 -25.952 -13.524 1.00 65.58 ? 77   GLN A N   1 
ATOM   381  C CA  . GLN A 1 76  ? -21.832 -25.504 -14.858 1.00 68.25 ? 77   GLN A CA  1 
ATOM   382  C C   . GLN A 1 76  ? -20.641 -25.166 -15.760 1.00 69.22 ? 77   GLN A C   1 
ATOM   383  O O   . GLN A 1 76  ? -20.607 -25.566 -16.914 1.00 69.00 ? 77   GLN A O   1 
ATOM   384  C CB  . GLN A 1 76  ? -22.768 -24.314 -14.781 1.00 70.67 ? 77   GLN A CB  1 
ATOM   385  C CG  . GLN A 1 76  ? -23.346 -23.957 -16.138 1.00 74.55 ? 77   GLN A CG  1 
ATOM   386  C CD  . GLN A 1 76  ? -23.804 -22.537 -16.197 1.00 79.42 ? 77   GLN A CD  1 
ATOM   387  O OE1 . GLN A 1 76  ? -23.235 -21.716 -16.933 1.00 83.94 ? 77   GLN A OE1 1 
ATOM   388  N NE2 . GLN A 1 76  ? -24.839 -22.218 -15.412 1.00 79.97 ? 77   GLN A NE2 1 
ATOM   389  N N   . LYS A 1 77  ? -19.677 -24.427 -15.215 1.00 70.02 ? 78   LYS A N   1 
ATOM   390  C CA  . LYS A 1 77  ? -18.373 -24.195 -15.858 1.00 70.83 ? 78   LYS A CA  1 
ATOM   391  C C   . LYS A 1 77  ? -17.689 -25.497 -16.334 1.00 68.10 ? 78   LYS A C   1 
ATOM   392  O O   . LYS A 1 77  ? -17.037 -25.497 -17.358 1.00 69.43 ? 78   LYS A O   1 
ATOM   393  C CB  . LYS A 1 77  ? -17.446 -23.454 -14.873 1.00 71.60 ? 78   LYS A CB  1 
ATOM   394  C CG  . LYS A 1 77  ? -16.231 -22.739 -15.504 1.00 75.69 ? 78   LYS A CG  1 
ATOM   395  C CD  . LYS A 1 77  ? -14.942 -22.929 -14.635 1.00 77.41 ? 78   LYS A CD  1 
ATOM   396  C CE  . LYS A 1 77  ? -13.779 -22.005 -15.080 1.00 80.65 ? 78   LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 77  ? -12.451 -22.481 -14.559 1.00 79.16 ? 78   LYS A NZ  1 
ATOM   398  N N   . ALA A 1 78  ? -17.836 -26.598 -15.594 1.00 65.05 ? 79   ALA A N   1 
ATOM   399  C CA  . ALA A 1 78  ? -17.224 -27.886 -15.968 1.00 62.51 ? 79   ALA A CA  1 
ATOM   400  C C   . ALA A 1 78  ? -18.113 -28.771 -16.863 1.00 61.59 ? 79   ALA A C   1 
ATOM   401  O O   . ALA A 1 78  ? -17.710 -29.874 -17.237 1.00 60.55 ? 79   ALA A O   1 
ATOM   402  C CB  . ALA A 1 78  ? -16.828 -28.652 -14.721 1.00 60.10 ? 79   ALA A CB  1 
ATOM   403  N N   . GLY A 1 79  ? -19.312 -28.303 -17.197 1.00 61.66 ? 80   GLY A N   1 
ATOM   404  C CA  . GLY A 1 79  ? -20.216 -29.052 -18.061 1.00 61.34 ? 80   GLY A CA  1 
ATOM   405  C C   . GLY A 1 79  ? -20.953 -30.263 -17.475 1.00 58.68 ? 80   GLY A C   1 
ATOM   406  O O   . GLY A 1 79  ? -21.302 -31.180 -18.212 1.00 58.99 ? 80   GLY A O   1 
ATOM   407  N N   . PHE A 1 80  ? -21.231 -30.287 -16.179 1.00 56.07 ? 81   PHE A N   1 
ATOM   408  C CA  . PHE A 1 80  ? -22.052 -31.375 -15.633 1.00 53.64 ? 81   PHE A CA  1 
ATOM   409  C C   . PHE A 1 80  ? -23.476 -31.353 -16.196 1.00 53.26 ? 81   PHE A C   1 
ATOM   410  O O   . PHE A 1 80  ? -24.089 -30.309 -16.280 1.00 54.31 ? 81   PHE A O   1 
ATOM   411  C CB  . PHE A 1 80  ? -22.049 -31.351 -14.105 1.00 52.28 ? 81   PHE A CB  1 
ATOM   412  C CG  . PHE A 1 80  ? -20.799 -31.900 -13.539 1.00 52.48 ? 81   PHE A CG  1 
ATOM   413  C CD1 . PHE A 1 80  ? -19.696 -31.080 -13.342 1.00 55.68 ? 81   PHE A CD1 1 
ATOM   414  C CD2 . PHE A 1 80  ? -20.679 -33.252 -13.300 1.00 49.40 ? 81   PHE A CD2 1 
ATOM   415  C CE1 . PHE A 1 80  ? -18.507 -31.601 -12.871 1.00 55.34 ? 81   PHE A CE1 1 
ATOM   416  C CE2 . PHE A 1 80  ? -19.500 -33.779 -12.846 1.00 51.07 ? 81   PHE A CE2 1 
ATOM   417  C CZ  . PHE A 1 80  ? -18.409 -32.962 -12.622 1.00 53.28 ? 81   PHE A CZ  1 
ATOM   418  N N   . THR A 1 81  ? -23.960 -32.518 -16.619 1.00 51.36 ? 82   THR A N   1 
ATOM   419  C CA  . THR A 1 81  ? -25.312 -32.689 -17.156 1.00 50.93 ? 82   THR A CA  1 
ATOM   420  C C   . THR A 1 81  ? -26.215 -33.566 -16.260 1.00 48.91 ? 82   THR A C   1 
ATOM   421  O O   . THR A 1 81  ? -27.417 -33.655 -16.483 1.00 49.45 ? 82   THR A O   1 
ATOM   422  C CB  . THR A 1 81  ? -25.236 -33.360 -18.515 1.00 51.65 ? 82   THR A CB  1 
ATOM   423  O OG1 . THR A 1 81  ? -24.477 -34.565 -18.383 1.00 49.62 ? 82   THR A OG1 1 
ATOM   424  C CG2 . THR A 1 81  ? -24.556 -32.438 -19.547 1.00 52.45 ? 82   THR A CG2 1 
ATOM   425  N N   . HIS A 1 82  ? -25.626 -34.237 -15.278 1.00 46.13 ? 83   HIS A N   1 
ATOM   426  C CA  . HIS A 1 82  ? -26.363 -35.136 -14.402 1.00 44.22 ? 83   HIS A CA  1 
ATOM   427  C C   . HIS A 1 82  ? -25.760 -35.077 -13.000 1.00 42.13 ? 83   HIS A C   1 
ATOM   428  O O   . HIS A 1 82  ? -24.552 -35.012 -12.854 1.00 41.60 ? 83   HIS A O   1 
ATOM   429  C CB  . HIS A 1 82  ? -26.262 -36.582 -14.901 1.00 43.42 ? 83   HIS A CB  1 
ATOM   430  C CG  . HIS A 1 82  ? -26.854 -36.807 -16.255 1.00 42.47 ? 83   HIS A CG  1 
ATOM   431  N ND1 . HIS A 1 82  ? -26.208 -36.446 -17.412 1.00 42.44 ? 83   HIS A ND1 1 
ATOM   432  C CD2 . HIS A 1 82  ? -28.003 -37.411 -16.638 1.00 41.47 ? 83   HIS A CD2 1 
ATOM   433  C CE1 . HIS A 1 82  ? -26.956 -36.774 -18.452 1.00 41.83 ? 83   HIS A CE1 1 
ATOM   434  N NE2 . HIS A 1 82  ? -28.054 -37.359 -18.009 1.00 41.20 ? 83   HIS A NE2 1 
ATOM   435  N N   . VAL A 1 83  ? -26.616 -35.087 -11.991 1.00 40.98 ? 84   VAL A N   1 
ATOM   436  C CA  . VAL A 1 83  ? -26.220 -35.146 -10.587 1.00 39.85 ? 84   VAL A CA  1 
ATOM   437  C C   . VAL A 1 83  ? -27.051 -36.247 -9.946  1.00 38.94 ? 84   VAL A C   1 
ATOM   438  O O   . VAL A 1 83  ? -28.276 -36.221 -10.036 1.00 39.72 ? 84   VAL A O   1 
ATOM   439  C CB  . VAL A 1 83  ? -26.492 -33.812 -9.846  1.00 40.97 ? 84   VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 83  ? -26.366 -33.979 -8.283  1.00 38.59 ? 84   VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 83  ? -25.573 -32.745 -10.364 1.00 41.29 ? 84   VAL A CG2 1 
ATOM   442  N N   . LEU A 1 84  ? -26.373 -37.229 -9.357  1.00 38.62 ? 85   LEU A N   1 
ATOM   443  C CA  . LEU A 1 84  ? -26.995 -38.290 -8.583  1.00 37.21 ? 85   LEU A CA  1 
ATOM   444  C C   . LEU A 1 84  ? -26.592 -38.064 -7.147  1.00 36.92 ? 85   LEU A C   1 
ATOM   445  O O   . LEU A 1 84  ? -25.433 -38.252 -6.779  1.00 36.75 ? 85   LEU A O   1 
ATOM   446  C CB  . LEU A 1 84  ? -26.500 -39.668 -9.029  1.00 36.61 ? 85   LEU A CB  1 
ATOM   447  C CG  . LEU A 1 84  ? -27.295 -40.897 -8.549  1.00 35.90 ? 85   LEU A CG  1 
ATOM   448  C CD1 . LEU A 1 84  ? -26.593 -42.124 -9.073  1.00 35.33 ? 85   LEU A CD1 1 
ATOM   449  C CD2 . LEU A 1 84  ? -27.519 -41.003 -7.024  1.00 35.98 ? 85   LEU A CD2 1 
ATOM   450  N N   . ASN A 1 85  ? -27.564 -37.699 -6.332  1.00 36.69 ? 86   ASN A N   1 
ATOM   451  C CA  . ASN A 1 85  ? -27.333 -37.374 -4.959  1.00 36.65 ? 86   ASN A CA  1 
ATOM   452  C C   . ASN A 1 85  ? -27.698 -38.591 -4.110  1.00 35.81 ? 86   ASN A C   1 
ATOM   453  O O   . ASN A 1 85  ? -28.873 -38.947 -3.921  1.00 36.21 ? 86   ASN A O   1 
ATOM   454  C CB  . ASN A 1 85  ? -28.173 -36.145 -4.566  1.00 37.34 ? 86   ASN A CB  1 
ATOM   455  C CG  . ASN A 1 85  ? -28.009 -35.767 -3.126  1.00 36.56 ? 86   ASN A CG  1 
ATOM   456  O OD1 . ASN A 1 85  ? -27.196 -36.385 -2.395  1.00 31.90 ? 86   ASN A OD1 1 
ATOM   457  N ND2 . ASN A 1 85  ? -28.750 -34.734 -2.695  1.00 31.90 ? 86   ASN A ND2 1 
ATOM   458  N N   . ALA A 1 86  ? -26.663 -39.203 -3.581  1.00 35.07 ? 87   ALA A N   1 
ATOM   459  C CA  . ALA A 1 86  ? -26.781 -40.420 -2.844  1.00 34.24 ? 87   ALA A CA  1 
ATOM   460  C C   . ALA A 1 86  ? -27.006 -40.093 -1.374  1.00 34.41 ? 87   ALA A C   1 
ATOM   461  O O   . ALA A 1 86  ? -27.004 -40.983 -0.538  1.00 33.08 ? 87   ALA A O   1 
ATOM   462  C CB  . ALA A 1 86  ? -25.502 -41.253 -3.045  1.00 33.67 ? 87   ALA A CB  1 
ATOM   463  N N   . ALA A 1 87  ? -27.177 -38.808 -1.068  1.00 35.11 ? 88   ALA A N   1 
ATOM   464  C CA  . ALA A 1 87  ? -27.556 -38.375 0.266   1.00 35.90 ? 88   ALA A CA  1 
ATOM   465  C C   . ALA A 1 87  ? -28.728 -37.427 0.127   1.00 37.11 ? 88   ALA A C   1 
ATOM   466  O O   . ALA A 1 87  ? -28.767 -36.392 0.767   1.00 38.36 ? 88   ALA A O   1 
ATOM   467  C CB  . ALA A 1 87  ? -26.410 -37.689 0.964   1.00 35.70 ? 88   ALA A CB  1 
ATOM   468  N N   . HIS A 1 88  ? -29.688 -37.792 -0.718  1.00 37.08 ? 89   HIS A N   1 
ATOM   469  C CA  . HIS A 1 88  ? -30.888 -36.997 -0.899  1.00 37.92 ? 89   HIS A CA  1 
ATOM   470  C C   . HIS A 1 88  ? -31.745 -36.868 0.344   1.00 38.44 ? 89   HIS A C   1 
ATOM   471  O O   . HIS A 1 88  ? -31.830 -37.784 1.173   1.00 38.00 ? 89   HIS A O   1 
ATOM   472  C CB  . HIS A 1 88  ? -31.744 -37.659 -1.952  1.00 38.23 ? 89   HIS A CB  1 
ATOM   473  C CG  . HIS A 1 88  ? -32.985 -36.905 -2.286  1.00 38.38 ? 89   HIS A CG  1 
ATOM   474  N ND1 . HIS A 1 88  ? -33.017 -35.947 -3.271  1.00 39.81 ? 89   HIS A ND1 1 
ATOM   475  C CD2 . HIS A 1 88  ? -34.243 -36.989 -1.793  1.00 38.25 ? 89   HIS A CD2 1 
ATOM   476  C CE1 . HIS A 1 88  ? -34.244 -35.462 -3.370  1.00 39.85 ? 89   HIS A CE1 1 
ATOM   477  N NE2 . HIS A 1 88  ? -35.010 -36.087 -2.491  1.00 39.38 ? 89   HIS A NE2 1 
ATOM   478  N N   . GLY A 1 89  ? -32.422 -35.737 0.447   1.00 39.98 ? 90   GLY A N   1 
ATOM   479  C CA  . GLY A 1 89  ? -33.413 -35.539 1.479   1.00 40.81 ? 90   GLY A CA  1 
ATOM   480  C C   . GLY A 1 89  ? -33.203 -34.281 2.293   1.00 42.49 ? 90   GLY A C   1 
ATOM   481  O O   . GLY A 1 89  ? -32.087 -33.748 2.377   1.00 42.71 ? 90   GLY A O   1 
ATOM   482  N N   . ARG A 1 90  ? -34.284 -33.824 2.913   1.00 43.21 ? 91   ARG A N   1 
ATOM   483  C CA  A ARG A 1 90  ? -34.193 -32.600 3.684   0.50 44.96 ? 91   ARG A CA  1 
ATOM   484  C CA  B ARG A 1 90  ? -34.280 -32.631 3.742   0.50 45.26 ? 91   ARG A CA  1 
ATOM   485  C C   . ARG A 1 90  ? -33.358 -32.806 4.969   1.00 45.32 ? 91   ARG A C   1 
ATOM   486  O O   . ARG A 1 90  ? -32.843 -31.836 5.509   1.00 47.23 ? 91   ARG A O   1 
ATOM   487  C CB  A ARG A 1 90  ? -35.582 -31.983 3.950   0.50 45.91 ? 91   ARG A CB  1 
ATOM   488  C CB  B ARG A 1 90  ? -35.729 -32.288 4.173   0.50 46.10 ? 91   ARG A CB  1 
ATOM   489  C CG  A ARG A 1 90  ? -36.065 -30.955 2.863   0.50 46.36 ? 91   ARG A CG  1 
ATOM   490  C CG  B ARG A 1 90  ? -36.685 -31.884 2.999   0.50 47.35 ? 91   ARG A CG  1 
ATOM   491  C CD  A ARG A 1 90  ? -37.582 -30.789 2.937   0.50 45.95 ? 91   ARG A CD  1 
ATOM   492  C CD  B ARG A 1 90  ? -38.178 -31.791 3.419   0.50 48.80 ? 91   ARG A CD  1 
ATOM   493  N NE  A ARG A 1 90  ? -38.158 -29.560 2.362   0.50 47.08 ? 91   ARG A NE  1 
ATOM   494  N NE  B ARG A 1 90  ? -39.001 -31.047 2.449   0.50 50.82 ? 91   ARG A NE  1 
ATOM   495  C CZ  A ARG A 1 90  ? -37.489 -28.585 1.759   0.50 46.05 ? 91   ARG A CZ  1 
ATOM   496  C CZ  B ARG A 1 90  ? -40.293 -30.740 2.604   0.50 50.82 ? 91   ARG A CZ  1 
ATOM   497  N NH1 A ARG A 1 90  ? -36.182 -28.650 1.607   0.50 45.20 ? 91   ARG A NH1 1 
ATOM   498  N NH1 B ARG A 1 90  ? -40.963 -31.107 3.683   0.50 49.80 ? 91   ARG A NH1 1 
ATOM   499  N NH2 A ARG A 1 90  ? -38.144 -27.538 1.311   0.50 47.57 ? 91   ARG A NH2 1 
ATOM   500  N NH2 B ARG A 1 90  ? -40.920 -30.050 1.665   0.50 51.01 ? 91   ARG A NH2 1 
ATOM   501  N N   . TRP A 1 91  ? -33.163 -34.056 5.414   1.00 43.74 ? 92   TRP A N   1 
ATOM   502  C CA  . TRP A 1 91  ? -32.289 -34.350 6.582   1.00 43.68 ? 92   TRP A CA  1 
ATOM   503  C C   . TRP A 1 91  ? -30.831 -34.696 6.213   1.00 43.78 ? 92   TRP A C   1 
ATOM   504  O O   . TRP A 1 91  ? -29.979 -34.881 7.087   1.00 44.24 ? 92   TRP A O   1 
ATOM   505  C CB  . TRP A 1 91  ? -32.904 -35.460 7.451   1.00 42.80 ? 92   TRP A CB  1 
ATOM   506  C CG  . TRP A 1 91  ? -34.138 -34.989 8.145   1.00 43.40 ? 92   TRP A CG  1 
ATOM   507  C CD1 . TRP A 1 91  ? -35.358 -34.727 7.571   1.00 41.73 ? 92   TRP A CD1 1 
ATOM   508  C CD2 . TRP A 1 91  ? -34.268 -34.655 9.534   1.00 43.71 ? 92   TRP A CD2 1 
ATOM   509  N NE1 . TRP A 1 91  ? -36.236 -34.258 8.535   1.00 43.39 ? 92   TRP A NE1 1 
ATOM   510  C CE2 . TRP A 1 91  ? -35.592 -34.206 9.738   1.00 42.79 ? 92   TRP A CE2 1 
ATOM   511  C CE3 . TRP A 1 91  ? -33.400 -34.705 10.627  1.00 44.71 ? 92   TRP A CE3 1 
ATOM   512  C CZ2 . TRP A 1 91  ? -36.063 -33.824 10.978  1.00 44.08 ? 92   TRP A CZ2 1 
ATOM   513  C CZ3 . TRP A 1 91  ? -33.874 -34.304 11.864  1.00 45.28 ? 92   TRP A CZ3 1 
ATOM   514  C CH2 . TRP A 1 91  ? -35.190 -33.884 12.032  1.00 44.26 ? 92   TRP A CH2 1 
ATOM   515  N N   . ASN A 1 92  ? -30.534 -34.732 4.910   1.00 43.68 ? 93   ASN A N   1 
ATOM   516  C CA  . ASN A 1 92  ? -29.206 -35.074 4.431   1.00 43.49 ? 93   ASN A CA  1 
ATOM   517  C C   . ASN A 1 92  ? -28.673 -33.879 3.651   1.00 44.17 ? 93   ASN A C   1 
ATOM   518  O O   . ASN A 1 92  ? -28.597 -32.798 4.233   1.00 45.02 ? 93   ASN A O   1 
ATOM   519  C CB  . ASN A 1 92  ? -29.263 -36.375 3.617   1.00 42.74 ? 93   ASN A CB  1 
ATOM   520  C CG  . ASN A 1 92  ? -29.751 -37.566 4.443   1.00 43.70 ? 93   ASN A CG  1 
ATOM   521  O OD1 . ASN A 1 92  ? -29.228 -37.829 5.514   1.00 47.30 ? 93   ASN A OD1 1 
ATOM   522  N ND2 . ASN A 1 92  ? -30.774 -38.272 3.949   1.00 45.95 ? 93   ASN A ND2 1 
ATOM   523  N N   . VAL A 1 93  ? -28.305 -34.051 2.375   1.00 42.97 ? 94   VAL A N   1 
ATOM   524  C CA  . VAL A 1 93  ? -27.839 -32.938 1.542   1.00 44.30 ? 94   VAL A CA  1 
ATOM   525  C C   . VAL A 1 93  ? -29.049 -32.428 0.775   1.00 45.54 ? 94   VAL A C   1 
ATOM   526  O O   . VAL A 1 93  ? -29.443 -33.005 -0.245  1.00 44.43 ? 94   VAL A O   1 
ATOM   527  C CB  . VAL A 1 93  ? -26.715 -33.355 0.534   1.00 44.09 ? 94   VAL A CB  1 
ATOM   528  C CG1 . VAL A 1 93  ? -26.312 -32.172 -0.380  1.00 42.96 ? 94   VAL A CG1 1 
ATOM   529  C CG2 . VAL A 1 93  ? -25.508 -33.910 1.287   1.00 43.36 ? 94   VAL A CG2 1 
ATOM   530  N N   . ASP A 1 94  ? -29.621 -31.338 1.287   1.00 47.47 ? 95   ASP A N   1 
ATOM   531  C CA  . ASP A 1 94  ? -30.917 -30.823 0.863   1.00 48.12 ? 95   ASP A CA  1 
ATOM   532  C C   . ASP A 1 94  ? -30.785 -29.920 -0.343  1.00 49.44 ? 95   ASP A C   1 
ATOM   533  O O   . ASP A 1 94  ? -30.796 -28.701 -0.210  1.00 51.44 ? 95   ASP A O   1 
ATOM   534  C CB  . ASP A 1 94  ? -31.586 -30.040 2.024   1.00 48.95 ? 95   ASP A CB  1 
ATOM   535  C CG  . ASP A 1 94  ? -33.014 -29.599 1.691   1.00 49.76 ? 95   ASP A CG  1 
ATOM   536  O OD1 . ASP A 1 94  ? -33.608 -30.245 0.809   1.00 49.40 ? 95   ASP A OD1 1 
ATOM   537  O OD2 . ASP A 1 94  ? -33.544 -28.630 2.309   1.00 51.74 ? 95   ASP A OD2 1 
ATOM   538  N N   . THR A 1 95  ? -30.680 -30.537 -1.511  1.00 49.12 ? 96   THR A N   1 
ATOM   539  C CA  . THR A 1 95  ? -30.628 -29.846 -2.796  1.00 50.46 ? 96   THR A CA  1 
ATOM   540  C C   . THR A 1 95  ? -31.888 -30.208 -3.600  1.00 50.95 ? 96   THR A C   1 
ATOM   541  O O   . THR A 1 95  ? -32.808 -29.407 -3.709  1.00 52.46 ? 96   THR A O   1 
ATOM   542  C CB  . THR A 1 95  ? -29.359 -30.243 -3.613  1.00 49.83 ? 96   THR A CB  1 
ATOM   543  O OG1 . THR A 1 95  ? -29.207 -31.671 -3.610  1.00 47.92 ? 96   THR A OG1 1 
ATOM   544  C CG2 . THR A 1 95  ? -28.116 -29.630 -3.020  1.00 49.28 ? 96   THR A CG2 1 
ATOM   545  N N   . GLY A 1 96  ? -31.928 -31.410 -4.168  1.00 50.68 ? 97   GLY A N   1 
ATOM   546  C CA  . GLY A 1 96  ? -33.034 -31.812 -5.033  1.00 51.17 ? 97   GLY A CA  1 
ATOM   547  C C   . GLY A 1 96  ? -33.024 -31.115 -6.382  1.00 52.94 ? 97   GLY A C   1 
ATOM   548  O O   . GLY A 1 96  ? -32.189 -30.246 -6.621  1.00 54.07 ? 97   GLY A O   1 
ATOM   549  N N   . PRO A 1 97  ? -33.971 -31.480 -7.273  1.00 54.05 ? 98   PRO A N   1 
ATOM   550  C CA  . PRO A 1 97  ? -33.992 -30.934 -8.636  1.00 55.79 ? 98   PRO A CA  1 
ATOM   551  C C   . PRO A 1 97  ? -34.175 -29.422 -8.698  1.00 58.34 ? 98   PRO A C   1 
ATOM   552  O O   . PRO A 1 97  ? -33.634 -28.758 -9.574  1.00 60.06 ? 98   PRO A O   1 
ATOM   553  C CB  . PRO A 1 97  ? -35.189 -31.646 -9.297  1.00 55.49 ? 98   PRO A CB  1 
ATOM   554  C CG  . PRO A 1 97  ? -35.921 -32.340 -8.246  1.00 53.66 ? 98   PRO A CG  1 
ATOM   555  C CD  . PRO A 1 97  ? -35.002 -32.518 -7.078  1.00 52.98 ? 98   PRO A CD  1 
ATOM   556  N N   . ASP A 1 98  ? -34.951 -28.889 -7.775  1.00 59.26 ? 99   ASP A N   1 
ATOM   557  C CA  . ASP A 1 98  ? -35.148 -27.452 -7.685  1.00 61.59 ? 99   ASP A CA  1 
ATOM   558  C C   . ASP A 1 98  ? -33.830 -26.707 -7.524  1.00 61.66 ? 99   ASP A C   1 
ATOM   559  O O   . ASP A 1 98  ? -33.650 -25.642 -8.091  1.00 63.81 ? 99   ASP A O   1 
ATOM   560  C CB  . ASP A 1 98  ? -36.043 -27.125 -6.489  1.00 62.12 ? 99   ASP A CB  1 
ATOM   561  C CG  . ASP A 1 98  ? -36.461 -25.688 -6.468  1.00 67.14 ? 99   ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 98  ? -36.662 -25.133 -7.578  1.00 71.09 ? 99   ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 98  ? -36.578 -25.120 -5.353  1.00 70.86 ? 99   ASP A OD2 1 
ATOM   564  N N   . TYR A 1 99  ? -32.913 -27.266 -6.738  1.00 59.69 ? 100  TYR A N   1 
ATOM   565  C CA  . TYR A 1 99  ? -31.605 -26.641 -6.508  1.00 59.36 ? 100  TYR A CA  1 
ATOM   566  C C   . TYR A 1 99  ? -30.844 -26.398 -7.815  1.00 60.22 ? 100  TYR A C   1 
ATOM   567  O O   . TYR A 1 99  ? -30.078 -25.446 -7.914  1.00 61.85 ? 100  TYR A O   1 
ATOM   568  C CB  . TYR A 1 99  ? -30.750 -27.489 -5.549  1.00 56.95 ? 100  TYR A CB  1 
ATOM   569  C CG  . TYR A 1 99  ? -29.468 -26.814 -5.102  1.00 55.36 ? 100  TYR A CG  1 
ATOM   570  C CD1 . TYR A 1 99  ? -29.485 -25.840 -4.114  1.00 54.52 ? 100  TYR A CD1 1 
ATOM   571  C CD2 . TYR A 1 99  ? -28.239 -27.163 -5.660  1.00 52.76 ? 100  TYR A CD2 1 
ATOM   572  C CE1 . TYR A 1 99  ? -28.323 -25.210 -3.699  1.00 56.24 ? 100  TYR A CE1 1 
ATOM   573  C CE2 . TYR A 1 99  ? -27.054 -26.536 -5.251  1.00 54.09 ? 100  TYR A CE2 1 
ATOM   574  C CZ  . TYR A 1 99  ? -27.109 -25.552 -4.276  1.00 56.31 ? 100  TYR A CZ  1 
ATOM   575  O OH  . TYR A 1 99  ? -25.964 -24.926 -3.853  1.00 56.48 ? 100  TYR A OH  1 
ATOM   576  N N   . TYR A 1 100 ? -31.055 -27.257 -8.807  1.00 59.21 ? 101  TYR A N   1 
ATOM   577  C CA  . TYR A 1 100 ? -30.391 -27.123 -10.085 1.00 59.96 ? 101  TYR A CA  1 
ATOM   578  C C   . TYR A 1 100 ? -31.292 -26.529 -11.184 1.00 62.82 ? 101  TYR A C   1 
ATOM   579  O O   . TYR A 1 100 ? -31.015 -26.707 -12.371 1.00 63.34 ? 101  TYR A O   1 
ATOM   580  C CB  . TYR A 1 100 ? -29.849 -28.492 -10.503 1.00 57.93 ? 101  TYR A CB  1 
ATOM   581  C CG  . TYR A 1 100 ? -28.854 -29.038 -9.519  1.00 53.63 ? 101  TYR A CG  1 
ATOM   582  C CD1 . TYR A 1 100 ? -27.573 -28.518 -9.437  1.00 52.20 ? 101  TYR A CD1 1 
ATOM   583  C CD2 . TYR A 1 100 ? -29.207 -30.054 -8.640  1.00 51.25 ? 101  TYR A CD2 1 
ATOM   584  C CE1 . TYR A 1 100 ? -26.671 -29.005 -8.521  1.00 50.50 ? 101  TYR A CE1 1 
ATOM   585  C CE2 . TYR A 1 100 ? -28.316 -30.545 -7.733  1.00 48.55 ? 101  TYR A CE2 1 
ATOM   586  C CZ  . TYR A 1 100 ? -27.055 -30.017 -7.677  1.00 47.88 ? 101  TYR A CZ  1 
ATOM   587  O OH  . TYR A 1 100 ? -26.206 -30.501 -6.752  1.00 45.30 ? 101  TYR A OH  1 
ATOM   588  N N   . ARG A 1 101 ? -32.352 -25.814 -10.799 1.00 64.89 ? 102  ARG A N   1 
ATOM   589  C CA  . ARG A 1 101 ? -33.252 -25.196 -11.782 1.00 68.03 ? 102  ARG A CA  1 
ATOM   590  C C   . ARG A 1 101 ? -32.478 -24.275 -12.728 1.00 70.43 ? 102  ARG A C   1 
ATOM   591  O O   . ARG A 1 101 ? -31.503 -23.632 -12.332 1.00 70.96 ? 102  ARG A O   1 
ATOM   592  C CB  . ARG A 1 101 ? -34.404 -24.432 -11.101 1.00 69.37 ? 102  ARG A CB  1 
ATOM   593  C CG  . ARG A 1 101 ? -34.000 -23.135 -10.365 1.00 72.77 ? 102  ARG A CG  1 
ATOM   594  C CD  . ARG A 1 101 ? -35.134 -22.617 -9.430  1.00 75.57 ? 102  ARG A CD  1 
ATOM   595  N NE  . ARG A 1 101 ? -34.708 -21.524 -8.533  1.00 78.12 ? 102  ARG A NE  1 
ATOM   596  C CZ  . ARG A 1 101 ? -33.900 -21.662 -7.468  1.00 78.32 ? 102  ARG A CZ  1 
ATOM   597  N NH1 . ARG A 1 101 ? -33.388 -22.847 -7.128  1.00 74.62 ? 102  ARG A NH1 1 
ATOM   598  N NH2 . ARG A 1 101 ? -33.590 -20.596 -6.729  1.00 79.98 ? 102  ARG A NH2 1 
ATOM   599  N N   . ASP A 1 102 ? -32.903 -24.256 -13.985 1.00 72.28 ? 103  ASP A N   1 
ATOM   600  C CA  . ASP A 1 102 ? -32.299 -23.416 -15.037 1.00 75.14 ? 103  ASP A CA  1 
ATOM   601  C C   . ASP A 1 102 ? -30.903 -23.860 -15.484 1.00 73.95 ? 103  ASP A C   1 
ATOM   602  O O   . ASP A 1 102 ? -30.339 -23.244 -16.388 1.00 75.91 ? 103  ASP A O   1 
ATOM   603  C CB  . ASP A 1 102 ? -32.214 -21.929 -14.620 1.00 78.03 ? 103  ASP A CB  1 
ATOM   604  C CG  . ASP A 1 102 ? -33.567 -21.319 -14.264 1.00 80.43 ? 103  ASP A CG  1 
ATOM   605  O OD1 . ASP A 1 102 ? -34.456 -21.270 -15.145 1.00 83.41 ? 103  ASP A OD1 1 
ATOM   606  O OD2 . ASP A 1 102 ? -33.718 -20.850 -13.108 1.00 81.91 ? 103  ASP A OD2 1 
ATOM   607  N N   . MET A 1 103 ? -30.345 -24.911 -14.881 1.00 73.80 ? 104  MET A N   1 
ATOM   608  C CA  . MET A 1 103 ? -28.962 -25.297 -15.179 1.00 72.26 ? 104  MET A CA  1 
ATOM   609  C C   . MET A 1 103 ? -28.813 -26.413 -16.203 1.00 71.39 ? 104  MET A C   1 
ATOM   610  O O   . MET A 1 103 ? -27.700 -26.647 -16.688 1.00 71.05 ? 104  MET A O   1 
ATOM   611  C CB  . MET A 1 103 ? -28.232 -25.721 -13.913 1.00 69.61 ? 104  MET A CB  1 
ATOM   612  C CG  . MET A 1 103 ? -27.925 -24.592 -12.973 1.00 69.87 ? 104  MET A CG  1 
ATOM   613  S SD  . MET A 1 103 ? -27.026 -25.234 -11.557 1.00 66.41 ? 104  MET A SD  1 
ATOM   614  C CE  . MET A 1 103 ? -25.497 -25.786 -12.343 1.00 62.55 ? 104  MET A CE  1 
ATOM   615  N N   . ASP A 1 104 ? -29.904 -27.109 -16.519 1.00 70.88 ? 105  ASP A N   1 
ATOM   616  C CA  . ASP A 1 104 ? -29.874 -28.196 -17.515 1.00 70.38 ? 105  ASP A CA  1 
ATOM   617  C C   . ASP A 1 104 ? -29.146 -29.426 -16.976 1.00 66.17 ? 105  ASP A C   1 
ATOM   618  O O   . ASP A 1 104 ? -28.282 -30.003 -17.649 1.00 65.97 ? 105  ASP A O   1 
ATOM   619  C CB  . ASP A 1 104 ? -29.228 -27.726 -18.818 1.00 73.22 ? 105  ASP A CB  1 
ATOM   620  C CG  . ASP A 1 104 ? -29.708 -28.502 -20.019 1.00 76.88 ? 105  ASP A CG  1 
ATOM   621  O OD1 . ASP A 1 104 ? -30.944 -28.552 -20.236 1.00 81.59 ? 105  ASP A OD1 1 
ATOM   622  O OD2 . ASP A 1 104 ? -28.851 -29.038 -20.762 1.00 79.90 ? 105  ASP A OD2 1 
ATOM   623  N N   . ILE A 1 105 ? -29.517 -29.796 -15.751 1.00 62.57 ? 106  ILE A N   1 
ATOM   624  C CA  . ILE A 1 105 ? -29.045 -30.985 -15.057 1.00 58.78 ? 106  ILE A CA  1 
ATOM   625  C C   . ILE A 1 105 ? -30.213 -31.951 -14.866 1.00 56.65 ? 106  ILE A C   1 
ATOM   626  O O   . ILE A 1 105 ? -31.299 -31.526 -14.500 1.00 56.89 ? 106  ILE A O   1 
ATOM   627  C CB  . ILE A 1 105 ? -28.542 -30.603 -13.636 1.00 57.65 ? 106  ILE A CB  1 
ATOM   628  C CG1 . ILE A 1 105 ? -27.243 -29.810 -13.709 1.00 58.22 ? 106  ILE A CG1 1 
ATOM   629  C CG2 . ILE A 1 105 ? -28.401 -31.841 -12.750 1.00 54.76 ? 106  ILE A CG2 1 
ATOM   630  C CD1 . ILE A 1 105 ? -26.176 -30.536 -14.426 1.00 58.63 ? 106  ILE A CD1 1 
ATOM   631  N N   . GLN A 1 106 ? -30.004 -33.237 -15.109 1.00 53.89 ? 107  GLN A N   1 
ATOM   632  C CA  . GLN A 1 106 ? -30.970 -34.243 -14.684 1.00 52.29 ? 107  GLN A CA  1 
ATOM   633  C C   . GLN A 1 106 ? -30.542 -34.751 -13.323 1.00 48.64 ? 107  GLN A C   1 
ATOM   634  O O   . GLN A 1 106 ? -29.361 -35.025 -13.089 1.00 46.80 ? 107  GLN A O   1 
ATOM   635  C CB  . GLN A 1 106 ? -31.072 -35.381 -15.691 1.00 52.68 ? 107  GLN A CB  1 
ATOM   636  C CG  . GLN A 1 106 ? -31.708 -34.931 -17.038 1.00 58.50 ? 107  GLN A CG  1 
ATOM   637  C CD  . GLN A 1 106 ? -31.331 -35.848 -18.179 1.00 62.53 ? 107  GLN A CD  1 
ATOM   638  O OE1 . GLN A 1 106 ? -30.630 -35.444 -19.102 1.00 67.29 ? 107  GLN A OE1 1 
ATOM   639  N NE2 . GLN A 1 106 ? -31.757 -37.111 -18.099 1.00 64.43 ? 107  GLN A NE2 1 
ATOM   640  N N   . TYR A 1 107 ? -31.509 -34.860 -12.423 1.00 47.07 ? 108  TYR A N   1 
ATOM   641  C CA  . TYR A 1 107 ? -31.247 -35.216 -11.036 1.00 44.92 ? 108  TYR A CA  1 
ATOM   642  C C   . TYR A 1 107 ? -31.848 -36.559 -10.695 1.00 43.19 ? 108  TYR A C   1 
ATOM   643  O O   . TYR A 1 107 ? -32.939 -36.864 -11.105 1.00 44.21 ? 108  TYR A O   1 
ATOM   644  C CB  . TYR A 1 107 ? -31.851 -34.161 -10.141 1.00 45.03 ? 108  TYR A CB  1 
ATOM   645  C CG  . TYR A 1 107 ? -31.579 -34.304 -8.648  1.00 43.48 ? 108  TYR A CG  1 
ATOM   646  C CD1 . TYR A 1 107 ? -30.453 -33.743 -8.070  1.00 42.76 ? 108  TYR A CD1 1 
ATOM   647  C CD2 . TYR A 1 107 ? -32.500 -34.920 -7.813  1.00 42.04 ? 108  TYR A CD2 1 
ATOM   648  C CE1 . TYR A 1 107 ? -30.218 -33.848 -6.700  1.00 41.75 ? 108  TYR A CE1 1 
ATOM   649  C CE2 . TYR A 1 107 ? -32.297 -35.006 -6.455  1.00 41.70 ? 108  TYR A CE2 1 
ATOM   650  C CZ  . TYR A 1 107 ? -31.157 -34.472 -5.894  1.00 41.41 ? 108  TYR A CZ  1 
ATOM   651  O OH  . TYR A 1 107 ? -30.968 -34.563 -4.535  1.00 35.84 ? 108  TYR A OH  1 
ATOM   652  N N   . HIS A 1 108 ? -31.115 -37.358 -9.950  1.00 41.23 ? 109  HIS A N   1 
ATOM   653  C CA  . HIS A 1 108 ? -31.628 -38.597 -9.406  1.00 40.42 ? 109  HIS A CA  1 
ATOM   654  C C   . HIS A 1 108 ? -31.254 -38.552 -7.923  1.00 39.05 ? 109  HIS A C   1 
ATOM   655  O O   . HIS A 1 108 ? -30.142 -38.209 -7.556  1.00 38.05 ? 109  HIS A O   1 
ATOM   656  C CB  . HIS A 1 108 ? -31.018 -39.788 -10.135 1.00 39.91 ? 109  HIS A CB  1 
ATOM   657  C CG  . HIS A 1 108 ? -31.563 -41.115 -9.706  1.00 42.39 ? 109  HIS A CG  1 
ATOM   658  N ND1 . HIS A 1 108 ? -32.676 -41.689 -10.283 1.00 45.16 ? 109  HIS A ND1 1 
ATOM   659  C CD2 . HIS A 1 108 ? -31.144 -41.987 -8.755  1.00 42.90 ? 109  HIS A CD2 1 
ATOM   660  C CE1 . HIS A 1 108 ? -32.923 -42.851 -9.702  1.00 44.74 ? 109  HIS A CE1 1 
ATOM   661  N NE2 . HIS A 1 108 ? -32.016 -43.050 -8.763  1.00 42.28 ? 109  HIS A NE2 1 
ATOM   662  N N   . GLY A 1 109 ? -32.223 -38.814 -7.073  1.00 39.02 ? 110  GLY A N   1 
ATOM   663  C CA  . GLY A 1 109 ? -32.026 -38.749 -5.637  1.00 38.68 ? 110  GLY A CA  1 
ATOM   664  C C   . GLY A 1 109 ? -32.215 -40.095 -4.972  1.00 37.19 ? 110  GLY A C   1 
ATOM   665  O O   . GLY A 1 109 ? -33.204 -40.762 -5.178  1.00 37.99 ? 110  GLY A O   1 
ATOM   666  N N   . VAL A 1 110 ? -31.237 -40.498 -4.187  1.00 36.38 ? 111  VAL A N   1 
ATOM   667  C CA  . VAL A 1 110 ? -31.350 -41.681 -3.355  1.00 35.23 ? 111  VAL A CA  1 
ATOM   668  C C   . VAL A 1 110 ? -31.255 -41.186 -1.931  1.00 36.01 ? 111  VAL A C   1 
ATOM   669  O O   . VAL A 1 110 ? -30.222 -40.664 -1.525  1.00 36.13 ? 111  VAL A O   1 
ATOM   670  C CB  . VAL A 1 110 ? -30.198 -42.663 -3.629  1.00 34.43 ? 111  VAL A CB  1 
ATOM   671  C CG1 . VAL A 1 110 ? -30.150 -43.756 -2.532  1.00 32.00 ? 111  VAL A CG1 1 
ATOM   672  C CG2 . VAL A 1 110 ? -30.302 -43.224 -5.079  1.00 30.11 ? 111  VAL A CG2 1 
ATOM   673  N N   . GLU A 1 111 ? -32.320 -41.364 -1.174  1.00 37.09 ? 112  GLU A N   1 
ATOM   674  C CA  . GLU A 1 111 ? -32.353 -40.907 0.215   1.00 39.43 ? 112  GLU A CA  1 
ATOM   675  C C   . GLU A 1 111 ? -31.661 -41.865 1.211   1.00 38.62 ? 112  GLU A C   1 
ATOM   676  O O   . GLU A 1 111 ? -32.338 -42.622 1.883   1.00 39.88 ? 112  GLU A O   1 
ATOM   677  C CB  . GLU A 1 111 ? -33.812 -40.675 0.615   1.00 40.33 ? 112  GLU A CB  1 
ATOM   678  C CG  . GLU A 1 111 ? -33.986 -40.207 2.022   1.00 45.16 ? 112  GLU A CG  1 
ATOM   679  C CD  . GLU A 1 111 ? -35.246 -39.384 2.219   1.00 50.64 ? 112  GLU A CD  1 
ATOM   680  O OE1 . GLU A 1 111 ? -36.144 -39.378 1.340   1.00 54.79 ? 112  GLU A OE1 1 
ATOM   681  O OE2 . GLU A 1 111 ? -35.321 -38.729 3.270   1.00 56.95 ? 112  GLU A OE2 1 
ATOM   682  N N   . ALA A 1 112 ? -30.332 -41.821 1.333   1.00 37.73 ? 113  ALA A N   1 
ATOM   683  C CA  . ALA A 1 112 ? -29.618 -42.869 2.092   1.00 37.62 ? 113  ALA A CA  1 
ATOM   684  C C   . ALA A 1 112 ? -28.854 -42.350 3.305   1.00 38.20 ? 113  ALA A C   1 
ATOM   685  O O   . ALA A 1 112 ? -28.310 -41.252 3.262   1.00 39.10 ? 113  ALA A O   1 
ATOM   686  C CB  . ALA A 1 112 ? -28.670 -43.674 1.174   1.00 35.00 ? 113  ALA A CB  1 
ATOM   687  N N   . ASP A 1 113 ? -28.802 -43.159 4.365   1.00 38.93 ? 114  ASP A N   1 
ATOM   688  C CA  . ASP A 1 113 ? -27.929 -42.897 5.529   1.00 40.49 ? 114  ASP A CA  1 
ATOM   689  C C   . ASP A 1 113 ? -26.649 -43.690 5.372   1.00 39.27 ? 114  ASP A C   1 
ATOM   690  O O   . ASP A 1 113 ? -26.700 -44.832 4.937   1.00 38.22 ? 114  ASP A O   1 
ATOM   691  C CB  . ASP A 1 113 ? -28.565 -43.357 6.858   1.00 42.07 ? 114  ASP A CB  1 
ATOM   692  C CG  . ASP A 1 113 ? -29.979 -42.808 7.090   1.00 46.18 ? 114  ASP A CG  1 
ATOM   693  O OD1 . ASP A 1 113 ? -30.221 -41.591 6.911   1.00 50.96 ? 114  ASP A OD1 1 
ATOM   694  O OD2 . ASP A 1 113 ? -30.850 -43.609 7.506   1.00 52.87 ? 114  ASP A OD2 1 
ATOM   695  N N   . ASP A 1 114 ? -25.509 -43.111 5.768   1.00 39.85 ? 115  ASP A N   1 
ATOM   696  C CA  . ASP A 1 114 ? -24.242 -43.876 5.837   1.00 38.80 ? 115  ASP A CA  1 
ATOM   697  C C   . ASP A 1 114 ? -24.214 -44.706 7.120   1.00 38.88 ? 115  ASP A C   1 
ATOM   698  O O   . ASP A 1 114 ? -23.582 -44.362 8.123   1.00 39.24 ? 115  ASP A O   1 
ATOM   699  C CB  . ASP A 1 114 ? -23.015 -42.981 5.767   1.00 38.77 ? 115  ASP A CB  1 
ATOM   700  C CG  . ASP A 1 114 ? -21.718 -43.785 5.740   1.00 39.72 ? 115  ASP A CG  1 
ATOM   701  O OD1 . ASP A 1 114 ? -21.694 -44.925 5.213   1.00 37.55 ? 115  ASP A OD1 1 
ATOM   702  O OD2 . ASP A 1 114 ? -20.721 -43.266 6.253   1.00 42.00 ? 115  ASP A OD2 1 
ATOM   703  N N   . LEU A 1 115 ? -24.939 -45.809 7.083   1.00 38.32 ? 116  LEU A N   1 
ATOM   704  C CA  . LEU A 1 115 ? -25.065 -46.661 8.253   1.00 38.82 ? 116  LEU A CA  1 
ATOM   705  C C   . LEU A 1 115 ? -25.045 -48.076 7.725   1.00 37.70 ? 116  LEU A C   1 
ATOM   706  O O   . LEU A 1 115 ? -25.632 -48.342 6.681   1.00 37.75 ? 116  LEU A O   1 
ATOM   707  C CB  . LEU A 1 115 ? -26.368 -46.386 8.997   1.00 38.75 ? 116  LEU A CB  1 
ATOM   708  C CG  . LEU A 1 115 ? -26.593 -45.042 9.687   1.00 41.11 ? 116  LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 115 ? -28.042 -44.987 10.383  1.00 38.31 ? 116  LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 115 ? -25.495 -44.752 10.719  1.00 39.81 ? 116  LEU A CD2 1 
ATOM   711  N N   . PRO A 1 116 ? -24.374 -48.977 8.428   1.00 37.83 ? 117  PRO A N   1 
ATOM   712  C CA  . PRO A 1 116 ? -24.366 -50.394 8.076   1.00 38.04 ? 117  PRO A CA  1 
ATOM   713  C C   . PRO A 1 116 ? -25.736 -51.077 8.124   1.00 38.34 ? 117  PRO A C   1 
ATOM   714  O O   . PRO A 1 116 ? -25.902 -52.151 7.528   1.00 38.98 ? 117  PRO A O   1 
ATOM   715  C CB  . PRO A 1 116 ? -23.420 -51.026 9.128   1.00 39.73 ? 117  PRO A CB  1 
ATOM   716  C CG  . PRO A 1 116 ? -23.370 -50.103 10.247  1.00 40.49 ? 117  PRO A CG  1 
ATOM   717  C CD  . PRO A 1 116 ? -23.682 -48.708 9.707   1.00 39.85 ? 117  PRO A CD  1 
ATOM   718  N N   . THR A 1 117 ? -26.698 -50.477 8.824   1.00 38.37 ? 118  THR A N   1 
ATOM   719  C CA  . THR A 1 117 ? -28.065 -50.988 8.862   1.00 38.71 ? 118  THR A CA  1 
ATOM   720  C C   . THR A 1 117 ? -28.926 -50.511 7.641   1.00 38.31 ? 118  THR A C   1 
ATOM   721  O O   . THR A 1 117 ? -30.067 -50.917 7.499   1.00 39.33 ? 118  THR A O   1 
ATOM   722  C CB  . THR A 1 117 ? -28.733 -50.562 10.197  1.00 40.26 ? 118  THR A CB  1 
ATOM   723  O OG1 . THR A 1 117 ? -28.480 -49.171 10.409  1.00 39.64 ? 118  THR A OG1 1 
ATOM   724  C CG2 . THR A 1 117 ? -28.141 -51.340 11.431  1.00 39.32 ? 118  THR A CG2 1 
ATOM   725  N N   . PHE A 1 118 ? -28.420 -49.623 6.792   1.00 37.25 ? 119  PHE A N   1 
ATOM   726  C CA  . PHE A 1 118 ? -29.263 -49.058 5.768   1.00 36.90 ? 119  PHE A CA  1 
ATOM   727  C C   . PHE A 1 118 ? -29.123 -49.914 4.525   1.00 36.94 ? 119  PHE A C   1 
ATOM   728  O O   . PHE A 1 118 ? -28.012 -50.240 4.141   1.00 35.23 ? 119  PHE A O   1 
ATOM   729  C CB  . PHE A 1 118 ? -28.887 -47.620 5.437   1.00 36.81 ? 119  PHE A CB  1 
ATOM   730  C CG  . PHE A 1 118 ? -29.797 -46.988 4.424   1.00 35.23 ? 119  PHE A CG  1 
ATOM   731  C CD1 . PHE A 1 118 ? -30.993 -46.374 4.825   1.00 34.65 ? 119  PHE A CD1 1 
ATOM   732  C CD2 . PHE A 1 118 ? -29.513 -47.080 3.078   1.00 31.74 ? 119  PHE A CD2 1 
ATOM   733  C CE1 . PHE A 1 118 ? -31.866 -45.817 3.895   1.00 33.74 ? 119  PHE A CE1 1 
ATOM   734  C CE2 . PHE A 1 118 ? -30.398 -46.535 2.123   1.00 34.29 ? 119  PHE A CE2 1 
ATOM   735  C CZ  . PHE A 1 118 ? -31.548 -45.897 2.506   1.00 31.70 ? 119  PHE A CZ  1 
ATOM   736  N N   . ASP A 1 119 ? -30.269 -50.269 3.927   1.00 37.67 ? 120  ASP A N   1 
ATOM   737  C CA  . ASP A 1 119 ? -30.345 -51.155 2.761   1.00 37.86 ? 120  ASP A CA  1 
ATOM   738  C C   . ASP A 1 119 ? -30.175 -50.275 1.543   1.00 36.26 ? 120  ASP A C   1 
ATOM   739  O O   . ASP A 1 119 ? -31.151 -49.827 0.922   1.00 36.19 ? 120  ASP A O   1 
ATOM   740  C CB  . ASP A 1 119 ? -31.688 -51.982 2.756   1.00 38.52 ? 120  ASP A CB  1 
ATOM   741  C CG  . ASP A 1 119 ? -32.014 -52.660 1.358   1.00 44.29 ? 120  ASP A CG  1 
ATOM   742  O OD1 . ASP A 1 119 ? -31.071 -52.882 0.526   1.00 44.80 ? 120  ASP A OD1 1 
ATOM   743  O OD2 . ASP A 1 119 ? -33.239 -52.979 1.091   1.00 49.94 ? 120  ASP A OD2 1 
ATOM   744  N N   . LEU A 1 120 ? -28.923 -50.044 1.175   1.00 35.41 ? 121  LEU A N   1 
ATOM   745  C CA  . LEU A 1 120 ? -28.632 -49.332 -0.056  1.00 35.20 ? 121  LEU A CA  1 
ATOM   746  C C   . LEU A 1 120 ? -28.881 -50.210 -1.315  1.00 35.28 ? 121  LEU A C   1 
ATOM   747  O O   . LEU A 1 120 ? -28.984 -49.702 -2.441  1.00 35.36 ? 121  LEU A O   1 
ATOM   748  C CB  . LEU A 1 120 ? -27.194 -48.836 -0.018  1.00 34.98 ? 121  LEU A CB  1 
ATOM   749  C CG  . LEU A 1 120 ? -26.780 -47.723 -0.975  1.00 35.24 ? 121  LEU A CG  1 
ATOM   750  C CD1 . LEU A 1 120 ? -27.675 -46.464 -0.889  1.00 34.73 ? 121  LEU A CD1 1 
ATOM   751  C CD2 . LEU A 1 120 ? -25.340 -47.346 -0.720  1.00 35.75 ? 121  LEU A CD2 1 
ATOM   752  N N   . SER A 1 121 ? -29.008 -51.517 -1.118  1.00 34.87 ? 122  SER A N   1 
ATOM   753  C CA  . SER A 1 121 ? -29.052 -52.431 -2.214  1.00 35.79 ? 122  SER A CA  1 
ATOM   754  C C   . SER A 1 121 ? -30.332 -52.358 -3.040  1.00 36.70 ? 122  SER A C   1 
ATOM   755  O O   . SER A 1 121 ? -30.276 -52.662 -4.238  1.00 37.57 ? 122  SER A O   1 
ATOM   756  C CB  . SER A 1 121 ? -28.842 -53.852 -1.728  1.00 36.31 ? 122  SER A CB  1 
ATOM   757  O OG  . SER A 1 121 ? -29.996 -54.277 -1.046  1.00 37.62 ? 122  SER A OG  1 
ATOM   758  N N   . VAL A 1 122 ? -31.474 -51.979 -2.444  1.00 37.63 ? 123  VAL A N   1 
ATOM   759  C CA  . VAL A 1 122 ? -32.697 -51.770 -3.257  1.00 37.54 ? 123  VAL A CA  1 
ATOM   760  C C   . VAL A 1 122 ? -32.477 -50.711 -4.309  1.00 37.47 ? 123  VAL A C   1 
ATOM   761  O O   . VAL A 1 122 ? -33.186 -50.716 -5.306  1.00 38.75 ? 123  VAL A O   1 
ATOM   762  C CB  . VAL A 1 122 ? -33.973 -51.223 -2.532  1.00 38.56 ? 123  VAL A CB  1 
ATOM   763  C CG1 . VAL A 1 122 ? -35.186 -52.186 -2.681  1.00 37.75 ? 123  VAL A CG1 1 
ATOM   764  C CG2 . VAL A 1 122 ? -33.708 -50.727 -1.162  1.00 37.67 ? 123  VAL A CG2 1 
ATOM   765  N N   . PHE A 1 123 ? -31.554 -49.775 -4.053  1.00 36.36 ? 124  PHE A N   1 
ATOM   766  C CA  . PHE A 1 123 ? -31.278 -48.682 -4.963  1.00 35.62 ? 124  PHE A CA  1 
ATOM   767  C C   . PHE A 1 123 ? -30.261 -49.034 -6.057  1.00 36.08 ? 124  PHE A C   1 
ATOM   768  O O   . PHE A 1 123 ? -30.082 -48.241 -6.987  1.00 37.16 ? 124  PHE A O   1 
ATOM   769  C CB  . PHE A 1 123 ? -30.811 -47.458 -4.184  1.00 34.46 ? 124  PHE A CB  1 
ATOM   770  C CG  . PHE A 1 123 ? -31.830 -46.947 -3.203  1.00 34.32 ? 124  PHE A CG  1 
ATOM   771  C CD1 . PHE A 1 123 ? -32.912 -46.184 -3.640  1.00 34.18 ? 124  PHE A CD1 1 
ATOM   772  C CD2 . PHE A 1 123 ? -31.723 -47.232 -1.842  1.00 32.58 ? 124  PHE A CD2 1 
ATOM   773  C CE1 . PHE A 1 123 ? -33.847 -45.718 -2.765  1.00 32.97 ? 124  PHE A CE1 1 
ATOM   774  C CE2 . PHE A 1 123 ? -32.667 -46.775 -0.936  1.00 31.60 ? 124  PHE A CE2 1 
ATOM   775  C CZ  . PHE A 1 123 ? -33.722 -46.011 -1.375  1.00 33.43 ? 124  PHE A CZ  1 
ATOM   776  N N   . PHE A 1 124 ? -29.601 -50.201 -5.975  1.00 36.09 ? 125  PHE A N   1 
ATOM   777  C CA  . PHE A 1 124 ? -28.447 -50.489 -6.859  1.00 35.53 ? 125  PHE A CA  1 
ATOM   778  C C   . PHE A 1 124 ? -28.835 -50.434 -8.334  1.00 35.73 ? 125  PHE A C   1 
ATOM   779  O O   . PHE A 1 124 ? -28.141 -49.795 -9.119  1.00 35.75 ? 125  PHE A O   1 
ATOM   780  C CB  . PHE A 1 124 ? -27.803 -51.878 -6.624  1.00 35.52 ? 125  PHE A CB  1 
ATOM   781  C CG  . PHE A 1 124 ? -26.970 -52.009 -5.363  1.00 34.20 ? 125  PHE A CG  1 
ATOM   782  C CD1 . PHE A 1 124 ? -26.550 -50.905 -4.627  1.00 33.57 ? 125  PHE A CD1 1 
ATOM   783  C CD2 . PHE A 1 124 ? -26.565 -53.270 -4.951  1.00 33.79 ? 125  PHE A CD2 1 
ATOM   784  C CE1 . PHE A 1 124 ? -25.771 -51.047 -3.512  1.00 32.42 ? 125  PHE A CE1 1 
ATOM   785  C CE2 . PHE A 1 124 ? -25.793 -53.432 -3.807  1.00 33.06 ? 125  PHE A CE2 1 
ATOM   786  C CZ  . PHE A 1 124 ? -25.399 -52.317 -3.082  1.00 34.01 ? 125  PHE A CZ  1 
ATOM   787  N N   . TYR A 1 125 ? -29.904 -51.118 -8.732  1.00 36.29 ? 126  TYR A N   1 
ATOM   788  C CA  . TYR A 1 125 ? -30.167 -51.223 -10.180 1.00 37.53 ? 126  TYR A CA  1 
ATOM   789  C C   . TYR A 1 125 ? -30.678 -49.915 -10.790 1.00 38.60 ? 126  TYR A C   1 
ATOM   790  O O   . TYR A 1 125 ? -30.124 -49.470 -11.822 1.00 39.39 ? 126  TYR A O   1 
ATOM   791  C CB  . TYR A 1 125 ? -31.007 -52.431 -10.540 1.00 37.84 ? 126  TYR A CB  1 
ATOM   792  C CG  . TYR A 1 125 ? -30.147 -53.679 -10.715 1.00 36.98 ? 126  TYR A CG  1 
ATOM   793  C CD1 . TYR A 1 125 ? -29.650 -54.353 -9.597  1.00 34.91 ? 126  TYR A CD1 1 
ATOM   794  C CD2 . TYR A 1 125 ? -29.826 -54.187 -12.002 1.00 37.16 ? 126  TYR A CD2 1 
ATOM   795  C CE1 . TYR A 1 125 ? -28.844 -55.492 -9.713  1.00 33.73 ? 126  TYR A CE1 1 
ATOM   796  C CE2 . TYR A 1 125 ? -29.023 -55.329 -12.140 1.00 37.38 ? 126  TYR A CE2 1 
ATOM   797  C CZ  . TYR A 1 125 ? -28.530 -55.979 -10.952 1.00 37.14 ? 126  TYR A CZ  1 
ATOM   798  O OH  . TYR A 1 125 ? -27.730 -57.097 -10.997 1.00 35.01 ? 126  TYR A OH  1 
ATOM   799  N N   . PRO A 1 126 ? -31.663 -49.259 -10.139 1.00 38.72 ? 127  PRO A N   1 
ATOM   800  C CA  . PRO A 1 126 ? -32.147 -48.027 -10.749 1.00 39.88 ? 127  PRO A CA  1 
ATOM   801  C C   . PRO A 1 126 ? -31.178 -46.858 -10.677 1.00 39.19 ? 127  PRO A C   1 
ATOM   802  O O   . PRO A 1 126 ? -31.118 -46.085 -11.615 1.00 41.60 ? 127  PRO A O   1 
ATOM   803  C CB  . PRO A 1 126 ? -33.474 -47.750 -10.013 1.00 39.75 ? 127  PRO A CB  1 
ATOM   804  C CG  . PRO A 1 126 ? -33.893 -49.089 -9.506  1.00 40.10 ? 127  PRO A CG  1 
ATOM   805  C CD  . PRO A 1 126 ? -32.589 -49.722 -9.090  1.00 39.48 ? 127  PRO A CD  1 
ATOM   806  N N   . ALA A 1 127 ? -30.435 -46.716 -9.597  1.00 37.79 ? 128  ALA A N   1 
ATOM   807  C CA  . ALA A 1 127 ? -29.326 -45.760 -9.578  1.00 37.22 ? 128  ALA A CA  1 
ATOM   808  C C   . ALA A 1 127 ? -28.319 -46.070 -10.693 1.00 37.00 ? 128  ALA A C   1 
ATOM   809  O O   . ALA A 1 127 ? -27.870 -45.174 -11.423 1.00 38.41 ? 128  ALA A O   1 
ATOM   810  C CB  . ALA A 1 127 ? -28.628 -45.754 -8.223  1.00 35.03 ? 128  ALA A CB  1 
ATOM   811  N N   . ALA A 1 128 ? -27.957 -47.328 -10.845 1.00 36.11 ? 129  ALA A N   1 
ATOM   812  C CA  . ALA A 1 128 ? -27.001 -47.673 -11.897 1.00 36.87 ? 129  ALA A CA  1 
ATOM   813  C C   . ALA A 1 128 ? -27.584 -47.378 -13.267 1.00 37.87 ? 129  ALA A C   1 
ATOM   814  O O   . ALA A 1 128 ? -26.838 -47.028 -14.199 1.00 39.22 ? 129  ALA A O   1 
ATOM   815  C CB  . ALA A 1 128 ? -26.550 -49.149 -11.814 1.00 35.92 ? 129  ALA A CB  1 
ATOM   816  N N   . ALA A 1 129 ? -28.897 -47.563 -13.411 1.00 37.87 ? 130  ALA A N   1 
ATOM   817  C CA  . ALA A 1 129 ? -29.540 -47.377 -14.724 1.00 38.79 ? 130  ALA A CA  1 
ATOM   818  C C   . ALA A 1 129 ? -29.470 -45.911 -15.102 1.00 39.38 ? 130  ALA A C   1 
ATOM   819  O O   . ALA A 1 129 ? -29.333 -45.582 -16.298 1.00 40.38 ? 130  ALA A O   1 
ATOM   820  C CB  . ALA A 1 129 ? -30.992 -47.874 -14.742 1.00 38.43 ? 130  ALA A CB  1 
ATOM   821  N N   . PHE A 1 130 ? -29.541 -45.048 -14.079 1.00 38.67 ? 131  PHE A N   1 
ATOM   822  C CA  . PHE A 1 130 ? -29.438 -43.608 -14.273 1.00 39.68 ? 131  PHE A CA  1 
ATOM   823  C C   . PHE A 1 130 ? -28.039 -43.210 -14.711 1.00 40.54 ? 131  PHE A C   1 
ATOM   824  O O   . PHE A 1 130 ? -27.871 -42.443 -15.654 1.00 42.00 ? 131  PHE A O   1 
ATOM   825  C CB  . PHE A 1 130 ? -29.815 -42.874 -12.992 1.00 38.96 ? 131  PHE A CB  1 
ATOM   826  C CG  . PHE A 1 130 ? -29.681 -41.377 -13.089 1.00 38.80 ? 131  PHE A CG  1 
ATOM   827  C CD1 . PHE A 1 130 ? -30.681 -40.622 -13.652 1.00 36.94 ? 131  PHE A CD1 1 
ATOM   828  C CD2 . PHE A 1 130 ? -28.554 -40.733 -12.596 1.00 39.72 ? 131  PHE A CD2 1 
ATOM   829  C CE1 . PHE A 1 130 ? -30.583 -39.235 -13.732 1.00 39.21 ? 131  PHE A CE1 1 
ATOM   830  C CE2 . PHE A 1 130 ? -28.440 -39.345 -12.659 1.00 40.66 ? 131  PHE A CE2 1 
ATOM   831  C CZ  . PHE A 1 130 ? -29.473 -38.593 -13.248 1.00 41.79 ? 131  PHE A CZ  1 
ATOM   832  N N   . ILE A 1 131 ? -27.024 -43.759 -14.046 1.00 40.60 ? 132  ILE A N   1 
ATOM   833  C CA  . ILE A 1 131 ? -25.632 -43.540 -14.473 1.00 41.49 ? 132  ILE A CA  1 
ATOM   834  C C   . ILE A 1 131 ? -25.416 -44.054 -15.916 1.00 42.99 ? 132  ILE A C   1 
ATOM   835  O O   . ILE A 1 131 ? -24.800 -43.379 -16.733 1.00 43.90 ? 132  ILE A O   1 
ATOM   836  C CB  . ILE A 1 131 ? -24.632 -44.223 -13.514 1.00 40.11 ? 132  ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 131 ? -24.797 -43.683 -12.097 1.00 38.88 ? 132  ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 131 ? -23.194 -44.081 -14.043 1.00 40.33 ? 132  ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 131 ? -24.141 -44.545 -10.996 1.00 35.59 ? 132  ILE A CD1 1 
ATOM   840  N N   . ASP A 1 132 ? -25.971 -45.221 -16.236 1.00 44.11 ? 133  ASP A N   1 
ATOM   841  C CA  . ASP A 1 132 ? -25.806 -45.814 -17.586 1.00 46.52 ? 133  ASP A CA  1 
ATOM   842  C C   . ASP A 1 132 ? -26.473 -45.005 -18.690 1.00 48.44 ? 133  ASP A C   1 
ATOM   843  O O   . ASP A 1 132 ? -25.903 -44.861 -19.771 1.00 49.36 ? 133  ASP A O   1 
ATOM   844  C CB  . ASP A 1 132 ? -26.341 -47.249 -17.626 1.00 46.97 ? 133  ASP A CB  1 
ATOM   845  C CG  . ASP A 1 132 ? -25.831 -48.054 -18.836 1.00 49.98 ? 133  ASP A CG  1 
ATOM   846  O OD1 . ASP A 1 132 ? -24.591 -48.276 -19.009 1.00 52.94 ? 133  ASP A OD1 1 
ATOM   847  O OD2 . ASP A 1 132 ? -26.698 -48.501 -19.598 1.00 55.35 ? 133  ASP A OD2 1 
ATOM   848  N N   . ARG A 1 133 ? -27.679 -44.489 -18.435 1.00 49.08 ? 134  ARG A N   1 
ATOM   849  C CA  . ARG A 1 133 ? -28.347 -43.634 -19.425 1.00 51.63 ? 134  ARG A CA  1 
ATOM   850  C C   . ARG A 1 133 ? -27.596 -42.328 -19.653 1.00 51.49 ? 134  ARG A C   1 
ATOM   851  O O   . ARG A 1 133 ? -27.558 -41.835 -20.756 1.00 54.24 ? 134  ARG A O   1 
ATOM   852  C CB  . ARG A 1 133 ? -29.803 -43.341 -19.046 1.00 52.69 ? 134  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 133 ? -30.757 -44.511 -19.307 1.00 56.51 ? 134  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 133 ? -32.260 -44.101 -19.258 1.00 62.08 ? 134  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 133 ? -32.610 -43.262 -18.098 1.00 64.26 ? 134  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 133 ? -32.684 -43.676 -16.823 1.00 65.96 ? 134  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 133 ? -32.438 -44.951 -16.477 1.00 64.69 ? 134  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 133 ? -33.005 -42.794 -15.872 1.00 66.02 ? 134  ARG A NH2 1 
ATOM   859  N N   . ALA A 1 134 ? -27.003 -41.770 -18.611 1.00 50.09 ? 135  ALA A N   1 
ATOM   860  C CA  . ALA A 1 134 ? -26.202 -40.562 -18.744 1.00 50.64 ? 135  ALA A CA  1 
ATOM   861  C C   . ALA A 1 134 ? -24.998 -40.846 -19.625 1.00 51.63 ? 135  ALA A C   1 
ATOM   862  O O   . ALA A 1 134 ? -24.711 -40.087 -20.546 1.00 53.01 ? 135  ALA A O   1 
ATOM   863  C CB  . ALA A 1 134 ? -25.737 -40.063 -17.379 1.00 48.34 ? 135  ALA A CB  1 
ATOM   864  N N   . LEU A 1 135 ? -24.313 -41.950 -19.334 1.00 50.77 ? 136  LEU A N   1 
ATOM   865  C CA  . LEU A 1 135 ? -23.050 -42.268 -19.989 1.00 51.79 ? 136  LEU A CA  1 
ATOM   866  C C   . LEU A 1 135 ? -23.177 -42.834 -21.403 1.00 54.15 ? 136  LEU A C   1 
ATOM   867  O O   . LEU A 1 135 ? -22.166 -42.993 -22.057 1.00 54.86 ? 136  LEU A O   1 
ATOM   868  C CB  . LEU A 1 135 ? -22.207 -43.198 -19.116 1.00 49.58 ? 136  LEU A CB  1 
ATOM   869  C CG  . LEU A 1 135 ? -21.686 -42.557 -17.823 1.00 48.28 ? 136  LEU A CG  1 
ATOM   870  C CD1 . LEU A 1 135 ? -20.894 -43.561 -16.983 1.00 44.93 ? 136  LEU A CD1 1 
ATOM   871  C CD2 . LEU A 1 135 ? -20.850 -41.348 -18.139 1.00 46.65 ? 136  LEU A CD2 1 
ATOM   872  N N   . SER A 1 136 ? -24.396 -43.136 -21.848 1.00 55.62 ? 137  SER A N   1 
ATOM   873  C CA  . SER A 1 136 ? -24.692 -43.455 -23.251 1.00 58.97 ? 137  SER A CA  1 
ATOM   874  C C   . SER A 1 136 ? -24.454 -42.293 -24.190 1.00 61.54 ? 137  SER A C   1 
ATOM   875  O O   . SER A 1 136 ? -24.190 -42.483 -25.369 1.00 62.83 ? 137  SER A O   1 
ATOM   876  C CB  . SER A 1 136 ? -26.165 -43.801 -23.402 1.00 59.53 ? 137  SER A CB  1 
ATOM   877  O OG  . SER A 1 136 ? -26.431 -44.986 -22.717 1.00 60.63 ? 137  SER A OG  1 
ATOM   878  N N   . ASP A 1 137 ? -24.632 -41.090 -23.667 1.00 62.10 ? 138  ASP A N   1 
ATOM   879  C CA  . ASP A 1 137 ? -24.443 -39.900 -24.448 1.00 65.08 ? 138  ASP A CA  1 
ATOM   880  C C   . ASP A 1 137 ? -23.051 -39.356 -24.141 1.00 64.67 ? 138  ASP A C   1 
ATOM   881  O O   . ASP A 1 137 ? -22.777 -38.948 -23.005 1.00 62.79 ? 138  ASP A O   1 
ATOM   882  C CB  . ASP A 1 137 ? -25.540 -38.876 -24.123 1.00 65.85 ? 138  ASP A CB  1 
ATOM   883  C CG  . ASP A 1 137 ? -25.554 -37.710 -25.097 1.00 71.17 ? 138  ASP A CG  1 
ATOM   884  O OD1 . ASP A 1 137 ? -24.457 -37.311 -25.571 1.00 73.38 ? 138  ASP A OD1 1 
ATOM   885  O OD2 . ASP A 1 137 ? -26.661 -37.199 -25.404 1.00 75.97 ? 138  ASP A OD2 1 
ATOM   886  N N   . ASP A 1 138 ? -22.181 -39.388 -25.155 1.00 66.27 ? 139  ASP A N   1 
ATOM   887  C CA  . ASP A 1 138 ? -20.830 -38.790 -25.108 1.00 66.60 ? 139  ASP A CA  1 
ATOM   888  C C   . ASP A 1 138 ? -20.770 -37.390 -24.466 1.00 65.68 ? 139  ASP A C   1 
ATOM   889  O O   . ASP A 1 138 ? -19.824 -37.079 -23.747 1.00 63.83 ? 139  ASP A O   1 
ATOM   890  C CB  . ASP A 1 138 ? -20.230 -38.699 -26.542 1.00 69.77 ? 139  ASP A CB  1 
ATOM   891  C CG  . ASP A 1 138 ? -19.702 -40.046 -27.065 1.00 71.39 ? 139  ASP A CG  1 
ATOM   892  O OD1 . ASP A 1 138 ? -19.433 -40.945 -26.237 1.00 68.75 ? 139  ASP A OD1 1 
ATOM   893  O OD2 . ASP A 1 138 ? -19.541 -40.200 -28.317 1.00 77.58 ? 139  ASP A OD2 1 
ATOM   894  N N   . HIS A 1 139 ? -21.767 -36.553 -24.743 1.00 66.51 ? 140  HIS A N   1 
ATOM   895  C CA  . HIS A 1 139 ? -21.828 -35.200 -24.180 1.00 67.08 ? 140  HIS A CA  1 
ATOM   896  C C   . HIS A 1 139 ? -22.031 -35.168 -22.646 1.00 63.42 ? 140  HIS A C   1 
ATOM   897  O O   . HIS A 1 139 ? -21.733 -34.153 -22.017 1.00 63.28 ? 140  HIS A O   1 
ATOM   898  C CB  . HIS A 1 139 ? -22.936 -34.393 -24.881 1.00 70.08 ? 140  HIS A CB  1 
ATOM   899  C CG  . HIS A 1 139 ? -23.055 -32.961 -24.420 1.00 74.64 ? 140  HIS A CG  1 
ATOM   900  N ND1 . HIS A 1 139 ? -23.672 -32.599 -23.232 1.00 75.22 ? 140  HIS A ND1 1 
ATOM   901  C CD2 . HIS A 1 139 ? -22.667 -31.800 -25.008 1.00 79.48 ? 140  HIS A CD2 1 
ATOM   902  C CE1 . HIS A 1 139 ? -23.642 -31.283 -23.101 1.00 76.47 ? 140  HIS A CE1 1 
ATOM   903  N NE2 . HIS A 1 139 ? -23.038 -30.775 -24.164 1.00 80.99 ? 140  HIS A NE2 1 
ATOM   904  N N   . SER A 1 140 ? -22.522 -36.251 -22.042 1.00 59.97 ? 141  SER A N   1 
ATOM   905  C CA  . SER A 1 140 ? -22.883 -36.197 -20.635 1.00 57.60 ? 141  SER A CA  1 
ATOM   906  C C   . SER A 1 140 ? -21.660 -36.250 -19.732 1.00 55.69 ? 141  SER A C   1 
ATOM   907  O O   . SER A 1 140 ? -20.614 -36.814 -20.081 1.00 55.58 ? 141  SER A O   1 
ATOM   908  C CB  . SER A 1 140 ? -23.818 -37.334 -20.223 1.00 55.86 ? 141  SER A CB  1 
ATOM   909  O OG  . SER A 1 140 ? -24.934 -37.403 -21.075 1.00 57.82 ? 141  SER A OG  1 
ATOM   910  N N   . LYS A 1 141 ? -21.825 -35.660 -18.561 1.00 53.48 ? 142  LYS A N   1 
ATOM   911  C CA  . LYS A 1 141 ? -20.818 -35.701 -17.531 1.00 51.73 ? 142  LYS A CA  1 
ATOM   912  C C   . LYS A 1 141 ? -21.566 -35.690 -16.222 1.00 48.71 ? 142  LYS A C   1 
ATOM   913  O O   . LYS A 1 141 ? -22.293 -34.737 -15.935 1.00 49.21 ? 142  LYS A O   1 
ATOM   914  C CB  . LYS A 1 141 ? -19.912 -34.483 -17.650 1.00 53.49 ? 142  LYS A CB  1 
ATOM   915  C CG  . LYS A 1 141 ? -18.808 -34.467 -16.635 1.00 53.44 ? 142  LYS A CG  1 
ATOM   916  C CD  . LYS A 1 141 ? -18.103 -33.117 -16.586 1.00 57.58 ? 142  LYS A CD  1 
ATOM   917  C CE  . LYS A 1 141 ? -16.911 -33.006 -17.510 1.00 59.85 ? 142  LYS A CE  1 
ATOM   918  N NZ  . LYS A 1 141 ? -15.841 -32.272 -16.769 1.00 61.62 ? 142  LYS A NZ  1 
ATOM   919  N N   . ILE A 1 142 ? -21.380 -36.738 -15.430 1.00 46.07 ? 143  ILE A N   1 
ATOM   920  C CA  . ILE A 1 142 ? -22.224 -37.001 -14.261 1.00 44.15 ? 143  ILE A CA  1 
ATOM   921  C C   . ILE A 1 142 ? -21.484 -36.905 -12.921 1.00 42.77 ? 143  ILE A C   1 
ATOM   922  O O   . ILE A 1 142 ? -20.375 -37.420 -12.775 1.00 42.43 ? 143  ILE A O   1 
ATOM   923  C CB  . ILE A 1 142 ? -22.899 -38.384 -14.393 1.00 43.26 ? 143  ILE A CB  1 
ATOM   924  C CG1 . ILE A 1 142 ? -23.724 -38.709 -13.145 1.00 42.18 ? 143  ILE A CG1 1 
ATOM   925  C CG2 . ILE A 1 142 ? -21.872 -39.499 -14.631 1.00 41.89 ? 143  ILE A CG2 1 
ATOM   926  C CD1 . ILE A 1 142 ? -24.640 -39.935 -13.321 1.00 42.23 ? 143  ILE A CD1 1 
ATOM   927  N N   . LEU A 1 143 ? -22.105 -36.232 -11.949 1.00 42.29 ? 144  LEU A N   1 
ATOM   928  C CA  . LEU A 1 143 ? -21.604 -36.196 -10.570 1.00 40.63 ? 144  LEU A CA  1 
ATOM   929  C C   . LEU A 1 143 ? -22.457 -37.110 -9.693  1.00 38.86 ? 144  LEU A C   1 
ATOM   930  O O   . LEU A 1 143 ? -23.677 -36.960 -9.635  1.00 39.68 ? 144  LEU A O   1 
ATOM   931  C CB  . LEU A 1 143 ? -21.644 -34.773 -10.004 1.00 41.31 ? 144  LEU A CB  1 
ATOM   932  C CG  . LEU A 1 143 ? -21.318 -34.657 -8.504  1.00 40.08 ? 144  LEU A CG  1 
ATOM   933  C CD1 . LEU A 1 143 ? -19.834 -35.025 -8.224  1.00 38.25 ? 144  LEU A CD1 1 
ATOM   934  C CD2 . LEU A 1 143 ? -21.654 -33.262 -7.975  1.00 38.04 ? 144  LEU A CD2 1 
ATOM   935  N N   . VAL A 1 144 ? -21.823 -38.079 -9.053  1.00 37.02 ? 145  VAL A N   1 
ATOM   936  C CA  . VAL A 1 144 ? -22.456 -38.904 -8.033  1.00 34.95 ? 145  VAL A CA  1 
ATOM   937  C C   . VAL A 1 144 ? -21.824 -38.426 -6.751  1.00 35.08 ? 145  VAL A C   1 
ATOM   938  O O   . VAL A 1 144 ? -20.621 -38.457 -6.645  1.00 36.15 ? 145  VAL A O   1 
ATOM   939  C CB  . VAL A 1 144 ? -22.147 -40.392 -8.230  1.00 34.01 ? 145  VAL A CB  1 
ATOM   940  C CG1 . VAL A 1 144 ? -22.901 -41.239 -7.226  1.00 30.73 ? 145  VAL A CG1 1 
ATOM   941  C CG2 . VAL A 1 144 ? -22.483 -40.820 -9.640  1.00 33.93 ? 145  VAL A CG2 1 
ATOM   942  N N   . HIS A 1 145 ? -22.606 -37.931 -5.799  1.00 35.46 ? 146  HIS A N   1 
ATOM   943  C CA  . HIS A 1 145 ? -22.059 -37.413 -4.543  1.00 35.50 ? 146  HIS A CA  1 
ATOM   944  C C   . HIS A 1 145 ? -22.887 -37.864 -3.357  1.00 35.46 ? 146  HIS A C   1 
ATOM   945  O O   . HIS A 1 145 ? -24.029 -38.309 -3.516  1.00 35.38 ? 146  HIS A O   1 
ATOM   946  C CB  . HIS A 1 145 ? -22.020 -35.874 -4.551  1.00 36.71 ? 146  HIS A CB  1 
ATOM   947  C CG  . HIS A 1 145 ? -23.350 -35.241 -4.307  1.00 36.29 ? 146  HIS A CG  1 
ATOM   948  N ND1 . HIS A 1 145 ? -23.795 -34.911 -3.044  1.00 37.39 ? 146  HIS A ND1 1 
ATOM   949  C CD2 . HIS A 1 145 ? -24.354 -34.931 -5.155  1.00 34.88 ? 146  HIS A CD2 1 
ATOM   950  C CE1 . HIS A 1 145 ? -25.013 -34.399 -3.132  1.00 38.63 ? 146  HIS A CE1 1 
ATOM   951  N NE2 . HIS A 1 145 ? -25.379 -34.409 -4.404  1.00 38.36 ? 146  HIS A NE2 1 
ATOM   952  N N   . CYS A 1 146 ? -22.299 -37.750 -2.169  1.00 36.16 ? 147  CYS A N   1 
ATOM   953  C CA  . CYS A 1 146 ? -23.036 -37.852 -0.909  1.00 36.51 ? 147  CYS A CA  1 
ATOM   954  C C   . CYS A 1 146 ? -22.574 -36.705 0.003   1.00 37.53 ? 147  CYS A C   1 
ATOM   955  O O   . CYS A 1 146 ? -22.560 -35.575 -0.451  1.00 39.06 ? 147  CYS A O   1 
ATOM   956  C CB  . CYS A 1 146 ? -22.910 -39.258 -0.313  1.00 35.68 ? 147  CYS A CB  1 
ATOM   957  S SG  . CYS A 1 146 ? -21.273 -39.959 -0.323  1.00 37.12 ? 147  CYS A SG  1 
ATOM   958  N N   . VAL A 1 147 ? -22.255 -36.932 1.276   1.00 38.47 ? 148  VAL A N   1 
ATOM   959  C CA  . VAL A 1 147 ? -21.733 -35.853 2.110   1.00 39.32 ? 148  VAL A CA  1 
ATOM   960  C C   . VAL A 1 147 ? -20.222 -35.787 1.922   1.00 40.46 ? 148  VAL A C   1 
ATOM   961  O O   . VAL A 1 147 ? -19.677 -34.722 1.590   1.00 41.63 ? 148  VAL A O   1 
ATOM   962  C CB  . VAL A 1 147 ? -22.143 -36.020 3.579   1.00 40.59 ? 148  VAL A CB  1 
ATOM   963  C CG1 . VAL A 1 147 ? -21.482 -34.939 4.465   1.00 42.01 ? 148  VAL A CG1 1 
ATOM   964  C CG2 . VAL A 1 147 ? -23.659 -35.976 3.719   1.00 37.29 ? 148  VAL A CG2 1 
ATOM   965  N N   . MET A 1 148 ? -19.551 -36.935 2.050   1.00 40.48 ? 149  MET A N   1 
ATOM   966  C CA  . MET A 1 148 ? -18.092 -37.022 1.866   1.00 41.33 ? 149  MET A CA  1 
ATOM   967  C C   . MET A 1 148 ? -17.681 -37.640 0.531   1.00 40.36 ? 149  MET A C   1 
ATOM   968  O O   . MET A 1 148 ? -16.547 -37.504 0.102   1.00 40.61 ? 149  MET A O   1 
ATOM   969  C CB  . MET A 1 148 ? -17.462 -37.841 2.997   1.00 41.81 ? 149  MET A CB  1 
ATOM   970  C CG  . MET A 1 148 ? -17.866 -37.375 4.397   1.00 47.38 ? 149  MET A CG  1 
ATOM   971  S SD  . MET A 1 148 ? -16.899 -38.147 5.716   1.00 56.63 ? 149  MET A SD  1 
ATOM   972  C CE  . MET A 1 148 ? -15.397 -37.220 5.514   1.00 53.01 ? 149  MET A CE  1 
ATOM   973  N N   . GLY A 1 149 ? -18.588 -38.358 -0.114  1.00 39.36 ? 150  GLY A N   1 
ATOM   974  C CA  . GLY A 1 149 ? -18.251 -39.042 -1.360  1.00 38.47 ? 150  GLY A CA  1 
ATOM   975  C C   . GLY A 1 149 ? -17.239 -40.141 -1.151  1.00 37.38 ? 150  GLY A C   1 
ATOM   976  O O   . GLY A 1 149 ? -16.395 -40.385 -2.016  1.00 37.15 ? 150  GLY A O   1 
ATOM   977  N N   . ARG A 1 150 ? -17.316 -40.788 0.010   1.00 36.55 ? 151  ARG A N   1 
ATOM   978  C CA  . ARG A 1 150 ? -16.475 -41.938 0.322   1.00 35.70 ? 151  ARG A CA  1 
ATOM   979  C C   . ARG A 1 150 ? -17.262 -43.237 0.510   1.00 34.64 ? 151  ARG A C   1 
ATOM   980  O O   . ARG A 1 150 ? -16.694 -44.288 0.330   1.00 34.95 ? 151  ARG A O   1 
ATOM   981  C CB  . ARG A 1 150 ? -15.667 -41.699 1.594   1.00 36.52 ? 151  ARG A CB  1 
ATOM   982  C CG  . ARG A 1 150 ? -14.957 -40.343 1.671   1.00 38.46 ? 151  ARG A CG  1 
ATOM   983  C CD  . ARG A 1 150 ? -13.817 -40.206 0.679   1.00 38.46 ? 151  ARG A CD  1 
ATOM   984  N NE  . ARG A 1 150 ? -13.395 -38.811 0.600   1.00 40.57 ? 151  ARG A NE  1 
ATOM   985  C CZ  . ARG A 1 150 ? -12.562 -38.297 -0.299  1.00 39.68 ? 151  ARG A CZ  1 
ATOM   986  N NH1 . ARG A 1 150 ? -11.977 -39.043 -1.232  1.00 39.17 ? 151  ARG A NH1 1 
ATOM   987  N NH2 . ARG A 1 150 ? -12.301 -37.011 -0.247  1.00 42.49 ? 151  ARG A NH2 1 
ATOM   988  N N   . SER A 1 151 ? -18.530 -43.191 0.925   1.00 33.92 ? 152  SER A N   1 
ATOM   989  C CA  . SER A 1 151 ? -19.217 -44.425 1.305   1.00 33.30 ? 152  SER A CA  1 
ATOM   990  C C   . SER A 1 151 ? -20.484 -44.643 0.492   1.00 33.33 ? 152  SER A C   1 
ATOM   991  O O   . SER A 1 151 ? -20.540 -45.585 -0.284  1.00 34.21 ? 152  SER A O   1 
ATOM   992  C CB  . SER A 1 151 ? -19.493 -44.488 2.829   1.00 33.74 ? 152  SER A CB  1 
ATOM   993  O OG  . SER A 1 151 ? -20.177 -45.684 3.203   1.00 30.47 ? 152  SER A OG  1 
ATOM   994  N N   . ARG A 1 152 ? -21.485 -43.777 0.638   1.00 33.54 ? 153  ARG A N   1 
ATOM   995  C CA  . ARG A 1 152 ? -22.742 -43.925 -0.095  1.00 33.51 ? 153  ARG A CA  1 
ATOM   996  C C   . ARG A 1 152 ? -22.572 -43.846 -1.609  1.00 33.97 ? 153  ARG A C   1 
ATOM   997  O O   . ARG A 1 152 ? -22.950 -44.758 -2.331  1.00 34.07 ? 153  ARG A O   1 
ATOM   998  C CB  . ARG A 1 152 ? -23.744 -42.874 0.345   1.00 34.06 ? 153  ARG A CB  1 
ATOM   999  C CG  . ARG A 1 152 ? -24.461 -43.246 1.605   1.00 33.21 ? 153  ARG A CG  1 
ATOM   1000 C CD  . ARG A 1 152 ? -25.225 -42.084 2.188   1.00 32.76 ? 153  ARG A CD  1 
ATOM   1001 N NE  . ARG A 1 152 ? -24.315 -41.083 2.713   1.00 32.83 ? 153  ARG A NE  1 
ATOM   1002 C CZ  . ARG A 1 152 ? -24.664 -40.081 3.505   1.00 35.96 ? 153  ARG A CZ  1 
ATOM   1003 N NH1 . ARG A 1 152 ? -25.924 -39.922 3.896   1.00 37.71 ? 153  ARG A NH1 1 
ATOM   1004 N NH2 . ARG A 1 152 ? -23.739 -39.253 3.948   1.00 37.57 ? 153  ARG A NH2 1 
ATOM   1005 N N   . SER A 1 153 ? -21.988 -42.759 -2.090  1.00 33.94 ? 154  SER A N   1 
ATOM   1006 C CA  . SER A 1 153 ? -21.823 -42.589 -3.514  1.00 34.11 ? 154  SER A CA  1 
ATOM   1007 C C   . SER A 1 153 ? -20.898 -43.643 -4.128  1.00 33.50 ? 154  SER A C   1 
ATOM   1008 O O   . SER A 1 153 ? -21.183 -44.183 -5.199  1.00 33.82 ? 154  SER A O   1 
ATOM   1009 C CB  . SER A 1 153 ? -21.338 -41.179 -3.813  1.00 34.92 ? 154  SER A CB  1 
ATOM   1010 O OG  . SER A 1 153 ? -20.189 -40.908 -3.051  1.00 37.30 ? 154  SER A OG  1 
ATOM   1011 N N   . ALA A 1 154 ? -19.799 -43.914 -3.444  1.00 32.89 ? 155  ALA A N   1 
ATOM   1012 C CA  . ALA A 1 154 ? -18.846 -44.941 -3.816  1.00 32.42 ? 155  ALA A CA  1 
ATOM   1013 C C   . ALA A 1 154 ? -19.507 -46.303 -3.996  1.00 32.01 ? 155  ALA A C   1 
ATOM   1014 O O   . ALA A 1 154 ? -19.274 -46.987 -4.996  1.00 32.75 ? 155  ALA A O   1 
ATOM   1015 C CB  . ALA A 1 154 ? -17.733 -45.017 -2.767  1.00 31.94 ? 155  ALA A CB  1 
ATOM   1016 N N   . THR A 1 155 ? -20.338 -46.702 -3.047  1.00 32.26 ? 156  THR A N   1 
ATOM   1017 C CA  . THR A 1 155 ? -21.103 -47.974 -3.163  1.00 31.52 ? 156  THR A CA  1 
ATOM   1018 C C   . THR A 1 155 ? -21.951 -48.019 -4.430  1.00 31.26 ? 156  THR A C   1 
ATOM   1019 O O   . THR A 1 155 ? -21.964 -49.014 -5.180  1.00 31.34 ? 156  THR A O   1 
ATOM   1020 C CB  . THR A 1 155 ? -21.972 -48.201 -1.927  1.00 31.27 ? 156  THR A CB  1 
ATOM   1021 O OG1 . THR A 1 155 ? -21.119 -48.211 -0.788  1.00 30.45 ? 156  THR A OG1 1 
ATOM   1022 C CG2 . THR A 1 155 ? -22.735 -49.528 -2.003  1.00 30.11 ? 156  THR A CG2 1 
ATOM   1023 N N   . LEU A 1 156 ? -22.644 -46.926 -4.716  1.00 31.78 ? 157  LEU A N   1 
ATOM   1024 C CA  . LEU A 1 156 ? -23.486 -46.914 -5.917  1.00 31.13 ? 157  LEU A CA  1 
ATOM   1025 C C   . LEU A 1 156 ? -22.671 -47.056 -7.187  1.00 30.95 ? 157  LEU A C   1 
ATOM   1026 O O   . LEU A 1 156 ? -23.109 -47.729 -8.141  1.00 31.68 ? 157  LEU A O   1 
ATOM   1027 C CB  . LEU A 1 156 ? -24.378 -45.683 -5.973  1.00 31.33 ? 157  LEU A CB  1 
ATOM   1028 C CG  . LEU A 1 156 ? -25.478 -45.591 -4.912  1.00 31.07 ? 157  LEU A CG  1 
ATOM   1029 C CD1 . LEU A 1 156 ? -26.313 -44.382 -5.176  1.00 30.69 ? 157  LEU A CD1 1 
ATOM   1030 C CD2 . LEU A 1 156 ? -26.350 -46.805 -4.872  1.00 29.46 ? 157  LEU A CD2 1 
ATOM   1031 N N   . VAL A 1 157 ? -21.499 -46.427 -7.228  1.00 30.91 ? 158  VAL A N   1 
ATOM   1032 C CA  . VAL A 1 157 ? -20.655 -46.506 -8.417  1.00 30.39 ? 158  VAL A CA  1 
ATOM   1033 C C   . VAL A 1 157 ? -19.985 -47.888 -8.544  1.00 31.42 ? 158  VAL A C   1 
ATOM   1034 O O   . VAL A 1 157 ? -19.852 -48.444 -9.633  1.00 31.61 ? 158  VAL A O   1 
ATOM   1035 C CB  . VAL A 1 157 ? -19.600 -45.398 -8.422  1.00 31.60 ? 158  VAL A CB  1 
ATOM   1036 C CG1 . VAL A 1 157 ? -18.547 -45.651 -9.549  1.00 27.22 ? 158  VAL A CG1 1 
ATOM   1037 C CG2 . VAL A 1 157 ? -20.277 -44.001 -8.567  1.00 28.62 ? 158  VAL A CG2 1 
ATOM   1038 N N   . LEU A 1 158 ? -19.594 -48.482 -7.421  1.00 31.76 ? 159  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 158 ? -19.075 -49.848 -7.480  1.00 31.60 ? 159  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 158 ? -20.130 -50.760 -8.117  1.00 32.45 ? 159  LEU A C   1 
ATOM   1041 O O   . LEU A 1 158 ? -19.832 -51.546 -9.065  1.00 31.80 ? 159  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 158 ? -18.679 -50.326 -6.098  1.00 30.88 ? 159  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 158 ? -17.416 -49.607 -5.585  1.00 30.92 ? 159  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 158 ? -17.155 -49.872 -4.094  1.00 25.85 ? 159  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 158 ? -16.206 -49.979 -6.444  1.00 26.39 ? 159  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 159 ? -21.363 -50.623 -7.617  1.00 31.74 ? 160  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 159 ? -22.488 -51.411 -8.124  1.00 32.94 ? 160  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 159 ? -22.678 -51.161 -9.608  1.00 34.04 ? 160  ALA A C   1 
ATOM   1049 O O   . ALA A 1 159 ? -22.844 -52.098 -10.365 1.00 33.91 ? 160  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 159 ? -23.805 -51.109 -7.363  1.00 31.81 ? 160  ALA A CB  1 
ATOM   1051 N N   . TYR A 1 160 ? -22.649 -49.891 -10.011 1.00 34.85 ? 161  TYR A N   1 
ATOM   1052 C CA  . TYR A 1 160 ? -22.755 -49.563 -11.427 1.00 35.49 ? 161  TYR A CA  1 
ATOM   1053 C C   . TYR A 1 160 ? -21.722 -50.331 -12.236 1.00 36.22 ? 161  TYR A C   1 
ATOM   1054 O O   . TYR A 1 160 ? -22.050 -50.919 -13.255 1.00 37.43 ? 161  TYR A O   1 
ATOM   1055 C CB  . TYR A 1 160 ? -22.574 -48.062 -11.686 1.00 35.71 ? 161  TYR A CB  1 
ATOM   1056 C CG  . TYR A 1 160 ? -22.346 -47.757 -13.152 1.00 35.94 ? 161  TYR A CG  1 
ATOM   1057 C CD1 . TYR A 1 160 ? -23.375 -47.867 -14.073 1.00 37.06 ? 161  TYR A CD1 1 
ATOM   1058 C CD2 . TYR A 1 160 ? -21.090 -47.432 -13.619 1.00 35.87 ? 161  TYR A CD2 1 
ATOM   1059 C CE1 . TYR A 1 160 ? -23.160 -47.639 -15.427 1.00 39.04 ? 161  TYR A CE1 1 
ATOM   1060 C CE2 . TYR A 1 160 ? -20.864 -47.183 -14.975 1.00 40.01 ? 161  TYR A CE2 1 
ATOM   1061 C CZ  . TYR A 1 160 ? -21.893 -47.284 -15.870 1.00 40.28 ? 161  TYR A CZ  1 
ATOM   1062 O OH  . TYR A 1 160 ? -21.652 -47.042 -17.205 1.00 46.75 ? 161  TYR A OH  1 
ATOM   1063 N N   . LEU A 1 161 ? -20.467 -50.269 -11.823 1.00 35.55 ? 162  LEU A N   1 
ATOM   1064 C CA  . LEU A 1 161 ? -19.412 -50.925 -12.591 1.00 36.00 ? 162  LEU A CA  1 
ATOM   1065 C C   . LEU A 1 161 ? -19.618 -52.430 -12.670 1.00 36.89 ? 162  LEU A C   1 
ATOM   1066 O O   . LEU A 1 161 ? -19.317 -53.060 -13.696 1.00 38.89 ? 162  LEU A O   1 
ATOM   1067 C CB  . LEU A 1 161 ? -18.057 -50.635 -12.001 1.00 35.03 ? 162  LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 161 ? -17.565 -49.213 -12.187 1.00 35.49 ? 162  LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 161 ? -16.219 -49.085 -11.523 1.00 33.76 ? 162  LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 161 ? -17.474 -48.857 -13.670 1.00 34.70 ? 162  LEU A CD2 1 
ATOM   1071 N N   . MET A 1 162 ? -20.121 -53.012 -11.594 1.00 36.12 ? 163  MET A N   1 
ATOM   1072 C CA  . MET A 1 162 ? -20.322 -54.441 -11.555 1.00 36.94 ? 163  MET A CA  1 
ATOM   1073 C C   . MET A 1 162 ? -21.451 -54.839 -12.477 1.00 37.99 ? 163  MET A C   1 
ATOM   1074 O O   . MET A 1 162 ? -21.337 -55.836 -13.201 1.00 39.16 ? 163  MET A O   1 
ATOM   1075 C CB  . MET A 1 162 ? -20.622 -54.900 -10.131 1.00 36.32 ? 163  MET A CB  1 
ATOM   1076 C CG  . MET A 1 162 ? -19.422 -54.755 -9.185  1.00 35.76 ? 163  MET A CG  1 
ATOM   1077 S SD  . MET A 1 162 ? -19.880 -54.748 -7.442  1.00 35.97 ? 163  MET A SD  1 
ATOM   1078 C CE  . MET A 1 162 ? -20.344 -56.464 -7.244  1.00 33.46 ? 163  MET A CE  1 
ATOM   1079 N N   . ILE A 1 163 ? -22.534 -54.058 -12.466 1.00 37.15 ? 164  ILE A N   1 
ATOM   1080 C CA  . ILE A 1 163 ? -23.716 -54.402 -13.229 1.00 38.04 ? 164  ILE A CA  1 
ATOM   1081 C C   . ILE A 1 163 ? -23.564 -54.091 -14.732 1.00 40.04 ? 164  ILE A C   1 
ATOM   1082 O O   . ILE A 1 163 ? -23.983 -54.897 -15.563 1.00 41.32 ? 164  ILE A O   1 
ATOM   1083 C CB  . ILE A 1 163 ? -24.973 -53.653 -12.713 1.00 37.08 ? 164  ILE A CB  1 
ATOM   1084 C CG1 . ILE A 1 163 ? -25.289 -54.040 -11.280 1.00 36.96 ? 164  ILE A CG1 1 
ATOM   1085 C CG2 . ILE A 1 163 ? -26.206 -53.929 -13.623 1.00 36.28 ? 164  ILE A CG2 1 
ATOM   1086 C CD1 . ILE A 1 163 ? -26.277 -53.064 -10.583 1.00 33.72 ? 164  ILE A CD1 1 
ATOM   1087 N N   . HIS A 1 164 ? -23.033 -52.912 -15.073 1.00 40.03 ? 165  HIS A N   1 
ATOM   1088 C CA  . HIS A 1 164 ? -23.037 -52.445 -16.463 1.00 41.94 ? 165  HIS A CA  1 
ATOM   1089 C C   . HIS A 1 164 ? -21.671 -52.588 -17.171 1.00 43.40 ? 165  HIS A C   1 
ATOM   1090 O O   . HIS A 1 164 ? -21.603 -52.547 -18.402 1.00 43.42 ? 165  HIS A O   1 
ATOM   1091 C CB  . HIS A 1 164 ? -23.564 -51.003 -16.548 1.00 41.93 ? 165  HIS A CB  1 
ATOM   1092 C CG  . HIS A 1 164 ? -25.024 -50.874 -16.208 1.00 42.28 ? 165  HIS A CG  1 
ATOM   1093 N ND1 . HIS A 1 164 ? -26.026 -51.228 -17.084 1.00 42.73 ? 165  HIS A ND1 1 
ATOM   1094 C CD2 . HIS A 1 164 ? -25.648 -50.468 -15.072 1.00 42.06 ? 165  HIS A CD2 1 
ATOM   1095 C CE1 . HIS A 1 164 ? -27.202 -51.050 -16.509 1.00 44.71 ? 165  HIS A CE1 1 
ATOM   1096 N NE2 . HIS A 1 164 ? -27.003 -50.575 -15.290 1.00 44.09 ? 165  HIS A NE2 1 
ATOM   1097 N N   . LYS A 1 165 ? -20.585 -52.765 -16.417 1.00 43.38 ? 166  LYS A N   1 
ATOM   1098 C CA  . LYS A 1 165 ? -19.271 -52.964 -17.080 1.00 45.26 ? 166  LYS A CA  1 
ATOM   1099 C C   . LYS A 1 165 ? -18.604 -54.321 -16.803 1.00 45.73 ? 166  LYS A C   1 
ATOM   1100 O O   . LYS A 1 165 ? -17.401 -54.452 -16.956 1.00 46.07 ? 166  LYS A O   1 
ATOM   1101 C CB  . LYS A 1 165 ? -18.319 -51.816 -16.735 1.00 44.68 ? 166  LYS A CB  1 
ATOM   1102 C CG  . LYS A 1 165 ? -18.817 -50.456 -17.196 1.00 45.21 ? 166  LYS A CG  1 
ATOM   1103 C CD  . LYS A 1 165 ? -18.952 -50.352 -18.744 1.00 45.20 ? 166  LYS A CD  1 
ATOM   1104 C CE  . LYS A 1 165 ? -19.733 -49.086 -19.104 1.00 45.33 ? 166  LYS A CE  1 
ATOM   1105 N NZ  . LYS A 1 165 ? -20.036 -48.969 -20.556 1.00 44.72 ? 166  LYS A NZ  1 
ATOM   1106 N N   . ASP A 1 166 ? -19.391 -55.323 -16.408 1.00 46.23 ? 167  ASP A N   1 
ATOM   1107 C CA  . ASP A 1 166 ? -18.910 -56.704 -16.330 1.00 47.84 ? 167  ASP A CA  1 
ATOM   1108 C C   . ASP A 1 166 ? -17.773 -56.903 -15.316 1.00 46.91 ? 167  ASP A C   1 
ATOM   1109 O O   . ASP A 1 166 ? -16.966 -57.823 -15.437 1.00 48.31 ? 167  ASP A O   1 
ATOM   1110 C CB  . ASP A 1 166 ? -18.439 -57.136 -17.735 1.00 50.64 ? 167  ASP A CB  1 
ATOM   1111 C CG  . ASP A 1 166 ? -18.549 -58.618 -17.957 1.00 54.74 ? 167  ASP A CG  1 
ATOM   1112 O OD1 . ASP A 1 166 ? -19.579 -59.178 -17.516 1.00 58.82 ? 167  ASP A OD1 1 
ATOM   1113 O OD2 . ASP A 1 166 ? -17.628 -59.220 -18.588 1.00 60.68 ? 167  ASP A OD2 1 
ATOM   1114 N N   . MET A 1 167 ? -17.703 -56.041 -14.315 1.00 45.10 ? 168  MET A N   1 
ATOM   1115 C CA  . MET A 1 167 ? -16.645 -56.121 -13.321 1.00 44.34 ? 168  MET A CA  1 
ATOM   1116 C C   . MET A 1 167 ? -17.023 -56.996 -12.109 1.00 42.59 ? 168  MET A C   1 
ATOM   1117 O O   . MET A 1 167 ? -18.181 -57.068 -11.699 1.00 41.44 ? 168  MET A O   1 
ATOM   1118 C CB  . MET A 1 167 ? -16.255 -54.702 -12.863 1.00 44.22 ? 168  MET A CB  1 
ATOM   1119 C CG  . MET A 1 167 ? -15.517 -53.882 -13.950 1.00 45.76 ? 168  MET A CG  1 
ATOM   1120 S SD  . MET A 1 167 ? -14.603 -52.486 -13.246 1.00 48.42 ? 168  MET A SD  1 
ATOM   1121 C CE  . MET A 1 167 ? -14.147 -51.581 -14.753 1.00 46.98 ? 168  MET A CE  1 
ATOM   1122 N N   . THR A 1 168 ? -16.027 -57.681 -11.566 1.00 42.24 ? 169  THR A N   1 
ATOM   1123 C CA  . THR A 1 168 ? -16.108 -58.269 -10.235 1.00 41.09 ? 169  THR A CA  1 
ATOM   1124 C C   . THR A 1 168 ? -16.049 -57.093 -9.233  1.00 39.77 ? 169  THR A C   1 
ATOM   1125 O O   . THR A 1 168 ? -15.596 -56.000 -9.576  1.00 38.76 ? 169  THR A O   1 
ATOM   1126 C CB  . THR A 1 168 ? -14.888 -59.176 -9.939  1.00 42.28 ? 169  THR A CB  1 
ATOM   1127 O OG1 . THR A 1 168 ? -13.702 -58.390 -10.081 1.00 43.24 ? 169  THR A OG1 1 
ATOM   1128 C CG2 . THR A 1 168 ? -14.790 -60.370 -10.895 1.00 41.56 ? 169  THR A CG2 1 
ATOM   1129 N N   . LEU A 1 169 ? -16.488 -57.341 -8.001  1.00 38.77 ? 170  LEU A N   1 
ATOM   1130 C CA  . LEU A 1 169 ? -16.311 -56.393 -6.912  1.00 37.64 ? 170  LEU A CA  1 
ATOM   1131 C C   . LEU A 1 169 ? -14.840 -55.942 -6.831  1.00 37.97 ? 170  LEU A C   1 
ATOM   1132 O O   . LEU A 1 169 ? -14.563 -54.739 -6.771  1.00 37.84 ? 170  LEU A O   1 
ATOM   1133 C CB  . LEU A 1 169 ? -16.816 -56.995 -5.584  1.00 37.33 ? 170  LEU A CB  1 
ATOM   1134 C CG  . LEU A 1 169 ? -16.778 -56.160 -4.290  1.00 36.01 ? 170  LEU A CG  1 
ATOM   1135 C CD1 . LEU A 1 169 ? -17.265 -54.730 -4.513  1.00 33.54 ? 170  LEU A CD1 1 
ATOM   1136 C CD2 . LEU A 1 169 ? -17.586 -56.812 -3.221  1.00 32.57 ? 170  LEU A CD2 1 
ATOM   1137 N N   . VAL A 1 170 ? -13.909 -56.892 -6.881  1.00 38.49 ? 171  VAL A N   1 
ATOM   1138 C CA  . VAL A 1 170 ? -12.469 -56.577 -6.821  1.00 38.35 ? 171  VAL A CA  1 
ATOM   1139 C C   . VAL A 1 170 ? -12.023 -55.600 -7.936  1.00 39.45 ? 171  VAL A C   1 
ATOM   1140 O O   . VAL A 1 170 ? -11.335 -54.600 -7.656  1.00 39.89 ? 171  VAL A O   1 
ATOM   1141 C CB  . VAL A 1 170 ? -11.575 -57.890 -6.854  1.00 39.97 ? 171  VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 170 ? -10.089 -57.558 -7.098  1.00 38.72 ? 171  VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 170 ? -11.751 -58.724 -5.555  1.00 35.98 ? 171  VAL A CG2 1 
ATOM   1144 N N   . ASP A 1 171 ? -12.395 -55.897 -9.183  1.00 40.01 ? 172  ASP A N   1 
ATOM   1145 C CA  . ASP A 1 171 ? -12.020 -55.068 -10.334 1.00 40.84 ? 172  ASP A CA  1 
ATOM   1146 C C   . ASP A 1 171 ? -12.591 -53.656 -10.145 1.00 39.35 ? 172  ASP A C   1 
ATOM   1147 O O   . ASP A 1 171 ? -11.938 -52.653 -10.447 1.00 40.00 ? 172  ASP A O   1 
ATOM   1148 C CB  . ASP A 1 171 ? -12.621 -55.620 -11.644 1.00 42.08 ? 172  ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 171 ? -12.020 -56.970 -12.104 1.00 46.36 ? 172  ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 171 ? -10.882 -57.334 -11.717 1.00 46.16 ? 172  ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 171 ? -12.735 -57.667 -12.889 1.00 52.39 ? 172  ASP A OD2 1 
ATOM   1152 N N   . ALA A 1 172 ? -13.830 -53.598 -9.662  1.00 36.81 ? 173  ALA A N   1 
ATOM   1153 C CA  . ALA A 1 172 ? -14.539 -52.351 -9.478  1.00 35.21 ? 173  ALA A CA  1 
ATOM   1154 C C   . ALA A 1 172 ? -13.865 -51.513 -8.400  1.00 34.65 ? 173  ALA A C   1 
ATOM   1155 O O   . ALA A 1 172 ? -13.727 -50.310 -8.534  1.00 34.27 ? 173  ALA A O   1 
ATOM   1156 C CB  . ALA A 1 172 ? -16.000 -52.621 -9.093  1.00 33.01 ? 173  ALA A CB  1 
ATOM   1157 N N   . ILE A 1 173 ? -13.457 -52.159 -7.315  1.00 34.91 ? 174  ILE A N   1 
ATOM   1158 C CA  . ILE A 1 173 ? -12.752 -51.460 -6.256  1.00 34.58 ? 174  ILE A CA  1 
ATOM   1159 C C   . ILE A 1 173 ? -11.412 -50.933 -6.780  1.00 36.41 ? 174  ILE A C   1 
ATOM   1160 O O   . ILE A 1 173 ? -11.071 -49.796 -6.522  1.00 36.56 ? 174  ILE A O   1 
ATOM   1161 C CB  . ILE A 1 173 ? -12.473 -52.360 -5.058  1.00 33.97 ? 174  ILE A CB  1 
ATOM   1162 C CG1 . ILE A 1 173 ? -13.755 -52.620 -4.299  1.00 32.49 ? 174  ILE A CG1 1 
ATOM   1163 C CG2 . ILE A 1 173 ? -11.439 -51.712 -4.184  1.00 31.20 ? 174  ILE A CG2 1 
ATOM   1164 C CD1 . ILE A 1 173 ? -13.673 -53.823 -3.359  1.00 31.07 ? 174  ILE A CD1 1 
ATOM   1165 N N   . GLN A 1 174 ? -10.651 -51.764 -7.484  1.00 37.94 ? 175  GLN A N   1 
ATOM   1166 C CA  . GLN A 1 174 ? -9.392  -51.291 -8.044  1.00 40.87 ? 175  GLN A CA  1 
ATOM   1167 C C   . GLN A 1 174 ? -9.599  -50.074 -8.960  1.00 39.94 ? 175  GLN A C   1 
ATOM   1168 O O   . GLN A 1 174 ? -8.791  -49.152 -8.960  1.00 40.53 ? 175  GLN A O   1 
ATOM   1169 C CB  . GLN A 1 174 ? -8.662  -52.398 -8.807  1.00 43.45 ? 175  GLN A CB  1 
ATOM   1170 C CG  . GLN A 1 174 ? -8.415  -53.691 -7.954  1.00 51.37 ? 175  GLN A CG  1 
ATOM   1171 C CD  . GLN A 1 174 ? -7.002  -53.807 -7.334  1.00 59.94 ? 175  GLN A CD  1 
ATOM   1172 O OE1 . GLN A 1 174 ? -6.305  -52.792 -7.094  1.00 65.37 ? 175  GLN A OE1 1 
ATOM   1173 N NE2 . GLN A 1 174 ? -6.586  -55.059 -7.052  1.00 61.26 ? 175  GLN A NE2 1 
ATOM   1174 N N   . GLN A 1 175 ? -10.683 -50.074 -9.729  1.00 38.31 ? 176  GLN A N   1 
ATOM   1175 C CA  . GLN A 1 175 ? -10.929 -49.005 -10.689 1.00 38.16 ? 176  GLN A CA  1 
ATOM   1176 C C   . GLN A 1 175 ? -11.231 -47.686 -9.967  1.00 36.79 ? 176  GLN A C   1 
ATOM   1177 O O   . GLN A 1 175 ? -10.794 -46.631 -10.406 1.00 36.72 ? 176  GLN A O   1 
ATOM   1178 C CB  . GLN A 1 175 ? -12.089 -49.380 -11.635 1.00 38.14 ? 176  GLN A CB  1 
ATOM   1179 C CG  . GLN A 1 175 ? -12.571 -48.251 -12.536 1.00 37.81 ? 176  GLN A CG  1 
ATOM   1180 C CD  . GLN A 1 175 ? -11.484 -47.837 -13.516 1.00 36.44 ? 176  GLN A CD  1 
ATOM   1181 O OE1 . GLN A 1 175 ? -10.719 -48.659 -13.964 1.00 42.06 ? 176  GLN A OE1 1 
ATOM   1182 N NE2 . GLN A 1 175 ? -11.405 -46.569 -13.815 1.00 32.70 ? 176  GLN A NE2 1 
ATOM   1183 N N   . VAL A 1 176 ? -11.942 -47.766 -8.847  1.00 35.47 ? 177  VAL A N   1 
ATOM   1184 C CA  . VAL A 1 176 ? -12.383 -46.576 -8.109  1.00 34.26 ? 177  VAL A CA  1 
ATOM   1185 C C   . VAL A 1 176 ? -11.342 -46.108 -7.113  1.00 34.71 ? 177  VAL A C   1 
ATOM   1186 O O   . VAL A 1 176 ? -10.970 -44.947 -7.097  1.00 36.14 ? 177  VAL A O   1 
ATOM   1187 C CB  . VAL A 1 176 ? -13.748 -46.816 -7.406  1.00 33.31 ? 177  VAL A CB  1 
ATOM   1188 C CG1 . VAL A 1 176 ? -14.118 -45.638 -6.499  1.00 31.67 ? 177  VAL A CG1 1 
ATOM   1189 C CG2 . VAL A 1 176 ? -14.841 -47.062 -8.457  1.00 31.61 ? 177  VAL A CG2 1 
ATOM   1190 N N   . ALA A 1 177 ? -10.853 -47.019 -6.291  1.00 34.95 ? 178  ALA A N   1 
ATOM   1191 C CA  . ALA A 1 177 ? -9.827  -46.700 -5.291  1.00 35.30 ? 178  ALA A CA  1 
ATOM   1192 C C   . ALA A 1 177 ? -8.564  -46.062 -5.874  1.00 35.76 ? 178  ALA A C   1 
ATOM   1193 O O   . ALA A 1 177 ? -7.914  -45.285 -5.220  1.00 35.79 ? 178  ALA A O   1 
ATOM   1194 C CB  . ALA A 1 177 ? -9.464  -47.956 -4.493  1.00 34.88 ? 178  ALA A CB  1 
ATOM   1195 N N   . LYS A 1 178 ? -8.210  -46.374 -7.111  1.00 36.80 ? 179  LYS A N   1 
ATOM   1196 C CA  . LYS A 1 178 ? -7.004  -45.764 -7.693  1.00 37.48 ? 179  LYS A CA  1 
ATOM   1197 C C   . LYS A 1 178 ? -7.267  -44.308 -8.116  1.00 38.15 ? 179  LYS A C   1 
ATOM   1198 O O   . LYS A 1 178 ? -6.322  -43.538 -8.290  1.00 39.94 ? 179  LYS A O   1 
ATOM   1199 C CB  . LYS A 1 178 ? -6.500  -46.580 -8.854  1.00 38.16 ? 179  LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 178 ? -7.248  -46.359 -10.155 1.00 37.86 ? 179  LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 178 ? -6.928  -47.426 -11.175 1.00 37.24 ? 179  LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 178 ? -7.478  -47.040 -12.572 1.00 36.87 ? 179  LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 178 ? -7.266  -48.103 -13.543 1.00 34.68 ? 179  LYS A NZ  1 
ATOM   1204 N N   . ASN A 1 179 ? -8.540  -43.931 -8.280  1.00 36.90 ? 180  ASN A N   1 
ATOM   1205 C CA  . ASN A 1 179 ? -8.892  -42.542 -8.600  1.00 37.17 ? 180  ASN A CA  1 
ATOM   1206 C C   . ASN A 1 179 ? -9.374  -41.721 -7.408  1.00 37.25 ? 180  ASN A C   1 
ATOM   1207 O O   . ASN A 1 179 ? -9.270  -40.502 -7.440  1.00 39.00 ? 180  ASN A O   1 
ATOM   1208 C CB  . ASN A 1 179 ? -9.957  -42.511 -9.699  1.00 36.58 ? 180  ASN A CB  1 
ATOM   1209 C CG  . ASN A 1 179 ? -9.414  -42.954 -11.032 1.00 35.82 ? 180  ASN A CG  1 
ATOM   1210 O OD1 . ASN A 1 179 ? -8.504  -42.333 -11.584 1.00 36.13 ? 180  ASN A OD1 1 
ATOM   1211 N ND2 . ASN A 1 179 ? -9.955  -44.051 -11.553 1.00 33.29 ? 180  ASN A ND2 1 
ATOM   1212 N N   . ARG A 1 180 ? -9.890  -42.368 -6.361  1.00 36.52 ? 181  ARG A N   1 
ATOM   1213 C CA  . ARG A 1 180 ? -10.470 -41.649 -5.206  1.00 36.21 ? 181  ARG A CA  1 
ATOM   1214 C C   . ARG A 1 180 ? -10.311 -42.472 -3.951  1.00 36.28 ? 181  ARG A C   1 
ATOM   1215 O O   . ARG A 1 180 ? -10.520 -43.660 -3.984  1.00 37.57 ? 181  ARG A O   1 
ATOM   1216 C CB  . ARG A 1 180 ? -11.969 -41.396 -5.462  1.00 34.59 ? 181  ARG A CB  1 
ATOM   1217 C CG  . ARG A 1 180 ? -12.625 -40.529 -4.437  1.00 35.28 ? 181  ARG A CG  1 
ATOM   1218 C CD  . ARG A 1 180 ? -14.002 -39.983 -4.829  1.00 33.74 ? 181  ARG A CD  1 
ATOM   1219 N NE  . ARG A 1 180 ? -14.545 -39.181 -3.735  1.00 33.89 ? 181  ARG A NE  1 
ATOM   1220 C CZ  . ARG A 1 180 ? -14.245 -37.913 -3.446  1.00 36.88 ? 181  ARG A CZ  1 
ATOM   1221 N NH1 . ARG A 1 180 ? -13.371 -37.224 -4.138  1.00 39.94 ? 181  ARG A NH1 1 
ATOM   1222 N NH2 . ARG A 1 180 ? -14.837 -37.323 -2.420  1.00 39.73 ? 181  ARG A NH2 1 
ATOM   1223 N N   . CYS A 1 181 ? -9.953  -41.853 -2.841  1.00 37.09 ? 182  CYS A N   1 
ATOM   1224 C CA  . CYS A 1 181 ? -9.954  -42.548 -1.575  1.00 37.27 ? 182  CYS A CA  1 
ATOM   1225 C C   . CYS A 1 181 ? -11.395 -42.836 -1.202  1.00 35.85 ? 182  CYS A C   1 
ATOM   1226 O O   . CYS A 1 181 ? -12.156 -41.896 -1.015  1.00 36.51 ? 182  CYS A O   1 
ATOM   1227 C CB  . CYS A 1 181 ? -9.325  -41.692 -0.481  1.00 38.19 ? 182  CYS A CB  1 
ATOM   1228 S SG  . CYS A 1 181 ? -7.593  -41.283 -0.707  1.00 41.15 ? 182  CYS A SG  1 
ATOM   1229 N N   . VAL A 1 182 ? -11.776 -44.111 -1.098  1.00 34.74 ? 183  VAL A N   1 
ATOM   1230 C CA  . VAL A 1 182 ? -13.153 -44.492 -0.696  1.00 33.90 ? 183  VAL A CA  1 
ATOM   1231 C C   . VAL A 1 182 ? -13.107 -45.676 0.290   1.00 34.54 ? 183  VAL A C   1 
ATOM   1232 O O   . VAL A 1 182 ? -12.140 -46.454 0.290   1.00 33.74 ? 183  VAL A O   1 
ATOM   1233 C CB  . VAL A 1 182 ? -14.025 -44.853 -1.908  1.00 33.22 ? 183  VAL A CB  1 
ATOM   1234 C CG1 . VAL A 1 182 ? -14.051 -43.686 -2.917  1.00 32.85 ? 183  VAL A CG1 1 
ATOM   1235 C CG2 . VAL A 1 182 ? -13.506 -46.111 -2.590  1.00 32.38 ? 183  VAL A CG2 1 
ATOM   1236 N N   . LEU A 1 183 ? -14.132 -45.764 1.139   1.00 34.03 ? 184  LEU A N   1 
ATOM   1237 C CA  . LEU A 1 183 ? -14.271 -46.828 2.123   1.00 34.83 ? 184  LEU A CA  1 
ATOM   1238 C C   . LEU A 1 183 ? -15.772 -46.973 2.444   1.00 34.36 ? 184  LEU A C   1 
ATOM   1239 O O   . LEU A 1 183 ? -16.266 -46.363 3.389   1.00 35.03 ? 184  LEU A O   1 
ATOM   1240 C CB  . LEU A 1 183 ? -13.496 -46.485 3.404   1.00 35.99 ? 184  LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 183 ? -13.355 -47.587 4.491   1.00 39.45 ? 184  LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 183 ? -12.732 -48.853 3.882   1.00 40.52 ? 184  LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 183 ? -12.501 -47.161 5.722   1.00 38.06 ? 184  LEU A CD2 1 
ATOM   1244 N N   . PRO A 1 184 ? -16.513 -47.774 1.659   1.00 33.37 ? 185  PRO A N   1 
ATOM   1245 C CA  . PRO A 1 184 ? -17.890 -48.039 2.047   1.00 32.92 ? 185  PRO A CA  1 
ATOM   1246 C C   . PRO A 1 184 ? -17.963 -48.687 3.414   1.00 33.59 ? 185  PRO A C   1 
ATOM   1247 O O   . PRO A 1 184 ? -17.047 -49.402 3.786   1.00 34.35 ? 185  PRO A O   1 
ATOM   1248 C CB  . PRO A 1 184 ? -18.357 -49.013 0.984   1.00 32.60 ? 185  PRO A CB  1 
ATOM   1249 C CG  . PRO A 1 184 ? -17.446 -48.733 -0.206  1.00 32.34 ? 185  PRO A CG  1 
ATOM   1250 C CD  . PRO A 1 184 ? -16.144 -48.513 0.449   1.00 32.83 ? 185  PRO A CD  1 
ATOM   1251 N N   . ASN A 1 185 ? -19.024 -48.426 4.171   1.00 34.09 ? 186  ASN A N   1 
ATOM   1252 C CA  . ASN A 1 185 ? -19.172 -49.015 5.508   1.00 34.82 ? 186  ASN A CA  1 
ATOM   1253 C C   . ASN A 1 185 ? -19.399 -50.526 5.391   1.00 35.74 ? 186  ASN A C   1 
ATOM   1254 O O   . ASN A 1 185 ? -19.753 -51.039 4.320   1.00 34.42 ? 186  ASN A O   1 
ATOM   1255 C CB  . ASN A 1 185 ? -20.278 -48.305 6.331   1.00 34.63 ? 186  ASN A CB  1 
ATOM   1256 C CG  . ASN A 1 185 ? -21.712 -48.684 5.904   1.00 34.76 ? 186  ASN A CG  1 
ATOM   1257 O OD1 . ASN A 1 185 ? -22.062 -49.860 5.786   1.00 34.90 ? 186  ASN A OD1 1 
ATOM   1258 N ND2 . ASN A 1 185 ? -22.546 -47.672 5.690   1.00 33.83 ? 186  ASN A ND2 1 
ATOM   1259 N N   . ARG A 1 186 ? -19.179 -51.225 6.498   1.00 37.73 ? 187  ARG A N   1 
ATOM   1260 C CA  . ARG A 1 186 ? -19.229 -52.694 6.532   1.00 39.19 ? 187  ARG A CA  1 
ATOM   1261 C C   . ARG A 1 186 ? -20.520 -53.293 5.983   1.00 37.48 ? 187  ARG A C   1 
ATOM   1262 O O   . ARG A 1 186 ? -20.492 -54.369 5.370   1.00 36.86 ? 187  ARG A O   1 
ATOM   1263 C CB  . ARG A 1 186 ? -18.955 -53.209 7.967   1.00 41.54 ? 187  ARG A CB  1 
ATOM   1264 C CG  . ARG A 1 186 ? -17.439 -53.538 8.228   1.00 49.45 ? 187  ARG A CG  1 
ATOM   1265 C CD  . ARG A 1 186 ? -17.169 -54.430 9.506   1.00 57.92 ? 187  ARG A CD  1 
ATOM   1266 N NE  . ARG A 1 186 ? -18.246 -55.423 9.698   1.00 65.27 ? 187  ARG A NE  1 
ATOM   1267 C CZ  . ARG A 1 186 ? -18.635 -55.950 10.865  1.00 70.07 ? 187  ARG A CZ  1 
ATOM   1268 N NH1 . ARG A 1 186 ? -18.033 -55.618 12.011  1.00 73.14 ? 187  ARG A NH1 1 
ATOM   1269 N NH2 . ARG A 1 186 ? -19.638 -56.834 10.883  1.00 70.95 ? 187  ARG A NH2 1 
ATOM   1270 N N   . GLY A 1 187 ? -21.650 -52.605 6.202   1.00 36.12 ? 188  GLY A N   1 
ATOM   1271 C CA  . GLY A 1 187 ? -22.951 -53.076 5.716   1.00 34.42 ? 188  GLY A CA  1 
ATOM   1272 C C   . GLY A 1 187 ? -23.046 -52.937 4.219   1.00 33.27 ? 188  GLY A C   1 
ATOM   1273 O O   . GLY A 1 187 ? -23.526 -53.825 3.527   1.00 33.28 ? 188  GLY A O   1 
ATOM   1274 N N   . PHE A 1 188 ? -22.589 -51.814 3.702   1.00 32.72 ? 189  PHE A N   1 
ATOM   1275 C CA  . PHE A 1 188 ? -22.597 -51.606 2.255   1.00 32.59 ? 189  PHE A CA  1 
ATOM   1276 C C   . PHE A 1 188 ? -21.690 -52.614 1.571   1.00 32.83 ? 189  PHE A C   1 
ATOM   1277 O O   . PHE A 1 188 ? -22.018 -53.104 0.492   1.00 32.32 ? 189  PHE A O   1 
ATOM   1278 C CB  . PHE A 1 188 ? -22.163 -50.186 1.892   1.00 32.01 ? 189  PHE A CB  1 
ATOM   1279 C CG  . PHE A 1 188 ? -23.121 -49.113 2.334   1.00 32.11 ? 189  PHE A CG  1 
ATOM   1280 C CD1 . PHE A 1 188 ? -24.388 -49.414 2.817   1.00 33.00 ? 189  PHE A CD1 1 
ATOM   1281 C CD2 . PHE A 1 188 ? -22.754 -47.771 2.234   1.00 33.84 ? 189  PHE A CD2 1 
ATOM   1282 C CE1 . PHE A 1 188 ? -25.250 -48.399 3.207   1.00 32.29 ? 189  PHE A CE1 1 
ATOM   1283 C CE2 . PHE A 1 188 ? -23.617 -46.760 2.638   1.00 34.07 ? 189  PHE A CE2 1 
ATOM   1284 C CZ  . PHE A 1 188 ? -24.853 -47.075 3.128   1.00 32.59 ? 189  PHE A CZ  1 
ATOM   1285 N N   . LEU A 1 189 ? -20.567 -52.941 2.208   1.00 33.75 ? 190  LEU A N   1 
ATOM   1286 C CA  . LEU A 1 189 ? -19.662 -53.968 1.683   1.00 34.77 ? 190  LEU A CA  1 
ATOM   1287 C C   . LEU A 1 189 ? -20.314 -55.343 1.578   1.00 34.92 ? 190  LEU A C   1 
ATOM   1288 O O   . LEU A 1 189 ? -20.171 -56.027 0.578   1.00 33.63 ? 190  LEU A O   1 
ATOM   1289 C CB  . LEU A 1 189 ? -18.418 -54.106 2.568   1.00 36.46 ? 190  LEU A CB  1 
ATOM   1290 C CG  . LEU A 1 189 ? -17.193 -53.292 2.164   1.00 39.06 ? 190  LEU A CG  1 
ATOM   1291 C CD1 . LEU A 1 189 ? -15.958 -53.813 2.930   1.00 40.36 ? 190  LEU A CD1 1 
ATOM   1292 C CD2 . LEU A 1 189 ? -16.997 -53.352 0.647   1.00 39.90 ? 190  LEU A CD2 1 
ATOM   1293 N N   . LYS A 1 190 ? -21.016 -55.743 2.626   1.00 35.40 ? 191  LYS A N   1 
ATOM   1294 C CA  . LYS A 1 190 ? -21.705 -57.004 2.608   1.00 36.89 ? 191  LYS A CA  1 
ATOM   1295 C C   . LYS A 1 190 ? -22.773 -56.952 1.498   1.00 35.53 ? 191  LYS A C   1 
ATOM   1296 O O   . LYS A 1 190 ? -22.970 -57.920 0.769   1.00 34.21 ? 191  LYS A O   1 
ATOM   1297 C CB  . LYS A 1 190 ? -22.292 -57.263 3.986   1.00 39.02 ? 191  LYS A CB  1 
ATOM   1298 C CG  . LYS A 1 190 ? -23.490 -58.210 4.039   1.00 46.04 ? 191  LYS A CG  1 
ATOM   1299 C CD  . LYS A 1 190 ? -23.171 -59.547 4.754   1.00 53.58 ? 191  LYS A CD  1 
ATOM   1300 C CE  . LYS A 1 190 ? -24.457 -60.434 4.825   1.00 57.13 ? 191  LYS A CE  1 
ATOM   1301 N NZ  . LYS A 1 190 ? -24.344 -61.550 5.875   1.00 60.84 ? 191  LYS A NZ  1 
ATOM   1302 N N   . GLN A 1 191 ? -23.409 -55.801 1.318   1.00 33.52 ? 192  GLN A N   1 
ATOM   1303 C CA  . GLN A 1 191 ? -24.417 -55.700 0.269   1.00 32.70 ? 192  GLN A CA  1 
ATOM   1304 C C   . GLN A 1 191 ? -23.774 -55.845 -1.123  1.00 31.84 ? 192  GLN A C   1 
ATOM   1305 O O   . GLN A 1 191 ? -24.308 -56.524 -2.005  1.00 29.46 ? 192  GLN A O   1 
ATOM   1306 C CB  . GLN A 1 191 ? -25.193 -54.408 0.382   1.00 32.33 ? 192  GLN A CB  1 
ATOM   1307 C CG  . GLN A 1 191 ? -26.172 -54.416 1.525   1.00 33.55 ? 192  GLN A CG  1 
ATOM   1308 C CD  . GLN A 1 191 ? -26.620 -53.032 1.906   1.00 34.45 ? 192  GLN A CD  1 
ATOM   1309 O OE1 . GLN A 1 191 ? -26.937 -52.195 1.039   1.00 31.43 ? 192  GLN A OE1 1 
ATOM   1310 N NE2 . GLN A 1 191 ? -26.623 -52.762 3.205   1.00 30.90 ? 192  GLN A NE2 1 
ATOM   1311 N N   . LEU A 1 192 ? -22.590 -55.258 -1.289  1.00 31.91 ? 193  LEU A N   1 
ATOM   1312 C CA  . LEU A 1 192 ? -21.854 -55.406 -2.541  1.00 31.67 ? 193  LEU A CA  1 
ATOM   1313 C C   . LEU A 1 192 ? -21.439 -56.874 -2.729  1.00 33.13 ? 193  LEU A C   1 
ATOM   1314 O O   . LEU A 1 192 ? -21.458 -57.398 -3.861  1.00 33.48 ? 193  LEU A O   1 
ATOM   1315 C CB  . LEU A 1 192 ? -20.639 -54.462 -2.583  1.00 31.12 ? 193  LEU A CB  1 
ATOM   1316 C CG  . LEU A 1 192 ? -20.936 -52.963 -2.736  1.00 29.74 ? 193  LEU A CG  1 
ATOM   1317 C CD1 . LEU A 1 192 ? -19.694 -52.132 -2.510  1.00 26.04 ? 193  LEU A CD1 1 
ATOM   1318 C CD2 . LEU A 1 192 ? -21.549 -52.649 -4.116  1.00 28.28 ? 193  LEU A CD2 1 
ATOM   1319 N N   . ARG A 1 193 ? -21.105 -57.547 -1.629  1.00 33.52 ? 194  ARG A N   1 
ATOM   1320 C CA  . ARG A 1 193 ? -20.683 -58.937 -1.729  1.00 35.56 ? 194  ARG A CA  1 
ATOM   1321 C C   . ARG A 1 193 ? -21.849 -59.786 -2.199  1.00 35.65 ? 194  ARG A C   1 
ATOM   1322 O O   . ARG A 1 193 ? -21.665 -60.650 -3.035  1.00 37.26 ? 194  ARG A O   1 
ATOM   1323 C CB  . ARG A 1 193 ? -20.069 -59.489 -0.428  1.00 36.11 ? 194  ARG A CB  1 
ATOM   1324 C CG  . ARG A 1 193 ? -18.711 -58.855 -0.022  1.00 38.58 ? 194  ARG A CG  1 
ATOM   1325 C CD  . ARG A 1 193 ? -17.933 -59.653 1.112   1.00 42.33 ? 194  ARG A CD  1 
ATOM   1326 N NE  . ARG A 1 193 ? -18.704 -60.802 1.548   1.00 48.77 ? 194  ARG A NE  1 
ATOM   1327 C CZ  . ARG A 1 193 ? -18.448 -62.091 1.289   1.00 54.89 ? 194  ARG A CZ  1 
ATOM   1328 N NH1 . ARG A 1 193 ? -17.356 -62.486 0.634   1.00 57.39 ? 194  ARG A NH1 1 
ATOM   1329 N NH2 . ARG A 1 193 ? -19.309 -63.012 1.719   1.00 56.41 ? 194  ARG A NH2 1 
ATOM   1330 N N   . GLU A 1 194 ? -23.048 -59.506 -1.710  1.00 35.88 ? 195  GLU A N   1 
ATOM   1331 C CA  . GLU A 1 194 ? -24.231 -60.272 -2.098  1.00 36.46 ? 195  GLU A CA  1 
ATOM   1332 C C   . GLU A 1 194 ? -24.553 -60.051 -3.541  1.00 35.35 ? 195  GLU A C   1 
ATOM   1333 O O   . GLU A 1 194 ? -24.920 -60.976 -4.243  1.00 36.59 ? 195  GLU A O   1 
ATOM   1334 C CB  . GLU A 1 194 ? -25.444 -59.949 -1.217  1.00 36.83 ? 195  GLU A CB  1 
ATOM   1335 C CG  . GLU A 1 194 ? -25.353 -60.459 0.216   1.00 39.45 ? 195  GLU A CG  1 
ATOM   1336 C CD  . GLU A 1 194 ? -25.008 -61.968 0.327   1.00 46.00 ? 195  GLU A CD  1 
ATOM   1337 O OE1 . GLU A 1 194 ? -25.663 -62.833 -0.319  1.00 48.24 ? 195  GLU A OE1 1 
ATOM   1338 O OE2 . GLU A 1 194 ? -24.032 -62.281 1.043   1.00 50.22 ? 195  GLU A OE2 1 
ATOM   1339 N N   . LEU A 1 195 ? -24.363 -58.837 -4.012  1.00 34.56 ? 196  LEU A N   1 
ATOM   1340 C CA  . LEU A 1 195 ? -24.517 -58.562 -5.443  1.00 34.54 ? 196  LEU A CA  1 
ATOM   1341 C C   . LEU A 1 195 ? -23.435 -59.299 -6.255  1.00 36.10 ? 196  LEU A C   1 
ATOM   1342 O O   . LEU A 1 195 ? -23.749 -59.990 -7.254  1.00 37.74 ? 196  LEU A O   1 
ATOM   1343 C CB  . LEU A 1 195 ? -24.472 -57.065 -5.705  1.00 33.50 ? 196  LEU A CB  1 
ATOM   1344 C CG  . LEU A 1 195 ? -24.546 -56.629 -7.179  1.00 34.56 ? 196  LEU A CG  1 
ATOM   1345 C CD1 . LEU A 1 195 ? -25.877 -57.046 -7.768  1.00 33.89 ? 196  LEU A CD1 1 
ATOM   1346 C CD2 . LEU A 1 195 ? -24.368 -55.109 -7.304  1.00 33.08 ? 196  LEU A CD2 1 
ATOM   1347 N N   . ASP A 1 196 ? -22.178 -59.183 -5.819  1.00 35.28 ? 197  ASP A N   1 
ATOM   1348 C CA  . ASP A 1 196 ? -21.055 -59.806 -6.528  1.00 35.79 ? 197  ASP A CA  1 
ATOM   1349 C C   . ASP A 1 196 ? -21.316 -61.309 -6.734  1.00 36.83 ? 197  ASP A C   1 
ATOM   1350 O O   . ASP A 1 196 ? -21.160 -61.830 -7.838  1.00 37.07 ? 197  ASP A O   1 
ATOM   1351 C CB  . ASP A 1 196 ? -19.761 -59.599 -5.701  1.00 36.02 ? 197  ASP A CB  1 
ATOM   1352 C CG  . ASP A 1 196 ? -18.470 -59.884 -6.493  1.00 38.30 ? 197  ASP A CG  1 
ATOM   1353 O OD1 . ASP A 1 196 ? -18.398 -59.502 -7.682  1.00 37.17 ? 197  ASP A OD1 1 
ATOM   1354 O OD2 . ASP A 1 196 ? -17.519 -60.474 -5.916  1.00 39.01 ? 197  ASP A OD2 1 
ATOM   1355 N N   . LYS A 1 197 ? -21.699 -62.020 -5.671  1.00 37.10 ? 198  LYS A N   1 
ATOM   1356 C CA  . LYS A 1 197 ? -21.919 -63.462 -5.795  1.00 39.17 ? 198  LYS A CA  1 
ATOM   1357 C C   . LYS A 1 197 ? -22.943 -63.776 -6.896  1.00 39.11 ? 198  LYS A C   1 
ATOM   1358 O O   . LYS A 1 197 ? -22.803 -64.764 -7.615  1.00 39.30 ? 198  LYS A O   1 
ATOM   1359 C CB  . LYS A 1 197 ? -22.372 -64.098 -4.488  1.00 39.84 ? 198  LYS A CB  1 
ATOM   1360 C CG  . LYS A 1 197 ? -21.289 -64.140 -3.411  1.00 44.35 ? 198  LYS A CG  1 
ATOM   1361 C CD  . LYS A 1 197 ? -21.701 -64.969 -2.167  1.00 48.10 ? 198  LYS A CD  1 
ATOM   1362 C CE  . LYS A 1 197 ? -21.984 -64.106 -0.942  1.00 50.23 ? 198  LYS A CE  1 
ATOM   1363 N NZ  . LYS A 1 197 ? -22.817 -64.866 0.098   1.00 51.45 ? 198  LYS A NZ  1 
ATOM   1364 N N   . GLN A 1 198 ? -23.958 -62.937 -7.023  1.00 37.71 ? 199  GLN A N   1 
ATOM   1365 C CA  . GLN A 1 198 ? -25.032 -63.210 -7.971  1.00 38.49 ? 199  GLN A CA  1 
ATOM   1366 C C   . GLN A 1 198 ? -24.558 -63.009 -9.396  1.00 39.10 ? 199  GLN A C   1 
ATOM   1367 O O   . GLN A 1 198 ? -24.832 -63.829 -10.269 1.00 39.05 ? 199  GLN A O   1 
ATOM   1368 C CB  . GLN A 1 198 ? -26.238 -62.327 -7.718  1.00 36.89 ? 199  GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 198 ? -27.044 -62.705 -6.486  1.00 37.09 ? 199  GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 198 ? -28.080 -61.614 -6.172  1.00 35.90 ? 199  GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 198 ? -27.785 -60.606 -5.525  1.00 35.54 ? 199  GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 198 ? -29.268 -61.795 -6.684  1.00 31.25 ? 199  GLN A NE2 1 
ATOM   1373 N N   . LEU A 1 199 ? -23.865 -61.903 -9.609  1.00 38.75 ? 200  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 199 ? -23.358 -61.560 -10.910 1.00 39.93 ? 200  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 199 ? -22.319 -62.551 -11.394 1.00 41.93 ? 200  LEU A C   1 
ATOM   1376 O O   . LEU A 1 199 ? -22.264 -62.876 -12.589 1.00 42.82 ? 200  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 199 ? -22.759 -60.156 -10.868 1.00 39.49 ? 200  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 199 ? -23.723 -58.994 -10.590 1.00 37.69 ? 200  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 199 ? -22.984 -57.675 -10.628 1.00 34.85 ? 200  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 199 ? -24.847 -59.018 -11.635 1.00 37.15 ? 200  LEU A CD2 1 
ATOM   1381 N N   . VAL A 1 200 ? -21.482 -63.032 -10.482 1.00 42.86 ? 201  VAL A N   1 
ATOM   1382 C CA  . VAL A 1 200 ? -20.497 -64.053 -10.847 1.00 44.46 ? 201  VAL A CA  1 
ATOM   1383 C C   . VAL A 1 200 ? -21.207 -65.342 -11.264 1.00 47.02 ? 201  VAL A C   1 
ATOM   1384 O O   . VAL A 1 200 ? -20.955 -65.879 -12.353 1.00 47.64 ? 201  VAL A O   1 
ATOM   1385 C CB  . VAL A 1 200 ? -19.493 -64.285 -9.722  1.00 44.59 ? 201  VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 200 ? -18.601 -65.522 -9.995  1.00 45.10 ? 201  VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 200 ? -18.651 -63.008 -9.538  1.00 43.12 ? 201  VAL A CG2 1 
ATOM   1388 N N   . GLN A 1 201 ? -22.131 -65.804 -10.437 1.00 48.09 ? 202  GLN A N   1 
ATOM   1389 C CA  . GLN A 1 201 ? -22.956 -66.954 -10.782 1.00 51.47 ? 202  GLN A CA  1 
ATOM   1390 C C   . GLN A 1 201 ? -23.641 -66.793 -12.179 1.00 53.80 ? 202  GLN A C   1 
ATOM   1391 O O   . GLN A 1 201 ? -23.639 -67.708 -13.012 1.00 54.53 ? 202  GLN A O   1 
ATOM   1392 C CB  . GLN A 1 201 ? -23.979 -67.202 -9.669  1.00 50.74 ? 202  GLN A CB  1 
ATOM   1393 C CG  . GLN A 1 201 ? -24.905 -68.398 -9.867  1.00 54.68 ? 202  GLN A CG  1 
ATOM   1394 C CD  . GLN A 1 201 ? -24.168 -69.680 -10.269 1.00 60.96 ? 202  GLN A CD  1 
ATOM   1395 O OE1 . GLN A 1 201 ? -23.067 -69.972 -9.783  1.00 63.38 ? 202  GLN A OE1 1 
ATOM   1396 N NE2 . GLN A 1 201 ? -24.770 -70.438 -11.179 1.00 64.87 ? 202  GLN A NE2 1 
ATOM   1397 N N   . GLN A 1 202 ? -24.196 -65.614 -12.414 1.00 54.86 ? 203  GLN A N   1 
ATOM   1398 C CA  . GLN A 1 202 ? -24.883 -65.267 -13.656 1.00 57.86 ? 203  GLN A CA  1 
ATOM   1399 C C   . GLN A 1 202 ? -23.945 -65.322 -14.879 1.00 60.76 ? 203  GLN A C   1 
ATOM   1400 O O   . GLN A 1 202 ? -24.339 -65.772 -15.952 1.00 61.21 ? 203  GLN A O   1 
ATOM   1401 C CB  . GLN A 1 202 ? -25.465 -63.862 -13.459 1.00 56.46 ? 203  GLN A CB  1 
ATOM   1402 C CG  . GLN A 1 202 ? -26.217 -63.207 -14.575 1.00 58.05 ? 203  GLN A CG  1 
ATOM   1403 C CD  . GLN A 1 202 ? -26.876 -61.908 -14.069 1.00 59.17 ? 203  GLN A CD  1 
ATOM   1404 O OE1 . GLN A 1 202 ? -27.934 -61.936 -13.442 1.00 57.88 ? 203  GLN A OE1 1 
ATOM   1405 N NE2 . GLN A 1 202 ? -26.229 -60.774 -14.326 1.00 60.16 ? 203  GLN A NE2 1 
ATOM   1406 N N   . ARG A 1 203 ? -22.702 -64.891 -14.685 1.00 63.15 ? 204  ARG A N   1 
ATOM   1407 C CA  . ARG A 1 203 ? -21.719 -64.820 -15.762 1.00 66.76 ? 204  ARG A CA  1 
ATOM   1408 C C   . ARG A 1 203 ? -20.980 -66.116 -16.054 1.00 72.25 ? 204  ARG A C   1 
ATOM   1409 O O   . ARG A 1 203 ? -20.351 -66.215 -17.097 1.00 73.65 ? 204  ARG A O   1 
ATOM   1410 C CB  . ARG A 1 203 ? -20.721 -63.703 -15.504 1.00 64.84 ? 204  ARG A CB  1 
ATOM   1411 C CG  . ARG A 1 203 ? -21.325 -62.370 -15.810 1.00 62.46 ? 204  ARG A CG  1 
ATOM   1412 C CD  . ARG A 1 203 ? -20.816 -61.227 -14.944 1.00 57.83 ? 204  ARG A CD  1 
ATOM   1413 N NE  . ARG A 1 203 ? -21.633 -60.057 -15.228 1.00 55.61 ? 204  ARG A NE  1 
ATOM   1414 C CZ  . ARG A 1 203 ? -21.554 -58.890 -14.601 1.00 53.06 ? 204  ARG A CZ  1 
ATOM   1415 N NH1 . ARG A 1 203 ? -20.687 -58.700 -13.607 1.00 54.24 ? 204  ARG A NH1 1 
ATOM   1416 N NH2 . ARG A 1 203 ? -22.352 -57.909 -14.968 1.00 50.25 ? 204  ARG A NH2 1 
ATOM   1417 N N   . ARG A 1 204 ? -21.035 -67.093 -15.152 1.00 77.11 ? 205  ARG A N   1 
ATOM   1418 C CA  . ARG A 1 204 ? -20.678 -68.462 -15.519 1.00 83.47 ? 205  ARG A CA  1 
ATOM   1419 C C   . ARG A 1 204 ? -21.517 -68.904 -16.736 1.00 88.84 ? 205  ARG A C   1 
ATOM   1420 O O   . ARG A 1 204 ? -20.988 -69.440 -17.707 1.00 90.06 ? 205  ARG A O   1 
ATOM   1421 C CB  . ARG A 1 204 ? -20.888 -69.413 -14.343 1.00 83.59 ? 205  ARG A CB  1 
ATOM   1422 C CG  . ARG A 1 204 ? -19.832 -69.259 -13.289 1.00 83.82 ? 205  ARG A CG  1 
ATOM   1423 C CD  . ARG A 1 204 ? -19.854 -70.381 -12.240 1.00 86.89 ? 205  ARG A CD  1 
ATOM   1424 N NE  . ARG A 1 204 ? -18.753 -70.185 -11.286 1.00 87.87 ? 205  ARG A NE  1 
ATOM   1425 C CZ  . ARG A 1 204 ? -18.837 -69.578 -10.096 1.00 87.73 ? 205  ARG A CZ  1 
ATOM   1426 N NH1 . ARG A 1 204 ? -19.994 -69.099 -9.610  1.00 86.52 ? 205  ARG A NH1 1 
ATOM   1427 N NH2 . ARG A 1 204 ? -17.732 -69.457 -9.366  1.00 88.57 ? 205  ARG A NH2 1 
ATOM   1428 N N   . ARG A 1 205 ? -22.826 -68.635 -16.650 1.00 53.79 ? 206  ARG A N   1 
ATOM   1429 C CA  . ARG A 1 205 ? -23.813 -68.825 -17.737 1.00 57.10 ? 206  ARG A CA  1 
ATOM   1430 C C   . ARG A 1 205 ? -23.733 -70.230 -18.342 1.00 57.82 ? 206  ARG A C   1 
ATOM   1431 O O   . ARG A 1 205 ? -24.769 -70.837 -18.624 1.00 60.02 ? 206  ARG A O   1 
ATOM   1432 C CB  . ARG A 1 205 ? -23.671 -67.710 -18.803 1.00 58.12 ? 206  ARG A CB  1 
ATOM   1433 C CG  . ARG A 1 205 ? -24.222 -68.066 -20.204 1.00 62.71 ? 206  ARG A CG  1 
ATOM   1434 C CD  . ARG A 1 205 ? -23.167 -67.891 -21.326 1.00 67.76 ? 206  ARG A CD  1 
ATOM   1435 N NE  . ARG A 1 205 ? -21.822 -68.347 -20.934 1.00 72.69 ? 206  ARG A NE  1 
ATOM   1436 C CZ  . ARG A 1 205 ? -21.416 -69.625 -20.843 1.00 76.42 ? 206  ARG A CZ  1 
ATOM   1437 N NH1 . ARG A 1 205 ? -22.243 -70.648 -21.104 1.00 77.69 ? 206  ARG A NH1 1 
ATOM   1438 N NH2 . ARG A 1 205 ? -20.159 -69.888 -20.466 1.00 76.71 ? 206  ARG A NH2 1 
ATOM   1439 N N   . ASP B 1 31  ? -13.022 -69.724 -11.185 1.00 74.94 ? 32   ASP B N   1 
ATOM   1440 C CA  . ASP B 1 31  ? -11.866 -69.563 -10.247 1.00 73.52 ? 32   ASP B CA  1 
ATOM   1441 C C   . ASP B 1 31  ? -12.016 -68.404 -9.232  1.00 70.41 ? 32   ASP B C   1 
ATOM   1442 O O   . ASP B 1 31  ? -11.913 -68.630 -8.017  1.00 70.76 ? 32   ASP B O   1 
ATOM   1443 C CB  . ASP B 1 31  ? -10.561 -69.384 -11.025 1.00 72.68 ? 32   ASP B CB  1 
ATOM   1444 C CG  . ASP B 1 31  ? -9.324  -69.611 -10.154 1.00 73.80 ? 32   ASP B CG  1 
ATOM   1445 O OD1 . ASP B 1 31  ? -9.309  -70.598 -9.377  1.00 76.74 ? 32   ASP B OD1 1 
ATOM   1446 O OD2 . ASP B 1 31  ? -8.355  -68.814 -10.262 1.00 76.11 ? 32   ASP B OD2 1 
ATOM   1447 N N   . TYR B 1 32  ? -12.233 -67.180 -9.719  1.00 67.36 ? 33   TYR B N   1 
ATOM   1448 C CA  . TYR B 1 32  ? -12.527 -66.027 -8.838  1.00 64.56 ? 33   TYR B CA  1 
ATOM   1449 C C   . TYR B 1 32  ? -13.632 -66.335 -7.820  1.00 65.12 ? 33   TYR B C   1 
ATOM   1450 O O   . TYR B 1 32  ? -14.637 -66.971 -8.135  1.00 67.07 ? 33   TYR B O   1 
ATOM   1451 C CB  . TYR B 1 32  ? -12.931 -64.779 -9.663  1.00 63.07 ? 33   TYR B CB  1 
ATOM   1452 C CG  . TYR B 1 32  ? -13.469 -63.592 -8.837  1.00 59.22 ? 33   TYR B CG  1 
ATOM   1453 C CD1 . TYR B 1 32  ? -14.802 -63.543 -8.434  1.00 56.56 ? 33   TYR B CD1 1 
ATOM   1454 C CD2 . TYR B 1 32  ? -12.643 -62.517 -8.491  1.00 53.76 ? 33   TYR B CD2 1 
ATOM   1455 C CE1 . TYR B 1 32  ? -15.299 -62.470 -7.690  1.00 54.29 ? 33   TYR B CE1 1 
ATOM   1456 C CE2 . TYR B 1 32  ? -13.125 -61.441 -7.753  1.00 52.04 ? 33   TYR B CE2 1 
ATOM   1457 C CZ  . TYR B 1 32  ? -14.466 -61.421 -7.353  1.00 52.58 ? 33   TYR B CZ  1 
ATOM   1458 O OH  . TYR B 1 32  ? -14.954 -60.363 -6.608  1.00 47.76 ? 33   TYR B OH  1 
ATOM   1459 N N   . CYS B 1 33  ? -13.423 -65.902 -6.588  1.00 63.44 ? 34   CYS B N   1 
ATOM   1460 C CA  . CYS B 1 33  ? -14.507 -65.839 -5.620  1.00 64.31 ? 34   CYS B CA  1 
ATOM   1461 C C   . CYS B 1 33  ? -14.452 -64.513 -4.859  1.00 60.01 ? 34   CYS B C   1 
ATOM   1462 O O   . CYS B 1 33  ? -13.410 -63.850 -4.773  1.00 58.16 ? 34   CYS B O   1 
ATOM   1463 C CB  . CYS B 1 33  ? -14.516 -67.053 -4.673  1.00 66.61 ? 34   CYS B CB  1 
ATOM   1464 S SG  . CYS B 1 33  ? -12.912 -67.394 -3.937  1.00 72.57 ? 34   CYS B SG  1 
ATOM   1465 N N   . THR B 1 34  ? -15.612 -64.110 -4.366  1.00 58.19 ? 35   THR B N   1 
ATOM   1466 C CA  . THR B 1 34  ? -15.770 -62.826 -3.733  1.00 54.89 ? 35   THR B CA  1 
ATOM   1467 C C   . THR B 1 34  ? -15.041 -62.863 -2.404  1.00 52.92 ? 35   THR B C   1 
ATOM   1468 O O   . THR B 1 34  ? -15.384 -63.653 -1.544  1.00 52.50 ? 35   THR B O   1 
ATOM   1469 C CB  . THR B 1 34  ? -17.253 -62.516 -3.471  1.00 55.87 ? 35   THR B CB  1 
ATOM   1470 O OG1 . THR B 1 34  ? -17.980 -62.565 -4.710  1.00 56.26 ? 35   THR B OG1 1 
ATOM   1471 C CG2 . THR B 1 34  ? -17.380 -61.159 -2.824  1.00 53.22 ? 35   THR B CG2 1 
ATOM   1472 N N   . PRO B 1 35  ? -14.051 -61.990 -2.223  1.00 50.63 ? 36   PRO B N   1 
ATOM   1473 C CA  . PRO B 1 35  ? -13.280 -62.041 -0.990  1.00 50.66 ? 36   PRO B CA  1 
ATOM   1474 C C   . PRO B 1 35  ? -14.104 -61.618 0.203   1.00 51.20 ? 36   PRO B C   1 
ATOM   1475 O O   . PRO B 1 35  ? -15.112 -60.905 0.044   1.00 50.92 ? 36   PRO B O   1 
ATOM   1476 C CB  . PRO B 1 35  ? -12.166 -61.028 -1.223  1.00 49.02 ? 36   PRO B CB  1 
ATOM   1477 C CG  . PRO B 1 35  ? -12.189 -60.727 -2.687  1.00 48.50 ? 36   PRO B CG  1 
ATOM   1478 C CD  . PRO B 1 35  ? -13.612 -60.882 -3.078  1.00 49.32 ? 36   PRO B CD  1 
ATOM   1479 N N   . GLY B 1 36  ? -13.682 -62.061 1.386   1.00 51.72 ? 37   GLY B N   1 
ATOM   1480 C CA  . GLY B 1 36  ? -14.329 -61.654 2.632   1.00 51.79 ? 37   GLY B CA  1 
ATOM   1481 C C   . GLY B 1 36  ? -13.980 -60.220 2.985   1.00 51.03 ? 37   GLY B C   1 
ATOM   1482 O O   . GLY B 1 36  ? -13.171 -59.565 2.294   1.00 49.10 ? 37   GLY B O   1 
ATOM   1483 N N   . ALA B 1 37  ? -14.576 -59.735 4.079   1.00 51.85 ? 38   ALA B N   1 
ATOM   1484 C CA  . ALA B 1 37  ? -14.541 -58.303 4.416   1.00 51.04 ? 38   ALA B CA  1 
ATOM   1485 C C   . ALA B 1 37  ? -13.130 -57.811 4.670   1.00 49.57 ? 38   ALA B C   1 
ATOM   1486 O O   . ALA B 1 37  ? -12.723 -56.793 4.112   1.00 50.32 ? 38   ALA B O   1 
ATOM   1487 C CB  . ALA B 1 37  ? -15.435 -57.993 5.621   1.00 52.56 ? 38   ALA B CB  1 
ATOM   1488 N N   . PHE B 1 38  ? -12.376 -58.542 5.473   1.00 49.13 ? 39   PHE B N   1 
ATOM   1489 C CA  . PHE B 1 38  ? -11.026 -58.149 5.811   1.00 47.94 ? 39   PHE B CA  1 
ATOM   1490 C C   . PHE B 1 38  ? -10.202 -57.848 4.573   1.00 46.58 ? 39   PHE B C   1 
ATOM   1491 O O   . PHE B 1 38  ? -9.586  -56.793 4.472   1.00 45.66 ? 39   PHE B O   1 
ATOM   1492 C CB  . PHE B 1 38  ? -10.343 -59.240 6.625   1.00 49.35 ? 39   PHE B CB  1 
ATOM   1493 C CG  . PHE B 1 38  ? -8.961  -58.871 7.078   1.00 48.92 ? 39   PHE B CG  1 
ATOM   1494 C CD1 . PHE B 1 38  ? -8.780  -58.029 8.162   1.00 46.39 ? 39   PHE B CD1 1 
ATOM   1495 C CD2 . PHE B 1 38  ? -7.854  -59.315 6.388   1.00 48.42 ? 39   PHE B CD2 1 
ATOM   1496 C CE1 . PHE B 1 38  ? -7.517  -57.661 8.561   1.00 46.72 ? 39   PHE B CE1 1 
ATOM   1497 C CE2 . PHE B 1 38  ? -6.585  -58.971 6.799   1.00 50.02 ? 39   PHE B CE2 1 
ATOM   1498 C CZ  . PHE B 1 38  ? -6.418  -58.134 7.890   1.00 50.46 ? 39   PHE B CZ  1 
ATOM   1499 N N   . GLU B 1 39  ? -10.226 -58.766 3.616   1.00 46.01 ? 40   GLU B N   1 
ATOM   1500 C CA  . GLU B 1 39  ? -9.466  -58.614 2.398   1.00 45.14 ? 40   GLU B CA  1 
ATOM   1501 C C   . GLU B 1 39  ? -10.008 -57.541 1.466   1.00 43.54 ? 40   GLU B C   1 
ATOM   1502 O O   . GLU B 1 39  ? -9.247  -56.936 0.774   1.00 41.06 ? 40   GLU B O   1 
ATOM   1503 C CB  . GLU B 1 39  ? -9.382  -59.956 1.673   1.00 46.04 ? 40   GLU B CB  1 
ATOM   1504 C CG  . GLU B 1 39  ? -8.521  -60.961 2.447   1.00 50.50 ? 40   GLU B CG  1 
ATOM   1505 C CD  . GLU B 1 39  ? -7.028  -60.553 2.496   1.00 53.52 ? 40   GLU B CD  1 
ATOM   1506 O OE1 . GLU B 1 39  ? -6.569  -59.805 1.571   1.00 53.39 ? 40   GLU B OE1 1 
ATOM   1507 O OE2 . GLU B 1 39  ? -6.323  -60.979 3.456   1.00 54.41 ? 40   GLU B OE2 1 
ATOM   1508 N N   . LEU B 1 40  ? -11.318 -57.318 1.445   1.00 44.37 ? 41   LEU B N   1 
ATOM   1509 C CA  . LEU B 1 40  ? -11.865 -56.194 0.679   1.00 43.92 ? 41   LEU B CA  1 
ATOM   1510 C C   . LEU B 1 40  ? -11.351 -54.897 1.257   1.00 43.44 ? 41   LEU B C   1 
ATOM   1511 O O   . LEU B 1 40  ? -10.961 -54.002 0.516   1.00 42.17 ? 41   LEU B O   1 
ATOM   1512 C CB  . LEU B 1 40  ? -13.398 -56.179 0.695   1.00 44.61 ? 41   LEU B CB  1 
ATOM   1513 C CG  . LEU B 1 40  ? -14.054 -57.298 -0.109  1.00 45.68 ? 41   LEU B CG  1 
ATOM   1514 C CD1 . LEU B 1 40  ? -15.539 -57.390 0.206   1.00 46.44 ? 41   LEU B CD1 1 
ATOM   1515 C CD2 . LEU B 1 40  ? -13.790 -57.147 -1.590  1.00 44.40 ? 41   LEU B CD2 1 
ATOM   1516 N N   . GLU B 1 41  ? -11.349 -54.800 2.586   1.00 43.96 ? 42   GLU B N   1 
ATOM   1517 C CA  . GLU B 1 41  ? -10.850 -53.590 3.224   1.00 44.17 ? 42   GLU B CA  1 
ATOM   1518 C C   . GLU B 1 41  ? -9.348  -53.319 2.963   1.00 42.72 ? 42   GLU B C   1 
ATOM   1519 O O   . GLU B 1 41  ? -8.955  -52.171 2.761   1.00 42.46 ? 42   GLU B O   1 
ATOM   1520 C CB  . GLU B 1 41  ? -11.277 -53.543 4.711   1.00 45.71 ? 42   GLU B CB  1 
ATOM   1521 C CG  . GLU B 1 41  ? -12.657 -52.887 4.803   1.00 49.14 ? 42   GLU B CG  1 
ATOM   1522 C CD  . GLU B 1 41  ? -13.287 -52.941 6.127   1.00 57.89 ? 42   GLU B CD  1 
ATOM   1523 O OE1 . GLU B 1 41  ? -12.549 -53.107 7.132   1.00 66.36 ? 42   GLU B OE1 1 
ATOM   1524 O OE2 . GLU B 1 41  ? -14.538 -52.821 6.176   1.00 62.40 ? 42   GLU B OE2 1 
ATOM   1525 N N   . ARG B 1 42  ? -8.530  -54.363 2.893   1.00 41.46 ? 43   ARG B N   1 
ATOM   1526 C CA  . ARG B 1 42  ? -7.142  -54.206 2.496   1.00 40.71 ? 43   ARG B CA  1 
ATOM   1527 C C   . ARG B 1 42  ? -7.048  -53.557 1.129   1.00 39.29 ? 43   ARG B C   1 
ATOM   1528 O O   . ARG B 1 42  ? -6.159  -52.715 0.888   1.00 37.80 ? 43   ARG B O   1 
ATOM   1529 C CB  . ARG B 1 42  ? -6.404  -55.548 2.472   1.00 41.15 ? 43   ARG B CB  1 
ATOM   1530 C CG  . ARG B 1 42  ? -5.015  -55.500 1.815   1.00 43.90 ? 43   ARG B CG  1 
ATOM   1531 C CD  . ARG B 1 42  ? -4.367  -56.886 1.738   1.00 47.98 ? 43   ARG B CD  1 
ATOM   1532 N NE  . ARG B 1 42  ? -4.028  -57.299 3.089   1.00 55.64 ? 43   ARG B NE  1 
ATOM   1533 C CZ  . ARG B 1 42  ? -3.953  -58.553 3.524   1.00 62.45 ? 43   ARG B CZ  1 
ATOM   1534 N NH1 . ARG B 1 42  ? -4.149  -59.571 2.700   1.00 65.46 ? 43   ARG B NH1 1 
ATOM   1535 N NH2 . ARG B 1 42  ? -3.674  -58.794 4.809   1.00 64.76 ? 43   ARG B NH2 1 
ATOM   1536 N N   . LEU B 1 43  ? -7.935  -53.978 0.229   1.00 38.29 ? 44   LEU B N   1 
ATOM   1537 C CA  . LEU B 1 43  ? -7.993  -53.420 -1.119  1.00 37.70 ? 44   LEU B CA  1 
ATOM   1538 C C   . LEU B 1 43  ? -8.297  -51.923 -1.119  1.00 36.84 ? 44   LEU B C   1 
ATOM   1539 O O   . LEU B 1 43  ? -7.715  -51.169 -1.874  1.00 35.14 ? 44   LEU B O   1 
ATOM   1540 C CB  . LEU B 1 43  ? -9.056  -54.157 -1.922  1.00 38.70 ? 44   LEU B CB  1 
ATOM   1541 C CG  . LEU B 1 43  ? -8.723  -55.275 -2.921  1.00 41.56 ? 44   LEU B CG  1 
ATOM   1542 C CD1 . LEU B 1 43  ? -7.452  -56.037 -2.685  1.00 41.95 ? 44   LEU B CD1 1 
ATOM   1543 C CD2 . LEU B 1 43  ? -9.933  -56.228 -2.950  1.00 44.11 ? 44   LEU B CD2 1 
ATOM   1544 N N   . PHE B 1 44  ? -9.214  -51.479 -0.264  1.00 37.09 ? 45   PHE B N   1 
ATOM   1545 C CA  . PHE B 1 44  ? -9.530  -50.046 -0.202  1.00 37.60 ? 45   PHE B CA  1 
ATOM   1546 C C   . PHE B 1 44  ? -8.351  -49.227 0.289   1.00 38.51 ? 45   PHE B C   1 
ATOM   1547 O O   . PHE B 1 44  ? -8.182  -48.100 -0.119  1.00 38.39 ? 45   PHE B O   1 
ATOM   1548 C CB  . PHE B 1 44  ? -10.771 -49.781 0.663   1.00 38.31 ? 45   PHE B CB  1 
ATOM   1549 C CG  . PHE B 1 44  ? -12.052 -50.182 -0.011  1.00 36.45 ? 45   PHE B CG  1 
ATOM   1550 C CD1 . PHE B 1 44  ? -12.516 -49.475 -1.087  1.00 34.68 ? 45   PHE B CD1 1 
ATOM   1551 C CD2 . PHE B 1 44  ? -12.749 -51.288 0.389   1.00 34.93 ? 45   PHE B CD2 1 
ATOM   1552 C CE1 . PHE B 1 44  ? -13.670 -49.840 -1.703  1.00 35.98 ? 45   PHE B CE1 1 
ATOM   1553 C CE2 . PHE B 1 44  ? -13.927 -51.663 -0.260  1.00 34.33 ? 45   PHE B CE2 1 
ATOM   1554 C CZ  . PHE B 1 44  ? -14.378 -50.945 -1.280  1.00 33.74 ? 45   PHE B CZ  1 
ATOM   1555 N N   . TRP B 1 45  ? -7.529  -49.828 1.136   1.00 39.91 ? 46   TRP B N   1 
ATOM   1556 C CA  . TRP B 1 45  ? -6.444  -49.142 1.821   1.00 41.40 ? 46   TRP B CA  1 
ATOM   1557 C C   . TRP B 1 45  ? -5.129  -49.247 1.098   1.00 42.24 ? 46   TRP B C   1 
ATOM   1558 O O   . TRP B 1 45  ? -4.461  -48.249 0.891   1.00 44.08 ? 46   TRP B O   1 
ATOM   1559 C CB  . TRP B 1 45  ? -6.290  -49.739 3.215   1.00 42.56 ? 46   TRP B CB  1 
ATOM   1560 C CG  . TRP B 1 45  ? -7.244  -49.168 4.224   1.00 42.44 ? 46   TRP B CG  1 
ATOM   1561 C CD1 . TRP B 1 45  ? -8.365  -49.760 4.753   1.00 43.20 ? 46   TRP B CD1 1 
ATOM   1562 C CD2 . TRP B 1 45  ? -7.133  -47.895 4.844   1.00 41.66 ? 46   TRP B CD2 1 
ATOM   1563 N NE1 . TRP B 1 45  ? -8.956  -48.926 5.666   1.00 41.30 ? 46   TRP B NE1 1 
ATOM   1564 C CE2 . TRP B 1 45  ? -8.213  -47.775 5.749   1.00 42.55 ? 46   TRP B CE2 1 
ATOM   1565 C CE3 . TRP B 1 45  ? -6.204  -46.857 4.753   1.00 40.51 ? 46   TRP B CE3 1 
ATOM   1566 C CZ2 . TRP B 1 45  ? -8.402  -46.646 6.529   1.00 42.92 ? 46   TRP B CZ2 1 
ATOM   1567 C CZ3 . TRP B 1 45  ? -6.390  -45.732 5.532   1.00 44.02 ? 46   TRP B CZ3 1 
ATOM   1568 C CH2 . TRP B 1 45  ? -7.489  -45.631 6.406   1.00 43.97 ? 46   TRP B CH2 1 
ATOM   1569 N N   . LYS B 1 46  ? -4.765  -50.458 0.692   1.00 42.17 ? 47   LYS B N   1 
ATOM   1570 C CA  . LYS B 1 46  ? -3.445  -50.743 0.145   1.00 42.13 ? 47   LYS B CA  1 
ATOM   1571 C C   . LYS B 1 46  ? -3.430  -51.181 -1.300  1.00 41.62 ? 47   LYS B C   1 
ATOM   1572 O O   . LYS B 1 46  ? -2.372  -51.325 -1.878  1.00 41.70 ? 47   LYS B O   1 
ATOM   1573 C CB  . LYS B 1 46  ? -2.811  -51.864 0.966   1.00 42.85 ? 47   LYS B CB  1 
ATOM   1574 C CG  . LYS B 1 46  ? -2.675  -51.551 2.477   1.00 43.87 ? 47   LYS B CG  1 
ATOM   1575 C CD  . LYS B 1 46  ? -1.887  -50.252 2.726   1.00 45.93 ? 47   LYS B CD  1 
ATOM   1576 C CE  . LYS B 1 46  ? -0.440  -50.396 2.345   1.00 47.00 ? 47   LYS B CE  1 
ATOM   1577 N NZ  . LYS B 1 46  ? 0.358   -49.160 2.639   1.00 51.43 ? 47   LYS B NZ  1 
ATOM   1578 N N   . GLY B 1 47  ? -4.585  -51.360 -1.909  1.00 42.01 ? 48   GLY B N   1 
ATOM   1579 C CA  . GLY B 1 47  ? -4.638  -51.918 -3.251  1.00 43.02 ? 48   GLY B CA  1 
ATOM   1580 C C   . GLY B 1 47  ? -4.163  -51.021 -4.402  1.00 43.93 ? 48   GLY B C   1 
ATOM   1581 O O   . GLY B 1 47  ? -3.906  -51.513 -5.486  1.00 43.23 ? 48   GLY B O   1 
ATOM   1582 N N   . SER B 1 48  ? -4.033  -49.721 -4.157  1.00 46.15 ? 49   SER B N   1 
ATOM   1583 C CA  . SER B 1 48  ? -3.895  -48.717 -5.225  1.00 47.79 ? 49   SER B CA  1 
ATOM   1584 C C   . SER B 1 48  ? -2.886  -47.671 -4.770  1.00 49.62 ? 49   SER B C   1 
ATOM   1585 O O   . SER B 1 48  ? -3.018  -47.104 -3.670  1.00 52.47 ? 49   SER B O   1 
ATOM   1586 C CB  . SER B 1 48  ? -5.251  -48.025 -5.520  1.00 47.94 ? 49   SER B CB  1 
ATOM   1587 O OG  . SER B 1 48  ? -6.137  -48.887 -6.260  1.00 49.08 ? 49   SER B OG  1 
ATOM   1588 N N   . PRO B 1 49  ? -1.837  -47.450 -5.556  1.00 50.06 ? 50   PRO B N   1 
ATOM   1589 C CA  . PRO B 1 49  ? -1.415  -48.213 -6.720  1.00 49.42 ? 50   PRO B CA  1 
ATOM   1590 C C   . PRO B 1 49  ? -0.929  -49.605 -6.366  1.00 49.43 ? 50   PRO B C   1 
ATOM   1591 O O   . PRO B 1 49  ? -0.289  -49.852 -5.324  1.00 49.25 ? 50   PRO B O   1 
ATOM   1592 C CB  . PRO B 1 49  ? -0.252  -47.410 -7.295  1.00 49.91 ? 50   PRO B CB  1 
ATOM   1593 C CG  . PRO B 1 49  ? -0.086  -46.200 -6.418  1.00 51.58 ? 50   PRO B CG  1 
ATOM   1594 C CD  . PRO B 1 49  ? -0.912  -46.366 -5.197  1.00 51.38 ? 50   PRO B CD  1 
ATOM   1595 N N   . GLN B 1 50  ? -1.206  -50.517 -7.258  1.00 49.43 ? 51   GLN B N   1 
ATOM   1596 C CA  . GLN B 1 50  ? -0.825  -51.900 -7.031  1.00 50.30 ? 51   GLN B CA  1 
ATOM   1597 C C   . GLN B 1 50  ? 0.640   -52.139 -7.393  1.00 49.31 ? 51   GLN B C   1 
ATOM   1598 O O   . GLN B 1 50  ? 1.176   -51.505 -8.302  1.00 49.17 ? 51   GLN B O   1 
ATOM   1599 C CB  . GLN B 1 50  ? -1.726  -52.800 -7.869  1.00 51.73 ? 51   GLN B CB  1 
ATOM   1600 C CG  . GLN B 1 50  ? -1.688  -52.479 -9.330  1.00 53.73 ? 51   GLN B CG  1 
ATOM   1601 C CD  . GLN B 1 50  ? -3.030  -52.641 -10.007 1.00 59.57 ? 51   GLN B CD  1 
ATOM   1602 O OE1 . GLN B 1 50  ? -3.794  -53.578 -9.698  1.00 61.79 ? 51   GLN B OE1 1 
ATOM   1603 N NE2 . GLN B 1 50  ? -3.315  -51.741 -10.980 1.00 62.07 ? 51   GLN B NE2 1 
ATOM   1604 N N   . TYR B 1 51  ? 1.286   -53.016 -6.634  1.00 48.53 ? 52   TYR B N   1 
ATOM   1605 C CA  . TYR B 1 51  ? 2.674   -53.340 -6.833  1.00 47.11 ? 52   TYR B CA  1 
ATOM   1606 C C   . TYR B 1 51  ? 2.768   -54.765 -7.394  1.00 46.75 ? 52   TYR B C   1 
ATOM   1607 O O   . TYR B 1 51  ? 2.645   -55.738 -6.643  1.00 47.98 ? 52   TYR B O   1 
ATOM   1608 C CB  . TYR B 1 51  ? 3.469   -53.219 -5.539  1.00 47.16 ? 52   TYR B CB  1 
ATOM   1609 C CG  . TYR B 1 51  ? 4.914   -53.522 -5.779  1.00 46.33 ? 52   TYR B CG  1 
ATOM   1610 C CD1 . TYR B 1 51  ? 5.371   -54.822 -5.738  1.00 47.55 ? 52   TYR B CD1 1 
ATOM   1611 C CD2 . TYR B 1 51  ? 5.808   -52.523 -6.151  1.00 47.03 ? 52   TYR B CD2 1 
ATOM   1612 C CE1 . TYR B 1 51  ? 6.703   -55.129 -6.005  1.00 48.40 ? 52   TYR B CE1 1 
ATOM   1613 C CE2 . TYR B 1 51  ? 7.148   -52.815 -6.432  1.00 48.12 ? 52   TYR B CE2 1 
ATOM   1614 C CZ  . TYR B 1 51  ? 7.574   -54.139 -6.358  1.00 48.84 ? 52   TYR B CZ  1 
ATOM   1615 O OH  . TYR B 1 51  ? 8.871   -54.504 -6.609  1.00 49.59 ? 52   TYR B OH  1 
ATOM   1616 N N   . THR B 1 52  ? 2.971   -54.880 -8.709  1.00 44.38 ? 53   THR B N   1 
ATOM   1617 C CA  . THR B 1 52  ? 2.909   -56.173 -9.390  1.00 43.05 ? 53   THR B CA  1 
ATOM   1618 C C   . THR B 1 52  ? 3.945   -56.275 -10.523 1.00 41.34 ? 53   THR B C   1 
ATOM   1619 O O   . THR B 1 52  ? 4.678   -55.341 -10.800 1.00 40.09 ? 53   THR B O   1 
ATOM   1620 C CB  . THR B 1 52  ? 1.493   -56.454 -9.959  1.00 43.37 ? 53   THR B CB  1 
ATOM   1621 O OG1 . THR B 1 52  ? 1.124   -55.427 -10.894 1.00 44.92 ? 53   THR B OG1 1 
ATOM   1622 C CG2 . THR B 1 52  ? 0.418   -56.562 -8.837  1.00 43.83 ? 53   THR B CG2 1 
ATOM   1623 N N   . HIS B 1 53  ? 4.006   -57.429 -11.165 1.00 40.00 ? 54   HIS B N   1 
ATOM   1624 C CA  . HIS B 1 53  ? 4.890   -57.613 -12.285 1.00 39.11 ? 54   HIS B CA  1 
ATOM   1625 C C   . HIS B 1 53  ? 4.573   -56.719 -13.482 1.00 37.72 ? 54   HIS B C   1 
ATOM   1626 O O   . HIS B 1 53  ? 5.493   -56.135 -14.052 1.00 36.97 ? 54   HIS B O   1 
ATOM   1627 C CB  . HIS B 1 53  ? 4.953   -59.069 -12.664 1.00 39.74 ? 54   HIS B CB  1 
ATOM   1628 C CG  . HIS B 1 53  ? 5.598   -59.899 -11.615 1.00 41.17 ? 54   HIS B CG  1 
ATOM   1629 N ND1 . HIS B 1 53  ? 6.964   -59.893 -11.407 1.00 42.96 ? 54   HIS B ND1 1 
ATOM   1630 C CD2 . HIS B 1 53  ? 5.071   -60.737 -10.690 1.00 40.06 ? 54   HIS B CD2 1 
ATOM   1631 C CE1 . HIS B 1 53  ? 7.253   -60.708 -10.407 1.00 43.32 ? 54   HIS B CE1 1 
ATOM   1632 N NE2 . HIS B 1 53  ? 6.122   -61.225 -9.949  1.00 42.92 ? 54   HIS B NE2 1 
ATOM   1633 N N   . VAL B 1 54  ? 3.287   -56.577 -13.803 1.00 36.94 ? 55   VAL B N   1 
ATOM   1634 C CA  . VAL B 1 54  ? 2.822   -55.809 -14.949 1.00 35.49 ? 55   VAL B CA  1 
ATOM   1635 C C   . VAL B 1 54  ? 1.537   -55.118 -14.561 1.00 35.92 ? 55   VAL B C   1 
ATOM   1636 O O   . VAL B 1 54  ? 0.842   -55.572 -13.673 1.00 36.62 ? 55   VAL B O   1 
ATOM   1637 C CB  . VAL B 1 54  ? 2.604   -56.753 -16.198 1.00 37.02 ? 55   VAL B CB  1 
ATOM   1638 C CG1 . VAL B 1 54  ? 1.575   -57.905 -15.887 1.00 34.83 ? 55   VAL B CG1 1 
ATOM   1639 C CG2 . VAL B 1 54  ? 2.253   -55.959 -17.473 1.00 33.03 ? 55   VAL B CG2 1 
ATOM   1640 N N   . ASN B 1 55  ? 1.241   -53.984 -15.184 1.00 35.98 ? 56   ASN B N   1 
ATOM   1641 C CA  . ASN B 1 55  ? -0.062  -53.297 -15.043 1.00 35.50 ? 56   ASN B CA  1 
ATOM   1642 C C   . ASN B 1 55  ? -0.380  -52.594 -16.346 1.00 36.13 ? 56   ASN B C   1 
ATOM   1643 O O   . ASN B 1 55  ? 0.536   -52.113 -17.057 1.00 35.47 ? 56   ASN B O   1 
ATOM   1644 C CB  . ASN B 1 55  ? -0.013  -52.189 -13.986 1.00 35.35 ? 56   ASN B CB  1 
ATOM   1645 C CG  . ASN B 1 55  ? 0.477   -52.667 -12.624 1.00 35.83 ? 56   ASN B CG  1 
ATOM   1646 O OD1 . ASN B 1 55  ? 1.631   -52.450 -12.238 1.00 33.51 ? 56   ASN B OD1 1 
ATOM   1647 N ND2 . ASN B 1 55  ? -0.414  -53.304 -11.882 1.00 32.82 ? 56   ASN B ND2 1 
ATOM   1648 N N   . GLU B 1 56  ? -1.664  -52.470 -16.631 1.00 36.52 ? 57   GLU B N   1 
ATOM   1649 C CA  . GLU B 1 56  ? -2.150  -51.623 -17.728 1.00 37.62 ? 57   GLU B CA  1 
ATOM   1650 C C   . GLU B 1 56  ? -2.192  -50.185 -17.225 1.00 37.15 ? 57   GLU B C   1 
ATOM   1651 O O   . GLU B 1 56  ? -2.836  -49.911 -16.213 1.00 37.42 ? 57   GLU B O   1 
ATOM   1652 C CB  . GLU B 1 56  ? -3.571  -52.060 -18.125 1.00 38.70 ? 57   GLU B CB  1 
ATOM   1653 C CG  . GLU B 1 56  ? -4.018  -51.625 -19.502 1.00 41.35 ? 57   GLU B CG  1 
ATOM   1654 C CD  . GLU B 1 56  ? -5.489  -51.992 -19.772 1.00 43.25 ? 57   GLU B CD  1 
ATOM   1655 O OE1 . GLU B 1 56  ? -6.146  -52.448 -18.829 1.00 44.12 ? 57   GLU B OE1 1 
ATOM   1656 O OE2 . GLU B 1 56  ? -5.973  -51.829 -20.907 1.00 43.00 ? 57   GLU B OE2 1 
ATOM   1657 N N   . VAL B 1 57  ? -1.531  -49.266 -17.910 1.00 36.69 ? 58   VAL B N   1 
ATOM   1658 C CA  . VAL B 1 57  ? -1.474  -47.891 -17.426 1.00 36.88 ? 58   VAL B CA  1 
ATOM   1659 C C   . VAL B 1 57  ? -2.269  -46.926 -18.298 1.00 39.18 ? 58   VAL B C   1 
ATOM   1660 O O   . VAL B 1 57  ? -2.429  -45.742 -17.952 1.00 40.31 ? 58   VAL B O   1 
ATOM   1661 C CB  . VAL B 1 57  ? -0.001  -47.426 -17.252 1.00 36.73 ? 58   VAL B CB  1 
ATOM   1662 C CG1 . VAL B 1 57  ? 0.689   -48.353 -16.276 1.00 33.00 ? 58   VAL B CG1 1 
ATOM   1663 C CG2 . VAL B 1 57  ? 0.744   -47.360 -18.630 1.00 34.42 ? 58   VAL B CG2 1 
ATOM   1664 N N   . TRP B 1 58  ? -2.798  -47.453 -19.403 1.00 40.39 ? 59   TRP B N   1 
ATOM   1665 C CA  . TRP B 1 58  ? -3.487  -46.679 -20.431 1.00 41.89 ? 59   TRP B CA  1 
ATOM   1666 C C   . TRP B 1 58  ? -4.078  -47.746 -21.348 1.00 42.59 ? 59   TRP B C   1 
ATOM   1667 O O   . TRP B 1 58  ? -3.538  -48.843 -21.412 1.00 41.73 ? 59   TRP B O   1 
ATOM   1668 C CB  . TRP B 1 58  ? -2.502  -45.769 -21.167 1.00 42.53 ? 59   TRP B CB  1 
ATOM   1669 C CG  . TRP B 1 58  ? -3.107  -44.861 -22.228 1.00 45.62 ? 59   TRP B CG  1 
ATOM   1670 C CD1 . TRP B 1 58  ? -3.062  -45.044 -23.571 1.00 47.50 ? 59   TRP B CD1 1 
ATOM   1671 C CD2 . TRP B 1 58  ? -3.811  -43.635 -22.019 1.00 49.58 ? 59   TRP B CD2 1 
ATOM   1672 N NE1 . TRP B 1 58  ? -3.697  -44.023 -24.213 1.00 49.67 ? 59   TRP B NE1 1 
ATOM   1673 C CE2 . TRP B 1 58  ? -4.162  -43.137 -23.287 1.00 51.22 ? 59   TRP B CE2 1 
ATOM   1674 C CE3 . TRP B 1 58  ? -4.207  -42.922 -20.880 1.00 52.01 ? 59   TRP B CE3 1 
ATOM   1675 C CZ2 . TRP B 1 58  ? -4.882  -41.945 -23.460 1.00 54.69 ? 59   TRP B CZ2 1 
ATOM   1676 C CZ3 . TRP B 1 58  ? -4.919  -41.724 -21.053 1.00 54.75 ? 59   TRP B CZ3 1 
ATOM   1677 C CH2 . TRP B 1 58  ? -5.252  -41.256 -22.331 1.00 54.20 ? 59   TRP B CH2 1 
ATOM   1678 N N   . PRO B 1 59  ? -5.214  -47.468 -22.019 1.00 43.87 ? 60   PRO B N   1 
ATOM   1679 C CA  . PRO B 1 59  ? -5.852  -48.616 -22.656 1.00 44.23 ? 60   PRO B CA  1 
ATOM   1680 C C   . PRO B 1 59  ? -4.958  -49.324 -23.667 1.00 43.69 ? 60   PRO B C   1 
ATOM   1681 O O   . PRO B 1 59  ? -4.406  -48.698 -24.574 1.00 42.81 ? 60   PRO B O   1 
ATOM   1682 C CB  . PRO B 1 59  ? -7.112  -48.005 -23.322 1.00 46.03 ? 60   PRO B CB  1 
ATOM   1683 C CG  . PRO B 1 59  ? -7.465  -46.878 -22.422 1.00 46.25 ? 60   PRO B CG  1 
ATOM   1684 C CD  . PRO B 1 59  ? -6.101  -46.290 -22.024 1.00 45.68 ? 60   PRO B CD  1 
ATOM   1685 N N   . LYS B 1 60  ? -4.810  -50.629 -23.460 1.00 43.34 ? 61   LYS B N   1 
ATOM   1686 C CA  . LYS B 1 60  ? -3.985  -51.498 -24.304 1.00 43.84 ? 61   LYS B CA  1 
ATOM   1687 C C   . LYS B 1 60  ? -2.473  -51.288 -24.168 1.00 41.25 ? 61   LYS B C   1 
ATOM   1688 O O   . LYS B 1 60  ? -1.713  -51.881 -24.934 1.00 42.69 ? 61   LYS B O   1 
ATOM   1689 C CB  . LYS B 1 60  ? -4.388  -51.408 -25.786 1.00 45.82 ? 61   LYS B CB  1 
ATOM   1690 C CG  . LYS B 1 60  ? -5.932  -51.487 -26.092 1.00 51.40 ? 61   LYS B CG  1 
ATOM   1691 C CD  . LYS B 1 60  ? -6.641  -52.733 -25.537 1.00 56.20 ? 61   LYS B CD  1 
ATOM   1692 C CE  . LYS B 1 60  ? -6.268  -54.012 -26.322 1.00 60.61 ? 61   LYS B CE  1 
ATOM   1693 N NZ  . LYS B 1 60  ? -6.964  -54.206 -27.670 1.00 64.27 ? 61   LYS B NZ  1 
ATOM   1694 N N   . LEU B 1 61  ? -2.052  -50.483 -23.198 1.00 38.81 ? 62   LEU B N   1 
ATOM   1695 C CA  . LEU B 1 61  ? -0.654  -50.128 -22.958 1.00 37.05 ? 62   LEU B CA  1 
ATOM   1696 C C   . LEU B 1 61  ? -0.262  -50.580 -21.547 1.00 35.85 ? 62   LEU B C   1 
ATOM   1697 O O   . LEU B 1 61  ? -0.770  -50.057 -20.538 1.00 35.12 ? 62   LEU B O   1 
ATOM   1698 C CB  . LEU B 1 61  ? -0.462  -48.619 -23.109 1.00 37.10 ? 62   LEU B CB  1 
ATOM   1699 C CG  . LEU B 1 61  ? 0.917   -48.049 -23.432 1.00 36.11 ? 62   LEU B CG  1 
ATOM   1700 C CD1 . LEU B 1 61  ? 0.901   -46.521 -23.376 1.00 34.16 ? 62   LEU B CD1 1 
ATOM   1701 C CD2 . LEU B 1 61  ? 1.922   -48.590 -22.466 1.00 36.08 ? 62   LEU B CD2 1 
ATOM   1702 N N   . TYR B 1 62  ? 0.630   -51.568 -21.496 1.00 35.18 ? 63   TYR B N   1 
ATOM   1703 C CA  . TYR B 1 62  ? 1.074   -52.177 -20.263 1.00 34.69 ? 63   TYR B CA  1 
ATOM   1704 C C   . TYR B 1 62  ? 2.539   -51.877 -20.008 1.00 34.38 ? 63   TYR B C   1 
ATOM   1705 O O   . TYR B 1 62  ? 3.350   -51.779 -20.939 1.00 33.74 ? 63   TYR B O   1 
ATOM   1706 C CB  . TYR B 1 62  ? 0.900   -53.681 -20.313 1.00 35.17 ? 63   TYR B CB  1 
ATOM   1707 C CG  . TYR B 1 62  ? -0.532  -54.143 -20.363 1.00 36.98 ? 63   TYR B CG  1 
ATOM   1708 C CD1 . TYR B 1 62  ? -1.301  -53.930 -21.489 1.00 38.35 ? 63   TYR B CD1 1 
ATOM   1709 C CD2 . TYR B 1 62  ? -1.114  -54.826 -19.280 1.00 39.26 ? 63   TYR B CD2 1 
ATOM   1710 C CE1 . TYR B 1 62  ? -2.625  -54.369 -21.561 1.00 40.57 ? 63   TYR B CE1 1 
ATOM   1711 C CE2 . TYR B 1 62  ? -2.447  -55.255 -19.334 1.00 40.43 ? 63   TYR B CE2 1 
ATOM   1712 C CZ  . TYR B 1 62  ? -3.186  -55.023 -20.483 1.00 41.95 ? 63   TYR B CZ  1 
ATOM   1713 O OH  . TYR B 1 62  ? -4.485  -55.430 -20.585 1.00 45.51 ? 63   TYR B OH  1 
ATOM   1714 N N   . ILE B 1 63  ? 2.856   -51.693 -18.735 1.00 33.41 ? 64   ILE B N   1 
ATOM   1715 C CA  . ILE B 1 63  ? 4.207   -51.550 -18.295 1.00 32.97 ? 64   ILE B CA  1 
ATOM   1716 C C   . ILE B 1 63  ? 4.473   -52.738 -17.362 1.00 34.43 ? 64   ILE B C   1 
ATOM   1717 O O   . ILE B 1 63  ? 3.675   -53.045 -16.466 1.00 34.05 ? 64   ILE B O   1 
ATOM   1718 C CB  . ILE B 1 63  ? 4.443   -50.257 -17.525 1.00 32.32 ? 64   ILE B CB  1 
ATOM   1719 C CG1 . ILE B 1 63  ? 4.135   -49.056 -18.383 1.00 30.59 ? 64   ILE B CG1 1 
ATOM   1720 C CG2 . ILE B 1 63  ? 5.902   -50.176 -17.064 1.00 30.38 ? 64   ILE B CG2 1 
ATOM   1721 C CD1 . ILE B 1 63  ? 4.602   -47.770 -17.774 1.00 26.95 ? 64   ILE B CD1 1 
ATOM   1722 N N   . GLY B 1 64  ? 5.598   -53.410 -17.577 1.00 35.61 ? 65   GLY B N   1 
ATOM   1723 C CA  . GLY B 1 64  ? 5.935   -54.571 -16.752 1.00 35.82 ? 65   GLY B CA  1 
ATOM   1724 C C   . GLY B 1 64  ? 7.406   -54.812 -16.661 1.00 35.64 ? 65   GLY B C   1 
ATOM   1725 O O   . GLY B 1 64  ? 8.200   -54.063 -17.199 1.00 35.70 ? 65   GLY B O   1 
ATOM   1726 N N   . ASP B 1 65  ? 7.759   -55.894 -16.001 1.00 36.38 ? 66   ASP B N   1 
ATOM   1727 C CA  . ASP B 1 65  ? 9.123   -56.176 -15.708 1.00 37.59 ? 66   ASP B CA  1 
ATOM   1728 C C   . ASP B 1 65  ? 9.570   -57.242 -16.665 1.00 38.56 ? 66   ASP B C   1 
ATOM   1729 O O   . ASP B 1 65  ? 8.887   -57.498 -17.624 1.00 38.93 ? 66   ASP B O   1 
ATOM   1730 C CB  . ASP B 1 65  ? 9.295   -56.547 -14.230 1.00 37.59 ? 66   ASP B CB  1 
ATOM   1731 C CG  . ASP B 1 65  ? 8.537   -57.788 -13.832 1.00 40.12 ? 66   ASP B CG  1 
ATOM   1732 O OD1 . ASP B 1 65  ? 7.999   -58.499 -14.701 1.00 43.17 ? 66   ASP B OD1 1 
ATOM   1733 O OD2 . ASP B 1 65  ? 8.456   -58.040 -12.616 1.00 46.37 ? 66   ASP B OD2 1 
ATOM   1734 N N   . GLU B 1 66  ? 10.720  -57.846 -16.405 1.00 40.73 ? 67   GLU B N   1 
ATOM   1735 C CA  . GLU B 1 66  ? 11.365  -58.720 -17.351 1.00 42.74 ? 67   GLU B CA  1 
ATOM   1736 C C   . GLU B 1 66  ? 10.713  -60.077 -17.383 1.00 43.70 ? 67   GLU B C   1 
ATOM   1737 O O   . GLU B 1 66  ? 10.467  -60.626 -18.452 1.00 45.42 ? 67   GLU B O   1 
ATOM   1738 C CB  . GLU B 1 66  ? 12.846  -58.865 -17.022 1.00 43.85 ? 67   GLU B CB  1 
ATOM   1739 C CG  . GLU B 1 66  ? 13.593  -59.497 -18.166 1.00 48.05 ? 67   GLU B CG  1 
ATOM   1740 C CD  . GLU B 1 66  ? 15.065  -59.220 -18.113 1.00 51.60 ? 67   GLU B CD  1 
ATOM   1741 O OE1 . GLU B 1 66  ? 15.664  -59.415 -17.031 1.00 57.32 ? 67   GLU B OE1 1 
ATOM   1742 O OE2 . GLU B 1 66  ? 15.603  -58.787 -19.149 1.00 52.56 ? 67   GLU B OE2 1 
ATOM   1743 N N   . ALA B 1 67  ? 10.406  -60.609 -16.217 1.00 44.07 ? 68   ALA B N   1 
ATOM   1744 C CA  . ALA B 1 67  ? 9.634   -61.831 -16.135 1.00 44.99 ? 68   ALA B CA  1 
ATOM   1745 C C   . ALA B 1 67  ? 8.388   -61.781 -17.046 1.00 44.57 ? 68   ALA B C   1 
ATOM   1746 O O   . ALA B 1 67  ? 8.122   -62.720 -17.786 1.00 46.26 ? 68   ALA B O   1 
ATOM   1747 C CB  . ALA B 1 67  ? 9.255   -62.127 -14.689 1.00 44.36 ? 68   ALA B CB  1 
ATOM   1748 N N   . THR B 1 68  ? 7.666   -60.678 -17.045 1.00 42.82 ? 69   THR B N   1 
ATOM   1749 C CA  . THR B 1 68  ? 6.482   -60.554 -17.912 1.00 42.79 ? 69   THR B CA  1 
ATOM   1750 C C   . THR B 1 68  ? 6.839   -60.593 -19.415 1.00 43.43 ? 69   THR B C   1 
ATOM   1751 O O   . THR B 1 68  ? 6.102   -61.159 -20.210 1.00 44.83 ? 69   THR B O   1 
ATOM   1752 C CB  . THR B 1 68  ? 5.740   -59.223 -17.633 1.00 41.73 ? 69   THR B CB  1 
ATOM   1753 O OG1 . THR B 1 68  ? 5.530   -59.063 -16.225 1.00 41.39 ? 69   THR B OG1 1 
ATOM   1754 C CG2 . THR B 1 68  ? 4.450   -59.130 -18.387 1.00 40.21 ? 69   THR B CG2 1 
ATOM   1755 N N   . ALA B 1 69  ? 7.960   -59.991 -19.800 1.00 42.81 ? 70   ALA B N   1 
ATOM   1756 C CA  . ALA B 1 69  ? 8.377   -59.944 -21.216 1.00 43.30 ? 70   ALA B CA  1 
ATOM   1757 C C   . ALA B 1 69  ? 8.879   -61.293 -21.728 1.00 44.78 ? 70   ALA B C   1 
ATOM   1758 O O   . ALA B 1 69  ? 8.796   -61.597 -22.905 1.00 44.91 ? 70   ALA B O   1 
ATOM   1759 C CB  . ALA B 1 69  ? 9.487   -58.864 -21.419 1.00 41.59 ? 70   ALA B CB  1 
ATOM   1760 N N   . LEU B 1 70  ? 9.417   -62.093 -20.824 1.00 46.49 ? 71   LEU B N   1 
ATOM   1761 C CA  . LEU B 1 70  ? 10.083  -63.344 -21.180 1.00 48.35 ? 71   LEU B CA  1 
ATOM   1762 C C   . LEU B 1 70  ? 9.059   -64.493 -21.170 1.00 50.10 ? 71   LEU B C   1 
ATOM   1763 O O   . LEU B 1 70  ? 9.291   -65.560 -21.715 1.00 51.88 ? 71   LEU B O   1 
ATOM   1764 C CB  . LEU B 1 70  ? 11.221  -63.606 -20.173 1.00 48.01 ? 71   LEU B CB  1 
ATOM   1765 C CG  . LEU B 1 70  ? 12.681  -63.204 -20.430 1.00 49.33 ? 71   LEU B CG  1 
ATOM   1766 C CD1 . LEU B 1 70  ? 12.910  -62.136 -21.522 1.00 49.34 ? 71   LEU B CD1 1 
ATOM   1767 C CD2 . LEU B 1 70  ? 13.415  -62.851 -19.127 1.00 46.13 ? 71   LEU B CD2 1 
ATOM   1768 N N   . ASP B 1 71  ? 7.916   -64.269 -20.551 1.00 50.52 ? 72   ASP B N   1 
ATOM   1769 C CA  . ASP B 1 71  ? 6.919   -65.319 -20.443 1.00 53.18 ? 72   ASP B CA  1 
ATOM   1770 C C   . ASP B 1 71  ? 6.002   -65.257 -21.655 1.00 53.40 ? 72   ASP B C   1 
ATOM   1771 O O   . ASP B 1 71  ? 4.879   -64.751 -21.614 1.00 52.27 ? 72   ASP B O   1 
ATOM   1772 C CB  . ASP B 1 71  ? 6.150   -65.208 -19.127 1.00 53.32 ? 72   ASP B CB  1 
ATOM   1773 C CG  . ASP B 1 71  ? 5.670   -66.541 -18.648 1.00 59.35 ? 72   ASP B CG  1 
ATOM   1774 O OD1 . ASP B 1 71  ? 5.143   -67.299 -19.510 1.00 64.08 ? 72   ASP B OD1 1 
ATOM   1775 O OD2 . ASP B 1 71  ? 5.832   -66.841 -17.427 1.00 64.81 ? 72   ASP B OD2 1 
ATOM   1776 N N   . ARG B 1 72  ? 6.511   -65.786 -22.751 1.00 55.05 ? 73   ARG B N   1 
ATOM   1777 C CA  . ARG B 1 72  ? 5.916   -65.514 -24.046 1.00 56.14 ? 73   ARG B CA  1 
ATOM   1778 C C   . ARG B 1 72  ? 4.609   -66.251 -24.271 1.00 58.39 ? 73   ARG B C   1 
ATOM   1779 O O   . ARG B 1 72  ? 3.750   -65.758 -24.997 1.00 58.74 ? 73   ARG B O   1 
ATOM   1780 C CB  . ARG B 1 72  ? 6.912   -65.763 -25.180 1.00 56.76 ? 73   ARG B CB  1 
ATOM   1781 C CG  . ARG B 1 72  ? 7.519   -67.113 -25.175 1.00 57.40 ? 73   ARG B CG  1 
ATOM   1782 C CD  . ARG B 1 72  ? 8.404   -67.296 -26.347 1.00 56.68 ? 73   ARG B CD  1 
ATOM   1783 N NE  . ARG B 1 72  ? 8.830   -68.681 -26.337 1.00 58.32 ? 73   ARG B NE  1 
ATOM   1784 C CZ  . ARG B 1 72  ? 9.596   -69.242 -27.250 1.00 57.51 ? 73   ARG B CZ  1 
ATOM   1785 N NH1 . ARG B 1 72  ? 10.059  -68.544 -28.285 1.00 57.56 ? 73   ARG B NH1 1 
ATOM   1786 N NH2 . ARG B 1 72  ? 9.900   -70.515 -27.109 1.00 60.33 ? 73   ARG B NH2 1 
ATOM   1787 N N   . TYR B 1 73  ? 4.436   -67.404 -23.637 1.00 60.69 ? 74   TYR B N   1 
ATOM   1788 C CA  . TYR B 1 73  ? 3.139   -68.082 -23.695 1.00 63.30 ? 74   TYR B CA  1 
ATOM   1789 C C   . TYR B 1 73  ? 2.054   -67.194 -23.060 1.00 62.34 ? 74   TYR B C   1 
ATOM   1790 O O   . TYR B 1 73  ? 0.994   -67.010 -23.654 1.00 63.00 ? 74   TYR B O   1 
ATOM   1791 C CB  . TYR B 1 73  ? 3.189   -69.479 -23.045 1.00 65.42 ? 74   TYR B CB  1 
ATOM   1792 N N   . ARG B 1 74  ? 2.326   -66.609 -21.891 1.00 61.21 ? 75   ARG B N   1 
ATOM   1793 C CA  . ARG B 1 74  ? 1.373   -65.637 -21.280 1.00 60.78 ? 75   ARG B CA  1 
ATOM   1794 C C   . ARG B 1 74  ? 1.082   -64.433 -22.199 1.00 59.02 ? 75   ARG B C   1 
ATOM   1795 O O   . ARG B 1 74  ? -0.089  -64.027 -22.336 1.00 58.90 ? 75   ARG B O   1 
ATOM   1796 C CB  . ARG B 1 74  ? 1.865   -65.086 -19.933 1.00 60.17 ? 75   ARG B CB  1 
ATOM   1797 C CG  . ARG B 1 74  ? 2.261   -66.115 -18.864 1.00 64.97 ? 75   ARG B CG  1 
ATOM   1798 C CD  . ARG B 1 74  ? 1.137   -66.378 -17.846 1.00 70.08 ? 75   ARG B CD  1 
ATOM   1799 N NE  . ARG B 1 74  ? 1.151   -67.770 -17.383 1.00 76.16 ? 75   ARG B NE  1 
ATOM   1800 C CZ  . ARG B 1 74  ? 0.353   -68.276 -16.441 1.00 80.48 ? 75   ARG B CZ  1 
ATOM   1801 N NH1 . ARG B 1 74  ? -0.544  -67.513 -15.807 1.00 80.59 ? 75   ARG B NH1 1 
ATOM   1802 N NH2 . ARG B 1 74  ? 0.457   -69.566 -16.129 1.00 83.36 ? 75   ARG B NH2 1 
ATOM   1803 N N   . LEU B 1 75  ? 2.136   -63.864 -22.814 1.00 57.05 ? 76   LEU B N   1 
ATOM   1804 C CA  . LEU B 1 75  ? 1.964   -62.717 -23.717 1.00 55.81 ? 76   LEU B CA  1 
ATOM   1805 C C   . LEU B 1 75  ? 1.047   -63.064 -24.889 1.00 56.92 ? 76   LEU B C   1 
ATOM   1806 O O   . LEU B 1 75  ? 0.177   -62.287 -25.268 1.00 56.05 ? 76   LEU B O   1 
ATOM   1807 C CB  . LEU B 1 75  ? 3.311   -62.196 -24.261 1.00 55.08 ? 76   LEU B CB  1 
ATOM   1808 C CG  . LEU B 1 75  ? 4.272   -61.444 -23.324 1.00 53.43 ? 76   LEU B CG  1 
ATOM   1809 C CD1 . LEU B 1 75  ? 5.390   -60.839 -24.155 1.00 51.79 ? 76   LEU B CD1 1 
ATOM   1810 C CD2 . LEU B 1 75  ? 3.576   -60.370 -22.463 1.00 51.03 ? 76   LEU B CD2 1 
ATOM   1811 N N   . GLN B 1 76  ? 1.240   -64.240 -25.462 1.00 58.84 ? 77   GLN B N   1 
ATOM   1812 C CA  . GLN B 1 76  ? 0.460   -64.621 -26.618 1.00 61.17 ? 77   GLN B CA  1 
ATOM   1813 C C   . GLN B 1 76  ? -0.992  -64.896 -26.216 1.00 62.13 ? 77   GLN B C   1 
ATOM   1814 O O   . GLN B 1 76  ? -1.910  -64.439 -26.886 1.00 62.77 ? 77   GLN B O   1 
ATOM   1815 C CB  . GLN B 1 76  ? 1.083   -65.820 -27.312 1.00 63.34 ? 77   GLN B CB  1 
ATOM   1816 C CG  . GLN B 1 76  ? 0.353   -66.256 -28.586 1.00 66.85 ? 77   GLN B CG  1 
ATOM   1817 C CD  . GLN B 1 76  ? 0.428   -67.748 -28.790 1.00 71.19 ? 77   GLN B CD  1 
ATOM   1818 O OE1 . GLN B 1 76  ? 0.101   -68.531 -27.890 1.00 73.06 ? 77   GLN B OE1 1 
ATOM   1819 N NE2 . GLN B 1 76  ? 0.859   -68.158 -29.975 1.00 73.99 ? 77   GLN B NE2 1 
ATOM   1820 N N   . LYS B 1 77  ? -1.201  -65.608 -25.112 1.00 62.18 ? 78   LYS B N   1 
ATOM   1821 C CA  . LYS B 1 77  ? -2.557  -65.862 -24.637 1.00 63.35 ? 78   LYS B CA  1 
ATOM   1822 C C   . LYS B 1 77  ? -3.225  -64.562 -24.187 1.00 61.03 ? 78   LYS B C   1 
ATOM   1823 O O   . LYS B 1 77  ? -4.423  -64.393 -24.390 1.00 61.94 ? 78   LYS B O   1 
ATOM   1824 C CB  . LYS B 1 77  ? -2.574  -66.919 -23.514 1.00 64.62 ? 78   LYS B CB  1 
ATOM   1825 C CG  . LYS B 1 77  ? -2.076  -68.320 -23.962 1.00 68.64 ? 78   LYS B CG  1 
ATOM   1826 C CD  . LYS B 1 77  ? -3.209  -69.236 -24.471 1.00 74.47 ? 78   LYS B CD  1 
ATOM   1827 C CE  . LYS B 1 77  ? -2.683  -70.348 -25.402 1.00 77.82 ? 78   LYS B CE  1 
ATOM   1828 N NZ  . LYS B 1 77  ? -3.717  -71.380 -25.706 1.00 81.89 ? 78   LYS B NZ  1 
ATOM   1829 N N   . ALA B 1 78  ? -2.451  -63.624 -23.625 1.00 57.89 ? 79   ALA B N   1 
ATOM   1830 C CA  . ALA B 1 78  ? -3.006  -62.313 -23.265 1.00 55.53 ? 79   ALA B CA  1 
ATOM   1831 C C   . ALA B 1 78  ? -3.280  -61.421 -24.480 1.00 54.75 ? 79   ALA B C   1 
ATOM   1832 O O   . ALA B 1 78  ? -3.748  -60.303 -24.328 1.00 54.01 ? 79   ALA B O   1 
ATOM   1833 C CB  . ALA B 1 78  ? -2.112  -61.603 -22.251 1.00 53.49 ? 79   ALA B CB  1 
ATOM   1834 N N   . GLY B 1 79  ? -3.006  -61.919 -25.679 1.00 55.28 ? 80   GLY B N   1 
ATOM   1835 C CA  . GLY B 1 79  ? -3.249  -61.179 -26.912 1.00 55.22 ? 80   GLY B CA  1 
ATOM   1836 C C   . GLY B 1 79  ? -2.238  -60.092 -27.254 1.00 53.00 ? 80   GLY B C   1 
ATOM   1837 O O   . GLY B 1 79  ? -2.513  -59.256 -28.096 1.00 53.64 ? 80   GLY B O   1 
ATOM   1838 N N   . PHE B 1 80  ? -1.069  -60.099 -26.625 1.00 50.52 ? 81   PHE B N   1 
ATOM   1839 C CA  . PHE B 1 80  ? -0.055  -59.081 -26.912 1.00 48.78 ? 81   PHE B CA  1 
ATOM   1840 C C   . PHE B 1 80  ? 0.486   -59.127 -28.338 1.00 49.09 ? 81   PHE B C   1 
ATOM   1841 O O   . PHE B 1 80  ? 0.656   -60.177 -28.958 1.00 50.18 ? 81   PHE B O   1 
ATOM   1842 C CB  . PHE B 1 80  ? 1.116   -59.126 -25.918 1.00 47.11 ? 81   PHE B CB  1 
ATOM   1843 C CG  . PHE B 1 80  ? 0.820   -58.472 -24.612 1.00 45.07 ? 81   PHE B CG  1 
ATOM   1844 C CD1 . PHE B 1 80  ? 1.048   -57.122 -24.436 1.00 44.48 ? 81   PHE B CD1 1 
ATOM   1845 C CD2 . PHE B 1 80  ? 0.324   -59.202 -23.559 1.00 47.40 ? 81   PHE B CD2 1 
ATOM   1846 C CE1 . PHE B 1 80  ? 0.788   -56.498 -23.224 1.00 43.58 ? 81   PHE B CE1 1 
ATOM   1847 C CE2 . PHE B 1 80  ? 0.053   -58.593 -22.327 1.00 46.22 ? 81   PHE B CE2 1 
ATOM   1848 C CZ  . PHE B 1 80  ? 0.286   -57.231 -22.163 1.00 44.71 ? 81   PHE B CZ  1 
ATOM   1849 N N   . THR B 1 81  ? 0.804   -57.939 -28.814 1.00 47.89 ? 82   THR B N   1 
ATOM   1850 C CA  . THR B 1 81  ? 1.021   -57.678 -30.219 1.00 48.07 ? 82   THR B CA  1 
ATOM   1851 C C   . THR B 1 81  ? 2.386   -56.979 -30.430 1.00 46.77 ? 82   THR B C   1 
ATOM   1852 O O   . THR B 1 81  ? 2.970   -57.015 -31.510 1.00 49.07 ? 82   THR B O   1 
ATOM   1853 C CB  . THR B 1 81  ? -0.187  -56.831 -30.628 1.00 48.47 ? 82   THR B CB  1 
ATOM   1854 O OG1 . THR B 1 81  ? -0.889  -57.435 -31.710 1.00 52.73 ? 82   THR B OG1 1 
ATOM   1855 C CG2 . THR B 1 81  ? 0.133   -55.443 -30.894 1.00 46.04 ? 82   THR B CG2 1 
ATOM   1856 N N   . HIS B 1 82  ? 2.899   -56.364 -29.378 1.00 44.30 ? 83   HIS B N   1 
ATOM   1857 C CA  . HIS B 1 82  ? 4.056   -55.487 -29.440 1.00 42.61 ? 83   HIS B CA  1 
ATOM   1858 C C   . HIS B 1 82  ? 4.775   -55.567 -28.084 1.00 40.06 ? 83   HIS B C   1 
ATOM   1859 O O   . HIS B 1 82  ? 4.132   -55.474 -27.047 1.00 38.51 ? 83   HIS B O   1 
ATOM   1860 C CB  . HIS B 1 82  ? 3.610   -54.022 -29.658 1.00 42.49 ? 83   HIS B CB  1 
ATOM   1861 C CG  . HIS B 1 82  ? 3.055   -53.738 -31.023 1.00 42.79 ? 83   HIS B CG  1 
ATOM   1862 N ND1 . HIS B 1 82  ? 1.728   -53.931 -31.343 1.00 42.74 ? 83   HIS B ND1 1 
ATOM   1863 C CD2 . HIS B 1 82  ? 3.639   -53.229 -32.136 1.00 40.96 ? 83   HIS B CD2 1 
ATOM   1864 C CE1 . HIS B 1 82  ? 1.529   -53.604 -32.610 1.00 43.67 ? 83   HIS B CE1 1 
ATOM   1865 N NE2 . HIS B 1 82  ? 2.670   -53.166 -33.112 1.00 42.05 ? 83   HIS B NE2 1 
ATOM   1866 N N   . VAL B 1 83  ? 6.093   -55.717 -28.112 1.00 38.84 ? 84   VAL B N   1 
ATOM   1867 C CA  . VAL B 1 83  ? 6.940   -55.510 -26.947 1.00 37.37 ? 84   VAL B CA  1 
ATOM   1868 C C   . VAL B 1 83  ? 8.022   -54.471 -27.255 1.00 37.13 ? 84   VAL B C   1 
ATOM   1869 O O   . VAL B 1 83  ? 8.742   -54.599 -28.234 1.00 37.36 ? 84   VAL B O   1 
ATOM   1870 C CB  . VAL B 1 83  ? 7.637   -56.790 -26.571 1.00 37.95 ? 84   VAL B CB  1 
ATOM   1871 C CG1 . VAL B 1 83  ? 8.725   -56.537 -25.484 1.00 35.58 ? 84   VAL B CG1 1 
ATOM   1872 C CG2 . VAL B 1 83  ? 6.595   -57.842 -26.145 1.00 38.36 ? 84   VAL B CG2 1 
ATOM   1873 N N   . LEU B 1 84  ? 8.102   -53.450 -26.410 1.00 36.79 ? 85   LEU B N   1 
ATOM   1874 C CA  . LEU B 1 84  ? 9.133   -52.446 -26.415 1.00 36.40 ? 85   LEU B CA  1 
ATOM   1875 C C   . LEU B 1 84  ? 10.006  -52.644 -25.178 1.00 36.97 ? 85   LEU B C   1 
ATOM   1876 O O   . LEU B 1 84  ? 9.554   -52.460 -24.045 1.00 37.72 ? 85   LEU B O   1 
ATOM   1877 C CB  . LEU B 1 84  ? 8.506   -51.058 -26.406 1.00 35.94 ? 85   LEU B CB  1 
ATOM   1878 C CG  . LEU B 1 84  ? 9.438   -49.841 -26.339 1.00 35.08 ? 85   LEU B CG  1 
ATOM   1879 C CD1 . LEU B 1 84  ? 10.455  -49.913 -27.429 1.00 36.03 ? 85   LEU B CD1 1 
ATOM   1880 C CD2 . LEU B 1 84  ? 8.622   -48.547 -26.439 1.00 34.26 ? 85   LEU B CD2 1 
ATOM   1881 N N   . ASN B 1 85  ? 11.246  -53.061 -25.400 1.00 38.46 ? 86   ASN B N   1 
ATOM   1882 C CA  . ASN B 1 85  ? 12.198  -53.343 -24.332 1.00 39.53 ? 86   ASN B CA  1 
ATOM   1883 C C   . ASN B 1 85  ? 13.080  -52.132 -24.212 1.00 40.41 ? 86   ASN B C   1 
ATOM   1884 O O   . ASN B 1 85  ? 13.886  -51.894 -25.080 1.00 41.35 ? 86   ASN B O   1 
ATOM   1885 C CB  . ASN B 1 85  ? 13.053  -54.579 -24.673 1.00 40.24 ? 86   ASN B CB  1 
ATOM   1886 C CG  . ASN B 1 85  ? 13.984  -55.016 -23.525 1.00 40.57 ? 86   ASN B CG  1 
ATOM   1887 O OD1 . ASN B 1 85  ? 14.060  -54.375 -22.497 1.00 42.95 ? 86   ASN B OD1 1 
ATOM   1888 N ND2 . ASN B 1 85  ? 14.666  -56.130 -23.710 1.00 40.32 ? 86   ASN B ND2 1 
ATOM   1889 N N   . ALA B 1 86  ? 12.872  -51.360 -23.157 1.00 41.78 ? 87   ALA B N   1 
ATOM   1890 C CA  . ALA B 1 86  ? 13.703  -50.239 -22.792 1.00 44.04 ? 87   ALA B CA  1 
ATOM   1891 C C   . ALA B 1 86  ? 15.016  -50.683 -22.110 1.00 46.47 ? 87   ALA B C   1 
ATOM   1892 O O   . ALA B 1 86  ? 15.734  -49.851 -21.596 1.00 47.04 ? 87   ALA B O   1 
ATOM   1893 C CB  . ALA B 1 86  ? 12.913  -49.283 -21.861 1.00 42.96 ? 87   ALA B CB  1 
ATOM   1894 N N   . ALA B 1 87  ? 15.302  -51.981 -22.068 1.00 49.37 ? 88   ALA B N   1 
ATOM   1895 C CA  . ALA B 1 87  ? 16.571  -52.500 -21.543 1.00 52.75 ? 88   ALA B CA  1 
ATOM   1896 C C   . ALA B 1 87  ? 17.152  -53.585 -22.469 1.00 55.60 ? 88   ALA B C   1 
ATOM   1897 O O   . ALA B 1 87  ? 17.653  -54.622 -22.000 1.00 56.50 ? 88   ALA B O   1 
ATOM   1898 C CB  . ALA B 1 87  ? 16.355  -53.073 -20.150 1.00 52.44 ? 88   ALA B CB  1 
ATOM   1899 N N   . HIS B 1 88  ? 17.065  -53.371 -23.781 1.00 58.36 ? 89   HIS B N   1 
ATOM   1900 C CA  . HIS B 1 88  ? 17.563  -54.369 -24.756 1.00 60.99 ? 89   HIS B CA  1 
ATOM   1901 C C   . HIS B 1 88  ? 18.941  -54.911 -24.326 1.00 62.01 ? 89   HIS B C   1 
ATOM   1902 O O   . HIS B 1 88  ? 19.217  -56.106 -24.473 1.00 63.87 ? 89   HIS B O   1 
ATOM   1903 C CB  . HIS B 1 88  ? 17.655  -53.742 -26.154 1.00 61.88 ? 89   HIS B CB  1 
ATOM   1904 C CG  . HIS B 1 88  ? 17.837  -54.727 -27.271 1.00 65.54 ? 89   HIS B CG  1 
ATOM   1905 N ND1 . HIS B 1 88  ? 17.105  -55.895 -27.366 1.00 68.61 ? 89   HIS B ND1 1 
ATOM   1906 C CD2 . HIS B 1 88  ? 18.625  -54.686 -28.375 1.00 68.35 ? 89   HIS B CD2 1 
ATOM   1907 C CE1 . HIS B 1 88  ? 17.466  -56.549 -28.459 1.00 69.25 ? 89   HIS B CE1 1 
ATOM   1908 N NE2 . HIS B 1 88  ? 18.382  -55.834 -29.092 1.00 69.14 ? 89   HIS B NE2 1 
ATOM   1909 N N   . ASP B 1 94  ? 20.080  -58.797 -23.407 1.00 83.52 ? 95   ASP B N   1 
ATOM   1910 C CA  . ASP B 1 94  ? 19.748  -59.287 -24.741 1.00 84.01 ? 95   ASP B CA  1 
ATOM   1911 C C   . ASP B 1 94  ? 18.748  -60.425 -24.615 1.00 84.27 ? 95   ASP B C   1 
ATOM   1912 O O   . ASP B 1 94  ? 18.818  -61.216 -23.657 1.00 85.38 ? 95   ASP B O   1 
ATOM   1913 C CB  . ASP B 1 94  ? 20.996  -59.793 -25.492 1.00 84.96 ? 95   ASP B CB  1 
ATOM   1914 C CG  . ASP B 1 94  ? 20.704  -60.168 -26.974 1.00 86.30 ? 95   ASP B CG  1 
ATOM   1915 O OD1 . ASP B 1 94  ? 19.733  -59.636 -27.563 1.00 87.07 ? 95   ASP B OD1 1 
ATOM   1916 O OD2 . ASP B 1 94  ? 21.455  -60.987 -27.560 1.00 86.59 ? 95   ASP B OD2 1 
ATOM   1917 N N   . THR B 1 95  ? 17.805  -60.483 -25.568 1.00 83.54 ? 96   THR B N   1 
ATOM   1918 C CA  . THR B 1 95  ? 16.941  -61.672 -25.774 1.00 83.10 ? 96   THR B CA  1 
ATOM   1919 C C   . THR B 1 95  ? 16.840  -62.010 -27.291 1.00 83.02 ? 96   THR B C   1 
ATOM   1920 O O   . THR B 1 95  ? 17.375  -63.043 -27.740 1.00 84.35 ? 96   THR B O   1 
ATOM   1921 C CB  . THR B 1 95  ? 15.565  -61.524 -25.043 1.00 82.58 ? 96   THR B CB  1 
ATOM   1922 O OG1 . THR B 1 95  ? 14.725  -62.645 -25.345 1.00 82.40 ? 96   THR B OG1 1 
ATOM   1923 C CG2 . THR B 1 95  ? 14.872  -60.185 -25.377 1.00 80.77 ? 96   THR B CG2 1 
ATOM   1924 N N   . GLY B 1 96  ? 16.228  -61.118 -28.082 1.00 80.92 ? 97   GLY B N   1 
ATOM   1925 C CA  . GLY B 1 96  ? 16.163  -61.266 -29.559 1.00 80.02 ? 97   GLY B CA  1 
ATOM   1926 C C   . GLY B 1 96  ? 14.759  -61.121 -30.157 1.00 78.53 ? 97   GLY B C   1 
ATOM   1927 O O   . GLY B 1 96  ? 13.772  -61.519 -29.552 1.00 78.09 ? 97   GLY B O   1 
ATOM   1928 N N   . PRO B 1 97  ? 14.656  -60.553 -31.371 1.00 77.15 ? 98   PRO B N   1 
ATOM   1929 C CA  . PRO B 1 97  ? 13.366  -60.653 -32.062 1.00 76.02 ? 98   PRO B CA  1 
ATOM   1930 C C   . PRO B 1 97  ? 12.974  -62.083 -32.514 1.00 75.42 ? 98   PRO B C   1 
ATOM   1931 O O   . PRO B 1 97  ? 11.793  -62.322 -32.732 1.00 76.08 ? 98   PRO B O   1 
ATOM   1932 C CB  . PRO B 1 97  ? 13.540  -59.725 -33.280 1.00 76.41 ? 98   PRO B CB  1 
ATOM   1933 C CG  . PRO B 1 97  ? 14.690  -58.819 -32.934 1.00 76.47 ? 98   PRO B CG  1 
ATOM   1934 C CD  . PRO B 1 97  ? 15.602  -59.687 -32.107 1.00 77.23 ? 98   PRO B CD  1 
ATOM   1935 N N   . ASP B 1 98  ? 13.917  -63.018 -32.662 1.00 73.21 ? 99   ASP B N   1 
ATOM   1936 C CA  . ASP B 1 98  ? 13.541  -64.400 -33.024 1.00 72.97 ? 99   ASP B CA  1 
ATOM   1937 C C   . ASP B 1 98  ? 12.705  -65.067 -31.902 1.00 70.92 ? 99   ASP B C   1 
ATOM   1938 O O   . ASP B 1 98  ? 11.808  -65.877 -32.165 1.00 71.07 ? 99   ASP B O   1 
ATOM   1939 C CB  . ASP B 1 98  ? 14.778  -65.248 -33.386 1.00 74.13 ? 99   ASP B CB  1 
ATOM   1940 C CG  . ASP B 1 98  ? 15.167  -65.146 -34.886 1.00 76.05 ? 99   ASP B CG  1 
ATOM   1941 O OD1 . ASP B 1 98  ? 14.880  -64.098 -35.518 1.00 74.12 ? 99   ASP B OD1 1 
ATOM   1942 O OD2 . ASP B 1 98  ? 15.758  -66.125 -35.436 1.00 78.11 ? 99   ASP B OD2 1 
ATOM   1943 N N   . TYR B 1 99  ? 12.999  -64.694 -30.653 1.00 66.94 ? 100  TYR B N   1 
ATOM   1944 C CA  . TYR B 1 99  ? 12.245  -65.160 -29.499 1.00 64.82 ? 100  TYR B CA  1 
ATOM   1945 C C   . TYR B 1 99  ? 10.776  -64.762 -29.638 1.00 64.86 ? 100  TYR B C   1 
ATOM   1946 O O   . TYR B 1 99  ? 9.885   -65.543 -29.309 1.00 65.02 ? 100  TYR B O   1 
ATOM   1947 C CB  . TYR B 1 99  ? 12.835  -64.564 -28.219 1.00 62.26 ? 100  TYR B CB  1 
ATOM   1948 C CG  . TYR B 1 99  ? 12.240  -65.103 -26.943 1.00 58.68 ? 100  TYR B CG  1 
ATOM   1949 C CD1 . TYR B 1 99  ? 12.463  -66.412 -26.554 1.00 58.17 ? 100  TYR B CD1 1 
ATOM   1950 C CD2 . TYR B 1 99  ? 11.461  -64.320 -26.126 1.00 53.34 ? 100  TYR B CD2 1 
ATOM   1951 C CE1 . TYR B 1 99  ? 11.935  -66.918 -25.381 1.00 54.70 ? 100  TYR B CE1 1 
ATOM   1952 C CE2 . TYR B 1 99  ? 10.925  -64.826 -24.951 1.00 52.68 ? 100  TYR B CE2 1 
ATOM   1953 C CZ  . TYR B 1 99  ? 11.180  -66.135 -24.588 1.00 52.88 ? 100  TYR B CZ  1 
ATOM   1954 O OH  . TYR B 1 99  ? 10.667  -66.685 -23.429 1.00 50.34 ? 100  TYR B OH  1 
ATOM   1955 N N   . TYR B 1 100 ? 10.536  -63.550 -30.138 1.00 64.40 ? 101  TYR B N   1 
ATOM   1956 C CA  . TYR B 1 100 ? 9.172   -63.018 -30.300 1.00 65.17 ? 101  TYR B CA  1 
ATOM   1957 C C   . TYR B 1 100 ? 8.581   -63.170 -31.694 1.00 68.20 ? 101  TYR B C   1 
ATOM   1958 O O   . TYR B 1 100 ? 7.362   -63.314 -31.816 1.00 69.67 ? 101  TYR B O   1 
ATOM   1959 C CB  . TYR B 1 100 ? 9.113   -61.535 -29.933 1.00 63.01 ? 101  TYR B CB  1 
ATOM   1960 C CG  . TYR B 1 100 ? 9.452   -61.241 -28.503 1.00 58.56 ? 101  TYR B CG  1 
ATOM   1961 C CD1 . TYR B 1 100 ? 8.537   -61.479 -27.497 1.00 55.38 ? 101  TYR B CD1 1 
ATOM   1962 C CD2 . TYR B 1 100 ? 10.688  -60.722 -28.161 1.00 55.46 ? 101  TYR B CD2 1 
ATOM   1963 C CE1 . TYR B 1 100 ? 8.824   -61.202 -26.185 1.00 51.75 ? 101  TYR B CE1 1 
ATOM   1964 C CE2 . TYR B 1 100 ? 11.002  -60.457 -26.845 1.00 54.69 ? 101  TYR B CE2 1 
ATOM   1965 C CZ  . TYR B 1 100 ? 10.054  -60.700 -25.857 1.00 52.90 ? 101  TYR B CZ  1 
ATOM   1966 O OH  . TYR B 1 100 ? 10.370  -60.436 -24.552 1.00 50.53 ? 101  TYR B OH  1 
ATOM   1967 N N   . ARG B 1 101 ? 9.420   -63.123 -32.732 1.00 70.56 ? 102  ARG B N   1 
ATOM   1968 C CA  . ARG B 1 101 ? 8.962   -63.201 -34.137 1.00 73.56 ? 102  ARG B CA  1 
ATOM   1969 C C   . ARG B 1 101 ? 8.301   -64.561 -34.463 1.00 76.28 ? 102  ARG B C   1 
ATOM   1970 O O   . ARG B 1 101 ? 7.555   -64.707 -35.464 1.00 78.45 ? 102  ARG B O   1 
ATOM   1971 C CB  . ARG B 1 101 ? 10.128  -62.918 -35.105 1.00 74.35 ? 102  ARG B CB  1 
ATOM   1972 C CG  . ARG B 1 101 ? 9.737   -62.830 -36.598 1.00 79.12 ? 102  ARG B CG  1 
ATOM   1973 C CD  . ARG B 1 101 ? 10.943  -62.898 -37.542 1.00 83.70 ? 102  ARG B CD  1 
ATOM   1974 N NE  . ARG B 1 101 ? 11.457  -61.569 -37.907 1.00 85.77 ? 102  ARG B NE  1 
ATOM   1975 C CZ  . ARG B 1 101 ? 12.424  -60.902 -37.267 1.00 85.85 ? 102  ARG B CZ  1 
ATOM   1976 N NH1 . ARG B 1 101 ? 13.024  -61.416 -36.186 1.00 85.27 ? 102  ARG B NH1 1 
ATOM   1977 N NH2 . ARG B 1 101 ? 12.797  -59.701 -37.716 1.00 85.10 ? 102  ARG B NH2 1 
ATOM   1978 N N   . ASP B 1 102 ? 8.549   -65.553 -33.613 1.00 76.68 ? 103  ASP B N   1 
ATOM   1979 C CA  . ASP B 1 102 ? 7.884   -66.839 -33.762 1.00 79.09 ? 103  ASP B CA  1 
ATOM   1980 C C   . ASP B 1 102 ? 6.440   -66.816 -33.255 1.00 78.89 ? 103  ASP B C   1 
ATOM   1981 O O   . ASP B 1 102 ? 5.775   -67.853 -33.255 1.00 80.90 ? 103  ASP B O   1 
ATOM   1982 C CB  . ASP B 1 102 ? 8.700   -67.932 -33.064 1.00 79.94 ? 103  ASP B CB  1 
ATOM   1983 C CG  . ASP B 1 102 ? 10.043  -68.201 -33.759 1.00 80.69 ? 103  ASP B CG  1 
ATOM   1984 O OD1 . ASP B 1 102 ? 10.435  -67.433 -34.673 1.00 79.37 ? 103  ASP B OD1 1 
ATOM   1985 O OD2 . ASP B 1 102 ? 10.717  -69.181 -33.372 1.00 82.75 ? 103  ASP B OD2 1 
ATOM   1986 N N   . MET B 1 103 ? 5.946   -65.641 -32.846 1.00 81.85 ? 104  MET B N   1 
ATOM   1987 C CA  . MET B 1 103 ? 4.567   -65.505 -32.340 1.00 80.60 ? 104  MET B CA  1 
ATOM   1988 C C   . MET B 1 103 ? 3.793   -64.276 -32.815 1.00 78.11 ? 104  MET B C   1 
ATOM   1989 O O   . MET B 1 103 ? 2.754   -63.944 -32.245 1.00 76.62 ? 104  MET B O   1 
ATOM   1990 C CB  . MET B 1 103 ? 4.600   -65.477 -30.824 1.00 78.99 ? 104  MET B CB  1 
ATOM   1991 C CG  . MET B 1 103 ? 5.187   -66.725 -30.208 1.00 82.05 ? 104  MET B CG  1 
ATOM   1992 S SD  . MET B 1 103 ? 4.914   -66.677 -28.451 1.00 81.31 ? 104  MET B SD  1 
ATOM   1993 C CE  . MET B 1 103 ? 5.730   -65.119 -28.146 1.00 76.34 ? 104  MET B CE  1 
ATOM   1994 N N   . ASP B 1 104 ? 4.280   -63.598 -33.852 1.00 77.62 ? 105  ASP B N   1 
ATOM   1995 C CA  . ASP B 1 104 ? 3.548   -62.456 -34.417 1.00 76.06 ? 105  ASP B CA  1 
ATOM   1996 C C   . ASP B 1 104 ? 3.505   -61.306 -33.399 1.00 71.04 ? 105  ASP B C   1 
ATOM   1997 O O   . ASP B 1 104 ? 2.469   -60.686 -33.162 1.00 69.92 ? 105  ASP B O   1 
ATOM   1998 C CB  . ASP B 1 104 ? 2.122   -62.894 -34.844 1.00 78.68 ? 105  ASP B CB  1 
ATOM   1999 C CG  . ASP B 1 104 ? 1.742   -62.411 -36.236 1.00 81.77 ? 105  ASP B CG  1 
ATOM   2000 O OD1 . ASP B 1 104 ? 2.111   -61.276 -36.625 1.00 82.33 ? 105  ASP B OD1 1 
ATOM   2001 O OD2 . ASP B 1 104 ? 1.078   -63.189 -36.951 1.00 86.95 ? 105  ASP B OD2 1 
ATOM   2002 N N   . ILE B 1 105 ? 4.656   -61.048 -32.799 1.00 67.78 ? 106  ILE B N   1 
ATOM   2003 C CA  . ILE B 1 105 ? 4.835   -59.934 -31.880 1.00 64.02 ? 106  ILE B CA  1 
ATOM   2004 C C   . ILE B 1 105 ? 5.950   -59.062 -32.439 1.00 62.17 ? 106  ILE B C   1 
ATOM   2005 O O   . ILE B 1 105 ? 7.064   -59.542 -32.610 1.00 62.47 ? 106  ILE B O   1 
ATOM   2006 C CB  . ILE B 1 105 ? 5.207   -60.437 -30.459 1.00 62.84 ? 106  ILE B CB  1 
ATOM   2007 C CG1 . ILE B 1 105 ? 3.959   -60.999 -29.761 1.00 63.44 ? 106  ILE B CG1 1 
ATOM   2008 C CG2 . ILE B 1 105 ? 5.872   -59.328 -29.654 1.00 59.73 ? 106  ILE B CG2 1 
ATOM   2009 C CD1 . ILE B 1 105 ? 4.254   -61.862 -28.540 1.00 63.03 ? 106  ILE B CD1 1 
ATOM   2010 N N   . GLN B 1 106 ? 5.638   -57.806 -32.756 1.00 60.06 ? 107  GLN B N   1 
ATOM   2011 C CA  . GLN B 1 106 ? 6.663   -56.845 -33.163 1.00 58.91 ? 107  GLN B CA  1 
ATOM   2012 C C   . GLN B 1 106 ? 7.477   -56.434 -31.942 1.00 55.37 ? 107  GLN B C   1 
ATOM   2013 O O   . GLN B 1 106 ? 6.922   -55.989 -30.933 1.00 53.78 ? 107  GLN B O   1 
ATOM   2014 C CB  . GLN B 1 106 ? 6.044   -55.606 -33.798 1.00 58.95 ? 107  GLN B CB  1 
ATOM   2015 C CG  . GLN B 1 106 ? 5.546   -55.843 -35.196 1.00 64.33 ? 107  GLN B CG  1 
ATOM   2016 C CD  . GLN B 1 106 ? 4.796   -54.648 -35.752 1.00 67.62 ? 107  GLN B CD  1 
ATOM   2017 O OE1 . GLN B 1 106 ? 3.588   -54.719 -35.996 1.00 70.27 ? 107  GLN B OE1 1 
ATOM   2018 N NE2 . GLN B 1 106 ? 5.508   -53.533 -35.939 1.00 69.35 ? 107  GLN B NE2 1 
ATOM   2019 N N   . TYR B 1 107 ? 8.785   -56.606 -32.035 1.00 53.73 ? 108  TYR B N   1 
ATOM   2020 C CA  . TYR B 1 107 ? 9.692   -56.284 -30.954 1.00 51.23 ? 108  TYR B CA  1 
ATOM   2021 C C   . TYR B 1 107 ? 10.551  -55.087 -31.344 1.00 50.26 ? 108  TYR B C   1 
ATOM   2022 O O   . TYR B 1 107 ? 10.905  -54.937 -32.501 1.00 51.81 ? 108  TYR B O   1 
ATOM   2023 C CB  . TYR B 1 107 ? 10.595  -57.483 -30.670 1.00 52.01 ? 108  TYR B CB  1 
ATOM   2024 C CG  . TYR B 1 107 ? 11.684  -57.203 -29.660 1.00 51.02 ? 108  TYR B CG  1 
ATOM   2025 C CD1 . TYR B 1 107 ? 11.440  -57.368 -28.324 1.00 48.19 ? 108  TYR B CD1 1 
ATOM   2026 C CD2 . TYR B 1 107 ? 12.961  -56.753 -30.051 1.00 53.08 ? 108  TYR B CD2 1 
ATOM   2027 C CE1 . TYR B 1 107 ? 12.394  -57.133 -27.384 1.00 49.07 ? 108  TYR B CE1 1 
ATOM   2028 C CE2 . TYR B 1 107 ? 13.939  -56.489 -29.097 1.00 52.76 ? 108  TYR B CE2 1 
ATOM   2029 C CZ  . TYR B 1 107 ? 13.631  -56.695 -27.747 1.00 51.41 ? 108  TYR B CZ  1 
ATOM   2030 O OH  . TYR B 1 107 ? 14.530  -56.470 -26.732 1.00 52.04 ? 108  TYR B OH  1 
ATOM   2031 N N   . HIS B 1 108 ? 10.883  -54.236 -30.382 1.00 47.91 ? 109  HIS B N   1 
ATOM   2032 C CA  . HIS B 1 108 ? 12.038  -53.350 -30.527 1.00 47.67 ? 109  HIS B CA  1 
ATOM   2033 C C   . HIS B 1 108 ? 12.736  -53.153 -29.182 1.00 46.06 ? 109  HIS B C   1 
ATOM   2034 O O   . HIS B 1 108 ? 12.079  -53.017 -28.161 1.00 44.41 ? 109  HIS B O   1 
ATOM   2035 C CB  . HIS B 1 108 ? 11.675  -51.979 -31.126 1.00 47.02 ? 109  HIS B CB  1 
ATOM   2036 C CG  . HIS B 1 108 ? 12.880  -51.153 -31.491 1.00 47.61 ? 109  HIS B CG  1 
ATOM   2037 N ND1 . HIS B 1 108 ? 13.500  -51.230 -32.725 1.00 48.57 ? 109  HIS B ND1 1 
ATOM   2038 C CD2 . HIS B 1 108 ? 13.605  -50.269 -30.765 1.00 46.87 ? 109  HIS B CD2 1 
ATOM   2039 C CE1 . HIS B 1 108 ? 14.543  -50.421 -32.745 1.00 49.62 ? 109  HIS B CE1 1 
ATOM   2040 N NE2 . HIS B 1 108 ? 14.612  -49.805 -31.577 1.00 48.84 ? 109  HIS B NE2 1 
ATOM   2041 N N   . GLY B 1 109 ? 14.064  -53.117 -29.210 1.00 46.67 ? 110  GLY B N   1 
ATOM   2042 C CA  . GLY B 1 109 ? 14.866  -52.897 -28.028 1.00 46.43 ? 110  GLY B CA  1 
ATOM   2043 C C   . GLY B 1 109 ? 15.604  -51.564 -28.052 1.00 46.67 ? 110  GLY B C   1 
ATOM   2044 O O   . GLY B 1 109 ? 16.346  -51.309 -28.965 1.00 47.83 ? 110  GLY B O   1 
ATOM   2045 N N   . VAL B 1 110 ? 15.380  -50.720 -27.050 1.00 45.48 ? 111  VAL B N   1 
ATOM   2046 C CA  . VAL B 1 110 ? 16.186  -49.504 -26.807 1.00 46.18 ? 111  VAL B CA  1 
ATOM   2047 C C   . VAL B 1 110 ? 17.267  -49.940 -25.777 1.00 47.12 ? 111  VAL B C   1 
ATOM   2048 O O   . VAL B 1 110 ? 16.957  -50.541 -24.732 1.00 46.66 ? 111  VAL B O   1 
ATOM   2049 C CB  . VAL B 1 110 ? 15.259  -48.368 -26.224 1.00 45.24 ? 111  VAL B CB  1 
ATOM   2050 C CG1 . VAL B 1 110 ? 16.050  -47.199 -25.598 1.00 45.76 ? 111  VAL B CG1 1 
ATOM   2051 C CG2 . VAL B 1 110 ? 14.251  -47.875 -27.284 1.00 44.79 ? 111  VAL B CG2 1 
ATOM   2052 N N   . GLU B 1 111 ? 18.523  -49.673 -26.044 1.00 48.36 ? 112  GLU B N   1 
ATOM   2053 C CA  . GLU B 1 111 ? 19.564  -50.258 -25.215 1.00 50.22 ? 112  GLU B CA  1 
ATOM   2054 C C   . GLU B 1 111 ? 19.933  -49.239 -24.125 1.00 49.05 ? 112  GLU B C   1 
ATOM   2055 O O   . GLU B 1 111 ? 20.986  -48.613 -24.169 1.00 50.95 ? 112  GLU B O   1 
ATOM   2056 C CB  . GLU B 1 111 ? 20.766  -50.656 -26.093 1.00 53.34 ? 112  GLU B CB  1 
ATOM   2057 C CG  . GLU B 1 111 ? 21.923  -51.316 -25.334 1.00 58.49 ? 112  GLU B CG  1 
ATOM   2058 C CD  . GLU B 1 111 ? 23.057  -51.750 -26.255 1.00 65.02 ? 112  GLU B CD  1 
ATOM   2059 O OE1 . GLU B 1 111 ? 22.856  -52.793 -26.941 1.00 67.63 ? 112  GLU B OE1 1 
ATOM   2060 O OE2 . GLU B 1 111 ? 24.120  -51.047 -26.306 1.00 65.69 ? 112  GLU B OE2 1 
ATOM   2061 N N   . ALA B 1 112 ? 19.042  -49.054 -23.160 1.00 45.87 ? 113  ALA B N   1 
ATOM   2062 C CA  . ALA B 1 112 ? 19.220  -47.998 -22.173 1.00 45.24 ? 113  ALA B CA  1 
ATOM   2063 C C   . ALA B 1 112 ? 19.661  -48.564 -20.808 1.00 45.00 ? 113  ALA B C   1 
ATOM   2064 O O   . ALA B 1 112 ? 19.332  -49.703 -20.460 1.00 44.07 ? 113  ALA B O   1 
ATOM   2065 C CB  . ALA B 1 112 ? 17.925  -47.165 -22.042 1.00 43.33 ? 113  ALA B CB  1 
ATOM   2066 N N   . ASP B 1 113 ? 20.420  -47.775 -20.058 1.00 44.53 ? 114  ASP B N   1 
ATOM   2067 C CA  . ASP B 1 113 ? 20.798  -48.148 -18.701 1.00 44.80 ? 114  ASP B CA  1 
ATOM   2068 C C   . ASP B 1 113 ? 19.983  -47.314 -17.734 1.00 42.71 ? 114  ASP B C   1 
ATOM   2069 O O   . ASP B 1 113 ? 19.635  -46.180 -18.044 1.00 41.75 ? 114  ASP B O   1 
ATOM   2070 C CB  . ASP B 1 113 ? 22.281  -47.889 -18.467 1.00 47.65 ? 114  ASP B CB  1 
ATOM   2071 C CG  . ASP B 1 113 ? 23.153  -48.635 -19.422 1.00 50.30 ? 114  ASP B CG  1 
ATOM   2072 O OD1 . ASP B 1 113 ? 22.805  -49.765 -19.807 1.00 53.03 ? 114  ASP B OD1 1 
ATOM   2073 O OD2 . ASP B 1 113 ? 24.211  -48.094 -19.775 1.00 56.15 ? 114  ASP B OD2 1 
ATOM   2074 N N   . ASP B 1 114 ? 19.679  -47.853 -16.563 1.00 41.99 ? 115  ASP B N   1 
ATOM   2075 C CA  . ASP B 1 114 ? 18.926  -47.073 -15.608 1.00 41.45 ? 115  ASP B CA  1 
ATOM   2076 C C   . ASP B 1 114 ? 19.868  -46.324 -14.682 1.00 42.61 ? 115  ASP B C   1 
ATOM   2077 O O   . ASP B 1 114 ? 20.053  -46.694 -13.524 1.00 43.57 ? 115  ASP B O   1 
ATOM   2078 C CB  . ASP B 1 114 ? 18.005  -47.936 -14.796 1.00 40.90 ? 115  ASP B CB  1 
ATOM   2079 C CG  . ASP B 1 114 ? 17.153  -47.123 -13.806 1.00 41.97 ? 115  ASP B CG  1 
ATOM   2080 O OD1 . ASP B 1 114 ? 16.798  -45.954 -14.107 1.00 40.62 ? 115  ASP B OD1 1 
ATOM   2081 O OD2 . ASP B 1 114 ? 16.835  -47.689 -12.735 1.00 43.61 ? 115  ASP B OD2 1 
ATOM   2082 N N   . LEU B 1 115 ? 20.391  -45.229 -15.210 1.00 42.17 ? 116  LEU B N   1 
ATOM   2083 C CA  . LEU B 1 115 ? 21.411  -44.429 -14.581 1.00 43.29 ? 116  LEU B CA  1 
ATOM   2084 C C   . LEU B 1 115 ? 21.065  -43.012 -14.950 1.00 42.56 ? 116  LEU B C   1 
ATOM   2085 O O   . LEU B 1 115 ? 20.666  -42.763 -16.077 1.00 40.88 ? 116  LEU B O   1 
ATOM   2086 C CB  . LEU B 1 115 ? 22.772  -44.746 -15.185 1.00 45.33 ? 116  LEU B CB  1 
ATOM   2087 C CG  . LEU B 1 115 ? 23.403  -46.110 -14.860 1.00 48.39 ? 116  LEU B CG  1 
ATOM   2088 C CD1 . LEU B 1 115 ? 24.772  -46.298 -15.576 1.00 47.90 ? 116  LEU B CD1 1 
ATOM   2089 C CD2 . LEU B 1 115 ? 23.566  -46.275 -13.363 1.00 48.44 ? 116  LEU B CD2 1 
ATOM   2090 N N   . PRO B 1 116 ? 21.251  -42.065 -14.024 1.00 43.73 ? 117  PRO B N   1 
ATOM   2091 C CA  . PRO B 1 116 ? 21.067  -40.655 -14.366 1.00 44.63 ? 117  PRO B CA  1 
ATOM   2092 C C   . PRO B 1 116 ? 21.982  -40.142 -15.496 1.00 46.44 ? 117  PRO B C   1 
ATOM   2093 O O   . PRO B 1 116 ? 21.684  -39.108 -16.086 1.00 47.20 ? 117  PRO B O   1 
ATOM   2094 C CB  . PRO B 1 116 ? 21.395  -39.917 -13.052 1.00 47.37 ? 117  PRO B CB  1 
ATOM   2095 C CG  . PRO B 1 116 ? 21.408  -40.955 -11.987 1.00 46.61 ? 117  PRO B CG  1 
ATOM   2096 C CD  . PRO B 1 116 ? 21.749  -42.253 -12.657 1.00 44.70 ? 117  PRO B CD  1 
ATOM   2097 N N   . THR B 1 117 ? 23.073  -40.852 -15.800 1.00 47.64 ? 118  THR B N   1 
ATOM   2098 C CA  . THR B 1 117 ? 23.987  -40.452 -16.873 1.00 49.16 ? 118  THR B CA  1 
ATOM   2099 C C   . THR B 1 117 ? 23.634  -41.021 -18.243 1.00 48.00 ? 118  THR B C   1 
ATOM   2100 O O   . THR B 1 117 ? 24.419  -40.897 -19.174 1.00 49.62 ? 118  THR B O   1 
ATOM   2101 C CB  . THR B 1 117 ? 25.423  -40.908 -16.572 1.00 52.34 ? 118  THR B CB  1 
ATOM   2102 O OG1 . THR B 1 117 ? 25.433  -42.330 -16.441 1.00 52.73 ? 118  THR B OG1 1 
ATOM   2103 C CG2 . THR B 1 117 ? 25.962  -40.254 -15.307 1.00 52.15 ? 118  THR B CG2 1 
ATOM   2104 N N   . PHE B 1 118 ? 22.481  -41.673 -18.352 1.00 45.43 ? 119  PHE B N   1 
ATOM   2105 C CA  . PHE B 1 118 ? 21.932  -42.077 -19.628 1.00 44.15 ? 119  PHE B CA  1 
ATOM   2106 C C   . PHE B 1 118 ? 20.868  -41.068 -20.077 1.00 43.00 ? 119  PHE B C   1 
ATOM   2107 O O   . PHE B 1 118 ? 19.950  -40.767 -19.340 1.00 41.62 ? 119  PHE B O   1 
ATOM   2108 C CB  . PHE B 1 118 ? 21.315  -43.483 -19.549 1.00 42.71 ? 119  PHE B CB  1 
ATOM   2109 C CG  . PHE B 1 118 ? 21.064  -44.095 -20.908 1.00 40.81 ? 119  PHE B CG  1 
ATOM   2110 C CD1 . PHE B 1 118 ? 19.890  -43.838 -21.589 1.00 38.48 ? 119  PHE B CD1 1 
ATOM   2111 C CD2 . PHE B 1 118 ? 22.037  -44.875 -21.524 1.00 43.24 ? 119  PHE B CD2 1 
ATOM   2112 C CE1 . PHE B 1 118 ? 19.683  -44.368 -22.853 1.00 38.81 ? 119  PHE B CE1 1 
ATOM   2113 C CE2 . PHE B 1 118 ? 21.833  -45.421 -22.800 1.00 40.99 ? 119  PHE B CE2 1 
ATOM   2114 C CZ  . PHE B 1 118 ? 20.650  -45.166 -23.451 1.00 40.01 ? 119  PHE B CZ  1 
ATOM   2115 N N   . ASP B 1 119 ? 21.017  -40.527 -21.279 1.00 44.42 ? 120  ASP B N   1 
ATOM   2116 C CA  . ASP B 1 119 ? 20.061  -39.561 -21.803 1.00 43.86 ? 120  ASP B CA  1 
ATOM   2117 C C   . ASP B 1 119 ? 19.015  -40.335 -22.598 1.00 42.16 ? 120  ASP B C   1 
ATOM   2118 O O   . ASP B 1 119 ? 19.134  -40.547 -23.797 1.00 42.12 ? 120  ASP B O   1 
ATOM   2119 C CB  . ASP B 1 119 ? 20.738  -38.468 -22.666 1.00 45.91 ? 120  ASP B CB  1 
ATOM   2120 C CG  . ASP B 1 119 ? 19.823  -37.264 -22.888 1.00 45.32 ? 120  ASP B CG  1 
ATOM   2121 O OD1 . ASP B 1 119 ? 18.643  -37.370 -22.534 1.00 43.86 ? 120  ASP B OD1 1 
ATOM   2122 O OD2 . ASP B 1 119 ? 20.261  -36.193 -23.360 1.00 49.16 ? 120  ASP B OD2 1 
ATOM   2123 N N   . LEU B 1 120 ? 17.982  -40.748 -21.900 1.00 40.41 ? 121  LEU B N   1 
ATOM   2124 C CA  . LEU B 1 120 ? 16.864  -41.450 -22.510 1.00 39.26 ? 121  LEU B CA  1 
ATOM   2125 C C   . LEU B 1 120 ? 16.047  -40.541 -23.432 1.00 39.55 ? 121  LEU B C   1 
ATOM   2126 O O   . LEU B 1 120 ? 15.252  -41.039 -24.236 1.00 39.36 ? 121  LEU B O   1 
ATOM   2127 C CB  . LEU B 1 120 ? 15.962  -42.002 -21.423 1.00 37.15 ? 121  LEU B CB  1 
ATOM   2128 C CG  . LEU B 1 120 ? 15.036  -43.145 -21.819 1.00 37.90 ? 121  LEU B CG  1 
ATOM   2129 C CD1 . LEU B 1 120 ? 15.785  -44.305 -22.538 1.00 36.77 ? 121  LEU B CD1 1 
ATOM   2130 C CD2 . LEU B 1 120 ? 14.338  -43.624 -20.543 1.00 34.03 ? 121  LEU B CD2 1 
ATOM   2131 N N   . SER B 1 121 ? 16.244  -39.223 -23.338 1.00 40.07 ? 122  SER B N   1 
ATOM   2132 C CA  . SER B 1 121 ? 15.497  -38.279 -24.178 1.00 40.35 ? 122  SER B CA  1 
ATOM   2133 C C   . SER B 1 121 ? 15.784  -38.447 -25.642 1.00 40.48 ? 122  SER B C   1 
ATOM   2134 O O   . SER B 1 121 ? 14.991  -38.037 -26.459 1.00 40.41 ? 122  SER B O   1 
ATOM   2135 C CB  . SER B 1 121 ? 15.775  -36.818 -23.806 1.00 42.14 ? 122  SER B CB  1 
ATOM   2136 O OG  . SER B 1 121 ? 17.077  -36.445 -24.142 1.00 42.91 ? 122  SER B OG  1 
ATOM   2137 N N   . VAL B 1 122 ? 16.924  -39.032 -25.965 1.00 41.35 ? 123  VAL B N   1 
ATOM   2138 C CA  . VAL B 1 122 ? 17.239  -39.357 -27.347 1.00 42.86 ? 123  VAL B CA  1 
ATOM   2139 C C   . VAL B 1 122 ? 16.171  -40.282 -27.967 1.00 41.51 ? 123  VAL B C   1 
ATOM   2140 O O   . VAL B 1 122 ? 15.990  -40.266 -29.166 1.00 41.72 ? 123  VAL B O   1 
ATOM   2141 C CB  . VAL B 1 122 ? 18.666  -39.967 -27.483 1.00 44.55 ? 123  VAL B CB  1 
ATOM   2142 C CG1 . VAL B 1 122 ? 18.876  -40.648 -28.879 1.00 43.92 ? 123  VAL B CG1 1 
ATOM   2143 C CG2 . VAL B 1 122 ? 19.710  -38.881 -27.262 1.00 47.00 ? 123  VAL B CG2 1 
ATOM   2144 N N   . PHE B 1 123 ? 15.451  -41.039 -27.132 1.00 39.40 ? 124  PHE B N   1 
ATOM   2145 C CA  . PHE B 1 123 ? 14.473  -42.000 -27.603 1.00 38.31 ? 124  PHE B CA  1 
ATOM   2146 C C   . PHE B 1 123 ? 13.016  -41.592 -27.382 1.00 37.75 ? 124  PHE B C   1 
ATOM   2147 O O   . PHE B 1 123 ? 12.107  -42.325 -27.776 1.00 37.51 ? 124  PHE B O   1 
ATOM   2148 C CB  . PHE B 1 123 ? 14.746  -43.352 -26.938 1.00 36.77 ? 124  PHE B CB  1 
ATOM   2149 C CG  . PHE B 1 123 ? 16.100  -43.917 -27.295 1.00 36.97 ? 124  PHE B CG  1 
ATOM   2150 C CD1 . PHE B 1 123 ? 16.333  -44.426 -28.548 1.00 37.26 ? 124  PHE B CD1 1 
ATOM   2151 C CD2 . PHE B 1 123 ? 17.135  -43.918 -26.387 1.00 37.40 ? 124  PHE B CD2 1 
ATOM   2152 C CE1 . PHE B 1 123 ? 17.594  -44.945 -28.893 1.00 40.58 ? 124  PHE B CE1 1 
ATOM   2153 C CE2 . PHE B 1 123 ? 18.379  -44.432 -26.716 1.00 39.99 ? 124  PHE B CE2 1 
ATOM   2154 C CZ  . PHE B 1 123 ? 18.607  -44.953 -27.976 1.00 40.63 ? 124  PHE B CZ  1 
ATOM   2155 N N   . PHE B 1 124 ? 12.761  -40.439 -26.779 1.00 38.46 ? 125  PHE B N   1 
ATOM   2156 C CA  . PHE B 1 124 ? 11.356  -40.085 -26.481 1.00 38.13 ? 125  PHE B CA  1 
ATOM   2157 C C   . PHE B 1 124 ? 10.501  -40.098 -27.757 1.00 38.51 ? 125  PHE B C   1 
ATOM   2158 O O   . PHE B 1 124 ? 9.487   -40.731 -27.792 1.00 37.04 ? 125  PHE B O   1 
ATOM   2159 C CB  . PHE B 1 124 ? 11.229  -38.715 -25.791 1.00 39.15 ? 125  PHE B CB  1 
ATOM   2160 C CG  . PHE B 1 124 ? 11.773  -38.664 -24.374 1.00 40.93 ? 125  PHE B CG  1 
ATOM   2161 C CD1 . PHE B 1 124 ? 12.090  -39.812 -23.665 1.00 39.49 ? 125  PHE B CD1 1 
ATOM   2162 C CD2 . PHE B 1 124 ? 11.940  -37.434 -23.745 1.00 44.08 ? 125  PHE B CD2 1 
ATOM   2163 C CE1 . PHE B 1 124 ? 12.578  -39.735 -22.381 1.00 40.52 ? 125  PHE B CE1 1 
ATOM   2164 C CE2 . PHE B 1 124 ? 12.429  -37.355 -22.464 1.00 44.74 ? 125  PHE B CE2 1 
ATOM   2165 C CZ  . PHE B 1 124 ? 12.746  -38.507 -21.773 1.00 42.39 ? 125  PHE B CZ  1 
ATOM   2166 N N   . TYR B 1 125 ? 10.922  -39.403 -28.811 1.00 40.81 ? 126  TYR B N   1 
ATOM   2167 C CA  . TYR B 1 125 ? 10.106  -39.333 -30.030 1.00 42.16 ? 126  TYR B CA  1 
ATOM   2168 C C   . TYR B 1 125 ? 9.990   -40.677 -30.723 1.00 41.09 ? 126  TYR B C   1 
ATOM   2169 O O   . TYR B 1 125 ? 8.883   -41.077 -31.054 1.00 41.41 ? 126  TYR B O   1 
ATOM   2170 C CB  . TYR B 1 125 ? 10.551  -38.187 -30.969 1.00 44.51 ? 126  TYR B CB  1 
ATOM   2171 C CG  . TYR B 1 125 ? 10.038  -36.890 -30.413 1.00 47.68 ? 126  TYR B CG  1 
ATOM   2172 C CD1 . TYR B 1 125 ? 10.757  -36.205 -29.430 1.00 48.42 ? 126  TYR B CD1 1 
ATOM   2173 C CD2 . TYR B 1 125 ? 8.761   -36.409 -30.760 1.00 50.08 ? 126  TYR B CD2 1 
ATOM   2174 C CE1 . TYR B 1 125 ? 10.248  -35.037 -28.846 1.00 51.17 ? 126  TYR B CE1 1 
ATOM   2175 C CE2 . TYR B 1 125 ? 8.241   -35.224 -30.175 1.00 51.94 ? 126  TYR B CE2 1 
ATOM   2176 C CZ  . TYR B 1 125 ? 9.001   -34.549 -29.229 1.00 52.45 ? 126  TYR B CZ  1 
ATOM   2177 O OH  . TYR B 1 125 ? 8.529   -33.400 -28.646 1.00 54.68 ? 126  TYR B OH  1 
ATOM   2178 N N   . PRO B 1 126 ? 11.097  -41.402 -30.908 1.00 41.44 ? 127  PRO B N   1 
ATOM   2179 C CA  . PRO B 1 126 ? 10.889  -42.655 -31.666 1.00 41.78 ? 127  PRO B CA  1 
ATOM   2180 C C   . PRO B 1 126 ? 10.221  -43.776 -30.867 1.00 40.41 ? 127  PRO B C   1 
ATOM   2181 O O   . PRO B 1 126 ? 9.472   -44.550 -31.430 1.00 41.08 ? 127  PRO B O   1 
ATOM   2182 C CB  . PRO B 1 126 ? 12.285  -43.050 -32.138 1.00 43.04 ? 127  PRO B CB  1 
ATOM   2183 C CG  . PRO B 1 126 ? 13.264  -42.049 -31.529 1.00 43.12 ? 127  PRO B CG  1 
ATOM   2184 C CD  . PRO B 1 126 ? 12.483  -40.906 -30.984 1.00 43.35 ? 127  PRO B CD  1 
ATOM   2185 N N   . ALA B 1 127 ? 10.462  -43.860 -29.569 1.00 39.37 ? 128  ALA B N   1 
ATOM   2186 C CA  . ALA B 1 127 ? 9.707   -44.778 -28.733 1.00 37.66 ? 128  ALA B CA  1 
ATOM   2187 C C   . ALA B 1 127 ? 8.231   -44.379 -28.752 1.00 37.57 ? 128  ALA B C   1 
ATOM   2188 O O   . ALA B 1 127 ? 7.368   -45.206 -28.959 1.00 36.99 ? 128  ALA B O   1 
ATOM   2189 C CB  . ALA B 1 127 ? 10.243  -44.773 -27.334 1.00 36.58 ? 128  ALA B CB  1 
ATOM   2190 N N   . ALA B 1 128 ? 7.938   -43.096 -28.571 1.00 38.33 ? 129  ALA B N   1 
ATOM   2191 C CA  . ALA B 1 128 ? 6.536   -42.657 -28.552 1.00 38.60 ? 129  ALA B CA  1 
ATOM   2192 C C   . ALA B 1 128 ? 5.865   -42.974 -29.890 1.00 39.53 ? 129  ALA B C   1 
ATOM   2193 O O   . ALA B 1 128 ? 4.712   -43.417 -29.912 1.00 40.17 ? 129  ALA B O   1 
ATOM   2194 C CB  . ALA B 1 128 ? 6.424   -41.173 -28.217 1.00 39.48 ? 129  ALA B CB  1 
ATOM   2195 N N   . ALA B 1 129 ? 6.596   -42.787 -30.997 1.00 39.83 ? 130  ALA B N   1 
ATOM   2196 C CA  . ALA B 1 129 ? 6.058   -43.099 -32.325 1.00 40.99 ? 130  ALA B CA  1 
ATOM   2197 C C   . ALA B 1 129 ? 5.712   -44.568 -32.448 1.00 40.02 ? 130  ALA B C   1 
ATOM   2198 O O   . ALA B 1 129 ? 4.690   -44.925 -33.027 1.00 40.75 ? 130  ALA B O   1 
ATOM   2199 C CB  . ALA B 1 129 ? 7.048   -42.664 -33.480 1.00 42.15 ? 130  ALA B CB  1 
ATOM   2200 N N   . PHE B 1 130 ? 6.557   -45.427 -31.895 1.00 38.70 ? 131  PHE B N   1 
ATOM   2201 C CA  . PHE B 1 130 ? 6.310   -46.877 -31.898 1.00 38.26 ? 131  PHE B CA  1 
ATOM   2202 C C   . PHE B 1 130 ? 5.002   -47.196 -31.157 1.00 38.02 ? 131  PHE B C   1 
ATOM   2203 O O   . PHE B 1 130 ? 4.138   -47.901 -31.670 1.00 38.68 ? 131  PHE B O   1 
ATOM   2204 C CB  . PHE B 1 130 ? 7.489   -47.576 -31.212 1.00 37.38 ? 131  PHE B CB  1 
ATOM   2205 C CG  . PHE B 1 130 ? 7.445   -49.093 -31.250 1.00 36.35 ? 131  PHE B CG  1 
ATOM   2206 C CD1 . PHE B 1 130 ? 8.007   -49.791 -32.313 1.00 37.51 ? 131  PHE B CD1 1 
ATOM   2207 C CD2 . PHE B 1 130 ? 6.890   -49.803 -30.198 1.00 33.21 ? 131  PHE B CD2 1 
ATOM   2208 C CE1 . PHE B 1 130 ? 8.013   -51.193 -32.343 1.00 38.75 ? 131  PHE B CE1 1 
ATOM   2209 C CE2 . PHE B 1 130 ? 6.867   -51.213 -30.194 1.00 34.72 ? 131  PHE B CE2 1 
ATOM   2210 C CZ  . PHE B 1 130 ? 7.423   -51.916 -31.253 1.00 39.74 ? 131  PHE B CZ  1 
ATOM   2211 N N   . ILE B 1 131 ? 4.872   -46.645 -29.955 1.00 37.06 ? 132  ILE B N   1 
ATOM   2212 C CA  . ILE B 1 131 ? 3.699   -46.826 -29.126 1.00 36.65 ? 132  ILE B CA  1 
ATOM   2213 C C   . ILE B 1 131 ? 2.478   -46.272 -29.868 1.00 39.22 ? 132  ILE B C   1 
ATOM   2214 O O   . ILE B 1 131 ? 1.468   -46.948 -29.966 1.00 39.34 ? 132  ILE B O   1 
ATOM   2215 C CB  . ILE B 1 131 ? 3.879   -46.168 -27.710 1.00 34.85 ? 132  ILE B CB  1 
ATOM   2216 C CG1 . ILE B 1 131 ? 4.996   -46.838 -26.909 1.00 33.39 ? 132  ILE B CG1 1 
ATOM   2217 C CG2 . ILE B 1 131 ? 2.611   -46.255 -26.913 1.00 34.35 ? 132  ILE B CG2 1 
ATOM   2218 C CD1 . ILE B 1 131 ? 5.553   -45.949 -25.690 1.00 31.08 ? 132  ILE B CD1 1 
ATOM   2219 N N   . ASP B 1 132 ? 2.577   -45.082 -30.455 1.00 42.10 ? 133  ASP B N   1 
ATOM   2220 C CA  . ASP B 1 132 ? 1.398   -44.493 -31.146 1.00 45.51 ? 133  ASP B CA  1 
ATOM   2221 C C   . ASP B 1 132 ? 0.930   -45.326 -32.318 1.00 47.13 ? 133  ASP B C   1 
ATOM   2222 O O   . ASP B 1 132 ? -0.268  -45.490 -32.563 1.00 48.60 ? 133  ASP B O   1 
ATOM   2223 C CB  . ASP B 1 132 ? 1.659   -43.064 -31.629 1.00 47.47 ? 133  ASP B CB  1 
ATOM   2224 C CG  . ASP B 1 132 ? 0.371   -42.296 -31.885 1.00 51.81 ? 133  ASP B CG  1 
ATOM   2225 O OD1 . ASP B 1 132 ? -0.515  -42.217 -30.976 1.00 58.38 ? 133  ASP B OD1 1 
ATOM   2226 O OD2 . ASP B 1 132 ? 0.244   -41.770 -32.995 1.00 57.44 ? 133  ASP B OD2 1 
ATOM   2227 N N   . ARG B 1 133 ? 1.891   -45.871 -33.032 1.00 47.61 ? 134  ARG B N   1 
ATOM   2228 C CA  . ARG B 1 133 ? 1.613   -46.677 -34.222 1.00 50.21 ? 134  ARG B CA  1 
ATOM   2229 C C   . ARG B 1 133 ? 0.882   -47.972 -33.788 1.00 49.85 ? 134  ARG B C   1 
ATOM   2230 O O   . ARG B 1 133 ? -0.121  -48.381 -34.382 1.00 51.70 ? 134  ARG B O   1 
ATOM   2231 C CB  . ARG B 1 133 ? 2.964   -46.959 -34.908 1.00 50.11 ? 134  ARG B CB  1 
ATOM   2232 C CG  . ARG B 1 133 ? 2.923   -47.455 -36.290 1.00 55.46 ? 134  ARG B CG  1 
ATOM   2233 C CD  . ARG B 1 133 ? 4.222   -47.099 -37.040 1.00 57.18 ? 134  ARG B CD  1 
ATOM   2234 N NE  . ARG B 1 133 ? 5.413   -47.451 -36.259 1.00 56.32 ? 134  ARG B NE  1 
ATOM   2235 C CZ  . ARG B 1 133 ? 6.404   -46.616 -35.919 1.00 53.92 ? 134  ARG B CZ  1 
ATOM   2236 N NH1 . ARG B 1 133 ? 6.380   -45.335 -36.270 1.00 54.70 ? 134  ARG B NH1 1 
ATOM   2237 N NH2 . ARG B 1 133 ? 7.432   -47.075 -35.223 1.00 49.69 ? 134  ARG B NH2 1 
ATOM   2238 N N   . ALA B 1 134 ? 1.372   -48.586 -32.713 1.00 47.77 ? 135  ALA B N   1 
ATOM   2239 C CA  . ALA B 1 134 ? 0.792   -49.819 -32.197 1.00 47.96 ? 135  ALA B CA  1 
ATOM   2240 C C   . ALA B 1 134 ? -0.659  -49.578 -31.738 1.00 49.41 ? 135  ALA B C   1 
ATOM   2241 O O   . ALA B 1 134 ? -1.553  -50.344 -32.081 1.00 50.47 ? 135  ALA B O   1 
ATOM   2242 C CB  . ALA B 1 134 ? 1.635   -50.366 -31.060 1.00 44.94 ? 135  ALA B CB  1 
ATOM   2243 N N   . LEU B 1 135 ? -0.867  -48.491 -31.000 1.00 49.49 ? 136  LEU B N   1 
ATOM   2244 C CA  . LEU B 1 135 ? -2.172  -48.154 -30.452 1.00 51.80 ? 136  LEU B CA  1 
ATOM   2245 C C   . LEU B 1 135 ? -3.153  -47.578 -31.473 1.00 55.43 ? 136  LEU B C   1 
ATOM   2246 O O   . LEU B 1 135 ? -4.328  -47.440 -31.164 1.00 57.47 ? 136  LEU B O   1 
ATOM   2247 C CB  . LEU B 1 135 ? -2.033  -47.191 -29.258 1.00 50.10 ? 136  LEU B CB  1 
ATOM   2248 C CG  . LEU B 1 135 ? -1.343  -47.806 -28.030 1.00 47.59 ? 136  LEU B CG  1 
ATOM   2249 C CD1 . LEU B 1 135 ? -1.214  -46.785 -26.880 1.00 44.89 ? 136  LEU B CD1 1 
ATOM   2250 C CD2 . LEU B 1 135 ? -2.042  -49.079 -27.560 1.00 44.12 ? 136  LEU B CD2 1 
ATOM   2251 N N   . SER B 1 136 ? -2.668  -47.239 -32.665 1.00 57.56 ? 137  SER B N   1 
ATOM   2252 C CA  . SER B 1 136 ? -3.525  -46.827 -33.779 1.00 61.57 ? 137  SER B CA  1 
ATOM   2253 C C   . SER B 1 136 ? -4.507  -47.907 -34.205 1.00 64.07 ? 137  SER B C   1 
ATOM   2254 O O   . SER B 1 136 ? -5.602  -47.612 -34.638 1.00 66.24 ? 137  SER B O   1 
ATOM   2255 C CB  . SER B 1 136 ? -2.681  -46.468 -35.001 1.00 62.09 ? 137  SER B CB  1 
ATOM   2256 O OG  . SER B 1 136 ? -2.352  -45.104 -34.948 1.00 64.15 ? 137  SER B OG  1 
ATOM   2257 N N   . ASP B 1 137 ? -4.055  -49.151 -34.131 1.00 64.00 ? 138  ASP B N   1 
ATOM   2258 C CA  . ASP B 1 137 ? -4.863  -50.308 -34.419 1.00 66.57 ? 138  ASP B CA  1 
ATOM   2259 C C   . ASP B 1 137 ? -5.543  -50.757 -33.112 1.00 66.27 ? 138  ASP B C   1 
ATOM   2260 O O   . ASP B 1 137 ? -4.893  -50.821 -32.068 1.00 63.46 ? 138  ASP B O   1 
ATOM   2261 C CB  . ASP B 1 137 ? -3.936  -51.390 -34.966 1.00 66.28 ? 138  ASP B CB  1 
ATOM   2262 C CG  . ASP B 1 137 ? -4.671  -52.607 -35.443 1.00 70.05 ? 138  ASP B CG  1 
ATOM   2263 O OD1 . ASP B 1 137 ? -5.847  -52.786 -35.061 1.00 74.45 ? 138  ASP B OD1 1 
ATOM   2264 O OD2 . ASP B 1 137 ? -4.058  -53.392 -36.202 1.00 73.07 ? 138  ASP B OD2 1 
ATOM   2265 N N   . ASP B 1 138 ? -6.839  -51.054 -33.186 1.00 69.46 ? 139  ASP B N   1 
ATOM   2266 C CA  . ASP B 1 138 ? -7.637  -51.534 -32.033 1.00 70.19 ? 139  ASP B CA  1 
ATOM   2267 C C   . ASP B 1 138 ? -7.245  -52.936 -31.565 1.00 68.85 ? 139  ASP B C   1 
ATOM   2268 O O   . ASP B 1 138 ? -7.314  -53.232 -30.376 1.00 67.83 ? 139  ASP B O   1 
ATOM   2269 C CB  . ASP B 1 138 ? -9.142  -51.565 -32.385 1.00 74.46 ? 139  ASP B CB  1 
ATOM   2270 C CG  . ASP B 1 138 ? -9.909  -50.373 -31.837 1.00 77.44 ? 139  ASP B CG  1 
ATOM   2271 O OD1 . ASP B 1 138 ? -9.678  -50.013 -30.663 1.00 79.48 ? 139  ASP B OD1 1 
ATOM   2272 O OD2 . ASP B 1 138 ? -10.768 -49.816 -32.564 1.00 83.26 ? 139  ASP B OD2 1 
ATOM   2273 N N   . HIS B 1 139 ? -6.875  -53.802 -32.504 1.00 69.54 ? 140  HIS B N   1 
ATOM   2274 C CA  . HIS B 1 139 ? -6.419  -55.171 -32.191 1.00 69.36 ? 140  HIS B CA  1 
ATOM   2275 C C   . HIS B 1 139 ? -5.120  -55.250 -31.353 1.00 64.37 ? 140  HIS B C   1 
ATOM   2276 O O   . HIS B 1 139 ? -4.841  -56.284 -30.751 1.00 63.61 ? 140  HIS B O   1 
ATOM   2277 C CB  . HIS B 1 139 ? -6.259  -55.984 -33.501 1.00 72.36 ? 140  HIS B CB  1 
ATOM   2278 C CG  . HIS B 1 139 ? -5.500  -57.279 -33.350 1.00 76.46 ? 140  HIS B CG  1 
ATOM   2279 N ND1 . HIS B 1 139 ? -4.186  -57.429 -33.756 1.00 79.40 ? 140  HIS B ND1 1 
ATOM   2280 C CD2 . HIS B 1 139 ? -5.880  -58.487 -32.859 1.00 80.72 ? 140  HIS B CD2 1 
ATOM   2281 C CE1 . HIS B 1 139 ? -3.791  -58.670 -33.518 1.00 80.01 ? 140  HIS B CE1 1 
ATOM   2282 N NE2 . HIS B 1 139 ? -4.794  -59.328 -32.962 1.00 80.38 ? 140  HIS B NE2 1 
ATOM   2283 N N   . SER B 1 140 ? -4.348  -54.166 -31.310 1.00 60.29 ? 141  SER B N   1 
ATOM   2284 C CA  . SER B 1 140 ? -3.050  -54.185 -30.671 1.00 56.52 ? 141  SER B CA  1 
ATOM   2285 C C   . SER B 1 140 ? -3.092  -54.011 -29.133 1.00 53.30 ? 141  SER B C   1 
ATOM   2286 O O   . SER B 1 140 ? -3.905  -53.288 -28.594 1.00 52.48 ? 141  SER B O   1 
ATOM   2287 C CB  . SER B 1 140 ? -2.171  -53.087 -31.251 1.00 55.41 ? 141  SER B CB  1 
ATOM   2288 O OG  . SER B 1 140 ? -2.024  -53.217 -32.642 1.00 57.83 ? 141  SER B OG  1 
ATOM   2289 N N   . LYS B 1 141 ? -2.162  -54.693 -28.481 1.00 50.19 ? 142  LYS B N   1 
ATOM   2290 C CA  . LYS B 1 141 ? -1.894  -54.597 -27.075 1.00 47.47 ? 142  LYS B CA  1 
ATOM   2291 C C   . LYS B 1 141 ? -0.360  -54.587 -26.948 1.00 43.96 ? 142  LYS B C   1 
ATOM   2292 O O   . LYS B 1 141 ? 0.315   -55.468 -27.477 1.00 43.89 ? 142  LYS B O   1 
ATOM   2293 C CB  . LYS B 1 141 ? -2.510  -55.806 -26.383 1.00 49.08 ? 142  LYS B CB  1 
ATOM   2294 C CG  . LYS B 1 141 ? -2.451  -55.753 -24.881 1.00 49.59 ? 142  LYS B CG  1 
ATOM   2295 C CD  . LYS B 1 141 ? -2.922  -57.053 -24.213 1.00 51.30 ? 142  LYS B CD  1 
ATOM   2296 C CE  . LYS B 1 141 ? -4.386  -57.218 -24.210 1.00 54.23 ? 142  LYS B CE  1 
ATOM   2297 N NZ  . LYS B 1 141 ? -4.772  -58.039 -22.999 1.00 56.57 ? 142  LYS B NZ  1 
ATOM   2298 N N   . ILE B 1 142 ? 0.186   -53.571 -26.293 1.00 40.98 ? 143  ILE B N   1 
ATOM   2299 C CA  . ILE B 1 142 ? 1.640   -53.377 -26.231 1.00 38.80 ? 143  ILE B CA  1 
ATOM   2300 C C   . ILE B 1 142 ? 2.181   -53.484 -24.795 1.00 36.95 ? 143  ILE B C   1 
ATOM   2301 O O   . ILE B 1 142 ? 1.569   -52.969 -23.872 1.00 37.23 ? 143  ILE B O   1 
ATOM   2302 C CB  . ILE B 1 142 ? 2.075   -52.023 -26.888 1.00 38.15 ? 143  ILE B CB  1 
ATOM   2303 C CG1 . ILE B 1 142 ? 3.575   -51.782 -26.679 1.00 37.20 ? 143  ILE B CG1 1 
ATOM   2304 C CG2 . ILE B 1 142 ? 1.282   -50.832 -26.319 1.00 37.27 ? 143  ILE B CG2 1 
ATOM   2305 C CD1 . ILE B 1 142 ? 4.137   -50.663 -27.530 1.00 39.00 ? 143  ILE B CD1 1 
ATOM   2306 N N   . LEU B 1 143 ? 3.312   -54.163 -24.629 1.00 35.84 ? 144  LEU B N   1 
ATOM   2307 C CA  . LEU B 1 143 ? 4.054   -54.195 -23.374 1.00 35.05 ? 144  LEU B CA  1 
ATOM   2308 C C   . LEU B 1 143 ? 5.319   -53.357 -23.483 1.00 34.12 ? 144  LEU B C   1 
ATOM   2309 O O   . LEU B 1 143 ? 6.191   -53.651 -24.310 1.00 34.85 ? 144  LEU B O   1 
ATOM   2310 C CB  . LEU B 1 143 ? 4.468   -55.629 -23.041 1.00 36.39 ? 144  LEU B CB  1 
ATOM   2311 C CG  . LEU B 1 143 ? 5.369   -55.850 -21.810 1.00 37.12 ? 144  LEU B CG  1 
ATOM   2312 C CD1 . LEU B 1 143 ? 4.638   -55.531 -20.511 1.00 34.25 ? 144  LEU B CD1 1 
ATOM   2313 C CD2 . LEU B 1 143 ? 5.902   -57.322 -21.742 1.00 39.77 ? 144  LEU B CD2 1 
ATOM   2314 N N   . VAL B 1 144 ? 5.419   -52.304 -22.681 1.00 32.96 ? 145  VAL B N   1 
ATOM   2315 C CA  . VAL B 1 144 ? 6.666   -51.572 -22.520 1.00 32.35 ? 145  VAL B CA  1 
ATOM   2316 C C   . VAL B 1 144 ? 7.336   -52.082 -21.271 1.00 33.32 ? 145  VAL B C   1 
ATOM   2317 O O   . VAL B 1 144 ? 6.750   -52.060 -20.198 1.00 34.18 ? 145  VAL B O   1 
ATOM   2318 C CB  . VAL B 1 144 ? 6.428   -50.071 -22.399 1.00 31.64 ? 145  VAL B CB  1 
ATOM   2319 C CG1 . VAL B 1 144 ? 7.733   -49.350 -22.436 1.00 29.69 ? 145  VAL B CG1 1 
ATOM   2320 C CG2 . VAL B 1 144 ? 5.496   -49.595 -23.528 1.00 28.81 ? 145  VAL B CG2 1 
ATOM   2321 N N   . HIS B 1 145 ? 8.556   -52.576 -21.378 1.00 34.66 ? 146  HIS B N   1 
ATOM   2322 C CA  . HIS B 1 145 ? 9.181   -53.125 -20.182 1.00 35.51 ? 146  HIS B CA  1 
ATOM   2323 C C   . HIS B 1 145 ? 10.641  -52.764 -20.031 1.00 36.30 ? 146  HIS B C   1 
ATOM   2324 O O   . HIS B 1 145 ? 11.266  -52.290 -20.973 1.00 36.60 ? 146  HIS B O   1 
ATOM   2325 C CB  . HIS B 1 145 ? 9.021   -54.653 -20.163 1.00 36.95 ? 146  HIS B CB  1 
ATOM   2326 C CG  . HIS B 1 145 ? 10.019  -55.385 -21.001 1.00 36.50 ? 146  HIS B CG  1 
ATOM   2327 N ND1 . HIS B 1 145 ? 11.199  -55.876 -20.481 1.00 38.07 ? 146  HIS B ND1 1 
ATOM   2328 C CD2 . HIS B 1 145 ? 10.002  -55.744 -22.307 1.00 34.85 ? 146  HIS B CD2 1 
ATOM   2329 C CE1 . HIS B 1 145 ? 11.863  -56.517 -21.433 1.00 38.01 ? 146  HIS B CE1 1 
ATOM   2330 N NE2 . HIS B 1 145 ? 11.162  -56.447 -22.552 1.00 36.81 ? 146  HIS B NE2 1 
ATOM   2331 N N   . CYS B 1 146 ? 11.161  -52.954 -18.819 1.00 37.10 ? 147  CYS B N   1 
ATOM   2332 C CA  . CYS B 1 146 ? 12.600  -52.948 -18.581 1.00 38.50 ? 147  CYS B CA  1 
ATOM   2333 C C   . CYS B 1 146 ? 12.887  -54.068 -17.586 1.00 39.62 ? 147  CYS B C   1 
ATOM   2334 O O   . CYS B 1 146 ? 12.184  -55.076 -17.606 1.00 41.18 ? 147  CYS B O   1 
ATOM   2335 C CB  . CYS B 1 146 ? 13.063  -51.563 -18.145 1.00 38.23 ? 147  CYS B CB  1 
ATOM   2336 S SG  . CYS B 1 146 ? 12.112  -50.790 -16.764 1.00 41.26 ? 147  CYS B SG  1 
ATOM   2337 N N   . VAL B 1 147 ? 13.898  -53.959 -16.732 1.00 40.03 ? 148  VAL B N   1 
ATOM   2338 C CA  . VAL B 1 147 ? 14.206  -55.070 -15.827 1.00 40.33 ? 148  VAL B CA  1 
ATOM   2339 C C   . VAL B 1 147 ? 13.147  -55.145 -14.728 1.00 39.80 ? 148  VAL B C   1 
ATOM   2340 O O   . VAL B 1 147 ? 12.566  -56.210 -14.496 1.00 40.08 ? 148  VAL B O   1 
ATOM   2341 C CB  . VAL B 1 147 ? 15.644  -55.015 -15.265 1.00 42.03 ? 148  VAL B CB  1 
ATOM   2342 C CG1 . VAL B 1 147 ? 15.940  -56.252 -14.387 1.00 42.81 ? 148  VAL B CG1 1 
ATOM   2343 C CG2 . VAL B 1 147 ? 16.629  -54.957 -16.405 1.00 42.55 ? 148  VAL B CG2 1 
ATOM   2344 N N   A MET B 1 148 ? 12.907  -53.990 -14.106 0.50 38.95 ? 149  MET B N   1 
ATOM   2345 N N   B MET B 1 148 ? 12.857  -54.027 -14.069 0.50 38.67 ? 149  MET B N   1 
ATOM   2346 C CA  A MET B 1 148 ? 11.983  -53.818 -12.995 0.50 39.20 ? 149  MET B CA  1 
ATOM   2347 C CA  B MET B 1 148 ? 11.818  -54.005 -13.035 0.50 38.74 ? 149  MET B CA  1 
ATOM   2348 C C   A MET B 1 148 ? 10.638  -53.225 -13.439 0.50 37.26 ? 149  MET B C   1 
ATOM   2349 C C   B MET B 1 148 ? 10.570  -53.245 -13.456 0.50 36.95 ? 149  MET B C   1 
ATOM   2350 O O   A MET B 1 148 ? 9.634   -53.388 -12.767 0.50 36.85 ? 149  MET B O   1 
ATOM   2351 O O   B MET B 1 148 ? 9.557   -53.307 -12.778 0.50 36.49 ? 149  MET B O   1 
ATOM   2352 C CB  A MET B 1 148 ? 12.623  -52.886 -11.944 0.50 40.50 ? 149  MET B CB  1 
ATOM   2353 C CB  B MET B 1 148 ? 12.360  -53.394 -11.744 0.50 40.11 ? 149  MET B CB  1 
ATOM   2354 C CG  A MET B 1 148 ? 13.881  -53.452 -11.212 0.50 44.31 ? 149  MET B CG  1 
ATOM   2355 C CG  B MET B 1 148 ? 13.684  -54.002 -11.266 0.50 42.89 ? 149  MET B CG  1 
ATOM   2356 S SD  A MET B 1 148 ? 14.111  -52.801 -9.509  0.50 49.90 ? 149  MET B SD  1 
ATOM   2357 S SD  B MET B 1 148 ? 13.493  -55.653 -10.570 0.50 45.29 ? 149  MET B SD  1 
ATOM   2358 C CE  A MET B 1 148 ? 14.767  -51.172 -9.913  0.50 46.09 ? 149  MET B CE  1 
ATOM   2359 C CE  B MET B 1 148 ? 11.723  -55.745 -10.296 0.50 45.09 ? 149  MET B CE  1 
ATOM   2360 N N   . GLY B 1 149 ? 10.638  -52.504 -14.552 1.00 35.71 ? 150  GLY B N   1 
ATOM   2361 C CA  . GLY B 1 149 ? 9.462   -51.810 -15.032 1.00 35.31 ? 150  GLY B CA  1 
ATOM   2362 C C   . GLY B 1 149 ? 9.041   -50.619 -14.197 1.00 35.30 ? 150  GLY B C   1 
ATOM   2363 O O   . GLY B 1 149 ? 7.848   -50.325 -14.113 1.00 36.94 ? 150  GLY B O   1 
ATOM   2364 N N   . ARG B 1 150 ? 9.997   -49.951 -13.579 1.00 35.23 ? 151  ARG B N   1 
ATOM   2365 C CA  . ARG B 1 150 ? 9.731   -48.820 -12.702 1.00 36.23 ? 151  ARG B CA  1 
ATOM   2366 C C   . ARG B 1 150 ? 10.303  -47.463 -13.188 1.00 36.01 ? 151  ARG B C   1 
ATOM   2367 O O   . ARG B 1 150 ? 9.759   -46.422 -12.825 1.00 36.46 ? 151  ARG B O   1 
ATOM   2368 C CB  . ARG B 1 150 ? 10.320  -49.092 -11.322 1.00 37.57 ? 151  ARG B CB  1 
ATOM   2369 C CG  . ARG B 1 150 ? 9.949   -50.424 -10.723 1.00 39.96 ? 151  ARG B CG  1 
ATOM   2370 C CD  . ARG B 1 150 ? 8.480   -50.507 -10.370 1.00 39.15 ? 151  ARG B CD  1 
ATOM   2371 N NE  . ARG B 1 150 ? 8.092   -51.869 -9.990  1.00 37.77 ? 151  ARG B NE  1 
ATOM   2372 C CZ  . ARG B 1 150 ? 6.835   -52.310 -9.913  1.00 36.56 ? 151  ARG B CZ  1 
ATOM   2373 N NH1 . ARG B 1 150 ? 5.801   -51.511 -10.149 1.00 36.75 ? 151  ARG B NH1 1 
ATOM   2374 N NH2 . ARG B 1 150 ? 6.603   -53.559 -9.553  1.00 38.54 ? 151  ARG B NH2 1 
ATOM   2375 N N   . SER B 1 151 ? 11.401  -47.479 -13.967 1.00 35.89 ? 152  SER B N   1 
ATOM   2376 C CA  . SER B 1 151 ? 12.175  -46.253 -14.317 1.00 35.61 ? 152  SER B CA  1 
ATOM   2377 C C   . SER B 1 151 ? 12.287  -46.016 -15.818 1.00 34.32 ? 152  SER B C   1 
ATOM   2378 O O   . SER B 1 151 ? 11.705  -45.081 -16.319 1.00 33.80 ? 152  SER B O   1 
ATOM   2379 C CB  . SER B 1 151 ? 13.575  -46.311 -13.689 1.00 37.20 ? 152  SER B CB  1 
ATOM   2380 O OG  . SER B 1 151 ? 14.387  -45.205 -14.045 1.00 39.21 ? 152  SER B OG  1 
ATOM   2381 N N   . ARG B 1 152 ? 13.026  -46.862 -16.533 1.00 34.29 ? 153  ARG B N   1 
ATOM   2382 C CA  . ARG B 1 152 ? 13.228  -46.678 -17.969 1.00 34.34 ? 153  ARG B CA  1 
ATOM   2383 C C   . ARG B 1 152 ? 11.904  -46.757 -18.728 1.00 34.18 ? 153  ARG B C   1 
ATOM   2384 O O   . ARG B 1 152 ? 11.579  -45.865 -19.511 1.00 33.45 ? 153  ARG B O   1 
ATOM   2385 C CB  . ARG B 1 152 ? 14.204  -47.718 -18.539 1.00 34.51 ? 153  ARG B CB  1 
ATOM   2386 C CG  . ARG B 1 152 ? 15.671  -47.481 -18.150 1.00 35.48 ? 153  ARG B CG  1 
ATOM   2387 C CD  . ARG B 1 152 ? 16.501  -48.652 -18.557 1.00 34.36 ? 153  ARG B CD  1 
ATOM   2388 N NE  . ARG B 1 152 ? 16.375  -49.691 -17.551 1.00 34.16 ? 153  ARG B NE  1 
ATOM   2389 C CZ  . ARG B 1 152 ? 17.238  -50.683 -17.374 1.00 35.30 ? 153  ARG B CZ  1 
ATOM   2390 N NH1 . ARG B 1 152 ? 18.320  -50.810 -18.159 1.00 34.76 ? 153  ARG B NH1 1 
ATOM   2391 N NH2 . ARG B 1 152 ? 17.047  -51.532 -16.386 1.00 30.85 ? 153  ARG B NH2 1 
ATOM   2392 N N   . SER B 1 153 ? 11.154  -47.833 -18.496 1.00 33.91 ? 154  SER B N   1 
ATOM   2393 C CA  . SER B 1 153 ? 9.945   -48.039 -19.263 1.00 34.65 ? 154  SER B CA  1 
ATOM   2394 C C   . SER B 1 153 ? 8.942   -46.956 -18.912 1.00 34.65 ? 154  SER B C   1 
ATOM   2395 O O   . SER B 1 153 ? 8.292   -46.382 -19.797 1.00 35.47 ? 154  SER B O   1 
ATOM   2396 C CB  . SER B 1 153 ? 9.371   -49.436 -19.036 1.00 34.86 ? 154  SER B CB  1 
ATOM   2397 O OG  . SER B 1 153 ? 9.383   -49.794 -17.670 1.00 36.88 ? 154  SER B OG  1 
ATOM   2398 N N   . ALA B 1 154 ? 8.844   -46.676 -17.616 1.00 33.91 ? 155  ALA B N   1 
ATOM   2399 C CA  . ALA B 1 154 ? 7.922   -45.682 -17.112 1.00 33.68 ? 155  ALA B CA  1 
ATOM   2400 C C   . ALA B 1 154 ? 8.199   -44.361 -17.823 1.00 33.31 ? 155  ALA B C   1 
ATOM   2401 O O   . ALA B 1 154 ? 7.267   -43.678 -18.272 1.00 34.01 ? 155  ALA B O   1 
ATOM   2402 C CB  . ALA B 1 154 ? 8.052   -45.546 -15.563 1.00 32.94 ? 155  ALA B CB  1 
ATOM   2403 N N   . THR B 1 155 ? 9.473   -43.994 -17.931 1.00 32.81 ? 156  THR B N   1 
ATOM   2404 C CA  . THR B 1 155 ? 9.828   -42.708 -18.542 1.00 32.77 ? 156  THR B CA  1 
ATOM   2405 C C   . THR B 1 155 ? 9.410   -42.627 -20.014 1.00 32.87 ? 156  THR B C   1 
ATOM   2406 O O   . THR B 1 155 ? 9.022   -41.565 -20.470 1.00 34.21 ? 156  THR B O   1 
ATOM   2407 C CB  . THR B 1 155 ? 11.308  -42.420 -18.432 1.00 33.54 ? 156  THR B CB  1 
ATOM   2408 O OG1 . THR B 1 155 ? 11.696  -42.494 -17.056 1.00 33.28 ? 156  THR B OG1 1 
ATOM   2409 C CG2 . THR B 1 155 ? 11.666  -40.999 -19.013 1.00 33.06 ? 156  THR B CG2 1 
ATOM   2410 N N   . LEU B 1 156 ? 9.459   -43.740 -20.751 1.00 31.85 ? 157  LEU B N   1 
ATOM   2411 C CA  . LEU B 1 156 ? 9.046   -43.735 -22.160 1.00 31.61 ? 157  LEU B CA  1 
ATOM   2412 C C   . LEU B 1 156 ? 7.532   -43.611 -22.314 1.00 31.77 ? 157  LEU B C   1 
ATOM   2413 O O   . LEU B 1 156 ? 7.040   -42.911 -23.193 1.00 32.83 ? 157  LEU B O   1 
ATOM   2414 C CB  . LEU B 1 156 ? 9.589   -44.962 -22.917 1.00 31.28 ? 157  LEU B CB  1 
ATOM   2415 C CG  . LEU B 1 156 ? 11.119  -45.039 -23.109 1.00 30.83 ? 157  LEU B CG  1 
ATOM   2416 C CD1 . LEU B 1 156 ? 11.463  -46.333 -23.869 1.00 29.63 ? 157  LEU B CD1 1 
ATOM   2417 C CD2 . LEU B 1 156 ? 11.711  -43.820 -23.852 1.00 27.74 ? 157  LEU B CD2 1 
ATOM   2418 N N   . VAL B 1 157 ? 6.775   -44.254 -21.434 1.00 31.91 ? 158  VAL B N   1 
ATOM   2419 C CA  . VAL B 1 157 ? 5.332   -44.117 -21.467 1.00 31.47 ? 158  VAL B CA  1 
ATOM   2420 C C   . VAL B 1 157 ? 4.919   -42.710 -21.033 1.00 32.51 ? 158  VAL B C   1 
ATOM   2421 O O   . VAL B 1 157 ? 3.974   -42.147 -21.556 1.00 33.16 ? 158  VAL B O   1 
ATOM   2422 C CB  . VAL B 1 157 ? 4.664   -45.204 -20.619 1.00 31.84 ? 158  VAL B CB  1 
ATOM   2423 C CG1 . VAL B 1 157 ? 3.140   -44.944 -20.491 1.00 31.17 ? 158  VAL B CG1 1 
ATOM   2424 C CG2 . VAL B 1 157 ? 4.969   -46.583 -21.249 1.00 28.87 ? 158  VAL B CG2 1 
ATOM   2425 N N   . LEU B 1 158 ? 5.625   -42.130 -20.082 1.00 32.72 ? 159  LEU B N   1 
ATOM   2426 C CA  . LEU B 1 158 ? 5.316   -40.758 -19.676 1.00 34.17 ? 159  LEU B CA  1 
ATOM   2427 C C   . LEU B 1 158 ? 5.513   -39.816 -20.873 1.00 36.59 ? 159  LEU B C   1 
ATOM   2428 O O   . LEU B 1 158 ? 4.622   -39.021 -21.206 1.00 38.60 ? 159  LEU B O   1 
ATOM   2429 C CB  . LEU B 1 158 ? 6.178   -40.350 -18.490 1.00 34.21 ? 159  LEU B CB  1 
ATOM   2430 C CG  . LEU B 1 158 ? 5.778   -41.007 -17.132 1.00 33.60 ? 159  LEU B CG  1 
ATOM   2431 C CD1 . LEU B 1 158 ? 6.837   -40.760 -16.070 1.00 32.03 ? 159  LEU B CD1 1 
ATOM   2432 C CD2 . LEU B 1 158 ? 4.432   -40.501 -16.613 1.00 29.97 ? 159  LEU B CD2 1 
ATOM   2433 N N   . ALA B 1 159 ? 6.671   -39.942 -21.538 1.00 36.38 ? 160  ALA B N   1 
ATOM   2434 C CA  . ALA B 1 159 ? 6.988   -39.155 -22.706 1.00 37.84 ? 160  ALA B CA  1 
ATOM   2435 C C   . ALA B 1 159 ? 5.922   -39.369 -23.784 1.00 38.13 ? 160  ALA B C   1 
ATOM   2436 O O   . ALA B 1 159 ? 5.472   -38.417 -24.390 1.00 38.94 ? 160  ALA B O   1 
ATOM   2437 C CB  . ALA B 1 159 ? 8.391   -39.518 -23.250 1.00 37.00 ? 160  ALA B CB  1 
ATOM   2438 N N   . TYR B 1 160 ? 5.498   -40.611 -23.980 1.00 37.40 ? 161  TYR B N   1 
ATOM   2439 C CA  . TYR B 1 160 ? 4.448   -40.888 -24.944 1.00 38.62 ? 161  TYR B CA  1 
ATOM   2440 C C   . TYR B 1 160 ? 3.179   -40.118 -24.635 1.00 40.39 ? 161  TYR B C   1 
ATOM   2441 O O   . TYR B 1 160 ? 2.592   -39.492 -25.505 1.00 42.41 ? 161  TYR B O   1 
ATOM   2442 C CB  . TYR B 1 160 ? 4.123   -42.374 -24.993 1.00 37.60 ? 161  TYR B CB  1 
ATOM   2443 C CG  . TYR B 1 160 ? 2.831   -42.646 -25.725 1.00 39.30 ? 161  TYR B CG  1 
ATOM   2444 C CD1 . TYR B 1 160 ? 2.752   -42.552 -27.109 1.00 42.21 ? 161  TYR B CD1 1 
ATOM   2445 C CD2 . TYR B 1 160 ? 1.678   -42.965 -25.024 1.00 39.88 ? 161  TYR B CD2 1 
ATOM   2446 C CE1 . TYR B 1 160 ? 1.530   -42.802 -27.780 1.00 45.00 ? 161  TYR B CE1 1 
ATOM   2447 C CE2 . TYR B 1 160 ? 0.503   -43.200 -25.653 1.00 42.26 ? 161  TYR B CE2 1 
ATOM   2448 C CZ  . TYR B 1 160 ? 0.416   -43.111 -27.020 1.00 44.39 ? 161  TYR B CZ  1 
ATOM   2449 O OH  . TYR B 1 160 ? -0.788  -43.365 -27.583 1.00 46.87 ? 161  TYR B OH  1 
ATOM   2450 N N   . LEU B 1 161 ? 2.722   -40.196 -23.396 1.00 40.44 ? 162  LEU B N   1 
ATOM   2451 C CA  . LEU B 1 161 ? 1.475   -39.538 -23.041 1.00 42.49 ? 162  LEU B CA  1 
ATOM   2452 C C   . LEU B 1 161 ? 1.567   -38.027 -23.269 1.00 44.63 ? 162  LEU B C   1 
ATOM   2453 O O   . LEU B 1 161 ? 0.583   -37.408 -23.632 1.00 46.64 ? 162  LEU B O   1 
ATOM   2454 C CB  . LEU B 1 161 ? 1.056   -39.871 -21.606 1.00 41.72 ? 162  LEU B CB  1 
ATOM   2455 C CG  . LEU B 1 161 ? 0.634   -41.346 -21.413 1.00 41.40 ? 162  LEU B CG  1 
ATOM   2456 C CD1 . LEU B 1 161 ? 0.242   -41.586 -20.005 1.00 39.68 ? 162  LEU B CD1 1 
ATOM   2457 C CD2 . LEU B 1 161 ? -0.513  -41.759 -22.348 1.00 41.68 ? 162  LEU B CD2 1 
ATOM   2458 N N   . MET B 1 162 ? 2.756   -37.458 -23.071 1.00 44.48 ? 163  MET B N   1 
ATOM   2459 C CA  . MET B 1 162 ? 2.973   -36.017 -23.200 1.00 46.48 ? 163  MET B CA  1 
ATOM   2460 C C   . MET B 1 162 ? 2.979   -35.570 -24.644 1.00 47.66 ? 163  MET B C   1 
ATOM   2461 O O   . MET B 1 162 ? 2.420   -34.535 -24.974 1.00 50.77 ? 163  MET B O   1 
ATOM   2462 C CB  . MET B 1 162 ? 4.302   -35.603 -22.536 1.00 45.99 ? 163  MET B CB  1 
ATOM   2463 C CG  . MET B 1 162 ? 4.249   -35.551 -20.982 1.00 46.06 ? 163  MET B CG  1 
ATOM   2464 S SD  . MET B 1 162 ? 5.876   -35.818 -20.220 1.00 43.39 ? 163  MET B SD  1 
ATOM   2465 C CE  . MET B 1 162 ? 6.638   -34.187 -20.344 1.00 43.08 ? 163  MET B CE  1 
ATOM   2466 N N   . ILE B 1 163 ? 3.642   -36.342 -25.494 1.00 46.03 ? 164  ILE B N   1 
ATOM   2467 C CA  . ILE B 1 163 ? 3.847   -35.971 -26.878 1.00 47.16 ? 164  ILE B CA  1 
ATOM   2468 C C   . ILE B 1 163 ? 2.589   -36.203 -27.705 1.00 49.33 ? 164  ILE B C   1 
ATOM   2469 O O   . ILE B 1 163 ? 2.305   -35.432 -28.615 1.00 50.56 ? 164  ILE B O   1 
ATOM   2470 C CB  . ILE B 1 163 ? 4.993   -36.802 -27.490 1.00 45.60 ? 164  ILE B CB  1 
ATOM   2471 C CG1 . ILE B 1 163 ? 6.318   -36.440 -26.828 1.00 42.90 ? 164  ILE B CG1 1 
ATOM   2472 C CG2 . ILE B 1 163 ? 5.047   -36.659 -29.058 1.00 45.22 ? 164  ILE B CG2 1 
ATOM   2473 C CD1 . ILE B 1 163 ? 7.423   -37.333 -27.260 1.00 39.47 ? 164  ILE B CD1 1 
ATOM   2474 N N   . HIS B 1 164 ? 1.851   -37.268 -27.382 1.00 48.51 ? 165  HIS B N   1 
ATOM   2475 C CA  . HIS B 1 164 ? 0.747   -37.728 -28.230 1.00 50.65 ? 165  HIS B CA  1 
ATOM   2476 C C   . HIS B 1 164 ? -0.665  -37.625 -27.635 1.00 52.21 ? 165  HIS B C   1 
ATOM   2477 O O   . HIS B 1 164 ? -1.633  -37.721 -28.370 1.00 54.15 ? 165  HIS B O   1 
ATOM   2478 C CB  . HIS B 1 164 ? 1.012   -39.181 -28.650 1.00 49.15 ? 165  HIS B CB  1 
ATOM   2479 C CG  . HIS B 1 164 ? 2.084   -39.314 -29.683 1.00 49.70 ? 165  HIS B CG  1 
ATOM   2480 N ND1 . HIS B 1 164 ? 1.935   -38.838 -30.963 1.00 53.44 ? 165  HIS B ND1 1 
ATOM   2481 C CD2 . HIS B 1 164 ? 3.331   -39.840 -29.619 1.00 49.40 ? 165  HIS B CD2 1 
ATOM   2482 C CE1 . HIS B 1 164 ? 3.037   -39.074 -31.654 1.00 52.98 ? 165  HIS B CE1 1 
ATOM   2483 N NE2 . HIS B 1 164 ? 3.901   -39.682 -30.862 1.00 52.10 ? 165  HIS B NE2 1 
ATOM   2484 N N   . LYS B 1 165 ? -0.789  -37.461 -26.323 1.00 51.87 ? 166  LYS B N   1 
ATOM   2485 C CA  . LYS B 1 165 ? -2.094  -37.359 -25.694 1.00 53.78 ? 166  LYS B CA  1 
ATOM   2486 C C   . LYS B 1 165 ? -2.258  -36.028 -24.982 1.00 56.17 ? 166  LYS B C   1 
ATOM   2487 O O   . LYS B 1 165 ? -3.075  -35.898 -24.074 1.00 56.80 ? 166  LYS B O   1 
ATOM   2488 C CB  . LYS B 1 165 ? -2.307  -38.532 -24.732 1.00 51.81 ? 166  LYS B CB  1 
ATOM   2489 C CG  . LYS B 1 165 ? -2.336  -39.901 -25.428 1.00 50.92 ? 166  LYS B CG  1 
ATOM   2490 C CD  . LYS B 1 165 ? -3.553  -40.037 -26.395 1.00 53.10 ? 166  LYS B CD  1 
ATOM   2491 C CE  . LYS B 1 165 ? -3.415  -41.230 -27.334 1.00 50.45 ? 166  LYS B CE  1 
ATOM   2492 N NZ  . LYS B 1 165 ? -4.537  -41.286 -28.280 1.00 52.59 ? 166  LYS B NZ  1 
ATOM   2493 N N   . ASP B 1 166 ? -1.482  -35.042 -25.418 1.00 57.60 ? 167  ASP B N   1 
ATOM   2494 C CA  . ASP B 1 166 ? -1.601  -33.655 -24.941 1.00 61.30 ? 167  ASP B CA  1 
ATOM   2495 C C   . ASP B 1 166 ? -1.568  -33.487 -23.420 1.00 60.55 ? 167  ASP B C   1 
ATOM   2496 O O   . ASP B 1 166 ? -2.286  -32.673 -22.858 1.00 63.44 ? 167  ASP B O   1 
ATOM   2497 C CB  . ASP B 1 166 ? -2.877  -33.025 -25.486 1.00 65.26 ? 167  ASP B CB  1 
ATOM   2498 C CG  . ASP B 1 166 ? -2.804  -31.508 -25.510 1.00 72.01 ? 167  ASP B CG  1 
ATOM   2499 O OD1 . ASP B 1 166 ? -1.707  -30.985 -25.849 1.00 75.17 ? 167  ASP B OD1 1 
ATOM   2500 O OD2 . ASP B 1 166 ? -3.833  -30.846 -25.200 1.00 77.15 ? 167  ASP B OD2 1 
ATOM   2501 N N   . MET B 1 167 ? -0.734  -34.266 -22.758 1.00 57.19 ? 168  MET B N   1 
ATOM   2502 C CA  . MET B 1 167 ? -0.641  -34.186 -21.320 1.00 56.84 ? 168  MET B CA  1 
ATOM   2503 C C   . MET B 1 167 ? 0.586   -33.403 -20.895 1.00 55.90 ? 168  MET B C   1 
ATOM   2504 O O   . MET B 1 167 ? 1.663   -33.451 -21.534 1.00 54.52 ? 168  MET B O   1 
ATOM   2505 C CB  . MET B 1 167 ? -0.587  -35.586 -20.695 1.00 54.45 ? 168  MET B CB  1 
ATOM   2506 C CG  . MET B 1 167 ? -1.903  -36.339 -20.782 1.00 56.40 ? 168  MET B CG  1 
ATOM   2507 S SD  . MET B 1 167 ? -1.931  -37.765 -19.688 1.00 58.03 ? 168  MET B SD  1 
ATOM   2508 C CE  . MET B 1 167 ? -3.374  -38.626 -20.344 1.00 58.22 ? 168  MET B CE  1 
ATOM   2509 N N   . THR B 1 168 ? 0.397   -32.683 -19.797 1.00 56.28 ? 169  THR B N   1 
ATOM   2510 C CA  . THR B 1 168 ? 1.487   -32.133 -19.045 1.00 54.92 ? 169  THR B CA  1 
ATOM   2511 C C   . THR B 1 168 ? 2.138   -33.291 -18.288 1.00 51.52 ? 169  THR B C   1 
ATOM   2512 O O   . THR B 1 168 ? 1.543   -34.362 -18.088 1.00 50.00 ? 169  THR B O   1 
ATOM   2513 C CB  . THR B 1 168 ? 1.009   -31.104 -18.008 1.00 57.81 ? 169  THR B CB  1 
ATOM   2514 O OG1 . THR B 1 168 ? 0.375   -31.804 -16.938 1.00 54.96 ? 169  THR B OG1 1 
ATOM   2515 C CG2 . THR B 1 168 ? 0.048   -30.060 -18.630 1.00 59.55 ? 169  THR B CG2 1 
ATOM   2516 N N   . LEU B 1 169 ? 3.353   -33.042 -17.829 1.00 50.21 ? 170  LEU B N   1 
ATOM   2517 C CA  . LEU B 1 169 ? 4.113   -34.033 -17.120 1.00 47.19 ? 170  LEU B CA  1 
ATOM   2518 C C   . LEU B 1 169 ? 3.362   -34.428 -15.857 1.00 47.15 ? 170  LEU B C   1 
ATOM   2519 O O   . LEU B 1 169 ? 3.361   -35.586 -15.498 1.00 45.08 ? 170  LEU B O   1 
ATOM   2520 C CB  . LEU B 1 169 ? 5.544   -33.534 -16.828 1.00 46.53 ? 170  LEU B CB  1 
ATOM   2521 C CG  . LEU B 1 169 ? 6.435   -34.407 -15.932 1.00 44.87 ? 170  LEU B CG  1 
ATOM   2522 C CD1 . LEU B 1 169 ? 6.484   -35.854 -16.384 1.00 38.46 ? 170  LEU B CD1 1 
ATOM   2523 C CD2 . LEU B 1 169 ? 7.834   -33.803 -15.857 1.00 45.72 ? 170  LEU B CD2 1 
ATOM   2524 N N   . VAL B 1 170 ? 2.714   -33.467 -15.199 1.00 49.90 ? 171  VAL B N   1 
ATOM   2525 C CA  . VAL B 1 170 ? 1.900   -33.763 -14.016 1.00 49.94 ? 171  VAL B CA  1 
ATOM   2526 C C   . VAL B 1 170 ? 0.702   -34.671 -14.336 1.00 49.62 ? 171  VAL B C   1 
ATOM   2527 O O   . VAL B 1 170 ? 0.453   -35.645 -13.626 1.00 48.44 ? 171  VAL B O   1 
ATOM   2528 C CB  . VAL B 1 170 ? 1.398   -32.486 -13.308 1.00 53.31 ? 171  VAL B CB  1 
ATOM   2529 C CG1 . VAL B 1 170 ? 0.299   -32.838 -12.314 1.00 51.89 ? 171  VAL B CG1 1 
ATOM   2530 C CG2 . VAL B 1 170 ? 2.568   -31.773 -12.609 1.00 54.21 ? 171  VAL B CG2 1 
ATOM   2531 N N   . ASP B 1 171 ? -0.038  -34.365 -15.389 1.00 50.81 ? 172  ASP B N   1 
ATOM   2532 C CA  . ASP B 1 171 ? -1.182  -35.209 -15.757 1.00 51.15 ? 172  ASP B CA  1 
ATOM   2533 C C   . ASP B 1 171 ? -0.702  -36.632 -16.088 1.00 47.41 ? 172  ASP B C   1 
ATOM   2534 O O   . ASP B 1 171 ? -1.287  -37.628 -15.637 1.00 47.09 ? 172  ASP B O   1 
ATOM   2535 C CB  . ASP B 1 171 ? -1.918  -34.629 -16.966 1.00 53.75 ? 172  ASP B CB  1 
ATOM   2536 C CG  . ASP B 1 171 ? -2.519  -33.252 -16.695 1.00 58.85 ? 172  ASP B CG  1 
ATOM   2537 O OD1 . ASP B 1 171 ? -2.909  -32.974 -15.546 1.00 60.90 ? 172  ASP B OD1 1 
ATOM   2538 O OD2 . ASP B 1 171 ? -2.584  -32.447 -17.651 1.00 65.03 ? 172  ASP B OD2 1 
ATOM   2539 N N   . ALA B 1 172 ? 0.386   -36.711 -16.841 1.00 44.56 ? 173  ALA B N   1 
ATOM   2540 C CA  . ALA B 1 172 ? 0.977   -37.997 -17.224 1.00 41.36 ? 173  ALA B CA  1 
ATOM   2541 C C   . ALA B 1 172 ? 1.399   -38.840 -16.034 1.00 39.18 ? 173  ALA B C   1 
ATOM   2542 O O   . ALA B 1 172 ? 1.146   -40.037 -15.996 1.00 37.89 ? 173  ALA B O   1 
ATOM   2543 C CB  . ALA B 1 172 ? 2.185   -37.774 -18.177 1.00 39.53 ? 173  ALA B CB  1 
ATOM   2544 N N   . ILE B 1 173 ? 2.080   -38.229 -15.080 1.00 39.36 ? 174  ILE B N   1 
ATOM   2545 C CA  . ILE B 1 173 ? 2.466   -38.939 -13.853 1.00 38.34 ? 174  ILE B CA  1 
ATOM   2546 C C   . ILE B 1 173 ? 1.220   -39.471 -13.113 1.00 39.52 ? 174  ILE B C   1 
ATOM   2547 O O   . ILE B 1 173 ? 1.218   -40.605 -12.640 1.00 37.90 ? 174  ILE B O   1 
ATOM   2548 C CB  . ILE B 1 173 ? 3.268   -38.028 -12.893 1.00 39.15 ? 174  ILE B CB  1 
ATOM   2549 C CG1 . ILE B 1 173 ? 4.672   -37.778 -13.459 1.00 36.99 ? 174  ILE B CG1 1 
ATOM   2550 C CG2 . ILE B 1 173 ? 3.331   -38.639 -11.468 1.00 36.64 ? 174  ILE B CG2 1 
ATOM   2551 C CD1 . ILE B 1 173 ? 5.452   -36.611 -12.727 1.00 36.26 ? 174  ILE B CD1 1 
ATOM   2552 N N   . GLN B 1 174 ? 0.172   -38.661 -13.016 1.00 42.19 ? 175  GLN B N   1 
ATOM   2553 C CA  . GLN B 1 174 ? -1.079  -39.115 -12.345 1.00 44.66 ? 175  GLN B CA  1 
ATOM   2554 C C   . GLN B 1 174 ? -1.700  -40.334 -13.081 1.00 43.20 ? 175  GLN B C   1 
ATOM   2555 O O   . GLN B 1 174 ? -2.091  -41.321 -12.462 1.00 42.86 ? 175  GLN B O   1 
ATOM   2556 C CB  . GLN B 1 174 ? -2.050  -37.931 -12.127 1.00 48.13 ? 175  GLN B CB  1 
ATOM   2557 C CG  . GLN B 1 174 ? -1.437  -36.886 -11.106 1.00 53.17 ? 175  GLN B CG  1 
ATOM   2558 C CD  . GLN B 1 174 ? -2.161  -35.513 -10.988 1.00 61.98 ? 175  GLN B CD  1 
ATOM   2559 O OE1 . GLN B 1 174 ? -2.304  -34.965 -9.868  1.00 66.99 ? 175  GLN B OE1 1 
ATOM   2560 N NE2 . GLN B 1 174 ? -2.595  -34.947 -12.130 1.00 63.14 ? 175  GLN B NE2 1 
ATOM   2561 N N   . GLN B 1 175 ? -1.701  -40.297 -14.407 1.00 42.68 ? 176  GLN B N   1 
ATOM   2562 C CA  . GLN B 1 175 ? -2.223  -41.417 -15.206 1.00 41.74 ? 176  GLN B CA  1 
ATOM   2563 C C   . GLN B 1 175 ? -1.470  -42.721 -14.922 1.00 39.64 ? 176  GLN B C   1 
ATOM   2564 O O   . GLN B 1 175 ? -2.090  -43.751 -14.677 1.00 40.38 ? 176  GLN B O   1 
ATOM   2565 C CB  . GLN B 1 175 ? -2.149  -41.093 -16.692 1.00 41.09 ? 176  GLN B CB  1 
ATOM   2566 C CG  . GLN B 1 175 ? -2.664  -42.163 -17.612 1.00 40.01 ? 176  GLN B CG  1 
ATOM   2567 C CD  . GLN B 1 175 ? -4.072  -42.541 -17.299 1.00 41.98 ? 176  GLN B CD  1 
ATOM   2568 O OE1 . GLN B 1 175 ? -4.924  -41.678 -17.082 1.00 46.06 ? 176  GLN B OE1 1 
ATOM   2569 N NE2 . GLN B 1 175 ? -4.331  -43.840 -17.250 1.00 38.18 ? 176  GLN B NE2 1 
ATOM   2570 N N   . VAL B 1 176 ? -0.142  -42.664 -14.933 1.00 37.91 ? 177  VAL B N   1 
ATOM   2571 C CA  . VAL B 1 176 ? 0.683   -43.857 -14.802 1.00 35.53 ? 177  VAL B CA  1 
ATOM   2572 C C   . VAL B 1 176 ? 0.787   -44.288 -13.361 1.00 35.63 ? 177  VAL B C   1 
ATOM   2573 O O   . VAL B 1 176 ? 0.522   -45.439 -13.040 1.00 36.71 ? 177  VAL B O   1 
ATOM   2574 C CB  . VAL B 1 176 ? 2.087   -43.666 -15.450 1.00 34.06 ? 177  VAL B CB  1 
ATOM   2575 C CG1 . VAL B 1 176 ? 2.996   -44.857 -15.162 1.00 32.76 ? 177  VAL B CG1 1 
ATOM   2576 C CG2 . VAL B 1 176 ? 1.952   -43.489 -16.963 1.00 32.18 ? 177  VAL B CG2 1 
ATOM   2577 N N   . ALA B 1 177 ? 1.143   -43.371 -12.476 1.00 35.89 ? 178  ALA B N   1 
ATOM   2578 C CA  . ALA B 1 177 ? 1.366   -43.710 -11.061 1.00 35.29 ? 178  ALA B CA  1 
ATOM   2579 C C   . ALA B 1 177 ? 0.145   -44.308 -10.343 1.00 37.26 ? 178  ALA B C   1 
ATOM   2580 O O   . ALA B 1 177 ? 0.300   -45.092 -9.387  1.00 37.61 ? 178  ALA B O   1 
ATOM   2581 C CB  . ALA B 1 177 ? 1.870   -42.486 -10.328 1.00 35.40 ? 178  ALA B CB  1 
ATOM   2582 N N   . LYS B 1 178 ? -1.079  -43.967 -10.768 1.00 38.29 ? 179  LYS B N   1 
ATOM   2583 C CA  . LYS B 1 178 ? -2.248  -44.586 -10.131 1.00 39.86 ? 179  LYS B CA  1 
ATOM   2584 C C   . LYS B 1 178 ? -2.394  -46.053 -10.496 1.00 39.46 ? 179  LYS B C   1 
ATOM   2585 O O   . LYS B 1 178 ? -3.068  -46.793 -9.791  1.00 40.60 ? 179  LYS B O   1 
ATOM   2586 C CB  . LYS B 1 178 ? -3.540  -43.831 -10.450 1.00 41.92 ? 179  LYS B CB  1 
ATOM   2587 C CG  . LYS B 1 178 ? -3.990  -43.933 -11.900 1.00 41.81 ? 179  LYS B CG  1 
ATOM   2588 C CD  . LYS B 1 178 ? -5.072  -42.896 -12.199 1.00 42.25 ? 179  LYS B CD  1 
ATOM   2589 C CE  . LYS B 1 178 ? -5.773  -43.129 -13.525 1.00 39.39 ? 179  LYS B CE  1 
ATOM   2590 N NZ  . LYS B 1 178 ? -6.853  -42.133 -13.586 1.00 42.76 ? 179  LYS B NZ  1 
ATOM   2591 N N   . ASN B 1 179 ? -1.777  -46.448 -11.612 1.00 38.41 ? 180  ASN B N   1 
ATOM   2592 C CA  . ASN B 1 179 ? -1.863  -47.810 -12.155 1.00 38.45 ? 180  ASN B CA  1 
ATOM   2593 C C   . ASN B 1 179 ? -0.636  -48.687 -11.840 1.00 37.51 ? 180  ASN B C   1 
ATOM   2594 O O   . ASN B 1 179 ? -0.753  -49.924 -11.807 1.00 39.17 ? 180  ASN B O   1 
ATOM   2595 C CB  . ASN B 1 179 ? -2.081  -47.750 -13.669 1.00 36.85 ? 180  ASN B CB  1 
ATOM   2596 C CG  . ASN B 1 179 ? -3.501  -47.381 -14.029 1.00 38.39 ? 180  ASN B CG  1 
ATOM   2597 O OD1 . ASN B 1 179 ? -4.458  -48.050 -13.622 1.00 42.89 ? 180  ASN B OD1 1 
ATOM   2598 N ND2 . ASN B 1 179 ? -3.656  -46.292 -14.753 1.00 34.66 ? 180  ASN B ND2 1 
ATOM   2599 N N   . ARG B 1 180 ? 0.504   -48.058 -11.584 1.00 35.42 ? 181  ARG B N   1 
ATOM   2600 C CA  . ARG B 1 180 ? 1.733   -48.781 -11.330 1.00 34.61 ? 181  ARG B CA  1 
ATOM   2601 C C   . ARG B 1 180 ? 2.702   -47.925 -10.499 1.00 34.27 ? 181  ARG B C   1 
ATOM   2602 O O   . ARG B 1 180 ? 2.903   -46.736 -10.767 1.00 34.27 ? 181  ARG B O   1 
ATOM   2603 C CB  . ARG B 1 180 ? 2.380   -49.181 -12.671 1.00 33.93 ? 181  ARG B CB  1 
ATOM   2604 C CG  . ARG B 1 180 ? 3.615   -50.051 -12.517 1.00 34.43 ? 181  ARG B CG  1 
ATOM   2605 C CD  . ARG B 1 180 ? 4.111   -50.596 -13.830 1.00 34.61 ? 181  ARG B CD  1 
ATOM   2606 N NE  . ARG B 1 180 ? 5.291   -51.427 -13.620 1.00 34.49 ? 181  ARG B NE  1 
ATOM   2607 C CZ  . ARG B 1 180 ? 5.268   -52.686 -13.187 1.00 35.33 ? 181  ARG B CZ  1 
ATOM   2608 N NH1 . ARG B 1 180 ? 4.125   -53.287 -12.908 1.00 35.97 ? 181  ARG B NH1 1 
ATOM   2609 N NH2 . ARG B 1 180 ? 6.413   -53.353 -13.019 1.00 36.69 ? 181  ARG B NH2 1 
ATOM   2610 N N   . CYS B 1 181 ? 3.295   -48.525 -9.479  1.00 35.25 ? 182  CYS B N   1 
ATOM   2611 C CA  . CYS B 1 181 ? 4.352   -47.860 -8.713  1.00 35.68 ? 182  CYS B CA  1 
ATOM   2612 C C   . CYS B 1 181 ? 5.503   -47.646 -9.675  1.00 33.53 ? 182  CYS B C   1 
ATOM   2613 O O   . CYS B 1 181 ? 6.098   -48.622 -10.086 1.00 33.53 ? 182  CYS B O   1 
ATOM   2614 C CB  . CYS B 1 181 ? 4.854   -48.721 -7.569  1.00 36.33 ? 182  CYS B CB  1 
ATOM   2615 S SG  . CYS B 1 181 ? 3.674   -49.173 -6.343  1.00 41.72 ? 182  CYS B SG  1 
ATOM   2616 N N   . VAL B 1 182 ? 5.775   -46.396 -10.042 1.00 32.64 ? 183  VAL B N   1 
ATOM   2617 C CA  . VAL B 1 182 ? 6.922   -46.045 -10.891 1.00 32.22 ? 183  VAL B CA  1 
ATOM   2618 C C   . VAL B 1 182 ? 7.720   -44.914 -10.270 1.00 33.55 ? 183  VAL B C   1 
ATOM   2619 O O   . VAL B 1 182 ? 7.204   -44.135 -9.473  1.00 35.28 ? 183  VAL B O   1 
ATOM   2620 C CB  . VAL B 1 182 ? 6.492   -45.615 -12.304 1.00 30.74 ? 183  VAL B CB  1 
ATOM   2621 C CG1 . VAL B 1 182 ? 5.778   -46.774 -12.975 1.00 29.07 ? 183  VAL B CG1 1 
ATOM   2622 C CG2 . VAL B 1 182 ? 5.589   -44.378 -12.229 1.00 31.24 ? 183  VAL B CG2 1 
ATOM   2623 N N   . LEU B 1 183 ? 8.995   -44.866 -10.611 1.00 33.68 ? 184  LEU B N   1 
ATOM   2624 C CA  . LEU B 1 183 ? 9.887   -43.822 -10.129 1.00 34.52 ? 184  LEU B CA  1 
ATOM   2625 C C   . LEU B 1 183 ? 11.059  -43.706 -11.112 1.00 33.45 ? 184  LEU B C   1 
ATOM   2626 O O   . LEU B 1 183 ? 12.036  -44.421 -11.011 1.00 33.56 ? 184  LEU B O   1 
ATOM   2627 C CB  . LEU B 1 183 ? 10.365  -44.114 -8.722  1.00 35.61 ? 184  LEU B CB  1 
ATOM   2628 C CG  . LEU B 1 183 ? 11.242  -43.020 -8.101  1.00 38.37 ? 184  LEU B CG  1 
ATOM   2629 C CD1 . LEU B 1 183 ? 10.429  -41.707 -7.932  1.00 39.40 ? 184  LEU B CD1 1 
ATOM   2630 C CD2 . LEU B 1 183 ? 11.803  -43.523 -6.762  1.00 38.52 ? 184  LEU B CD2 1 
ATOM   2631 N N   . PRO B 1 184 ? 10.934  -42.807 -12.086 1.00 33.62 ? 185  PRO B N   1 
ATOM   2632 C CA  . PRO B 1 184 ? 12.065  -42.536 -12.980 1.00 34.55 ? 185  PRO B CA  1 
ATOM   2633 C C   . PRO B 1 184 ? 13.246  -42.019 -12.202 1.00 35.89 ? 185  PRO B C   1 
ATOM   2634 O O   . PRO B 1 184 ? 13.062  -41.310 -11.218 1.00 36.98 ? 185  PRO B O   1 
ATOM   2635 C CB  . PRO B 1 184 ? 11.524  -41.456 -13.897 1.00 34.75 ? 185  PRO B CB  1 
ATOM   2636 C CG  . PRO B 1 184 ? 10.038  -41.656 -13.861 1.00 34.12 ? 185  PRO B CG  1 
ATOM   2637 C CD  . PRO B 1 184 ? 9.779   -41.971 -12.431 1.00 33.25 ? 185  PRO B CD  1 
ATOM   2638 N N   . ASN B 1 185 ? 14.451  -42.404 -12.607 1.00 36.38 ? 186  ASN B N   1 
ATOM   2639 C CA  . ASN B 1 185 ? 15.630  -42.005 -11.858 1.00 37.75 ? 186  ASN B CA  1 
ATOM   2640 C C   . ASN B 1 185 ? 15.774  -40.487 -11.979 1.00 39.84 ? 186  ASN B C   1 
ATOM   2641 O O   . ASN B 1 185 ? 15.116  -39.867 -12.807 1.00 39.24 ? 186  ASN B O   1 
ATOM   2642 C CB  . ASN B 1 185 ? 16.872  -42.794 -12.304 1.00 38.14 ? 186  ASN B CB  1 
ATOM   2643 C CG  . ASN B 1 185 ? 17.459  -42.325 -13.644 1.00 37.62 ? 186  ASN B CG  1 
ATOM   2644 O OD1 . ASN B 1 185 ? 17.626  -41.122 -13.903 1.00 38.44 ? 186  ASN B OD1 1 
ATOM   2645 N ND2 . ASN B 1 185 ? 17.786  -43.292 -14.496 1.00 35.29 ? 186  ASN B ND2 1 
ATOM   2646 N N   . ARG B 1 186 ? 16.609  -39.891 -11.138 1.00 42.44 ? 187  ARG B N   1 
ATOM   2647 C CA  . ARG B 1 186 ? 16.695  -38.429 -11.050 1.00 44.66 ? 187  ARG B CA  1 
ATOM   2648 C C   . ARG B 1 186 ? 17.093  -37.765 -12.390 1.00 44.88 ? 187  ARG B C   1 
ATOM   2649 O O   . ARG B 1 186 ? 16.731  -36.610 -12.657 1.00 45.84 ? 187  ARG B O   1 
ATOM   2650 C CB  . ARG B 1 186 ? 17.673  -38.019 -9.938  1.00 47.17 ? 187  ARG B CB  1 
ATOM   2651 C CG  . ARG B 1 186 ? 19.146  -38.341 -10.252 1.00 49.98 ? 187  ARG B CG  1 
ATOM   2652 C CD  . ARG B 1 186 ? 20.088  -37.903 -9.160  1.00 55.54 ? 187  ARG B CD  1 
ATOM   2653 N NE  . ARG B 1 186 ? 20.270  -36.444 -9.127  1.00 60.35 ? 187  ARG B NE  1 
ATOM   2654 C CZ  . ARG B 1 186 ? 19.795  -35.605 -8.201  1.00 62.49 ? 187  ARG B CZ  1 
ATOM   2655 N NH1 . ARG B 1 186 ? 19.072  -36.032 -7.162  1.00 65.31 ? 187  ARG B NH1 1 
ATOM   2656 N NH2 . ARG B 1 186 ? 20.052  -34.309 -8.320  1.00 65.57 ? 187  ARG B NH2 1 
ATOM   2657 N N   . GLY B 1 187 ? 17.849  -38.492 -13.211 1.00 43.80 ? 188  GLY B N   1 
ATOM   2658 C CA  . GLY B 1 187 ? 18.266  -37.984 -14.524 1.00 44.16 ? 188  GLY B CA  1 
ATOM   2659 C C   . GLY B 1 187 ? 17.128  -38.046 -15.527 1.00 42.10 ? 188  GLY B C   1 
ATOM   2660 O O   . GLY B 1 187 ? 16.868  -37.087 -16.246 1.00 42.73 ? 188  GLY B O   1 
ATOM   2661 N N   . PHE B 1 188 ? 16.431  -39.172 -15.550 1.00 39.32 ? 189  PHE B N   1 
ATOM   2662 C CA  . PHE B 1 188 ? 15.265  -39.318 -16.418 1.00 37.95 ? 189  PHE B CA  1 
ATOM   2663 C C   . PHE B 1 188 ? 14.212  -38.268 -16.132 1.00 38.41 ? 189  PHE B C   1 
ATOM   2664 O O   . PHE B 1 188 ? 13.559  -37.757 -17.053 1.00 37.50 ? 189  PHE B O   1 
ATOM   2665 C CB  . PHE B 1 188 ? 14.629  -40.691 -16.254 1.00 35.53 ? 189  PHE B CB  1 
ATOM   2666 C CG  . PHE B 1 188 ? 15.477  -41.819 -16.731 1.00 34.57 ? 189  PHE B CG  1 
ATOM   2667 C CD1 . PHE B 1 188 ? 16.660  -41.602 -17.456 1.00 35.30 ? 189  PHE B CD1 1 
ATOM   2668 C CD2 . PHE B 1 188 ? 15.081  -43.119 -16.488 1.00 33.67 ? 189  PHE B CD2 1 
ATOM   2669 C CE1 . PHE B 1 188 ? 17.424  -42.659 -17.888 1.00 32.81 ? 189  PHE B CE1 1 
ATOM   2670 C CE2 . PHE B 1 188 ? 15.838  -44.183 -16.963 1.00 34.76 ? 189  PHE B CE2 1 
ATOM   2671 C CZ  . PHE B 1 188 ? 17.028  -43.949 -17.638 1.00 31.34 ? 189  PHE B CZ  1 
ATOM   2672 N N   . LEU B 1 189 ? 14.059  -37.962 -14.854 1.00 38.66 ? 190  LEU B N   1 
ATOM   2673 C CA  . LEU B 1 189 ? 13.089  -36.977 -14.414 1.00 40.23 ? 190  LEU B CA  1 
ATOM   2674 C C   . LEU B 1 189 ? 13.488  -35.601 -14.888 1.00 42.62 ? 190  LEU B C   1 
ATOM   2675 O O   . LEU B 1 189 ? 12.657  -34.878 -15.410 1.00 44.04 ? 190  LEU B O   1 
ATOM   2676 C CB  . LEU B 1 189 ? 13.001  -36.976 -12.884 1.00 41.19 ? 190  LEU B CB  1 
ATOM   2677 C CG  . LEU B 1 189 ? 11.908  -36.140 -12.248 1.00 42.85 ? 190  LEU B CG  1 
ATOM   2678 C CD1 . LEU B 1 189 ? 10.643  -36.258 -13.075 1.00 42.97 ? 190  LEU B CD1 1 
ATOM   2679 C CD2 . LEU B 1 189 ? 11.661  -36.624 -10.804 1.00 42.13 ? 190  LEU B CD2 1 
ATOM   2680 N N   . LYS B 1 190 ? 14.760  -35.244 -14.700 1.00 43.89 ? 191  LYS B N   1 
ATOM   2681 C CA  . LYS B 1 190 ? 15.298  -34.009 -15.284 1.00 46.93 ? 191  LYS B CA  1 
ATOM   2682 C C   . LYS B 1 190 ? 15.004  -33.961 -16.802 1.00 45.59 ? 191  LYS B C   1 
ATOM   2683 O O   . LYS B 1 190 ? 14.555  -32.946 -17.315 1.00 46.50 ? 191  LYS B O   1 
ATOM   2684 C CB  . LYS B 1 190 ? 16.813  -33.866 -14.979 1.00 48.67 ? 191  LYS B CB  1 
ATOM   2685 C CG  . LYS B 1 190 ? 17.520  -32.752 -15.741 1.00 53.64 ? 191  LYS B CG  1 
ATOM   2686 C CD  . LYS B 1 190 ? 19.016  -32.652 -15.369 1.00 59.23 ? 191  LYS B CD  1 
ATOM   2687 C CE  . LYS B 1 190 ? 19.853  -31.879 -16.464 1.00 63.15 ? 191  LYS B CE  1 
ATOM   2688 N NZ  . LYS B 1 190 ? 20.264  -30.463 -16.085 1.00 65.38 ? 191  LYS B NZ  1 
ATOM   2689 N N   . GLN B 1 191 ? 15.209  -35.078 -17.498 1.00 43.89 ? 192  GLN B N   1 
ATOM   2690 C CA  . GLN B 1 191 ? 14.927  -35.166 -18.954 1.00 43.29 ? 192  GLN B CA  1 
ATOM   2691 C C   . GLN B 1 191 ? 13.446  -34.953 -19.260 1.00 42.44 ? 192  GLN B C   1 
ATOM   2692 O O   . GLN B 1 191 ? 13.113  -34.255 -20.179 1.00 43.95 ? 192  GLN B O   1 
ATOM   2693 C CB  . GLN B 1 191 ? 15.415  -36.503 -19.522 1.00 41.25 ? 192  GLN B CB  1 
ATOM   2694 C CG  . GLN B 1 191 ? 16.940  -36.634 -19.455 1.00 42.76 ? 192  GLN B CG  1 
ATOM   2695 C CD  . GLN B 1 191 ? 17.427  -38.076 -19.472 1.00 42.92 ? 192  GLN B CD  1 
ATOM   2696 O OE1 . GLN B 1 191 ? 16.860  -38.921 -20.161 1.00 44.36 ? 192  GLN B OE1 1 
ATOM   2697 N NE2 . GLN B 1 191 ? 18.508  -38.347 -18.759 1.00 42.95 ? 192  GLN B NE2 1 
ATOM   2698 N N   . LEU B 1 192 ? 12.562  -35.519 -18.459 1.00 42.28 ? 193  LEU B N   1 
ATOM   2699 C CA  . LEU B 1 192 ? 11.122  -35.329 -18.644 1.00 42.78 ? 193  LEU B CA  1 
ATOM   2700 C C   . LEU B 1 192 ? 10.722  -33.898 -18.337 1.00 45.83 ? 193  LEU B C   1 
ATOM   2701 O O   . LEU B 1 192 ? 9.818   -33.375 -18.976 1.00 47.08 ? 193  LEU B O   1 
ATOM   2702 C CB  . LEU B 1 192 ? 10.304  -36.268 -17.752 1.00 41.09 ? 193  LEU B CB  1 
ATOM   2703 C CG  . LEU B 1 192 ? 10.261  -37.741 -18.151 1.00 39.54 ? 193  LEU B CG  1 
ATOM   2704 C CD1 . LEU B 1 192 ? 9.777   -38.543 -16.973 1.00 35.27 ? 193  LEU B CD1 1 
ATOM   2705 C CD2 . LEU B 1 192 ? 9.383   -37.961 -19.420 1.00 39.21 ? 193  LEU B CD2 1 
ATOM   2706 N N   . ARG B 1 193 ? 11.367  -33.262 -17.356 1.00 47.80 ? 194  ARG B N   1 
ATOM   2707 C CA  . ARG B 1 193 ? 11.070  -31.840 -17.082 1.00 51.19 ? 194  ARG B CA  1 
ATOM   2708 C C   . ARG B 1 193 ? 11.403  -31.017 -18.318 1.00 52.80 ? 194  ARG B C   1 
ATOM   2709 O O   . ARG B 1 193 ? 10.632  -30.166 -18.742 1.00 53.89 ? 194  ARG B O   1 
ATOM   2710 C CB  . ARG B 1 193 ? 11.821  -31.311 -15.861 1.00 52.92 ? 194  ARG B CB  1 
ATOM   2711 C CG  . ARG B 1 193 ? 11.305  -31.864 -14.522 1.00 54.06 ? 194  ARG B CG  1 
ATOM   2712 C CD  . ARG B 1 193 ? 12.153  -31.434 -13.329 1.00 58.23 ? 194  ARG B CD  1 
ATOM   2713 N NE  . ARG B 1 193 ? 12.737  -30.119 -13.536 1.00 66.33 ? 194  ARG B NE  1 
ATOM   2714 C CZ  . ARG B 1 193 ? 12.074  -28.969 -13.457 1.00 71.59 ? 194  ARG B CZ  1 
ATOM   2715 N NH1 . ARG B 1 193 ? 10.786  -28.946 -13.155 1.00 73.93 ? 194  ARG B NH1 1 
ATOM   2716 N NH2 . ARG B 1 193 ? 12.700  -27.835 -13.691 1.00 73.41 ? 194  ARG B NH2 1 
ATOM   2717 N N   . GLU B 1 194 ? 12.537  -31.317 -18.930 1.00 53.03 ? 195  GLU B N   1 
ATOM   2718 C CA  . GLU B 1 194 ? 12.974  -30.559 -20.107 1.00 55.96 ? 195  GLU B CA  1 
ATOM   2719 C C   . GLU B 1 194 ? 12.045  -30.786 -21.289 1.00 54.37 ? 195  GLU B C   1 
ATOM   2720 O O   . GLU B 1 194 ? 11.689  -29.836 -21.950 1.00 55.52 ? 195  GLU B O   1 
ATOM   2721 C CB  . GLU B 1 194 ? 14.438  -30.859 -20.431 1.00 56.92 ? 195  GLU B CB  1 
ATOM   2722 C CG  . GLU B 1 194 ? 15.345  -30.386 -19.264 1.00 63.06 ? 195  GLU B CG  1 
ATOM   2723 C CD  . GLU B 1 194 ? 16.823  -30.650 -19.474 1.00 69.27 ? 195  GLU B CD  1 
ATOM   2724 O OE1 . GLU B 1 194 ? 17.177  -31.754 -19.979 1.00 70.78 ? 195  GLU B OE1 1 
ATOM   2725 O OE2 . GLU B 1 194 ? 17.623  -29.740 -19.123 1.00 74.71 ? 195  GLU B OE2 1 
ATOM   2726 N N   . LEU B 1 195 ? 11.603  -32.029 -21.498 1.00 51.22 ? 196  LEU B N   1 
ATOM   2727 C CA  . LEU B 1 195 ? 10.558  -32.292 -22.480 1.00 50.92 ? 196  LEU B CA  1 
ATOM   2728 C C   . LEU B 1 195 ? 9.285   -31.508 -22.178 1.00 52.74 ? 196  LEU B C   1 
ATOM   2729 O O   . LEU B 1 195 ? 8.684   -30.960 -23.090 1.00 54.71 ? 196  LEU B O   1 
ATOM   2730 C CB  . LEU B 1 195 ? 10.220  -33.775 -22.570 1.00 48.27 ? 196  LEU B CB  1 
ATOM   2731 C CG  . LEU B 1 195 ? 9.064   -34.083 -23.536 1.00 47.31 ? 196  LEU B CG  1 
ATOM   2732 C CD1 . LEU B 1 195 ? 9.477   -33.793 -24.986 1.00 49.28 ? 196  LEU B CD1 1 
ATOM   2733 C CD2 . LEU B 1 195 ? 8.619   -35.480 -23.400 1.00 43.75 ? 196  LEU B CD2 1 
ATOM   2734 N N   . ASP B 1 196 ? 8.877   -31.466 -20.905 1.00 52.90 ? 197  ASP B N   1 
ATOM   2735 C CA  . ASP B 1 196 ? 7.660   -30.738 -20.480 1.00 54.37 ? 197  ASP B CA  1 
ATOM   2736 C C   . ASP B 1 196 ? 7.786   -29.253 -20.804 1.00 58.20 ? 197  ASP B C   1 
ATOM   2737 O O   . ASP B 1 196 ? 6.861   -28.655 -21.337 1.00 60.65 ? 197  ASP B O   1 
ATOM   2738 C CB  . ASP B 1 196 ? 7.394   -30.962 -18.978 1.00 53.44 ? 197  ASP B CB  1 
ATOM   2739 C CG  . ASP B 1 196 ? 5.929   -30.728 -18.566 1.00 53.20 ? 197  ASP B CG  1 
ATOM   2740 O OD1 . ASP B 1 196 ? 4.995   -31.221 -19.232 1.00 47.85 ? 197  ASP B OD1 1 
ATOM   2741 O OD2 . ASP B 1 196 ? 5.708   -30.064 -17.521 1.00 57.42 ? 197  ASP B OD2 1 
ATOM   2742 N N   . LYS B 1 197 ? 8.943   -28.668 -20.518 1.00 60.12 ? 198  LYS B N   1 
ATOM   2743 C CA  . LYS B 1 197 ? 9.224   -27.262 -20.896 1.00 64.46 ? 198  LYS B CA  1 
ATOM   2744 C C   . LYS B 1 197 ? 9.115   -26.996 -22.422 1.00 65.93 ? 198  LYS B C   1 
ATOM   2745 O O   . LYS B 1 197 ? 8.452   -26.056 -22.837 1.00 68.91 ? 198  LYS B O   1 
ATOM   2746 C CB  . LYS B 1 197 ? 10.603  -26.827 -20.372 1.00 65.46 ? 198  LYS B CB  1 
ATOM   2747 C CG  . LYS B 1 197 ? 10.673  -26.722 -18.834 1.00 66.53 ? 198  LYS B CG  1 
ATOM   2748 C CD  . LYS B 1 197 ? 12.042  -26.241 -18.335 1.00 69.04 ? 198  LYS B CD  1 
ATOM   2749 C CE  . LYS B 1 197 ? 12.095  -26.232 -16.831 1.00 70.15 ? 198  LYS B CE  1 
ATOM   2750 N NZ  . LYS B 1 197 ? 13.263  -25.482 -16.283 1.00 74.78 ? 198  LYS B NZ  1 
ATOM   2751 N N   . GLN B 1 198 ? 9.756   -27.834 -23.241 1.00 64.29 ? 199  GLN B N   1 
ATOM   2752 C CA  . GLN B 1 198 ? 9.654   -27.745 -24.694 1.00 65.43 ? 199  GLN B CA  1 
ATOM   2753 C C   . GLN B 1 198 ? 8.203   -27.854 -25.143 1.00 65.19 ? 199  GLN B C   1 
ATOM   2754 O O   . GLN B 1 198 ? 7.775   -27.074 -25.955 1.00 68.00 ? 199  GLN B O   1 
ATOM   2755 C CB  . GLN B 1 198 ? 10.477  -28.837 -25.397 1.00 63.46 ? 199  GLN B CB  1 
ATOM   2756 C CG  . GLN B 1 198 ? 12.006  -28.747 -25.237 1.00 66.23 ? 199  GLN B CG  1 
ATOM   2757 C CD  . GLN B 1 198 ? 12.727  -30.134 -25.292 1.00 67.31 ? 199  GLN B CD  1 
ATOM   2758 O OE1 . GLN B 1 198 ? 12.094  -31.190 -25.470 1.00 65.41 ? 199  GLN B OE1 1 
ATOM   2759 N NE2 . GLN B 1 198 ? 14.057  -30.118 -25.109 1.00 69.21 ? 199  GLN B NE2 1 
ATOM   2760 N N   . LEU B 1 199 ? 7.444   -28.817 -24.634 1.00 62.55 ? 200  LEU B N   1 
ATOM   2761 C CA  . LEU B 1 199 ? 6.040   -28.965 -25.070 1.00 63.07 ? 200  LEU B CA  1 
ATOM   2762 C C   . LEU B 1 199 ? 5.141   -27.776 -24.683 1.00 67.17 ? 200  LEU B C   1 
ATOM   2763 O O   . LEU B 1 199 ? 4.232   -27.415 -25.432 1.00 69.25 ? 200  LEU B O   1 
ATOM   2764 C CB  . LEU B 1 199 ? 5.429   -30.273 -24.553 1.00 59.28 ? 200  LEU B CB  1 
ATOM   2765 C CG  . LEU B 1 199 ? 5.977   -31.560 -25.195 1.00 55.77 ? 200  LEU B CG  1 
ATOM   2766 C CD1 . LEU B 1 199 ? 5.318   -32.779 -24.569 1.00 50.51 ? 200  LEU B CD1 1 
ATOM   2767 C CD2 . LEU B 1 199 ? 5.824   -31.562 -26.745 1.00 53.70 ? 200  LEU B CD2 1 
ATOM   2768 N N   . VAL B 1 200 ? 5.394   -27.164 -23.526 1.00 68.43 ? 201  VAL B N   1 
ATOM   2769 C CA  . VAL B 1 200 ? 4.658   -25.958 -23.116 1.00 72.23 ? 201  VAL B CA  1 
ATOM   2770 C C   . VAL B 1 200 ? 5.254   -24.680 -23.732 1.00 75.85 ? 201  VAL B C   1 
ATOM   2771 O O   . VAL B 1 200 ? 5.074   -24.375 -24.916 1.00 78.07 ? 201  VAL B O   1 
ATOM   2772 C CB  . VAL B 1 200 ? 4.638   -25.845 -21.553 1.00 72.11 ? 201  VAL B CB  1 
ATOM   2773 C CG1 . VAL B 1 200 ? 3.933   -24.572 -21.091 1.00 75.53 ? 201  VAL B CG1 1 
ATOM   2774 C CG2 . VAL B 1 200 ? 3.991   -27.089 -20.934 1.00 68.59 ? 201  VAL B CG2 1 
HETATM 2775 S S   . SO4 C 2 .   ? -20.538 -40.617 2.909   1.00 41.19 ? 1207 SO4 A S   1 
HETATM 2776 O O1  . SO4 C 2 .   ? -21.523 -41.610 2.468   1.00 32.32 ? 1207 SO4 A O1  1 
HETATM 2777 O O2  . SO4 C 2 .   ? -20.076 -40.952 4.262   1.00 39.96 ? 1207 SO4 A O2  1 
HETATM 2778 O O3  . SO4 C 2 .   ? -21.110 -39.256 2.986   1.00 38.72 ? 1207 SO4 A O3  1 
HETATM 2779 O O4  . SO4 C 2 .   ? -19.324 -40.626 2.051   1.00 40.49 ? 1207 SO4 A O4  1 
HETATM 2780 S S   . SO4 D 2 .   ? -10.863 -30.475 -5.523  1.00 81.92 ? 1208 SO4 A S   1 
HETATM 2781 O O1  . SO4 D 2 .   ? -11.457 -31.723 -6.014  1.00 79.72 ? 1208 SO4 A O1  1 
HETATM 2782 O O2  . SO4 D 2 .   ? -10.255 -30.607 -4.186  1.00 78.87 ? 1208 SO4 A O2  1 
HETATM 2783 O O3  . SO4 D 2 .   ? -11.935 -29.476 -5.548  1.00 81.64 ? 1208 SO4 A O3  1 
HETATM 2784 O O4  . SO4 D 2 .   ? -9.782  -30.049 -6.415  1.00 82.61 ? 1208 SO4 A O4  1 
HETATM 2785 S S   . SO4 E 2 .   ? -31.238 -21.578 -3.973  1.00 93.87 ? 1209 SO4 A S   1 
HETATM 2786 O O1  . SO4 E 2 .   ? -31.199 -22.283 -5.255  1.00 93.88 ? 1209 SO4 A O1  1 
HETATM 2787 O O2  . SO4 E 2 .   ? -29.884 -21.340 -3.461  1.00 93.09 ? 1209 SO4 A O2  1 
HETATM 2788 O O3  . SO4 E 2 .   ? -31.983 -22.393 -3.015  1.00 92.98 ? 1209 SO4 A O3  1 
HETATM 2789 O O4  . SO4 E 2 .   ? -31.919 -20.300 -4.195  1.00 93.54 ? 1209 SO4 A O4  1 
HETATM 2790 S S   . SO4 F 2 .   ? -34.683 -41.678 -13.127 1.00 70.67 ? 1210 SO4 A S   1 
HETATM 2791 O O1  . SO4 F 2 .   ? -33.821 -42.852 -13.194 1.00 72.09 ? 1210 SO4 A O1  1 
HETATM 2792 O O2  . SO4 F 2 .   ? -35.788 -42.031 -12.238 1.00 73.08 ? 1210 SO4 A O2  1 
HETATM 2793 O O3  . SO4 F 2 .   ? -35.216 -41.381 -14.455 1.00 71.39 ? 1210 SO4 A O3  1 
HETATM 2794 O O4  . SO4 F 2 .   ? -33.928 -40.514 -12.620 1.00 70.46 ? 1210 SO4 A O4  1 
HETATM 2795 S S   . SO4 G 2 .   ? -9.565  -35.858 -11.135 1.00 86.31 ? 1211 SO4 A S   1 
HETATM 2796 O O1  . SO4 G 2 .   ? -9.758  -37.135 -11.827 1.00 86.10 ? 1211 SO4 A O1  1 
HETATM 2797 O O2  . SO4 G 2 .   ? -9.245  -36.106 -9.724  1.00 86.38 ? 1211 SO4 A O2  1 
HETATM 2798 O O3  . SO4 G 2 .   ? -10.774 -35.035 -11.281 1.00 86.42 ? 1211 SO4 A O3  1 
HETATM 2799 O O4  . SO4 G 2 .   ? -8.433  -35.132 -11.698 1.00 86.75 ? 1211 SO4 A O4  1 
HETATM 2800 S S   . SO4 H 2 .   ? 14.271  -50.335 -14.506 1.00 68.03 ? 1202 SO4 B S   1 
HETATM 2801 O O1  . SO4 H 2 .   ? 14.110  -51.573 -15.260 1.00 64.79 ? 1202 SO4 B O1  1 
HETATM 2802 O O2  . SO4 H 2 .   ? 15.339  -50.787 -13.584 1.00 64.76 ? 1202 SO4 B O2  1 
HETATM 2803 O O3  . SO4 H 2 .   ? 13.086  -49.924 -13.703 1.00 63.19 ? 1202 SO4 B O3  1 
HETATM 2804 O O4  . SO4 H 2 .   ? 14.568  -49.215 -15.415 1.00 59.87 ? 1202 SO4 B O4  1 
HETATM 2805 S S   . SO4 I 2 .   ? 20.445  -53.420 -16.273 1.00 89.34 ? 1203 SO4 B S   1 
HETATM 2806 O O1  . SO4 I 2 .   ? 19.672  -53.751 -17.479 1.00 88.13 ? 1203 SO4 B O1  1 
HETATM 2807 O O2  . SO4 I 2 .   ? 21.487  -54.446 -16.132 1.00 88.44 ? 1203 SO4 B O2  1 
HETATM 2808 O O3  . SO4 I 2 .   ? 19.634  -53.379 -15.048 1.00 87.81 ? 1203 SO4 B O3  1 
HETATM 2809 O O4  . SO4 I 2 .   ? 21.001  -52.069 -16.420 1.00 89.41 ? 1203 SO4 B O4  1 
HETATM 2810 O O   . HOH J 3 .   ? 14.194  -29.174 -10.100 1.00 27.18 ? 2001 HOH A O   1 
HETATM 2811 O O   . HOH J 3 .   ? 14.236  -39.733 -9.019  1.00 24.12 ? 2002 HOH A O   1 
HETATM 2812 O O   . HOH J 3 .   ? 1.569   -41.977 -6.120  1.00 31.59 ? 2003 HOH A O   1 
HETATM 2813 O O   . HOH J 3 .   ? 2.428   -44.764 -7.704  1.00 27.81 ? 2004 HOH A O   1 
HETATM 2814 O O   . HOH J 3 .   ? 4.613   -43.860 -8.615  1.00 17.94 ? 2005 HOH A O   1 
HETATM 2815 O O   . HOH J 3 .   ? 0.568   -42.714 -3.477  1.00 26.97 ? 2006 HOH A O   1 
HETATM 2816 O O   . HOH J 3 .   ? 12.633  -40.308 -4.930  1.00 34.47 ? 2007 HOH A O   1 
HETATM 2817 O O   . HOH J 3 .   ? -10.176 -38.282 -3.385  1.00 15.59 ? 2008 HOH A O   1 
HETATM 2818 O O   . HOH J 3 .   ? -10.433 -41.823 -14.550 1.00 30.70 ? 2009 HOH A O   1 
HETATM 2819 O O   . HOH J 3 .   ? -10.530 -35.623 -14.423 1.00 20.34 ? 2010 HOH A O   1 
HETATM 2820 O O   . HOH J 3 .   ? -17.906 -43.308 -20.115 1.00 13.14 ? 2011 HOH A O   1 
HETATM 2821 O O   . HOH J 3 .   ? -15.562 -33.262 2.276   1.00 22.00 ? 2012 HOH A O   1 
HETATM 2822 O O   . HOH J 3 .   ? -18.067 -31.218 1.432   1.00 22.20 ? 2013 HOH A O   1 
HETATM 2823 O O   . HOH J 3 .   ? -24.019 -22.303 -6.165  1.00 23.02 ? 2014 HOH A O   1 
HETATM 2824 O O   . HOH J 3 .   ? -27.873 -46.099 13.863  1.00 13.65 ? 2015 HOH A O   1 
HETATM 2825 O O   . HOH J 3 .   ? -16.537 -14.093 -13.915 1.00 62.29 ? 2016 HOH A O   1 
HETATM 2826 O O   . HOH J 3 .   ? -28.663 -32.770 -18.548 1.00 15.38 ? 2017 HOH A O   1 
HETATM 2827 O O   . HOH J 3 .   ? -27.227 -32.501 -5.136  1.00 3.28  ? 2018 HOH A O   1 
HETATM 2828 O O   . HOH J 3 .   ? -38.061 -36.126 -2.300  1.00 28.28 ? 2019 HOH A O   1 
HETATM 2829 O O   . HOH J 3 .   ? -36.624 -35.334 2.434   1.00 29.29 ? 2020 HOH A O   1 
HETATM 2830 O O   . HOH J 3 .   ? -32.188 -28.678 5.203   1.00 25.61 ? 2021 HOH A O   1 
HETATM 2831 O O   . HOH J 3 .   ? -34.442 -30.965 8.008   1.00 13.12 ? 2022 HOH A O   1 
HETATM 2832 O O   . HOH J 3 .   ? -26.693 -37.290 5.372   1.00 26.01 ? 2023 HOH A O   1 
HETATM 2833 O O   . HOH J 3 .   ? -32.008 -41.336 4.785   1.00 27.66 ? 2024 HOH A O   1 
HETATM 2834 O O   . HOH J 3 .   ? -34.376 -32.484 -0.594  1.00 29.46 ? 2025 HOH A O   1 
HETATM 2835 O O   . HOH J 3 .   ? -35.946 -29.811 -5.211  1.00 17.92 ? 2026 HOH A O   1 
HETATM 2836 O O   . HOH J 3 .   ? -35.069 -19.404 -10.537 1.00 16.92 ? 2027 HOH A O   1 
HETATM 2837 O O   . HOH J 3 .   ? -32.597 -40.174 -16.778 1.00 22.45 ? 2028 HOH A O   1 
HETATM 2838 O O   . HOH J 3 .   ? -34.824 -39.716 -8.174  1.00 15.74 ? 2029 HOH A O   1 
HETATM 2839 O O   . HOH J 3 .   ? -35.663 -39.015 -5.195  1.00 26.13 ? 2030 HOH A O   1 
HETATM 2840 O O   . HOH J 3 .   ? -34.803 -42.344 -2.065  1.00 9.96  ? 2031 HOH A O   1 
HETATM 2841 O O   . HOH J 3 .   ? -33.922 -38.676 5.909   1.00 38.97 ? 2032 HOH A O   1 
HETATM 2842 O O   . HOH J 3 .   ? -31.070 -46.330 8.473   1.00 29.02 ? 2033 HOH A O   1 
HETATM 2843 O O   . HOH J 3 .   ? -25.709 -40.689 7.204   1.00 24.52 ? 2034 HOH A O   1 
HETATM 2844 O O   . HOH J 3 .   ? -18.855 -44.845 6.767   1.00 18.99 ? 2035 HOH A O   1 
HETATM 2845 O O   . HOH J 3 .   ? -20.283 -41.038 7.675   1.00 20.65 ? 2036 HOH A O   1 
HETATM 2846 O O   . HOH J 3 .   ? -17.917 -42.016 5.161   1.00 20.14 ? 2037 HOH A O   1 
HETATM 2847 O O   . HOH J 3 .   ? -27.041 -48.085 12.215  1.00 28.31 ? 2038 HOH A O   1 
HETATM 2848 O O   . HOH J 3 .   ? -30.042 -53.862 4.632   1.00 31.50 ? 2039 HOH A O   1 
HETATM 2849 O O   . HOH J 3 .   ? -32.710 -49.400 4.887   1.00 17.49 ? 2040 HOH A O   1 
HETATM 2850 O O   . HOH J 3 .   ? -33.434 -49.444 2.091   1.00 19.17 ? 2041 HOH A O   1 
HETATM 2851 O O   . HOH J 3 .   ? -35.210 -51.229 1.320   1.00 17.22 ? 2042 HOH A O   1 
HETATM 2852 O O   . HOH J 3 .   ? -31.765 -54.743 -5.553  0.50 6.15  ? 2043 HOH A O   1 
HETATM 2853 O O   . HOH J 3 .   ? -31.758 -52.436 -7.200  1.00 14.43 ? 2044 HOH A O   1 
HETATM 2854 O O   . HOH J 3 .   ? -25.879 -48.009 -8.182  1.00 23.21 ? 2045 HOH A O   1 
HETATM 2855 O O   . HOH J 3 .   ? -29.048 -50.812 -13.697 1.00 14.37 ? 2046 HOH A O   1 
HETATM 2856 O O   . HOH J 3 .   ? -27.505 -58.096 -13.371 1.00 18.18 ? 2047 HOH A O   1 
HETATM 2857 O O   . HOH J 3 .   ? -33.183 -45.148 -13.076 1.00 17.57 ? 2048 HOH A O   1 
HETATM 2858 O O   . HOH J 3 .   ? -22.827 -50.604 -20.262 1.00 20.41 ? 2049 HOH A O   1 
HETATM 2859 O O   . HOH J 3 .   ? -36.037 -42.963 -16.587 1.00 17.52 ? 2050 HOH A O   1 
HETATM 2860 O O   . HOH J 3 .   ? -19.992 -41.216 -21.417 1.00 18.59 ? 2051 HOH A O   1 
HETATM 2861 O O   . HOH J 3 .   ? -23.342 -40.765 -27.761 1.00 12.16 ? 2052 HOH A O   1 
HETATM 2862 O O   . HOH J 3 .   ? -26.187 -34.898 -21.746 1.00 24.02 ? 2053 HOH A O   1 
HETATM 2863 O O   . HOH J 3 .   ? -14.632 -35.826 0.841   1.00 27.53 ? 2054 HOH A O   1 
HETATM 2864 O O   . HOH J 3 .   ? -23.077 -37.740 6.800   1.00 27.63 ? 2055 HOH A O   1 
HETATM 2865 O O   . HOH J 3 .   ? -25.648 -56.949 -15.099 1.00 27.94 ? 2056 HOH A O   1 
HETATM 2866 O O   . HOH J 3 .   ? -21.930 -55.528 -17.330 1.00 17.82 ? 2057 HOH A O   1 
HETATM 2867 O O   . HOH J 3 .   ? -18.904 -60.336 -12.385 1.00 12.37 ? 2058 HOH A O   1 
HETATM 2868 O O   . HOH J 3 .   ? -19.500 -58.981 -10.144 1.00 12.94 ? 2059 HOH A O   1 
HETATM 2869 O O   . HOH J 3 .   ? -10.236 -52.492 -12.420 1.00 14.67 ? 2060 HOH A O   1 
HETATM 2870 O O   . HOH J 3 .   ? -7.885  -45.444 -2.742  1.00 19.25 ? 2061 HOH A O   1 
HETATM 2871 O O   . HOH J 3 .   ? -5.516  -41.039 -8.529  1.00 25.43 ? 2062 HOH A O   1 
HETATM 2872 O O   . HOH J 3 .   ? -9.831  -46.601 -1.420  1.00 5.75  ? 2063 HOH A O   1 
HETATM 2873 O O   . HOH J 3 .   ? -16.918 -46.403 6.000   1.00 19.61 ? 2064 HOH A O   1 
HETATM 2874 O O   . HOH J 3 .   ? -15.884 -50.633 5.886   1.00 22.06 ? 2065 HOH A O   1 
HETATM 2875 O O   . HOH J 3 .   ? -18.140 -49.723 8.901   1.00 25.55 ? 2066 HOH A O   1 
HETATM 2876 O O   . HOH J 3 .   ? -18.419 -55.995 5.568   1.00 24.55 ? 2067 HOH A O   1 
HETATM 2877 O O   . HOH J 3 .   ? -25.908 -55.184 5.077   1.00 20.08 ? 2068 HOH A O   1 
HETATM 2878 O O   . HOH J 3 .   ? -25.751 -63.452 -3.034  1.00 6.97  ? 2069 HOH A O   1 
HETATM 2879 O O   . HOH J 3 .   ? -26.608 -65.393 -0.199  1.00 16.03 ? 2070 HOH A O   1 
HETATM 2880 O O   . HOH J 3 .   ? -21.014 -66.749 -6.797  1.00 12.76 ? 2071 HOH A O   1 
HETATM 2881 O O   . HOH J 3 .   ? -27.137 -65.343 -10.266 1.00 13.33 ? 2072 HOH A O   1 
HETATM 2882 O O   . HOH J 3 .   ? -30.335 -64.159 -7.246  1.00 15.50 ? 2073 HOH A O   1 
HETATM 2883 O O   . HOH J 3 .   ? -24.796 -59.905 -16.982 1.00 31.38 ? 2074 HOH A O   1 
HETATM 2884 O O   . HOH J 3 .   ? -20.455 -39.111 5.985   1.00 33.24 ? 2075 HOH A O   1 
HETATM 2885 O O   . HOH K 3 .   ? -18.458 -65.521 -5.943  1.00 13.20 ? 2001 HOH B O   1 
HETATM 2886 O O   . HOH K 3 .   ? -10.955 -63.037 1.685   1.00 30.12 ? 2002 HOH B O   1 
HETATM 2887 O O   . HOH K 3 .   ? -11.372 -61.881 3.994   1.00 24.55 ? 2003 HOH B O   1 
HETATM 2888 O O   . HOH K 3 .   ? -7.022  -58.109 -0.282  1.00 23.18 ? 2004 HOH B O   1 
HETATM 2889 O O   . HOH K 3 .   ? -1.659  -55.021 2.718   1.00 22.86 ? 2005 HOH B O   1 
HETATM 2890 O O   . HOH K 3 .   ? -2.183  -60.163 1.095   1.00 25.94 ? 2006 HOH B O   1 
HETATM 2891 O O   . HOH K 3 .   ? -6.183  -48.608 -2.297  1.00 16.82 ? 2007 HOH B O   1 
HETATM 2892 O O   . HOH K 3 .   ? -9.363  -62.611 -0.390  1.00 24.45 ? 2008 HOH B O   1 
HETATM 2893 O O   . HOH K 3 .   ? -2.726  -47.527 -1.091  1.00 40.13 ? 2009 HOH B O   1 
HETATM 2894 O O   . HOH K 3 .   ? -4.575  -45.067 0.515   1.00 36.95 ? 2010 HOH B O   1 
HETATM 2895 O O   . HOH K 3 .   ? -3.349  -55.198 -4.973  1.00 29.76 ? 2011 HOH B O   1 
HETATM 2896 O O   . HOH K 3 .   ? -3.671  -49.412 -9.221  1.00 15.06 ? 2012 HOH B O   1 
HETATM 2897 O O   . HOH K 3 .   ? 2.993   -52.260 -9.951  1.00 4.98  ? 2013 HOH B O   1 
HETATM 2898 O O   . HOH K 3 .   ? -4.165  -50.938 -13.290 1.00 34.03 ? 2014 HOH B O   1 
HETATM 2899 O O   . HOH K 3 .   ? -0.923  -54.299 -5.438  1.00 33.61 ? 2015 HOH B O   1 
HETATM 2900 O O   . HOH K 3 .   ? 9.907   -53.579 -8.349  1.00 19.44 ? 2016 HOH B O   1 
HETATM 2901 O O   . HOH K 3 .   ? 5.358   -62.570 -7.803  1.00 30.90 ? 2017 HOH B O   1 
HETATM 2902 O O   . HOH K 3 .   ? -5.519  -48.673 -16.845 1.00 17.72 ? 2018 HOH B O   1 
HETATM 2903 O O   . HOH K 3 .   ? -5.681  -54.548 -17.169 1.00 18.99 ? 2019 HOH B O   1 
HETATM 2904 O O   . HOH K 3 .   ? -5.710  -54.296 -22.338 1.00 22.00 ? 2020 HOH B O   1 
HETATM 2905 O O   . HOH K 3 .   ? -5.178  -46.911 -26.489 1.00 10.81 ? 2021 HOH B O   1 
HETATM 2906 O O   . HOH K 3 .   ? -3.764  -58.665 -20.395 1.00 25.03 ? 2022 HOH B O   1 
HETATM 2907 O O   . HOH K 3 .   ? 18.498  -58.019 -16.536 1.00 35.41 ? 2023 HOH B O   1 
HETATM 2908 O O   . HOH K 3 .   ? 4.418   -61.409 -15.128 1.00 26.73 ? 2024 HOH B O   1 
HETATM 2909 O O   . HOH K 3 .   ? 5.451   -68.606 -21.126 0.50 9.60  ? 2025 HOH B O   1 
HETATM 2910 O O   . HOH K 3 .   ? 4.218   -69.050 -17.177 1.00 26.71 ? 2026 HOH B O   1 
HETATM 2911 O O   . HOH K 3 .   ? -1.831  -70.560 -17.256 1.00 28.30 ? 2027 HOH B O   1 
HETATM 2912 O O   . HOH K 3 .   ? 2.430   -57.016 -34.427 1.00 16.94 ? 2028 HOH B O   1 
HETATM 2913 O O   . HOH K 3 .   ? 2.465   -51.187 -35.304 1.00 18.26 ? 2029 HOH B O   1 
HETATM 2914 O O   . HOH K 3 .   ? 12.266  -58.570 -24.004 1.00 22.09 ? 2030 HOH B O   1 
HETATM 2915 O O   . HOH K 3 .   ? 19.916  -52.746 -21.879 1.00 30.44 ? 2031 HOH B O   1 
HETATM 2916 O O   . HOH K 3 .   ? 21.456  -56.258 -22.579 1.00 37.63 ? 2032 HOH B O   1 
HETATM 2917 O O   . HOH K 3 .   ? 21.911  -62.641 -29.942 1.00 27.77 ? 2033 HOH B O   1 
HETATM 2918 O O   . HOH K 3 .   ? 4.192   -64.271 -36.788 1.00 22.10 ? 2034 HOH B O   1 
HETATM 2919 O O   . HOH K 3 .   ? 9.802   -58.618 -34.159 1.00 27.51 ? 2035 HOH B O   1 
HETATM 2920 O O   . HOH K 3 .   ? 22.026  -51.632 -21.590 1.00 35.14 ? 2036 HOH B O   1 
HETATM 2921 O O   . HOH K 3 .   ? 16.201  -45.787 -10.650 1.00 21.26 ? 2037 HOH B O   1 
HETATM 2922 O O   . HOH K 3 .   ? 17.659  -50.133 -11.601 1.00 21.66 ? 2038 HOH B O   1 
HETATM 2923 O O   . HOH K 3 .   ? 24.950  -44.017 -20.121 0.50 2.90  ? 2039 HOH B O   1 
HETATM 2924 O O   . HOH K 3 .   ? 21.383  -36.118 -25.700 1.00 13.71 ? 2040 HOH B O   1 
HETATM 2925 O O   . HOH K 3 .   ? 13.619  -38.045 -28.925 1.00 6.51  ? 2041 HOH B O   1 
HETATM 2926 O O   . HOH K 3 .   ? 13.592  -36.024 -26.686 1.00 18.82 ? 2042 HOH B O   1 
HETATM 2927 O O   . HOH K 3 .   ? 6.758   -39.396 -31.478 1.00 17.47 ? 2043 HOH B O   1 
HETATM 2928 O O   . HOH K 3 .   ? 6.436   -32.362 -29.807 1.00 14.93 ? 2044 HOH B O   1 
HETATM 2929 O O   . HOH K 3 .   ? 10.533  -31.368 -27.905 1.00 12.22 ? 2045 HOH B O   1 
HETATM 2930 O O   . HOH K 3 .   ? -2.153  -40.006 -30.438 1.00 26.79 ? 2046 HOH B O   1 
HETATM 2931 O O   . HOH K 3 .   ? -0.546  -38.518 -32.087 1.00 21.24 ? 2047 HOH B O   1 
HETATM 2932 O O   . HOH K 3 .   ? -4.757  -50.668 -29.591 1.00 25.79 ? 2048 HOH B O   1 
HETATM 2933 O O   . HOH K 3 .   ? -5.627  -48.509 -28.503 1.00 23.39 ? 2049 HOH B O   1 
HETATM 2934 O O   . HOH K 3 .   ? -7.971  -49.764 -35.721 1.00 19.30 ? 2050 HOH B O   1 
HETATM 2935 O O   . HOH K 3 .   ? -4.811  -55.891 -36.782 1.00 26.33 ? 2051 HOH B O   1 
HETATM 2936 O O   . HOH K 3 .   ? -1.990  -55.035 -34.305 1.00 26.38 ? 2052 HOH B O   1 
HETATM 2937 O O   . HOH K 3 .   ? -11.698 -49.638 -27.663 1.00 17.22 ? 2053 HOH B O   1 
HETATM 2938 O O   . HOH K 3 .   ? -8.582  -55.378 -35.177 1.00 26.99 ? 2054 HOH B O   1 
HETATM 2939 O O   . HOH K 3 .   ? -9.613  -54.598 -33.258 1.00 35.47 ? 2055 HOH B O   1 
HETATM 2940 O O   . HOH K 3 .   ? -7.612  -56.885 -23.354 1.00 34.73 ? 2056 HOH B O   1 
HETATM 2941 O O   . HOH K 3 .   ? 1.744   -32.189 -26.410 1.00 16.66 ? 2057 HOH B O   1 
HETATM 2942 O O   . HOH K 3 .   ? -3.962  -37.636 -15.486 1.00 11.39 ? 2058 HOH B O   1 
HETATM 2943 O O   . HOH K 3 .   ? 18.211  -41.539 -9.345  1.00 14.44 ? 2059 HOH B O   1 
HETATM 2944 O O   . HOH K 3 .   ? 15.868  -35.008 -11.026 1.00 20.94 ? 2060 HOH B O   1 
HETATM 2945 O O   . HOH K 3 .   ? 14.397  -34.120 -22.558 1.00 18.20 ? 2061 HOH B O   1 
HETATM 2946 O O   . HOH K 3 .   ? 18.588  -56.636 -18.543 1.00 31.71 ? 2062 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 31  ? 1.2316 0.9709 1.0979 -0.0103 0.2717  0.2610  32  ASP A N   
2    C CA  . ASP A 31  ? 1.2155 0.9490 1.0877 -0.0068 0.2673  0.2283  32  ASP A CA  
3    C C   . ASP A 31  ? 1.1739 0.9261 1.0139 -0.0158 0.2578  0.1953  32  ASP A C   
4    O O   . ASP A 31  ? 1.1683 0.9106 1.0195 -0.0231 0.2631  0.1653  32  ASP A O   
5    C CB  . ASP A 31  ? 1.2197 0.9600 1.0951 0.0087  0.2591  0.2430  32  ASP A CB  
6    C CG  . ASP A 31  ? 1.2081 0.9518 1.0806 0.0118  0.2516  0.2114  32  ASP A CG  
7    O OD1 . ASP A 31  ? 1.2281 0.9541 1.1275 0.0082  0.2599  0.1859  32  ASP A OD1 
8    O OD2 . ASP A 31  ? 1.1951 0.9623 1.0397 0.0174  0.2379  0.2116  32  ASP A OD2 
9    N N   . TYR A 32  ? 1.1412 0.9226 0.9456 -0.0153 0.2447  0.1999  33  TYR A N   
10   C CA  . TYR A 32  ? 1.0981 0.8963 0.8789 -0.0245 0.2377  0.1722  33  TYR A CA  
11   C C   . TYR A 32  ? 1.0976 0.8900 0.8760 -0.0387 0.2459  0.1662  33  TYR A C   
12   O O   . TYR A 32  ? 1.1107 0.9040 0.8864 -0.0419 0.2504  0.1890  33  TYR A O   
13   C CB  . TYR A 32  ? 1.0778 0.9091 0.8280 -0.0219 0.2238  0.1770  33  TYR A CB  
14   C CG  . TYR A 32  ? 1.0382 0.8876 0.7689 -0.0331 0.2186  0.1544  33  TYR A CG  
15   C CD1 . TYR A 32  ? 1.0230 0.8825 0.7410 -0.0443 0.2210  0.1580  33  TYR A CD1 
16   C CD2 . TYR A 32  ? 0.9967 0.8549 0.7247 -0.0324 0.2117  0.1306  33  TYR A CD2 
17   C CE1 . TYR A 32  ? 0.9920 0.8672 0.6970 -0.0543 0.2169  0.1374  33  TYR A CE1 
18   C CE2 . TYR A 32  ? 0.9586 0.8336 0.6746 -0.0419 0.2077  0.1129  33  TYR A CE2 
19   C CZ  . TYR A 32  ? 0.9585 0.8408 0.6639 -0.0528 0.2104  0.1159  33  TYR A CZ  
20   O OH  . TYR A 32  ? 0.8944 0.7932 0.5919 -0.0622 0.2070  0.0986  33  TYR A OH  
21   N N   . CYS A 33  ? 1.0736 0.8627 0.8539 -0.0472 0.2480  0.1364  34  CYS A N   
22   C CA  . CYS A 33  ? 1.0710 0.8599 0.8438 -0.0612 0.2535  0.1271  34  CYS A CA  
23   C C   . CYS A 33  ? 1.0185 0.8291 0.7717 -0.0674 0.2444  0.1029  34  CYS A C   
24   O O   . CYS A 33  ? 1.0037 0.8253 0.7554 -0.0614 0.2365  0.0910  34  CYS A O   
25   C CB  . CYS A 33  ? 1.0916 0.8531 0.8935 -0.0673 0.2691  0.1163  34  CYS A CB  
26   S SG  . CYS A 33  ? 1.1333 0.8859 0.9631 -0.0624 0.2726  0.0885  34  CYS A SG  
27   N N   . THR A 34  ? 0.9910 0.8093 0.7312 -0.0792 0.2456  0.0976  35  THR A N   
28   C CA  . THR A 34  ? 0.9426 0.7818 0.6687 -0.0856 0.2380  0.0776  35  THR A CA  
29   C C   . THR A 34  ? 0.9222 0.7554 0.6621 -0.0893 0.2425  0.0517  35  THR A C   
30   O O   . THR A 34  ? 0.9243 0.7426 0.6748 -0.0976 0.2534  0.0427  35  THR A O   
31   C CB  . THR A 34  ? 0.9398 0.7883 0.6519 -0.0981 0.2393  0.0778  35  THR A CB  
32   O OG1 . THR A 34  ? 0.9234 0.7827 0.6242 -0.0962 0.2369  0.1019  35  THR A OG1 
33   C CG2 . THR A 34  ? 0.9049 0.7765 0.6074 -0.1032 0.2310  0.0594  35  THR A CG2 
34   N N   . PRO A 35  ? 0.8838 0.7324 0.6242 -0.0837 0.2345  0.0395  36  PRO A N   
35   C CA  . PRO A 35  ? 0.8680 0.7211 0.6204 -0.0878 0.2380  0.0154  36  PRO A CA  
36   C C   . PRO A 35  ? 0.8523 0.7146 0.5985 -0.1006 0.2402  0.0013  36  PRO A C   
37   O O   . PRO A 35  ? 0.8477 0.7176 0.5796 -0.1053 0.2360  0.0081  36  PRO A O   
38   C CB  . PRO A 35  ? 0.8454 0.7204 0.5959 -0.0795 0.2270  0.0110  36  PRO A CB  
39   C CG  . PRO A 35  ? 0.8481 0.7223 0.5899 -0.0693 0.2197  0.0318  36  PRO A CG  
40   C CD  . PRO A 35  ? 0.8677 0.7350 0.5983 -0.0745 0.2222  0.0469  36  PRO A CD  
41   N N   . GLY A 36  ? 0.8446 0.7093 0.6035 -0.1064 0.2471  -0.0197 37  GLY A N   
42   C CA  . GLY A 36  ? 0.8215 0.6988 0.5762 -0.1178 0.2489  -0.0351 37  GLY A CA  
43   C C   . GLY A 36  ? 0.7854 0.6922 0.5313 -0.1172 0.2370  -0.0371 37  GLY A C   
44   O O   . GLY A 36  ? 0.7586 0.6777 0.5033 -0.1079 0.2280  -0.0297 37  GLY A O   
45   N N   . ALA A 37  ? 0.7705 0.6880 0.5131 -0.1272 0.2380  -0.0471 38  ALA A N   
46   C CA  . ALA A 37  ? 0.7407 0.6838 0.4802 -0.1282 0.2286  -0.0472 38  ALA A CA  
47   C C   . ALA A 37  ? 0.7180 0.6874 0.4677 -0.1212 0.2227  -0.0521 38  ALA A C   
48   O O   . ALA A 37  ? 0.7008 0.6870 0.4518 -0.1152 0.2134  -0.0435 38  ALA A O   
49   C CB  . ALA A 37  ? 0.7236 0.6724 0.4618 -0.1409 0.2325  -0.0587 38  ALA A CB  
50   N N   . PHE A 38  ? 0.7169 0.6920 0.4757 -0.1220 0.2289  -0.0661 39  PHE A N   
51   C CA  . PHE A 38  ? 0.7017 0.7093 0.4702 -0.1173 0.2241  -0.0719 39  PHE A CA  
52   C C   . PHE A 38  ? 0.7076 0.7162 0.4762 -0.1049 0.2162  -0.0588 39  PHE A C   
53   O O   . PHE A 38  ? 0.6734 0.7085 0.4462 -0.0997 0.2076  -0.0529 39  PHE A O   
54   C CB  . PHE A 38  ? 0.7043 0.7222 0.4840 -0.1217 0.2335  -0.0928 39  PHE A CB  
55   C CG  . PHE A 38  ? 0.6916 0.7501 0.4811 -0.1172 0.2288  -0.0989 39  PHE A CG  
56   C CD1 . PHE A 38  ? 0.6714 0.7687 0.4643 -0.1201 0.2241  -0.1003 39  PHE A CD1 
57   C CD2 . PHE A 38  ? 0.6843 0.7447 0.4814 -0.1100 0.2291  -0.1020 39  PHE A CD2 
58   C CE1 . PHE A 38  ? 0.6943 0.8351 0.4969 -0.1159 0.2197  -0.1029 39  PHE A CE1 
59   C CE2 . PHE A 38  ? 0.7046 0.8071 0.5105 -0.1065 0.2247  -0.1078 39  PHE A CE2 
60   C CZ  . PHE A 38  ? 0.6911 0.8357 0.4990 -0.1094 0.2200  -0.1073 39  PHE A CZ  
61   N N   . GLU A 39  ? 0.7332 0.7137 0.4994 -0.1001 0.2194  -0.0531 40  GLU A N   
62   C CA  . GLU A 39  ? 0.7359 0.7166 0.5024 -0.0881 0.2125  -0.0420 40  GLU A CA  
63   C C   . GLU A 39  ? 0.7157 0.6942 0.4722 -0.0833 0.2037  -0.0244 40  GLU A C   
64   O O   . GLU A 39  ? 0.7024 0.6928 0.4605 -0.0745 0.1959  -0.0169 40  GLU A O   
65   C CB  . GLU A 39  ? 0.7631 0.7197 0.5363 -0.0832 0.2190  -0.0429 40  GLU A CB  
66   C CG  . GLU A 39  ? 0.8273 0.7530 0.6033 -0.0893 0.2305  -0.0441 40  GLU A CG  
67   C CD  . GLU A 39  ? 0.8712 0.8008 0.6616 -0.0991 0.2422  -0.0675 40  GLU A CD  
68   O OE1 . GLU A 39  ? 0.8945 0.8457 0.6986 -0.0985 0.2439  -0.0843 40  GLU A OE1 
69   O OE2 . GLU A 39  ? 0.8769 0.7903 0.6658 -0.1079 0.2501  -0.0699 40  GLU A OE2 
70   N N   . LEU A 40  ? 0.7299 0.6963 0.4778 -0.0897 0.2053  -0.0195 41  LEU A N   
71   C CA  . LEU A 40  ? 0.7143 0.6876 0.4567 -0.0876 0.1978  -0.0082 41  LEU A CA  
72   C C   . LEU A 40  ? 0.6868 0.6895 0.4402 -0.0877 0.1914  -0.0114 41  LEU A C   
73   O O   . LEU A 40  ? 0.6697 0.6848 0.4282 -0.0811 0.1843  -0.0038 41  LEU A O   
74   C CB  . LEU A 40  ? 0.7263 0.6874 0.4593 -0.0966 0.2016  -0.0057 41  LEU A CB  
75   C CG  . LEU A 40  ? 0.7536 0.6895 0.4776 -0.0952 0.2070  0.0049  41  LEU A CG  
76   C CD1 . LEU A 40  ? 0.7177 0.6481 0.4325 -0.1055 0.2109  0.0074  41  LEU A CD1 
77   C CD2 . LEU A 40  ? 0.7464 0.6827 0.4669 -0.0836 0.2009  0.0192  41  LEU A CD2 
78   N N   . GLU A 41  ? 0.6831 0.6991 0.4434 -0.0949 0.1944  -0.0220 42  GLU A N   
79   C CA  . GLU A 41  ? 0.6645 0.7116 0.4396 -0.0941 0.1890  -0.0217 42  GLU A CA  
80   C C   . GLU A 41  ? 0.6421 0.7082 0.4257 -0.0839 0.1836  -0.0166 42  GLU A C   
81   O O   . GLU A 41  ? 0.6336 0.7186 0.4298 -0.0792 0.1772  -0.0081 42  GLU A O   
82   C CB  . GLU A 41  ? 0.6614 0.7231 0.4420 -0.1032 0.1935  -0.0329 42  GLU A CB  
83   C CG  . GLU A 41  ? 0.7071 0.7728 0.4931 -0.1109 0.1930  -0.0330 42  GLU A CG  
84   C CD  . GLU A 41  ? 0.7616 0.8162 0.5399 -0.1219 0.2006  -0.0448 42  GLU A CD  
85   O OE1 . GLU A 41  ? 0.8115 0.8626 0.5853 -0.1231 0.2064  -0.0541 42  GLU A OE1 
86   O OE2 . GLU A 41  ? 0.7997 0.8505 0.5786 -0.1295 0.2012  -0.0464 42  GLU A OE2 
87   N N   . ARG A 42  ? 0.6428 0.7046 0.4224 -0.0809 0.1867  -0.0226 43  ARG A N   
88   C CA  . ARG A 42  ? 0.6347 0.7149 0.4210 -0.0716 0.1818  -0.0191 43  ARG A CA  
89   C C   . ARG A 42  ? 0.6201 0.6920 0.4050 -0.0626 0.1750  -0.0055 43  ARG A C   
90   O O   . ARG A 42  ? 0.5912 0.6850 0.3867 -0.0557 0.1687  0.0019  43  ARG A O   
91   C CB  . ARG A 42  ? 0.6526 0.7245 0.4366 -0.0703 0.1873  -0.0302 43  ARG A CB  
92   C CG  . ARG A 42  ? 0.6646 0.7609 0.4564 -0.0622 0.1826  -0.0298 43  ARG A CG  
93   C CD  . ARG A 42  ? 0.7129 0.7930 0.5048 -0.0587 0.1872  -0.0389 43  ARG A CD  
94   N NE  . ARG A 42  ? 0.7505 0.8436 0.5504 -0.0668 0.1959  -0.0591 43  ARG A NE  
95   C CZ  . ARG A 42  ? 0.8247 0.8919 0.6266 -0.0727 0.2062  -0.0710 43  ARG A CZ  
96   N NH1 . ARG A 42  ? 0.8593 0.8849 0.6543 -0.0712 0.2092  -0.0616 43  ARG A NH1 
97   N NH2 . ARG A 42  ? 0.8275 0.9141 0.6408 -0.0805 0.2144  -0.0926 43  ARG A NH2 
98   N N   . LEU A 43  ? 0.6292 0.6725 0.4021 -0.0627 0.1767  -0.0017 44  LEU A N   
99   C CA  . LEU A 43  ? 0.6234 0.6616 0.3939 -0.0545 0.1710  0.0093  44  LEU A CA  
100  C C   . LEU A 43  ? 0.5920 0.6506 0.3763 -0.0547 0.1659  0.0140  44  LEU A C   
101  O O   . LEU A 43  ? 0.5780 0.6491 0.3715 -0.0466 0.1604  0.0204  44  LEU A O   
102  C CB  . LEU A 43  ? 0.6481 0.6593 0.4039 -0.0552 0.1740  0.0139  44  LEU A CB  
103  C CG  . LEU A 43  ? 0.6785 0.6693 0.4285 -0.0500 0.1778  0.0145  44  LEU A CG  
104  C CD1 . LEU A 43  ? 0.6972 0.6634 0.4358 -0.0527 0.1827  0.0220  44  LEU A CD1 
105  C CD2 . LEU A 43  ? 0.6258 0.6216 0.3784 -0.0380 0.1720  0.0201  44  LEU A CD2 
106  N N   . PHE A 44  ? 0.5707 0.6339 0.3605 -0.0641 0.1684  0.0098  45  PHE A N   
107  C CA  . PHE A 44  ? 0.5443 0.6275 0.3552 -0.0653 0.1651  0.0127  45  PHE A CA  
108  C C   . PHE A 44  ? 0.5279 0.6391 0.3602 -0.0598 0.1613  0.0184  45  PHE A C   
109  O O   . PHE A 44  ? 0.4960 0.6218 0.3488 -0.0552 0.1578  0.0251  45  PHE A O   
110  C CB  . PHE A 44  ? 0.5332 0.6170 0.3488 -0.0771 0.1690  0.0057  45  PHE A CB  
111  C CG  . PHE A 44  ? 0.5363 0.6016 0.3365 -0.0829 0.1718  0.0023  45  PHE A CG  
112  C CD1 . PHE A 44  ? 0.5318 0.6024 0.3379 -0.0814 0.1693  0.0038  45  PHE A CD1 
113  C CD2 . PHE A 44  ? 0.5644 0.6111 0.3463 -0.0905 0.1775  -0.0029 45  PHE A CD2 
114  C CE1 . PHE A 44  ? 0.5533 0.6150 0.3449 -0.0874 0.1718  0.0013  45  PHE A CE1 
115  C CE2 . PHE A 44  ? 0.5501 0.5843 0.3187 -0.0962 0.1802  -0.0034 45  PHE A CE2 
116  C CZ  . PHE A 44  ? 0.5560 0.5996 0.3282 -0.0946 0.1770  -0.0008 45  PHE A CZ  
117  N N   . TRP A 45  ? 0.5369 0.6587 0.3667 -0.0609 0.1629  0.0157  46  TRP A N   
118  C CA  . TRP A 45  ? 0.5212 0.6772 0.3706 -0.0568 0.1597  0.0228  46  TRP A CA  
119  C C   . TRP A 45  ? 0.5310 0.6940 0.3789 -0.0464 0.1554  0.0285  46  TRP A C   
120  O O   . TRP A 45  ? 0.5190 0.7054 0.3869 -0.0403 0.1512  0.0397  46  TRP A O   
121  C CB  . TRP A 45  ? 0.5231 0.6962 0.3703 -0.0635 0.1634  0.0155  46  TRP A CB  
122  C CG  . TRP A 45  ? 0.5094 0.6890 0.3675 -0.0725 0.1661  0.0136  46  TRP A CG  
123  C CD1 . TRP A 45  ? 0.5327 0.6920 0.3777 -0.0821 0.1715  0.0020  46  TRP A CD1 
124  C CD2 . TRP A 45  ? 0.4840 0.6924 0.3713 -0.0726 0.1638  0.0245  46  TRP A CD2 
125  N NE1 . TRP A 45  ? 0.5006 0.6748 0.3630 -0.0885 0.1723  0.0032  46  TRP A NE1 
126  C CE2 . TRP A 45  ? 0.4769 0.6808 0.3671 -0.0825 0.1678  0.0176  46  TRP A CE2 
127  C CE3 . TRP A 45  ? 0.4715 0.7096 0.3859 -0.0650 0.1593  0.0409  46  TRP A CE3 
128  C CZ2 . TRP A 45  ? 0.4643 0.6917 0.3846 -0.0849 0.1672  0.0258  46  TRP A CZ2 
129  C CZ3 . TRP A 45  ? 0.4813 0.7434 0.4279 -0.0671 0.1593  0.0511  46  TRP A CZ3 
130  C CH2 . TRP A 45  ? 0.4662 0.7225 0.4160 -0.0769 0.1632  0.0432  46  TRP A CH2 
131  N N   . LYS A 46  ? 0.5581 0.7014 0.3854 -0.0442 0.1570  0.0214  47  LYS A N   
132  C CA  . LYS A 46  ? 0.5610 0.7142 0.3869 -0.0356 0.1536  0.0234  47  LYS A CA  
133  C C   . LYS A 46  ? 0.5810 0.7078 0.3949 -0.0280 0.1515  0.0254  47  LYS A C   
134  O O   . LYS A 46  ? 0.5878 0.7209 0.4013 -0.0205 0.1485  0.0268  47  LYS A O   
135  C CB  . LYS A 46  ? 0.5679 0.7296 0.3868 -0.0394 0.1579  0.0107  47  LYS A CB  
136  C CG  . LYS A 46  ? 0.5493 0.7451 0.3789 -0.0465 0.1600  0.0076  47  LYS A CG  
137  C CD  . LYS A 46  ? 0.5371 0.7713 0.3878 -0.0423 0.1542  0.0233  47  LYS A CD  
138  C CE  . LYS A 46  ? 0.5400 0.7993 0.3948 -0.0341 0.1498  0.0279  47  LYS A CE  
139  N NZ  . LYS A 46  ? 0.5134 0.8161 0.3920 -0.0311 0.1455  0.0454  47  LYS A NZ  
140  N N   . GLY A 47  ? 0.6098 0.7105 0.4143 -0.0299 0.1531  0.0258  48  GLY A N   
141  C CA  . GLY A 47  ? 0.6322 0.7088 0.4225 -0.0236 0.1524  0.0278  48  GLY A CA  
142  C C   . GLY A 47  ? 0.6366 0.7197 0.4328 -0.0143 0.1464  0.0360  48  GLY A C   
143  O O   . GLY A 47  ? 0.6553 0.7247 0.4412 -0.0072 0.1448  0.0383  48  GLY A O   
144  N N   . SER A 48  ? 0.6306 0.7346 0.4461 -0.0142 0.1437  0.0403  49  SER A N   
145  C CA  . SER A 48  ? 0.6314 0.7420 0.4574 -0.0069 0.1396  0.0458  49  SER A CA  
146  C C   . SER A 48  ? 0.6240 0.7619 0.4732 -0.0021 0.1364  0.0524  49  SER A C   
147  O O   . SER A 48  ? 0.6274 0.7841 0.4939 -0.0069 0.1376  0.0551  49  SER A O   
148  C CB  . SER A 48  ? 0.6194 0.7310 0.4557 -0.0124 0.1414  0.0436  49  SER A CB  
149  O OG  . SER A 48  ? 0.6604 0.7520 0.4753 -0.0171 0.1443  0.0396  49  SER A OG  
150  N N   . PRO A 49  ? 0.6263 0.7686 0.4768 0.0074  0.1324  0.0565  50  PRO A N   
151  C CA  . PRO A 49  ? 0.6438 0.7683 0.4740 0.0148  0.1302  0.0547  50  PRO A CA  
152  C C   . PRO A 49  ? 0.6568 0.7720 0.4705 0.0138  0.1317  0.0496  50  PRO A C   
153  O O   . PRO A 49  ? 0.6516 0.7843 0.4718 0.0103  0.1326  0.0478  50  PRO A O   
154  C CB  . PRO A 49  ? 0.6320 0.7740 0.4763 0.0241  0.1256  0.0606  50  PRO A CB  
155  C CG  . PRO A 49  ? 0.6154 0.7830 0.4906 0.0215  0.1262  0.0672  50  PRO A CG  
156  C CD  . PRO A 49  ? 0.6130 0.7837 0.4901 0.0117  0.1298  0.0654  50  PRO A CD  
157  N N   . GLN A 50  ? 0.6788 0.7701 0.4746 0.0171  0.1325  0.0472  51  GLN A N   
158  C CA  . GLN A 50  ? 0.7002 0.7816 0.4873 0.0168  0.1351  0.0405  51  GLN A CA  
159  C C   . GLN A 50  ? 0.6902 0.7835 0.4810 0.0253  0.1309  0.0397  51  GLN A C   
160  O O   . GLN A 50  ? 0.6871 0.7848 0.4803 0.0332  0.1260  0.0458  51  GLN A O   
161  C CB  . GLN A 50  ? 0.7381 0.7883 0.5105 0.0166  0.1389  0.0407  51  GLN A CB  
162  C CG  . GLN A 50  ? 0.7551 0.7970 0.5205 0.0185  0.1373  0.0489  51  GLN A CG  
163  C CD  . GLN A 50  ? 0.7920 0.8090 0.5438 0.0202  0.1404  0.0538  51  GLN A CD  
164  O OE1 . GLN A 50  ? 0.8133 0.8289 0.5584 0.0250  0.1380  0.0613  51  GLN A OE1 
165  N NE2 . GLN A 50  ? 0.8333 0.8335 0.5840 0.0165  0.1463  0.0499  51  GLN A NE2 
166  N N   . TYR A 51  ? 0.6800 0.7827 0.4734 0.0230  0.1331  0.0305  52  TYR A N   
167  C CA  . TYR A 51  ? 0.6616 0.7766 0.4585 0.0299  0.1296  0.0269  52  TYR A CA  
168  C C   . TYR A 51  ? 0.6728 0.7596 0.4635 0.0327  0.1331  0.0199  52  TYR A C   
169  O O   . TYR A 51  ? 0.6890 0.7729 0.4839 0.0269  0.1392  0.0077  52  TYR A O   
170  C CB  . TYR A 51  ? 0.6506 0.8038 0.4587 0.0254  0.1297  0.0198  52  TYR A CB  
171  C CG  . TYR A 51  ? 0.6391 0.8133 0.4523 0.0324  0.1249  0.0184  52  TYR A CG  
172  C CD1 . TYR A 51  ? 0.6335 0.8299 0.4542 0.0380  0.1188  0.0308  52  TYR A CD1 
173  C CD2 . TYR A 51  ? 0.6650 0.8373 0.4787 0.0334  0.1269  0.0040  52  TYR A CD2 
174  C CE1 . TYR A 51  ? 0.6187 0.8355 0.4438 0.0442  0.1143  0.0301  52  TYR A CE1 
175  C CE2 . TYR A 51  ? 0.6499 0.8437 0.4687 0.0394  0.1222  0.0014  52  TYR A CE2 
176  C CZ  . TYR A 51  ? 0.6436 0.8594 0.4660 0.0448  0.1156  0.0151  52  TYR A CZ  
177  O OH  . TYR A 51  ? 0.6860 0.9238 0.5129 0.0506  0.1108  0.0135  52  TYR A OH  
178  N N   . THR A 52  ? 0.6582 0.7258 0.4421 0.0414  0.1300  0.0278  53  THR A N   
179  C CA  . THR A 52  ? 0.6577 0.6983 0.4391 0.0459  0.1329  0.0260  53  THR A CA  
180  C C   . THR A 52  ? 0.6445 0.6872 0.4260 0.0572  0.1268  0.0288  53  THR A C   
181  O O   . THR A 52  ? 0.6183 0.6804 0.3998 0.0614  0.1206  0.0331  53  THR A O   
182  C CB  . THR A 52  ? 0.6740 0.6877 0.4452 0.0455  0.1357  0.0370  53  THR A CB  
183  O OG1 . THR A 52  ? 0.6548 0.6759 0.4186 0.0496  0.1300  0.0475  53  THR A OG1 
184  C CG2 . THR A 52  ? 0.6609 0.6686 0.4319 0.0341  0.1426  0.0334  53  THR A CG2 
185  N N   . HIS A 53  ? 0.6506 0.6724 0.4348 0.0623  0.1292  0.0271  54  HIS A N   
186  C CA  . HIS A 53  ? 0.6478 0.6690 0.4328 0.0731  0.1239  0.0291  54  HIS A CA  
187  C C   . HIS A 53  ? 0.6419 0.6614 0.4145 0.0810  0.1178  0.0436  54  HIS A C   
188  O O   . HIS A 53  ? 0.6351 0.6699 0.4077 0.0873  0.1117  0.0437  54  HIS A O   
189  C CB  . HIS A 53  ? 0.6657 0.6632 0.4611 0.0766  0.1290  0.0252  54  HIS A CB  
190  C CG  . HIS A 53  ? 0.6787 0.6842 0.4920 0.0692  0.1354  0.0053  54  HIS A CG  
191  N ND1 . HIS A 53  ? 0.6640 0.6956 0.4868 0.0695  0.1326  -0.0095 54  HIS A ND1 
192  C CD2 . HIS A 53  ? 0.6994 0.6955 0.5240 0.0603  0.1447  -0.0040 54  HIS A CD2 
193  C CE1 . HIS A 53  ? 0.6896 0.7300 0.5294 0.0609  0.1402  -0.0286 54  HIS A CE1 
194  N NE2 . HIS A 53  ? 0.7220 0.7400 0.5638 0.0553  0.1479  -0.0261 54  HIS A NE2 
195  N N   . VAL A 54  ? 0.6425 0.6476 0.4060 0.0799  0.1199  0.0545  55  VAL A N   
196  C CA  . VAL A 54  ? 0.6375 0.6467 0.3910 0.0859  0.1152  0.0654  55  VAL A CA  
197  C C   . VAL A 54  ? 0.6329 0.6457 0.3806 0.0777  0.1176  0.0698  55  VAL A C   
198  O O   . VAL A 54  ? 0.6442 0.6464 0.3921 0.0695  0.1233  0.0686  55  VAL A O   
199  C CB  . VAL A 54  ? 0.6646 0.6560 0.4136 0.0951  0.1152  0.0761  55  VAL A CB  
200  C CG1 . VAL A 54  ? 0.6619 0.6317 0.4104 0.0903  0.1225  0.0844  55  VAL A CG1 
201  C CG2 . VAL A 54  ? 0.6561 0.6601 0.3950 0.1025  0.1097  0.0849  55  VAL A CG2 
202  N N   . ASN A 55  ? 0.6118 0.6409 0.3570 0.0793  0.1139  0.0726  56  ASN A N   
203  C CA  . ASN A 55  ? 0.6042 0.6409 0.3474 0.0715  0.1162  0.0743  56  ASN A CA  
204  C C   . ASN A 55  ? 0.5994 0.6501 0.3387 0.0769  0.1130  0.0782  56  ASN A C   
205  O O   . ASN A 55  ? 0.5898 0.6512 0.3333 0.0848  0.1087  0.0762  56  ASN A O   
206  C CB  . ASN A 55  ? 0.5873 0.6413 0.3438 0.0640  0.1164  0.0671  56  ASN A CB  
207  C CG  . ASN A 55  ? 0.5833 0.6340 0.3450 0.0578  0.1193  0.0616  56  ASN A CG  
208  O OD1 . ASN A 55  ? 0.5910 0.6530 0.3610 0.0605  0.1169  0.0577  56  ASN A OD1 
209  N ND2 . ASN A 55  ? 0.5447 0.5834 0.3021 0.0493  0.1246  0.0608  56  ASN A ND2 
210  N N   . GLU A 56  ? 0.6070 0.6610 0.3391 0.0721  0.1155  0.0825  57  GLU A N   
211  C CA  . GLU A 56  ? 0.6062 0.6833 0.3379 0.0739  0.1138  0.0817  57  GLU A CA  
212  C C   . GLU A 56  ? 0.5817 0.6776 0.3323 0.0679  0.1143  0.0699  57  GLU A C   
213  O O   . GLU A 56  ? 0.5902 0.6846 0.3472 0.0582  0.1177  0.0664  57  GLU A O   
214  C CB  . GLU A 56  ? 0.6155 0.6958 0.3352 0.0686  0.1170  0.0891  57  GLU A CB  
215  C CG  . GLU A 56  ? 0.6293 0.7406 0.3475 0.0701  0.1156  0.0873  57  GLU A CG  
216  C CD  . GLU A 56  ? 0.6371 0.7572 0.3407 0.0664  0.1181  0.0985  57  GLU A CD  
217  O OE1 . GLU A 56  ? 0.6533 0.7585 0.3526 0.0582  0.1222  0.1030  57  GLU A OE1 
218  O OE2 . GLU A 56  ? 0.6287 0.7727 0.3253 0.0717  0.1161  0.1035  57  GLU A OE2 
219  N N   . VAL A 57  ? 0.5630 0.6766 0.3258 0.0738  0.1115  0.0642  58  VAL A N   
220  C CA  . VAL A 57  ? 0.5376 0.6690 0.3266 0.0689  0.1131  0.0545  58  VAL A CA  
221  C C   . VAL A 57  ? 0.5373 0.6961 0.3394 0.0669  0.1150  0.0448  58  VAL A C   
222  O O   . VAL A 57  ? 0.5268 0.7018 0.3575 0.0621  0.1180  0.0354  58  VAL A O   
223  C CB  . VAL A 57  ? 0.5285 0.6615 0.3315 0.0757  0.1101  0.0543  58  VAL A CB  
224  C CG1 . VAL A 57  ? 0.4978 0.6123 0.2921 0.0754  0.1091  0.0599  58  VAL A CG1 
225  C CG2 . VAL A 57  ? 0.5162 0.6559 0.3146 0.0870  0.1062  0.0538  58  VAL A CG2 
226  N N   . TRP A 58  ? 0.5514 0.7183 0.3356 0.0703  0.1140  0.0471  59  TRP A N   
227  C CA  . TRP A 58  ? 0.5457 0.7456 0.3388 0.0681  0.1160  0.0361  59  TRP A CA  
228  C C   . TRP A 58  ? 0.5707 0.7724 0.3342 0.0714  0.1142  0.0476  59  TRP A C   
229  O O   . TRP A 58  ? 0.5850 0.7619 0.3302 0.0783  0.1113  0.0620  59  TRP A O   
230  C CB  . TRP A 58  ? 0.5305 0.7478 0.3435 0.0757  0.1149  0.0265  59  TRP A CB  
231  C CG  . TRP A 58  ? 0.5224 0.7780 0.3502 0.0733  0.1180  0.0107  59  TRP A CG  
232  C CD1 . TRP A 58  ? 0.5424 0.8196 0.3578 0.0801  0.1159  0.0091  59  TRP A CD1 
233  C CD2 . TRP A 58  ? 0.5020 0.7829 0.3639 0.0632  0.1244  -0.0078 59  TRP A CD2 
234  N NE1 . TRP A 58  ? 0.5498 0.8674 0.3874 0.0743  0.1207  -0.0108 59  TRP A NE1 
235  C CE2 . TRP A 58  ? 0.5276 0.8471 0.3958 0.0636  0.1264  -0.0224 59  TRP A CE2 
236  C CE3 . TRP A 58  ? 0.4827 0.7595 0.3721 0.0536  0.1291  -0.0137 59  TRP A CE3 
237  C CZ2 . TRP A 58  ? 0.5052 0.8592 0.4089 0.0542  0.1335  -0.0454 59  TRP A CZ2 
238  C CZ3 . TRP A 58  ? 0.4937 0.8013 0.4195 0.0449  0.1359  -0.0343 59  TRP A CZ3 
239  C CH2 . TRP A 58  ? 0.4964 0.8424 0.4302 0.0449  0.1384  -0.0514 59  TRP A CH2 
240  N N   . PRO A 59  ? 0.5716 0.8041 0.3329 0.0658  0.1166  0.0423  60  PRO A N   
241  C CA  . PRO A 59  ? 0.5995 0.8361 0.3337 0.0686  0.1152  0.0583  60  PRO A CA  
242  C C   . PRO A 59  ? 0.6107 0.8426 0.3313 0.0830  0.1102  0.0704  60  PRO A C   
243  O O   . PRO A 59  ? 0.6037 0.8577 0.3323 0.0892  0.1084  0.0609  60  PRO A O   
244  C CB  . PRO A 59  ? 0.5966 0.8803 0.3354 0.0606  0.1183  0.0466  60  PRO A CB  
245  C CG  . PRO A 59  ? 0.5732 0.8623 0.3397 0.0490  0.1230  0.0267  60  PRO A CG  
246  C CD  . PRO A 59  ? 0.5614 0.8239 0.3459 0.0544  0.1217  0.0234  60  PRO A CD  
247  N N   . LYS A 60  ? 0.6331 0.8355 0.3365 0.0880  0.1088  0.0903  61  LYS A N   
248  C CA  . LYS A 60  ? 0.6500 0.8432 0.3429 0.1017  0.1045  0.1042  61  LYS A CA  
249  C C   . LYS A 60  ? 0.6360 0.8102 0.3386 0.1095  0.1012  0.0966  61  LYS A C   
250  O O   . LYS A 60  ? 0.6499 0.8197 0.3467 0.1209  0.0973  0.1041  61  LYS A O   
251  C CB  . LYS A 60  ? 0.6661 0.9008 0.3512 0.1074  0.1025  0.1076  61  LYS A CB  
252  C CG  . LYS A 60  ? 0.6978 0.9682 0.3740 0.0992  0.1055  0.1133  61  LYS A CG  
253  C CD  . LYS A 60  ? 0.7659 1.0125 0.4300 0.0960  0.1080  0.1360  61  LYS A CD  
254  C CE  . LYS A 60  ? 0.8276 1.0629 0.4808 0.1087  0.1057  0.1639  61  LYS A CE  
255  N NZ  . LYS A 60  ? 0.8245 1.1076 0.4666 0.1129  0.1044  0.1797  61  LYS A NZ  
256  N N   . LEU A 61  ? 0.6061 0.7712 0.3245 0.1034  0.1026  0.0830  62  LEU A N   
257  C CA  . LEU A 61  ? 0.5850 0.7385 0.3142 0.1095  0.0998  0.0765  62  LEU A CA  
258  C C   . LEU A 61  ? 0.5820 0.7052 0.3136 0.1053  0.1009  0.0790  62  LEU A C   
259  O O   . LEU A 61  ? 0.5749 0.6982 0.3162 0.0954  0.1043  0.0731  62  LEU A O   
260  C CB  . LEU A 61  ? 0.5595 0.7377 0.3114 0.1062  0.1011  0.0591  62  LEU A CB  
261  C CG  . LEU A 61  ? 0.5413 0.7206 0.3062 0.1145  0.0981  0.0526  62  LEU A CG  
262  C CD1 . LEU A 61  ? 0.5130 0.7180 0.3076 0.1099  0.1017  0.0364  62  LEU A CD1 
263  C CD2 . LEU A 61  ? 0.5159 0.6677 0.2804 0.1164  0.0961  0.0582  62  LEU A CD2 
264  N N   . TYR A 62  ? 0.5797 0.6804 0.3051 0.1125  0.0986  0.0860  63  TYR A N   
265  C CA  . TYR A 62  ? 0.5756 0.6532 0.3050 0.1082  0.1002  0.0853  63  TYR A CA  
266  C C   . TYR A 62  ? 0.5596 0.6377 0.2997 0.1127  0.0970  0.0777  63  TYR A C   
267  O O   . TYR A 62  ? 0.5597 0.6437 0.2994 0.1222  0.0929  0.0769  63  TYR A O   
268  C CB  . TYR A 62  ? 0.6018 0.6549 0.3220 0.1107  0.1020  0.0966  63  TYR A CB  
269  C CG  . TYR A 62  ? 0.6264 0.6776 0.3375 0.1053  0.1062  0.1073  63  TYR A CG  
270  C CD1 . TYR A 62  ? 0.6445 0.7160 0.3466 0.1085  0.1050  0.1152  63  TYR A CD1 
271  C CD2 . TYR A 62  ? 0.6606 0.6930 0.3724 0.0967  0.1116  0.1095  63  TYR A CD2 
272  C CE1 . TYR A 62  ? 0.6627 0.7382 0.3563 0.1031  0.1087  0.1267  63  TYR A CE1 
273  C CE2 . TYR A 62  ? 0.6748 0.7061 0.3785 0.0915  0.1157  0.1209  63  TYR A CE2 
274  C CZ  . TYR A 62  ? 0.6904 0.7442 0.3848 0.0947  0.1140  0.1302  63  TYR A CZ  
275  O OH  . TYR A 62  ? 0.7741 0.8333 0.4605 0.0894  0.1178  0.1429  63  TYR A OH  
276  N N   . ILE A 63  ? 0.5363 0.6121 0.2863 0.1057  0.0987  0.0725  64  ILE A N   
277  C CA  . ILE A 63  ? 0.5122 0.5918 0.2715 0.1087  0.0960  0.0675  64  ILE A CA  
278  C C   . ILE A 63  ? 0.5279 0.5905 0.2847 0.1056  0.0981  0.0664  64  ILE A C   
279  O O   . ILE A 63  ? 0.5347 0.5920 0.2922 0.0965  0.1024  0.0657  64  ILE A O   
280  C CB  . ILE A 63  ? 0.4900 0.5893 0.2671 0.1033  0.0965  0.0634  64  ILE A CB  
281  C CG1 . ILE A 63  ? 0.4651 0.5821 0.2524 0.1061  0.0960  0.0613  64  ILE A CG1 
282  C CG2 . ILE A 63  ? 0.4715 0.5801 0.2579 0.1059  0.0937  0.0608  64  ILE A CG2 
283  C CD1 . ILE A 63  ? 0.4391 0.5752 0.2519 0.1017  0.0977  0.0590  64  ILE A CD1 
284  N N   . GLY A 64  ? 0.5333 0.5888 0.2893 0.1127  0.0958  0.0644  65  GLY A N   
285  C CA  . GLY A 64  ? 0.5435 0.5857 0.3028 0.1098  0.0988  0.0594  65  GLY A CA  
286  C C   . GLY A 64  ? 0.5383 0.5923 0.3065 0.1127  0.0959  0.0497  65  GLY A C   
287  O O   . GLY A 64  ? 0.5070 0.5783 0.2778 0.1173  0.0911  0.0487  65  GLY A O   
288  N N   . ASP A 65  ? 0.5631 0.6097 0.3382 0.1090  0.0996  0.0412  66  ASP A N   
289  C CA  . ASP A 65  ? 0.5718 0.6340 0.3570 0.1093  0.0980  0.0288  66  ASP A CA  
290  C C   . ASP A 65  ? 0.5934 0.6380 0.3834 0.1174  0.0978  0.0250  66  ASP A C   
291  O O   . ASP A 65  ? 0.6093 0.6313 0.3943 0.1236  0.0985  0.0355  66  ASP A O   
292  C CB  . ASP A 65  ? 0.5691 0.6436 0.3633 0.0980  0.1032  0.0179  66  ASP A CB  
293  C CG  . ASP A 65  ? 0.6149 0.6650 0.4153 0.0938  0.1109  0.0124  66  ASP A CG  
294  O OD1 . ASP A 65  ? 0.6806 0.7025 0.4781 0.0995  0.1125  0.0216  66  ASP A OD1 
295  O OD2 . ASP A 65  ? 0.6319 0.6941 0.4422 0.0846  0.1159  -0.0006 66  ASP A OD2 
296  N N   . GLU A 66  ? 0.5967 0.6553 0.3982 0.1172  0.0971  0.0106  67  GLU A N   
297  C CA  . GLU A 66  ? 0.6218 0.6671 0.4331 0.1246  0.0969  0.0044  67  GLU A CA  
298  C C   . GLU A 66  ? 0.6508 0.6658 0.4740 0.1238  0.1047  0.0049  67  GLU A C   
299  O O   . GLU A 66  ? 0.6814 0.6753 0.5076 0.1330  0.1044  0.0136  67  GLU A O   
300  C CB  . GLU A 66  ? 0.6102 0.6824 0.4346 0.1217  0.0956  -0.0151 67  GLU A CB  
301  C CG  . GLU A 66  ? 0.6574 0.7177 0.4959 0.1288  0.0956  -0.0243 67  GLU A CG  
302  C CD  . GLU A 66  ? 0.6575 0.7494 0.5095 0.1252  0.0942  -0.0460 67  GLU A CD  
303  O OE1 . GLU A 66  ? 0.6637 0.7899 0.5140 0.1170  0.0933  -0.0523 67  GLU A OE1 
304  O OE2 . GLU A 66  ? 0.7344 0.8198 0.6007 0.1303  0.0941  -0.0563 67  GLU A OE2 
305  N N   . ALA A 67  ? 0.6529 0.6669 0.4851 0.1132  0.1122  -0.0031 68  ALA A N   
306  C CA  . ALA A 67  ? 0.6660 0.6504 0.5141 0.1118  0.1213  -0.0018 68  ALA A CA  
307  C C   . ALA A 67  ? 0.6719 0.6315 0.5074 0.1194  0.1204  0.0232  68  ALA A C   
308  O O   . ALA A 67  ? 0.6993 0.6354 0.5484 0.1258  0.1240  0.0316  68  ALA A O   
309  C CB  . ALA A 67  ? 0.6586 0.6471 0.5145 0.0987  0.1295  -0.0125 68  ALA A CB  
310  N N   . THR A 68  ? 0.6564 0.6249 0.4688 0.1185  0.1157  0.0353  69  THR A N   
311  C CA  . THR A 68  ? 0.6574 0.6120 0.4560 0.1233  0.1150  0.0572  69  THR A CA  
312  C C   . THR A 68  ? 0.6608 0.6116 0.4568 0.1367  0.1096  0.0677  69  THR A C   
313  O O   . THR A 68  ? 0.6806 0.6144 0.4799 0.1427  0.1120  0.0839  69  THR A O   
314  C CB  . THR A 68  ? 0.6497 0.6209 0.4285 0.1180  0.1117  0.0623  69  THR A CB  
315  O OG1 . THR A 68  ? 0.6588 0.6360 0.4418 0.1059  0.1164  0.0517  69  THR A OG1 
316  C CG2 . THR A 68  ? 0.6249 0.5882 0.3905 0.1203  0.1121  0.0819  69  THR A CG2 
317  N N   . ALA A 69  ? 0.6412 0.6098 0.4334 0.1414  0.1025  0.0590  70  ALA A N   
318  C CA  . ALA A 69  ? 0.6425 0.6109 0.4320 0.1541  0.0968  0.0657  70  ALA A CA  
319  C C   . ALA A 69  ? 0.6696 0.6177 0.4808 0.1601  0.1005  0.0659  70  ALA A C   
320  O O   . ALA A 69  ? 0.6820 0.6226 0.4929 0.1709  0.0982  0.0802  70  ALA A O   
321  C CB  . ALA A 69  ? 0.6146 0.6062 0.3989 0.1563  0.0896  0.0538  70  ALA A CB  
322  N N   . LEU A 70  ? 0.6834 0.6252 0.5166 0.1530  0.1069  0.0495  71  LEU A N   
323  C CA  . LEU A 70  ? 0.7063 0.6310 0.5694 0.1574  0.1119  0.0437  71  LEU A CA  
324  C C   . LEU A 70  ? 0.7380 0.6349 0.6187 0.1587  0.1207  0.0605  71  LEU A C   
325  O O   . LEU A 70  ? 0.7453 0.6259 0.6486 0.1670  0.1234  0.0678  71  LEU A O   
326  C CB  . LEU A 70  ? 0.7002 0.6365 0.5846 0.1481  0.1161  0.0143  71  LEU A CB  
327  C CG  . LEU A 70  ? 0.6760 0.6414 0.5540 0.1484  0.1083  -0.0032 71  LEU A CG  
328  C CD1 . LEU A 70  ? 0.6278 0.6129 0.5279 0.1372  0.1136  -0.0327 71  LEU A CD1 
329  C CD2 . LEU A 70  ? 0.6995 0.6589 0.5818 0.1615  0.1028  0.0011  71  LEU A CD2 
330  N N   . ASP A 71  ? 0.7607 0.6532 0.6332 0.1503  0.1255  0.0674  72  ASP A N   
331  C CA  . ASP A 71  ? 0.7953 0.6632 0.6848 0.1497  0.1350  0.0843  72  ASP A CA  
332  C C   . ASP A 71  ? 0.8107 0.6746 0.6860 0.1605  0.1312  0.1167  72  ASP A C   
333  O O   . ASP A 71  ? 0.8061 0.6786 0.6564 0.1578  0.1290  0.1306  72  ASP A O   
334  C CB  . ASP A 71  ? 0.7962 0.6649 0.6789 0.1361  0.1407  0.0785  72  ASP A CB  
335  C CG  . ASP A 71  ? 0.8464 0.6892 0.7544 0.1328  0.1530  0.0893  72  ASP A CG  
336  O OD1 . ASP A 71  ? 0.8650 0.6902 0.7899 0.1420  0.1562  0.1113  72  ASP A OD1 
337  O OD2 . ASP A 71  ? 0.8916 0.7336 0.8039 0.1208  0.1597  0.0762  72  ASP A OD2 
338  N N   . ARG A 72  ? 0.8354 0.6899 0.7289 0.1723  0.1307  0.1280  73  ARG A N   
339  C CA  . ARG A 72  ? 0.8570 0.7157 0.7377 0.1840  0.1261  0.1585  73  ARG A CA  
340  C C   . ARG A 72  ? 0.8924 0.7389 0.7810 0.1834  0.1338  0.1868  73  ARG A C   
341  O O   . ARG A 72  ? 0.8879 0.7503 0.7523 0.1865  0.1297  0.2093  73  ARG A O   
342  C CB  . ARG A 72  ? 0.8634 0.7179 0.7630 0.1973  0.1231  0.1625  73  ARG A CB  
343  C CG  . ARG A 72  ? 0.8387 0.7122 0.7209 0.1998  0.1131  0.1414  73  ARG A CG  
344  C CD  . ARG A 72  ? 0.8492 0.7163 0.7543 0.2114  0.1112  0.1401  73  ARG A CD  
345  N NE  . ARG A 72  ? 0.8720 0.7208 0.8181 0.2066  0.1198  0.1200  73  ARG A NE  
346  C CZ  . ARG A 72  ? 0.8612 0.7047 0.8346 0.2129  0.1197  0.1078  73  ARG A CZ  
347  N NH1 . ARG A 72  ? 0.8428 0.6960 0.8052 0.2250  0.1108  0.1153  73  ARG A NH1 
348  N NH2 . ARG A 72  ? 0.8578 0.6886 0.8717 0.2064  0.1290  0.0858  73  ARG A NH2 
349  N N   . TYR A 73  ? 0.9274 0.7492 0.8518 0.1787  0.1454  0.1848  74  TYR A N   
350  C CA  . TYR A 73  ? 0.9691 0.7787 0.9035 0.1766  0.1541  0.2111  74  TYR A CA  
351  C C   . TYR A 73  ? 0.9624 0.7891 0.8584 0.1670  0.1509  0.2134  74  TYR A C   
352  O O   . TYR A 73  ? 0.9767 0.8145 0.8570 0.1697  0.1497  0.2411  74  TYR A O   
353  C CB  . TYR A 73  ? 0.9911 0.7718 0.9721 0.1700  0.1687  0.2013  74  TYR A CB  
354  C CG  . TYR A 73  ? 1.0341 0.8029 1.0236 0.1650  0.1784  0.2253  74  TYR A CG  
355  C CD1 . TYR A 73  ? 1.0861 0.8453 1.0988 0.1747  0.1836  0.2632  74  TYR A CD1 
356  C CD2 . TYR A 73  ? 1.0462 0.8160 1.0200 0.1508  0.1821  0.2119  74  TYR A CD2 
357  C CE1 . TYR A 73  ? 1.1197 0.8707 1.1401 0.1698  0.1927  0.2874  74  TYR A CE1 
358  C CE2 . TYR A 73  ? 1.0743 0.8342 1.0542 0.1458  0.1909  0.2334  74  TYR A CE2 
359  C CZ  . TYR A 73  ? 1.1098 0.8606 1.1127 0.1551  0.1962  0.2711  74  TYR A CZ  
360  O OH  . TYR A 73  ? 1.1337 0.8769 1.1434 0.1497  0.2051  0.2935  74  TYR A OH  
361  N N   . ARG A 74  ? 0.9525 0.7851 0.8348 0.1558  0.1496  0.1844  75  ARG A N   
362  C CA  . ARG A 74  ? 0.9489 0.7949 0.8019 0.1451  0.1481  0.1821  75  ARG A CA  
363  C C   . ARG A 74  ? 0.9243 0.7997 0.7409 0.1488  0.1369  0.1889  75  ARG A C   
364  O O   . ARG A 74  ? 0.9315 0.8199 0.7279 0.1430  0.1365  0.1981  75  ARG A O   
365  C CB  . ARG A 74  ? 0.9414 0.7872 0.7962 0.1329  0.1504  0.1499  75  ARG A CB  
366  C CG  . ARG A 74  ? 0.9903 0.8426 0.8259 0.1201  0.1526  0.1469  75  ARG A CG  
367  C CD  . ARG A 74  ? 1.0423 0.8872 0.8939 0.1079  0.1601  0.1203  75  ARG A CD  
368  N NE  . ARG A 74  ? 1.1151 0.9353 1.0063 0.1083  0.1715  0.1179  75  ARG A NE  
369  C CZ  . ARG A 74  ? 1.1404 0.9550 1.0563 0.0995  0.1799  0.0921  75  ARG A CZ  
370  N NH1 . ARG A 74  ? 1.1203 0.9541 1.0226 0.0896  0.1776  0.0684  75  ARG A NH1 
371  N NH2 . ARG A 74  ? 1.1648 0.9571 1.1226 0.1005  0.1915  0.0901  75  ARG A NH2 
372  N N   . LEU A 75  ? 0.9032 0.7908 0.7136 0.1576  0.1286  0.1822  76  LEU A N   
373  C CA  . LEU A 75  ? 0.8810 0.7978 0.6627 0.1622  0.1192  0.1878  76  LEU A CA  
374  C C   . LEU A 75  ? 0.9012 0.8279 0.6786 0.1701  0.1192  0.2197  76  LEU A C   
375  O O   . LEU A 75  ? 0.8867 0.8379 0.6421 0.1671  0.1166  0.2281  76  LEU A O   
376  C CB  . LEU A 75  ? 0.8641 0.7905 0.6436 0.1706  0.1112  0.1740  76  LEU A CB  
377  C CG  . LEU A 75  ? 0.8399 0.7701 0.6188 0.1646  0.1083  0.1447  76  LEU A CG  
378  C CD1 . LEU A 75  ? 0.8075 0.7468 0.5865 0.1749  0.1009  0.1371  76  LEU A CD1 
379  C CD2 . LEU A 75  ? 0.7877 0.7369 0.5466 0.1549  0.1060  0.1357  76  LEU A CD2 
380  N N   . GLN A 76  ? 0.9267 0.8375 0.7277 0.1797  0.1227  0.2377  77  GLN A N   
381  C CA  . GLN A 76  ? 0.9562 0.8814 0.7556 0.1887  0.1225  0.2722  77  GLN A CA  
382  C C   . GLN A 76  ? 0.9687 0.8954 0.7659 0.1807  0.1294  0.2921  77  GLN A C   
383  O O   . GLN A 76  ? 0.9624 0.9199 0.7394 0.1816  0.1264  0.3106  77  GLN A O   
384  C CB  . GLN A 76  ? 0.9822 0.8896 0.8133 0.2014  0.1253  0.2892  77  GLN A CB  
385  C CG  . GLN A 76  ? 1.0247 0.9548 0.8532 0.2125  0.1236  0.3275  77  GLN A CG  
386  C CD  . GLN A 76  ? 1.0804 0.9872 0.9501 0.2226  0.1305  0.3522  77  GLN A CD  
387  O OE1 . GLN A 76  ? 1.1336 1.0354 1.0205 0.2225  0.1384  0.3819  77  GLN A OE1 
388  N NE2 . GLN A 76  ? 1.0854 0.9781 0.9751 0.2312  0.1283  0.3404  77  GLN A NE2 
389  N N   . LYS A 77  ? 0.9818 0.8781 0.8007 0.1725  0.1391  0.2867  78  LYS A N   
390  C CA  . LYS A 77  ? 0.9935 0.8877 0.8099 0.1622  0.1463  0.2989  78  LYS A CA  
391  C C   . LYS A 77  ? 0.9614 0.8851 0.7412 0.1522  0.1409  0.2882  78  LYS A C   
392  O O   . LYS A 77  ? 0.9764 0.9160 0.7457 0.1477  0.1432  0.3066  78  LYS A O   
393  C CB  . LYS A 77  ? 1.0061 0.8643 0.8500 0.1530  0.1569  0.2817  78  LYS A CB  
394  C CG  . LYS A 77  ? 1.0582 0.9044 0.9134 0.1450  0.1677  0.2997  78  LYS A CG  
395  C CD  . LYS A 77  ? 1.0850 0.9154 0.9409 0.1296  0.1735  0.2700  78  LYS A CD  
396  C CE  . LYS A 77  ? 1.1257 0.9373 1.0014 0.1219  0.1864  0.2849  78  LYS A CE  
397  N NZ  . LYS A 77  ? 1.1120 0.9196 0.9761 0.1063  0.1897  0.2592  78  LYS A NZ  
398  N N   . ALA A 78  ? 0.9251 0.8576 0.6890 0.1486  0.1342  0.2590  79  ALA A N   
399  C CA  . ALA A 78  ? 0.8929 0.8525 0.6296 0.1393  0.1299  0.2464  79  ALA A CA  
400  C C   . ALA A 78  ? 0.8746 0.8747 0.5908 0.1458  0.1215  0.2523  79  ALA A C   
401  O O   . ALA A 78  ? 0.8585 0.8847 0.5572 0.1384  0.1185  0.2403  79  ALA A O   
402  C CB  . ALA A 78  ? 0.8657 0.8166 0.6012 0.1315  0.1284  0.2140  79  ALA A CB  
403  N N   . GLY A 79  ? 0.8715 0.8786 0.5927 0.1593  0.1182  0.2691  80  GLY A N   
404  C CA  . GLY A 79  ? 0.8594 0.9084 0.5628 0.1661  0.1109  0.2743  80  GLY A CA  
405  C C   . GLY A 79  ? 0.8241 0.8875 0.5180 0.1678  0.1035  0.2469  80  GLY A C   
406  O O   . GLY A 79  ? 0.8200 0.9224 0.4988 0.1679  0.0992  0.2429  80  GLY A O   
407  N N   . PHE A 80  ? 0.7965 0.8329 0.5009 0.1689  0.1025  0.2278  81  PHE A N   
408  C CA  . PHE A 80  ? 0.7631 0.8141 0.4611 0.1720  0.0958  0.2058  81  PHE A CA  
409  C C   . PHE A 80  ? 0.7522 0.8254 0.4460 0.1858  0.0901  0.2161  81  PHE A C   
410  O O   . PHE A 80  ? 0.7663 0.8267 0.4706 0.1956  0.0906  0.2344  81  PHE A O   
411  C CB  . PHE A 80  ? 0.7512 0.7736 0.4617 0.1700  0.0960  0.1852  81  PHE A CB  
412  C CG  . PHE A 80  ? 0.7560 0.7718 0.4662 0.1564  0.0994  0.1693  81  PHE A CG  
413  C CD1 . PHE A 80  ? 0.8016 0.7936 0.5204 0.1486  0.1065  0.1736  81  PHE A CD1 
414  C CD2 . PHE A 80  ? 0.7127 0.7482 0.4162 0.1511  0.0962  0.1513  81  PHE A CD2 
415  C CE1 . PHE A 80  ? 0.7987 0.7876 0.5164 0.1360  0.1095  0.1594  81  PHE A CE1 
416  C CE2 . PHE A 80  ? 0.7344 0.7664 0.4396 0.1389  0.0994  0.1393  81  PHE A CE2 
417  C CZ  . PHE A 80  ? 0.7682 0.7777 0.4788 0.1314  0.1056  0.1431  81  PHE A CZ  
418  N N   . THR A 81  ? 0.7207 0.8289 0.4020 0.1862  0.0855  0.2041  82  THR A N   
419  C CA  . THR A 81  ? 0.7077 0.8436 0.3836 0.1984  0.0800  0.2092  82  THR A CA  
420  C C   . THR A 81  ? 0.6813 0.8179 0.3591 0.2022  0.0751  0.1847  82  THR A C   
421  O O   . THR A 81  ? 0.6833 0.8370 0.3585 0.2130  0.0706  0.1860  82  THR A O   
422  C CB  . THR A 81  ? 0.7049 0.8907 0.3669 0.1957  0.0795  0.2134  82  THR A CB  
423  O OG1 . THR A 81  ? 0.6759 0.8733 0.3359 0.1832  0.0811  0.1891  82  THR A OG1 
424  C CG2 . THR A 81  ? 0.7132 0.9072 0.3723 0.1939  0.0835  0.2428  82  THR A CG2 
425  N N   . HIS A 82  ? 0.6495 0.7708 0.3324 0.1934  0.0763  0.1636  83  HIS A N   
426  C CA  . HIS A 82  ? 0.6230 0.7471 0.3100 0.1957  0.0725  0.1422  83  HIS A CA  
427  C C   . HIS A 82  ? 0.6033 0.6967 0.3009 0.1891  0.0743  0.1301  83  HIS A C   
428  O O   . HIS A 82  ? 0.5995 0.6820 0.2991 0.1788  0.0787  0.1297  83  HIS A O   
429  C CB  . HIS A 82  ? 0.6021 0.7611 0.2866 0.1900  0.0726  0.1262  83  HIS A CB  
430  C CG  . HIS A 82  ? 0.5796 0.7791 0.2549 0.1948  0.0714  0.1324  83  HIS A CG  
431  N ND1 . HIS A 82  ? 0.5756 0.7943 0.2425 0.1907  0.0741  0.1473  83  HIS A ND1 
432  C CD2 . HIS A 82  ? 0.5574 0.7872 0.2310 0.2025  0.0681  0.1241  83  HIS A CD2 
433  C CE1 . HIS A 82  ? 0.5556 0.8178 0.2157 0.1959  0.0722  0.1488  83  HIS A CE1 
434  N NE2 . HIS A 82  ? 0.5440 0.8131 0.2082 0.2032  0.0687  0.1340  83  HIS A NE2 
435  N N   . VAL A 83  ? 0.5897 0.6734 0.2940 0.1950  0.0708  0.1202  84  VAL A N   
436  C CA  . VAL A 83  ? 0.5781 0.6435 0.2927 0.1891  0.0717  0.1068  84  VAL A CA  
437  C C   . VAL A 83  ? 0.5602 0.6417 0.2777 0.1919  0.0675  0.0912  84  VAL A C   
438  O O   . VAL A 83  ? 0.5683 0.6568 0.2840 0.2021  0.0633  0.0905  84  VAL A O   
439  C CB  . VAL A 83  ? 0.5981 0.6359 0.3229 0.1933  0.0724  0.1102  84  VAL A CB  
440  C CG1 . VAL A 83  ? 0.5667 0.5971 0.3024 0.1880  0.0723  0.0921  84  VAL A CG1 
441  C CG2 . VAL A 83  ? 0.6070 0.6266 0.3351 0.1895  0.0783  0.1250  84  VAL A CG2 
442  N N   . LEU A 84  ? 0.5516 0.6406 0.2754 0.1830  0.0691  0.0802  85  LEU A N   
443  C CA  . LEU A 84  ? 0.5261 0.6294 0.2584 0.1842  0.0666  0.0675  85  LEU A CA  
444  C C   . LEU A 84  ? 0.5231 0.6152 0.2643 0.1791  0.0669  0.0616  85  LEU A C   
445  O O   . LEU A 84  ? 0.5200 0.6103 0.2660 0.1692  0.0704  0.0609  85  LEU A O   
446  C CB  . LEU A 84  ? 0.5086 0.6342 0.2482 0.1778  0.0693  0.0613  85  LEU A CB  
447  C CG  . LEU A 84  ? 0.4888 0.6334 0.2419 0.1806  0.0679  0.0501  85  LEU A CG  
448  C CD1 . LEU A 84  ? 0.4704 0.6343 0.2377 0.1728  0.0728  0.0444  85  LEU A CD1 
449  C CD2 . LEU A 84  ? 0.4881 0.6278 0.2510 0.1803  0.0659  0.0459  85  LEU A CD2 
450  N N   . ASN A 85  ? 0.5204 0.6093 0.2644 0.1854  0.0632  0.0564  86  ASN A N   
451  C CA  . ASN A 85  ? 0.5182 0.6034 0.2710 0.1808  0.0632  0.0491  86  ASN A CA  
452  C C   . ASN A 85  ? 0.4970 0.6046 0.2588 0.1797  0.0611  0.0418  86  ASN A C   
453  O O   . ASN A 85  ? 0.4987 0.6153 0.2617 0.1873  0.0572  0.0373  86  ASN A O   
454  C CB  . ASN A 85  ? 0.5314 0.6019 0.2856 0.1877  0.0611  0.0464  86  ASN A CB  
455  C CG  . ASN A 85  ? 0.5168 0.5900 0.2821 0.1822  0.0615  0.0348  86  ASN A CG  
456  O OD1 . ASN A 85  ? 0.4516 0.5389 0.2217 0.1732  0.0632  0.0311  86  ASN A OD1 
457  N ND2 . ASN A 85  ? 0.4591 0.5221 0.2310 0.1871  0.0604  0.0286  86  ASN A ND2 
458  N N   . ALA A 86  ? 0.4817 0.5989 0.2518 0.1702  0.0641  0.0418  87  ALA A N   
459  C CA  . ALA A 86  ? 0.4590 0.5991 0.2426 0.1682  0.0635  0.0398  87  ALA A CA  
460  C C   . ALA A 86  ? 0.4557 0.6064 0.2452 0.1663  0.0613  0.0344  87  ALA A C   
461  O O   . ALA A 86  ? 0.4270 0.6007 0.2293 0.1636  0.0610  0.0354  87  ALA A O   
462  C CB  . ALA A 86  ? 0.4461 0.5940 0.2394 0.1590  0.0682  0.0447  87  ALA A CB  
463  N N   . ALA A 87  ? 0.4712 0.6082 0.2545 0.1672  0.0605  0.0287  88  ALA A N   
464  C CA  . ALA A 87  ? 0.4744 0.6253 0.2642 0.1655  0.0585  0.0192  88  ALA A CA  
465  C C   . ALA A 87  ? 0.4961 0.6323 0.2816 0.1743  0.0554  0.0122  88  ALA A C   
466  O O   . ALA A 87  ? 0.5114 0.6440 0.3021 0.1722  0.0561  0.0024  88  ALA A O   
467  C CB  . ALA A 87  ? 0.4695 0.6232 0.2638 0.1552  0.0624  0.0147  88  ALA A CB  
468  N N   . HIS A 88  ? 0.5000 0.6301 0.2790 0.1840  0.0524  0.0160  89  HIS A N   
469  C CA  . HIS A 88  ? 0.5155 0.6337 0.2915 0.1936  0.0490  0.0112  89  HIS A CA  
470  C C   . HIS A 88  ? 0.5142 0.6484 0.2979 0.1944  0.0454  -0.0015 89  HIS A C   
471  O O   . HIS A 88  ? 0.4983 0.6582 0.2872 0.1910  0.0440  -0.0036 89  HIS A O   
472  C CB  . HIS A 88  ? 0.5222 0.6403 0.2900 0.2031  0.0464  0.0169  89  HIS A CB  
473  C CG  . HIS A 88  ? 0.5289 0.6363 0.2930 0.2142  0.0426  0.0144  89  HIS A CG  
474  N ND1 . HIS A 88  ? 0.5554 0.6426 0.3146 0.2196  0.0436  0.0229  89  HIS A ND1 
475  C CD2 . HIS A 88  ? 0.5239 0.6394 0.2899 0.2211  0.0380  0.0060  89  HIS A CD2 
476  C CE1 . HIS A 88  ? 0.5572 0.6405 0.3165 0.2298  0.0396  0.0203  89  HIS A CE1 
477  N NE2 . HIS A 88  ? 0.5447 0.6442 0.3071 0.2308  0.0361  0.0088  89  HIS A NE2 
478  N N   . GLY A 89  ? 0.5371 0.6577 0.3242 0.1992  0.0442  -0.0092 90  GLY A N   
479  C CA  . GLY A 89  ? 0.5401 0.6756 0.3347 0.2011  0.0405  -0.0233 90  GLY A CA  
480  C C   . GLY A 89  ? 0.5573 0.6904 0.3667 0.1955  0.0432  -0.0380 90  GLY A C   
481  O O   . GLY A 89  ? 0.5600 0.6873 0.3754 0.1874  0.0487  -0.0387 90  GLY A O   
482  N N   . ARG A 90  ? 0.5615 0.7011 0.3792 0.1994  0.0400  -0.0519 91  ARG A N   
483  C CA  A ARG A 90  ? 0.5769 0.7168 0.4147 0.1940  0.0435  -0.0702 91  ARG A CA  
484  C CA  B ARG A 90  ? 0.5800 0.7217 0.4179 0.1942  0.0431  -0.0710 91  ARG A CA  
485  C C   . ARG A 90  ? 0.5670 0.7425 0.4125 0.1800  0.0460  -0.0825 91  ARG A C   
486  O O   . ARG A 90  ? 0.5844 0.7624 0.4477 0.1724  0.0513  -0.0979 91  ARG A O   
487  C CB  A ARG A 90  ? 0.5862 0.7235 0.4346 0.2017  0.0398  -0.0835 91  ARG A CB  
488  C CB  B ARG A 90  ? 0.5864 0.7332 0.4321 0.2013  0.0383  -0.0848 91  ARG A CB  
489  C CG  A ARG A 90  ? 0.6021 0.7012 0.4581 0.2126  0.0413  -0.0760 91  ARG A CG  
490  C CG  B ARG A 90  ? 0.6139 0.7292 0.4561 0.2159  0.0358  -0.0745 91  ARG A CG  
491  C CD  A ARG A 90  ? 0.5957 0.6948 0.4555 0.2229  0.0356  -0.0835 91  ARG A CD  
492  C CD  B ARG A 90  ? 0.6279 0.7513 0.4748 0.2234  0.0300  -0.0871 91  ARG A CD  
493  N NE  A ARG A 90  ? 0.6130 0.6838 0.4921 0.2317  0.0376  -0.0825 91  ARG A NE  
494  N NE  B ARG A 90  ? 0.6617 0.7563 0.5131 0.2364  0.0289  -0.0797 91  ARG A NE  
495  C CZ  A ARG A 90  ? 0.6033 0.6481 0.4983 0.2318  0.0443  -0.0739 91  ARG A CZ  
496  C CZ  B ARG A 90  ? 0.6593 0.7539 0.5177 0.2447  0.0245  -0.0891 91  ARG A CZ  
497  N NH1 A ARG A 90  ? 0.5949 0.6363 0.4861 0.2232  0.0497  -0.0671 91  ARG A NH1 
498  N NH1 B ARG A 90  ? 0.6367 0.7579 0.4973 0.2412  0.0207  -0.1076 91  ARG A NH1 
499  N NH2 A ARG A 90  ? 0.6228 0.6451 0.5396 0.2408  0.0460  -0.0713 91  ARG A NH2 
500  N NH2 B ARG A 90  ? 0.6681 0.7380 0.5321 0.2567  0.0239  -0.0786 91  ARG A NH2 
501  N N   . TRP A 91  ? 0.5407 0.7453 0.3758 0.1766  0.0431  -0.0750 92  TRP A N   
502  C CA  . TRP A 91  ? 0.5246 0.7688 0.3661 0.1637  0.0453  -0.0815 92  TRP A CA  
503  C C   . TRP A 91  ? 0.5288 0.7689 0.3656 0.1570  0.0499  -0.0683 92  TRP A C   
504  O O   . TRP A 91  ? 0.5220 0.7946 0.3644 0.1464  0.0523  -0.0720 92  TRP A O   
505  C CB  . TRP A 91  ? 0.5008 0.7857 0.3396 0.1631  0.0400  -0.0792 92  TRP A CB  
506  C CG  . TRP A 91  ? 0.5011 0.8006 0.3475 0.1656  0.0363  -0.0977 92  TRP A CG  
507  C CD1 . TRP A 91  ? 0.4891 0.7636 0.3327 0.1769  0.0325  -0.1005 92  TRP A CD1 
508  C CD2 . TRP A 91  ? 0.4853 0.8305 0.3450 0.1562  0.0361  -0.1177 92  TRP A CD2 
509  N NE1 . TRP A 91  ? 0.4982 0.7972 0.3531 0.1750  0.0301  -0.1215 92  TRP A NE1 
510  C CE2 . TRP A 91  ? 0.4725 0.8160 0.3374 0.1621  0.0323  -0.1330 92  TRP A CE2 
511  C CE3 . TRP A 91  ? 0.4797 0.8716 0.3476 0.1432  0.0389  -0.1246 92  TRP A CE3 
512  C CZ2 . TRP A 91  ? 0.4701 0.8563 0.3486 0.1547  0.0313  -0.1559 92  TRP A CZ2 
513  C CZ3 . TRP A 91  ? 0.4672 0.9051 0.3481 0.1358  0.0379  -0.1473 92  TRP A CZ3 
514  C CH2 . TRP A 91  ? 0.4534 0.8884 0.3397 0.1413  0.0341  -0.1632 92  TRP A CH2 
515  N N   . ASN A 92  ? 0.5432 0.7461 0.3702 0.1628  0.0513  -0.0534 93  ASN A N   
516  C CA  . ASN A 92  ? 0.5448 0.7409 0.3669 0.1570  0.0556  -0.0411 93  ASN A CA  
517  C C   . ASN A 92  ? 0.5642 0.7245 0.3897 0.1569  0.0610  -0.0428 93  ASN A C   
518  O O   . ASN A 92  ? 0.5695 0.7306 0.4104 0.1524  0.0648  -0.0596 93  ASN A O   
519  C CB  . ASN A 92  ? 0.5405 0.7327 0.3507 0.1623  0.0530  -0.0220 93  ASN A CB  
520  C CG  . ASN A 92  ? 0.5396 0.7677 0.3531 0.1621  0.0491  -0.0186 93  ASN A CG  
521  O OD1 . ASN A 92  ? 0.5713 0.8333 0.3927 0.1537  0.0498  -0.0207 93  ASN A OD1 
522  N ND2 . ASN A 92  ? 0.5711 0.7946 0.3803 0.1715  0.0453  -0.0130 93  ASN A ND2 
523  N N   . VAL A 93  ? 0.5619 0.6943 0.3765 0.1612  0.0622  -0.0264 94  VAL A N   
524  C CA  . VAL A 93  ? 0.5886 0.6876 0.4071 0.1621  0.0676  -0.0235 94  VAL A CA  
525  C C   . VAL A 93  ? 0.6119 0.6887 0.4298 0.1747  0.0646  -0.0190 94  VAL A C   
526  O O   . VAL A 93  ? 0.6055 0.6737 0.4090 0.1826  0.0614  -0.0042 94  VAL A O   
527  C CB  . VAL A 93  ? 0.5944 0.6796 0.4014 0.1590  0.0708  -0.0070 94  VAL A CB  
528  C CG1 . VAL A 93  ? 0.5895 0.6413 0.4015 0.1606  0.0765  -0.0010 94  VAL A CG1 
529  C CG2 . VAL A 93  ? 0.5768 0.6850 0.3855 0.1470  0.0735  -0.0102 94  VAL A CG2 
530  N N   . ASP A 94  ? 0.6322 0.7030 0.4685 0.1762  0.0663  -0.0331 95  ASP A N   
531  C CA  . ASP A 94  ? 0.6438 0.6997 0.4847 0.1882  0.0629  -0.0319 95  ASP A CA  
532  C C   . ASP A 94  ? 0.6700 0.6924 0.5161 0.1947  0.0670  -0.0162 95  ASP A C   
533  O O   . ASP A 94  ? 0.6926 0.6985 0.5634 0.1946  0.0725  -0.0227 95  ASP A O   
534  C CB  . ASP A 94  ? 0.6428 0.7100 0.5070 0.1861  0.0635  -0.0560 95  ASP A CB  
535  C CG  . ASP A 94  ? 0.6552 0.7098 0.5255 0.1988  0.0593  -0.0560 95  ASP A CG  
536  O OD1 . ASP A 94  ? 0.6591 0.7078 0.5100 0.2086  0.0539  -0.0395 95  ASP A OD1 
537  O OD2 . ASP A 94  ? 0.6722 0.7252 0.5684 0.1987  0.0616  -0.0738 95  ASP A OD2 
538  N N   . THR A 95  ? 0.6750 0.6907 0.5008 0.2000  0.0647  0.0044  96  THR A N   
539  C CA  . THR A 95  ? 0.6998 0.6913 0.5263 0.2071  0.0674  0.0244  96  THR A CA  
540  C C   . THR A 95  ? 0.7091 0.7035 0.5231 0.2208  0.0606  0.0357  96  THR A C   
541  O O   . THR A 95  ? 0.7273 0.7111 0.5550 0.2298  0.0597  0.0372  96  THR A O   
542  C CB  . THR A 95  ? 0.6975 0.6856 0.5100 0.2008  0.0711  0.0391  96  THR A CB  
543  O OG1 . THR A 95  ? 0.6728 0.6829 0.4649 0.1979  0.0666  0.0385  96  THR A OG1 
544  C CG2 . THR A 95  ? 0.6881 0.6687 0.5154 0.1888  0.0790  0.0304  96  THR A CG2 
545  N N   . GLY A 96  ? 0.7080 0.7185 0.4991 0.2221  0.0564  0.0426  97  GLY A N   
546  C CA  . GLY A 96  ? 0.7158 0.7338 0.4946 0.2342  0.0508  0.0520  97  GLY A CA  
547  C C   . GLY A 96  ? 0.7424 0.7494 0.5197 0.2416  0.0527  0.0748  97  GLY A C   
548  O O   . GLY A 96  ? 0.7589 0.7484 0.5471 0.2378  0.0587  0.0842  97  GLY A O   
549  N N   . PRO A 97  ? 0.7561 0.7763 0.5212 0.2524  0.0479  0.0844  98  PRO A N   
550  C CA  . PRO A 97  ? 0.7794 0.7993 0.5410 0.2598  0.0491  0.1090  98  PRO A CA  
551  C C   . PRO A 97  ? 0.8117 0.8076 0.5972 0.2659  0.0526  0.1221  98  PRO A C   
552  O O   . PRO A 97  ? 0.8344 0.8233 0.6243 0.2671  0.0569  0.1442  98  PRO A O   
553  C CB  . PRO A 97  ? 0.7722 0.8172 0.5189 0.2704  0.0426  0.1106  98  PRO A CB  
554  C CG  . PRO A 97  ? 0.7470 0.7982 0.4937 0.2702  0.0384  0.0879  98  PRO A CG  
555  C CD  . PRO A 97  ? 0.7391 0.7806 0.4931 0.2574  0.0416  0.0728  98  PRO A CD  
556  N N   . ASP A 98  ? 0.8210 0.8057 0.6247 0.2696  0.0513  0.1086  99  ASP A N   
557  C CA  . ASP A 98  ? 0.8480 0.8088 0.6834 0.2747  0.0559  0.1170  99  ASP A CA  
558  C C   . ASP A 98  ? 0.8497 0.7900 0.7030 0.2644  0.0652  0.1200  99  ASP A C   
559  O O   . ASP A 98  ? 0.8752 0.7988 0.7507 0.2687  0.0709  0.1398  99  ASP A O   
560  C CB  . ASP A 98  ? 0.8501 0.8052 0.7049 0.2765  0.0538  0.0935  99  ASP A CB  
561  C CG  . ASP A 98  ? 0.9085 0.8411 0.8015 0.2835  0.0585  0.1010  99  ASP A CG  
562  O OD1 . ASP A 98  ? 0.9581 0.8864 0.8567 0.2935  0.0596  0.1299  99  ASP A OD1 
563  O OD2 . ASP A 98  ? 0.9499 0.8724 0.8700 0.2788  0.0617  0.0782  99  ASP A OD2 
564  N N   . TYR A 99  ? 0.8262 0.7693 0.6723 0.2511  0.0672  0.1012  100 TYR A N   
565  C CA  . TYR A 99  ? 0.8224 0.7489 0.6843 0.2401  0.0763  0.1003  100 TYR A CA  
566  C C   . TYR A 99  ? 0.8372 0.7586 0.6922 0.2409  0.0803  0.1291  100 TYR A C   
567  O O   . TYR A 99  ? 0.8570 0.7585 0.7346 0.2370  0.0889  0.1370  100 TYR A O   
568  C CB  . TYR A 99  ? 0.7919 0.7303 0.6417 0.2261  0.0764  0.0778  100 TYR A CB  
569  C CG  . TYR A 99  ? 0.7704 0.6945 0.6386 0.2142  0.0859  0.0711  100 TYR A CG  
570  C CD1 . TYR A 99  ? 0.7520 0.6655 0.6540 0.2103  0.0919  0.0522  100 TYR A CD1 
571  C CD2 . TYR A 99  ? 0.7424 0.6663 0.5961 0.2063  0.0894  0.0813  100 TYR A CD2 
572  C CE1 . TYR A 99  ? 0.7707 0.6740 0.6922 0.1990  0.1016  0.0433  100 TYR A CE1 
573  C CE2 . TYR A 99  ? 0.7577 0.6691 0.6285 0.1953  0.0985  0.0741  100 TYR A CE2 
574  C CZ  . TYR A 99  ? 0.7777 0.6790 0.6827 0.1918  0.1048  0.0550  100 TYR A CZ  
575  O OH  . TYR A 99  ? 0.7765 0.6685 0.7010 0.1806  0.1146  0.0449  100 TYR A OH  
576  N N   . TYR A 100 ? 0.8272 0.7694 0.6532 0.2454  0.0746  0.1434  101 TYR A N   
577  C CA  . TYR A 100 ? 0.8385 0.7844 0.6552 0.2456  0.0776  0.1701  101 TYR A CA  
578  C C   . TYR A 100 ? 0.8710 0.8236 0.6924 0.2603  0.0757  0.1987  101 TYR A C   
579  O O   . TYR A 100 ? 0.8767 0.8471 0.6828 0.2621  0.0755  0.2212  101 TYR A O   
580  C CB  . TYR A 100 ? 0.8152 0.7863 0.5996 0.2386  0.0740  0.1652  101 TYR A CB  
581  C CG  . TYR A 100 ? 0.7629 0.7293 0.5453 0.2246  0.0765  0.1428  101 TYR A CG  
582  C CD1 . TYR A 100 ? 0.7472 0.6974 0.5388 0.2145  0.0842  0.1451  101 TYR A CD1 
583  C CD2 . TYR A 100 ? 0.7314 0.7112 0.5046 0.2217  0.0715  0.1204  101 TYR A CD2 
584  C CE1 . TYR A 100 ? 0.7263 0.6760 0.5165 0.2021  0.0864  0.1252  101 TYR A CE1 
585  C CE2 . TYR A 100 ? 0.6971 0.6773 0.4704 0.2097  0.0737  0.1034  101 TYR A CE2 
586  C CZ  . TYR A 100 ? 0.6907 0.6567 0.4718 0.2000  0.0809  0.1056  101 TYR A CZ  
587  O OH  . TYR A 100 ? 0.6565 0.6267 0.4379 0.1886  0.0827  0.0889  101 TYR A OH  
588  N N   . ARG A 101 ? 0.8932 0.8351 0.7371 0.2704  0.0744  0.1983  102 ARG A N   
589  C CA  . ARG A 101 ? 0.9277 0.8771 0.7799 0.2854  0.0726  0.2274  102 ARG A CA  
590  C C   . ARG A 101 ? 0.9556 0.8969 0.8235 0.2859  0.0803  0.2606  102 ARG A C   
591  O O   . ARG A 101 ? 0.9636 0.8797 0.8529 0.2772  0.0890  0.2583  102 ARG A O   
592  C CB  . ARG A 101 ? 0.9399 0.8739 0.8220 0.2953  0.0715  0.2206  102 ARG A CB  
593  C CG  . ARG A 101 ? 0.9791 0.8778 0.9080 0.2919  0.0814  0.2164  102 ARG A CG  
594  C CD  . ARG A 101 ? 1.0088 0.8961 0.9666 0.2985  0.0798  0.1975  102 ARG A CD  
595  N NE  . ARG A 101 ? 1.0350 0.8931 1.0401 0.2922  0.0902  0.1827  102 ARG A NE  
596  C CZ  . ARG A 101 ? 1.0384 0.8900 1.0476 0.2775  0.0945  0.1520  102 ARG A CZ  
597  N NH1 . ARG A 101 ? 0.9987 0.8681 0.9683 0.2678  0.0894  0.1353  102 ARG A NH1 
598  N NH2 . ARG A 101 ? 1.0508 0.8804 1.1077 0.2723  0.1048  0.1375  102 ARG A NH2 
599  N N   . ASP A 102 ? 0.9741 0.9410 0.8311 0.2958  0.0774  0.2914  103 ASP A N   
600  C CA  . ASP A 102 ? 1.0055 0.9732 0.8762 0.2980  0.0840  0.3294  103 ASP A CA  
601  C C   . ASP A 102 ? 0.9949 0.9694 0.8455 0.2844  0.0880  0.3314  103 ASP A C   
602  O O   . ASP A 102 ? 1.0154 0.9943 0.8745 0.2851  0.0934  0.3630  103 ASP A O   
603  C CB  . ASP A 102 ? 1.0375 0.9667 0.9604 0.3015  0.0937  0.3417  103 ASP A CB  
604  C CG  . ASP A 102 ? 1.0613 0.9824 1.0122 0.3155  0.0911  0.3433  103 ASP A CG  
605  O OD1 . ASP A 102 ? 1.0923 1.0389 1.0379 0.3290  0.0858  0.3698  103 ASP A OD1 
606  O OD2 . ASP A 102 ? 1.0800 0.9716 1.0605 0.3127  0.0948  0.3177  103 ASP A OD2 
607  N N   . MET A 103 ? 1.0402 0.8891 0.8747 0.2521  -0.0190 0.1960  104 MET A N   
608  C CA  . MET A 103 ? 1.0327 0.8771 0.8359 0.2318  -0.0018 0.2013  104 MET A CA  
609  C C   . MET A 103 ? 1.0282 0.8920 0.7922 0.2283  -0.0073 0.2086  104 MET A C   
610  O O   . MET A 103 ? 1.0360 0.8929 0.7708 0.2136  0.0064  0.2165  104 MET A O   
611  C CB  . MET A 103 ? 0.9850 0.8487 0.8110 0.2157  0.0159  0.1774  104 MET A CB  
612  C CG  . MET A 103 ? 0.9866 0.8266 0.8416 0.2121  0.0271  0.1703  104 MET A CG  
613  S SD  . MET A 103 ? 0.9271 0.7944 0.8017 0.1921  0.0450  0.1429  104 MET A SD  
614  C CE  . MET A 103 ? 0.8910 0.7569 0.7287 0.1730  0.0586  0.1557  104 MET A CE  
615  N N   . ASP A 104 ? 1.0130 0.9020 0.7781 0.2409  -0.0261 0.2043  105 ASP A N   
616  C CA  . ASP A 104 ? 1.0127 0.9206 0.7409 0.2382  -0.0330 0.2088  105 ASP A CA  
617  C C   . ASP A 104 ? 0.9492 0.8865 0.6784 0.2222  -0.0187 0.1892  105 ASP A C   
618  O O   . ASP A 104 ? 0.9573 0.8956 0.6535 0.2109  -0.0096 0.1944  105 ASP A O   
619  C CB  . ASP A 104 ? 1.0749 0.9524 0.7548 0.2350  -0.0313 0.2359  105 ASP A CB  
620  C CG  . ASP A 104 ? 1.1293 1.0206 0.7712 0.2402  -0.0474 0.2440  105 ASP A CG  
621  O OD1 . ASP A 104 ? 1.1816 1.0848 0.8336 0.2566  -0.0706 0.2440  105 ASP A OD1 
622  O OD2 . ASP A 104 ? 1.1807 1.0717 0.7834 0.2278  -0.0370 0.2497  105 ASP A OD2 
623  N N   . ILE A 105 ? 0.8830 0.8434 0.6508 0.2216  -0.0164 0.1670  106 ILE A N   
624  C CA  . ILE A 105 ? 0.8226 0.8125 0.5984 0.2090  -0.0062 0.1476  106 ILE A CA  
625  C C   . ILE A 105 ? 0.7794 0.8024 0.5709 0.2169  -0.0207 0.1332  106 ILE A C   
626  O O   . ILE A 105 ? 0.7719 0.7997 0.5901 0.2294  -0.0322 0.1287  106 ILE A O   
627  C CB  . ILE A 105 ? 0.7974 0.7873 0.6057 0.2003  0.0087  0.1332  106 ILE A CB  
628  C CG1 . ILE A 105 ? 0.8178 0.7799 0.6144 0.1886  0.0253  0.1436  106 ILE A CG1 
629  C CG2 . ILE A 105 ? 0.7450 0.7683 0.5674 0.1911  0.0143  0.1126  106 ILE A CG2 
630  C CD1 . ILE A 105 ? 0.8319 0.7979 0.5980 0.1765  0.0351  0.1495  106 ILE A CD1 
631  N N   . GLN A 106 ? 0.7415 0.7871 0.5191 0.2095  -0.0198 0.1251  107 GLN A N   
632  C CA  . GLN A 106 ? 0.7036 0.7815 0.5016 0.2126  -0.0294 0.1082  107 GLN A CA  
633  C C   . GLN A 106 ? 0.6438 0.7370 0.4673 0.2015  -0.0151 0.0907  107 GLN A C   
634  O O   . GLN A 106 ? 0.6250 0.7143 0.4389 0.1889  -0.0003 0.0901  107 GLN A O   
635  C CB  . GLN A 106 ? 0.7129 0.8054 0.4832 0.2108  -0.0373 0.1080  107 GLN A CB  
636  C CG  . GLN A 106 ? 0.7993 0.8808 0.5427 0.2229  -0.0558 0.1245  107 GLN A CG  
637  C CD  . GLN A 106 ? 0.8622 0.9485 0.5651 0.2172  -0.0578 0.1272  107 GLN A CD  
638  O OE1 . GLN A 106 ? 0.9420 1.0070 0.6078 0.2148  -0.0535 0.1433  107 GLN A OE1 
639  N NE2 . GLN A 106 ? 0.8748 0.9887 0.5845 0.2138  -0.0624 0.1106  107 GLN A NE2 
640  N N   . TYR A 107 ? 0.6067 0.7184 0.4633 0.2061  -0.0198 0.0768  108 TYR A N   
641  C CA  . TYR A 107 ? 0.5670 0.6924 0.4472 0.1962  -0.0074 0.0609  108 TYR A CA  
642  C C   . TYR A 107 ? 0.5317 0.6875 0.4219 0.1926  -0.0110 0.0471  108 TYR A C   
643  O O   . TYR A 107 ? 0.5373 0.7073 0.4353 0.2010  -0.0245 0.0442  108 TYR A O   
644  C CB  . TYR A 107 ? 0.5600 0.6804 0.4706 0.2029  -0.0063 0.0548  108 TYR A CB  
645  C CG  . TYR A 107 ? 0.5295 0.6612 0.4614 0.1925  0.0071  0.0386  108 TYR A CG  
646  C CD1 . TYR A 107 ? 0.5268 0.6425 0.4552 0.1825  0.0206  0.0392  108 TYR A CD1 
647  C CD2 . TYR A 107 ? 0.4945 0.6527 0.4502 0.1924  0.0058  0.0228  108 TYR A CD2 
648  C CE1 . TYR A 107 ? 0.5049 0.6315 0.4498 0.1728  0.0311  0.0244  108 TYR A CE1 
649  C CE2 . TYR A 107 ? 0.4819 0.6497 0.4529 0.1827  0.0178  0.0090  108 TYR A CE2 
650  C CZ  . TYR A 107 ? 0.4857 0.6378 0.4501 0.1731  0.0296  0.0098  108 TYR A CZ  
651  O OH  . TYR A 107 ? 0.4076 0.5702 0.3840 0.1631  0.0400  -0.0042 108 TYR A OH  
652  N N   . HIS A 108 ? 0.5035 0.6687 0.3945 0.1797  0.0005  0.0390  109 HIS A N   
653  C CA  . HIS A 108 ? 0.4805 0.6715 0.3839 0.1743  -0.0005 0.0261  109 HIS A CA  
654  C C   . HIS A 108 ? 0.4554 0.6518 0.3764 0.1650  0.0122  0.0164  109 HIS A C   
655  O O   . HIS A 108 ? 0.4494 0.6335 0.3629 0.1577  0.0223  0.0197  109 HIS A O   
656  C CB  . HIS A 108 ? 0.4803 0.6752 0.3611 0.1678  -0.0002 0.0280  109 HIS A CB  
657  C CG  . HIS A 108 ? 0.5001 0.7179 0.3927 0.1623  -0.0020 0.0160  109 HIS A CG  
658  N ND1 . HIS A 108 ? 0.5287 0.7613 0.4261 0.1674  -0.0148 0.0110  109 HIS A ND1 
659  C CD2 . HIS A 108 ? 0.5007 0.7282 0.4014 0.1515  0.0070  0.0085  109 HIS A CD2 
660  C CE1 . HIS A 108 ? 0.5139 0.7633 0.4229 0.1591  -0.0121 0.0006  109 HIS A CE1 
661  N NE2 . HIS A 108 ? 0.4834 0.7291 0.3937 0.1498  0.0009  -0.0002 109 HIS A NE2 
662  N N   . GLY A 109 ? 0.4409 0.6560 0.3855 0.1651  0.0114  0.0042  110 GLY A N   
663  C CA  . GLY A 109 ? 0.4297 0.6515 0.3885 0.1562  0.0227  -0.0057 110 GLY A CA  
664  C C   . GLY A 109 ? 0.4025 0.6451 0.3656 0.1462  0.0256  -0.0138 110 GLY A C   
665  O O   . GLY A 109 ? 0.4037 0.6626 0.3770 0.1486  0.0192  -0.0190 110 GLY A O   
666  N N   . VAL A 110 ? 0.3950 0.6366 0.3506 0.1347  0.0347  -0.0142 111 VAL A N   
667  C CA  . VAL A 110 ? 0.3737 0.6318 0.3331 0.1245  0.0384  -0.0203 111 VAL A CA  
668  C C   . VAL A 110 ? 0.3796 0.6415 0.3471 0.1173  0.0478  -0.0280 111 VAL A C   
669  O O   . VAL A 110 ? 0.3875 0.6386 0.3467 0.1126  0.0530  -0.0253 111 VAL A O   
670  C CB  . VAL A 110 ? 0.3707 0.6242 0.3131 0.1174  0.0398  -0.0132 111 VAL A CB  
671  C CG1 . VAL A 110 ? 0.3346 0.6008 0.2805 0.1061  0.0445  -0.0173 111 VAL A CG1 
672  C CG2 . VAL A 110 ? 0.3208 0.5709 0.2525 0.1237  0.0316  -0.0080 111 VAL A CG2 
673  N N   . GLU A 111 ? 0.3823 0.6608 0.3659 0.1154  0.0505  -0.0383 112 GLU A N   
674  C CA  . GLU A 111 ? 0.4083 0.6923 0.3975 0.1078  0.0606  -0.0477 112 GLU A CA  
675  C C   . GLU A 111 ? 0.4003 0.6905 0.3766 0.0932  0.0661  -0.0464 112 GLU A C   
676  O O   . GLU A 111 ? 0.4096 0.7148 0.3908 0.0863  0.0698  -0.0514 112 GLU A O   
677  C CB  . GLU A 111 ? 0.4063 0.7070 0.4189 0.1117  0.0630  -0.0602 112 GLU A CB  
678  C CG  . GLU A 111 ? 0.4633 0.7714 0.4813 0.1039  0.0751  -0.0724 112 GLU A CG  
679  C CD  . GLU A 111 ? 0.5202 0.8384 0.5653 0.1126  0.0785  -0.0859 112 GLU A CD  
680  O OE1 . GLU A 111 ? 0.5648 0.8893 0.6276 0.1240  0.0703  -0.0857 112 GLU A OE1 
681  O OE2 . GLU A 111 ? 0.5981 0.9186 0.6473 0.1081  0.0893  -0.0977 112 GLU A OE2 
682  N N   . ALA A 112 ? 0.3979 0.6768 0.3589 0.0882  0.0665  -0.0392 113 ALA A N   
683  C CA  . ALA A 112 ? 0.3988 0.6829 0.3478 0.0765  0.0681  -0.0347 113 ALA A CA  
684  C C   . ALA A 112 ? 0.4089 0.6927 0.3497 0.0671  0.0734  -0.0380 113 ALA A C   
685  O O   . ALA A 112 ? 0.4237 0.6974 0.3646 0.0692  0.0746  -0.0403 113 ALA A O   
686  C CB  . ALA A 112 ? 0.3713 0.6473 0.3112 0.0781  0.0622  -0.0229 113 ALA A CB  
687  N N   . ASP A 113 ? 0.4176 0.7116 0.3502 0.0561  0.0759  -0.0379 114 ASP A N   
688  C CA  . ASP A 113 ? 0.4411 0.7364 0.3609 0.0456  0.0781  -0.0390 114 ASP A CA  
689  C C   . ASP A 113 ? 0.4300 0.7213 0.3408 0.0427  0.0712  -0.0260 114 ASP A C   
690  O O   . ASP A 113 ? 0.4164 0.7085 0.3273 0.0438  0.0675  -0.0177 114 ASP A O   
691  C CB  . ASP A 113 ? 0.4593 0.7682 0.3711 0.0343  0.0843  -0.0446 114 ASP A CB  
692  C CG  . ASP A 113 ? 0.5041 0.8218 0.4287 0.0365  0.0932  -0.0588 114 ASP A CG  
693  O OD1 . ASP A 113 ? 0.5627 0.8757 0.4978 0.0431  0.0963  -0.0690 114 ASP A OD1 
694  O OD2 . ASP A 113 ? 0.5846 0.9142 0.5102 0.0311  0.0978  -0.0600 114 ASP A OD2 
695  N N   . ASP A 114 ? 0.4404 0.7283 0.3456 0.0385  0.0694  -0.0254 115 ASP A N   
696  C CA  . ASP A 114 ? 0.4287 0.7170 0.3285 0.0350  0.0624  -0.0139 115 ASP A CA  
697  C C   . ASP A 114 ? 0.4308 0.7293 0.3172 0.0243  0.0604  -0.0106 115 ASP A C   
698  O O   . ASP A 114 ? 0.4369 0.7406 0.3133 0.0157  0.0584  -0.0126 115 ASP A O   
699  C CB  . ASP A 114 ? 0.4291 0.7128 0.3313 0.0338  0.0605  -0.0146 115 ASP A CB  
700  C CG  . ASP A 114 ? 0.4398 0.7268 0.3424 0.0319  0.0530  -0.0033 115 ASP A CG  
701  O OD1 . ASP A 114 ? 0.4117 0.6982 0.3167 0.0362  0.0500  0.0058  115 ASP A OD1 
702  O OD2 . ASP A 114 ? 0.4675 0.7579 0.3702 0.0260  0.0500  -0.0046 115 ASP A OD2 
703  N N   . LEU A 115 ? 0.4233 0.7241 0.3085 0.0241  0.0608  -0.0052 116 LEU A N   
704  C CA  . LEU A 115 ? 0.4322 0.7401 0.3028 0.0136  0.0599  0.0001  116 LEU A CA  
705  C C   . LEU A 115 ? 0.4182 0.7215 0.2929 0.0165  0.0555  0.0127  116 LEU A C   
706  O O   . LEU A 115 ? 0.4162 0.7150 0.3031 0.0240  0.0573  0.0112  116 LEU A O   
707  C CB  . LEU A 115 ? 0.4304 0.7464 0.2955 0.0072  0.0699  -0.0105 116 LEU A CB  
708  C CG  . LEU A 115 ? 0.4601 0.7808 0.3211 0.0034  0.0767  -0.0261 116 LEU A CG  
709  C CD1 . LEU A 115 ? 0.4218 0.7529 0.2808 -0.0026 0.0891  -0.0374 116 LEU A CD1 
710  C CD2 . LEU A 115 ? 0.4485 0.7724 0.2918 -0.0060 0.0715  -0.0248 116 LEU A CD2 
711  N N   . PRO A 116 ? 0.4230 0.7266 0.2878 0.0107  0.0490  0.0248  117 PRO A N   
712  C CA  . PRO A 116 ? 0.4265 0.7232 0.2956 0.0126  0.0451  0.0370  117 PRO A CA  
713  C C   . PRO A 116 ? 0.4303 0.7269 0.2993 0.0083  0.0524  0.0355  117 PRO A C   
714  O O   . PRO A 116 ? 0.4384 0.7270 0.3158 0.0112  0.0506  0.0420  117 PRO A O   
715  C CB  . PRO A 116 ? 0.4520 0.7498 0.3079 0.0061  0.0361  0.0506  117 PRO A CB  
716  C CG  . PRO A 116 ? 0.4640 0.7718 0.3027 -0.0030 0.0373  0.0443  117 PRO A CG  
717  C CD  . PRO A 116 ? 0.4520 0.7625 0.2996 0.0012  0.0445  0.0274  117 PRO A CD  
718  N N   . THR A 117 ? 0.4302 0.7359 0.2917 0.0011  0.0611  0.0258  118 THR A N   
719  C CA  . THR A 117 ? 0.4319 0.7412 0.2976 -0.0037 0.0697  0.0219  118 THR A CA  
720  C C   . THR A 117 ? 0.4191 0.7304 0.3063 0.0062  0.0732  0.0096  118 THR A C   
721  O O   . THR A 117 ? 0.4271 0.7436 0.3235 0.0035  0.0790  0.0049  118 THR A O   
722  C CB  . THR A 117 ? 0.4531 0.7740 0.3025 -0.0164 0.0793  0.0158  118 THR A CB  
723  O OG1 . THR A 117 ? 0.4441 0.7708 0.2914 -0.0140 0.0812  0.0034  118 THR A OG1 
724  C CG2 . THR A 117 ? 0.4505 0.7691 0.2744 -0.0284 0.0756  0.0309  118 THR A CG2 
725  N N   . PHE A 118 ? 0.4041 0.7121 0.2991 0.0169  0.0694  0.0047  119 PHE A N   
726  C CA  . PHE A 118 ? 0.3936 0.7036 0.3048 0.0260  0.0715  -0.0057 119 PHE A CA  
727  C C   . PHE A 118 ? 0.3940 0.6955 0.3140 0.0332  0.0653  -0.0004 119 PHE A C   
728  O O   . PHE A 118 ? 0.3766 0.6689 0.2931 0.0368  0.0596  0.0077  119 PHE A O   
729  C CB  . PHE A 118 ? 0.3923 0.7005 0.3060 0.0336  0.0713  -0.0130 119 PHE A CB  
730  C CG  . PHE A 118 ? 0.3666 0.6761 0.2960 0.0437  0.0719  -0.0218 119 PHE A CG  
731  C CD1 . PHE A 118 ? 0.3522 0.6728 0.2915 0.0432  0.0789  -0.0338 119 PHE A CD1 
732  C CD2 . PHE A 118 ? 0.3235 0.6243 0.2580 0.0538  0.0655  -0.0181 119 PHE A CD2 
733  C CE1 . PHE A 118 ? 0.3342 0.6572 0.2907 0.0538  0.0773  -0.0410 119 PHE A CE1 
734  C CE2 . PHE A 118 ? 0.3512 0.6535 0.2980 0.0634  0.0638  -0.0247 119 PHE A CE2 
735  C CZ  . PHE A 118 ? 0.3108 0.6239 0.2697 0.0642  0.0685  -0.0353 119 PHE A CZ  
736  N N   . ASP A 119 ? 0.3974 0.7037 0.3301 0.0350  0.0668  -0.0065 120 ASP A N   
737  C CA  . ASP A 119 ? 0.3994 0.6990 0.3399 0.0402  0.0613  -0.0045 120 ASP A CA  
738  C C   . ASP A 119 ? 0.3791 0.6754 0.3232 0.0527  0.0569  -0.0090 120 ASP A C   
739  O O   . ASP A 119 ? 0.3726 0.6756 0.3269 0.0580  0.0559  -0.0172 120 ASP A O   
740  C CB  . ASP A 119 ? 0.4009 0.7089 0.3537 0.0340  0.0643  -0.0097 120 ASP A CB  
741  C CG  . ASP A 119 ? 0.4720 0.7756 0.4351 0.0403  0.0578  -0.0130 120 ASP A CG  
742  O OD1 . ASP A 119 ? 0.4845 0.7759 0.4418 0.0472  0.0524  -0.0086 120 ASP A OD1 
743  O OD2 . ASP A 119 ? 0.5352 0.8494 0.5130 0.0376  0.0585  -0.0213 120 ASP A OD2 
744  N N   . LEU A 120 ? 0.3744 0.6605 0.3105 0.0574  0.0539  -0.0028 121 LEU A N   
745  C CA  . LEU A 120 ? 0.3738 0.6540 0.3098 0.0681  0.0506  -0.0045 121 LEU A CA  
746  C C   . LEU A 120 ? 0.3753 0.6512 0.3138 0.0729  0.0460  -0.0056 121 LEU A C   
747  O O   . LEU A 120 ? 0.3781 0.6509 0.3144 0.0812  0.0427  -0.0081 121 LEU A O   
748  C CB  . LEU A 120 ? 0.3762 0.6486 0.3045 0.0697  0.0507  0.0018  121 LEU A CB  
749  C CG  . LEU A 120 ? 0.3826 0.6482 0.3081 0.0781  0.0503  0.0011  121 LEU A CG  
750  C CD1 . LEU A 120 ? 0.3739 0.6423 0.3032 0.0816  0.0515  -0.0056 121 LEU A CD1 
751  C CD2 . LEU A 120 ? 0.3921 0.6528 0.3136 0.0765  0.0519  0.0068  121 LEU A CD2 
752  N N   . SER A 121 ? 0.3694 0.6442 0.3111 0.0670  0.0458  -0.0039 122 SER A N   
753  C CA  . SER A 121 ? 0.3825 0.6513 0.3259 0.0702  0.0421  -0.0061 122 SER A CA  
754  C C   . SER A 121 ? 0.3894 0.6659 0.3393 0.0731  0.0380  -0.0157 122 SER A C   
755  O O   . SER A 121 ? 0.4033 0.6749 0.3493 0.0785  0.0336  -0.0191 122 SER A O   
756  C CB  . SER A 121 ? 0.3899 0.6527 0.3371 0.0629  0.0431  -0.0018 122 SER A CB  
757  O OG  . SER A 121 ? 0.4011 0.6720 0.3564 0.0542  0.0451  -0.0048 122 SER A OG  
758  N N   . VAL A 122 ? 0.3933 0.6830 0.3535 0.0697  0.0392  -0.0209 123 VAL A N   
759  C CA  . VAL A 122 ? 0.3852 0.6856 0.3555 0.0741  0.0333  -0.0304 123 VAL A CA  
760  C C   . VAL A 122 ? 0.3885 0.6852 0.3502 0.0862  0.0275  -0.0302 123 VAL A C   
761  O O   . VAL A 122 ? 0.4022 0.7037 0.3664 0.0914  0.0196  -0.0358 123 VAL A O   
762  C CB  . VAL A 122 ? 0.3865 0.7050 0.3738 0.0713  0.0358  -0.0374 123 VAL A CB  
763  C CG1 . VAL A 122 ? 0.3661 0.6972 0.3712 0.0646  0.0338  -0.0459 123 VAL A CG1 
764  C CG2 . VAL A 122 ? 0.3751 0.6956 0.3605 0.0655  0.0450  -0.0342 123 VAL A CG2 
765  N N   . PHE A 123 ? 0.3805 0.6690 0.3321 0.0898  0.0310  -0.0237 124 PHE A N   
766  C CA  . PHE A 123 ? 0.3765 0.6583 0.3186 0.1001  0.0272  -0.0212 124 PHE A CA  
767  C C   . PHE A 123 ? 0.3924 0.6612 0.3174 0.1035  0.0259  -0.0167 124 PHE A C   
768  O O   . PHE A 123 ? 0.4120 0.6743 0.3257 0.1113  0.0227  -0.0138 124 PHE A O   
769  C CB  . PHE A 123 ? 0.3631 0.6415 0.3045 0.1011  0.0326  -0.0177 124 PHE A CB  
770  C CG  . PHE A 123 ? 0.3519 0.6430 0.3091 0.0990  0.0352  -0.0244 124 PHE A CG  
771  C CD1 . PHE A 123 ? 0.3438 0.6422 0.3127 0.1073  0.0300  -0.0298 124 PHE A CD1 
772  C CD2 . PHE A 123 ? 0.3268 0.6235 0.2875 0.0889  0.0430  -0.0254 124 PHE A CD2 
773  C CE1 . PHE A 123 ? 0.3181 0.6297 0.3050 0.1061  0.0338  -0.0377 124 PHE A CE1 
774  C CE2 . PHE A 123 ? 0.3056 0.6152 0.2799 0.0861  0.0477  -0.0332 124 PHE A CE2 
775  C CZ  . PHE A 123 ? 0.3212 0.6387 0.3103 0.0948  0.0441  -0.0402 124 PHE A CZ  
776  N N   . PHE A 124 ? 0.3946 0.6589 0.3178 0.0980  0.0289  -0.0158 125 PHE A N   
777  C CA  . PHE A 124 ? 0.3960 0.6486 0.3055 0.1011  0.0310  -0.0124 125 PHE A CA  
778  C C   . PHE A 124 ? 0.4036 0.6539 0.3003 0.1075  0.0248  -0.0165 125 PHE A C   
779  O O   . PHE A 124 ? 0.4116 0.6538 0.2928 0.1125  0.0265  -0.0120 125 PHE A O   
780  C CB  . PHE A 124 ? 0.3959 0.6440 0.3097 0.0957  0.0344  -0.0127 125 PHE A CB  
781  C CG  . PHE A 124 ? 0.3773 0.6243 0.2979 0.0905  0.0396  -0.0056 125 PHE A CG  
782  C CD1 . PHE A 124 ? 0.3689 0.6181 0.2885 0.0902  0.0422  -0.0004 125 PHE A CD1 
783  C CD2 . PHE A 124 ? 0.3711 0.6139 0.2988 0.0860  0.0410  -0.0041 125 PHE A CD2 
784  C CE1 . PHE A 124 ? 0.3527 0.6024 0.2765 0.0850  0.0450  0.0055  125 PHE A CE1 
785  C CE2 . PHE A 124 ? 0.3604 0.6026 0.2930 0.0817  0.0434  0.0040  125 PHE A CE2 
786  C CZ  . PHE A 124 ? 0.3718 0.6188 0.3016 0.0809  0.0449  0.0085  125 PHE A CZ  
787  N N   . TYR A 125 ? 0.4064 0.6642 0.3084 0.1065  0.0178  -0.0248 126 TYR A N   
788  C CA  . TYR A 125 ? 0.4280 0.6839 0.3142 0.1116  0.0107  -0.0295 126 TYR A CA  
789  C C   . TYR A 125 ? 0.4442 0.7016 0.3207 0.1202  0.0034  -0.0254 126 TYR A C   
790  O O   . TYR A 125 ? 0.4649 0.7129 0.3188 0.1252  0.0029  -0.0210 126 TYR A O   
791  C CB  . TYR A 125 ? 0.4273 0.6897 0.3209 0.1071  0.0047  -0.0409 126 TYR A CB  
792  C CG  . TYR A 125 ? 0.4207 0.6727 0.3117 0.1025  0.0114  -0.0446 126 TYR A CG  
793  C CD1 . TYR A 125 ? 0.3907 0.6389 0.2967 0.0963  0.0190  -0.0412 126 TYR A CD1 
794  C CD2 . TYR A 125 ? 0.4311 0.6765 0.3044 0.1047  0.0101  -0.0517 126 TYR A CD2 
795  C CE1 . TYR A 125 ? 0.3790 0.6163 0.2864 0.0936  0.0245  -0.0438 126 TYR A CE1 
796  C CE2 . TYR A 125 ? 0.4369 0.6720 0.3114 0.1014  0.0174  -0.0567 126 TYR A CE2 
797  C CZ  . TYR A 125 ? 0.4287 0.6595 0.3228 0.0965  0.0244  -0.0521 126 TYR A CZ  
798  O OH  . TYR A 125 ? 0.4036 0.6232 0.3033 0.0947  0.0309  -0.0557 126 TYR A OH  
799  N N   . PRO A 126 ? 0.4365 0.7047 0.3299 0.1220  -0.0012 -0.0259 127 PRO A N   
800  C CA  . PRO A 126 ? 0.4537 0.7214 0.3402 0.1317  -0.0093 -0.0212 127 PRO A CA  
801  C C   . PRO A 126 ? 0.4540 0.7067 0.3285 0.1356  -0.0023 -0.0099 127 PRO A C   
802  O O   . PRO A 126 ? 0.4932 0.7373 0.3501 0.1428  -0.0073 -0.0033 127 PRO A O   
803  C CB  . PRO A 126 ? 0.4373 0.7221 0.3509 0.1327  -0.0148 -0.0272 127 PRO A CB  
804  C CG  . PRO A 126 ? 0.4331 0.7288 0.3618 0.1227  -0.0128 -0.0367 127 PRO A CG  
805  C CD  . PRO A 126 ? 0.4329 0.7154 0.3517 0.1159  -0.0011 -0.0325 127 PRO A CD  
806  N N   . ALA A 127 ? 0.4346 0.6840 0.3175 0.1302  0.0085  -0.0073 128 ALA A N   
807  C CA  . ALA A 127 ? 0.4358 0.6708 0.3076 0.1314  0.0161  0.0021  128 ALA A CA  
808  C C   . ALA A 127 ? 0.4445 0.6685 0.2929 0.1315  0.0198  0.0065  128 ALA A C   
809  O O   . ALA A 127 ? 0.4721 0.6840 0.3034 0.1357  0.0210  0.0148  128 ALA A O   
810  C CB  . ALA A 127 ? 0.4034 0.6394 0.2881 0.1239  0.0259  0.0024  128 ALA A CB  
811  N N   . ALA A 128 ? 0.4325 0.6597 0.2797 0.1268  0.0225  0.0008  129 ALA A N   
812  C CA  . ALA A 128 ? 0.4520 0.6702 0.2785 0.1269  0.0279  0.0024  129 ALA A CA  
813  C C   . ALA A 128 ? 0.4737 0.6885 0.2767 0.1329  0.0193  0.0031  129 ALA A C   
814  O O   . ALA A 128 ? 0.5021 0.7065 0.2816 0.1343  0.0245  0.0087  129 ALA A O   
815  C CB  . ALA A 128 ? 0.4370 0.6582 0.2697 0.1216  0.0324  -0.0057 129 ALA A CB  
816  N N   . ALA A 129 ? 0.4685 0.6932 0.2772 0.1359  0.0063  -0.0027 130 ALA A N   
817  C CA  . ALA A 129 ? 0.4879 0.7120 0.2739 0.1418  -0.0053 -0.0025 130 ALA A CA  
818  C C   . ALA A 129 ? 0.5039 0.7167 0.2758 0.1489  -0.0076 0.0114  130 ALA A C   
819  O O   . ALA A 129 ? 0.5294 0.7335 0.2712 0.1525  -0.0112 0.0174  130 ALA A O   
820  C CB  . ALA A 129 ? 0.4731 0.7136 0.2736 0.1432  -0.0203 -0.0123 130 ALA A CB  
821  N N   . PHE A 130 ? 0.4885 0.7000 0.2808 0.1502  -0.0048 0.0163  131 PHE A N   
822  C CA  . PHE A 130 ? 0.5087 0.7063 0.2928 0.1566  -0.0056 0.0294  131 PHE A CA  
823  C C   . PHE A 130 ? 0.5325 0.7130 0.2951 0.1526  0.0081  0.0389  131 PHE A C   
824  O O   . PHE A 130 ? 0.5639 0.7303 0.3015 0.1567  0.0064  0.0501  131 PHE A O   
825  C CB  . PHE A 130 ? 0.4888 0.6893 0.3023 0.1577  -0.0040 0.0288  131 PHE A CB  
826  C CG  . PHE A 130 ? 0.4939 0.6771 0.3031 0.1639  -0.0037 0.0410  131 PHE A CG  
827  C CD1 . PHE A 130 ? 0.4717 0.6523 0.2795 0.1751  -0.0177 0.0465  131 PHE A CD1 
828  C CD2 . PHE A 130 ? 0.5102 0.6798 0.3191 0.1585  0.0100  0.0468  131 PHE A CD2 
829  C CE1 . PHE A 130 ? 0.5076 0.6691 0.3133 0.1815  -0.0176 0.0586  131 PHE A CE1 
830  C CE2 . PHE A 130 ? 0.5289 0.6801 0.3358 0.1633  0.0109  0.0575  131 PHE A CE2 
831  C CZ  . PHE A 130 ? 0.5459 0.6914 0.3506 0.1752  -0.0028 0.0640  131 PHE A CZ  
832  N N   . ILE A 131 ? 0.5293 0.7116 0.3017 0.1444  0.0215  0.0348  132 ILE A N   
833  C CA  . ILE A 131 ? 0.5498 0.7203 0.3064 0.1396  0.0357  0.0414  132 ILE A CA  
834  C C   . ILE A 131 ? 0.5808 0.7475 0.3050 0.1402  0.0362  0.0415  132 ILE A C   
835  O O   . ILE A 131 ? 0.6050 0.7582 0.3048 0.1399  0.0426  0.0517  132 ILE A O   
836  C CB  . ILE A 131 ? 0.5233 0.7007 0.3001 0.1317  0.0476  0.0354  132 ILE A CB  
837  C CG1 . ILE A 131 ? 0.4977 0.6787 0.3009 0.1299  0.0473  0.0350  132 ILE A CG1 
838  C CG2 . ILE A 131 ? 0.5330 0.7021 0.2973 0.1269  0.0625  0.0405  132 ILE A CG2 
839  C CD1 . ILE A 131 ? 0.4454 0.6371 0.2696 0.1228  0.0535  0.0284  132 ILE A CD1 
840  N N   . ASP A 132 ? 0.5917 0.7698 0.3145 0.1402  0.0295  0.0299  133 ASP A N   
841  C CA  . ASP A 132 ? 0.6336 0.8094 0.3246 0.1399  0.0299  0.0264  133 ASP A CA  
842  C C   . ASP A 132 ? 0.6711 0.8387 0.3306 0.1462  0.0183  0.0362  133 ASP A C   
843  O O   . ASP A 132 ? 0.6972 0.8553 0.3228 0.1448  0.0243  0.0413  133 ASP A O   
844  C CB  . ASP A 132 ? 0.6322 0.8210 0.3313 0.1379  0.0242  0.0097  133 ASP A CB  
845  C CG  . ASP A 132 ? 0.6807 0.8672 0.3513 0.1353  0.0302  0.0018  133 ASP A CG  
846  O OD1 . ASP A 132 ? 0.7215 0.9028 0.3872 0.1312  0.0473  0.0012  133 ASP A OD1 
847  O OD2 . ASP A 132 ? 0.7523 0.9437 0.4071 0.1370  0.0176  -0.0056 133 ASP A OD2 
848  N N   . ARG A 133 ? 0.6741 0.8461 0.3446 0.1532  0.0016  0.0390  134 ARG A N   
849  C CA  . ARG A 133 ? 0.7183 0.8820 0.3615 0.1610  -0.0122 0.0507  134 ARG A CA  
850  C C   . ARG A 133 ? 0.7292 0.8712 0.3559 0.1619  -0.0033 0.0695  134 ARG A C   
851  O O   . ARG A 133 ? 0.7801 0.9099 0.3707 0.1644  -0.0068 0.0810  134 ARG A O   
852  C CB  . ARG A 133 ? 0.7205 0.8955 0.3860 0.1696  -0.0323 0.0491  134 ARG A CB  
853  C CG  . ARG A 133 ? 0.7602 0.9556 0.4314 0.1692  -0.0456 0.0329  134 ARG A CG  
854  C CD  . ARG A 133 ? 0.8205 1.0288 0.5094 0.1789  -0.0679 0.0328  134 ARG A CD  
855  N NE  . ARG A 133 ? 0.8361 1.0450 0.5605 0.1835  -0.0666 0.0369  134 ARG A NE  
856  C CZ  . ARG A 133 ? 0.8420 1.0619 0.6021 0.1784  -0.0583 0.0266  134 ARG A CZ  
857  N NH1 . ARG A 133 ? 0.8198 1.0499 0.5880 0.1687  -0.0510 0.0131  134 ARG A NH1 
858  N NH2 . ARG A 133 ? 0.8341 1.0533 0.6213 0.1829  -0.0569 0.0300  134 ARG A NH2 
859  N N   . ALA A 134 ? 0.7048 0.8415 0.3569 0.1590  0.0082  0.0727  135 ALA A N   
860  C CA  . ALA A 134 ? 0.7227 0.8380 0.3633 0.1577  0.0187  0.0889  135 ALA A CA  
861  C C   . ALA A 134 ? 0.7479 0.8557 0.3581 0.1496  0.0351  0.0919  135 ALA A C   
862  O O   . ALA A 134 ? 0.7819 0.8722 0.3599 0.1498  0.0378  0.1069  135 ALA A O   
863  C CB  . ALA A 134 ? 0.6821 0.7964 0.3582 0.1541  0.0283  0.0875  135 ALA A CB  
864  N N   . LEU A 135 ? 0.7289 0.8499 0.3503 0.1426  0.0463  0.0779  136 LEU A N   
865  C CA  . LEU A 135 ? 0.7495 0.8667 0.3514 0.1346  0.0653  0.0777  136 LEU A CA  
866  C C   . LEU A 135 ? 0.7935 0.9102 0.3536 0.1347  0.0637  0.0753  136 LEU A C   
867  O O   . LEU A 135 ? 0.8104 0.9231 0.3507 0.1281  0.0808  0.0755  136 LEU A O   
868  C CB  . LEU A 135 ? 0.7065 0.8375 0.3399 0.1285  0.0778  0.0639  136 LEU A CB  
869  C CG  . LEU A 135 ? 0.6788 0.8092 0.3466 0.1253  0.0838  0.0674  136 LEU A CG  
870  C CD1 . LEU A 135 ? 0.6213 0.7668 0.3188 0.1202  0.0929  0.0548  136 LEU A CD1 
871  C CD2 . LEU A 135 ? 0.6676 0.7811 0.3236 0.1209  0.0961  0.0821  136 LEU A CD2 
872  N N   . SER A 136 ? 0.8144 0.9366 0.3623 0.1414  0.0438  0.0718  137 SER A N   
873  C CA  . SER A 136 ? 0.8727 0.9930 0.3749 0.1420  0.0378  0.0714  137 SER A CA  
874  C C   . SER A 136 ? 0.9257 1.0253 0.3871 0.1425  0.0398  0.0928  137 SER A C   
875  O O   . SER A 136 ? 0.9582 1.0531 0.3759 0.1392  0.0441  0.0944  137 SER A O   
876  C CB  . SER A 136 ? 0.8757 1.0072 0.3789 0.1498  0.0122  0.0653  137 SER A CB  
877  O OG  . SER A 136 ? 0.8732 1.0224 0.4079 0.1477  0.0107  0.0453  137 SER A OG  
878  N N   . ASP A 137 ? 0.9328 1.0192 0.4076 0.1468  0.0358  0.1092  138 ASP A N   
879  C CA  . ASP A 137 ? 0.9900 1.0529 0.4298 0.1476  0.0371  0.1322  138 ASP A CA  
880  C C   . ASP A 137 ? 0.9866 1.0373 0.4334 0.1375  0.0631  0.1391  138 ASP A C   
881  O O   . ASP A 137 ? 0.9495 1.0000 0.4364 0.1366  0.0682  0.1384  138 ASP A O   
882  C CB  . ASP A 137 ? 0.9988 1.0523 0.4508 0.1593  0.0158  0.1459  138 ASP A CB  
883  C CG  . ASP A 137 ? 1.0889 1.1157 0.4994 0.1622  0.0121  0.1717  138 ASP A CG  
884  O OD1 . ASP A 137 ? 1.1305 1.1411 0.5163 0.1526  0.0326  0.1823  138 ASP A OD1 
885  O OD2 . ASP A 137 ? 1.1537 1.1759 0.5568 0.1740  -0.0114 0.1821  138 ASP A OD2 
886  N N   . ASP A 138 ? 1.0224 1.0652 0.4305 0.1292  0.0799  0.1444  139 ASP A N   
887  C CA  . ASP A 138 ? 1.0303 1.0611 0.4393 0.1182  0.1059  0.1530  139 ASP A CA  
888  C C   . ASP A 138 ? 1.0193 1.0294 0.4470 0.1190  0.1058  0.1712  139 ASP A C   
889  O O   . ASP A 138 ? 0.9865 0.9957 0.4430 0.1111  0.1229  0.1699  139 ASP A O   
890  C CB  . ASP A 138 ? 1.0929 1.1124 0.4454 0.1107  0.1200  0.1627  139 ASP A CB  
891  C CG  . ASP A 138 ? 1.1107 1.1501 0.4517 0.1050  0.1329  0.1411  139 ASP A CG  
892  O OD1 . ASP A 138 ? 1.0570 1.1159 0.4394 0.1047  0.1370  0.1212  139 ASP A OD1 
893  O OD2 . ASP A 138 ? 1.2080 1.2423 0.4974 0.1007  0.1393  0.1443  139 ASP A OD2 
894  N N   . HIS A 139 ? 1.0405 1.0338 0.4528 0.1287  0.0863  0.1875  140 HIS A N   
895  C CA  . HIS A 139 ? 1.0495 1.0198 0.4796 0.1310  0.0847  0.2042  140 HIS A CA  
896  C C   . HIS A 139 ? 0.9800 0.9617 0.4681 0.1340  0.0810  0.1909  140 HIS A C   
897  O O   . HIS A 139 ? 0.9767 0.9419 0.4857 0.1319  0.0866  0.1994  140 HIS A O   
898  C CB  . HIS A 139 ? 1.1036 1.0541 0.5051 0.1432  0.0622  0.2243  140 HIS A CB  
899  C CG  . HIS A 139 ? 1.1653 1.0877 0.5831 0.1470  0.0599  0.2426  140 HIS A CG  
900  N ND1 . HIS A 139 ? 1.1554 1.0812 0.6212 0.1551  0.0496  0.2352  140 HIS A ND1 
901  C CD2 . HIS A 139 ? 1.2465 1.1354 0.6382 0.1436  0.0669  0.2678  140 HIS A CD2 
902  C CE1 . HIS A 139 ? 1.1799 1.0754 0.6503 0.1571  0.0504  0.2534  140 HIS A CE1 
903  N NE2 . HIS A 139 ? 1.2596 1.1314 0.6861 0.1502  0.0605  0.2742  140 HIS A NE2 
904  N N   . SER A 140 ? 0.9192 0.9277 0.4318 0.1379  0.0723  0.1703  141 SER A N   
905  C CA  . SER A 140 ? 0.8695 0.8882 0.4308 0.1412  0.0668  0.1593  141 SER A CA  
906  C C   . SER A 140 ? 0.8337 0.8579 0.4242 0.1296  0.0870  0.1512  141 SER A C   
907  O O   . SER A 140 ? 0.8329 0.8640 0.4149 0.1200  0.1039  0.1468  141 SER A O   
908  C CB  . SER A 140 ? 0.8329 0.8778 0.4117 0.1478  0.0518  0.1409  141 SER A CB  
909  O OG  . SER A 140 ? 0.8659 0.9107 0.4202 0.1578  0.0320  0.1458  141 SER A OG  
910  N N   . LYS A 141 ? 0.7944 0.8169 0.4206 0.1308  0.0845  0.1483  142 LYS A N   
911  C CA  . LYS A 141 ? 0.7591 0.7897 0.4168 0.1206  0.0990  0.1392  142 LYS A CA  
912  C C   . LYS A 141 ? 0.7053 0.7464 0.3990 0.1259  0.0879  0.1279  142 LYS A C   
913  O O   . LYS A 141 ? 0.7139 0.7406 0.4151 0.1326  0.0790  0.1340  142 LYS A O   
914  C CB  . LYS A 141 ? 0.7902 0.7972 0.4450 0.1119  0.1136  0.1530  142 LYS A CB  
915  C CG  . LYS A 141 ? 0.7754 0.7921 0.4631 0.1004  0.1278  0.1434  142 LYS A CG  
916  C CD  . LYS A 141 ? 0.8348 0.8268 0.5262 0.0917  0.1397  0.1556  142 LYS A CD  
917  C CE  . LYS A 141 ? 0.8725 0.8578 0.5437 0.0797  0.1599  0.1648  142 LYS A CE  
918  N NZ  . LYS A 141 ? 0.8866 0.8680 0.5867 0.0664  0.1742  0.1632  142 LYS A NZ  
919  N N   . ILE A 142 ? 0.6566 0.7217 0.3721 0.1228  0.0890  0.1118  143 ILE A N   
920  C CA  . ILE A 142 ? 0.6181 0.6971 0.3623 0.1274  0.0780  0.0999  143 ILE A CA  
921  C C   . ILE A 142 ? 0.5876 0.6748 0.3627 0.1188  0.0863  0.0910  143 ILE A C   
922  O O   . ILE A 142 ? 0.5783 0.6748 0.3589 0.1100  0.0975  0.0872  143 ILE A O   
923  C CB  . ILE A 142 ? 0.6003 0.7005 0.3427 0.1318  0.0688  0.0888  143 ILE A CB  
924  C CG1 . ILE A 142 ? 0.5717 0.6873 0.3437 0.1345  0.0600  0.0767  143 ILE A CG1 
925  C CG2 . ILE A 142 ? 0.5800 0.6927 0.3188 0.1242  0.0800  0.0821  143 ILE A CG2 
926  C CD1 . ILE A 142 ? 0.5666 0.7001 0.3380 0.1391  0.0491  0.0671  143 ILE A CD1 
927  N N   . LEU A 143 ? 0.5756 0.6602 0.3711 0.1215  0.0804  0.0871  144 LEU A N   
928  C CA  . LEU A 143 ? 0.5422 0.6369 0.3649 0.1137  0.0853  0.0766  144 LEU A CA  
929  C C   . LEU A 143 ? 0.5077 0.6237 0.3452 0.1170  0.0761  0.0638  144 LEU A C   
930  O O   . LEU A 143 ? 0.5170 0.6333 0.3573 0.1258  0.0660  0.0618  144 LEU A O   
931  C CB  . LEU A 143 ? 0.5528 0.6290 0.3876 0.1124  0.0874  0.0788  144 LEU A CB  
932  C CG  . LEU A 143 ? 0.5249 0.6121 0.3857 0.1046  0.0901  0.0657  144 LEU A CG  
933  C CD1 . LEU A 143 ? 0.4964 0.5934 0.3635 0.0916  0.1007  0.0637  144 LEU A CD1 
934  C CD2 . LEU A 143 ? 0.5016 0.5694 0.3743 0.1054  0.0906  0.0648  144 LEU A CD2 
935  N N   . VAL A 144 ? 0.4750 0.6089 0.3226 0.1101  0.0796  0.0560  145 VAL A N   
936  C CA  . VAL A 144 ? 0.4377 0.5901 0.3000 0.1103  0.0733  0.0451  145 VAL A CA  
937  C C   . VAL A 144 ? 0.4324 0.5883 0.3123 0.1016  0.0780  0.0395  145 VAL A C   
938  O O   . VAL A 144 ? 0.4442 0.6018 0.3274 0.0938  0.0852  0.0410  145 VAL A O   
939  C CB  . VAL A 144 ? 0.4215 0.5894 0.2814 0.1087  0.0730  0.0417  145 VAL A CB  
940  C CG1 . VAL A 144 ? 0.3702 0.5541 0.2431 0.1083  0.0665  0.0326  145 VAL A CG1 
941  C CG2 . VAL A 144 ? 0.4291 0.5922 0.2680 0.1150  0.0705  0.0463  145 VAL A CG2 
942  N N   . HIS A 145 ? 0.4328 0.5903 0.3242 0.1026  0.0743  0.0324  146 HIS A N   
943  C CA  . HIS A 145 ? 0.4278 0.5883 0.3329 0.0935  0.0783  0.0252  146 HIS A CA  
944  C C   . HIS A 145 ? 0.4189 0.5949 0.3333 0.0926  0.0739  0.0144  146 HIS A C   
945  O O   . HIS A 145 ? 0.4162 0.5979 0.3302 0.0998  0.0685  0.0122  146 HIS A O   
946  C CB  . HIS A 145 ? 0.4488 0.5886 0.3576 0.0934  0.0823  0.0264  146 HIS A CB  
947  C CG  . HIS A 145 ? 0.4434 0.5772 0.3583 0.1021  0.0775  0.0214  146 HIS A CG  
948  N ND1 . HIS A 145 ? 0.4506 0.5911 0.3790 0.0990  0.0780  0.0084  146 HIS A ND1 
949  C CD2 . HIS A 145 ? 0.4304 0.5543 0.3407 0.1143  0.0717  0.0269  146 HIS A CD2 
950  C CE1 . HIS A 145 ? 0.4660 0.6010 0.4009 0.1093  0.0742  0.0053  146 HIS A CE1 
951  N NE2 . HIS A 145 ? 0.4690 0.5943 0.3941 0.1192  0.0692  0.0170  146 HIS A NE2 
952  N N   . CYS A 146 ? 0.4226 0.6064 0.3450 0.0829  0.0764  0.0075  147 CYS A N   
953  C CA  . CYS A 146 ? 0.4210 0.6164 0.3496 0.0800  0.0747  -0.0035 147 CYS A CA  
954  C C   . CYS A 146 ? 0.4338 0.6231 0.3691 0.0722  0.0791  -0.0117 147 CYS A C   
955  O O   . CYS A 146 ? 0.4582 0.6294 0.3967 0.0750  0.0824  -0.0108 147 CYS A O   
956  C CB  . CYS A 146 ? 0.4050 0.6194 0.3313 0.0753  0.0713  -0.0039 147 CYS A CB  
957  S SG  . CYS A 146 ? 0.4211 0.6422 0.3473 0.0679  0.0714  0.0030  147 CYS A SG  
958  N N   . VAL A 147 ? 0.4408 0.6435 0.3775 0.0623  0.0790  -0.0200 148 VAL A N   
959  C CA  . VAL A 147 ? 0.4515 0.6489 0.3935 0.0535  0.0828  -0.0295 148 VAL A CA  
960  C C   . VAL A 147 ? 0.4653 0.6625 0.4096 0.0454  0.0833  -0.0239 148 VAL A C   
961  O O   . VAL A 147 ? 0.4833 0.6650 0.4336 0.0426  0.0880  -0.0242 148 VAL A O   
962  C CB  . VAL A 147 ? 0.4634 0.6757 0.4030 0.0459  0.0824  -0.0425 148 VAL A CB  
963  C CG1 . VAL A 147 ? 0.4818 0.6896 0.4250 0.0351  0.0856  -0.0544 148 VAL A CG1 
964  C CG2 . VAL A 147 ? 0.4206 0.6340 0.3622 0.0538  0.0843  -0.0495 148 VAL A CG2 
965  N N   . MET A 148 ? 0.4608 0.6745 0.4028 0.0421  0.0789  -0.0181 149 MET A N   
966  C CA  . MET A 148 ? 0.4677 0.6862 0.4166 0.0352  0.0789  -0.0131 149 MET A CA  
967  C C   . MET A 148 ? 0.4565 0.6720 0.4050 0.0420  0.0810  -0.0008 149 MET A C   
968  O O   . MET A 148 ? 0.4568 0.6730 0.4133 0.0377  0.0844  0.0033  149 MET A O   
969  C CB  . MET A 148 ? 0.4662 0.7064 0.4159 0.0270  0.0717  -0.0154 149 MET A CB  
970  C CG  . MET A 148 ? 0.5366 0.7824 0.4811 0.0189  0.0694  -0.0283 149 MET A CG  
971  S SD  . MET A 148 ? 0.6464 0.9165 0.5888 0.0075  0.0589  -0.0292 149 MET A SD  
972  C CE  . MET A 148 ? 0.5948 0.8645 0.5550 -0.0013 0.0599  -0.0316 149 MET A CE  
973  N N   . GLY A 149 ? 0.4472 0.6610 0.3873 0.0519  0.0794  0.0038  150 GLY A N   
974  C CA  . GLY A 149 ? 0.4376 0.6495 0.3744 0.0580  0.0814  0.0134  150 GLY A CA  
975  C C   . GLY A 149 ? 0.4159 0.6444 0.3601 0.0547  0.0791  0.0162  150 GLY A C   
976  O O   . GLY A 149 ? 0.4117 0.6402 0.3596 0.0556  0.0838  0.0216  150 GLY A O   
977  N N   . ARG A 150 ? 0.3999 0.6425 0.3464 0.0508  0.0720  0.0127  151 ARG A N   
978  C CA  . ARG A 150 ? 0.3813 0.6393 0.3357 0.0494  0.0672  0.0166  151 ARG A CA  
979  C C   . ARG A 150 ? 0.3685 0.6311 0.3164 0.0544  0.0617  0.0191  151 ARG A C   
980  O O   . ARG A 150 ? 0.3680 0.6374 0.3225 0.0568  0.0592  0.0239  151 ARG A O   
981  C CB  . ARG A 150 ? 0.3846 0.6558 0.3472 0.0394  0.0615  0.0129  151 ARG A CB  
982  C CG  . ARG A 150 ? 0.4077 0.6750 0.3785 0.0315  0.0661  0.0078  151 ARG A CG  
983  C CD  . ARG A 150 ? 0.4030 0.6704 0.3877 0.0314  0.0729  0.0124  151 ARG A CD  
984  N NE  . ARG A 150 ? 0.4311 0.6890 0.4215 0.0236  0.0795  0.0079  151 ARG A NE  
985  C CZ  . ARG A 150 ? 0.4182 0.6710 0.4184 0.0212  0.0889  0.0112  151 ARG A CZ  
986  N NH1 . ARG A 150 ? 0.4081 0.6663 0.4140 0.0260  0.0937  0.0179  151 ARG A NH1 
987  N NH2 . ARG A 150 ? 0.4561 0.6976 0.4608 0.0130  0.0945  0.0070  151 ARG A NH2 
988  N N   . SER A 151 ? 0.3640 0.6234 0.3016 0.0553  0.0602  0.0153  152 SER A N   
989  C CA  . SER A 151 ? 0.3556 0.6207 0.2888 0.0569  0.0554  0.0174  152 SER A CA  
990  C C   . SER A 151 ? 0.3607 0.6181 0.2876 0.0642  0.0575  0.0160  152 SER A C   
991  O O   . SER A 151 ? 0.3722 0.6280 0.2995 0.0694  0.0569  0.0196  152 SER A O   
992  C CB  . SER A 151 ? 0.3599 0.6344 0.2878 0.0486  0.0508  0.0145  152 SER A CB  
993  O OG  . SER A 151 ? 0.3190 0.5970 0.2417 0.0488  0.0474  0.0182  152 SER A OG  
994  N N   . ARG A 152 ? 0.3661 0.6194 0.2890 0.0649  0.0596  0.0098  153 ARG A N   
995  C CA  . ARG A 152 ? 0.3680 0.6171 0.2881 0.0721  0.0597  0.0079  153 ARG A CA  
996  C C   . ARG A 152 ? 0.3782 0.6173 0.2954 0.0801  0.0610  0.0121  153 ARG A C   
997  O O   . ARG A 152 ? 0.3801 0.6196 0.2947 0.0845  0.0589  0.0136  153 ARG A O   
998  C CB  . ARG A 152 ? 0.3752 0.6227 0.2962 0.0725  0.0617  0.0000  153 ARG A CB  
999  C CG  . ARG A 152 ? 0.3607 0.6196 0.2815 0.0661  0.0617  -0.0058 153 ARG A CG  
1000 C CD  . ARG A 152 ? 0.3541 0.6124 0.2782 0.0657  0.0658  -0.0160 153 ARG A CD  
1001 N NE  . ARG A 152 ? 0.3569 0.6104 0.2803 0.0603  0.0681  -0.0190 153 ARG A NE  
1002 C CZ  . ARG A 152 ? 0.3961 0.6488 0.3215 0.0569  0.0724  -0.0298 153 ARG A CZ  
1003 N NH1 . ARG A 152 ? 0.4151 0.6730 0.3445 0.0590  0.0758  -0.0387 153 ARG A NH1 
1004 N NH2 . ARG A 152 ? 0.4181 0.6662 0.3432 0.0507  0.0738  -0.0331 153 ARG A NH2 
1005 N N   . SER A 153 ? 0.3812 0.6108 0.2975 0.0810  0.0648  0.0137  154 SER A N   
1006 C CA  . SER A 153 ? 0.3893 0.6084 0.2984 0.0875  0.0670  0.0188  154 SER A CA  
1007 C C   . SER A 153 ? 0.3806 0.6032 0.2891 0.0875  0.0688  0.0228  154 SER A C   
1008 O O   . SER A 153 ? 0.3886 0.6077 0.2888 0.0931  0.0686  0.0241  154 SER A O   
1009 C CB  . SER A 153 ? 0.4042 0.6105 0.3123 0.0867  0.0721  0.0212  154 SER A CB  
1010 O OG  . SER A 153 ? 0.4299 0.6406 0.3467 0.0780  0.0754  0.0204  154 SER A OG  
1011 N N   . ALA A 154 ? 0.3670 0.5974 0.2853 0.0815  0.0702  0.0237  155 ALA A N   
1012 C CA  . ALA A 154 ? 0.3572 0.5933 0.2814 0.0819  0.0719  0.0263  155 ALA A CA  
1013 C C   . ALA A 154 ? 0.3518 0.5904 0.2741 0.0859  0.0676  0.0250  155 ALA A C   
1014 O O   . ALA A 154 ? 0.3630 0.5989 0.2826 0.0904  0.0704  0.0251  155 ALA A O   
1015 C CB  . ALA A 154 ? 0.3426 0.5897 0.2814 0.0752  0.0705  0.0272  155 ALA A CB  
1016 N N   . THR A 155 ? 0.3529 0.5964 0.2764 0.0836  0.0617  0.0231  156 THR A N   
1017 C CA  . THR A 155 ? 0.3434 0.5879 0.2662 0.0857  0.0580  0.0217  156 THR A CA  
1018 C C   . THR A 155 ? 0.3456 0.5835 0.2586 0.0920  0.0583  0.0183  156 THR A C   
1019 O O   . THR A 155 ? 0.3478 0.5835 0.2595 0.0950  0.0582  0.0166  156 THR A O   
1020 C CB  . THR A 155 ? 0.3378 0.5883 0.2618 0.0805  0.0536  0.0204  156 THR A CB  
1021 O OG1 . THR A 155 ? 0.3237 0.5805 0.2529 0.0744  0.0519  0.0242  156 THR A OG1 
1022 C CG2 . THR A 155 ? 0.3226 0.5733 0.2480 0.0808  0.0507  0.0195  156 THR A CG2 
1023 N N   . LEU A 156 ? 0.3558 0.5899 0.2617 0.0943  0.0580  0.0171  157 LEU A N   
1024 C CA  . LEU A 156 ? 0.3528 0.5819 0.2481 0.1007  0.0557  0.0149  157 LEU A CA  
1025 C C   . LEU A 156 ? 0.3563 0.5784 0.2412 0.1040  0.0603  0.0171  157 LEU A C   
1026 O O   . LEU A 156 ? 0.3691 0.5894 0.2451 0.1077  0.0582  0.0137  157 LEU A O   
1027 C CB  . LEU A 156 ? 0.3576 0.5834 0.2495 0.1040  0.0531  0.0144  157 LEU A CB  
1028 C CG  . LEU A 156 ? 0.3478 0.5823 0.2502 0.1019  0.0495  0.0092  157 LEU A CG  
1029 C CD1 . LEU A 156 ? 0.3446 0.5751 0.2466 0.1078  0.0470  0.0082  157 LEU A CD1 
1030 C CD2 . LEU A 156 ? 0.3231 0.5661 0.2301 0.1008  0.0452  0.0045  157 LEU A CD2 
1031 N N   . VAL A 157 ? 0.3566 0.5755 0.2423 0.1020  0.0673  0.0216  158 VAL A N   
1032 C CA  . VAL A 157 ? 0.3551 0.5685 0.2309 0.1040  0.0746  0.0234  158 VAL A CA  
1033 C C   . VAL A 157 ? 0.3635 0.5824 0.2479 0.1040  0.0774  0.0195  158 VAL A C   
1034 O O   . VAL A 157 ? 0.3704 0.5860 0.2446 0.1071  0.0812  0.0161  158 VAL A O   
1035 C CB  . VAL A 157 ? 0.3714 0.5807 0.2487 0.1006  0.0827  0.0290  158 VAL A CB  
1036 C CG1 . VAL A 157 ? 0.3190 0.5259 0.1894 0.1009  0.0934  0.0301  158 VAL A CG1 
1037 C CG2 . VAL A 157 ? 0.3407 0.5391 0.2076 0.1020  0.0808  0.0332  158 VAL A CG2 
1038 N N   . LEU A 158 ? 0.3591 0.5858 0.2618 0.1007  0.0752  0.0195  159 LEU A N   
1039 C CA  . LEU A 158 ? 0.3525 0.5821 0.2660 0.1021  0.0763  0.0165  159 LEU A CA  
1040 C C   . LEU A 158 ? 0.3677 0.5929 0.2723 0.1051  0.0722  0.0101  159 LEU A C   
1041 O O   . LEU A 158 ? 0.3617 0.5835 0.2630 0.1082  0.0766  0.0044  159 LEU A O   
1042 C CB  . LEU A 158 ? 0.3347 0.5718 0.2669 0.0985  0.0715  0.0199  159 LEU A CB  
1043 C CG  . LEU A 158 ? 0.3288 0.5729 0.2730 0.0954  0.0749  0.0244  159 LEU A CG  
1044 C CD1 . LEU A 158 ? 0.2574 0.5099 0.2151 0.0910  0.0672  0.0286  159 LEU A CD1 
1045 C CD2 . LEU A 158 ? 0.2676 0.5138 0.2212 0.0986  0.0840  0.0227  159 LEU A CD2 
1046 N N   . ALA A 159 ? 0.3594 0.5856 0.2611 0.1036  0.0644  0.0094  160 ALA A N   
1047 C CA  . ALA A 159 ? 0.3770 0.6014 0.2732 0.1049  0.0592  0.0026  160 ALA A CA  
1048 C C   . ALA A 159 ? 0.3992 0.6185 0.2759 0.1093  0.0607  -0.0016 160 ALA A C   
1049 O O   . ALA A 159 ? 0.3998 0.6165 0.2721 0.1107  0.0607  -0.0091 160 ALA A O   
1050 C CB  . ALA A 159 ? 0.3601 0.5896 0.2588 0.1022  0.0518  0.0022  160 ALA A CB  
1051 N N   . TYR A 160 ? 0.4146 0.6313 0.2784 0.1112  0.0620  0.0035  161 TYR A N   
1052 C CA  . TYR A 160 ? 0.4324 0.6430 0.2730 0.1151  0.0633  0.0022  161 TYR A CA  
1053 C C   . TYR A 160 ? 0.4441 0.6521 0.2801 0.1154  0.0731  -0.0024 161 TYR A C   
1054 O O   . TYR A 160 ? 0.4653 0.6706 0.2861 0.1172  0.0724  -0.0098 161 TYR A O   
1055 C CB  . TYR A 160 ? 0.4413 0.6459 0.2697 0.1165  0.0655  0.0114  161 TYR A CB  
1056 C CG  . TYR A 160 ? 0.4560 0.6525 0.2571 0.1192  0.0696  0.0129  161 TYR A CG  
1057 C CD1 . TYR A 160 ? 0.4772 0.6721 0.2588 0.1232  0.0604  0.0099  161 TYR A CD1 
1058 C CD2 . TYR A 160 ? 0.4588 0.6508 0.2536 0.1171  0.0827  0.0169  161 TYR A CD2 
1059 C CE1 . TYR A 160 ? 0.5148 0.7022 0.2664 0.1250  0.0636  0.0117  161 TYR A CE1 
1060 C CE2 . TYR A 160 ? 0.5233 0.7077 0.2894 0.1182  0.0883  0.0187  161 TYR A CE2 
1061 C CZ  . TYR A 160 ? 0.5356 0.7170 0.2780 0.1222  0.0785  0.0165  161 TYR A CZ  
1062 O OH  . TYR A 160 ? 0.6310 0.8047 0.3405 0.1226  0.0837  0.0190  161 TYR A OH  
1063 N N   . LEU A 161 ? 0.4307 0.6402 0.2797 0.1135  0.0824  0.0011  162 LEU A N   
1064 C CA  . LEU A 161 ? 0.4368 0.6457 0.2854 0.1144  0.0937  -0.0042 162 LEU A CA  
1065 C C   . LEU A 161 ? 0.4449 0.6539 0.3030 0.1158  0.0918  -0.0149 162 LEU A C   
1066 O O   . LEU A 161 ? 0.4745 0.6803 0.3227 0.1176  0.0987  -0.0239 162 LEU A O   
1067 C CB  . LEU A 161 ? 0.4161 0.6303 0.2845 0.1123  0.1027  0.0008  162 LEU A CB  
1068 C CG  . LEU A 161 ? 0.4257 0.6379 0.2850 0.1096  0.1089  0.0095  162 LEU A CG  
1069 C CD1 . LEU A 161 ? 0.3925 0.6133 0.2769 0.1065  0.1165  0.0122  162 LEU A CD1 
1070 C CD2 . LEU A 161 ? 0.4278 0.6324 0.2581 0.1105  0.1176  0.0087  162 LEU A CD2 
1071 N N   . MET A 162 ? 0.4282 0.6396 0.3046 0.1144  0.0835  -0.0142 163 MET A N   
1072 C CA  . MET A 162 ? 0.4357 0.6442 0.3237 0.1149  0.0816  -0.0229 163 MET A CA  
1073 C C   . MET A 162 ? 0.4563 0.6610 0.3261 0.1149  0.0761  -0.0328 163 MET A C   
1074 O O   . MET A 162 ? 0.4732 0.6730 0.3416 0.1160  0.0797  -0.0443 163 MET A O   
1075 C CB  . MET A 162 ? 0.4201 0.6308 0.3293 0.1119  0.0741  -0.0173 163 MET A CB  
1076 C CG  . MET A 162 ? 0.4047 0.6203 0.3337 0.1119  0.0773  -0.0086 163 MET A CG  
1077 S SD  . MET A 162 ? 0.4017 0.6214 0.3436 0.1067  0.0675  0.0015  163 MET A SD  
1078 C CE  . MET A 162 ? 0.3686 0.5795 0.3231 0.1063  0.0637  -0.0029 163 MET A CE  
1079 N N   . ILE A 163 ? 0.4489 0.6564 0.3063 0.1139  0.0672  -0.0296 164 ILE A N   
1080 C CA  . ILE A 163 ? 0.4649 0.6721 0.3084 0.1137  0.0589  -0.0388 164 ILE A CA  
1081 C C   . ILE A 163 ? 0.5012 0.7051 0.3149 0.1165  0.0621  -0.0439 164 ILE A C   
1082 O O   . ILE A 163 ? 0.5215 0.7234 0.3250 0.1159  0.0597  -0.0565 164 ILE A O   
1083 C CB  . ILE A 163 ? 0.4502 0.6643 0.2943 0.1128  0.0473  -0.0340 164 ILE A CB  
1084 C CG1 . ILE A 163 ? 0.4390 0.6571 0.3081 0.1084  0.0448  -0.0306 164 ILE A CG1 
1085 C CG2 . ILE A 163 ? 0.4435 0.6606 0.2744 0.1131  0.0368  -0.0439 164 ILE A CG2 
1086 C CD1 . ILE A 163 ? 0.3941 0.6203 0.2667 0.1078  0.0376  -0.0251 164 ILE A CD1 
1087 N N   . HIS A 164 ? 0.5068 0.7093 0.3049 0.1185  0.0670  -0.0343 165 HIS A N   
1088 C CA  . HIS A 164 ? 0.5435 0.7420 0.3078 0.1204  0.0688  -0.0357 165 HIS A CA  
1089 C C   . HIS A 164 ? 0.5665 0.7610 0.3215 0.1201  0.0861  -0.0383 165 HIS A C   
1090 O O   . HIS A 164 ? 0.5780 0.7688 0.3029 0.1203  0.0901  -0.0430 165 HIS A O   
1091 C CB  . HIS A 164 ? 0.5490 0.7463 0.2980 0.1227  0.0618  -0.0227 165 HIS A CB  
1092 C CG  . HIS A 164 ? 0.5495 0.7528 0.3041 0.1242  0.0449  -0.0233 165 HIS A CG  
1093 N ND1 . HIS A 164 ? 0.5597 0.7661 0.2976 0.1256  0.0332  -0.0314 165 HIS A ND1 
1094 C CD2 . HIS A 164 ? 0.5375 0.7463 0.3145 0.1243  0.0382  -0.0183 165 HIS A CD2 
1095 C CE1 . HIS A 164 ? 0.5771 0.7917 0.3301 0.1267  0.0200  -0.0311 165 HIS A CE1 
1096 N NE2 . HIS A 164 ? 0.5611 0.7769 0.3372 0.1260  0.0237  -0.0234 165 HIS A NE2 
1097 N N   . LYS A 165 ? 0.5571 0.7535 0.3375 0.1194  0.0964  -0.0356 166 LYS A N   
1098 C CA  . LYS A 165 ? 0.5821 0.7778 0.3597 0.1193  0.1140  -0.0398 166 LYS A CA  
1099 C C   . LYS A 165 ? 0.5785 0.7759 0.3833 0.1206  0.1209  -0.0517 166 LYS A C   
1100 O O   . LYS A 165 ? 0.5781 0.7783 0.3942 0.1214  0.1353  -0.0537 166 LYS A O   
1101 C CB  . LYS A 165 ? 0.5725 0.7700 0.3553 0.1176  0.1231  -0.0265 166 LYS A CB  
1102 C CG  . LYS A 165 ? 0.5906 0.7822 0.3449 0.1167  0.1192  -0.0147 166 LYS A CG  
1103 C CD  . LYS A 165 ? 0.6064 0.7917 0.3194 0.1166  0.1242  -0.0182 166 LYS A CD  
1104 C CE  . LYS A 165 ? 0.6198 0.7972 0.3054 0.1173  0.1146  -0.0045 166 LYS A CE  
1105 N NZ  . LYS A 165 ? 0.6290 0.8000 0.2702 0.1174  0.1151  -0.0058 166 LYS A NZ  
1106 N N   . ASP A 166 ? 0.5814 0.7767 0.3985 0.1209  0.1107  -0.0593 167 ASP A N   
1107 C CA  . ASP A 166 ? 0.5952 0.7876 0.4348 0.1228  0.1163  -0.0717 167 ASP A CA  
1108 C C   . ASP A 166 ? 0.5701 0.7667 0.4454 0.1251  0.1222  -0.0648 167 ASP A C   
1109 O O   . ASP A 166 ? 0.5818 0.7769 0.4767 0.1286  0.1310  -0.0736 167 ASP A O   
1110 C CB  . ASP A 166 ? 0.6386 0.8278 0.4577 0.1238  0.1293  -0.0871 167 ASP A CB  
1111 C CG  . ASP A 166 ? 0.6884 0.8706 0.5209 0.1251  0.1306  -0.1049 167 ASP A CG  
1112 O OD1 . ASP A 166 ? 0.7393 0.9173 0.5782 0.1230  0.1172  -0.1073 167 ASP A OD1 
1113 O OD2 . ASP A 166 ? 0.7625 0.9432 0.6000 0.1278  0.1457  -0.1175 167 ASP A OD2 
1114 N N   . MET A 167 ? 0.5421 0.7444 0.4270 0.1236  0.1166  -0.0498 168 MET A N   
1115 C CA  . MET A 167 ? 0.5198 0.7284 0.4365 0.1252  0.1196  -0.0424 168 MET A CA  
1116 C C   . MET A 167 ? 0.4905 0.6963 0.4313 0.1254  0.1083  -0.0387 168 MET A C   
1117 O O   . MET A 167 ? 0.4797 0.6818 0.4129 0.1220  0.0974  -0.0367 168 MET A O   
1118 C CB  . MET A 167 ? 0.5168 0.7330 0.4305 0.1221  0.1202  -0.0291 168 MET A CB  
1119 C CG  . MET A 167 ? 0.5414 0.7597 0.4376 0.1212  0.1347  -0.0302 168 MET A CG  
1120 S SD  . MET A 167 ? 0.5681 0.7956 0.4760 0.1170  0.1386  -0.0163 168 MET A SD  
1121 C CE  . MET A 167 ? 0.5612 0.7855 0.4383 0.1142  0.1556  -0.0171 168 MET A CE  
1122 N N   . THR A 168 ? 0.4754 0.6834 0.4460 0.1293  0.1113  -0.0375 169 THR A N   
1123 C CA  . THR A 168 ? 0.4537 0.6603 0.4470 0.1291  0.1006  -0.0284 169 THR A CA  
1124 C C   . THR A 168 ? 0.4341 0.6510 0.4259 0.1247  0.0943  -0.0142 169 THR A C   
1125 O O   . THR A 168 ? 0.4218 0.6463 0.4047 0.1233  0.1002  -0.0122 169 THR A O   
1126 C CB  . THR A 168 ? 0.4572 0.6649 0.4844 0.1361  0.1045  -0.0290 169 THR A CB  
1127 O OG1 . THR A 168 ? 0.4614 0.6834 0.4982 0.1378  0.1130  -0.0266 169 THR A OG1 
1128 C CG2 . THR A 168 ? 0.4495 0.6462 0.4831 0.1414  0.1126  -0.0450 169 THR A CG2 
1129 N N   . LEU A 169 ? 0.4191 0.6351 0.4190 0.1217  0.0831  -0.0049 170 LEU A N   
1130 C CA  . LEU A 169 ? 0.4011 0.6269 0.4023 0.1174  0.0771  0.0068  170 LEU A CA  
1131 C C   . LEU A 169 ? 0.3951 0.6329 0.4147 0.1201  0.0824  0.0098  170 LEU A C   
1132 O O   . LEU A 169 ? 0.3931 0.6391 0.4058 0.1164  0.0848  0.0130  170 LEU A O   
1133 C CB  . LEU A 169 ? 0.3957 0.6186 0.4041 0.1140  0.0656  0.0160  170 LEU A CB  
1134 C CG  . LEU A 169 ? 0.3764 0.6088 0.3831 0.1081  0.0581  0.0270  170 LEU A CG  
1135 C CD1 . LEU A 169 ? 0.3498 0.5874 0.3373 0.1039  0.0607  0.0251  170 LEU A CD1 
1136 C CD2 . LEU A 169 ? 0.3353 0.5622 0.3401 0.1033  0.0492  0.0341  170 LEU A CD2 
1137 N N   . VAL A 170 ? 0.3928 0.6317 0.4378 0.1266  0.0848  0.0080  171 VAL A N   
1138 C CA  . VAL A 170 ? 0.3782 0.6318 0.4473 0.1297  0.0898  0.0095  171 VAL A CA  
1139 C C   . VAL A 170 ? 0.3937 0.6533 0.4518 0.1281  0.1044  0.0026  171 VAL A C   
1140 O O   . VAL A 170 ? 0.3932 0.6652 0.4572 0.1241  0.1065  0.0071  171 VAL A O   
1141 C CB  . VAL A 170 ? 0.3877 0.6408 0.4901 0.1393  0.0910  0.0066  171 VAL A CB  
1142 C CG1 . VAL A 170 ? 0.3565 0.6279 0.4867 0.1433  0.0995  0.0043  171 VAL A CG1 
1143 C CG2 . VAL A 170 ? 0.3343 0.5824 0.4503 0.1406  0.0750  0.0185  171 VAL A CG2 
1144 N N   . ASP A 171 ? 0.4093 0.6599 0.4511 0.1302  0.1146  -0.0083 172 ASP A N   
1145 C CA  . ASP A 171 ? 0.4239 0.6777 0.4501 0.1282  0.1294  -0.0141 172 ASP A CA  
1146 C C   . ASP A 171 ? 0.4132 0.6666 0.4152 0.1206  0.1260  -0.0059 172 ASP A C   
1147 O O   . ASP A 171 ? 0.4199 0.6799 0.4200 0.1168  0.1348  -0.0036 172 ASP A O   
1148 C CB  . ASP A 171 ? 0.4513 0.6933 0.4544 0.1304  0.1375  -0.0267 172 ASP A CB  
1149 C CG  . ASP A 171 ? 0.4988 0.7389 0.5239 0.1380  0.1451  -0.0389 172 ASP A CG  
1150 O OD1 . ASP A 171 ? 0.4811 0.7316 0.5410 0.1428  0.1487  -0.0385 172 ASP A OD1 
1151 O OD2 . ASP A 171 ? 0.5848 0.8128 0.5928 0.1393  0.1470  -0.0500 172 ASP A OD2 
1152 N N   . ALA A 172 ? 0.3894 0.6344 0.3747 0.1184  0.1141  -0.0023 173 ALA A N   
1153 C CA  . ALA A 172 ? 0.3770 0.6197 0.3411 0.1129  0.1100  0.0040  173 ALA A CA  
1154 C C   . ALA A 172 ? 0.3613 0.6142 0.3412 0.1083  0.1066  0.0123  173 ALA A C   
1155 O O   . ALA A 172 ? 0.3594 0.6128 0.3301 0.1038  0.1107  0.0157  173 ALA A O   
1156 C CB  . ALA A 172 ? 0.3566 0.5912 0.3064 0.1121  0.0981  0.0044  173 ALA A CB  
1157 N N   . ILE A 173 ? 0.3543 0.6145 0.3574 0.1091  0.0984  0.0158  174 ILE A N   
1158 C CA  . ILE A 173 ? 0.3411 0.6132 0.3596 0.1043  0.0936  0.0224  174 ILE A CA  
1159 C C   . ILE A 173 ? 0.3550 0.6382 0.3901 0.1033  0.1052  0.0206  174 ILE A C   
1160 O O   . ILE A 173 ? 0.3555 0.6436 0.3902 0.0968  0.1070  0.0235  174 ILE A O   
1161 C CB  . ILE A 173 ? 0.3244 0.6029 0.3636 0.1060  0.0815  0.0275  174 ILE A CB  
1162 C CG1 . ILE A 173 ? 0.3141 0.5838 0.3366 0.1034  0.0709  0.0311  174 ILE A CG1 
1163 C CG2 . ILE A 173 ? 0.2775 0.5720 0.3358 0.1016  0.0774  0.0323  174 ILE A CG2 
1164 C CD1 . ILE A 173 ? 0.2912 0.5610 0.3283 0.1058  0.0603  0.0370  174 ILE A CD1 
1165 N N   . GLN A 174 ? 0.3675 0.6549 0.4191 0.1094  0.1139  0.0148  175 GLN A N   
1166 C CA  . GLN A 174 ? 0.3945 0.6945 0.4637 0.1079  0.1275  0.0119  175 GLN A CA  
1167 C C   . GLN A 174 ? 0.3940 0.6865 0.4368 0.1014  0.1396  0.0118  175 GLN A C   
1168 O O   . GLN A 174 ? 0.3953 0.6966 0.4480 0.0950  0.1469  0.0137  175 GLN A O   
1169 C CB  . GLN A 174 ? 0.4190 0.7237 0.5084 0.1160  0.1377  0.0032  175 GLN A CB  
1170 C CG  . GLN A 174 ? 0.5081 0.8171 0.6265 0.1241  0.1254  0.0046  175 GLN A CG  
1171 C CD  . GLN A 174 ? 0.5947 0.9260 0.7568 0.1265  0.1235  0.0065  175 GLN A CD  
1172 O OE1 . GLN A 174 ? 0.6553 1.0011 0.8272 0.1195  0.1261  0.0089  175 GLN A OE1 
1173 N NE2 . GLN A 174 ? 0.6011 0.9349 0.7916 0.1366  0.1179  0.0054  175 GLN A NE2 
1174 N N   . GLN A 175 ? 0.3899 0.6660 0.3997 0.1028  0.1410  0.0101  176 GLN A N   
1175 C CA  . GLN A 175 ? 0.4006 0.6670 0.3822 0.0982  0.1512  0.0118  176 GLN A CA  
1176 C C   . GLN A 175 ? 0.3865 0.6495 0.3619 0.0910  0.1449  0.0201  176 GLN A C   
1177 O O   . GLN A 175 ? 0.3885 0.6489 0.3577 0.0850  0.1548  0.0236  176 GLN A O   
1178 C CB  . GLN A 175 ? 0.4167 0.6677 0.3647 0.1022  0.1505  0.0083  176 GLN A CB  
1179 C CG  . GLN A 175 ? 0.4280 0.6664 0.3422 0.0984  0.1563  0.0131  176 GLN A CG  
1180 C CD  . GLN A 175 ? 0.4104 0.6519 0.3222 0.0945  0.1760  0.0123  176 GLN A CD  
1181 O OE1 . GLN A 175 ? 0.4741 0.7245 0.3996 0.0970  0.1865  0.0039  176 GLN A OE1 
1182 N NE2 . GLN A 175 ? 0.3707 0.6045 0.2671 0.0881  0.1818  0.0207  176 GLN A NE2 
1183 N N   . VAL A 176 ? 0.3692 0.6316 0.3471 0.0912  0.1295  0.0228  177 VAL A N   
1184 C CA  . VAL A 176 ? 0.3576 0.6155 0.3286 0.0851  0.1231  0.0281  177 VAL A CA  
1185 C C   . VAL A 176 ? 0.3496 0.6219 0.3474 0.0786  0.1213  0.0294  177 VAL A C   
1186 O O   . VAL A 176 ? 0.3682 0.6386 0.3662 0.0714  0.1266  0.0316  177 VAL A O   
1187 C CB  . VAL A 176 ? 0.3520 0.6032 0.3105 0.0876  0.1091  0.0286  177 VAL A CB  
1188 C CG1 . VAL A 176 ? 0.3328 0.5814 0.2889 0.0815  0.1034  0.0316  177 VAL A CG1 
1189 C CG2 . VAL A 176 ? 0.3437 0.5817 0.2758 0.0929  0.1098  0.0268  177 VAL A CG2 
1190 N N   . ALA A 177 ? 0.3402 0.6265 0.3612 0.0808  0.1133  0.0284  178 ALA A N   
1191 C CA  . ALA A 177 ? 0.3299 0.6333 0.3780 0.0750  0.1086  0.0293  178 ALA A CA  
1192 C C   . ALA A 177 ? 0.3262 0.6397 0.3929 0.0698  0.1222  0.0276  178 ALA A C   
1193 O O   . ALA A 177 ? 0.3182 0.6415 0.4002 0.0616  0.1202  0.0279  178 ALA A O   
1194 C CB  . ALA A 177 ? 0.3132 0.6294 0.3829 0.0805  0.0972  0.0301  178 ALA A CB  
1195 N N   . LYS A 178 ? 0.3407 0.6521 0.4056 0.0733  0.1371  0.0249  179 LYS A N   
1196 C CA  . LYS A 178 ? 0.3397 0.6617 0.4226 0.0669  0.1527  0.0232  179 LYS A CA  
1197 C C   . LYS A 178 ? 0.3605 0.6672 0.4217 0.0575  0.1613  0.0273  179 LYS A C   
1198 O O   . LYS A 178 ? 0.3755 0.6897 0.4525 0.0485  0.1722  0.0272  179 LYS A O   
1199 C CB  . LYS A 178 ? 0.3453 0.6712 0.4332 0.0730  0.1678  0.0179  179 LYS A CB  
1200 C CG  . LYS A 178 ? 0.3615 0.6668 0.4104 0.0741  0.1796  0.0183  179 LYS A CG  
1201 C CD  . LYS A 178 ? 0.3519 0.6606 0.4023 0.0814  0.1918  0.0105  179 LYS A CD  
1202 C CE  . LYS A 178 ? 0.3671 0.6576 0.3761 0.0799  0.2054  0.0109  179 LYS A CE  
1203 N NZ  . LYS A 178 ? 0.3395 0.6324 0.3457 0.0865  0.2169  0.0010  179 LYS A NZ  
1204 N N   . ASN A 179 ? 0.3632 0.6484 0.3906 0.0594  0.1563  0.0310  180 ASN A N   
1205 C CA  . ASN A 179 ? 0.3792 0.6465 0.3866 0.0522  0.1619  0.0362  180 ASN A CA  
1206 C C   . ASN A 179 ? 0.3811 0.6441 0.3900 0.0472  0.1492  0.0370  180 ASN A C   
1207 O O   . ASN A 179 ? 0.4081 0.6603 0.4134 0.0391  0.1545  0.0398  180 ASN A O   
1208 C CB  . ASN A 179 ? 0.3915 0.6373 0.3610 0.0581  0.1653  0.0401  180 ASN A CB  
1209 C CG  . ASN A 179 ? 0.3844 0.6310 0.3455 0.0596  0.1818  0.0391  180 ASN A CG  
1210 O OD1 . ASN A 179 ? 0.3860 0.6342 0.3524 0.0518  0.1975  0.0411  180 ASN A OD1 
1211 N ND2 . ASN A 179 ? 0.3569 0.6028 0.3052 0.0688  0.1794  0.0348  180 ASN A ND2 
1212 N N   . ARG A 180 ? 0.3680 0.6382 0.3815 0.0513  0.1336  0.0344  181 ARG A N   
1213 C CA  . ARG A 180 ? 0.3661 0.6324 0.3771 0.0467  0.1223  0.0334  181 ARG A CA  
1214 C C   . ARG A 180 ? 0.3557 0.6400 0.3828 0.0474  0.1082  0.0304  181 ARG A C   
1215 O O   . ARG A 180 ? 0.3701 0.6597 0.3977 0.0552  0.1034  0.0309  181 ARG A O   
1216 C CB  . ARG A 180 ? 0.3622 0.6081 0.3440 0.0525  0.1184  0.0354  181 ARG A CB  
1217 C CG  . ARG A 180 ? 0.3742 0.6137 0.3525 0.0482  0.1105  0.0329  181 ARG A CG  
1218 C CD  . ARG A 180 ? 0.3694 0.5884 0.3241 0.0538  0.1091  0.0348  181 ARG A CD  
1219 N NE  . ARG A 180 ? 0.3721 0.5875 0.3283 0.0497  0.1028  0.0298  181 ARG A NE  
1220 C CZ  . ARG A 180 ? 0.4113 0.6172 0.3728 0.0420  0.1067  0.0278  181 ARG A CZ  
1221 N NH1 . ARG A 180 ? 0.4508 0.6495 0.4173 0.0363  0.1172  0.0318  181 ARG A NH1 
1222 N NH2 . ARG A 180 ? 0.4481 0.6514 0.4101 0.0391  0.1010  0.0208  181 ARG A NH2 
1223 N N   . CYS A 181 ? 0.3593 0.6519 0.3981 0.0389  0.1011  0.0274  182 CYS A N   
1224 C CA  . CYS A 181 ? 0.3539 0.6614 0.4007 0.0389  0.0859  0.0260  182 CYS A CA  
1225 C C   . CYS A 181 ? 0.3482 0.6435 0.3704 0.0438  0.0790  0.0265  182 CYS A C   
1226 O O   . CYS A 181 ? 0.3657 0.6481 0.3733 0.0406  0.0801  0.0239  182 CYS A O   
1227 C CB  . CYS A 181 ? 0.3575 0.6760 0.4175 0.0273  0.0796  0.0213  182 CYS A CB  
1228 S SG  . CYS A 181 ? 0.3768 0.7147 0.4722 0.0189  0.0860  0.0190  182 CYS A SG  
1229 N N   . VAL A 182 ? 0.3338 0.6327 0.3534 0.0514  0.0727  0.0295  183 VAL A N   
1230 C CA  . VAL A 182 ? 0.3330 0.6228 0.3321 0.0548  0.0666  0.0297  183 VAL A CA  
1231 C C   . VAL A 182 ? 0.3357 0.6368 0.3399 0.0560  0.0547  0.0331  183 VAL A C   
1232 O O   . VAL A 182 ? 0.3155 0.6280 0.3385 0.0587  0.0517  0.0364  183 VAL A O   
1233 C CB  . VAL A 182 ? 0.3342 0.6096 0.3185 0.0631  0.0733  0.0307  183 VAL A CB  
1234 C CG1 . VAL A 182 ? 0.3365 0.5989 0.3126 0.0623  0.0841  0.0301  183 VAL A CG1 
1235 C CG2 . VAL A 182 ? 0.3187 0.5988 0.3129 0.0701  0.0752  0.0328  183 VAL A CG2 
1236 N N   . LEU A 183 ? 0.3356 0.6335 0.3240 0.0538  0.0484  0.0326  184 LEU A N   
1237 C CA  . LEU A 183 ? 0.3438 0.6487 0.3309 0.0536  0.0377  0.0376  184 LEU A CA  
1238 C C   . LEU A 183 ? 0.3478 0.6434 0.3143 0.0532  0.0376  0.0361  184 LEU A C   
1239 O O   . LEU A 183 ? 0.3593 0.6569 0.3146 0.0462  0.0352  0.0324  184 LEU A O   
1240 C CB  . LEU A 183 ? 0.3518 0.6714 0.3443 0.0450  0.0278  0.0380  184 LEU A CB  
1241 C CG  . LEU A 183 ? 0.3931 0.7214 0.3844 0.0443  0.0145  0.0464  184 LEU A CG  
1242 C CD1 . LEU A 183 ? 0.4000 0.7295 0.4101 0.0541  0.0124  0.0540  184 LEU A CD1 
1243 C CD2 . LEU A 183 ? 0.3688 0.7138 0.3635 0.0354  0.0028  0.0465  184 LEU A CD2 
1244 N N   . PRO A 184 ? 0.3396 0.6262 0.3021 0.0601  0.0408  0.0375  185 PRO A N   
1245 C CA  . PRO A 184 ? 0.3405 0.6220 0.2882 0.0588  0.0401  0.0361  185 PRO A CA  
1246 C C   . PRO A 184 ? 0.3486 0.6368 0.2910 0.0525  0.0319  0.0413  185 PRO A C   
1247 O O   . PRO A 184 ? 0.3532 0.6472 0.3048 0.0530  0.0249  0.0487  185 PRO A O   
1248 C CB  . PRO A 184 ? 0.3388 0.6119 0.2880 0.0665  0.0429  0.0371  185 PRO A CB  
1249 C CG  . PRO A 184 ? 0.3331 0.6042 0.2916 0.0720  0.0488  0.0359  185 PRO A CG  
1250 C CD  . PRO A 184 ? 0.3312 0.6132 0.3029 0.0684  0.0453  0.0391  185 PRO A CD  
1251 N N   . ASN A 185 ? 0.3596 0.6479 0.2877 0.0468  0.0327  0.0379  186 ASN A N   
1252 C CA  . ASN A 185 ? 0.3705 0.6646 0.2880 0.0391  0.0261  0.0436  186 ASN A CA  
1253 C C   . ASN A 185 ? 0.3832 0.6715 0.3031 0.0422  0.0230  0.0532  186 ASN A C   
1254 O O   . ASN A 185 ? 0.3668 0.6468 0.2943 0.0493  0.0271  0.0519  186 ASN A O   
1255 C CB  . ASN A 185 ? 0.3726 0.6691 0.2740 0.0313  0.0307  0.0356  186 ASN A CB  
1256 C CG  . ASN A 185 ? 0.3771 0.6679 0.2756 0.0334  0.0375  0.0321  186 ASN A CG  
1257 O OD1 . ASN A 185 ? 0.3799 0.6668 0.2794 0.0343  0.0361  0.0390  186 ASN A OD1 
1258 N ND2 . ASN A 185 ? 0.3657 0.6562 0.2632 0.0340  0.0445  0.0210  186 ASN A ND2 
1259 N N   . ARG A 186 ? 0.4099 0.7014 0.3222 0.0366  0.0152  0.0629  187 ARG A N   
1260 C CA  . ARG A 186 ? 0.4299 0.7135 0.3457 0.0390  0.0108  0.0745  187 ARG A CA  
1261 C C   . ARG A 186 ? 0.4124 0.6858 0.3260 0.0394  0.0185  0.0713  187 ARG A C   
1262 O O   . ARG A 186 ? 0.4042 0.6677 0.3284 0.0448  0.0178  0.0758  187 ARG A O   
1263 C CB  . ARG A 186 ? 0.4630 0.7505 0.3649 0.0309  0.0010  0.0870  187 ARG A CB  
1264 C CG  . ARG A 186 ? 0.5567 0.8503 0.4720 0.0355  -0.0120 0.0970  187 ARG A CG  
1265 C CD  . ARG A 186 ? 0.6684 0.9618 0.5707 0.0302  -0.0248 0.1144  187 ARG A CD  
1266 N NE  . ARG A 186 ? 0.7702 1.0490 0.6607 0.0265  -0.0204 0.1217  187 ARG A NE  
1267 C CZ  . ARG A 186 ? 0.8396 1.1156 0.7072 0.0169  -0.0250 0.1341  187 ARG A CZ  
1268 N NH1 . ARG A 186 ? 0.8805 1.1675 0.7310 0.0103  -0.0360 0.1411  187 ARG A NH1 
1269 N NH2 . ARG A 186 ? 0.8578 1.1196 0.7184 0.0130  -0.0185 0.1396  187 ARG A NH2 
1270 N N   . GLY A 187 ? 0.3978 0.6745 0.3001 0.0337  0.0257  0.0624  188 GLY A N   
1271 C CA  . GLY A 187 ? 0.3779 0.6490 0.2809 0.0332  0.0325  0.0577  188 GLY A CA  
1272 C C   . GLY A 187 ? 0.3606 0.6268 0.2767 0.0432  0.0358  0.0497  188 GLY A C   
1273 O O   . GLY A 187 ? 0.3611 0.6196 0.2840 0.0460  0.0369  0.0493  188 GLY A O   
1274 N N   . PHE A 188 ? 0.3517 0.6215 0.2701 0.0479  0.0373  0.0432  189 PHE A N   
1275 C CA  . PHE A 188 ? 0.3491 0.6137 0.2755 0.0569  0.0403  0.0371  189 PHE A CA  
1276 C C   . PHE A 188 ? 0.3509 0.6087 0.2877 0.0631  0.0378  0.0423  189 PHE A C   
1277 O O   . PHE A 188 ? 0.3453 0.5965 0.2861 0.0684  0.0402  0.0380  189 PHE A O   
1278 C CB  . PHE A 188 ? 0.3411 0.6085 0.2667 0.0597  0.0430  0.0316  189 PHE A CB  
1279 C CG  . PHE A 188 ? 0.3432 0.6148 0.2621 0.0563  0.0465  0.0239  189 PHE A CG  
1280 C CD1 . PHE A 188 ? 0.3543 0.6294 0.2700 0.0520  0.0485  0.0204  189 PHE A CD1 
1281 C CD2 . PHE A 188 ? 0.3653 0.6370 0.2836 0.0573  0.0489  0.0192  189 PHE A CD2 
1282 C CE1 . PHE A 188 ? 0.3445 0.6247 0.2578 0.0499  0.0529  0.0117  189 PHE A CE1 
1283 C CE2 . PHE A 188 ? 0.3685 0.6425 0.2835 0.0553  0.0526  0.0110  189 PHE A CE2 
1284 C CZ  . PHE A 188 ? 0.3487 0.6277 0.2619 0.0522  0.0546  0.0069  189 PHE A CZ  
1285 N N   . LEU A 189 ? 0.3600 0.6202 0.3019 0.0624  0.0327  0.0507  190 LEU A N   
1286 C CA  . LEU A 189 ? 0.3701 0.6247 0.3264 0.0691  0.0303  0.0555  190 LEU A CA  
1287 C C   . LEU A 189 ? 0.3748 0.6181 0.3338 0.0692  0.0295  0.0583  190 LEU A C   
1288 O O   . LEU A 189 ? 0.3579 0.5932 0.3265 0.0757  0.0320  0.0545  190 LEU A O   
1289 C CB  . LEU A 189 ? 0.3867 0.6481 0.3507 0.0685  0.0225  0.0652  190 LEU A CB  
1290 C CG  . LEU A 189 ? 0.4127 0.6833 0.3883 0.0724  0.0233  0.0624  190 LEU A CG  
1291 C CD1 . LEU A 189 ? 0.4217 0.6999 0.4118 0.0736  0.0134  0.0724  190 LEU A CD1 
1292 C CD2 . LEU A 189 ? 0.4222 0.6873 0.4066 0.0806  0.0320  0.0548  190 LEU A CD2 
1293 N N   . LYS A 190 ? 0.3843 0.6265 0.3343 0.0610  0.0269  0.0646  191 LYS A N   
1294 C CA  . LYS A 190 ? 0.4062 0.6364 0.3588 0.0588  0.0270  0.0677  191 LYS A CA  
1295 C C   . LYS A 190 ? 0.3898 0.6173 0.3428 0.0602  0.0334  0.0546  191 LYS A C   
1296 O O   . LYS A 190 ? 0.3738 0.5906 0.3355 0.0630  0.0344  0.0516  191 LYS A O   
1297 C CB  . LYS A 190 ? 0.4374 0.6683 0.3769 0.0477  0.0248  0.0772  191 LYS A CB  
1298 C CG  . LYS A 190 ? 0.5298 0.7512 0.4683 0.0408  0.0286  0.0775  191 LYS A CG  
1299 C CD  . LYS A 190 ? 0.6295 0.8362 0.5700 0.0377  0.0234  0.0936  191 LYS A CD  
1300 C CE  . LYS A 190 ? 0.6780 0.8746 0.6179 0.0282  0.0291  0.0932  191 LYS A CE  
1301 N NZ  . LYS A 190 ? 0.7317 0.9136 0.6663 0.0210  0.0251  0.1122  191 LYS A NZ  
1302 N N   . GLN A 191 ? 0.3638 0.6010 0.3088 0.0589  0.0369  0.0462  192 GLN A N   
1303 C CA  . GLN A 191 ? 0.3533 0.5900 0.2990 0.0611  0.0404  0.0347  192 GLN A CA  
1304 C C   . GLN A 191 ? 0.3427 0.5735 0.2937 0.0708  0.0414  0.0289  192 GLN A C   
1305 O O   . GLN A 191 ? 0.3135 0.5382 0.2677 0.0725  0.0421  0.0218  192 GLN A O   
1306 C CB  . GLN A 191 ? 0.3473 0.5952 0.2858 0.0595  0.0429  0.0279  192 GLN A CB  
1307 C CG  . GLN A 191 ? 0.3619 0.6164 0.2963 0.0494  0.0448  0.0290  192 GLN A CG  
1308 C CD  . GLN A 191 ? 0.3714 0.6370 0.3004 0.0485  0.0477  0.0229  192 GLN A CD  
1309 O OE1 . GLN A 191 ? 0.3318 0.5997 0.2628 0.0552  0.0483  0.0151  192 GLN A OE1 
1310 N NE2 . GLN A 191 ? 0.3271 0.5986 0.2482 0.0403  0.0494  0.0267  192 GLN A NE2 
1311 N N   . LEU A 192 ? 0.3423 0.5754 0.2945 0.0759  0.0418  0.0315  193 LEU A N   
1312 C CA  . LEU A 192 ? 0.3394 0.5679 0.2960 0.0841  0.0449  0.0264  193 LEU A CA  
1313 C C   . LEU A 192 ? 0.3572 0.5751 0.3265 0.0867  0.0442  0.0276  193 LEU A C   
1314 O O   . LEU A 192 ? 0.3632 0.5743 0.3344 0.0914  0.0476  0.0189  193 LEU A O   
1315 C CB  . LEU A 192 ? 0.3298 0.5646 0.2880 0.0875  0.0469  0.0292  193 LEU A CB  
1316 C CG  . LEU A 192 ? 0.3141 0.5549 0.2611 0.0865  0.0492  0.0263  193 LEU A CG  
1317 C CD1 . LEU A 192 ? 0.2637 0.5104 0.2154 0.0869  0.0510  0.0300  193 LEU A CD1 
1318 C CD2 . LEU A 192 ? 0.3004 0.5368 0.2376 0.0911  0.0527  0.0182  193 LEU A CD2 
1319 N N   . ARG A 193 ? 0.3606 0.5758 0.3373 0.0836  0.0396  0.0382  194 ARG A N   
1320 C CA  . ARG A 193 ? 0.3858 0.5882 0.3771 0.0869  0.0384  0.0409  194 ARG A CA  
1321 C C   . ARG A 193 ? 0.3910 0.5826 0.3810 0.0832  0.0399  0.0335  194 ARG A C   
1322 O O   . ARG A 193 ? 0.4119 0.5927 0.4112 0.0878  0.0424  0.0264  194 ARG A O   
1323 C CB  . ARG A 193 ? 0.3910 0.5912 0.3897 0.0849  0.0313  0.0565  194 ARG A CB  
1324 C CG  . ARG A 193 ? 0.4160 0.6279 0.4221 0.0894  0.0277  0.0629  194 ARG A CG  
1325 C CD  . ARG A 193 ? 0.4609 0.6695 0.4779 0.0902  0.0179  0.0791  194 ARG A CD  
1326 N NE  . ARG A 193 ? 0.5486 0.7407 0.5638 0.0857  0.0155  0.0859  194 ARG A NE  
1327 C CZ  . ARG A 193 ? 0.6262 0.8013 0.6582 0.0912  0.0143  0.0890  194 ARG A CZ  
1328 N NH1 . ARG A 193 ? 0.6508 0.8243 0.7055 0.1029  0.0148  0.0857  194 ARG A NH1 
1329 N NH2 . ARG A 193 ? 0.6523 0.8112 0.6800 0.0844  0.0134  0.0951  194 ARG A NH2 
1330 N N   . GLU A 194 ? 0.3958 0.5916 0.3758 0.0745  0.0392  0.0332  195 GLU A N   
1331 C CA  . GLU A 194 ? 0.4050 0.5936 0.3865 0.0692  0.0404  0.0255  195 GLU A CA  
1332 C C   . GLU A 194 ? 0.3915 0.5816 0.3699 0.0742  0.0428  0.0100  195 GLU A C   
1333 O O   . GLU A 194 ? 0.4086 0.5888 0.3929 0.0738  0.0435  0.0012  195 GLU A O   
1334 C CB  . GLU A 194 ? 0.4094 0.6062 0.3838 0.0584  0.0403  0.0279  195 GLU A CB  
1335 C CG  . GLU A 194 ? 0.4443 0.6365 0.4180 0.0505  0.0386  0.0433  195 GLU A CG  
1336 C CD  . GLU A 194 ? 0.5302 0.7017 0.5158 0.0499  0.0370  0.0505  195 GLU A CD  
1337 O OE1 . GLU A 194 ? 0.5593 0.7202 0.5535 0.0474  0.0391  0.0421  195 GLU A OE1 
1338 O OE2 . GLU A 194 ? 0.5849 0.7505 0.5727 0.0526  0.0328  0.0643  195 GLU A OE2 
1339 N N   . LEU A 195 ? 0.3812 0.5825 0.3494 0.0787  0.0438  0.0068  196 LEU A N   
1340 C CA  . LEU A 195 ? 0.3832 0.5852 0.3439 0.0842  0.0456  -0.0059 196 LEU A CA  
1341 C C   . LEU A 195 ? 0.4043 0.5961 0.3712 0.0911  0.0498  -0.0103 196 LEU A C   
1342 O O   . LEU A 195 ? 0.4278 0.6125 0.3938 0.0923  0.0511  -0.0225 196 LEU A O   
1343 C CB  . LEU A 195 ? 0.3706 0.5838 0.3184 0.0874  0.0461  -0.0054 196 LEU A CB  
1344 C CG  . LEU A 195 ? 0.3883 0.6017 0.3230 0.0932  0.0474  -0.0152 196 LEU A CG  
1345 C CD1 . LEU A 195 ? 0.3804 0.5950 0.3121 0.0903  0.0426  -0.0256 196 LEU A CD1 
1346 C CD2 . LEU A 195 ? 0.3711 0.5919 0.2939 0.0963  0.0482  -0.0110 196 LEU A CD2 
1347 N N   . ASP A 196 ? 0.3911 0.5832 0.3660 0.0955  0.0518  -0.0019 197 ASP A N   
1348 C CA  . ASP A 196 ? 0.3964 0.5818 0.3817 0.1031  0.0572  -0.0065 197 ASP A CA  
1349 C C   . ASP A 196 ? 0.4107 0.5802 0.4086 0.1027  0.0572  -0.0128 197 ASP A C   
1350 O O   . ASP A 196 ? 0.4159 0.5787 0.4140 0.1067  0.0623  -0.0262 197 ASP A O   
1351 C CB  . ASP A 196 ? 0.3931 0.5835 0.3922 0.1067  0.0569  0.0054  197 ASP A CB  
1352 C CG  . ASP A 196 ? 0.4177 0.6075 0.4299 0.1155  0.0643  -0.0002 197 ASP A CG  
1353 O OD1 . ASP A 196 ? 0.4065 0.5982 0.4076 0.1182  0.0718  -0.0112 197 ASP A OD1 
1354 O OD2 . ASP A 196 ? 0.4200 0.6084 0.4538 0.1200  0.0627  0.0068  197 ASP A OD2 
1355 N N   . LYS A 197 ? 0.4134 0.5753 0.4209 0.0973  0.0520  -0.0034 198 LYS A N   
1356 C CA  . LYS A 197 ? 0.4411 0.5845 0.4626 0.0963  0.0522  -0.0079 198 LYS A CA  
1357 C C   . LYS A 197 ? 0.4444 0.5841 0.4575 0.0926  0.0540  -0.0259 198 LYS A C   
1358 O O   . LYS A 197 ? 0.4485 0.5743 0.4706 0.0950  0.0574  -0.0375 198 LYS A O   
1359 C CB  . LYS A 197 ? 0.4501 0.5849 0.4787 0.0886  0.0467  0.0065  198 LYS A CB  
1360 C CG  . LYS A 197 ? 0.5040 0.6385 0.5426 0.0927  0.0426  0.0245  198 LYS A CG  
1361 C CD  . LYS A 197 ? 0.5544 0.6760 0.5973 0.0849  0.0372  0.0403  198 LYS A CD  
1362 C CE  . LYS A 197 ? 0.5818 0.7173 0.6093 0.0772  0.0328  0.0542  198 LYS A CE  
1363 N NZ  . LYS A 197 ? 0.6023 0.7258 0.6266 0.0655  0.0306  0.0663  198 LYS A NZ  
1364 N N   . GLN A 198 ? 0.4278 0.5803 0.4249 0.0871  0.0512  -0.0289 199 GLN A N   
1365 C CA  . GLN A 198 ? 0.4401 0.5923 0.4302 0.0828  0.0500  -0.0451 199 GLN A CA  
1366 C C   . GLN A 198 ? 0.4514 0.6045 0.4296 0.0900  0.0542  -0.0595 199 GLN A C   
1367 O O   . GLN A 198 ? 0.4536 0.5977 0.4323 0.0890  0.0555  -0.0750 199 GLN A O   
1368 C CB  . GLN A 198 ? 0.4181 0.5861 0.3977 0.0764  0.0448  -0.0441 199 GLN A CB  
1369 C CG  . GLN A 198 ? 0.4172 0.5848 0.4072 0.0662  0.0425  -0.0350 199 GLN A CG  
1370 C CD  . GLN A 198 ? 0.3984 0.5854 0.3804 0.0619  0.0391  -0.0341 199 GLN A CD  
1371 O OE1 . GLN A 198 ? 0.3927 0.5893 0.3682 0.0641  0.0395  -0.0243 199 GLN A OE1 
1372 N NE2 . GLN A 198 ? 0.3367 0.5299 0.3207 0.0565  0.0357  -0.0459 199 GLN A NE2 
1373 N N   . LEU A 199 ? 0.4474 0.6112 0.4139 0.0960  0.0569  -0.0545 200 LEU A N   
1374 C CA  . LEU A 199 ? 0.4667 0.6325 0.4179 0.1020  0.0625  -0.0655 200 LEU A CA  
1375 C C   . LEU A 199 ? 0.4919 0.6455 0.4558 0.1075  0.0710  -0.0739 200 LEU A C   
1376 O O   . LEU A 199 ? 0.5081 0.6579 0.4612 0.1094  0.0759  -0.0901 200 LEU A O   
1377 C CB  . LEU A 199 ? 0.4611 0.6391 0.4000 0.1060  0.0647  -0.0555 200 LEU A CB  
1378 C CG  . LEU A 199 ? 0.4391 0.6287 0.3643 0.1026  0.0575  -0.0493 200 LEU A CG  
1379 C CD1 . LEU A 199 ? 0.4041 0.6012 0.3188 0.1066  0.0613  -0.0404 200 LEU A CD1 
1380 C CD2 . LEU A 199 ? 0.4371 0.6288 0.3457 0.1006  0.0521  -0.0621 200 LEU A CD2 
1381 N N   . VAL A 200 ? 0.4980 0.6457 0.4847 0.1106  0.0726  -0.0634 201 VAL A N   
1382 C CA  . VAL A 200 ? 0.5160 0.6516 0.5216 0.1174  0.0803  -0.0712 201 VAL A CA  
1383 C C   . VAL A 200 ? 0.5520 0.6702 0.5642 0.1136  0.0795  -0.0857 201 VAL A C   
1384 O O   . VAL A 200 ? 0.5629 0.6744 0.5726 0.1167  0.0869  -0.1041 201 VAL A O   
1385 C CB  . VAL A 200 ? 0.5097 0.6437 0.5406 0.1223  0.0793  -0.0552 201 VAL A CB  
1386 C CG1 . VAL A 200 ? 0.5125 0.6315 0.5698 0.1304  0.0856  -0.0630 201 VAL A CG1 
1387 C CG2 . VAL A 200 ? 0.4870 0.6391 0.5124 0.1258  0.0816  -0.0455 201 VAL A CG2 
1388 N N   . GLN A 201 ? 0.5656 0.6771 0.5847 0.1056  0.0716  -0.0789 202 GLN A N   
1389 C CA  . GLN A 201 ? 0.6114 0.7068 0.6372 0.0992  0.0703  -0.0926 202 GLN A CA  
1390 C C   . GLN A 201 ? 0.6466 0.7476 0.6501 0.0964  0.0711  -0.1146 202 GLN A C   
1391 O O   . GLN A 201 ? 0.6590 0.7470 0.6659 0.0963  0.0753  -0.1336 202 GLN A O   
1392 C CB  . GLN A 201 ? 0.6011 0.6934 0.6336 0.0886  0.0623  -0.0804 202 GLN A CB  
1393 C CG  . GLN A 201 ? 0.6531 0.7284 0.6960 0.0794  0.0609  -0.0926 202 GLN A CG  
1394 C CD  . GLN A 201 ? 0.7342 0.7848 0.7970 0.0848  0.0671  -0.1029 202 GLN A CD  
1395 O OE1 . GLN A 201 ? 0.7624 0.8041 0.8416 0.0939  0.0702  -0.0921 202 GLN A OE1 
1396 N NE2 . GLN A 201 ? 0.7872 0.8274 0.8502 0.0796  0.0686  -0.1250 202 GLN A NE2 
1397 N N   . GLN A 202 ? 0.6613 0.7811 0.6419 0.0943  0.0664  -0.1118 203 GLN A N   
1398 C CA  . GLN A 202 ? 0.7048 0.8329 0.6605 0.0920  0.0640  -0.1285 203 GLN A CA  
1399 C C   . GLN A 202 ? 0.7471 0.8724 0.6891 0.0993  0.0742  -0.1428 203 GLN A C   
1400 O O   . GLN A 202 ? 0.7584 0.8805 0.6867 0.0967  0.0746  -0.1628 203 GLN A O   
1401 C CB  . GLN A 202 ? 0.6865 0.8343 0.6242 0.0911  0.0568  -0.1169 203 GLN A CB  
1402 C CG  . GLN A 202 ? 0.7119 0.8714 0.6221 0.0900  0.0509  -0.1276 203 GLN A CG  
1403 C CD  . GLN A 202 ? 0.7233 0.8995 0.6252 0.0896  0.0427  -0.1133 203 GLN A CD  
1404 O OE1 . GLN A 202 ? 0.7013 0.8840 0.6141 0.0833  0.0347  -0.1108 203 GLN A OE1 
1405 N NE2 . GLN A 202 ? 0.7395 0.9221 0.6242 0.0961  0.0461  -0.1044 203 GLN A NE2 
1406 N N   . ARG A 203 ? 0.7750 0.9026 0.7217 0.1075  0.0830  -0.1334 204 ARG A N   
1407 C CA  . ARG A 203 ? 0.8245 0.9524 0.7595 0.1140  0.0954  -0.1453 204 ARG A CA  
1408 C C   . ARG A 203 ? 0.8922 1.0036 0.8492 0.1184  0.1056  -0.1602 204 ARG A C   
1409 O O   . ARG A 203 ? 0.9138 1.0251 0.8596 0.1223  0.1170  -0.1757 204 ARG A O   
1410 C CB  . ARG A 203 ? 0.7972 0.9375 0.7291 0.1199  0.1014  -0.1300 204 ARG A CB  
1411 C CG  . ARG A 203 ? 0.7725 0.9266 0.6740 0.1169  0.0955  -0.1226 204 ARG A CG  
1412 C CD  . ARG A 203 ? 0.7090 0.8736 0.6148 0.1190  0.0949  -0.1017 204 ARG A CD  
1413 N NE  . ARG A 203 ? 0.6867 0.8606 0.5655 0.1161  0.0874  -0.0958 204 ARG A NE  
1414 C CZ  . ARG A 203 ? 0.6524 0.8349 0.5288 0.1163  0.0847  -0.0797 204 ARG A CZ  
1415 N NH1 . ARG A 203 ? 0.6594 0.8442 0.5572 0.1182  0.0881  -0.0676 204 ARG A NH1 
1416 N NH2 . ARG A 203 ? 0.6226 0.8110 0.4757 0.1148  0.0776  -0.0759 204 ARG A NH2 
1417 N N   . ARG A 204 ? 0.9484 1.0452 0.9362 0.1179  0.1022  -0.1556 205 ARG A N   
1418 C CA  . ARG A 204 ? 1.0287 1.1053 1.0374 0.1206  0.1094  -0.1730 205 ARG A CA  
1419 C C   . ARG A 204 ? 1.1056 1.1777 1.0923 0.1138  0.1095  -0.1990 205 ARG A C   
1420 O O   . ARG A 204 ? 1.1244 1.1895 1.1081 0.1174  0.1207  -0.2201 205 ARG A O   
1421 C CB  . ARG A 204 ? 1.0254 1.0843 1.0664 0.1188  0.1030  -0.1616 205 ARG A CB  
1422 C CG  . ARG A 204 ? 1.0198 1.0802 1.0849 0.1275  0.1037  -0.1402 205 ARG A CG  
1423 C CD  . ARG A 204 ? 1.0554 1.0936 1.1523 0.1274  0.0984  -0.1293 205 ARG A CD  
1424 N NE  . ARG A 204 ? 1.0594 1.1017 1.1777 0.1369  0.0974  -0.1086 205 ARG A NE  
1425 C CZ  . ARG A 204 ? 1.0548 1.1064 1.1721 0.1341  0.0879  -0.0843 205 ARG A CZ  
1426 N NH1 . ARG A 204 ? 1.0440 1.1013 1.1419 0.1223  0.0797  -0.0762 205 ARG A NH1 
1427 N NH2 . ARG A 204 ? 1.0572 1.1135 1.1945 0.1433  0.0865  -0.0687 205 ARG A NH2 
1439 N N   . ASP B 31  ? 0.8029 0.9501 1.0943 -0.2307 0.1808  0.0279  32  ASP B N   
1440 C CA  . ASP B 31  ? 0.7963 0.9232 1.0738 -0.1966 0.1899  0.0437  32  ASP B CA  
1441 C C   . ASP B 31  ? 0.7485 0.9085 1.0184 -0.1695 0.1808  0.0676  32  ASP B C   
1442 O O   . ASP B 31  ? 0.7511 0.9072 1.0301 -0.1482 0.1934  0.0902  32  ASP B O   
1443 C CB  . ASP B 31  ? 0.8016 0.9089 1.0511 -0.1916 0.1858  0.0247  32  ASP B CB  
1444 C CG  . ASP B 31  ? 0.8269 0.9104 1.0669 -0.1618 0.2001  0.0384  32  ASP B CG  
1445 O OD1 . ASP B 31  ? 0.8657 0.9256 1.1243 -0.1545 0.2219  0.0529  32  ASP B OD1 
1446 O OD2 . ASP B 31  ? 0.8622 0.9526 1.0769 -0.1457 0.1907  0.0353  32  ASP B OD2 
1447 N N   . TYR B 32  ? 0.7050 0.8967 0.9577 -0.1692 0.1608  0.0627  33  TYR B N   
1448 C CA  . TYR B 32  ? 0.6621 0.8835 0.9074 -0.1465 0.1532  0.0826  33  TYR B CA  
1449 C C   . TYR B 32  ? 0.6554 0.8926 0.9263 -0.1427 0.1612  0.1064  33  TYR B C   
1450 O O   . TYR B 32  ? 0.6699 0.9145 0.9641 -0.1650 0.1636  0.1059  33  TYR B O   
1451 C CB  . TYR B 32  ? 0.6380 0.8910 0.8674 -0.1517 0.1339  0.0751  33  TYR B CB  
1452 C CG  . TYR B 32  ? 0.5814 0.8635 0.8050 -0.1312 0.1283  0.0951  33  TYR B CG  
1453 C CD1 . TYR B 32  ? 0.5320 0.8422 0.7747 -0.1344 0.1281  0.1121  33  TYR B CD1 
1454 C CD2 . TYR B 32  ? 0.5209 0.8020 0.7197 -0.1096 0.1241  0.0960  33  TYR B CD2 
1455 C CE1 . TYR B 32  ? 0.4976 0.8319 0.7334 -0.1141 0.1249  0.1304  33  TYR B CE1 
1456 C CE2 . TYR B 32  ? 0.4941 0.7968 0.6862 -0.0917 0.1213  0.1116  33  TYR B CE2 
1457 C CZ  . TYR B 32  ? 0.4864 0.8149 0.6964 -0.0928 0.1220  0.1293  33  TYR B CZ  
1458 O OH  . TYR B 32  ? 0.4215 0.7695 0.6235 -0.0732 0.1210  0.1452  33  TYR B OH  
1459 N N   . CYS B 33  ? 0.6330 0.8775 0.9000 -0.1149 0.1659  0.1268  34  CYS B N   
1460 C CA  . CYS B 33  ? 0.6296 0.8983 0.9155 -0.1065 0.1700  0.1512  34  CYS B CA  
1461 C C   . CYS B 33  ? 0.5738 0.8665 0.8397 -0.0804 0.1621  0.1631  34  CYS B C   
1462 O O   . CYS B 33  ? 0.5612 0.8468 0.8020 -0.0659 0.1582  0.1549  34  CYS B O   
1463 C CB  . CYS B 33  ? 0.6565 0.9074 0.9672 -0.0995 0.1911  0.1685  34  CYS B CB  
1464 S SG  . CYS B 33  ? 0.7455 0.9705 1.0412 -0.0720 0.2046  0.1718  34  CYS B SG  
1465 N N   . THR B 34  ? 0.5373 0.8591 0.8145 -0.0763 0.1600  0.1810  35  THR B N   
1466 C CA  . THR B 34  ? 0.4943 0.8381 0.7531 -0.0539 0.1537  0.1911  35  THR B CA  
1467 C C   . THR B 34  ? 0.4731 0.8120 0.7256 -0.0262 0.1639  0.2029  35  THR B C   
1468 O O   . THR B 34  ? 0.4597 0.8019 0.7331 -0.0183 0.1761  0.2215  35  THR B O   
1469 C CB  . THR B 34  ? 0.4903 0.8677 0.7649 -0.0545 0.1516  0.2106  35  THR B CB  
1470 O OG1 . THR B 34  ? 0.4879 0.8789 0.7707 -0.0814 0.1424  0.2007  35  THR B OG1 
1471 C CG2 . THR B 34  ? 0.4580 0.8530 0.7110 -0.0297 0.1476  0.2201  35  THR B CG2 
1472 N N   . PRO B 35  ? 0.4548 0.7896 0.6793 -0.0115 0.1593  0.1926  36  PRO B N   
1473 C CA  . PRO B 35  ? 0.4569 0.7940 0.6740 0.0136  0.1683  0.2013  36  PRO B CA  
1474 C C   . PRO B 35  ? 0.4533 0.8173 0.6749 0.0341  0.1723  0.2233  36  PRO B C   
1475 O O   . PRO B 35  ? 0.4447 0.8241 0.6661 0.0319  0.1661  0.2289  36  PRO B O   
1476 C CB  . PRO B 35  ? 0.4485 0.7799 0.6342 0.0192  0.1601  0.1817  36  PRO B CB  
1477 C CG  . PRO B 35  ? 0.4484 0.7667 0.6278 -0.0036 0.1493  0.1632  36  PRO B CG  
1478 C CD  . PRO B 35  ? 0.4478 0.7794 0.6467 -0.0165 0.1469  0.1737  36  PRO B CD  
1479 N N   . GLY B 36  ? 0.4557 0.8285 0.6810 0.0555  0.1836  0.2371  37  GLY B N   
1480 C CA  . GLY B 36  ? 0.4467 0.8479 0.6734 0.0788  0.1883  0.2576  37  GLY B CA  
1481 C C   . GLY B 36  ? 0.4441 0.8560 0.6388 0.0923  0.1804  0.2459  37  GLY B C   
1482 O O   . GLY B 36  ? 0.4320 0.8288 0.6049 0.0836  0.1721  0.2227  37  GLY B O   
1483 N N   . ALA B 37  ? 0.4472 0.8841 0.6390 0.1136  0.1843  0.2615  38  ALA B N   
1484 C CA  . ALA B 37  ? 0.4440 0.8885 0.6068 0.1251  0.1790  0.2509  38  ALA B CA  
1485 C C   . ALA B 37  ? 0.4352 0.8761 0.5719 0.1307  0.1772  0.2289  38  ALA B C   
1486 O O   . ALA B 37  ? 0.4569 0.8836 0.5713 0.1229  0.1701  0.2078  38  ALA B O   
1487 C CB  . ALA B 37  ? 0.4532 0.9259 0.6181 0.1488  0.1856  0.2723  38  ALA B CB  
1488 N N   . PHE B 38  ? 0.4234 0.8792 0.5643 0.1438  0.1845  0.2346  39  PHE B N   
1489 C CA  . PHE B 38  ? 0.4137 0.8762 0.5316 0.1496  0.1830  0.2155  39  PHE B CA  
1490 C C   . PHE B 38  ? 0.4100 0.8437 0.5159 0.1275  0.1741  0.1907  39  PHE B C   
1491 O O   . PHE B 38  ? 0.4078 0.8381 0.4891 0.1246  0.1685  0.1692  39  PHE B O   
1492 C CB  . PHE B 38  ? 0.4203 0.9049 0.5499 0.1654  0.1934  0.2297  39  PHE B CB  
1493 C CG  . PHE B 38  ? 0.4163 0.9195 0.5231 0.1730  0.1921  0.2123  39  PHE B CG  
1494 C CD1 . PHE B 38  ? 0.3801 0.9158 0.4667 0.1900  0.1922  0.2062  39  PHE B CD1 
1495 C CD2 . PHE B 38  ? 0.4150 0.9050 0.5195 0.1621  0.1906  0.2005  39  PHE B CD2 
1496 C CE1 . PHE B 38  ? 0.3836 0.9418 0.4495 0.1939  0.1902  0.1879  39  PHE B CE1 
1497 C CE2 . PHE B 38  ? 0.4343 0.9474 0.5189 0.1682  0.1892  0.1854  39  PHE B CE2 
1498 C CZ  . PHE B 38  ? 0.4342 0.9832 0.4998 0.1831  0.1885  0.1785  39  PHE B CZ  
1499 N N   . GLU B 39  ? 0.4040 0.8164 0.5279 0.1112  0.1739  0.1933  40  GLU B N   
1500 C CA  . GLU B 39  ? 0.4046 0.7915 0.5191 0.0913  0.1661  0.1719  40  GLU B CA  
1501 C C   . GLU B 39  ? 0.3934 0.7642 0.4968 0.0770  0.1565  0.1593  40  GLU B C   
1502 O O   . GLU B 39  ? 0.3719 0.7290 0.4589 0.0670  0.1503  0.1395  40  GLU B O   
1503 C CB  . GLU B 39  ? 0.4147 0.7835 0.5511 0.0788  0.1703  0.1777  40  GLU B CB  
1504 C CG  . GLU B 39  ? 0.4650 0.8453 0.6085 0.0943  0.1822  0.1883  40  GLU B CG  
1505 C CD  . GLU B 39  ? 0.5087 0.8961 0.6288 0.0984  0.1791  0.1707  40  GLU B CD  
1506 O OE1 . GLU B 39  ? 0.5181 0.8889 0.6216 0.0827  0.1684  0.1485  40  GLU B OE1 
1507 O OE2 . GLU B 39  ? 0.5116 0.9249 0.6310 0.1178  0.1879  0.1802  40  GLU B OE2 
1508 N N   . LEU B 40  ? 0.3991 0.7743 0.5125 0.0772  0.1564  0.1729  41  LEU B N   
1509 C CA  . LEU B 40  ? 0.4005 0.7662 0.5021 0.0690  0.1500  0.1649  41  LEU B CA  
1510 C C   . LEU B 40  ? 0.4033 0.7697 0.4776 0.0804  0.1508  0.1514  41  LEU B C   
1511 O O   . LEU B 40  ? 0.3981 0.7477 0.4564 0.0714  0.1468  0.1348  41  LEU B O   
1512 C CB  . LEU B 40  ? 0.3999 0.7779 0.5172 0.0709  0.1513  0.1856  41  LEU B CB  
1513 C CG  . LEU B 40  ? 0.4046 0.7817 0.5492 0.0530  0.1495  0.1949  41  LEU B CG  
1514 C CD1 . LEU B 40  ? 0.4010 0.7996 0.5638 0.0573  0.1523  0.2185  41  LEU B CD1 
1515 C CD2 . LEU B 40  ? 0.3953 0.7562 0.5357 0.0313  0.1409  0.1779  41  LEU B CD2 
1516 N N   . GLU B 41  ? 0.4049 0.7914 0.4740 0.0999  0.1571  0.1582  42  GLU B N   
1517 C CA  . GLU B 41  ? 0.4160 0.8041 0.4583 0.1091  0.1591  0.1420  42  GLU B CA  
1518 C C   . GLU B 41  ? 0.4058 0.7859 0.4316 0.0996  0.1554  0.1164  42  GLU B C   
1519 O O   . GLU B 41  ? 0.4139 0.7799 0.4193 0.0948  0.1551  0.0972  42  GLU B O   
1520 C CB  . GLU B 41  ? 0.4268 0.8432 0.4668 0.1326  0.1666  0.1544  42  GLU B CB  
1521 C CG  . GLU B 41  ? 0.4706 0.8856 0.5111 0.1410  0.1702  0.1689  42  GLU B CG  
1522 C CD  . GLU B 41  ? 0.5719 1.0145 0.6134 0.1642  0.1776  0.1854  42  GLU B CD  
1523 O OE1 . GLU B 41  ? 0.6746 1.1388 0.7080 0.1760  0.1804  0.1795  42  GLU B OE1 
1524 O OE2 . GLU B 41  ? 0.6242 1.0715 0.6750 0.1717  0.1808  0.2055  42  GLU B OE2 
1525 N N   . ARG B 42  ? 0.3842 0.7714 0.4197 0.0963  0.1540  0.1169  43  ARG B N   
1526 C CA  . ARG B 42  ? 0.3809 0.7627 0.4032 0.0862  0.1501  0.0955  43  ARG B CA  
1527 C C   . ARG B 42  ? 0.3752 0.7261 0.3915 0.0672  0.1440  0.0816  43  ARG B C   
1528 O O   . ARG B 42  ? 0.3650 0.7077 0.3635 0.0596  0.1420  0.0606  43  ARG B O   
1529 C CB  . ARG B 42  ? 0.3786 0.7701 0.4148 0.0869  0.1514  0.1030  43  ARG B CB  
1530 C CG  . ARG B 42  ? 0.4195 0.8041 0.4446 0.0750  0.1469  0.0837  43  ARG B CG  
1531 C CD  . ARG B 42  ? 0.4643 0.8554 0.5035 0.0782  0.1510  0.0943  43  ARG B CD  
1532 N NE  . ARG B 42  ? 0.5484 0.9775 0.5883 0.0992  0.1587  0.1055  43  ARG B NE  
1533 C CZ  . ARG B 42  ? 0.6245 1.0667 0.6817 0.1121  0.1682  0.1263  43  ARG B CZ  
1534 N NH1 . ARG B 42  ? 0.6656 1.0810 0.7406 0.1041  0.1718  0.1356  43  ARG B NH1 
1535 N NH2 . ARG B 42  ? 0.6403 1.1236 0.6967 0.1340  0.1758  0.1379  43  ARG B NH2 
1536 N N   . LEU B 43  ? 0.3619 0.6990 0.3940 0.0589  0.1416  0.0934  44  LEU B N   
1537 C CA  . LEU B 43  ? 0.3633 0.6773 0.3916 0.0430  0.1362  0.0840  44  LEU B CA  
1538 C C   . LEU B 43  ? 0.3619 0.6654 0.3726 0.0457  0.1392  0.0762  44  LEU B C   
1539 O O   . LEU B 43  ? 0.3499 0.6362 0.3491 0.0359  0.1377  0.0612  44  LEU B O   
1540 C CB  . LEU B 43  ? 0.3699 0.6814 0.4190 0.0351  0.1336  0.0993  44  LEU B CB  
1541 C CG  . LEU B 43  ? 0.4045 0.7073 0.4674 0.0197  0.1291  0.0971  44  LEU B CG  
1542 C CD1 . LEU B 43  ? 0.4104 0.7120 0.4715 0.0202  0.1304  0.0893  44  LEU B CD1 
1543 C CD2 . LEU B 43  ? 0.4257 0.7369 0.5132 0.0171  0.1307  0.1160  44  LEU B CD2 
1544 N N   . PHE B 44  ? 0.3626 0.6751 0.3715 0.0601  0.1454  0.0873  45  PHE B N   
1545 C CA  . PHE B 44  ? 0.3798 0.6780 0.3709 0.0648  0.1519  0.0805  45  PHE B CA  
1546 C C   . PHE B 44  ? 0.4009 0.6919 0.3705 0.0629  0.1551  0.0555  45  PHE B C   
1547 O O   . PHE B 44  ? 0.4115 0.6801 0.3673 0.0583  0.1602  0.0431  45  PHE B O   
1548 C CB  . PHE B 44  ? 0.3844 0.6944 0.3770 0.0827  0.1592  0.0986  45  PHE B CB  
1549 C CG  . PHE B 44  ? 0.3526 0.6686 0.3639 0.0822  0.1574  0.1218  45  PHE B CG  
1550 C CD1 . PHE B 44  ? 0.3352 0.6379 0.3444 0.0764  0.1583  0.1242  45  PHE B CD1 
1551 C CD2 . PHE B 44  ? 0.3190 0.6571 0.3512 0.0864  0.1553  0.1415  45  PHE B CD2 
1552 C CE1 . PHE B 44  ? 0.3413 0.6581 0.3675 0.0751  0.1560  0.1449  45  PHE B CE1 
1553 C CE2 . PHE B 44  ? 0.3019 0.6499 0.3527 0.0824  0.1532  0.1612  45  PHE B CE2 
1554 C CZ  . PHE B 44  ? 0.2982 0.6384 0.3454 0.0768  0.1528  0.1623  45  PHE B CZ  
1555 N N   . TRP B 45  ? 0.4121 0.7242 0.3803 0.0661  0.1531  0.0488  46  TRP B N   
1556 C CA  . TRP B 45  ? 0.4357 0.7530 0.3844 0.0644  0.1557  0.0248  46  TRP B CA  
1557 C C   . TRP B 45  ? 0.4490 0.7610 0.3948 0.0479  0.1497  0.0077  46  TRP B C   
1558 O O   . TRP B 45  ? 0.4823 0.7794 0.4133 0.0378  0.1523  -0.0132 46  TRP B O   
1559 C CB  . TRP B 45  ? 0.4381 0.7924 0.3867 0.0795  0.1571  0.0292  46  TRP B CB  
1560 C CG  . TRP B 45  ? 0.4367 0.7982 0.3776 0.0964  0.1653  0.0356  46  TRP B CG  
1561 C CD1 . TRP B 45  ? 0.4368 0.8136 0.3911 0.1128  0.1677  0.0612  46  TRP B CD1 
1562 C CD2 . TRP B 45  ? 0.4371 0.7909 0.3549 0.0985  0.1732  0.0152  46  TRP B CD2 
1563 N NE1 . TRP B 45  ? 0.4163 0.7970 0.3561 0.1269  0.1761  0.0592  46  TRP B NE1 
1564 C CE2 . TRP B 45  ? 0.4451 0.8103 0.3615 0.1183  0.1801  0.0299  46  TRP B CE2 
1565 C CE3 . TRP B 45  ? 0.4343 0.7725 0.3326 0.0848  0.1763  -0.0150 46  TRP B CE3 
1566 C CZ2 . TRP B 45  ? 0.4591 0.8180 0.3535 0.1257  0.1904  0.0146  46  TRP B CZ2 
1567 C CZ3 . TRP B 45  ? 0.4881 0.8185 0.3659 0.0898  0.1870  -0.0317 46  TRP B CZ3 
1568 C CH2 . TRP B 45  ? 0.4854 0.8250 0.3603 0.1107  0.1942  -0.0172 46  TRP B CH2 
1569 N N   . LYS B 46  ? 0.4397 0.7624 0.4002 0.0450  0.1430  0.0171  47  LYS B N   
1570 C CA  . LYS B 46  ? 0.4394 0.7639 0.3974 0.0328  0.1378  0.0036  47  LYS B CA  
1571 C C   . LYS B 46  ? 0.4367 0.7395 0.4051 0.0204  0.1322  0.0078  47  LYS B C   
1572 O O   . LYS B 46  ? 0.4393 0.7404 0.4046 0.0105  0.1283  -0.0030 47  LYS B O   
1573 C CB  . LYS B 46  ? 0.4350 0.7939 0.3991 0.0425  0.1371  0.0104  47  LYS B CB  
1574 C CG  . LYS B 46  ? 0.4403 0.8328 0.3936 0.0563  0.1420  0.0060  47  LYS B CG  
1575 C CD  . LYS B 46  ? 0.4737 0.8663 0.4052 0.0460  0.1430  -0.0228 47  LYS B CD  
1576 C CE  . LYS B 46  ? 0.4844 0.8897 0.4116 0.0337  0.1382  -0.0376 47  LYS B CE  
1577 N NZ  . LYS B 46  ? 0.5458 0.9545 0.4538 0.0208  0.1399  -0.0671 47  LYS B NZ  
1578 N N   . GLY B 47  ? 0.4423 0.7316 0.4222 0.0207  0.1318  0.0227  48  GLY B N   
1579 C CA  . GLY B 47  ? 0.4562 0.7317 0.4467 0.0090  0.1260  0.0264  48  GLY B CA  
1580 C C   . GLY B 47  ? 0.4777 0.7327 0.4589 -0.0036 0.1240  0.0132  48  GLY B C   
1581 O O   . GLY B 47  ? 0.4690 0.7172 0.4563 -0.0132 0.1187  0.0127  48  GLY B O   
1582 N N   . SER B 48  ? 0.5139 0.7588 0.4808 -0.0033 0.1298  0.0025  49  SER B N   
1583 C CA  . SER B 48  ? 0.5442 0.7669 0.5049 -0.0122 0.1319  -0.0047 49  SER B CA  
1584 C C   . SER B 48  ? 0.5753 0.7901 0.5200 -0.0172 0.1378  -0.0255 49  SER B C   
1585 O O   . SER B 48  ? 0.6136 0.8313 0.5489 -0.0106 0.1447  -0.0318 49  SER B O   
1586 C CB  . SER B 48  ? 0.5488 0.7611 0.5117 -0.0050 0.1383  0.0096  49  SER B CB  
1587 O OG  . SER B 48  ? 0.5547 0.7768 0.5335 -0.0056 0.1319  0.0266  49  SER B OG  
1588 N N   . PRO B 49  ? 0.5844 0.7917 0.5258 -0.0295 0.1353  -0.0377 50  PRO B N   
1589 C CA  . PRO B 49  ? 0.5732 0.7817 0.5230 -0.0369 0.1267  -0.0340 50  PRO B CA  
1590 C C   . PRO B 49  ? 0.5639 0.7938 0.5203 -0.0350 0.1191  -0.0310 50  PRO B C   
1591 O O   . PRO B 49  ? 0.5570 0.8055 0.5088 -0.0313 0.1197  -0.0373 50  PRO B O   
1592 C CB  . PRO B 49  ? 0.5858 0.7833 0.5273 -0.0489 0.1286  -0.0502 50  PRO B CB  
1593 C CG  . PRO B 49  ? 0.6140 0.8023 0.5435 -0.0500 0.1392  -0.0642 50  PRO B CG  
1594 C CD  . PRO B 49  ? 0.6085 0.8073 0.5364 -0.0377 0.1421  -0.0587 50  PRO B CD  
1595 N N   . GLN B 50  ? 0.5608 0.7895 0.5279 -0.0372 0.1134  -0.0216 51  GLN B N   
1596 C CA  . GLN B 50  ? 0.5647 0.8070 0.5394 -0.0347 0.1095  -0.0169 51  GLN B CA  
1597 C C   . GLN B 50  ? 0.5526 0.7998 0.5210 -0.0407 0.1067  -0.0281 51  GLN B C   
1598 O O   . GLN B 50  ? 0.5561 0.7929 0.5191 -0.0498 0.1050  -0.0367 51  GLN B O   
1599 C CB  . GLN B 50  ? 0.5802 0.8166 0.5687 -0.0370 0.1061  -0.0050 51  GLN B CB  
1600 C CG  . GLN B 50  ? 0.6097 0.8344 0.5973 -0.0472 0.1019  -0.0091 51  GLN B CG  
1601 C CD  . GLN B 50  ? 0.6803 0.9046 0.6785 -0.0493 0.0999  0.0020  51  GLN B CD  
1602 O OE1 . GLN B 50  ? 0.7022 0.9328 0.7127 -0.0478 0.0995  0.0113  51  GLN B OE1 
1603 N NE2 . GLN B 50  ? 0.7146 0.9346 0.7094 -0.0530 0.0995  0.0018  51  GLN B NE2 
1604 N N   . TYR B 51  ? 0.5361 0.8020 0.5057 -0.0339 0.1076  -0.0259 52  TYR B N   
1605 C CA  . TYR B 51  ? 0.5163 0.7935 0.4803 -0.0366 0.1061  -0.0333 52  TYR B CA  
1606 C C   . TYR B 51  ? 0.5100 0.7828 0.4833 -0.0334 0.1060  -0.0235 52  TYR B C   
1607 O O   . TYR B 51  ? 0.5196 0.8034 0.5001 -0.0224 0.1110  -0.0124 52  TYR B O   
1608 C CB  . TYR B 51  ? 0.5089 0.8171 0.4658 -0.0297 0.1091  -0.0379 52  TYR B CB  
1609 C CG  . TYR B 51  ? 0.4944 0.8200 0.4457 -0.0322 0.1077  -0.0439 52  TYR B CG  
1610 C CD1 . TYR B 51  ? 0.5041 0.8414 0.4610 -0.0221 0.1103  -0.0321 52  TYR B CD1 
1611 C CD2 . TYR B 51  ? 0.5057 0.8338 0.4474 -0.0447 0.1052  -0.0599 52  TYR B CD2 
1612 C CE1 . TYR B 51  ? 0.5108 0.8659 0.4622 -0.0222 0.1100  -0.0350 52  TYR B CE1 
1613 C CE2 . TYR B 51  ? 0.5144 0.8620 0.4519 -0.0472 0.1036  -0.0638 52  TYR B CE2 
1614 C CZ  . TYR B 51  ? 0.5172 0.8794 0.4591 -0.0348 0.1058  -0.0505 52  TYR B CZ  
1615 O OH  . TYR B 51  ? 0.5209 0.9048 0.4585 -0.0340 0.1056  -0.0511 52  TYR B OH  
1616 N N   . THR B 52  ? 0.4858 0.7417 0.4589 -0.0425 0.1021  -0.0276 53  THR B N   
1617 C CA  . THR B 52  ? 0.4699 0.7150 0.4509 -0.0420 0.1031  -0.0215 53  THR B CA  
1618 C C   . THR B 52  ? 0.4526 0.6920 0.4263 -0.0483 0.1000  -0.0297 53  THR B C   
1619 O O   . THR B 52  ? 0.4379 0.6830 0.4024 -0.0533 0.0968  -0.0385 53  THR B O   
1620 C CB  . THR B 52  ? 0.4757 0.7044 0.4679 -0.0475 0.1014  -0.0161 53  THR B CB  
1621 O OG1 . THR B 52  ? 0.4991 0.7207 0.4871 -0.0569 0.0956  -0.0224 53  THR B OG1 
1622 C CG2 . THR B 52  ? 0.4761 0.7114 0.4778 -0.0398 0.1055  -0.0046 53  THR B CG2 
1623 N N   . HIS B 53  ? 0.4380 0.6655 0.4162 -0.0479 0.1023  -0.0269 54  HIS B N   
1624 C CA  . HIS B 53  ? 0.4314 0.6526 0.4022 -0.0523 0.1000  -0.0340 54  HIS B CA  
1625 C C   . HIS B 53  ? 0.4175 0.6309 0.3848 -0.0639 0.0920  -0.0423 54  HIS B C   
1626 O O   . HIS B 53  ? 0.4092 0.6274 0.3679 -0.0667 0.0892  -0.0484 54  HIS B O   
1627 C CB  . HIS B 53  ? 0.4426 0.6491 0.4181 -0.0489 0.1066  -0.0304 54  HIS B CB  
1628 C CG  . HIS B 53  ? 0.4568 0.6738 0.4339 -0.0340 0.1172  -0.0198 54  HIS B CG  
1629 N ND1 . HIS B 53  ? 0.4764 0.7122 0.4438 -0.0255 0.1198  -0.0187 54  HIS B ND1 
1630 C CD2 . HIS B 53  ? 0.4394 0.6552 0.4275 -0.0246 0.1268  -0.0076 54  HIS B CD2 
1631 C CE1 . HIS B 53  ? 0.4755 0.7233 0.4471 -0.0102 0.1309  -0.0056 54  HIS B CE1 
1632 N NE2 . HIS B 53  ? 0.4706 0.7051 0.4550 -0.0089 0.1358  0.0016  54  HIS B NE2 
1633 N N   . VAL B 54  ? 0.4077 0.6133 0.3827 -0.0696 0.0894  -0.0405 55  VAL B N   
1634 C CA  . VAL B 54  ? 0.3905 0.5940 0.3639 -0.0780 0.0834  -0.0447 55  VAL B CA  
1635 C C   . VAL B 54  ? 0.3928 0.5989 0.3730 -0.0786 0.0829  -0.0383 55  VAL B C   
1636 O O   . VAL B 54  ? 0.3989 0.6056 0.3869 -0.0749 0.0859  -0.0316 55  VAL B O   
1637 C CB  . VAL B 54  ? 0.4118 0.6078 0.3871 -0.0846 0.0807  -0.0496 55  VAL B CB  
1638 C CG1 . VAL B 54  ? 0.3825 0.5709 0.3702 -0.0874 0.0839  -0.0462 55  VAL B CG1 
1639 C CG2 . VAL B 54  ? 0.3600 0.5624 0.3325 -0.0912 0.0744  -0.0530 55  VAL B CG2 
1640 N N   . ASN B 55  ? 0.3938 0.6023 0.3711 -0.0813 0.0809  -0.0384 56  ASN B N   
1641 C CA  . ASN B 55  ? 0.3845 0.5966 0.3676 -0.0803 0.0818  -0.0300 56  ASN B CA  
1642 C C   . ASN B 55  ? 0.3910 0.6088 0.3729 -0.0836 0.0794  -0.0288 56  ASN B C   
1643 O O   . ASN B 55  ? 0.3856 0.6018 0.3602 -0.0849 0.0791  -0.0339 56  ASN B O   
1644 C CB  . ASN B 55  ? 0.3851 0.5945 0.3637 -0.0742 0.0878  -0.0281 56  ASN B CB  
1645 C CG  . ASN B 55  ? 0.3908 0.6022 0.3684 -0.0691 0.0906  -0.0297 56  ASN B CG  
1646 O OD1 . ASN B 55  ? 0.3633 0.5769 0.3330 -0.0688 0.0919  -0.0374 56  ASN B OD1 
1647 N ND2 . ASN B 55  ? 0.3487 0.5636 0.3348 -0.0645 0.0919  -0.0214 56  ASN B ND2 
1648 N N   . GLU B 56  ? 0.3900 0.6183 0.3793 -0.0838 0.0786  -0.0200 57  GLU B N   
1649 C CA  . GLU B 56  ? 0.3998 0.6407 0.3887 -0.0830 0.0786  -0.0140 57  GLU B CA  
1650 C C   . GLU B 56  ? 0.3982 0.6303 0.3829 -0.0744 0.0881  -0.0067 57  GLU B C   
1651 O O   . GLU B 56  ? 0.4023 0.6303 0.3892 -0.0692 0.0929  -0.0006 57  GLU B O   
1652 C CB  . GLU B 56  ? 0.4029 0.6654 0.4022 -0.0859 0.0748  -0.0059 57  GLU B CB  
1653 C CG  . GLU B 56  ? 0.4282 0.7151 0.4278 -0.0864 0.0723  -0.0010 57  GLU B CG  
1654 C CD  . GLU B 56  ? 0.4387 0.7552 0.4493 -0.0900 0.0686  0.0077  57  GLU B CD  
1655 O OE1 . GLU B 56  ? 0.4482 0.7615 0.4665 -0.0911 0.0692  0.0113  57  GLU B OE1 
1656 O OE2 . GLU B 56  ? 0.4250 0.7717 0.4373 -0.0914 0.0652  0.0114  57  GLU B OE2 
1657 N N   . VAL B 57  ? 0.3957 0.6236 0.3747 -0.0728 0.0924  -0.0072 58  VAL B N   
1658 C CA  . VAL B 57  ? 0.4044 0.6172 0.3796 -0.0663 0.1048  -0.0024 58  VAL B CA  
1659 C C   . VAL B 57  ? 0.4296 0.6517 0.4076 -0.0581 0.1126  0.0132  58  VAL B C   
1660 O O   . VAL B 57  ? 0.4498 0.6564 0.4255 -0.0508 0.1265  0.0200  58  VAL B O   
1661 C CB  . VAL B 57  ? 0.4105 0.6067 0.3783 -0.0710 0.1082  -0.0149 58  VAL B CB  
1662 C CG1 . VAL B 57  ? 0.3648 0.5589 0.3300 -0.0758 0.1020  -0.0267 58  VAL B CG1 
1663 C CG2 . VAL B 57  ? 0.3791 0.5827 0.3460 -0.0737 0.1056  -0.0157 58  VAL B CG2 
1664 N N   . TRP B 58  ? 0.4343 0.6832 0.4171 -0.0588 0.1052  0.0191  59  TRP B N   
1665 C CA  . TRP B 58  ? 0.4454 0.7148 0.4313 -0.0497 0.1115  0.0358  59  TRP B CA  
1666 C C   . TRP B 58  ? 0.4407 0.7459 0.4317 -0.0557 0.0980  0.0351  59  TRP B C   
1667 O O   . TRP B 58  ? 0.4307 0.7342 0.4205 -0.0668 0.0871  0.0196  59  TRP B O   
1668 C CB  . TRP B 58  ? 0.4583 0.7174 0.4402 -0.0465 0.1200  0.0366  59  TRP B CB  
1669 C CG  . TRP B 58  ? 0.4892 0.7694 0.4748 -0.0336 0.1301  0.0571  59  TRP B CG  
1670 C CD1 . TRP B 58  ? 0.5018 0.8139 0.4891 -0.0315 0.1251  0.0623  59  TRP B CD1 
1671 C CD2 . TRP B 58  ? 0.5412 0.8138 0.5288 -0.0189 0.1488  0.0763  59  TRP B CD2 
1672 N NE1 . TRP B 58  ? 0.5223 0.8513 0.5135 -0.0158 0.1391  0.0851  59  TRP B NE1 
1673 C CE2 . TRP B 58  ? 0.5505 0.8535 0.5421 -0.0073 0.1549  0.0949  59  TRP B CE2 
1674 C CE3 . TRP B 58  ? 0.5821 0.8262 0.5678 -0.0131 0.1622  0.0801  59  TRP B CE3 
1675 C CZ2 . TRP B 58  ? 0.5929 0.8975 0.5875 0.0113  0.1755  0.1196  59  TRP B CZ2 
1676 C CZ3 . TRP B 58  ? 0.6172 0.8583 0.6048 0.0042  0.1828  0.1025  59  TRP B CZ3 
1677 C CH2 . TRP B 58  ? 0.5986 0.8695 0.5911 0.0168  0.1899  0.1231  59  TRP B CH2 
1678 N N   . PRO B 59  ? 0.4435 0.7829 0.4403 -0.0487 0.0995  0.0514  60  PRO B N   
1679 C CA  . PRO B 59  ? 0.4346 0.8092 0.4368 -0.0590 0.0856  0.0460  60  PRO B CA  
1680 C C   . PRO B 59  ? 0.4269 0.8086 0.4244 -0.0684 0.0761  0.0301  60  PRO B C   
1681 O O   . PRO B 59  ? 0.4144 0.8045 0.4077 -0.0617 0.0797  0.0344  60  PRO B O   
1682 C CB  . PRO B 59  ? 0.4407 0.8591 0.4491 -0.0483 0.0901  0.0680  60  PRO B CB  
1683 C CG  . PRO B 59  ? 0.4511 0.8472 0.4590 -0.0334 0.1060  0.0845  60  PRO B CG  
1684 C CD  . PRO B 59  ? 0.4624 0.8114 0.4617 -0.0326 0.1138  0.0744  60  PRO B CD  
1685 N N   . LYS B 60  ? 0.4241 0.8002 0.4225 -0.0827 0.0657  0.0127  61  LYS B N   
1686 C CA  . LYS B 60  ? 0.4317 0.8096 0.4243 -0.0923 0.0573  -0.0050 61  LYS B CA  
1687 C C   . LYS B 60  ? 0.4129 0.7583 0.3961 -0.0895 0.0606  -0.0128 61  LYS B C   
1688 O O   . LYS B 60  ? 0.4325 0.7799 0.4095 -0.0942 0.0553  -0.0250 61  LYS B O   
1689 C CB  . LYS B 60  ? 0.4417 0.8654 0.4339 -0.0918 0.0527  -0.0023 61  LYS B CB  
1690 C CG  . LYS B 60  ? 0.4935 0.9639 0.4955 -0.0942 0.0493  0.0076  61  LYS B CG  
1691 C CD  . LYS B 60  ? 0.5518 1.0219 0.5618 -0.1115 0.0419  -0.0050 61  LYS B CD  
1692 C CE  . LYS B 60  ? 0.6070 1.0823 0.6135 -0.1290 0.0324  -0.0301 61  LYS B CE  
1693 N NZ  . LYS B 60  ? 0.6336 1.1676 0.6410 -0.1362 0.0247  -0.0344 61  LYS B NZ  
1694 N N   . LEU B 61  ? 0.3915 0.7096 0.3734 -0.0826 0.0693  -0.0068 62  LEU B N   
1695 C CA  . LEU B 61  ? 0.3804 0.6725 0.3549 -0.0811 0.0732  -0.0131 62  LEU B CA  
1696 C C   . LEU B 61  ? 0.3744 0.6395 0.3482 -0.0845 0.0741  -0.0207 62  LEU B C   
1697 O O   . LEU B 61  ? 0.3674 0.6227 0.3442 -0.0807 0.0800  -0.0142 62  LEU B O   
1698 C CB  . LEU B 61  ? 0.3826 0.6701 0.3568 -0.0710 0.0851  0.0000  62  LEU B CB  
1699 C CG  . LEU B 61  ? 0.3766 0.6500 0.3454 -0.0702 0.0898  -0.0038 62  LEU B CG  
1700 C CD1 . LEU B 61  ? 0.3548 0.6171 0.3260 -0.0616 0.1054  0.0097  62  LEU B CD1 
1701 C CD2 . LEU B 61  ? 0.3855 0.6359 0.3496 -0.0774 0.0870  -0.0181 62  LEU B CD2 
1702 N N   . TYR B 62  ? 0.3704 0.6263 0.3398 -0.0901 0.0690  -0.0335 63  TYR B N   
1703 C CA  . TYR B 62  ? 0.3706 0.6082 0.3394 -0.0915 0.0700  -0.0394 63  TYR B CA  
1704 C C   . TYR B 62  ? 0.3729 0.5992 0.3339 -0.0902 0.0728  -0.0452 63  TYR B C   
1705 O O   . TYR B 62  ? 0.3652 0.5958 0.3210 -0.0906 0.0713  -0.0483 63  TYR B O   
1706 C CB  . TYR B 62  ? 0.3761 0.6128 0.3473 -0.0976 0.0650  -0.0474 63  TYR B CB  
1707 C CG  . TYR B 62  ? 0.3918 0.6405 0.3729 -0.1024 0.0623  -0.0437 63  TYR B CG  
1708 C CD1 . TYR B 62  ? 0.4002 0.6732 0.3837 -0.1055 0.0581  -0.0415 63  TYR B CD1 
1709 C CD2 . TYR B 62  ? 0.4207 0.6611 0.4098 -0.1037 0.0643  -0.0416 63  TYR B CD2 
1710 C CE1 . TYR B 62  ? 0.4189 0.7100 0.4125 -0.1119 0.0550  -0.0385 63  TYR B CE1 
1711 C CE2 . TYR B 62  ? 0.4273 0.6814 0.4275 -0.1098 0.0620  -0.0377 63  TYR B CE2 
1712 C CZ  . TYR B 62  ? 0.4372 0.7174 0.4394 -0.1148 0.0569  -0.0369 63  TYR B CZ  
1713 O OH  . TYR B 62  ? 0.4715 0.7723 0.4852 -0.1224 0.0540  -0.0335 63  TYR B OH  
1714 N N   . ILE B 63  ? 0.3643 0.5804 0.3247 -0.0886 0.0769  -0.0461 64  ILE B N   
1715 C CA  . ILE B 63  ? 0.3622 0.5744 0.3163 -0.0889 0.0789  -0.0524 64  ILE B CA  
1716 C C   . ILE B 63  ? 0.3810 0.5921 0.3351 -0.0871 0.0780  -0.0554 64  ILE B C   
1717 O O   . ILE B 63  ? 0.3750 0.5843 0.3344 -0.0848 0.0794  -0.0516 64  ILE B O   
1718 C CB  . ILE B 63  ? 0.3562 0.5626 0.3090 -0.0892 0.0860  -0.0525 64  ILE B CB  
1719 C CG1 . ILE B 63  ? 0.3349 0.5383 0.2892 -0.0889 0.0912  -0.0467 64  ILE B CG1 
1720 C CG2 . ILE B 63  ? 0.3325 0.5424 0.2795 -0.0923 0.0871  -0.0609 64  ILE B CG2 
1721 C CD1 . ILE B 63  ? 0.2933 0.4851 0.2458 -0.0915 0.1011  -0.0497 64  ILE B CD1 
1722 N N   . GLY B 64  ? 0.3969 0.6105 0.3456 -0.0862 0.0770  -0.0600 65  GLY B N   
1723 C CA  . GLY B 64  ? 0.3995 0.6130 0.3484 -0.0813 0.0791  -0.0597 65  GLY B CA  
1724 C C   . GLY B 64  ? 0.3968 0.6191 0.3381 -0.0779 0.0808  -0.0623 65  GLY B C   
1725 O O   . GLY B 64  ? 0.3971 0.6257 0.3336 -0.0811 0.0795  -0.0653 65  GLY B O   
1726 N N   . ASP B 65  ? 0.4056 0.6298 0.3469 -0.0706 0.0849  -0.0591 66  ASP B N   
1727 C CA  . ASP B 65  ? 0.4182 0.6573 0.3528 -0.0645 0.0880  -0.0583 66  ASP B CA  
1728 C C   . ASP B 65  ? 0.4353 0.6646 0.3654 -0.0603 0.0899  -0.0583 66  ASP B C   
1729 O O   . ASP B 65  ? 0.4447 0.6584 0.3760 -0.0652 0.0873  -0.0623 66  ASP B O   
1730 C CB  . ASP B 65  ? 0.4124 0.6666 0.3493 -0.0559 0.0935  -0.0522 66  ASP B CB  
1731 C CG  . ASP B 65  ? 0.4464 0.6874 0.3905 -0.0482 0.0997  -0.0446 66  ASP B CG  
1732 O OD1 . ASP B 65  ? 0.4915 0.7106 0.4381 -0.0509 0.1002  -0.0461 66  ASP B OD1 
1733 O OD2 . ASP B 65  ? 0.5199 0.7739 0.4679 -0.0399 0.1048  -0.0374 66  ASP B OD2 
1734 N N   . GLU B 66  ? 0.4607 0.7019 0.3851 -0.0508 0.0953  -0.0541 67  GLU B N   
1735 C CA  . GLU B 66  ? 0.4914 0.7238 0.4086 -0.0453 0.0988  -0.0543 67  GLU B CA  
1736 C C   . GLU B 66  ? 0.5108 0.7182 0.4314 -0.0403 0.1070  -0.0526 67  GLU B C   
1737 O O   . GLU B 66  ? 0.5401 0.7281 0.4574 -0.0438 0.1072  -0.0595 67  GLU B O   
1738 C CB  . GLU B 66  ? 0.4998 0.7568 0.4094 -0.0350 0.1034  -0.0479 67  GLU B CB  
1739 C CG  . GLU B 66  ? 0.5587 0.8080 0.4589 -0.0295 0.1062  -0.0485 67  GLU B CG  
1740 C CD  . GLU B 66  ? 0.5959 0.8758 0.4888 -0.0229 0.1072  -0.0428 67  GLU B CD  
1741 O OE1 . GLU B 66  ? 0.6597 0.9647 0.5533 -0.0140 0.1127  -0.0338 67  GLU B OE1 
1742 O OE2 . GLU B 66  ? 0.6090 0.8920 0.4961 -0.0266 0.1025  -0.0466 67  GLU B OE2 
1743 N N   . ALA B 67  ? 0.5127 0.7212 0.4405 -0.0329 0.1146  -0.0440 68  ALA B N   
1744 C CA  . ALA B 67  ? 0.5310 0.7127 0.4658 -0.0302 0.1243  -0.0417 68  ALA B CA  
1745 C C   . ALA B 67  ? 0.5309 0.6916 0.4709 -0.0461 0.1173  -0.0534 68  ALA B C   
1746 O O   . ALA B 67  ? 0.5604 0.6975 0.4999 -0.0492 0.1227  -0.0599 68  ALA B O   
1747 C CB  . ALA B 67  ? 0.5168 0.7068 0.4618 -0.0213 0.1319  -0.0293 68  ALA B CB  
1748 N N   . THR B 68  ? 0.5040 0.6751 0.4479 -0.0560 0.1062  -0.0566 69  THR B N   
1749 C CA  . THR B 68  ? 0.5053 0.6663 0.4542 -0.0697 0.0993  -0.0653 69  THR B CA  
1750 C C   . THR B 68  ? 0.5178 0.6756 0.4568 -0.0752 0.0946  -0.0765 69  THR B C   
1751 O O   . THR B 68  ? 0.5386 0.6852 0.4797 -0.0843 0.0937  -0.0857 69  THR B O   
1752 C CB  . THR B 68  ? 0.4853 0.6613 0.4390 -0.0757 0.0903  -0.0634 69  THR B CB  
1753 O OG1 . THR B 68  ? 0.4766 0.6592 0.4368 -0.0695 0.0942  -0.0542 69  THR B OG1 
1754 C CG2 . THR B 68  ? 0.4648 0.6382 0.4250 -0.0873 0.0844  -0.0685 69  THR B CG2 
1755 N N   . ALA B 69  ? 0.5091 0.6796 0.4378 -0.0702 0.0918  -0.0760 70  ALA B N   
1756 C CA  . ALA B 69  ? 0.5183 0.6900 0.4371 -0.0730 0.0875  -0.0847 70  ALA B CA  
1757 C C   . ALA B 69  ? 0.5460 0.6985 0.4570 -0.0680 0.0965  -0.0904 70  ALA B C   
1758 O O   . ALA B 69  ? 0.5516 0.6992 0.4557 -0.0728 0.0942  -0.1014 70  ALA B O   
1759 C CB  . ALA B 69  ? 0.4921 0.6842 0.4039 -0.0688 0.0833  -0.0805 70  ALA B CB  
1760 N N   . LEU B 70  ? 0.5708 0.7135 0.4822 -0.0571 0.1083  -0.0824 71  LEU B N   
1761 C CA  . LEU B 70  ? 0.6040 0.7260 0.5070 -0.0482 0.1212  -0.0845 71  LEU B CA  
1762 C C   . LEU B 70  ? 0.6340 0.7248 0.5450 -0.0555 0.1305  -0.0920 71  LEU B C   
1763 O O   . LEU B 70  ? 0.6671 0.7325 0.5717 -0.0533 0.1419  -0.0995 71  LEU B O   
1764 C CB  . LEU B 70  ? 0.5973 0.7291 0.4977 -0.0300 0.1318  -0.0684 71  LEU B CB  
1765 C CG  . LEU B 70  ? 0.6105 0.7653 0.4985 -0.0188 0.1310  -0.0621 71  LEU B CG  
1766 C CD1 . LEU B 70  ? 0.6073 0.7782 0.4890 -0.0278 0.1167  -0.0703 71  LEU B CD1 
1767 C CD2 . LEU B 70  ? 0.5592 0.7431 0.4505 -0.0079 0.1341  -0.0465 71  LEU B CD2 
1768 N N   . ASP B 71  ? 0.6340 0.7260 0.5595 -0.0648 0.1266  -0.0905 72  ASP B N   
1769 C CA  . ASP B 71  ? 0.6731 0.7382 0.6093 -0.0737 0.1359  -0.0966 72  ASP B CA  
1770 C C   . ASP B 71  ? 0.6760 0.7409 0.6119 -0.0933 0.1259  -0.1158 72  ASP B C   
1771 O O   . ASP B 71  ? 0.6536 0.7320 0.6003 -0.1059 0.1162  -0.1177 72  ASP B O   
1772 C CB  . ASP B 71  ? 0.6679 0.7373 0.6208 -0.0727 0.1381  -0.0835 72  ASP B CB  
1773 C CG  . ASP B 71  ? 0.7508 0.7890 0.7151 -0.0727 0.1559  -0.0815 72  ASP B CG  
1774 O OD1 . ASP B 71  ? 0.8182 0.8331 0.7834 -0.0868 0.1599  -0.0979 72  ASP B OD1 
1775 O OD2 . ASP B 71  ? 0.8172 0.8553 0.7898 -0.0588 0.1671  -0.0640 72  ASP B OD2 
1776 N N   . ARG B 72  ? 0.7052 0.7584 0.6279 -0.0947 0.1288  -0.1297 73  ARG B N   
1777 C CA  . ARG B 72  ? 0.7163 0.7824 0.6342 -0.1104 0.1168  -0.1479 73  ARG B CA  
1778 C C   . ARG B 72  ? 0.7451 0.7991 0.6745 -0.1308 0.1187  -0.1629 73  ARG B C   
1779 O O   . ARG B 72  ? 0.7403 0.8194 0.6723 -0.1454 0.1056  -0.1729 73  ARG B O   
1780 C CB  . ARG B 72  ? 0.7317 0.7945 0.6302 -0.1046 0.1183  -0.1585 73  ARG B CB  
1781 C CG  . ARG B 72  ? 0.7553 0.7791 0.6465 -0.0977 0.1380  -0.1640 73  ARG B CG  
1782 C CD  . ARG B 72  ? 0.7532 0.7761 0.6242 -0.0919 0.1388  -0.1751 73  ARG B CD  
1783 N NE  . ARG B 72  ? 0.7908 0.7702 0.6552 -0.0860 0.1609  -0.1817 73  ARG B NE  
1784 C CZ  . ARG B 72  ? 0.7916 0.7562 0.6373 -0.0793 0.1689  -0.1930 73  ARG B CZ  
1785 N NH1 . ARG B 72  ? 0.7872 0.7806 0.6190 -0.0774 0.1552  -0.1987 73  ARG B NH1 
1786 N NH2 . ARG B 72  ? 0.8437 0.7635 0.6850 -0.0732 0.1925  -0.1974 73  ARG B NH2 
1787 N N   . TYR B 73  ? 0.7830 0.8021 0.7209 -0.1319 0.1359  -0.1633 74  TYR B N   
1788 C CA  . TYR B 73  ? 0.8147 0.8229 0.7676 -0.1536 0.1388  -0.1764 74  TYR B CA  
1789 C C   . TYR B 73  ? 0.7869 0.8256 0.7561 -0.1603 0.1258  -0.1646 74  TYR B C   
1790 O O   . TYR B 73  ? 0.7860 0.8457 0.7618 -0.1792 0.1154  -0.1763 74  TYR B O   
1791 C CB  . TYR B 73  ? 0.8546 0.8153 0.8159 -0.1522 0.1634  -0.1759 74  TYR B CB  
1792 N N   . ARG B 74  ? 0.7685 0.8140 0.7433 -0.1443 0.1262  -0.1419 75  ARG B N   
1793 C CA  . ARG B 74  ? 0.7491 0.8236 0.7366 -0.1476 0.1144  -0.1299 75  ARG B CA  
1794 C C   . ARG B 74  ? 0.7168 0.8287 0.6972 -0.1529 0.0960  -0.1342 75  ARG B C   
1795 O O   . ARG B 74  ? 0.7041 0.8390 0.6948 -0.1650 0.0873  -0.1346 75  ARG B O   
1796 C CB  . ARG B 74  ? 0.7391 0.8177 0.7295 -0.1283 0.1175  -0.1073 75  ARG B CB  
1797 C CG  . ARG B 74  ? 0.8067 0.8576 0.8043 -0.1165 0.1366  -0.0962 75  ARG B CG  
1798 C CD  . ARG B 74  ? 0.8649 0.9144 0.8835 -0.1207 0.1414  -0.0854 75  ARG B CD  
1799 N NE  . ARG B 74  ? 0.9500 0.9647 0.9790 -0.1186 0.1629  -0.0826 75  ARG B NE  
1800 C CZ  . ARG B 74  ? 1.0007 1.0077 1.0495 -0.1194 0.1728  -0.0709 75  ARG B CZ  
1801 N NH1 . ARG B 74  ? 0.9897 1.0230 1.0494 -0.1216 0.1623  -0.0608 75  ARG B NH1 
1802 N NH2 . ARG B 74  ? 1.0459 1.0174 1.1042 -0.1168 0.1953  -0.0680 75  ARG B NH2 
1803 N N   . LEU B 75  ? 0.6947 0.8146 0.6585 -0.1428 0.0914  -0.1351 76  LEU B N   
1804 C CA  . LEU B 75  ? 0.6696 0.8239 0.6272 -0.1449 0.0769  -0.1364 76  LEU B CA  
1805 C C   . LEU B 75  ? 0.6776 0.8489 0.6363 -0.1631 0.0705  -0.1543 76  LEU B C   
1806 O O   . LEU B 75  ? 0.6536 0.8587 0.6174 -0.1690 0.0602  -0.1514 76  LEU B O   
1807 C CB  . LEU B 75  ? 0.6645 0.8228 0.6054 -0.1318 0.0752  -0.1350 76  LEU B CB  
1808 C CG  . LEU B 75  ? 0.6446 0.8024 0.5830 -0.1156 0.0774  -0.1182 76  LEU B CG  
1809 C CD1 . LEU B 75  ? 0.6247 0.7943 0.5489 -0.1076 0.0735  -0.1187 76  LEU B CD1 
1810 C CD2 . LEU B 75  ? 0.6054 0.7789 0.5545 -0.1147 0.0725  -0.1046 76  LEU B CD2 
1811 N N   . GLN B 76  ? 0.7110 0.8605 0.6643 -0.1719 0.0778  -0.1731 77  GLN B N   
1812 C CA  . GLN B 76  ? 0.7344 0.9030 0.6868 -0.1912 0.0717  -0.1943 77  GLN B CA  
1813 C C   . GLN B 76  ? 0.7364 0.9158 0.7084 -0.2094 0.0702  -0.1960 77  GLN B C   
1814 O O   . GLN B 76  ? 0.7295 0.9502 0.7055 -0.2210 0.0588  -0.2006 77  GLN B O   
1815 C CB  . GLN B 76  ? 0.7761 0.9144 0.7162 -0.1965 0.0819  -0.2166 77  GLN B CB  
1816 C CG  . GLN B 76  ? 0.8142 0.9749 0.7508 -0.2184 0.0757  -0.2436 77  GLN B CG  
1817 C CD  . GLN B 76  ? 0.8843 1.0022 0.8185 -0.2322 0.0912  -0.2679 77  GLN B CD  
1818 O OE1 . GLN B 76  ? 0.9151 0.9976 0.8632 -0.2380 0.1046  -0.2658 77  GLN B OE1 
1819 N NE2 . GLN B 76  ? 0.9251 1.0445 0.8415 -0.2369 0.0912  -0.2910 77  GLN B NE2 
1820 N N   . LYS B 77  ? 0.7435 0.8904 0.7287 -0.2106 0.0821  -0.1898 78  LYS B N   
1821 C CA  . LYS B 77  ? 0.7479 0.9052 0.7538 -0.2271 0.0816  -0.1886 78  LYS B CA  
1822 C C   . LYS B 77  ? 0.7033 0.8991 0.7166 -0.2195 0.0698  -0.1672 78  LYS B C   
1823 O O   . LYS B 77  ? 0.7001 0.9282 0.7252 -0.2336 0.0626  -0.1682 78  LYS B O   
1824 C CB  . LYS B 77  ? 0.7744 0.8871 0.7939 -0.2272 0.0995  -0.1836 78  LYS B CB  
1825 C CG  . LYS B 77  ? 0.8416 0.9105 0.8560 -0.2364 0.1158  -0.2052 78  LYS B CG  
1826 C CD  . LYS B 77  ? 0.9112 0.9793 0.9392 -0.2678 0.1189  -0.2286 78  LYS B CD  
1827 C CE  . LYS B 77  ? 0.9691 1.0032 0.9846 -0.2796 0.1310  -0.2581 78  LYS B CE  
1828 N NZ  . LYS B 77  ? 1.0190 1.0427 1.0498 -0.3122 0.1387  -0.2824 78  LYS B NZ  
1829 N N   . ALA B 78  ? 0.6665 0.8609 0.6723 -0.1976 0.0685  -0.1487 79  ALA B N   
1830 C CA  . ALA B 78  ? 0.6244 0.8507 0.6347 -0.1892 0.0597  -0.1298 79  ALA B CA  
1831 C C   . ALA B 78  ? 0.6029 0.8719 0.6055 -0.1910 0.0477  -0.1325 79  ALA B C   
1832 O O   . ALA B 78  ? 0.5838 0.8791 0.5892 -0.1829 0.0426  -0.1164 79  ALA B O   
1833 C CB  . ALA B 78  ? 0.6057 0.8160 0.6108 -0.1681 0.0637  -0.1123 79  ALA B CB  
1834 N N   . GLY B 79  ? 0.6104 0.8868 0.6032 -0.2003 0.0448  -0.1521 80  GLY B N   
1835 C CA  . GLY B 79  ? 0.5968 0.9191 0.5823 -0.2009 0.0343  -0.1547 80  GLY B CA  
1836 C C   . GLY B 79  ? 0.5713 0.8992 0.5434 -0.1811 0.0324  -0.1431 80  GLY B C   
1837 O O   . GLY B 79  ? 0.5670 0.9350 0.5360 -0.1771 0.0257  -0.1376 80  GLY B O   
1838 N N   . PHE B 80  ? 0.5544 0.8456 0.5196 -0.1686 0.0391  -0.1384 81  PHE B N   
1839 C CA  . PHE B 80  ? 0.5345 0.8301 0.4887 -0.1522 0.0382  -0.1280 81  PHE B CA  
1840 C C   . PHE B 80  ? 0.5364 0.8515 0.4772 -0.1518 0.0338  -0.1396 81  PHE B C   
1841 O O   . PHE B 80  ? 0.5552 0.8624 0.4890 -0.1611 0.0345  -0.1595 81  PHE B O   
1842 C CB  . PHE B 80  ? 0.5271 0.7857 0.4772 -0.1406 0.0460  -0.1215 81  PHE B CB  
1843 C CG  . PHE B 80  ? 0.5005 0.7517 0.4602 -0.1344 0.0490  -0.1049 81  PHE B CG  
1844 C CD1 . PHE B 80  ? 0.4898 0.7520 0.4484 -0.1239 0.0482  -0.0907 81  PHE B CD1 
1845 C CD2 . PHE B 80  ? 0.5329 0.7652 0.5028 -0.1386 0.0541  -0.1039 81  PHE B CD2 
1846 C CE1 . PHE B 80  ? 0.4786 0.7328 0.4443 -0.1185 0.0519  -0.0780 81  PHE B CE1 
1847 C CE2 . PHE B 80  ? 0.5169 0.7450 0.4944 -0.1316 0.0569  -0.0890 81  PHE B CE2 
1848 C CZ  . PHE B 80  ? 0.4952 0.7342 0.4695 -0.1218 0.0555  -0.0773 81  PHE B CZ  
1849 N N   . THR B 81  ? 0.5147 0.8531 0.4518 -0.1396 0.0311  -0.1262 82  THR B N   
1850 C CA  . THR B 81  ? 0.5091 0.8808 0.4366 -0.1367 0.0260  -0.1311 82  THR B CA  
1851 C C   . THR B 81  ? 0.4988 0.8613 0.4168 -0.1209 0.0293  -0.1217 82  THR B C   
1852 O O   . THR B 81  ? 0.5261 0.9050 0.4334 -0.1165 0.0272  -0.1275 82  THR B O   
1853 C CB  . THR B 81  ? 0.4954 0.9142 0.4321 -0.1368 0.0212  -0.1190 82  THR B CB  
1854 O OG1 . THR B 81  ? 0.5374 0.9946 0.4716 -0.1487 0.0142  -0.1351 82  THR B OG1 
1855 C CG2 . THR B 81  ? 0.4588 0.8951 0.3954 -0.1199 0.0237  -0.0976 82  THR B CG2 
1856 N N   . HIS B 82  ? 0.4743 0.8123 0.3966 -0.1132 0.0348  -0.1079 83  HIS B N   
1857 C CA  . HIS B 82  ? 0.4561 0.7894 0.3735 -0.1006 0.0384  -0.0967 83  HIS B CA  
1858 C C   . HIS B 82  ? 0.4351 0.7329 0.3542 -0.0987 0.0442  -0.0934 83  HIS B C   
1859 O O   . HIS B 82  ? 0.4161 0.7030 0.3442 -0.1019 0.0461  -0.0887 83  HIS B O   
1860 C CB  . HIS B 82  ? 0.4439 0.8015 0.3689 -0.0926 0.0401  -0.0775 83  HIS B CB  
1861 C CG  . HIS B 82  ? 0.4336 0.8351 0.3572 -0.0896 0.0359  -0.0752 83  HIS B CG  
1862 N ND1 . HIS B 82  ? 0.4210 0.8528 0.3502 -0.0961 0.0312  -0.0769 83  HIS B ND1 
1863 C CD2 . HIS B 82  ? 0.4043 0.8299 0.3221 -0.0798 0.0362  -0.0697 83  HIS B CD2 
1864 C CE1 . HIS B 82  ? 0.4193 0.8948 0.3452 -0.0904 0.0282  -0.0736 83  HIS B CE1 
1865 N NE2 . HIS B 82  ? 0.4023 0.8739 0.3214 -0.0796 0.0316  -0.0686 83  HIS B NE2 
1866 N N   . VAL B 83  ? 0.4267 0.7119 0.3373 -0.0926 0.0471  -0.0948 84  VAL B N   
1867 C CA  . VAL B 83  ? 0.4146 0.6790 0.3263 -0.0889 0.0525  -0.0888 84  VAL B CA  
1868 C C   . VAL B 83  ? 0.4095 0.6826 0.3188 -0.0818 0.0546  -0.0796 84  VAL B C   
1869 O O   . VAL B 83  ? 0.4118 0.6951 0.3128 -0.0771 0.0536  -0.0816 84  VAL B O   
1870 C CB  . VAL B 83  ? 0.4313 0.6748 0.3358 -0.0880 0.0560  -0.0978 84  VAL B CB  
1871 C CG1 . VAL B 83  ? 0.4047 0.6383 0.3089 -0.0819 0.0613  -0.0902 84  VAL B CG1 
1872 C CG2 . VAL B 83  ? 0.4394 0.6691 0.3491 -0.0963 0.0568  -0.1063 84  VAL B CG2 
1873 N N   . LEU B 84  ? 0.4042 0.6729 0.3208 -0.0817 0.0585  -0.0704 85  LEU B N   
1874 C CA  . LEU B 84  ? 0.3979 0.6700 0.3150 -0.0787 0.0627  -0.0630 85  LEU B CA  
1875 C C   . LEU B 84  ? 0.4095 0.6696 0.3257 -0.0803 0.0657  -0.0652 85  LEU B C   
1876 O O   . LEU B 84  ? 0.4204 0.6710 0.3419 -0.0838 0.0677  -0.0650 85  LEU B O   
1877 C CB  . LEU B 84  ? 0.3876 0.6638 0.3143 -0.0789 0.0673  -0.0523 85  LEU B CB  
1878 C CG  . LEU B 84  ? 0.3758 0.6508 0.3064 -0.0787 0.0748  -0.0449 85  LEU B CG  
1879 C CD1 . LEU B 84  ? 0.3846 0.6741 0.3102 -0.0738 0.0738  -0.0429 85  LEU B CD1 
1880 C CD2 . LEU B 84  ? 0.3625 0.6367 0.3027 -0.0771 0.0829  -0.0334 85  LEU B CD2 
1881 N N   . ASN B 85  ? 0.4294 0.6939 0.3382 -0.0765 0.0661  -0.0666 86  ASN B N   
1882 C CA  . ASN B 85  ? 0.4441 0.7070 0.3510 -0.0762 0.0690  -0.0673 86  ASN B CA  
1883 C C   . ASN B 85  ? 0.4502 0.7238 0.3612 -0.0800 0.0721  -0.0626 86  ASN B C   
1884 O O   . ASN B 85  ? 0.4592 0.7442 0.3676 -0.0773 0.0724  -0.0592 86  ASN B O   
1885 C CB  . ASN B 85  ? 0.4563 0.7204 0.3523 -0.0682 0.0695  -0.0699 86  ASN B CB  
1886 C CG  . ASN B 85  ? 0.4596 0.7281 0.3535 -0.0647 0.0737  -0.0676 86  ASN B CG  
1887 O OD1 . ASN B 85  ? 0.4858 0.7601 0.3859 -0.0697 0.0749  -0.0662 86  ASN B OD1 
1888 N ND2 . ASN B 85  ? 0.4599 0.7276 0.3445 -0.0551 0.0771  -0.0673 86  ASN B ND2 
1889 N N   . ALA B 86  ? 0.4666 0.7363 0.3845 -0.0870 0.0752  -0.0632 87  ALA B N   
1890 C CA  . ALA B 86  ? 0.4911 0.7684 0.4139 -0.0946 0.0799  -0.0626 87  ALA B CA  
1891 C C   . ALA B 86  ? 0.5172 0.8128 0.4356 -0.0951 0.0797  -0.0650 87  ALA B C   
1892 O O   . ALA B 86  ? 0.5194 0.8257 0.4421 -0.1043 0.0830  -0.0674 87  ALA B O   
1893 C CB  . ALA B 86  ? 0.4793 0.7437 0.4095 -0.1025 0.0846  -0.0652 87  ALA B CB  
1894 N N   . ALA B 87  ? 0.5551 0.8553 0.4653 -0.0855 0.0772  -0.0642 88  ALA B N   
1895 C CA  . ALA B 87  ? 0.5920 0.9149 0.4972 -0.0817 0.0785  -0.0624 88  ALA B CA  
1896 C C   . ALA B 87  ? 0.6305 0.9563 0.5258 -0.0687 0.0783  -0.0576 88  ALA B C   
1897 O O   . ALA B 87  ? 0.6417 0.9747 0.5304 -0.0587 0.0811  -0.0545 88  ALA B O   
1898 C CB  . ALA B 87  ? 0.5869 0.9137 0.4918 -0.0794 0.0800  -0.0641 88  ALA B CB  
1899 N N   . HIS B 88  ? 0.6678 0.9883 0.5614 -0.0670 0.0764  -0.0564 89  HIS B N   
1900 C CA  . HIS B 88  ? 0.7046 1.0260 0.5868 -0.0545 0.0767  -0.0540 89  HIS B CA  
1901 C C   . HIS B 88  ? 0.7123 1.0558 0.5882 -0.0463 0.0807  -0.0476 89  HIS B C   
1902 O O   . HIS B 88  ? 0.7410 1.0794 0.6065 -0.0332 0.0847  -0.0456 89  HIS B O   
1903 C CB  . HIS B 88  ? 0.7143 1.0405 0.5965 -0.0542 0.0745  -0.0515 89  HIS B CB  
1904 C CG  . HIS B 88  ? 0.7657 1.0894 0.6351 -0.0421 0.0742  -0.0524 89  HIS B CG  
1905 N ND1 . HIS B 88  ? 0.8140 1.1175 0.6755 -0.0374 0.0747  -0.0604 89  HIS B ND1 
1906 C CD2 . HIS B 88  ? 0.7986 1.1367 0.6616 -0.0344 0.0743  -0.0476 89  HIS B CD2 
1907 C CE1 . HIS B 88  ? 0.8259 1.1301 0.6752 -0.0279 0.0755  -0.0624 89  HIS B CE1 
1908 N NE2 . HIS B 88  ? 0.8171 1.1434 0.6666 -0.0247 0.0748  -0.0540 89  HIS B NE2 
1909 N N   . ASP B 94  ? 0.9975 1.3305 0.8454 -0.0017 0.1033  -0.0342 95  ASP B N   
1910 C CA  . ASP B 94  ? 1.0149 1.3236 0.8536 0.0020  0.1033  -0.0411 95  ASP B CA  
1911 C C   . ASP B 94  ? 1.0312 1.3032 0.8674 0.0050  0.1098  -0.0486 95  ASP B C   
1912 O O   . ASP B 94  ? 1.0470 1.3133 0.8837 0.0137  0.1196  -0.0423 95  ASP B O   
1913 C CB  . ASP B 94  ? 1.0270 1.3489 0.8524 0.0177  0.1093  -0.0331 95  ASP B CB  
1914 C CG  . ASP B 94  ? 1.0544 1.3559 0.8686 0.0209  0.1083  -0.0424 95  ASP B CG  
1915 O OD1 . ASP B 94  ? 1.0658 1.3573 0.8850 0.0086  0.0998  -0.0531 95  ASP B OD1 
1916 O OD2 . ASP B 94  ? 1.0638 1.3626 0.8637 0.0366  0.1167  -0.0388 95  ASP B OD2 
1917 N N   . THR B 95  ? 1.0297 1.2800 0.8643 -0.0027 0.1050  -0.0615 96  THR B N   
1918 C CA  . THR B 95  ? 1.0375 1.2522 0.8679 -0.0019 0.1119  -0.0721 96  THR B CA  
1919 C C   . THR B 95  ? 1.0439 1.2485 0.8619 -0.0017 0.1103  -0.0846 96  THR B C   
1920 O O   . THR B 95  ? 1.0707 1.2592 0.8750 0.0103  0.1212  -0.0869 96  THR B O   
1921 C CB  . THR B 95  ? 1.0308 1.2318 0.8752 -0.0155 0.1081  -0.0778 96  THR B CB  
1922 O OG1 . THR B 95  ? 1.0403 1.2085 0.8823 -0.0180 0.1148  -0.0896 96  THR B OG1 
1923 C CG2 . THR B 95  ? 0.9996 1.2162 0.8530 -0.0299 0.0941  -0.0814 96  THR B CG2 
1924 N N   . GLY B 96  ? 1.0119 1.2288 0.8338 -0.0130 0.0980  -0.0914 97  GLY B N   
1925 C CA  . GLY B 96  ? 1.0038 1.2227 0.8141 -0.0122 0.0946  -0.1023 97  GLY B CA  
1926 C C   . GLY B 96  ? 0.9842 1.2003 0.7993 -0.0268 0.0864  -0.1169 97  GLY B C   
1927 O O   . GLY B 96  ? 0.9818 1.1802 0.8050 -0.0365 0.0875  -0.1235 97  GLY B O   
1928 N N   . PRO B 97  ? 0.9608 1.1991 0.7716 -0.0278 0.0785  -0.1208 98  PRO B N   
1929 C CA  . PRO B 97  ? 0.9449 1.1863 0.7574 -0.0399 0.0720  -0.1361 98  PRO B CA  
1930 C C   . PRO B 97  ? 0.9499 1.1656 0.7503 -0.0437 0.0786  -0.1578 98  PRO B C   
1931 O O   . PRO B 97  ? 0.9568 1.1719 0.7619 -0.0578 0.0745  -0.1718 98  PRO B O   
1932 C CB  . PRO B 97  ? 0.9388 1.2161 0.7483 -0.0358 0.0640  -0.1320 98  PRO B CB  
1933 C CG  . PRO B 97  ? 0.9339 1.2241 0.7476 -0.0263 0.0652  -0.1120 98  PRO B CG  
1934 C CD  . PRO B 97  ? 0.9534 1.2204 0.7606 -0.0188 0.0749  -0.1096 98  PRO B CD  
1935 N N   . ASP B 98  ? 0.9337 1.1287 0.7191 -0.0320 0.0899  -0.1609 99  ASP B N   
1936 C CA  . ASP B 98  ? 0.9452 1.1080 0.7194 -0.0366 0.0999  -0.1831 99  ASP B CA  
1937 C C   . ASP B 98  ? 0.9256 1.0563 0.7128 -0.0476 0.1072  -0.1867 99  ASP B C   
1938 O O   . ASP B 98  ? 0.9341 1.0453 0.7210 -0.0616 0.1107  -0.2073 99  ASP B O   
1939 C CB  . ASP B 98  ? 0.9728 1.1166 0.7273 -0.0187 0.1138  -0.1833 99  ASP B CB  
1940 C CG  . ASP B 98  ? 0.9955 1.1617 0.7322 -0.0129 0.1089  -0.1937 99  ASP B CG  
1941 O OD1 . ASP B 98  ? 0.9562 1.1622 0.6979 -0.0166 0.0943  -0.1902 99  ASP B OD1 
1942 O OD2 . ASP B 98  ? 1.0355 1.1793 0.7529 -0.0031 0.1213  -0.2047 99  ASP B OD2 
1943 N N   . TYR B 99  ? 0.8719 1.0005 0.6711 -0.0419 0.1096  -0.1667 100 TYR B N   
1944 C CA  . TYR B 99  ? 0.8481 0.9531 0.6616 -0.0496 0.1159  -0.1653 100 TYR B CA  
1945 C C   . TYR B 99  ? 0.8405 0.9572 0.6669 -0.0700 0.1041  -0.1759 100 TYR B C   
1946 O O   . TYR B 99  ? 0.8477 0.9413 0.6816 -0.0820 0.1099  -0.1868 100 TYR B O   
1947 C CB  . TYR B 99  ? 0.8092 0.9237 0.6326 -0.0395 0.1170  -0.1416 100 TYR B CB  
1948 C CG  . TYR B 99  ? 0.7667 0.8594 0.6036 -0.0424 0.1257  -0.1364 100 TYR B CG  
1949 C CD1 . TYR B 99  ? 0.7733 0.8303 0.6067 -0.0347 0.1450  -0.1374 100 TYR B CD1 
1950 C CD2 . TYR B 99  ? 0.6890 0.7956 0.5422 -0.0512 0.1168  -0.1293 100 TYR B CD2 
1951 C CE1 . TYR B 99  ? 0.7308 0.7694 0.5781 -0.0354 0.1547  -0.1299 100 TYR B CE1 
1952 C CE2 . TYR B 99  ? 0.6823 0.7715 0.5479 -0.0522 0.1252  -0.1232 100 TYR B CE2 
1953 C CZ  . TYR B 99  ? 0.6966 0.7529 0.5598 -0.0440 0.1442  -0.1229 100 TYR B CZ  
1954 O OH  . TYR B 99  ? 0.6654 0.7051 0.5423 -0.0430 0.1547  -0.1145 100 TYR B OH  
1955 N N   . TYR B 100 ? 0.8210 0.9748 0.6509 -0.0731 0.0890  -0.1711 101 TYR B N   
1956 C CA  . TYR B 100 ? 0.8201 0.9936 0.6623 -0.0892 0.0779  -0.1767 101 TYR B CA  
1957 C C   . TYR B 100 ? 0.8543 1.0485 0.6884 -0.0989 0.0708  -0.1961 101 TYR B C   
1958 O O   . TYR B 100 ? 0.8673 1.0702 0.7098 -0.1150 0.0659  -0.2070 101 TYR B O   
1959 C CB  . TYR B 100 ? 0.7796 0.9821 0.6324 -0.0861 0.0682  -0.1577 101 TYR B CB  
1960 C CG  . TYR B 100 ? 0.7242 0.9142 0.5867 -0.0806 0.0729  -0.1414 101 TYR B CG  
1961 C CD1 . TYR B 100 ? 0.6838 0.8607 0.5595 -0.0885 0.0750  -0.1400 101 TYR B CD1 
1962 C CD2 . TYR B 100 ? 0.6843 0.8800 0.5429 -0.0679 0.0752  -0.1276 101 TYR B CD2 
1963 C CE1 . TYR B 100 ? 0.6374 0.8077 0.5210 -0.0827 0.0790  -0.1258 101 TYR B CE1 
1964 C CE2 . TYR B 100 ? 0.6735 0.8642 0.5401 -0.0640 0.0791  -0.1149 101 TYR B CE2 
1965 C CZ  . TYR B 100 ? 0.6511 0.8292 0.5296 -0.0708 0.0809  -0.1143 101 TYR B CZ  
1966 O OH  . TYR B 100 ? 0.6189 0.7966 0.5043 -0.0659 0.0847  -0.1022 101 TYR B OH  
1967 N N   . ARG B 101 ? 0.8853 1.0923 0.7033 -0.0891 0.0700  -0.1998 102 ARG B N   
1968 C CA  . ARG B 101 ? 0.9172 1.1523 0.7253 -0.0958 0.0627  -0.2180 102 ARG B CA  
1969 C C   . ARG B 101 ? 0.9617 1.1729 0.7638 -0.1120 0.0692  -0.2473 102 ARG B C   
1970 O O   . ARG B 101 ? 0.9816 1.2199 0.7793 -0.1246 0.0620  -0.2671 102 ARG B O   
1971 C CB  . ARG B 101 ? 0.9271 1.1792 0.7186 -0.0791 0.0623  -0.2142 102 ARG B CB  
1972 C CG  . ARG B 101 ? 0.9780 1.2695 0.7587 -0.0825 0.0539  -0.2299 102 ARG B CG  
1973 C CD  . ARG B 101 ? 1.0397 1.3396 0.8009 -0.0651 0.0567  -0.2297 102 ARG B CD  
1974 N NE  . ARG B 101 ? 1.0514 1.3901 0.8174 -0.0512 0.0497  -0.2056 102 ARG B NE  
1975 C CZ  . ARG B 101 ? 1.0527 1.3845 0.8246 -0.0387 0.0529  -0.1818 102 ARG B CZ  
1976 N NH1 . ARG B 101 ? 1.0579 1.3509 0.8309 -0.0362 0.0620  -0.1769 102 ARG B NH1 
1977 N NH2 . ARG B 101 ? 1.0297 1.3966 0.8072 -0.0288 0.0478  -0.1623 102 ARG B NH2 
1978 N N   . ASP B 102 ? 0.9827 1.1453 0.7857 -0.1123 0.0838  -0.2502 103 ASP B N   
1979 C CA  . ASP B 102 ? 1.0240 1.1560 0.8250 -0.1295 0.0934  -0.2770 103 ASP B CA  
1980 C C   . ASP B 102 ? 1.0121 1.1520 0.8333 -0.1512 0.0877  -0.2819 103 ASP B C   
1981 O O   . ASP B 102 ? 1.0451 1.1597 0.8692 -0.1692 0.0961  -0.3036 103 ASP B O   
1982 C CB  . ASP B 102 ? 1.0556 1.1309 0.8508 -0.1192 0.1149  -0.2755 103 ASP B CB  
1983 C CG  . ASP B 102 ? 1.0755 1.1424 0.8478 -0.0994 0.1227  -0.2758 103 ASP B CG  
1984 O OD1 . ASP B 102 ? 1.0492 1.1550 0.8115 -0.0921 0.1105  -0.2737 103 ASP B OD1 
1985 O OD2 . ASP B 102 ? 1.1192 1.1411 0.8838 -0.0892 0.1426  -0.2759 103 ASP B OD2 
1986 N N   . MET B 103 ? 1.1226 1.0379 0.9495 -0.1850 0.1621  -0.2598 104 MET B N   
1987 C CA  . MET B 103 ? 1.0989 1.0297 0.9338 -0.2136 0.1467  -0.2462 104 MET B CA  
1988 C C   . MET B 103 ? 1.0434 1.0420 0.8825 -0.2269 0.1329  -0.2365 104 MET B C   
1989 O O   . MET B 103 ? 1.0100 1.0352 0.8661 -0.2429 0.1211  -0.2213 104 MET B O   
1990 C CB  . MET B 103 ? 1.0717 0.9946 0.9352 -0.2032 0.1457  -0.2194 104 MET B CB  
1991 C CG  . MET B 103 ? 1.1357 0.9875 0.9942 -0.1912 0.1552  -0.2232 104 MET B CG  
1992 S SD  . MET B 103 ? 1.1199 0.9660 1.0034 -0.1889 0.1504  -0.1896 104 MET B SD  
1993 C CE  . MET B 103 ? 1.0255 0.9393 0.9357 -0.1609 0.1492  -0.1705 104 MET B CE  
1994 N N   . ASP B 104 ? 1.0331 1.0599 0.8562 -0.2197 0.1347  -0.2447 105 ASP B N   
1995 C CA  . ASP B 104 ? 0.9950 1.0792 0.8158 -0.2308 0.1199  -0.2349 105 ASP B CA  
1996 C C   . ASP B 104 ? 0.9084 1.0287 0.7620 -0.2159 0.1147  -0.2041 105 ASP B C   
1997 O O   . ASP B 104 ? 0.8779 1.0339 0.7449 -0.2264 0.1005  -0.1904 105 ASP B O   
1998 C CB  . ASP B 104 ? 1.0284 1.1219 0.8393 -0.2648 0.1041  -0.2444 105 ASP B CB  
1999 C CG  . ASP B 104 ? 1.0665 1.1931 0.8471 -0.2785 0.0930  -0.2556 105 ASP B CG  
2000 O OD1 . ASP B 104 ? 1.0633 1.2246 0.8403 -0.2643 0.0905  -0.2429 105 ASP B OD1 
2001 O OD2 . ASP B 104 ? 1.1441 1.2588 0.9007 -0.3055 0.0863  -0.2771 105 ASP B OD2 
2002 N N   . ILE B 105 ? 0.8658 0.9772 0.7325 -0.1909 0.1265  -0.1950 106 ILE B N   
2003 C CA  . ILE B 105 ? 0.8003 0.9401 0.6919 -0.1762 0.1236  -0.1691 106 ILE B CA  
2004 C C   . ILE B 105 ? 0.7735 0.9315 0.6571 -0.1605 0.1311  -0.1671 106 ILE B C   
2005 O O   . ILE B 105 ? 0.7842 0.9244 0.6649 -0.1474 0.1452  -0.1781 106 ILE B O   
2006 C CB  . ILE B 105 ? 0.7863 0.8999 0.7016 -0.1644 0.1294  -0.1575 106 ILE B CB  
2007 C CG1 . ILE B 105 ? 0.7936 0.8988 0.7181 -0.1838 0.1217  -0.1527 106 ILE B CG1 
2008 C CG2 . ILE B 105 ? 0.7327 0.8701 0.6667 -0.1457 0.1304  -0.1364 106 ILE B CG2 
2009 C CD1 . ILE B 105 ? 0.7981 0.8631 0.7337 -0.1779 0.1280  -0.1450 106 ILE B CD1 
2010 N N   . GLN B 106 ? 0.7365 0.9295 0.6159 -0.1621 0.1222  -0.1535 107 GLN B N   
2011 C CA  . GLN B 106 ? 0.7194 0.9287 0.5904 -0.1511 0.1293  -0.1474 107 GLN B CA  
2012 C C   . GLN B 106 ? 0.6654 0.8745 0.5637 -0.1344 0.1352  -0.1317 107 GLN B C   
2013 O O   . GLN B 106 ? 0.6376 0.8516 0.5542 -0.1325 0.1271  -0.1153 107 GLN B O   
2014 C CB  . GLN B 106 ? 0.7160 0.9534 0.5706 -0.1579 0.1164  -0.1345 107 GLN B CB  
2015 C CG  . GLN B 106 ? 0.7936 1.0368 0.6137 -0.1735 0.1104  -0.1491 107 GLN B CG  
2016 C CD  . GLN B 106 ? 0.8318 1.1015 0.6360 -0.1780 0.0933  -0.1328 107 GLN B CD  
2017 O OE1 . GLN B 106 ? 0.8608 1.1454 0.6639 -0.1880 0.0762  -0.1322 107 GLN B OE1 
2018 N NE2 . GLN B 106 ? 0.8556 1.1314 0.6480 -0.1706 0.0972  -0.1184 107 GLN B NE2 
2019 N N   . TYR B 107 ? 0.6444 0.8512 0.5458 -0.1226 0.1496  -0.1380 108 TYR B N   
2020 C CA  . TYR B 107 ? 0.6027 0.8142 0.5297 -0.1078 0.1542  -0.1251 108 TYR B CA  
2021 C C   . TYR B 107 ? 0.5833 0.8218 0.5045 -0.1072 0.1593  -0.1171 108 TYR B C   
2022 O O   . TYR B 107 ? 0.6069 0.8554 0.5061 -0.1131 0.1668  -0.1273 108 TYR B O   
2023 C CB  . TYR B 107 ? 0.6143 0.8063 0.5555 -0.0929 0.1659  -0.1379 108 TYR B CB  
2024 C CG  . TYR B 107 ? 0.5886 0.7929 0.5571 -0.0765 0.1694  -0.1256 108 TYR B CG  
2025 C CD1 . TYR B 107 ? 0.5510 0.7428 0.5372 -0.0710 0.1612  -0.1110 108 TYR B CD1 
2026 C CD2 . TYR B 107 ? 0.6029 0.8357 0.5784 -0.0686 0.1808  -0.1287 108 TYR B CD2 
2027 C CE1 . TYR B 107 ? 0.5506 0.7551 0.5589 -0.0576 0.1616  -0.0997 108 TYR B CE1 
2028 C CE2 . TYR B 107 ? 0.5836 0.8342 0.5866 -0.0558 0.1814  -0.1174 108 TYR B CE2 
2029 C CZ  . TYR B 107 ? 0.5667 0.8016 0.5850 -0.0500 0.1703  -0.1028 108 TYR B CZ  
2030 O OH  . TYR B 107 ? 0.5609 0.8130 0.6034 -0.0385 0.1677  -0.0909 108 TYR B OH  
2031 N N   . HIS B 108 ? 0.5448 0.7934 0.4821 -0.1027 0.1558  -0.0994 109 HIS B N   
2032 C CA  . HIS B 108 ? 0.5340 0.8050 0.4723 -0.1023 0.1638  -0.0938 109 HIS B CA  
2033 C C   . HIS B 108 ? 0.5021 0.7792 0.4687 -0.0928 0.1626  -0.0823 109 HIS B C   
2034 O O   . HIS B 108 ? 0.4827 0.7477 0.4571 -0.0913 0.1523  -0.0711 109 HIS B O   
2035 C CB  . HIS B 108 ? 0.5320 0.8103 0.4442 -0.1156 0.1582  -0.0817 109 HIS B CB  
2036 C CG  . HIS B 108 ? 0.5344 0.8331 0.4414 -0.1215 0.1689  -0.0780 109 HIS B CG  
2037 N ND1 . HIS B 108 ? 0.5483 0.8614 0.4359 -0.1288 0.1822  -0.0893 109 HIS B ND1 
2038 C CD2 . HIS B 108 ? 0.5180 0.8267 0.4362 -0.1239 0.1695  -0.0654 109 HIS B CD2 
2039 C CE1 . HIS B 108 ? 0.5542 0.8877 0.4435 -0.1362 0.1912  -0.0825 109 HIS B CE1 
2040 N NE2 . HIS B 108 ? 0.5394 0.8696 0.4467 -0.1344 0.1826  -0.0679 109 HIS B NE2 
2041 N N   . GLY B 109 ? 0.4972 0.7974 0.4784 -0.0876 0.1732  -0.0856 110 GLY B N   
2042 C CA  . GLY B 109 ? 0.4809 0.7947 0.4885 -0.0803 0.1706  -0.0754 110 GLY B CA  
2043 C C   . GLY B 109 ? 0.4768 0.8155 0.4810 -0.0935 0.1725  -0.0656 110 GLY B C   
2044 O O   . GLY B 109 ? 0.4856 0.8472 0.4846 -0.1003 0.1845  -0.0723 110 GLY B O   
2045 N N   . VAL B 110 ? 0.4640 0.7958 0.4681 -0.0990 0.1619  -0.0508 111 VAL B N   
2046 C CA  . VAL B 110 ? 0.4674 0.8175 0.4698 -0.1132 0.1624  -0.0416 111 VAL B CA  
2047 C C   . VAL B 110 ? 0.4586 0.8358 0.4959 -0.1038 0.1609  -0.0409 111 VAL B C   
2048 O O   . VAL B 110 ? 0.4530 0.8175 0.5026 -0.0912 0.1516  -0.0369 111 VAL B O   
2049 C CB  . VAL B 110 ? 0.4729 0.7934 0.4524 -0.1226 0.1508  -0.0280 111 VAL B CB  
2050 C CG1 . VAL B 110 ? 0.4776 0.8062 0.4551 -0.1375 0.1488  -0.0189 111 VAL B CG1 
2051 C CG2 . VAL B 110 ? 0.4852 0.7842 0.4326 -0.1290 0.1498  -0.0265 111 VAL B CG2 
2052 N N   . GLU B 111 ? 0.4556 0.8728 0.5092 -0.1100 0.1694  -0.0438 112 GLU B N   
2053 C CA  . GLU B 111 ? 0.4550 0.9063 0.5466 -0.0968 0.1669  -0.0445 112 GLU B CA  
2054 C C   . GLU B 111 ? 0.4371 0.8970 0.5296 -0.1122 0.1553  -0.0318 112 GLU B C   
2055 O O   . GLU B 111 ? 0.4437 0.9429 0.5491 -0.1268 0.1589  -0.0313 112 GLU B O   
2056 C CB  . GLU B 111 ? 0.4700 0.9705 0.5863 -0.0924 0.1833  -0.0571 112 GLU B CB  
2057 C CG  . GLU B 111 ? 0.5048 1.0500 0.6674 -0.0739 0.1804  -0.0583 112 GLU B CG  
2058 C CD  . GLU B 111 ? 0.5601 1.1590 0.7513 -0.0657 0.1993  -0.0731 112 GLU B CD  
2059 O OE1 . GLU B 111 ? 0.5974 1.1827 0.7897 -0.0450 0.2097  -0.0872 112 GLU B OE1 
2060 O OE2 . GLU B 111 ? 0.5436 1.1976 0.7548 -0.0815 0.2047  -0.0721 112 GLU B OE2 
2061 N N   . ALA B 112 ? 0.4141 0.8376 0.4911 -0.1112 0.1423  -0.0229 113 ALA B N   
2062 C CA  . ALA B 112 ? 0.4101 0.8312 0.4775 -0.1278 0.1321  -0.0134 113 ALA B CA  
2063 C C   . ALA B 112 ? 0.3950 0.8308 0.4841 -0.1160 0.1190  -0.0080 113 ALA B C   
2064 O O   . ALA B 112 ? 0.3827 0.8085 0.4831 -0.0942 0.1156  -0.0077 113 ALA B O   
2065 C CB  . ALA B 112 ? 0.4154 0.7859 0.4449 -0.1364 0.1281  -0.0079 113 ALA B CB  
2066 N N   . ASP B 113 ? 0.3807 0.8384 0.4727 -0.1323 0.1111  -0.0033 114 ASP B N   
2067 C CA  . ASP B 113 ? 0.3754 0.8462 0.4804 -0.1247 0.0956  0.0035  114 ASP B CA  
2068 C C   . ASP B 113 ? 0.3747 0.8042 0.4437 -0.1380 0.0870  0.0093  114 ASP B C   
2069 O O   . ASP B 113 ? 0.3793 0.7854 0.4214 -0.1577 0.0914  0.0077  114 ASP B O   
2070 C CB  . ASP B 113 ? 0.3810 0.9134 0.5163 -0.1346 0.0907  0.0033  114 ASP B CB  
2071 C CG  . ASP B 113 ? 0.3855 0.9660 0.5596 -0.1204 0.1019  -0.0044 114 ASP B CG  
2072 O OD1 . ASP B 113 ? 0.4208 0.9888 0.6054 -0.0935 0.1071  -0.0079 114 ASP B OD1 
2073 O OD2 . ASP B 113 ? 0.4358 1.0675 0.6301 -0.1370 0.1065  -0.0079 114 ASP B OD2 
2074 N N   . ASP B 114 ? 0.3706 0.7886 0.4362 -0.1269 0.0753  0.0160  115 ASP B N   
2075 C CA  . ASP B 114 ? 0.3876 0.7693 0.4179 -0.1389 0.0695  0.0192  115 ASP B CA  
2076 C C   . ASP B 114 ? 0.3956 0.8011 0.4221 -0.1584 0.0571  0.0209  115 ASP B C   
2077 O O   . ASP B 114 ? 0.4062 0.8188 0.4306 -0.1542 0.0438  0.0272  115 ASP B O   
2078 C CB  . ASP B 114 ? 0.3931 0.7473 0.4136 -0.1221 0.0654  0.0253  115 ASP B CB  
2079 C CG  . ASP B 114 ? 0.4311 0.7497 0.4138 -0.1334 0.0629  0.0263  115 ASP B CG  
2080 O OD1 . ASP B 114 ? 0.4282 0.7258 0.3893 -0.1479 0.0687  0.0204  115 ASP B OD1 
2081 O OD2 . ASP B 114 ? 0.4580 0.7677 0.4312 -0.1266 0.0559  0.0331  115 ASP B OD2 
2082 N N   . LEU B 115 ? 0.3893 0.8030 0.4098 -0.1822 0.0615  0.0157  116 LEU B N   
2083 C CA  . LEU B 115 ? 0.3948 0.8361 0.4140 -0.2075 0.0512  0.0148  116 LEU B CA  
2084 C C   . LEU B 115 ? 0.4112 0.8118 0.3939 -0.2337 0.0590  0.0095  116 LEU B C   
2085 O O   . LEU B 115 ? 0.3980 0.7799 0.3755 -0.2333 0.0723  0.0078  116 LEU B O   
2086 C CB  . LEU B 115 ? 0.3831 0.8927 0.4467 -0.2108 0.0514  0.0136  116 LEU B CB  
2087 C CG  . LEU B 115 ? 0.3914 0.9492 0.4979 -0.1827 0.0423  0.0188  116 LEU B CG  
2088 C CD1 . LEU B 115 ? 0.3443 0.9767 0.4992 -0.1850 0.0458  0.0149  116 LEU B CD1 
2089 C CD2 . LEU B 115 ? 0.3932 0.9561 0.4910 -0.1818 0.0211  0.0265  116 LEU B CD2 
2090 N N   . PRO B 116 ? 0.4410 0.8253 0.3952 -0.2572 0.0501  0.0070  117 PRO B N   
2091 C CA  . PRO B 116 ? 0.4795 0.8195 0.3967 -0.2838 0.0569  0.0017  117 PRO B CA  
2092 C C   . PRO B 116 ? 0.4887 0.8558 0.4199 -0.3070 0.0652  0.0010  117 PRO B C   
2093 O O   . PRO B 116 ? 0.5240 0.8460 0.4233 -0.3245 0.0738  -0.0004 117 PRO B O   
2094 C CB  . PRO B 116 ? 0.5273 0.8560 0.4163 -0.3069 0.0437  -0.0029 117 PRO B CB  
2095 C CG  . PRO B 116 ? 0.5035 0.8604 0.4071 -0.2875 0.0307  0.0016  117 PRO B CG  
2096 C CD  . PRO B 116 ? 0.4462 0.8528 0.3994 -0.2619 0.0324  0.0087  117 PRO B CD  
2097 N N   . THR B 117 ? 0.4644 0.9038 0.4420 -0.3063 0.0635  0.0022  118 THR B N   
2098 C CA  . THR B 117 ? 0.4659 0.9414 0.4606 -0.3290 0.0741  0.0009  118 THR B CA  
2099 C C   . THR B 117 ? 0.4463 0.9237 0.4539 -0.3098 0.0910  0.0019  118 THR B C   
2100 O O   . THR B 117 ? 0.4480 0.9639 0.4733 -0.3248 0.1021  0.0006  118 THR B O   
2101 C CB  . THR B 117 ? 0.4602 1.0246 0.5041 -0.3378 0.0657  -0.0001 118 THR B CB  
2102 O OG1 . THR B 117 ? 0.4394 1.0411 0.5229 -0.2985 0.0617  0.0025  118 THR B OG1 
2103 C CG2 . THR B 117 ? 0.4593 1.0321 0.4902 -0.3647 0.0472  -0.0019 118 THR B CG2 
2104 N N   . PHE B 118 ? 0.4291 0.8691 0.4280 -0.2786 0.0932  0.0035  119 PHE B N   
2105 C CA  . PHE B 118 ? 0.4165 0.8451 0.4157 -0.2634 0.1075  0.0034  119 PHE B CA  
2106 C C   . PHE B 118 ? 0.4420 0.7994 0.3922 -0.2713 0.1123  0.0063  119 PHE B C   
2107 O O   . PHE B 118 ? 0.4484 0.7592 0.3737 -0.2634 0.1056  0.0074  119 PHE B O   
2108 C CB  . PHE B 118 ? 0.3893 0.8230 0.4106 -0.2258 0.1062  0.0029  119 PHE B CB  
2109 C CG  . PHE B 118 ? 0.3607 0.7996 0.3902 -0.2124 0.1205  -0.0005 119 PHE B CG  
2110 C CD1 . PHE B 118 ? 0.3582 0.7474 0.3565 -0.2074 0.1258  0.0008  119 PHE B CD1 
2111 C CD2 . PHE B 118 ? 0.3597 0.8559 0.4274 -0.2053 0.1286  -0.0059 119 PHE B CD2 
2112 C CE1 . PHE B 118 ? 0.3595 0.7544 0.3606 -0.1984 0.1375  -0.0031 119 PHE B CE1 
2113 C CE2 . PHE B 118 ? 0.3293 0.8286 0.3994 -0.1947 0.1432  -0.0117 119 PHE B CE2 
2114 C CZ  . PHE B 118 ? 0.3461 0.7936 0.3806 -0.1929 0.1468  -0.0102 119 PHE B CZ  
2115 N N   . ASP B 119 ? 0.4672 0.8177 0.4030 -0.2865 0.1241  0.0082  120 ASP B N   
2116 C CA  . ASP B 119 ? 0.4981 0.7810 0.3871 -0.2916 0.1271  0.0135  120 ASP B CA  
2117 C C   . ASP B 119 ? 0.4803 0.7514 0.3703 -0.2624 0.1313  0.0143  120 ASP B C   
2118 O O   . ASP B 119 ? 0.4754 0.7598 0.3652 -0.2637 0.1412  0.0150  120 ASP B O   
2119 C CB  . ASP B 119 ? 0.5360 0.8090 0.3996 -0.3270 0.1360  0.0182  120 ASP B CB  
2120 C CG  . ASP B 119 ? 0.5740 0.7650 0.3830 -0.3333 0.1347  0.0257  120 ASP B CG  
2121 O OD1 . ASP B 119 ? 0.5721 0.7246 0.3697 -0.3067 0.1285  0.0261  120 ASP B OD1 
2122 O OD2 . ASP B 119 ? 0.6424 0.8056 0.4197 -0.3643 0.1394  0.0316  120 ASP B OD2 
2123 N N   . LEU B 120 ? 0.4662 0.7137 0.3556 -0.2384 0.1239  0.0135  121 LEU B N   
2124 C CA  . LEU B 120 ? 0.4554 0.6907 0.3455 -0.2132 0.1256  0.0136  121 LEU B CA  
2125 C C   . LEU B 120 ? 0.4870 0.6763 0.3393 -0.2158 0.1275  0.0203  121 LEU B C   
2126 O O   . LEU B 120 ? 0.4860 0.6725 0.3371 -0.2002 0.1288  0.0209  121 LEU B O   
2127 C CB  . LEU B 120 ? 0.4302 0.6532 0.3279 -0.1918 0.1178  0.0118  121 LEU B CB  
2128 C CG  . LEU B 120 ? 0.4327 0.6616 0.3456 -0.1678 0.1189  0.0096  121 LEU B CG  
2129 C CD1 . LEU B 120 ? 0.3943 0.6664 0.3365 -0.1630 0.1251  0.0042  121 LEU B CD1 
2130 C CD2 . LEU B 120 ? 0.3843 0.6047 0.3040 -0.1535 0.1125  0.0089  121 LEU B CD2 
2131 N N   . SER B 121 ? 0.5173 0.6686 0.3367 -0.2359 0.1266  0.0258  122 SER B N   
2132 C CA  . SER B 121 ? 0.5511 0.6514 0.3306 -0.2365 0.1265  0.0351  122 SER B CA  
2133 C C   . SER B 121 ? 0.5499 0.6663 0.3219 -0.2446 0.1343  0.0398  122 SER B C   
2134 O O   . SER B 121 ? 0.5692 0.6530 0.3132 -0.2375 0.1320  0.0482  122 SER B O   
2135 C CB  . SER B 121 ? 0.6040 0.6520 0.3453 -0.2588 0.1248  0.0403  122 SER B CB  
2136 O OG  . SER B 121 ? 0.6082 0.6757 0.3464 -0.2926 0.1316  0.0416  122 SER B OG  
2137 N N   . VAL B 122 ? 0.5354 0.7040 0.3317 -0.2588 0.1433  0.0344  123 VAL B N   
2138 C CA  . VAL B 122 ? 0.5485 0.7403 0.3395 -0.2655 0.1538  0.0355  123 VAL B CA  
2139 C C   . VAL B 122 ? 0.5290 0.7234 0.3248 -0.2380 0.1509  0.0324  123 VAL B C   
2140 O O   . VAL B 122 ? 0.5399 0.7317 0.3137 -0.2415 0.1555  0.0360  123 VAL B O   
2141 C CB  . VAL B 122 ? 0.5366 0.7942 0.3620 -0.2806 0.1660  0.0266  123 VAL B CB  
2142 C CG1 . VAL B 122 ? 0.5179 0.8071 0.3436 -0.2795 0.1795  0.0223  123 VAL B CG1 
2143 C CG2 . VAL B 122 ? 0.5721 0.8289 0.3847 -0.3168 0.1701  0.0316  123 VAL B CG2 
2144 N N   . PHE B 123 ? 0.4928 0.6907 0.3136 -0.2137 0.1431  0.0261  124 PHE B N   
2145 C CA  . PHE B 123 ? 0.4740 0.6782 0.3034 -0.1916 0.1401  0.0214  124 PHE B CA  
2146 C C   . PHE B 123 ? 0.4849 0.6510 0.2983 -0.1747 0.1281  0.0279  124 PHE B C   
2147 O O   . PHE B 123 ? 0.4772 0.6505 0.2975 -0.1591 0.1240  0.0245  124 PHE B O   
2148 C CB  . PHE B 123 ? 0.4281 0.6690 0.2999 -0.1778 0.1419  0.0093  124 PHE B CB  
2149 C CG  . PHE B 123 ? 0.4084 0.6941 0.3021 -0.1870 0.1540  0.0013  124 PHE B CG  
2150 C CD1 . PHE B 123 ? 0.4073 0.7123 0.2963 -0.1888 0.1645  -0.0052 124 PHE B CD1 
2151 C CD2 . PHE B 123 ? 0.3969 0.7085 0.3156 -0.1935 0.1547  -0.0005 124 PHE B CD2 
2152 C CE1 . PHE B 123 ? 0.4262 0.7772 0.3383 -0.1947 0.1783  -0.0145 124 PHE B CE1 
2153 C CE2 . PHE B 123 ? 0.4045 0.7654 0.3495 -0.1990 0.1657  -0.0081 124 PHE B CE2 
2154 C CZ  . PHE B 123 ? 0.4065 0.7876 0.3496 -0.1984 0.1788  -0.0157 124 PHE B CZ  
2155 N N   . PHE B 124 ? 0.5140 0.6408 0.3065 -0.1773 0.1226  0.0362  125 PHE B N   
2156 C CA  . PHE B 124 ? 0.5228 0.6195 0.3067 -0.1562 0.1124  0.0405  125 PHE B CA  
2157 C C   . PHE B 124 ? 0.5350 0.6271 0.3011 -0.1475 0.1068  0.0471  125 PHE B C   
2158 O O   . PHE B 124 ? 0.5066 0.6122 0.2883 -0.1297 0.1007  0.0437  125 PHE B O   
2159 C CB  . PHE B 124 ? 0.5611 0.6078 0.3184 -0.1587 0.1088  0.0475  125 PHE B CB  
2160 C CG  . PHE B 124 ? 0.5787 0.6267 0.3498 -0.1646 0.1110  0.0399  125 PHE B CG  
2161 C CD1 . PHE B 124 ? 0.5344 0.6245 0.3415 -0.1610 0.1131  0.0303  125 PHE B CD1 
2162 C CD2 . PHE B 124 ? 0.6435 0.6450 0.3865 -0.1738 0.1098  0.0427  125 PHE B CD2 
2163 C CE1 . PHE B 124 ? 0.5445 0.6358 0.3592 -0.1669 0.1127  0.0251  125 PHE B CE1 
2164 C CE2 . PHE B 124 ? 0.6490 0.6514 0.3993 -0.1815 0.1105  0.0347  125 PHE B CE2 
2165 C CZ  . PHE B 124 ? 0.5916 0.6414 0.3778 -0.1780 0.1112  0.0266  125 PHE B CZ  
2166 N N   . TYR B 125 ? 0.5813 0.6560 0.3131 -0.1625 0.1085  0.0570  126 TYR B N   
2167 C CA  . TYR B 125 ? 0.6084 0.6767 0.3167 -0.1548 0.1004  0.0654  126 TYR B CA  
2168 C C   . TYR B 125 ? 0.5733 0.6869 0.3011 -0.1525 0.1029  0.0538  126 TYR B C   
2169 O O   . TYR B 125 ? 0.5732 0.6947 0.3055 -0.1367 0.0925  0.0533  126 TYR B O   
2170 C CB  . TYR B 125 ? 0.6672 0.6983 0.3256 -0.1726 0.1009  0.0820  126 TYR B CB  
2171 C CG  . TYR B 125 ? 0.7346 0.7080 0.3692 -0.1636 0.0922  0.0945  126 TYR B CG  
2172 C CD1 . TYR B 125 ? 0.7536 0.7006 0.3856 -0.1767 0.0984  0.0928  126 TYR B CD1 
2173 C CD2 . TYR B 125 ? 0.7789 0.7262 0.3976 -0.1387 0.0768  0.1059  126 TYR B CD2 
2174 C CE1 . TYR B 125 ? 0.8161 0.7036 0.4244 -0.1665 0.0916  0.1009  126 TYR B CE1 
2175 C CE2 . TYR B 125 ? 0.8279 0.7186 0.4269 -0.1244 0.0696  0.1155  126 TYR B CE2 
2176 C CZ  . TYR B 125 ? 0.8478 0.7054 0.4396 -0.1389 0.0781  0.1120  126 TYR B CZ  
2177 O OH  . TYR B 125 ? 0.9042 0.7002 0.4730 -0.1252 0.0728  0.1184  126 TYR B OH  
2178 N N   . PRO B 126 ? 0.5630 0.7074 0.3042 -0.1672 0.1166  0.0431  127 PRO B N   
2179 C CA  . PRO B 126 ? 0.5523 0.7302 0.3052 -0.1632 0.1191  0.0305  127 PRO B CA  
2180 C C   . PRO B 126 ? 0.5157 0.7120 0.3077 -0.1461 0.1153  0.0181  127 PRO B C   
2181 O O   . PRO B 126 ? 0.5191 0.7281 0.3137 -0.1398 0.1103  0.0114  127 PRO B O   
2182 C CB  . PRO B 126 ? 0.5585 0.7629 0.3138 -0.1810 0.1368  0.0218  127 PRO B CB  
2183 C CG  . PRO B 126 ? 0.5650 0.7574 0.3161 -0.1968 0.1428  0.0301  127 PRO B CG  
2184 C CD  . PRO B 126 ? 0.5897 0.7362 0.3211 -0.1910 0.1296  0.0449  127 PRO B CD  
2185 N N   . ALA B 127 ? 0.4936 0.6899 0.3123 -0.1410 0.1170  0.0157  128 ALA B N   
2186 C CA  . ALA B 127 ? 0.4584 0.6650 0.3076 -0.1264 0.1128  0.0080  128 ALA B CA  
2187 C C   . ALA B 127 ? 0.4631 0.6579 0.3063 -0.1135 0.0996  0.0147  128 ALA B C   
2188 O O   . ALA B 127 ? 0.4462 0.6567 0.3024 -0.1071 0.0947  0.0084  128 ALA B O   
2189 C CB  . ALA B 127 ? 0.4379 0.6436 0.3085 -0.1248 0.1160  0.0071  128 ALA B CB  
2190 N N   . ALA B 128 ? 0.4885 0.6557 0.3120 -0.1098 0.0938  0.0273  129 ALA B N   
2191 C CA  . ALA B 128 ? 0.4947 0.6548 0.3171 -0.0926 0.0813  0.0338  129 ALA B CA  
2192 C C   . ALA B 128 ? 0.5057 0.6808 0.3153 -0.0919 0.0719  0.0353  129 ALA B C   
2193 O O   . ALA B 128 ? 0.5014 0.6966 0.3282 -0.0807 0.0625  0.0326  129 ALA B O   
2194 C CB  . ALA B 128 ? 0.5270 0.6470 0.3259 -0.0861 0.0773  0.0466  129 ALA B CB  
2195 N N   . ALA B 129 ? 0.5215 0.6910 0.3010 -0.1062 0.0746  0.0387  130 ALA B N   
2196 C CA  . ALA B 129 ? 0.5380 0.7214 0.2979 -0.1086 0.0655  0.0395  130 ALA B CA  
2197 C C   . ALA B 129 ? 0.5059 0.7233 0.2913 -0.1107 0.0669  0.0216  130 ALA B C   
2198 O O   . ALA B 129 ? 0.5094 0.7441 0.2947 -0.1067 0.0541  0.0200  130 ALA B O   
2199 C CB  . ALA B 129 ? 0.5709 0.7422 0.2883 -0.1274 0.0722  0.0455  130 ALA B CB  
2200 N N   . PHE B 130 ? 0.4793 0.7050 0.2860 -0.1172 0.0815  0.0082  131 PHE B N   
2201 C CA  . PHE B 130 ? 0.4592 0.7062 0.2883 -0.1191 0.0844  -0.0093 131 PHE B CA  
2202 C C   . PHE B 130 ? 0.4434 0.7013 0.2998 -0.1087 0.0740  -0.0096 131 PHE B C   
2203 O O   . PHE B 130 ? 0.4445 0.7202 0.3051 -0.1115 0.0659  -0.0170 131 PHE B O   
2204 C CB  . PHE B 130 ? 0.4412 0.6891 0.2901 -0.1223 0.1006  -0.0195 131 PHE B CB  
2205 C CG  . PHE B 130 ? 0.4186 0.6771 0.2853 -0.1237 0.1058  -0.0375 131 PHE B CG  
2206 C CD1 . PHE B 130 ? 0.4366 0.7007 0.2879 -0.1317 0.1140  -0.0515 131 PHE B CD1 
2207 C CD2 . PHE B 130 ? 0.3693 0.6279 0.2647 -0.1176 0.1039  -0.0407 131 PHE B CD2 
2208 C CE1 . PHE B 130 ? 0.4479 0.7124 0.3121 -0.1320 0.1197  -0.0697 131 PHE B CE1 
2209 C CE2 . PHE B 130 ? 0.3843 0.6427 0.2921 -0.1201 0.1088  -0.0560 131 PHE B CE2 
2210 C CZ  . PHE B 130 ? 0.4529 0.7114 0.3456 -0.1263 0.1162  -0.0710 131 PHE B CZ  
2211 N N   . ILE B 131 ? 0.4286 0.6775 0.3020 -0.0987 0.0750  -0.0022 132 ILE B N   
2212 C CA  . ILE B 131 ? 0.4101 0.6722 0.3102 -0.0888 0.0689  -0.0020 132 ILE B CA  
2213 C C   . ILE B 131 ? 0.4399 0.7166 0.3335 -0.0806 0.0524  0.0054  132 ILE B C   
2214 O O   . ILE B 131 ? 0.4259 0.7304 0.3384 -0.0814 0.0451  -0.0006 132 ILE B O   
2215 C CB  . ILE B 131 ? 0.3884 0.6353 0.3004 -0.0794 0.0749  0.0040  132 ILE B CB  
2216 C CG1 . ILE B 131 ? 0.3690 0.6088 0.2908 -0.0868 0.0876  -0.0024 132 ILE B CG1 
2217 C CG2 . ILE B 131 ? 0.3679 0.6321 0.3051 -0.0688 0.0709  0.0040  132 ILE B CG2 
2218 C CD1 . ILE B 131 ? 0.3468 0.5668 0.2673 -0.0824 0.0927  0.0042  132 ILE B CD1 
2219 N N   . ASP B 132 ? 0.4917 0.7506 0.3574 -0.0740 0.0453  0.0189  133 ASP B N   
2220 C CA  . ASP B 132 ? 0.5322 0.8051 0.3919 -0.0615 0.0265  0.0288  133 ASP B CA  
2221 C C   . ASP B 132 ? 0.5455 0.8470 0.3983 -0.0732 0.0160  0.0216  133 ASP B C   
2222 O O   . ASP B 132 ? 0.5478 0.8819 0.4167 -0.0669 0.0010  0.0219  133 ASP B O   
2223 C CB  . ASP B 132 ? 0.5804 0.8190 0.4040 -0.0524 0.0199  0.0471  133 ASP B CB  
2224 C CG  . ASP B 132 ? 0.6311 0.8799 0.4575 -0.0294 0.0004  0.0598  133 ASP B CG  
2225 O OD1 . ASP B 132 ? 0.6967 0.9635 0.5580 -0.0118 -0.0009 0.0577  133 ASP B OD1 
2226 O OD2 . ASP B 132 ? 0.7160 0.9567 0.5096 -0.0280 -0.0134 0.0723  133 ASP B OD2 
2227 N N   . ARG B 133 ? 0.5625 0.8547 0.3919 -0.0909 0.0246  0.0135  134 ARG B N   
2228 C CA  . ARG B 133 ? 0.5939 0.9065 0.4073 -0.1051 0.0169  0.0035  134 ARG B CA  
2229 C C   . ARG B 133 ? 0.5684 0.9088 0.4169 -0.1122 0.0167  -0.0136 134 ARG B C   
2230 O O   . ARG B 133 ? 0.5808 0.9507 0.4328 -0.1174 0.0015  -0.0179 134 ARG B O   
2231 C CB  . ARG B 133 ? 0.6094 0.9031 0.3915 -0.1209 0.0321  -0.0041 134 ARG B CB  
2232 C CG  . ARG B 133 ? 0.6847 0.9889 0.4338 -0.1356 0.0267  -0.0125 134 ARG B CG  
2233 C CD  . ARG B 133 ? 0.7263 1.0106 0.4357 -0.1465 0.0410  -0.0112 134 ARG B CD  
2234 N NE  . ARG B 133 ? 0.7124 0.9859 0.4417 -0.1482 0.0638  -0.0203 134 ARG B NE  
2235 C CZ  . ARG B 133 ? 0.6901 0.9460 0.4126 -0.1483 0.0751  -0.0096 134 ARG B CZ  
2236 N NH1 . ARG B 133 ? 0.7160 0.9539 0.4084 -0.1476 0.0676  0.0112  134 ARG B NH1 
2237 N NH2 . ARG B 133 ? 0.6289 0.8846 0.3743 -0.1497 0.0932  -0.0195 134 ARG B NH2 
2238 N N   . ALA B 134 ? 0.5371 0.8674 0.4105 -0.1136 0.0327  -0.0219 135 ALA B N   
2239 C CA  . ALA B 134 ? 0.5245 0.8709 0.4270 -0.1227 0.0352  -0.0361 135 ALA B CA  
2240 C C   . ALA B 134 ? 0.5216 0.9021 0.4537 -0.1150 0.0219  -0.0300 135 ALA B C   
2241 O O   . ALA B 134 ? 0.5215 0.9305 0.4656 -0.1272 0.0129  -0.0392 135 ALA B O   
2242 C CB  . ALA B 134 ? 0.4878 0.8125 0.4071 -0.1225 0.0533  -0.0411 135 ALA B CB  
2243 N N   . LEU B 135 ? 0.5197 0.8981 0.4626 -0.0954 0.0212  -0.0157 136 LEU B N   
2244 C CA  . LEU B 135 ? 0.5266 0.9399 0.5015 -0.0830 0.0121  -0.0104 136 LEU B CA  
2245 C C   . LEU B 135 ? 0.5634 1.0089 0.5340 -0.0745 -0.0107 -0.0024 136 LEU B C   
2246 O O   . LEU B 135 ? 0.5647 1.0514 0.5674 -0.0648 -0.0199 -0.0001 136 LEU B O   
2247 C CB  . LEU B 135 ? 0.5072 0.9033 0.4930 -0.0627 0.0213  -0.0005 136 LEU B CB  
2248 C CG  . LEU B 135 ? 0.4784 0.8545 0.4754 -0.0702 0.0407  -0.0072 136 LEU B CG  
2249 C CD1 . LEU B 135 ? 0.4486 0.8070 0.4499 -0.0519 0.0487  0.0010  136 LEU B CD1 
2250 C CD2 . LEU B 135 ? 0.4159 0.8193 0.4413 -0.0858 0.0446  -0.0182 136 LEU B CD2 
2251 N N   . SER B 136 ? 0.6087 1.0383 0.5398 -0.0779 -0.0197 0.0023  137 SER B N   
2252 C CA  . SER B 136 ? 0.6537 1.1127 0.5730 -0.0728 -0.0443 0.0105  137 SER B CA  
2253 C C   . SER B 136 ? 0.6617 1.1708 0.6019 -0.0911 -0.0562 -0.0033 137 SER B C   
2254 O O   . SER B 136 ? 0.6698 1.2231 0.6241 -0.0830 -0.0776 0.0031  137 SER B O   
2255 C CB  . SER B 136 ? 0.6884 1.1174 0.5534 -0.0802 -0.0485 0.0163  137 SER B CB  
2256 O OG  . SER B 136 ? 0.7322 1.1289 0.5764 -0.0596 -0.0506 0.0366  137 SER B OG  
2257 N N   . ASP B 137 ? 0.6643 1.1638 0.6038 -0.1164 -0.0430 -0.0223 138 ASP B N   
2258 C CA  . ASP B 137 ? 0.6792 1.2150 0.6354 -0.1400 -0.0505 -0.0385 138 ASP B CA  
2259 C C   . ASP B 137 ? 0.6508 1.2100 0.6571 -0.1409 -0.0408 -0.0423 138 ASP B C   
2260 O O   . ASP B 137 ? 0.6231 1.1507 0.6374 -0.1359 -0.0207 -0.0419 138 ASP B O   
2261 C CB  . ASP B 137 ? 0.6977 1.1986 0.6222 -0.1648 -0.0385 -0.0574 138 ASP B CB  
2262 C CG  . ASP B 137 ? 0.7351 1.2616 0.6649 -0.1936 -0.0467 -0.0767 138 ASP B CG  
2263 O OD1 . ASP B 137 ? 0.7627 1.3359 0.7300 -0.1984 -0.0573 -0.0765 138 ASP B OD1 
2264 O OD2 . ASP B 137 ? 0.7935 1.2935 0.6894 -0.2126 -0.0416 -0.0935 138 ASP B OD2 
2265 N N   . ASP B 138 ? 0.6611 1.2785 0.6995 -0.1487 -0.0554 -0.0454 139 ASP B N   
2266 C CA  . ASP B 138 ? 0.6434 1.2933 0.7301 -0.1545 -0.0461 -0.0495 139 ASP B CA  
2267 C C   . ASP B 138 ? 0.6367 1.2578 0.7216 -0.1852 -0.0286 -0.0661 139 ASP B C   
2268 O O   . ASP B 138 ? 0.6172 1.2338 0.7263 -0.1867 -0.0120 -0.0658 139 ASP B O   
2269 C CB  . ASP B 138 ? 0.6589 1.3882 0.7822 -0.1596 -0.0674 -0.0499 139 ASP B CB  
2270 C CG  . ASP B 138 ? 0.6706 1.4418 0.8299 -0.1242 -0.0732 -0.0340 139 ASP B CG  
2271 O OD1 . ASP B 138 ? 0.6974 1.4502 0.8724 -0.1084 -0.0535 -0.0296 139 ASP B OD1 
2272 O OD2 . ASP B 138 ? 0.7228 1.5460 0.8946 -0.1113 -0.0978 -0.0265 139 ASP B OD2 
2273 N N   . HIS B 139 ? 0.6627 1.2627 0.7166 -0.2094 -0.0325 -0.0807 140 HIS B N   
2274 C CA  . HIS B 139 ? 0.6767 1.2370 0.7218 -0.2365 -0.0166 -0.0975 140 HIS B CA  
2275 C C   . HIS B 139 ? 0.6382 1.1368 0.6706 -0.2240 0.0065  -0.0945 140 HIS B C   
2276 O O   . HIS B 139 ? 0.6387 1.1057 0.6724 -0.2397 0.0204  -0.1031 140 HIS B O   
2277 C CB  . HIS B 139 ? 0.7314 1.2779 0.7401 -0.2615 -0.0260 -0.1161 140 HIS B CB  
2278 C CG  . HIS B 139 ? 0.8097 1.2974 0.7979 -0.2818 -0.0084 -0.1340 140 HIS B CG  
2279 N ND1 . HIS B 139 ? 0.8773 1.3104 0.8290 -0.2735 0.0037  -0.1406 140 HIS B ND1 
2280 C CD2 . HIS B 139 ? 0.8647 1.3386 0.8636 -0.3093 -0.0009 -0.1464 140 HIS B CD2 
2281 C CE1 . HIS B 139 ? 0.9033 1.2910 0.8455 -0.2909 0.0172  -0.1567 140 HIS B CE1 
2282 N NE2 . HIS B 139 ? 0.8933 1.2997 0.8611 -0.3134 0.0145  -0.1596 140 HIS B NE2 
2283 N N   . SER B 140 ? 0.5964 1.0781 0.6161 -0.1968 0.0093  -0.0815 141 SER B N   
2284 C CA  . SER B 140 ? 0.5701 1.0006 0.5768 -0.1862 0.0280  -0.0792 141 SER B CA  
2285 C C   . SER B 140 ? 0.5215 0.9484 0.5554 -0.1762 0.0410  -0.0693 141 SER B C   
2286 O O   . SER B 140 ? 0.4914 0.9528 0.5498 -0.1650 0.0371  -0.0595 141 SER B O   
2287 C CB  . SER B 140 ? 0.5703 0.9848 0.5504 -0.1665 0.0263  -0.0698 141 SER B CB  
2288 O OG  . SER B 140 ? 0.6113 1.0261 0.5599 -0.1761 0.0166  -0.0780 141 SER B OG  
2289 N N   . LYS B 141 ? 0.4988 0.8830 0.5254 -0.1791 0.0564  -0.0726 142 LYS B N   
2290 C CA  . LYS B 141 ? 0.4642 0.8345 0.5050 -0.1705 0.0691  -0.0633 142 LYS B CA  
2291 C C   . LYS B 141 ? 0.4414 0.7672 0.4615 -0.1595 0.0789  -0.0624 142 LYS B C   
2292 O O   . LYS B 141 ? 0.4550 0.7532 0.4594 -0.1675 0.0828  -0.0735 142 LYS B O   
2293 C CB  . LYS B 141 ? 0.4805 0.8485 0.5357 -0.1924 0.0755  -0.0686 142 LYS B CB  
2294 C CG  . LYS B 141 ? 0.4856 0.8452 0.5535 -0.1870 0.0879  -0.0579 142 LYS B CG  
2295 C CD  . LYS B 141 ? 0.5095 0.8560 0.5835 -0.2121 0.0957  -0.0611 142 LYS B CD  
2296 C CE  . LYS B 141 ? 0.5216 0.9181 0.6208 -0.2312 0.0917  -0.0637 142 LYS B CE  
2297 N NZ  . LYS B 141 ? 0.5523 0.9382 0.6588 -0.2501 0.1049  -0.0588 142 LYS B NZ  
2298 N N   . ILE B 142 ? 0.4053 0.7262 0.4255 -0.1412 0.0828  -0.0505 143 ILE B N   
2299 C CA  . ILE B 142 ? 0.3933 0.6835 0.3976 -0.1315 0.0901  -0.0489 143 ILE B CA  
2300 C C   . ILE B 142 ? 0.3731 0.6455 0.3855 -0.1257 0.0997  -0.0412 143 ILE B C   
2301 O O   . ILE B 142 ? 0.3687 0.6535 0.3923 -0.1216 0.1007  -0.0331 143 ILE B O   
2302 C CB  . ILE B 142 ? 0.3885 0.6835 0.3774 -0.1190 0.0851  -0.0419 143 ILE B CB  
2303 C CG1 . ILE B 142 ? 0.3883 0.6593 0.3657 -0.1125 0.0940  -0.0398 143 ILE B CG1 
2304 C CG2 . ILE B 142 ? 0.3683 0.6809 0.3670 -0.1067 0.0801  -0.0302 143 ILE B CG2 
2305 C CD1 . ILE B 142 ? 0.4184 0.6887 0.3748 -0.1076 0.0911  -0.0348 143 ILE B CD1 
2306 N N   . LEU B 143 ? 0.3702 0.6155 0.3761 -0.1244 0.1063  -0.0441 144 LEU B N   
2307 C CA  . LEU B 143 ? 0.3644 0.5936 0.3737 -0.1171 0.1123  -0.0354 144 LEU B CA  
2308 C C   . LEU B 143 ? 0.3562 0.5824 0.3577 -0.1058 0.1136  -0.0320 144 LEU B C   
2309 O O   . LEU B 143 ? 0.3693 0.5902 0.3648 -0.1042 0.1159  -0.0394 144 LEU B O   
2310 C CB  . LEU B 143 ? 0.3906 0.5918 0.4004 -0.1217 0.1171  -0.0394 144 LEU B CB  
2311 C CG  . LEU B 143 ? 0.4056 0.5883 0.4166 -0.1128 0.1206  -0.0292 144 LEU B CG  
2312 C CD1 . LEU B 143 ? 0.3662 0.5550 0.3801 -0.1167 0.1215  -0.0175 144 LEU B CD1 
2313 C CD2 . LEU B 143 ? 0.4512 0.5996 0.4601 -0.1126 0.1236  -0.0332 144 LEU B CD2 
2314 N N   . VAL B 144 ? 0.3402 0.5711 0.3410 -0.0997 0.1131  -0.0222 145 VAL B N   
2315 C CA  . VAL B 144 ? 0.3360 0.5630 0.3303 -0.0936 0.1145  -0.0182 145 VAL B CA  
2316 C C   . VAL B 144 ? 0.3498 0.5667 0.3497 -0.0908 0.1167  -0.0127 145 VAL B C   
2317 O O   . VAL B 144 ? 0.3613 0.5753 0.3620 -0.0918 0.1169  -0.0066 145 VAL B O   
2318 C CB  . VAL B 144 ? 0.3289 0.5598 0.3135 -0.0905 0.1117  -0.0117 145 VAL B CB  
2319 C CG1 . VAL B 144 ? 0.3086 0.5352 0.2842 -0.0904 0.1130  -0.0091 145 VAL B CG1 
2320 C CG2 . VAL B 144 ? 0.2918 0.5324 0.2705 -0.0906 0.1064  -0.0137 145 VAL B CG2 
2321 N N   . HIS B 145 ? 0.3664 0.5803 0.3703 -0.0866 0.1183  -0.0147 146 HIS B N   
2322 C CA  . HIS B 145 ? 0.3781 0.5839 0.3874 -0.0818 0.1172  -0.0074 146 HIS B CA  
2323 C C   . HIS B 145 ? 0.3824 0.6001 0.3968 -0.0761 0.1158  -0.0053 146 HIS B C   
2324 O O   . HIS B 145 ? 0.3812 0.6127 0.3968 -0.0768 0.1186  -0.0112 146 HIS B O   
2325 C CB  . HIS B 145 ? 0.4010 0.5874 0.4156 -0.0799 0.1187  -0.0101 146 HIS B CB  
2326 C CG  . HIS B 145 ? 0.3936 0.5774 0.4158 -0.0709 0.1217  -0.0192 146 HIS B CG  
2327 N ND1 . HIS B 145 ? 0.4104 0.5932 0.4428 -0.0579 0.1202  -0.0151 146 HIS B ND1 
2328 C CD2 . HIS B 145 ? 0.3733 0.5569 0.3941 -0.0719 0.1264  -0.0332 146 HIS B CD2 
2329 C CE1 . HIS B 145 ? 0.4072 0.5897 0.4472 -0.0490 0.1256  -0.0271 146 HIS B CE1 
2330 N NE2 . HIS B 145 ? 0.3955 0.5768 0.4262 -0.0585 0.1302  -0.0389 146 HIS B NE2 
2331 N N   . CYS B 146 ? 0.3925 0.6082 0.4091 -0.0723 0.1113  0.0039  147 CYS B N   
2332 C CA  . CYS B 146 ? 0.4006 0.6335 0.4289 -0.0655 0.1078  0.0062  147 CYS B CA  
2333 C C   . CYS B 146 ? 0.4173 0.6375 0.4507 -0.0554 0.1021  0.0150  147 CYS B C   
2334 O O   . CYS B 146 ? 0.4463 0.6414 0.4768 -0.0532 0.1043  0.0150  147 CYS B O   
2335 C CB  . CYS B 146 ? 0.3946 0.6430 0.4150 -0.0747 0.1043  0.0097  147 CYS B CB  
2336 S SG  . CYS B 146 ? 0.4463 0.6780 0.4435 -0.0830 0.1006  0.0178  147 CYS B SG  
2337 N N   . VAL B 147 ? 0.4154 0.6508 0.4549 -0.0502 0.0937  0.0233  148 VAL B N   
2338 C CA  . VAL B 147 ? 0.4232 0.6441 0.4651 -0.0379 0.0860  0.0345  148 VAL B CA  
2339 C C   . VAL B 147 ? 0.4334 0.6283 0.4506 -0.0477 0.0841  0.0450  148 VAL B C   
2340 O O   . VAL B 147 ? 0.4492 0.6139 0.4597 -0.0451 0.0854  0.0503  148 VAL B O   
2341 C CB  . VAL B 147 ? 0.4290 0.6804 0.4874 -0.0274 0.0748  0.0413  148 VAL B CB  
2342 C CG1 . VAL B 147 ? 0.4452 0.6770 0.5043 -0.0104 0.0647  0.0553  148 VAL B CG1 
2343 C CG2 . VAL B 147 ? 0.4159 0.6993 0.5015 -0.0189 0.0804  0.0292  148 VAL B CG2 
2344 N N   A MET B 148 ? 0.4239 0.6296 0.4263 -0.0602 0.0827  0.0468  149 MET B N   
2345 N N   B MET B 148 ? 0.4212 0.6254 0.4228 -0.0603 0.0827  0.0472  149 MET B N   
2346 C CA  A MET B 148 ? 0.4409 0.6301 0.4185 -0.0702 0.0832  0.0546  149 MET B CA  
2347 C CA  B MET B 148 ? 0.4366 0.6214 0.4140 -0.0700 0.0843  0.0548  149 MET B CA  
2348 C C   A MET B 148 ? 0.4206 0.6043 0.3909 -0.0804 0.0947  0.0459  149 MET B C   
2349 C C   B MET B 148 ? 0.4169 0.5998 0.3871 -0.0807 0.0952  0.0457  149 MET B C   
2350 O O   A MET B 148 ? 0.4242 0.5956 0.3803 -0.0874 0.0996  0.0499  149 MET B O   
2351 O O   B MET B 148 ? 0.4197 0.5916 0.3752 -0.0881 0.1002  0.0493  149 MET B O   
2352 C CB  A MET B 148 ? 0.4571 0.6614 0.4203 -0.0763 0.0744  0.0598  149 MET B CB  
2353 C CB  B MET B 148 ? 0.4567 0.6506 0.4168 -0.0746 0.0748  0.0638  149 MET B CB  
2354 C CG  A MET B 148 ? 0.4996 0.7159 0.4682 -0.0668 0.0590  0.0718  149 MET B CG  
2355 C CG  B MET B 148 ? 0.4847 0.6904 0.4546 -0.0627 0.0601  0.0744  149 MET B CG  
2356 S SD  A MET B 148 ? 0.5801 0.8003 0.5155 -0.0786 0.0472  0.0823  149 MET B SD  
2357 S SD  B MET B 148 ? 0.5294 0.7010 0.4903 -0.0517 0.0548  0.0919  149 MET B SD  
2358 C CE  A MET B 148 ? 0.5211 0.7695 0.4604 -0.0915 0.0466  0.0680  149 MET B CE  
2359 C CE  B MET B 148 ? 0.5453 0.6868 0.4809 -0.0692 0.0699  0.0914  149 MET B CE  
2360 N N   . GLY B 149 ? 0.3936 0.5895 0.3736 -0.0810 0.0987  0.0347  150 GLY B N   
2361 C CA  . GLY B 149 ? 0.3905 0.5855 0.3655 -0.0869 0.1064  0.0276  150 GLY B CA  
2362 C C   . GLY B 149 ? 0.3965 0.5915 0.3532 -0.0923 0.1080  0.0279  150 GLY B C   
2363 O O   . GLY B 149 ? 0.4195 0.6124 0.3717 -0.0941 0.1150  0.0250  150 GLY B O   
2364 N N   . ARG B 150 ? 0.3978 0.5964 0.3446 -0.0948 0.1019  0.0300  151 ARG B N   
2365 C CA  . ARG B 150 ? 0.4203 0.6124 0.3439 -0.1008 0.1033  0.0281  151 ARG B CA  
2366 C C   . ARG B 150 ? 0.4201 0.6114 0.3367 -0.1055 0.1016  0.0213  151 ARG B C   
2367 O O   . ARG B 150 ? 0.4370 0.6140 0.3342 -0.1078 0.1059  0.0161  151 ARG B O   
2368 C CB  . ARG B 150 ? 0.4430 0.6342 0.3502 -0.1053 0.0962  0.0362  151 ARG B CB  
2369 C CG  . ARG B 150 ? 0.4753 0.6606 0.3825 -0.1028 0.0963  0.0467  151 ARG B CG  
2370 C CD  . ARG B 150 ? 0.4709 0.6478 0.3686 -0.1061 0.1090  0.0451  151 ARG B CD  
2371 N NE  . ARG B 150 ? 0.4566 0.6242 0.3545 -0.1078 0.1104  0.0558  151 ARG B NE  
2372 C CZ  . ARG B 150 ? 0.4420 0.6070 0.3401 -0.1134 0.1219  0.0557  151 ARG B CZ  
2373 N NH1 . ARG B 150 ? 0.4392 0.6161 0.3410 -0.1142 0.1328  0.0452  151 ARG B NH1 
2374 N NH2 . ARG B 150 ? 0.4731 0.6239 0.3675 -0.1184 0.1226  0.0668  151 ARG B NH2 
2375 N N   . SER B 151 ? 0.4094 0.6142 0.3401 -0.1073 0.0965  0.0210  152 SER B N   
2376 C CA  . SER B 151 ? 0.4088 0.6135 0.3305 -0.1177 0.0944  0.0167  152 SER B CA  
2377 C C   . SER B 151 ? 0.3876 0.5964 0.3202 -0.1173 0.0985  0.0133  152 SER B C   
2378 O O   . SER B 151 ? 0.3920 0.5821 0.3101 -0.1188 0.1024  0.0104  152 SER B O   
2379 C CB  . SER B 151 ? 0.4208 0.6462 0.3464 -0.1263 0.0842  0.0200  152 SER B CB  
2380 O OG  . SER B 151 ? 0.4475 0.6760 0.3662 -0.1413 0.0825  0.0158  152 SER B OG  
2381 N N   . ARG B 152 ? 0.3719 0.6034 0.3275 -0.1140 0.0978  0.0138  153 ARG B N   
2382 C CA  . ARG B 152 ? 0.3682 0.6063 0.3302 -0.1156 0.1030  0.0099  153 ARG B CA  
2383 C C   . ARG B 152 ? 0.3734 0.5954 0.3300 -0.1082 0.1078  0.0078  153 ARG B C   
2384 O O   . ARG B 152 ? 0.3727 0.5831 0.3153 -0.1119 0.1098  0.0070  153 ARG B O   
2385 C CB  . ARG B 152 ? 0.3519 0.6190 0.3405 -0.1102 0.1039  0.0081  153 ARG B CB  
2386 C CG  . ARG B 152 ? 0.3502 0.6470 0.3510 -0.1182 0.0992  0.0094  153 ARG B CG  
2387 C CD  . ARG B 152 ? 0.3158 0.6424 0.3473 -0.1055 0.1005  0.0072  153 ARG B CD  
2388 N NE  . ARG B 152 ? 0.3121 0.6340 0.3517 -0.0913 0.0929  0.0132  153 ARG B NE  
2389 C CZ  . ARG B 152 ? 0.3104 0.6551 0.3756 -0.0769 0.0888  0.0150  153 ARG B CZ  
2390 N NH1 . ARG B 152 ? 0.2830 0.6642 0.3735 -0.0735 0.0934  0.0089  153 ARG B NH1 
2391 N NH2 . ARG B 152 ? 0.2585 0.5904 0.3235 -0.0653 0.0804  0.0236  153 ARG B NH2 
2392 N N   . SER B 153 ? 0.3667 0.5882 0.3336 -0.0988 0.1085  0.0078  154 SER B N   
2393 C CA  . SER B 153 ? 0.3781 0.5935 0.3450 -0.0941 0.1114  0.0049  154 SER B CA  
2394 C C   . SER B 153 ? 0.3882 0.5890 0.3393 -0.0929 0.1116  0.0062  154 SER B C   
2395 O O   . SER B 153 ? 0.4021 0.5986 0.3471 -0.0902 0.1115  0.0052  154 SER B O   
2396 C CB  . SER B 153 ? 0.3757 0.5926 0.3562 -0.0891 0.1125  0.0042  154 SER B CB  
2397 O OG  . SER B 153 ? 0.4035 0.6153 0.3825 -0.0886 0.1109  0.0100  154 SER B OG  
2398 N N   . ALA B 154 ? 0.3841 0.5772 0.3271 -0.0934 0.1116  0.0083  155 ALA B N   
2399 C CA  . ALA B 154 ? 0.3912 0.5693 0.3192 -0.0892 0.1141  0.0071  155 ALA B CA  
2400 C C   . ALA B 154 ? 0.3981 0.5585 0.3090 -0.0911 0.1125  0.0068  155 ALA B C   
2401 O O   . ALA B 154 ? 0.4127 0.5622 0.3172 -0.0820 0.1132  0.0064  155 ALA B O   
2402 C CB  . ALA B 154 ? 0.3885 0.5593 0.3038 -0.0924 0.1154  0.0076  155 ALA B CB  
2403 N N   . THR B 155 ? 0.3951 0.5530 0.2986 -0.1032 0.1100  0.0077  156 THR B N   
2404 C CA  . THR B 155 ? 0.4094 0.5445 0.2912 -0.1102 0.1093  0.0088  156 THR B CA  
2405 C C   . THR B 155 ? 0.4106 0.5459 0.2925 -0.1057 0.1090  0.0116  156 THR B C   
2406 O O   . THR B 155 ? 0.4434 0.5519 0.3044 -0.1033 0.1077  0.0147  156 THR B O   
2407 C CB  . THR B 155 ? 0.4188 0.5594 0.2962 -0.1287 0.1074  0.0092  156 THR B CB  
2408 O OG1 . THR B 155 ? 0.4156 0.5584 0.2904 -0.1336 0.1048  0.0072  156 THR B OG1 
2409 C CG2 . THR B 155 ? 0.4327 0.5420 0.2816 -0.1414 0.1077  0.0113  156 THR B CG2 
2410 N N   . LEU B 156 ? 0.3821 0.5439 0.2840 -0.1040 0.1095  0.0105  157 LEU B N   
2411 C CA  . LEU B 156 ? 0.3796 0.5439 0.2776 -0.1015 0.1083  0.0121  157 LEU B CA  
2412 C C   . LEU B 156 ? 0.3826 0.5430 0.2816 -0.0864 0.1046  0.0131  157 LEU B C   
2413 O O   . LEU B 156 ? 0.4047 0.5537 0.2889 -0.0818 0.1003  0.0179  157 LEU B O   
2414 C CB  . LEU B 156 ? 0.3606 0.5520 0.2759 -0.1051 0.1110  0.0073  157 LEU B CB  
2415 C CG  . LEU B 156 ? 0.3493 0.5543 0.2677 -0.1176 0.1156  0.0058  157 LEU B CG  
2416 C CD1 . LEU B 156 ? 0.3201 0.5494 0.2564 -0.1150 0.1200  -0.0017 157 LEU B CD1 
2417 C CD2 . LEU B 156 ? 0.3231 0.5147 0.2164 -0.1314 0.1172  0.0110  157 LEU B CD2 
2418 N N   . VAL B 157 ? 0.3747 0.5467 0.2911 -0.0787 0.1061  0.0097  158 VAL B N   
2419 C CA  . VAL B 157 ? 0.3646 0.5427 0.2882 -0.0650 0.1037  0.0098  158 VAL B CA  
2420 C C   . VAL B 157 ? 0.3931 0.5439 0.2984 -0.0541 0.1034  0.0126  158 VAL B C   
2421 O O   . VAL B 157 ? 0.4023 0.5514 0.3062 -0.0400 0.0987  0.0156  158 VAL B O   
2422 C CB  . VAL B 157 ? 0.3545 0.5544 0.3010 -0.0637 0.1078  0.0054  158 VAL B CB  
2423 C CG1 . VAL B 157 ? 0.3371 0.5517 0.2954 -0.0501 0.1074  0.0046  158 VAL B CG1 
2424 C CG2 . VAL B 157 ? 0.3064 0.5237 0.2669 -0.0728 0.1073  0.0022  158 VAL B CG2 
2425 N N   . LEU B 158 ? 0.4083 0.5364 0.2986 -0.0598 0.1075  0.0112  159 LEU B N   
2426 C CA  . LEU B 158 ? 0.4463 0.5385 0.3136 -0.0503 0.1082  0.0116  159 LEU B CA  
2427 C C   . LEU B 158 ? 0.4936 0.5585 0.3382 -0.0499 0.1018  0.0197  159 LEU B C   
2428 O O   . LEU B 158 ? 0.5278 0.5749 0.3639 -0.0316 0.0980  0.0235  159 LEU B O   
2429 C CB  . LEU B 158 ? 0.4597 0.5305 0.3099 -0.0621 0.1128  0.0070  159 LEU B CB  
2430 C CG  . LEU B 158 ? 0.4420 0.5305 0.3041 -0.0596 0.1193  0.0004  159 LEU B CG  
2431 C CD1 . LEU B 158 ? 0.4336 0.5068 0.2767 -0.0756 0.1204  -0.0031 159 LEU B CD1 
2432 C CD2 . LEU B 158 ? 0.3972 0.4813 0.2602 -0.0387 0.1253  -0.0047 159 LEU B CD2 
2433 N N   . ALA B 159 ? 0.4943 0.5584 0.3297 -0.0694 0.1008  0.0232  160 ALA B N   
2434 C CA  . ALA B 159 ? 0.5294 0.5691 0.3393 -0.0748 0.0963  0.0324  160 ALA B CA  
2435 C C   . ALA B 159 ? 0.5260 0.5807 0.3421 -0.0589 0.0886  0.0380  160 ALA B C   
2436 O O   . ALA B 159 ? 0.5535 0.5789 0.3470 -0.0488 0.0821  0.0472  160 ALA B O   
2437 C CB  . ALA B 159 ? 0.5156 0.5680 0.3223 -0.0999 0.0997  0.0331  160 ALA B CB  
2438 N N   . TYR B 160 ? 0.4926 0.5908 0.3378 -0.0569 0.0881  0.0327  161 TYR B N   
2439 C CA  . TYR B 160 ? 0.4986 0.6175 0.3516 -0.0448 0.0791  0.0362  161 TYR B CA  
2440 C C   . TYR B 160 ? 0.5224 0.6334 0.3787 -0.0195 0.0734  0.0396  161 TYR B C   
2441 O O   . TYR B 160 ? 0.5554 0.6574 0.3986 -0.0070 0.0627  0.0492  161 TYR B O   
2442 C CB  . TYR B 160 ? 0.4605 0.6236 0.3444 -0.0491 0.0804  0.0272  161 TYR B CB  
2443 C CG  . TYR B 160 ? 0.4688 0.6590 0.3655 -0.0372 0.0700  0.0286  161 TYR B CG  
2444 C CD1 . TYR B 160 ? 0.5104 0.7037 0.3897 -0.0399 0.0601  0.0344  161 TYR B CD1 
2445 C CD2 . TYR B 160 ? 0.4578 0.6741 0.3832 -0.0247 0.0698  0.0241  161 TYR B CD2 
2446 C CE1 . TYR B 160 ? 0.5315 0.7553 0.4230 -0.0299 0.0473  0.0357  161 TYR B CE1 
2447 C CE2 . TYR B 160 ? 0.4717 0.7208 0.4132 -0.0155 0.0593  0.0249  161 TYR B CE2 
2448 C CZ  . TYR B 160 ? 0.5026 0.7560 0.4280 -0.0176 0.0467  0.0308  161 TYR B CZ  
2449 O OH  . TYR B 160 ? 0.5152 0.8070 0.4587 -0.0093 0.0340  0.0313  161 TYR B OH  
2450 N N   . LEU B 161 ? 0.5149 0.6323 0.3894 -0.0105 0.0805  0.0319  162 LEU B N   
2451 C CA  . LEU B 161 ? 0.5376 0.6556 0.4213 0.0164  0.0779  0.0324  162 LEU B CA  
2452 C C   . LEU B 161 ? 0.5948 0.6573 0.4437 0.0297  0.0736  0.0412  162 LEU B C   
2453 O O   . LEU B 161 ? 0.6203 0.6806 0.4713 0.0552  0.0653  0.0470  162 LEU B O   
2454 C CB  . LEU B 161 ? 0.5155 0.6493 0.4203 0.0212  0.0900  0.0212  162 LEU B CB  
2455 C CG  . LEU B 161 ? 0.4822 0.6690 0.4216 0.0111  0.0932  0.0150  162 LEU B CG  
2456 C CD1 . LEU B 161 ? 0.4521 0.6503 0.4052 0.0138  0.1059  0.0064  162 LEU B CD1 
2457 C CD2 . LEU B 161 ? 0.4634 0.6927 0.4275 0.0208  0.0827  0.0174  162 LEU B CD2 
2458 N N   . MET B 162 ? 0.6183 0.6363 0.4355 0.0119  0.0784  0.0425  163 MET B N   
2459 C CA  . MET B 162 ? 0.6782 0.6320 0.4559 0.0186  0.0758  0.0503  163 MET B CA  
2460 C C   . MET B 162 ? 0.7070 0.6433 0.4607 0.0193  0.0632  0.0669  163 MET B C   
2461 O O   . MET B 162 ? 0.7667 0.6633 0.4989 0.0406  0.0554  0.0769  163 MET B O   
2462 C CB  . MET B 162 ? 0.6935 0.6092 0.4448 -0.0077 0.0846  0.0459  163 MET B CB  
2463 C CG  . MET B 162 ? 0.6939 0.6046 0.4517 -0.0049 0.0954  0.0310  163 MET B CG  
2464 S SD  . MET B 162 ? 0.6653 0.5718 0.4116 -0.0428 0.1024  0.0240  163 MET B SD  
2465 C CE  . MET B 162 ? 0.7064 0.5319 0.3986 -0.0566 0.1015  0.0287  163 MET B CE  
2466 N N   . ILE B 163 ? 0.6772 0.6404 0.4314 -0.0033 0.0616  0.0699  164 ILE B N   
2467 C CA  . ILE B 163 ? 0.7071 0.6538 0.4311 -0.0096 0.0519  0.0853  164 ILE B CA  
2468 C C   . ILE B 163 ? 0.7196 0.6973 0.4573 0.0140  0.0367  0.0924  164 ILE B C   
2469 O O   . ILE B 163 ? 0.7548 0.7038 0.4623 0.0237  0.0243  0.1088  164 ILE B O   
2470 C CB  . ILE B 163 ? 0.6798 0.6514 0.4013 -0.0417 0.0582  0.0827  164 ILE B CB  
2471 C CG1 . ILE B 163 ? 0.6594 0.6044 0.3663 -0.0667 0.0705  0.0784  164 ILE B CG1 
2472 C CG2 . ILE B 163 ? 0.6863 0.6544 0.3776 -0.0488 0.0487  0.0972  164 ILE B CG2 
2473 C CD1 . ILE B 163 ? 0.6016 0.5814 0.3167 -0.0933 0.0785  0.0731  164 ILE B CD1 
2474 N N   . HIS B 164 ? 0.6752 0.7114 0.4568 0.0213  0.0368  0.0809  165 HIS B N   
2475 C CA  . HIS B 164 ? 0.6815 0.7616 0.4812 0.0358  0.0217  0.0851  165 HIS B CA  
2476 C C   . HIS B 164 ? 0.6792 0.7892 0.5154 0.0675  0.0165  0.0816  165 HIS B C   
2477 O O   . HIS B 164 ? 0.6883 0.8318 0.5372 0.0829  0.0007  0.0879  165 HIS B O   
2478 C CB  . HIS B 164 ? 0.6394 0.7693 0.4589 0.0128  0.0245  0.0744  165 HIS B CB  
2479 C CG  . HIS B 164 ? 0.6626 0.7778 0.4480 -0.0121 0.0256  0.0792  165 HIS B CG  
2480 N ND1 . HIS B 164 ? 0.7249 0.8288 0.4768 -0.0113 0.0118  0.0938  165 HIS B ND1 
2481 C CD2 . HIS B 164 ? 0.6619 0.7741 0.4410 -0.0375 0.0394  0.0715  165 HIS B CD2 
2482 C CE1 . HIS B 164 ? 0.7310 0.8259 0.4559 -0.0374 0.0193  0.0938  165 HIS B CE1 
2483 N NE2 . HIS B 164 ? 0.7113 0.8133 0.4550 -0.0525 0.0363  0.0798  165 HIS B NE2 
2484 N N   . LYS B 165 ? 0.6712 0.7749 0.5248 0.0764  0.0298  0.0710  166 LYS B N   
2485 C CA  . LYS B 165 ? 0.6722 0.8091 0.5623 0.1061  0.0291  0.0657  166 LYS B CA  
2486 C C   . LYS B 165 ? 0.7260 0.8095 0.5985 0.1325  0.0339  0.0672  166 LYS B C   
2487 O O   . LYS B 165 ? 0.7184 0.8214 0.6185 0.1546  0.0417  0.0575  166 LYS B O   
2488 C CB  . LYS B 165 ? 0.6173 0.8042 0.5469 0.0935  0.0428  0.0491  166 LYS B CB  
2489 C CG  . LYS B 165 ? 0.5829 0.8202 0.5317 0.0703  0.0377  0.0458  166 LYS B CG  
2490 C CD  . LYS B 165 ? 0.5869 0.8733 0.5575 0.0853  0.0188  0.0517  166 LYS B CD  
2491 C CE  . LYS B 165 ? 0.5408 0.8613 0.5149 0.0589  0.0113  0.0487  166 LYS B CE  
2492 N NZ  . LYS B 165 ? 0.5468 0.9140 0.5373 0.0707  -0.0095 0.0545  166 LYS B NZ  
2493 N N   . ASP B 166 ? 0.7832 0.7977 0.6076 0.1288  0.0302  0.0788  167 ASP B N   
2494 C CA  . ASP B 166 ? 0.8614 0.8090 0.6585 0.1536  0.0323  0.0820  167 ASP B CA  
2495 C C   . ASP B 166 ? 0.8532 0.7881 0.6593 0.1577  0.0518  0.0632  167 ASP B C   
2496 O O   . ASP B 166 ? 0.8968 0.8091 0.7044 0.1903  0.0552  0.0589  167 ASP B O   
2497 C CB  . ASP B 166 ? 0.9049 0.8609 0.7138 0.1967  0.0162  0.0931  167 ASP B CB  
2498 C CG  . ASP B 166 ? 1.0348 0.9022 0.7990 0.2204  0.0126  0.1038  167 ASP B CG  
2499 O OD1 . ASP B 166 ? 1.1139 0.9150 0.8273 0.1951  0.0133  0.1128  167 ASP B OD1 
2500 O OD2 . ASP B 166 ? 1.0960 0.9596 0.8757 0.2638  0.0096  0.1031  167 ASP B OD2 
2501 N N   . MET B 167 ? 0.8043 0.7540 0.6148 0.1258  0.0645  0.0519  168 MET B N   
2502 C CA  . MET B 167 ? 0.8020 0.7421 0.6158 0.1255  0.0818  0.0348  168 MET B CA  
2503 C C   . MET B 167 ? 0.8297 0.6980 0.5962 0.1038  0.0880  0.0330  168 MET B C   
2504 O O   . MET B 167 ? 0.8267 0.6756 0.5693 0.0748  0.0835  0.0417  168 MET B O   
2505 C CB  . MET B 167 ? 0.7384 0.7428 0.5878 0.1054  0.0910  0.0238  168 MET B CB  
2506 C CG  . MET B 167 ? 0.7228 0.7990 0.6210 0.1238  0.0892  0.0211  168 MET B CG  
2507 S SD  . MET B 167 ? 0.7138 0.8465 0.6446 0.1019  0.1044  0.0072  168 MET B SD  
2508 C CE  . MET B 167 ? 0.6712 0.8859 0.6548 0.1148  0.0964  0.0091  168 MET B CE  
2509 N N   . THR B 168 ? 0.8511 0.6831 0.6043 0.1171  0.0994  0.0201  169 THR B N   
2510 C CA  . THR B 168 ? 0.8655 0.6417 0.5797 0.0924  0.1076  0.0122  169 THR B CA  
2511 C C   . THR B 168 ? 0.7994 0.6247 0.5332 0.0629  0.1155  0.0026  169 THR B C   
2512 O O   . THR B 168 ? 0.7450 0.6358 0.5191 0.0676  0.1183  -0.0008 169 THR B O   
2513 C CB  . THR B 168 ? 0.9263 0.6511 0.6193 0.1160  0.1186  -0.0026 169 THR B CB  
2514 O OG1 . THR B 168 ? 0.8617 0.6397 0.5869 0.1247  0.1318  -0.0187 169 THR B OG1 
2515 C CG2 . THR B 168 ? 0.9648 0.6491 0.6488 0.1582  0.1115  0.0056  169 THR B CG2 
2516 N N   . LEU B 169 ? 0.8041 0.5956 0.5079 0.0322  0.1184  -0.0013 170 LEU B N   
2517 C CA  . LEU B 169 ? 0.7480 0.5795 0.4656 0.0051  0.1230  -0.0080 170 LEU B CA  
2518 C C   . LEU B 169 ? 0.7331 0.5912 0.4670 0.0187  0.1347  -0.0226 170 LEU B C   
2519 O O   . LEU B 169 ? 0.6799 0.5913 0.4415 0.0097  0.1372  -0.0239 170 LEU B O   
2520 C CB  . LEU B 169 ? 0.7647 0.5565 0.4469 -0.0293 0.1223  -0.0098 170 LEU B CB  
2521 C CG  . LEU B 169 ? 0.7280 0.5565 0.4203 -0.0558 0.1249  -0.0168 170 LEU B CG  
2522 C CD1 . LEU B 169 ? 0.6103 0.5068 0.3443 -0.0593 0.1218  -0.0099 170 LEU B CD1 
2523 C CD2 . LEU B 169 ? 0.7603 0.5555 0.4213 -0.0900 0.1214  -0.0169 170 LEU B CD2 
2524 N N   . VAL B 170 ? 0.7877 0.6061 0.5022 0.0407  0.1429  -0.0337 171 VAL B N   
2525 C CA  . VAL B 170 ? 0.7748 0.6200 0.5028 0.0554  0.1572  -0.0488 171 VAL B CA  
2526 C C   . VAL B 170 ? 0.7305 0.6457 0.5090 0.0764  0.1589  -0.0450 171 VAL B C   
2527 O O   . VAL B 170 ? 0.6920 0.6560 0.4924 0.0686  0.1670  -0.0500 171 VAL B O   
2528 C CB  . VAL B 170 ? 0.8476 0.6341 0.5437 0.0786  0.1679  -0.0640 171 VAL B CB  
2529 C CG1 . VAL B 170 ? 0.8086 0.6361 0.5269 0.1003  0.1847  -0.0788 171 VAL B CG1 
2530 C CG2 . VAL B 170 ? 0.8971 0.6211 0.5415 0.0500  0.1691  -0.0734 171 VAL B CG2 
2531 N N   . ASP B 171 ? 0.7382 0.6587 0.5337 0.1010  0.1504  -0.0355 172 ASP B N   
2532 C CA  . ASP B 171 ? 0.7020 0.6940 0.5473 0.1178  0.1498  -0.0323 172 ASP B CA  
2533 C C   . ASP B 171 ? 0.6304 0.6723 0.4985 0.0883  0.1445  -0.0249 172 ASP B C   
2534 O O   . ASP B 171 ? 0.5975 0.6946 0.4970 0.0850  0.1517  -0.0288 172 ASP B O   
2535 C CB  . ASP B 171 ? 0.7322 0.7215 0.5886 0.1466  0.1365  -0.0207 172 ASP B CB  
2536 C CG  . ASP B 171 ? 0.8201 0.7587 0.6575 0.1831  0.1410  -0.0270 172 ASP B CG  
2537 O OD1 . ASP B 171 ? 0.8481 0.7825 0.6832 0.1951  0.1583  -0.0442 172 ASP B OD1 
2538 O OD2 . ASP B 171 ? 0.9167 0.8161 0.7382 0.2000  0.1274  -0.0145 172 ASP B OD2 
2539 N N   . ALA B 172 ? 0.6077 0.6274 0.4580 0.0663  0.1335  -0.0150 173 ALA B N   
2540 C CA  . ALA B 172 ? 0.5485 0.6066 0.4165 0.0407  0.1287  -0.0092 173 ALA B CA  
2541 C C   . ALA B 172 ? 0.5136 0.5900 0.3848 0.0219  0.1386  -0.0167 173 ALA B C   
2542 O O   . ALA B 172 ? 0.4735 0.5944 0.3717 0.0135  0.1398  -0.0154 173 ALA B O   
2543 C CB  . ALA B 172 ? 0.5430 0.5712 0.3877 0.0212  0.1181  0.0007  173 ALA B CB  
2544 N N   . ILE B 173 ? 0.5389 0.5777 0.3790 0.0133  0.1445  -0.0238 174 ILE B N   
2545 C CA  . ILE B 173 ? 0.5220 0.5756 0.3590 -0.0033 0.1523  -0.0298 174 ILE B CA  
2546 C C   . ILE B 173 ? 0.5164 0.6091 0.3761 0.0098  0.1651  -0.0362 174 ILE B C   
2547 O O   . ILE B 173 ? 0.4801 0.6059 0.3540 -0.0038 0.1684  -0.0340 174 ILE B O   
2548 C CB  . ILE B 173 ? 0.5621 0.5681 0.3572 -0.0137 0.1558  -0.0386 174 ILE B CB  
2549 C CG1 . ILE B 173 ? 0.5491 0.5302 0.3263 -0.0364 0.1442  -0.0318 174 ILE B CG1 
2550 C CG2 . ILE B 173 ? 0.5271 0.5500 0.3149 -0.0249 0.1651  -0.0458 174 ILE B CG2 
2551 C CD1 . ILE B 173 ? 0.5730 0.4993 0.3052 -0.0492 0.1452  -0.0411 174 ILE B CD1 
2552 N N   . GLN B 174 ? 0.5503 0.6391 0.4136 0.0362  0.1729  -0.0437 175 GLN B N   
2553 C CA  . GLN B 174 ? 0.5575 0.6924 0.4471 0.0489  0.1875  -0.0509 175 GLN B CA  
2554 C C   . GLN B 174 ? 0.5049 0.6986 0.4381 0.0439  0.1824  -0.0419 175 GLN B C   
2555 O O   . GLN B 174 ? 0.4827 0.7139 0.4318 0.0318  0.1915  -0.0426 175 GLN B O   
2556 C CB  . GLN B 174 ? 0.6065 0.7279 0.4943 0.0826  0.1975  -0.0624 175 GLN B CB  
2557 C CG  . GLN B 174 ? 0.7077 0.7672 0.5455 0.0818  0.2064  -0.0758 175 GLN B CG  
2558 C CD  . GLN B 174 ? 0.8357 0.8586 0.6608 0.1174  0.2150  -0.0884 175 GLN B CD  
2559 O OE1 . GLN B 174 ? 0.9157 0.9153 0.7143 0.1233  0.2315  -0.1057 175 GLN B OE1 
2560 N NE2 . GLN B 174 ? 0.8482 0.8623 0.6884 0.1418  0.2035  -0.0800 175 GLN B NE2 
2561 N N   . GLN B 175 ? 0.4926 0.6895 0.4397 0.0492  0.1674  -0.0329 176 GLN B N   
2562 C CA  . GLN B 175 ? 0.4519 0.6991 0.4351 0.0416  0.1605  -0.0261 176 GLN B CA  
2563 C C   . GLN B 175 ? 0.4230 0.6780 0.4050 0.0116  0.1605  -0.0220 176 GLN B C   
2564 O O   . GLN B 175 ? 0.4115 0.7058 0.4169 0.0017  0.1661  -0.0220 176 GLN B O   
2565 C CB  . GLN B 175 ? 0.4444 0.6855 0.4315 0.0494  0.1430  -0.0173 176 GLN B CB  
2566 C CG  . GLN B 175 ? 0.4043 0.6930 0.4230 0.0404  0.1341  -0.0124 176 GLN B CG  
2567 C CD  . GLN B 175 ? 0.3971 0.7438 0.4543 0.0499  0.1413  -0.0175 176 GLN B CD  
2568 O OE1 . GLN B 175 ? 0.4413 0.7992 0.5095 0.0768  0.1456  -0.0217 176 GLN B OE1 
2569 N NE2 . GLN B 175 ? 0.3295 0.7133 0.4078 0.0278  0.1437  -0.0177 176 GLN B NE2 
2570 N N   . VAL B 176 ? 0.4227 0.6402 0.3776 -0.0024 0.1545  -0.0183 177 VAL B N   
2571 C CA  . VAL B 176 ? 0.3911 0.6129 0.3459 -0.0256 0.1518  -0.0132 177 VAL B CA  
2572 C C   . VAL B 176 ? 0.3963 0.6183 0.3392 -0.0358 0.1628  -0.0156 177 VAL B C   
2573 O O   . VAL B 176 ? 0.3982 0.6426 0.3540 -0.0480 0.1665  -0.0121 177 VAL B O   
2574 C CB  . VAL B 176 ? 0.3885 0.5804 0.3251 -0.0353 0.1407  -0.0083 177 VAL B CB  
2575 C CG1 . VAL B 176 ? 0.3701 0.5666 0.3080 -0.0540 0.1385  -0.0039 177 VAL B CG1 
2576 C CG2 . VAL B 176 ? 0.3601 0.5563 0.3064 -0.0294 0.1303  -0.0043 177 VAL B CG2 
2577 N N   . ALA B 177 ? 0.4184 0.6125 0.3329 -0.0325 0.1682  -0.0214 178 ALA B N   
2578 C CA  . ALA B 177 ? 0.4186 0.6094 0.3128 -0.0442 0.1773  -0.0233 178 ALA B CA  
2579 C C   . ALA B 177 ? 0.4269 0.6528 0.3359 -0.0435 0.1928  -0.0260 178 ALA B C   
2580 O O   . ALA B 177 ? 0.4339 0.6644 0.3307 -0.0591 0.1985  -0.0219 178 ALA B O   
2581 C CB  . ALA B 177 ? 0.4447 0.5979 0.3024 -0.0409 0.1801  -0.0322 178 ALA B CB  
2582 N N   . LYS B 178 ? 0.4220 0.6756 0.3573 -0.0264 0.1998  -0.0317 179 LYS B N   
2583 C CA  . LYS B 178 ? 0.4211 0.7175 0.3757 -0.0291 0.2160  -0.0344 179 LYS B CA  
2584 C C   . LYS B 178 ? 0.4002 0.7225 0.3767 -0.0497 0.2120  -0.0240 179 LYS B C   
2585 O O   . LYS B 178 ? 0.4035 0.7525 0.3866 -0.0623 0.2251  -0.0229 179 LYS B O   
2586 C CB  . LYS B 178 ? 0.4273 0.7557 0.4099 -0.0037 0.2245  -0.0440 179 LYS B CB  
2587 C CG  . LYS B 178 ? 0.4060 0.7584 0.4241 0.0056  0.2101  -0.0392 179 LYS B CG  
2588 C CD  . LYS B 178 ? 0.3965 0.7718 0.4369 0.0379  0.2144  -0.0477 179 LYS B CD  
2589 C CE  . LYS B 178 ? 0.3341 0.7486 0.4138 0.0459  0.2002  -0.0423 179 LYS B CE  
2590 N NZ  . LYS B 178 ? 0.3606 0.8012 0.4630 0.0805  0.2054  -0.0501 179 LYS B NZ  
2591 N N   . ASN B 179 ? 0.3874 0.6993 0.3728 -0.0537 0.1951  -0.0172 180 ASN B N   
2592 C CA  . ASN B 179 ? 0.3764 0.7041 0.3805 -0.0717 0.1898  -0.0097 180 ASN B CA  
2593 C C   . ASN B 179 ? 0.3827 0.6778 0.3647 -0.0884 0.1828  -0.0003 180 ASN B C   
2594 O O   . ASN B 179 ? 0.4002 0.6995 0.3885 -0.1051 0.1833  0.0062  180 ASN B O   
2595 C CB  . ASN B 179 ? 0.3438 0.6844 0.3721 -0.0643 0.1765  -0.0104 180 ASN B CB  
2596 C CG  . ASN B 179 ? 0.3370 0.7242 0.3973 -0.0520 0.1810  -0.0165 180 ASN B CG  
2597 O OD1 . ASN B 179 ? 0.3744 0.7999 0.4555 -0.0629 0.1914  -0.0178 180 ASN B OD1 
2598 N ND2 . ASN B 179 ? 0.2888 0.6746 0.3536 -0.0293 0.1733  -0.0194 180 ASN B ND2 
2599 N N   . ARG B 180 ? 0.3754 0.6384 0.3319 -0.0839 0.1763  0.0005  181 ARG B N   
2600 C CA  . ARG B 180 ? 0.3786 0.6173 0.3189 -0.0950 0.1674  0.0094  181 ARG B CA  
2601 C C   . ARG B 180 ? 0.3927 0.6074 0.3020 -0.0932 0.1648  0.0085  181 ARG B C   
2602 O O   . ARG B 180 ? 0.3987 0.6028 0.3006 -0.0833 0.1629  0.0011  181 ARG B O   
2603 C CB  . ARG B 180 ? 0.3665 0.6002 0.3223 -0.0940 0.1546  0.0112  181 ARG B CB  
2604 C CG  . ARG B 180 ? 0.3823 0.5967 0.3292 -0.1013 0.1459  0.0196  181 ARG B CG  
2605 C CD  . ARG B 180 ? 0.3795 0.5925 0.3429 -0.0999 0.1375  0.0187  181 ARG B CD  
2606 N NE  . ARG B 180 ? 0.3851 0.5821 0.3433 -0.1023 0.1304  0.0259  181 ARG B NE  
2607 C CZ  . ARG B 180 ? 0.3998 0.5857 0.3569 -0.1087 0.1308  0.0335  181 ARG B CZ  
2608 N NH1 . ARG B 180 ? 0.4059 0.5954 0.3655 -0.1185 0.1391  0.0349  181 ARG B NH1 
2609 N NH2 . ARG B 180 ? 0.4232 0.5941 0.3769 -0.1054 0.1227  0.0405  181 ARG B NH2 
2610 N N   . CYS B 181 ? 0.4158 0.6196 0.3041 -0.1040 0.1635  0.0165  182 CYS B N   
2611 C CA  . CYS B 181 ? 0.4376 0.6221 0.2961 -0.1062 0.1570  0.0163  182 CYS B CA  
2612 C C   . CYS B 181 ? 0.4095 0.5865 0.2780 -0.1034 0.1425  0.0172  182 CYS B C   
2613 O O   . CYS B 181 ? 0.4043 0.5836 0.2860 -0.1059 0.1343  0.0256  182 CYS B O   
2614 C CB  . CYS B 181 ? 0.4555 0.6333 0.2916 -0.1181 0.1538  0.0281  182 CYS B CB  
2615 S SG  . CYS B 181 ? 0.5272 0.7132 0.3447 -0.1275 0.1719  0.0306  182 CYS B SG  
2616 N N   . VAL B 182 ? 0.4041 0.5707 0.2654 -0.0985 0.1408  0.0084  183 VAL B N   
2617 C CA  . VAL B 182 ? 0.3989 0.5598 0.2655 -0.1000 0.1291  0.0091  183 VAL B CA  
2618 C C   . VAL B 182 ? 0.4312 0.5739 0.2695 -0.1070 0.1250  0.0037  183 VAL B C   
2619 O O   . VAL B 182 ? 0.4662 0.5941 0.2804 -0.1063 0.1327  -0.0043 183 VAL B O   
2620 C CB  . VAL B 182 ? 0.3735 0.5360 0.2586 -0.0911 0.1298  0.0051  183 VAL B CB  
2621 C CG1 . VAL B 182 ? 0.3369 0.5187 0.2488 -0.0879 0.1319  0.0088  183 VAL B CG1 
2622 C CG2 . VAL B 182 ? 0.3882 0.5373 0.2614 -0.0812 0.1378  -0.0038 183 VAL B CG2 
2623 N N   . LEU B 183 ? 0.4310 0.5765 0.2722 -0.1150 0.1136  0.0069  184 LEU B N   
2624 C CA  . LEU B 183 ? 0.4548 0.5859 0.2710 -0.1273 0.1076  0.0016  184 LEU B CA  
2625 C C   . LEU B 183 ? 0.4320 0.5743 0.2648 -0.1344 0.0985  0.0043  184 LEU B C   
2626 O O   . LEU B 183 ? 0.4207 0.5867 0.2677 -0.1391 0.0891  0.0109  184 LEU B O   
2627 C CB  . LEU B 183 ? 0.4747 0.6095 0.2690 -0.1372 0.1017  0.0043  184 LEU B CB  
2628 C CG  . LEU B 183 ? 0.5244 0.6450 0.2886 -0.1539 0.0945  -0.0033 184 LEU B CG  
2629 C CD1 . LEU B 183 ? 0.5598 0.6425 0.2947 -0.1521 0.1065  -0.0181 184 LEU B CD1 
2630 C CD2 . LEU B 183 ? 0.5290 0.6615 0.2732 -0.1641 0.0846  0.0021  184 LEU B CD2 
2631 N N   . PRO B 184 ? 0.4401 0.5662 0.2712 -0.1341 0.1020  -0.0003 185 PRO B N   
2632 C CA  . PRO B 184 ? 0.4452 0.5812 0.2862 -0.1454 0.0961  0.0016  185 PRO B CA  
2633 C C   . PRO B 184 ? 0.4661 0.6057 0.2919 -0.1655 0.0872  -0.0004 185 PRO B C   
2634 O O   . PRO B 184 ? 0.4981 0.6138 0.2933 -0.1726 0.0872  -0.0068 185 PRO B O   
2635 C CB  . PRO B 184 ? 0.4623 0.5679 0.2903 -0.1430 0.1020  -0.0020 185 PRO B CB  
2636 C CG  . PRO B 184 ? 0.4563 0.5532 0.2867 -0.1230 0.1098  -0.0035 185 PRO B CG  
2637 C CD  . PRO B 184 ? 0.4485 0.5472 0.2678 -0.1230 0.1114  -0.0063 185 PRO B CD  
2638 N N   . ASN B 185 ? 0.4539 0.6268 0.3017 -0.1748 0.0798  0.0038  186 ASN B N   
2639 C CA  . ASN B 185 ? 0.4689 0.6570 0.3084 -0.1956 0.0689  0.0025  186 ASN B CA  
2640 C C   . ASN B 185 ? 0.5181 0.6699 0.3256 -0.2160 0.0715  -0.0059 186 ASN B C   
2641 O O   . ASN B 185 ? 0.5247 0.6442 0.3221 -0.2111 0.0807  -0.0077 186 ASN B O   
2642 C CB  . ASN B 185 ? 0.4437 0.6844 0.3211 -0.1979 0.0612  0.0086  186 ASN B CB  
2643 C CG  . ASN B 185 ? 0.4288 0.6802 0.3203 -0.2080 0.0671  0.0069  186 ASN B CG  
2644 O OD1 . ASN B 185 ? 0.4553 0.6821 0.3234 -0.2280 0.0699  0.0023  186 ASN B OD1 
2645 N ND2 . ASN B 185 ? 0.3763 0.6615 0.3031 -0.1950 0.0700  0.0106  186 ASN B ND2 
2646 N N   . ARG B 186 ? 0.5566 0.7105 0.3453 -0.2392 0.0622  -0.0106 187 ARG B N   
2647 C CA  . ARG B 186 ? 0.6131 0.7208 0.3628 -0.2614 0.0644  -0.0203 187 ARG B CA  
2648 C C   . ARG B 186 ? 0.6176 0.7157 0.3720 -0.2738 0.0701  -0.0181 187 ARG B C   
2649 O O   . ARG B 186 ? 0.6596 0.7023 0.3798 -0.2824 0.0760  -0.0231 187 ARG B O   
2650 C CB  . ARG B 186 ? 0.6474 0.7667 0.3781 -0.2894 0.0512  -0.0263 187 ARG B CB  
2651 C CG  . ARG B 186 ? 0.6510 0.8321 0.4159 -0.3092 0.0397  -0.0208 187 ARG B CG  
2652 C CD  . ARG B 186 ? 0.7217 0.9195 0.4689 -0.3389 0.0240  -0.0269 187 ARG B CD  
2653 N NE  . ARG B 186 ? 0.8133 0.9613 0.5182 -0.3712 0.0266  -0.0390 187 ARG B NE  
2654 C CZ  . ARG B 186 ? 0.8766 0.9685 0.5293 -0.3816 0.0269  -0.0519 187 ARG B CZ  
2655 N NH1 . ARG B 186 ? 0.9220 1.0034 0.5559 -0.3635 0.0259  -0.0549 187 ARG B NH1 
2656 N NH2 . ARG B 186 ? 0.9444 0.9868 0.5600 -0.4118 0.0295  -0.0626 187 ARG B NH2 
2657 N N   . GLY B 187 ? 0.5736 0.7232 0.3675 -0.2743 0.0688  -0.0106 188 GLY B N   
2658 C CA  . GLY B 187 ? 0.5774 0.7250 0.3755 -0.2873 0.0758  -0.0075 188 GLY B CA  
2659 C C   . GLY B 187 ? 0.5628 0.6796 0.3574 -0.2635 0.0863  -0.0033 188 GLY B C   
2660 O O   . GLY B 187 ? 0.5939 0.6675 0.3623 -0.2715 0.0921  -0.0021 188 GLY B O   
2661 N N   . PHE B 188 ? 0.5128 0.6498 0.3315 -0.2353 0.0876  -0.0006 189 PHE B N   
2662 C CA  . PHE B 188 ? 0.5033 0.6177 0.3209 -0.2129 0.0953  0.0025  189 PHE B CA  
2663 C C   . PHE B 188 ? 0.5415 0.5957 0.3222 -0.2063 0.0984  -0.0008 189 PHE B C   
2664 O O   . PHE B 188 ? 0.5439 0.5687 0.3123 -0.1979 0.1027  0.0029  189 PHE B O   
2665 C CB  . PHE B 188 ? 0.4538 0.5963 0.2999 -0.1878 0.0954  0.0043  189 PHE B CB  
2666 C CG  . PHE B 188 ? 0.4124 0.6061 0.2951 -0.1861 0.0941  0.0071  189 PHE B CG  
2667 C CD1 . PHE B 188 ? 0.4089 0.6296 0.3028 -0.2037 0.0953  0.0076  189 PHE B CD1 
2668 C CD2 . PHE B 188 ? 0.3864 0.6005 0.2924 -0.1664 0.0932  0.0088  189 PHE B CD2 
2669 C CE1 . PHE B 188 ? 0.3488 0.6189 0.2790 -0.1977 0.0960  0.0082  189 PHE B CE1 
2670 C CE2 . PHE B 188 ? 0.3758 0.6304 0.3144 -0.1607 0.0928  0.0102  189 PHE B CE2 
2671 C CZ  . PHE B 188 ? 0.3181 0.6026 0.2702 -0.1745 0.0944  0.0091  189 PHE B CZ  
2672 N N   . LEU B 189 ? 0.5566 0.5935 0.3188 -0.2085 0.0958  -0.0079 190 LEU B N   
2673 C CA  . LEU B 189 ? 0.6071 0.5871 0.3344 -0.1995 0.1004  -0.0144 190 LEU B CA  
2674 C C   . LEU B 189 ? 0.6658 0.5951 0.3583 -0.2188 0.1011  -0.0153 190 LEU B C   
2675 O O   . LEU B 189 ? 0.7058 0.5891 0.3786 -0.2047 0.1056  -0.0139 190 LEU B O   
2676 C CB  . LEU B 189 ? 0.6263 0.6014 0.3372 -0.2017 0.0987  -0.0240 190 LEU B CB  
2677 C CG  . LEU B 189 ? 0.6758 0.5987 0.3536 -0.1872 0.1065  -0.0342 190 LEU B CG  
2678 C CD1 . LEU B 189 ? 0.6748 0.5908 0.3671 -0.1569 0.1137  -0.0296 190 LEU B CD1 
2679 C CD2 . LEU B 189 ? 0.6645 0.6013 0.3350 -0.1845 0.1072  -0.0419 190 LEU B CD2 
2680 N N   . LYS B 190 ? 0.6815 0.6195 0.3667 -0.2516 0.0960  -0.0170 191 LYS B N   
2681 C CA  . LYS B 190 ? 0.7460 0.6382 0.3988 -0.2774 0.0971  -0.0158 191 LYS B CA  
2682 C C   . LYS B 190 ? 0.7295 0.6150 0.3878 -0.2686 0.1019  -0.0032 191 LYS B C   
2683 O O   . LYS B 190 ? 0.7730 0.5969 0.3969 -0.2676 0.1048  0.0003  191 LYS B O   
2684 C CB  . LYS B 190 ? 0.7565 0.6802 0.4125 -0.3178 0.0907  -0.0183 191 LYS B CB  
2685 C CG  . LYS B 190 ? 0.8407 0.7284 0.4689 -0.3514 0.0931  -0.0147 191 LYS B CG  
2686 C CD  . LYS B 190 ? 0.8940 0.8250 0.5315 -0.3940 0.0865  -0.0184 191 LYS B CD  
2687 C CE  . LYS B 190 ? 0.9515 0.8717 0.5764 -0.4302 0.0920  -0.0107 191 LYS B CE  
2688 N NZ  . LYS B 190 ? 1.0199 0.8720 0.5921 -0.4699 0.0907  -0.0173 191 LYS B NZ  
2689 N N   . GLN B 191 ? 0.6744 0.6201 0.3730 -0.2603 0.1025  0.0034  192 GLN B N   
2690 C CA  . GLN B 191 ? 0.6655 0.6114 0.3679 -0.2524 0.1068  0.0143  192 GLN B CA  
2691 C C   . GLN B 191 ? 0.6719 0.5789 0.3618 -0.2197 0.1076  0.0174  192 GLN B C   
2692 O O   . GLN B 191 ? 0.7117 0.5807 0.3776 -0.2180 0.1084  0.0261  192 GLN B O   
2693 C CB  . GLN B 191 ? 0.6006 0.6186 0.3479 -0.2481 0.1082  0.0166  192 GLN B CB  
2694 C CG  . GLN B 191 ? 0.5991 0.6624 0.3633 -0.2787 0.1081  0.0149  192 GLN B CG  
2695 C CD  . GLN B 191 ? 0.5608 0.6960 0.3738 -0.2673 0.1078  0.0130  192 GLN B CD  
2696 O OE1 . GLN B 191 ? 0.5681 0.7188 0.3985 -0.2452 0.1113  0.0150  192 GLN B OE1 
2697 N NE2 . GLN B 191 ? 0.5400 0.7181 0.3739 -0.2827 0.1029  0.0091  192 GLN B NE2 
2698 N N   . LEU B 192 ? 0.6612 0.5788 0.3664 -0.1946 0.1071  0.0110  193 LEU B N   
2699 C CA  . LEU B 192 ? 0.6780 0.5692 0.3780 -0.1627 0.1080  0.0125  193 LEU B CA  
2700 C C   . LEU B 192 ? 0.7557 0.5732 0.4124 -0.1600 0.1089  0.0101  193 LEU B C   
2701 O O   . LEU B 192 ? 0.7866 0.5714 0.4308 -0.1385 0.1081  0.0165  193 LEU B O   
2702 C CB  . LEU B 192 ? 0.6368 0.5607 0.3638 -0.1407 0.1096  0.0052  193 LEU B CB  
2703 C CG  . LEU B 192 ? 0.5832 0.5678 0.3513 -0.1340 0.1089  0.0082  193 LEU B CG  
2704 C CD1 . LEU B 192 ? 0.5155 0.5238 0.3008 -0.1232 0.1108  0.0014  193 LEU B CD1 
2705 C CD2 . LEU B 192 ? 0.5739 0.5645 0.3515 -0.1162 0.1077  0.0157  193 LEU B CD2 
2706 N N   . ARG B 193 ? 0.7982 0.5876 0.4305 -0.1805 0.1097  0.0005  194 ARG B N   
2707 C CA  . ARG B 193 ? 0.8841 0.5920 0.4688 -0.1802 0.1114  -0.0038 194 ARG B CA  
2708 C C   . ARG B 193 ? 0.9277 0.5929 0.4854 -0.1933 0.1094  0.0104  194 ARG B C   
2709 O O   . ARG B 193 ? 0.9704 0.5764 0.5007 -0.1738 0.1090  0.0159  194 ARG B O   
2710 C CB  . ARG B 193 ? 0.9226 0.6067 0.4812 -0.2066 0.1119  -0.0183 194 ARG B CB  
2711 C CG  . ARG B 193 ? 0.9255 0.6333 0.4952 -0.1912 0.1148  -0.0326 194 ARG B CG  
2712 C CD  . ARG B 193 ? 0.9929 0.6847 0.5348 -0.2212 0.1128  -0.0468 194 ARG B CD  
2713 N NE  . ARG B 193 ? 1.1341 0.7561 0.6301 -0.2477 0.1120  -0.0493 194 ARG B NE  
2714 C CZ  . ARG B 193 ? 1.2425 0.7815 0.6959 -0.2351 0.1173  -0.0560 194 ARG B CZ  
2715 N NH1 . ARG B 193 ? 1.2772 0.7996 0.7321 -0.1939 0.1244  -0.0620 194 ARG B NH1 
2716 N NH2 . ARG B 193 ? 1.3026 0.7745 0.7122 -0.2637 0.1160  -0.0568 194 ARG B NH2 
2717 N N   . GLU B 194 ? 0.9167 0.6151 0.4831 -0.2249 0.1083  0.0173  195 GLU B N   
2718 C CA  . GLU B 194 ? 0.9760 0.6370 0.5129 -0.2441 0.1083  0.0319  195 GLU B CA  
2719 C C   . GLU B 194 ? 0.9534 0.6162 0.4961 -0.2150 0.1060  0.0462  195 GLU B C   
2720 O O   . GLU B 194 ? 1.0017 0.6014 0.5064 -0.2106 0.1038  0.0578  195 GLU B O   
2721 C CB  . GLU B 194 ? 0.9692 0.6757 0.5178 -0.2862 0.1102  0.0341  195 GLU B CB  
2722 C CG  . GLU B 194 ? 1.0547 0.7511 0.5901 -0.3186 0.1094  0.0206  195 GLU B CG  
2723 C CD  . GLU B 194 ? 1.1092 0.8603 0.6623 -0.3607 0.1105  0.0215  195 GLU B CD  
2724 O OE1 . GLU B 194 ? 1.0882 0.9156 0.6856 -0.3556 0.1121  0.0250  195 GLU B OE1 
2725 O OE2 . GLU B 194 ? 1.1995 0.9169 0.7223 -0.3990 0.1101  0.0176  195 GLU B OE2 
2726 N N   . LEU B 195 ? 0.8760 0.6069 0.4633 -0.1945 0.1052  0.0454  196 LEU B N   
2727 C CA  . LEU B 195 ? 0.8679 0.6046 0.4622 -0.1649 0.1009  0.0562  196 LEU B CA  
2728 C C   . LEU B 195 ? 0.9148 0.5979 0.4911 -0.1303 0.0972  0.0565  196 LEU B C   
2729 O O   . LEU B 195 ? 0.9580 0.6075 0.5134 -0.1147 0.0912  0.0705  196 LEU B O   
2730 C CB  . LEU B 195 ? 0.7919 0.6061 0.4360 -0.1501 0.1008  0.0515  196 LEU B CB  
2731 C CG  . LEU B 195 ? 0.7732 0.5985 0.4259 -0.1215 0.0945  0.0606  196 LEU B CG  
2732 C CD1 . LEU B 195 ? 0.8102 0.6246 0.4376 -0.1362 0.0920  0.0761  196 LEU B CD1 
2733 C CD2 . LEU B 195 ? 0.6907 0.5823 0.3892 -0.1084 0.0949  0.0530  196 LEU B CD2 
2734 N N   . ASP B 196 ? 0.9163 0.5937 0.5001 -0.1171 0.1008  0.0413  197 ASP B N   
2735 C CA  . ASP B 196 ? 0.9543 0.5861 0.5254 -0.0809 0.1004  0.0377  197 ASP B CA  
2736 C C   . ASP B 196 ? 1.0524 0.5906 0.5683 -0.0846 0.0983  0.0455  197 ASP B C   
2737 O O   . ASP B 196 ? 1.1005 0.6011 0.6029 -0.0536 0.0929  0.0551  197 ASP B O   
2738 C CB  . ASP B 196 ? 0.9344 0.5780 0.5182 -0.0731 0.1081  0.0175  197 ASP B CB  
2739 C CG  . ASP B 196 ? 0.9311 0.5657 0.5246 -0.0286 0.1108  0.0112  197 ASP B CG  
2740 O OD1 . ASP B 196 ? 0.8409 0.5131 0.4639 -0.0021 0.1061  0.0192  197 ASP B OD1 
2741 O OD2 . ASP B 196 ? 1.0052 0.5987 0.5778 -0.0207 0.1182  -0.0036 197 ASP B OD2 
2742 N N   . LYS B 197 ? 1.1000 0.6006 0.5836 -0.1235 0.1015  0.0426  198 LYS B N   
2743 C CA  . LYS B 197 ? 1.2068 0.6107 0.6316 -0.1361 0.1000  0.0515  198 LYS B CA  
2744 C C   . LYS B 197 ? 1.2377 0.6230 0.6442 -0.1342 0.0924  0.0770  198 LYS B C   
2745 O O   . LYS B 197 ? 1.3110 0.6247 0.6827 -0.1113 0.0871  0.0882  198 LYS B O   
2746 C CB  . LYS B 197 ? 1.2362 0.6169 0.6343 -0.1873 0.1045  0.0437  198 LYS B CB  
2747 C CG  . LYS B 197 ? 1.2531 0.6255 0.6492 -0.1902 0.1098  0.0191  198 LYS B CG  
2748 C CD  . LYS B 197 ? 1.3011 0.6526 0.6695 -0.2438 0.1114  0.0111  198 LYS B CD  
2749 C CE  . LYS B 197 ? 1.3166 0.6671 0.6816 -0.2472 0.1147  -0.0132 198 LYS B CE  
2750 N NZ  . LYS B 197 ? 1.4011 0.7122 0.7278 -0.2979 0.1144  -0.0230 198 LYS B NZ  
2751 N N   . GLN B 198 ? 1.1884 0.6375 0.6168 -0.1565 0.0920  0.0858  199 GLN B N   
2752 C CA  . GLN B 198 ? 1.2104 0.6538 0.6219 -0.1563 0.0856  0.1087  199 GLN B CA  
2753 C C   . GLN B 198 ? 1.2019 0.6488 0.6262 -0.1059 0.0753  0.1169  199 GLN B C   
2754 O O   . GLN B 198 ? 1.2683 0.6595 0.6560 -0.0929 0.0668  0.1358  199 GLN B O   
2755 C CB  . GLN B 198 ? 1.1484 0.6734 0.5892 -0.1831 0.0894  0.1112  199 GLN B CB  
2756 C CG  . GLN B 198 ? 1.1832 0.7179 0.6153 -0.2349 0.0989  0.1069  199 GLN B CG  
2757 C CD  . GLN B 198 ? 1.1458 0.7817 0.6301 -0.2491 0.1049  0.0975  199 GLN B CD  
2758 O OE1 . GLN B 198 ? 1.0899 0.7825 0.6129 -0.2226 0.1023  0.0939  199 GLN B OE1 
2759 N NE2 . GLN B 198 ? 1.1620 0.8196 0.6479 -0.2909 0.1126  0.0927  199 GLN B NE2 
2760 N N   . LEU B 199 ? 1.1293 0.6426 0.6049 -0.0786 0.0752  0.1041  200 LEU B N   
2761 C CA  . LEU B 199 ? 1.1244 0.6534 0.6186 -0.0326 0.0647  0.1111  200 LEU B CA  
2762 C C   . LEU B 199 ? 1.2103 0.6636 0.6783 0.0038  0.0607  0.1130  200 LEU B C   
2763 O O   . LEU B 199 ? 1.2442 0.6817 0.7054 0.0364  0.0482  0.1285  200 LEU B O   
2764 C CB  . LEU B 199 ? 1.0264 0.6443 0.5818 -0.0161 0.0671  0.0960  200 LEU B CB  
2765 C CG  . LEU B 199 ? 0.9471 0.6405 0.5316 -0.0389 0.0678  0.0964  200 LEU B CG  
2766 C CD1 . LEU B 199 ? 0.8377 0.6045 0.4770 -0.0230 0.0705  0.0816  200 LEU B CD1 
2767 C CD2 . LEU B 199 ? 0.9258 0.6223 0.4922 -0.0390 0.0567  0.1165  200 LEU B CD2 
2768 N N   . VAL B 200 ? 1.2472 0.6535 0.6994 -0.0005 0.0705  0.0967  201 VAL B N   
2769 C CA  . VAL B 200 ? 1.3336 0.6564 0.7546 0.0331  0.0695  0.0955  201 VAL B CA  
2770 C C   . VAL B 200 ? 1.4374 0.6547 0.7899 0.0148  0.0652  0.1130  201 VAL B C   
2771 O O   . VAL B 200 ? 1.4805 0.6751 0.8105 0.0211  0.0531  0.1379  201 VAL B O   
2772 C CB  . VAL B 200 ? 1.3329 0.6462 0.7608 0.0360  0.0835  0.0673  201 VAL B CB  
2773 C CG1 . VAL B 200 ? 1.4188 0.6399 0.8113 0.0712  0.0853  0.0621  201 VAL B CG1 
2774 C CG2 . VAL B 200 ? 1.2340 0.6469 0.7252 0.0533  0.0886  0.0524  201 VAL B CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   2   ?   ?   ?   A . n 
A 1 2   SER 2   3   ?   ?   ?   A . n 
A 1 3   GLY 3   4   ?   ?   ?   A . n 
A 1 4   GLU 4   5   ?   ?   ?   A . n 
A 1 5   VAL 5   6   ?   ?   ?   A . n 
A 1 6   LYS 6   7   ?   ?   ?   A . n 
A 1 7   THR 7   8   ?   ?   ?   A . n 
A 1 8   SER 8   9   ?   ?   ?   A . n 
A 1 9   LEU 9   10  ?   ?   ?   A . n 
A 1 10  LYS 10  11  ?   ?   ?   A . n 
A 1 11  ASN 11  12  ?   ?   ?   A . n 
A 1 12  ALA 12  13  ?   ?   ?   A . n 
A 1 13  TYR 13  14  ?   ?   ?   A . n 
A 1 14  SER 14  15  ?   ?   ?   A . n 
A 1 15  SER 15  16  ?   ?   ?   A . n 
A 1 16  ALA 16  17  ?   ?   ?   A . n 
A 1 17  LYS 17  18  ?   ?   ?   A . n 
A 1 18  ARG 18  19  ?   ?   ?   A . n 
A 1 19  LEU 19  20  ?   ?   ?   A . n 
A 1 20  SER 20  21  ?   ?   ?   A . n 
A 1 21  PRO 21  22  ?   ?   ?   A . n 
A 1 22  LYS 22  23  ?   ?   ?   A . n 
A 1 23  MET 23  24  ?   ?   ?   A . n 
A 1 24  GLU 24  25  ?   ?   ?   A . n 
A 1 25  GLU 25  26  ?   ?   ?   A . n 
A 1 26  GLU 26  27  ?   ?   ?   A . n 
A 1 27  GLY 27  28  ?   ?   ?   A . n 
A 1 28  GLU 28  29  ?   ?   ?   A . n 
A 1 29  GLU 29  30  ?   ?   ?   A . n 
A 1 30  GLU 30  31  ?   ?   ?   A . n 
A 1 31  ASP 31  32  32  ASP ASP A . n 
A 1 32  TYR 32  33  33  TYR TYR A . n 
A 1 33  CYS 33  34  34  CYS CYS A . n 
A 1 34  THR 34  35  35  THR THR A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  GLY 36  37  37  GLY GLY A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  PHE 38  39  39  PHE PHE A . n 
A 1 39  GLU 39  40  40  GLU GLU A . n 
A 1 40  LEU 40  41  41  LEU LEU A . n 
A 1 41  GLU 41  42  42  GLU GLU A . n 
A 1 42  ARG 42  43  43  ARG ARG A . n 
A 1 43  LEU 43  44  44  LEU LEU A . n 
A 1 44  PHE 44  45  45  PHE PHE A . n 
A 1 45  TRP 45  46  46  TRP TRP A . n 
A 1 46  LYS 46  47  47  LYS LYS A . n 
A 1 47  GLY 47  48  48  GLY GLY A . n 
A 1 48  SER 48  49  49  SER SER A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLN 50  51  51  GLN GLN A . n 
A 1 51  TYR 51  52  52  TYR TYR A . n 
A 1 52  THR 52  53  53  THR THR A . n 
A 1 53  HIS 53  54  54  HIS HIS A . n 
A 1 54  VAL 54  55  55  VAL VAL A . n 
A 1 55  ASN 55  56  56  ASN ASN A . n 
A 1 56  GLU 56  57  57  GLU GLU A . n 
A 1 57  VAL 57  58  58  VAL VAL A . n 
A 1 58  TRP 58  59  59  TRP TRP A . n 
A 1 59  PRO 59  60  60  PRO PRO A . n 
A 1 60  LYS 60  61  61  LYS LYS A . n 
A 1 61  LEU 61  62  62  LEU LEU A . n 
A 1 62  TYR 62  63  63  TYR TYR A . n 
A 1 63  ILE 63  64  64  ILE ILE A . n 
A 1 64  GLY 64  65  65  GLY GLY A . n 
A 1 65  ASP 65  66  66  ASP ASP A . n 
A 1 66  GLU 66  67  67  GLU GLU A . n 
A 1 67  ALA 67  68  68  ALA ALA A . n 
A 1 68  THR 68  69  69  THR THR A . n 
A 1 69  ALA 69  70  70  ALA ALA A . n 
A 1 70  LEU 70  71  71  LEU LEU A . n 
A 1 71  ASP 71  72  72  ASP ASP A . n 
A 1 72  ARG 72  73  73  ARG ARG A . n 
A 1 73  TYR 73  74  74  TYR TYR A . n 
A 1 74  ARG 74  75  75  ARG ARG A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  GLN 76  77  77  GLN GLN A . n 
A 1 77  LYS 77  78  78  LYS LYS A . n 
A 1 78  ALA 78  79  79  ALA ALA A . n 
A 1 79  GLY 79  80  80  GLY GLY A . n 
A 1 80  PHE 80  81  81  PHE PHE A . n 
A 1 81  THR 81  82  82  THR THR A . n 
A 1 82  HIS 82  83  83  HIS HIS A . n 
A 1 83  VAL 83  84  84  VAL VAL A . n 
A 1 84  LEU 84  85  85  LEU LEU A . n 
A 1 85  ASN 85  86  86  ASN ASN A . n 
A 1 86  ALA 86  87  87  ALA ALA A . n 
A 1 87  ALA 87  88  88  ALA ALA A . n 
A 1 88  HIS 88  89  89  HIS HIS A . n 
A 1 89  GLY 89  90  90  GLY GLY A . n 
A 1 90  ARG 90  91  91  ARG ARG A . n 
A 1 91  TRP 91  92  92  TRP TRP A . n 
A 1 92  ASN 92  93  93  ASN ASN A . n 
A 1 93  VAL 93  94  94  VAL VAL A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  THR 95  96  96  THR THR A . n 
A 1 96  GLY 96  97  97  GLY GLY A . n 
A 1 97  PRO 97  98  98  PRO PRO A . n 
A 1 98  ASP 98  99  99  ASP ASP A . n 
A 1 99  TYR 99  100 100 TYR TYR A . n 
A 1 100 TYR 100 101 101 TYR TYR A . n 
A 1 101 ARG 101 102 102 ARG ARG A . n 
A 1 102 ASP 102 103 103 ASP ASP A . n 
A 1 103 MET 103 104 104 MET MET A . n 
A 1 104 ASP 104 105 105 ASP ASP A . n 
A 1 105 ILE 105 106 106 ILE ILE A . n 
A 1 106 GLN 106 107 107 GLN GLN A . n 
A 1 107 TYR 107 108 108 TYR TYR A . n 
A 1 108 HIS 108 109 109 HIS HIS A . n 
A 1 109 GLY 109 110 110 GLY GLY A . n 
A 1 110 VAL 110 111 111 VAL VAL A . n 
A 1 111 GLU 111 112 112 GLU GLU A . n 
A 1 112 ALA 112 113 113 ALA ALA A . n 
A 1 113 ASP 113 114 114 ASP ASP A . n 
A 1 114 ASP 114 115 115 ASP ASP A . n 
A 1 115 LEU 115 116 116 LEU LEU A . n 
A 1 116 PRO 116 117 117 PRO PRO A . n 
A 1 117 THR 117 118 118 THR THR A . n 
A 1 118 PHE 118 119 119 PHE PHE A . n 
A 1 119 ASP 119 120 120 ASP ASP A . n 
A 1 120 LEU 120 121 121 LEU LEU A . n 
A 1 121 SER 121 122 122 SER SER A . n 
A 1 122 VAL 122 123 123 VAL VAL A . n 
A 1 123 PHE 123 124 124 PHE PHE A . n 
A 1 124 PHE 124 125 125 PHE PHE A . n 
A 1 125 TYR 125 126 126 TYR TYR A . n 
A 1 126 PRO 126 127 127 PRO PRO A . n 
A 1 127 ALA 127 128 128 ALA ALA A . n 
A 1 128 ALA 128 129 129 ALA ALA A . n 
A 1 129 ALA 129 130 130 ALA ALA A . n 
A 1 130 PHE 130 131 131 PHE PHE A . n 
A 1 131 ILE 131 132 132 ILE ILE A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 ARG 133 134 134 ARG ARG A . n 
A 1 134 ALA 134 135 135 ALA ALA A . n 
A 1 135 LEU 135 136 136 LEU LEU A . n 
A 1 136 SER 136 137 137 SER SER A . n 
A 1 137 ASP 137 138 138 ASP ASP A . n 
A 1 138 ASP 138 139 139 ASP ASP A . n 
A 1 139 HIS 139 140 140 HIS HIS A . n 
A 1 140 SER 140 141 141 SER SER A . n 
A 1 141 LYS 141 142 142 LYS LYS A . n 
A 1 142 ILE 142 143 143 ILE ILE A . n 
A 1 143 LEU 143 144 144 LEU LEU A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 HIS 145 146 146 HIS HIS A . n 
A 1 146 CYS 146 147 147 CYS CYS A . n 
A 1 147 VAL 147 148 148 VAL VAL A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 GLY 149 150 150 GLY GLY A . n 
A 1 150 ARG 150 151 151 ARG ARG A . n 
A 1 151 SER 151 152 152 SER SER A . n 
A 1 152 ARG 152 153 153 ARG ARG A . n 
A 1 153 SER 153 154 154 SER SER A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 THR 155 156 156 THR THR A . n 
A 1 156 LEU 156 157 157 LEU LEU A . n 
A 1 157 VAL 157 158 158 VAL VAL A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 TYR 160 161 161 TYR TYR A . n 
A 1 161 LEU 161 162 162 LEU LEU A . n 
A 1 162 MET 162 163 163 MET MET A . n 
A 1 163 ILE 163 164 164 ILE ILE A . n 
A 1 164 HIS 164 165 165 HIS HIS A . n 
A 1 165 LYS 165 166 166 LYS LYS A . n 
A 1 166 ASP 166 167 167 ASP ASP A . n 
A 1 167 MET 167 168 168 MET MET A . n 
A 1 168 THR 168 169 169 THR THR A . n 
A 1 169 LEU 169 170 170 LEU LEU A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 ASP 171 172 172 ASP ASP A . n 
A 1 172 ALA 172 173 173 ALA ALA A . n 
A 1 173 ILE 173 174 174 ILE ILE A . n 
A 1 174 GLN 174 175 175 GLN GLN A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 VAL 176 177 177 VAL VAL A . n 
A 1 177 ALA 177 178 178 ALA ALA A . n 
A 1 178 LYS 178 179 179 LYS LYS A . n 
A 1 179 ASN 179 180 180 ASN ASN A . n 
A 1 180 ARG 180 181 181 ARG ARG A . n 
A 1 181 CYS 181 182 182 CYS CYS A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 LEU 183 184 184 LEU LEU A . n 
A 1 184 PRO 184 185 185 PRO PRO A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 ARG 186 187 187 ARG ARG A . n 
A 1 187 GLY 187 188 188 GLY GLY A . n 
A 1 188 PHE 188 189 189 PHE PHE A . n 
A 1 189 LEU 189 190 190 LEU LEU A . n 
A 1 190 LYS 190 191 191 LYS LYS A . n 
A 1 191 GLN 191 192 192 GLN GLN A . n 
A 1 192 LEU 192 193 193 LEU LEU A . n 
A 1 193 ARG 193 194 194 ARG ARG A . n 
A 1 194 GLU 194 195 195 GLU GLU A . n 
A 1 195 LEU 195 196 196 LEU LEU A . n 
A 1 196 ASP 196 197 197 ASP ASP A . n 
A 1 197 LYS 197 198 198 LYS LYS A . n 
A 1 198 GLN 198 199 199 GLN GLN A . n 
A 1 199 LEU 199 200 200 LEU LEU A . n 
A 1 200 VAL 200 201 201 VAL VAL A . n 
A 1 201 GLN 201 202 202 GLN GLN A . n 
A 1 202 GLN 202 203 203 GLN GLN A . n 
A 1 203 ARG 203 204 204 ARG ARG A . n 
A 1 204 ARG 204 205 205 ARG ARG A . n 
A 1 205 ARG 205 206 206 ARG ARG A . n 
A 1 206 SER 206 207 ?   ?   ?   A . n 
A 1 207 GLN 207 208 ?   ?   ?   A . n 
A 1 208 ARG 208 209 ?   ?   ?   A . n 
A 1 209 GLN 209 210 ?   ?   ?   A . n 
A 1 210 ASP 210 211 ?   ?   ?   A . n 
A 1 211 GLY 211 212 ?   ?   ?   A . n 
A 1 212 GLU 212 213 ?   ?   ?   A . n 
A 1 213 GLU 213 214 ?   ?   ?   A . n 
A 1 214 GLU 214 215 ?   ?   ?   A . n 
A 1 215 ASP 215 216 ?   ?   ?   A . n 
A 1 216 GLY 216 217 ?   ?   ?   A . n 
A 1 217 ARG 217 218 ?   ?   ?   A . n 
A 1 218 GLU 218 219 ?   ?   ?   A . n 
A 1 219 LEU 219 220 ?   ?   ?   A . n 
B 1 1   THR 1   2   ?   ?   ?   B . n 
B 1 2   SER 2   3   ?   ?   ?   B . n 
B 1 3   GLY 3   4   ?   ?   ?   B . n 
B 1 4   GLU 4   5   ?   ?   ?   B . n 
B 1 5   VAL 5   6   ?   ?   ?   B . n 
B 1 6   LYS 6   7   ?   ?   ?   B . n 
B 1 7   THR 7   8   ?   ?   ?   B . n 
B 1 8   SER 8   9   ?   ?   ?   B . n 
B 1 9   LEU 9   10  ?   ?   ?   B . n 
B 1 10  LYS 10  11  ?   ?   ?   B . n 
B 1 11  ASN 11  12  ?   ?   ?   B . n 
B 1 12  ALA 12  13  ?   ?   ?   B . n 
B 1 13  TYR 13  14  ?   ?   ?   B . n 
B 1 14  SER 14  15  ?   ?   ?   B . n 
B 1 15  SER 15  16  ?   ?   ?   B . n 
B 1 16  ALA 16  17  ?   ?   ?   B . n 
B 1 17  LYS 17  18  ?   ?   ?   B . n 
B 1 18  ARG 18  19  ?   ?   ?   B . n 
B 1 19  LEU 19  20  ?   ?   ?   B . n 
B 1 20  SER 20  21  ?   ?   ?   B . n 
B 1 21  PRO 21  22  ?   ?   ?   B . n 
B 1 22  LYS 22  23  ?   ?   ?   B . n 
B 1 23  MET 23  24  ?   ?   ?   B . n 
B 1 24  GLU 24  25  ?   ?   ?   B . n 
B 1 25  GLU 25  26  ?   ?   ?   B . n 
B 1 26  GLU 26  27  ?   ?   ?   B . n 
B 1 27  GLY 27  28  ?   ?   ?   B . n 
B 1 28  GLU 28  29  ?   ?   ?   B . n 
B 1 29  GLU 29  30  ?   ?   ?   B . n 
B 1 30  GLU 30  31  ?   ?   ?   B . n 
B 1 31  ASP 31  32  32  ASP ASP B . n 
B 1 32  TYR 32  33  33  TYR TYR B . n 
B 1 33  CYS 33  34  34  CYS CYS B . n 
B 1 34  THR 34  35  35  THR THR B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  GLY 36  37  37  GLY GLY B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  PHE 38  39  39  PHE PHE B . n 
B 1 39  GLU 39  40  40  GLU GLU B . n 
B 1 40  LEU 40  41  41  LEU LEU B . n 
B 1 41  GLU 41  42  42  GLU GLU B . n 
B 1 42  ARG 42  43  43  ARG ARG B . n 
B 1 43  LEU 43  44  44  LEU LEU B . n 
B 1 44  PHE 44  45  45  PHE PHE B . n 
B 1 45  TRP 45  46  46  TRP TRP B . n 
B 1 46  LYS 46  47  47  LYS LYS B . n 
B 1 47  GLY 47  48  48  GLY GLY B . n 
B 1 48  SER 48  49  49  SER SER B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLN 50  51  51  GLN GLN B . n 
B 1 51  TYR 51  52  52  TYR TYR B . n 
B 1 52  THR 52  53  53  THR THR B . n 
B 1 53  HIS 53  54  54  HIS HIS B . n 
B 1 54  VAL 54  55  55  VAL VAL B . n 
B 1 55  ASN 55  56  56  ASN ASN B . n 
B 1 56  GLU 56  57  57  GLU GLU B . n 
B 1 57  VAL 57  58  58  VAL VAL B . n 
B 1 58  TRP 58  59  59  TRP TRP B . n 
B 1 59  PRO 59  60  60  PRO PRO B . n 
B 1 60  LYS 60  61  61  LYS LYS B . n 
B 1 61  LEU 61  62  62  LEU LEU B . n 
B 1 62  TYR 62  63  63  TYR TYR B . n 
B 1 63  ILE 63  64  64  ILE ILE B . n 
B 1 64  GLY 64  65  65  GLY GLY B . n 
B 1 65  ASP 65  66  66  ASP ASP B . n 
B 1 66  GLU 66  67  67  GLU GLU B . n 
B 1 67  ALA 67  68  68  ALA ALA B . n 
B 1 68  THR 68  69  69  THR THR B . n 
B 1 69  ALA 69  70  70  ALA ALA B . n 
B 1 70  LEU 70  71  71  LEU LEU B . n 
B 1 71  ASP 71  72  72  ASP ASP B . n 
B 1 72  ARG 72  73  73  ARG ARG B . n 
B 1 73  TYR 73  74  74  TYR TYR B . n 
B 1 74  ARG 74  75  75  ARG ARG B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  GLN 76  77  77  GLN GLN B . n 
B 1 77  LYS 77  78  78  LYS LYS B . n 
B 1 78  ALA 78  79  79  ALA ALA B . n 
B 1 79  GLY 79  80  80  GLY GLY B . n 
B 1 80  PHE 80  81  81  PHE PHE B . n 
B 1 81  THR 81  82  82  THR THR B . n 
B 1 82  HIS 82  83  83  HIS HIS B . n 
B 1 83  VAL 83  84  84  VAL VAL B . n 
B 1 84  LEU 84  85  85  LEU LEU B . n 
B 1 85  ASN 85  86  86  ASN ASN B . n 
B 1 86  ALA 86  87  87  ALA ALA B . n 
B 1 87  ALA 87  88  88  ALA ALA B . n 
B 1 88  HIS 88  89  89  HIS HIS B . n 
B 1 89  GLY 89  90  ?   ?   ?   B . n 
B 1 90  ARG 90  91  ?   ?   ?   B . n 
B 1 91  TRP 91  92  ?   ?   ?   B . n 
B 1 92  ASN 92  93  ?   ?   ?   B . n 
B 1 93  VAL 93  94  ?   ?   ?   B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  THR 95  96  96  THR THR B . n 
B 1 96  GLY 96  97  97  GLY GLY B . n 
B 1 97  PRO 97  98  98  PRO PRO B . n 
B 1 98  ASP 98  99  99  ASP ASP B . n 
B 1 99  TYR 99  100 100 TYR TYR B . n 
B 1 100 TYR 100 101 101 TYR TYR B . n 
B 1 101 ARG 101 102 102 ARG ARG B . n 
B 1 102 ASP 102 103 103 ASP ASP B . n 
B 1 103 MET 103 104 104 MET MET B . n 
B 1 104 ASP 104 105 105 ASP ASP B . n 
B 1 105 ILE 105 106 106 ILE ILE B . n 
B 1 106 GLN 106 107 107 GLN GLN B . n 
B 1 107 TYR 107 108 108 TYR TYR B . n 
B 1 108 HIS 108 109 109 HIS HIS B . n 
B 1 109 GLY 109 110 110 GLY GLY B . n 
B 1 110 VAL 110 111 111 VAL VAL B . n 
B 1 111 GLU 111 112 112 GLU GLU B . n 
B 1 112 ALA 112 113 113 ALA ALA B . n 
B 1 113 ASP 113 114 114 ASP ASP B . n 
B 1 114 ASP 114 115 115 ASP ASP B . n 
B 1 115 LEU 115 116 116 LEU LEU B . n 
B 1 116 PRO 116 117 117 PRO PRO B . n 
B 1 117 THR 117 118 118 THR THR B . n 
B 1 118 PHE 118 119 119 PHE PHE B . n 
B 1 119 ASP 119 120 120 ASP ASP B . n 
B 1 120 LEU 120 121 121 LEU LEU B . n 
B 1 121 SER 121 122 122 SER SER B . n 
B 1 122 VAL 122 123 123 VAL VAL B . n 
B 1 123 PHE 123 124 124 PHE PHE B . n 
B 1 124 PHE 124 125 125 PHE PHE B . n 
B 1 125 TYR 125 126 126 TYR TYR B . n 
B 1 126 PRO 126 127 127 PRO PRO B . n 
B 1 127 ALA 127 128 128 ALA ALA B . n 
B 1 128 ALA 128 129 129 ALA ALA B . n 
B 1 129 ALA 129 130 130 ALA ALA B . n 
B 1 130 PHE 130 131 131 PHE PHE B . n 
B 1 131 ILE 131 132 132 ILE ILE B . n 
B 1 132 ASP 132 133 133 ASP ASP B . n 
B 1 133 ARG 133 134 134 ARG ARG B . n 
B 1 134 ALA 134 135 135 ALA ALA B . n 
B 1 135 LEU 135 136 136 LEU LEU B . n 
B 1 136 SER 136 137 137 SER SER B . n 
B 1 137 ASP 137 138 138 ASP ASP B . n 
B 1 138 ASP 138 139 139 ASP ASP B . n 
B 1 139 HIS 139 140 140 HIS HIS B . n 
B 1 140 SER 140 141 141 SER SER B . n 
B 1 141 LYS 141 142 142 LYS LYS B . n 
B 1 142 ILE 142 143 143 ILE ILE B . n 
B 1 143 LEU 143 144 144 LEU LEU B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 HIS 145 146 146 HIS HIS B . n 
B 1 146 CYS 146 147 147 CYS CYS B . n 
B 1 147 VAL 147 148 148 VAL VAL B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 GLY 149 150 150 GLY GLY B . n 
B 1 150 ARG 150 151 151 ARG ARG B . n 
B 1 151 SER 151 152 152 SER SER B . n 
B 1 152 ARG 152 153 153 ARG ARG B . n 
B 1 153 SER 153 154 154 SER SER B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 THR 155 156 156 THR THR B . n 
B 1 156 LEU 156 157 157 LEU LEU B . n 
B 1 157 VAL 157 158 158 VAL VAL B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 TYR 160 161 161 TYR TYR B . n 
B 1 161 LEU 161 162 162 LEU LEU B . n 
B 1 162 MET 162 163 163 MET MET B . n 
B 1 163 ILE 163 164 164 ILE ILE B . n 
B 1 164 HIS 164 165 165 HIS HIS B . n 
B 1 165 LYS 165 166 166 LYS LYS B . n 
B 1 166 ASP 166 167 167 ASP ASP B . n 
B 1 167 MET 167 168 168 MET MET B . n 
B 1 168 THR 168 169 169 THR THR B . n 
B 1 169 LEU 169 170 170 LEU LEU B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 ASP 171 172 172 ASP ASP B . n 
B 1 172 ALA 172 173 173 ALA ALA B . n 
B 1 173 ILE 173 174 174 ILE ILE B . n 
B 1 174 GLN 174 175 175 GLN GLN B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 VAL 176 177 177 VAL VAL B . n 
B 1 177 ALA 177 178 178 ALA ALA B . n 
B 1 178 LYS 178 179 179 LYS LYS B . n 
B 1 179 ASN 179 180 180 ASN ASN B . n 
B 1 180 ARG 180 181 181 ARG ARG B . n 
B 1 181 CYS 181 182 182 CYS CYS B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 LEU 183 184 184 LEU LEU B . n 
B 1 184 PRO 184 185 185 PRO PRO B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 ARG 186 187 187 ARG ARG B . n 
B 1 187 GLY 187 188 188 GLY GLY B . n 
B 1 188 PHE 188 189 189 PHE PHE B . n 
B 1 189 LEU 189 190 190 LEU LEU B . n 
B 1 190 LYS 190 191 191 LYS LYS B . n 
B 1 191 GLN 191 192 192 GLN GLN B . n 
B 1 192 LEU 192 193 193 LEU LEU B . n 
B 1 193 ARG 193 194 194 ARG ARG B . n 
B 1 194 GLU 194 195 195 GLU GLU B . n 
B 1 195 LEU 195 196 196 LEU LEU B . n 
B 1 196 ASP 196 197 197 ASP ASP B . n 
B 1 197 LYS 197 198 198 LYS LYS B . n 
B 1 198 GLN 198 199 199 GLN GLN B . n 
B 1 199 LEU 199 200 200 LEU LEU B . n 
B 1 200 VAL 200 201 201 VAL VAL B . n 
B 1 201 GLN 201 202 ?   ?   ?   B . n 
B 1 202 GLN 202 203 ?   ?   ?   B . n 
B 1 203 ARG 203 204 ?   ?   ?   B . n 
B 1 204 ARG 204 205 ?   ?   ?   B . n 
B 1 205 ARG 205 206 ?   ?   ?   B . n 
B 1 206 SER 206 207 ?   ?   ?   B . n 
B 1 207 GLN 207 208 ?   ?   ?   B . n 
B 1 208 ARG 208 209 ?   ?   ?   B . n 
B 1 209 GLN 209 210 ?   ?   ?   B . n 
B 1 210 ASP 210 211 ?   ?   ?   B . n 
B 1 211 GLY 211 212 ?   ?   ?   B . n 
B 1 212 GLU 212 213 ?   ?   ?   B . n 
B 1 213 GLU 213 214 ?   ?   ?   B . n 
B 1 214 GLU 214 215 ?   ?   ?   B . n 
B 1 215 ASP 215 216 ?   ?   ?   B . n 
B 1 216 GLY 216 217 ?   ?   ?   B . n 
B 1 217 ARG 217 218 ?   ?   ?   B . n 
B 1 218 GLU 218 219 ?   ?   ?   B . n 
B 1 219 LEU 219 220 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1  1207 1207 SO4 SO4 A . 
D 2 SO4 1  1208 1208 SO4 SO4 A . 
E 2 SO4 1  1209 1209 SO4 SO4 A . 
F 2 SO4 1  1210 1210 SO4 SO4 A . 
G 2 SO4 1  1211 1211 SO4 SO4 A . 
H 2 SO4 1  1202 1202 SO4 SO4 B . 
I 2 SO4 1  1203 1203 SO4 SO4 B . 
J 3 HOH 1  2001 2001 HOH HOH A . 
J 3 HOH 2  2002 2002 HOH HOH A . 
J 3 HOH 3  2003 2003 HOH HOH A . 
J 3 HOH 4  2004 2004 HOH HOH A . 
J 3 HOH 5  2005 2005 HOH HOH A . 
J 3 HOH 6  2006 2006 HOH HOH A . 
J 3 HOH 7  2007 2007 HOH HOH A . 
J 3 HOH 8  2008 2008 HOH HOH A . 
J 3 HOH 9  2009 2009 HOH HOH A . 
J 3 HOH 10 2010 2010 HOH HOH A . 
J 3 HOH 11 2011 2011 HOH HOH A . 
J 3 HOH 12 2012 2012 HOH HOH A . 
J 3 HOH 13 2013 2013 HOH HOH A . 
J 3 HOH 14 2014 2014 HOH HOH A . 
J 3 HOH 15 2015 2015 HOH HOH A . 
J 3 HOH 16 2016 2016 HOH HOH A . 
J 3 HOH 17 2017 2017 HOH HOH A . 
J 3 HOH 18 2018 2018 HOH HOH A . 
J 3 HOH 19 2019 2019 HOH HOH A . 
J 3 HOH 20 2020 2020 HOH HOH A . 
J 3 HOH 21 2021 2021 HOH HOH A . 
J 3 HOH 22 2022 2022 HOH HOH A . 
J 3 HOH 23 2023 2023 HOH HOH A . 
J 3 HOH 24 2024 2024 HOH HOH A . 
J 3 HOH 25 2025 2025 HOH HOH A . 
J 3 HOH 26 2026 2026 HOH HOH A . 
J 3 HOH 27 2027 2027 HOH HOH A . 
J 3 HOH 28 2028 2028 HOH HOH A . 
J 3 HOH 29 2029 2029 HOH HOH A . 
J 3 HOH 30 2030 2030 HOH HOH A . 
J 3 HOH 31 2031 2031 HOH HOH A . 
J 3 HOH 32 2032 2032 HOH HOH A . 
J 3 HOH 33 2033 2033 HOH HOH A . 
J 3 HOH 34 2034 2034 HOH HOH A . 
J 3 HOH 35 2035 2035 HOH HOH A . 
J 3 HOH 36 2036 2036 HOH HOH A . 
J 3 HOH 37 2037 2037 HOH HOH A . 
J 3 HOH 38 2038 2038 HOH HOH A . 
J 3 HOH 39 2039 2039 HOH HOH A . 
J 3 HOH 40 2040 2040 HOH HOH A . 
J 3 HOH 41 2041 2041 HOH HOH A . 
J 3 HOH 42 2042 2042 HOH HOH A . 
J 3 HOH 43 2043 2043 HOH HOH A . 
J 3 HOH 44 2044 2044 HOH HOH A . 
J 3 HOH 45 2045 2045 HOH HOH A . 
J 3 HOH 46 2046 2046 HOH HOH A . 
J 3 HOH 47 2047 2047 HOH HOH A . 
J 3 HOH 48 2048 2048 HOH HOH A . 
J 3 HOH 49 2049 2049 HOH HOH A . 
J 3 HOH 50 2050 2050 HOH HOH A . 
J 3 HOH 51 2051 2051 HOH HOH A . 
J 3 HOH 52 2052 2052 HOH HOH A . 
J 3 HOH 53 2053 2053 HOH HOH A . 
J 3 HOH 54 2054 2054 HOH HOH A . 
J 3 HOH 55 2055 2055 HOH HOH A . 
J 3 HOH 56 2056 2056 HOH HOH A . 
J 3 HOH 57 2057 2057 HOH HOH A . 
J 3 HOH 58 2058 2058 HOH HOH A . 
J 3 HOH 59 2059 2059 HOH HOH A . 
J 3 HOH 60 2060 2060 HOH HOH A . 
J 3 HOH 61 2061 2061 HOH HOH A . 
J 3 HOH 62 2062 2062 HOH HOH A . 
J 3 HOH 63 2063 2063 HOH HOH A . 
J 3 HOH 64 2064 2064 HOH HOH A . 
J 3 HOH 65 2065 2065 HOH HOH A . 
J 3 HOH 66 2066 2066 HOH HOH A . 
J 3 HOH 67 2067 2067 HOH HOH A . 
J 3 HOH 68 2068 2068 HOH HOH A . 
J 3 HOH 69 2069 2069 HOH HOH A . 
J 3 HOH 70 2070 2070 HOH HOH A . 
J 3 HOH 71 2071 2071 HOH HOH A . 
J 3 HOH 72 2072 2072 HOH HOH A . 
J 3 HOH 73 2073 2073 HOH HOH A . 
J 3 HOH 74 2074 2074 HOH HOH A . 
J 3 HOH 75 2075 2075 HOH HOH A . 
K 3 HOH 1  2001 2001 HOH HOH B . 
K 3 HOH 2  2002 2002 HOH HOH B . 
K 3 HOH 3  2003 2003 HOH HOH B . 
K 3 HOH 4  2004 2004 HOH HOH B . 
K 3 HOH 5  2005 2005 HOH HOH B . 
K 3 HOH 6  2006 2006 HOH HOH B . 
K 3 HOH 7  2007 2007 HOH HOH B . 
K 3 HOH 8  2008 2008 HOH HOH B . 
K 3 HOH 9  2009 2009 HOH HOH B . 
K 3 HOH 10 2010 2010 HOH HOH B . 
K 3 HOH 11 2011 2011 HOH HOH B . 
K 3 HOH 12 2012 2012 HOH HOH B . 
K 3 HOH 13 2013 2013 HOH HOH B . 
K 3 HOH 14 2014 2014 HOH HOH B . 
K 3 HOH 15 2015 2015 HOH HOH B . 
K 3 HOH 16 2016 2016 HOH HOH B . 
K 3 HOH 17 2017 2017 HOH HOH B . 
K 3 HOH 18 2018 2018 HOH HOH B . 
K 3 HOH 19 2019 2019 HOH HOH B . 
K 3 HOH 20 2020 2020 HOH HOH B . 
K 3 HOH 21 2021 2021 HOH HOH B . 
K 3 HOH 22 2022 2022 HOH HOH B . 
K 3 HOH 23 2023 2023 HOH HOH B . 
K 3 HOH 24 2024 2024 HOH HOH B . 
K 3 HOH 25 2025 2025 HOH HOH B . 
K 3 HOH 26 2026 2026 HOH HOH B . 
K 3 HOH 27 2027 2027 HOH HOH B . 
K 3 HOH 28 2028 2028 HOH HOH B . 
K 3 HOH 29 2029 2029 HOH HOH B . 
K 3 HOH 30 2030 2030 HOH HOH B . 
K 3 HOH 31 2031 2031 HOH HOH B . 
K 3 HOH 32 2032 2032 HOH HOH B . 
K 3 HOH 33 2033 2033 HOH HOH B . 
K 3 HOH 34 2034 2034 HOH HOH B . 
K 3 HOH 35 2035 2035 HOH HOH B . 
K 3 HOH 36 2036 2036 HOH HOH B . 
K 3 HOH 37 2037 2037 HOH HOH B . 
K 3 HOH 38 2038 2038 HOH HOH B . 
K 3 HOH 39 2039 2039 HOH HOH B . 
K 3 HOH 40 2040 2040 HOH HOH B . 
K 3 HOH 41 2041 2041 HOH HOH B . 
K 3 HOH 42 2042 2042 HOH HOH B . 
K 3 HOH 43 2043 2043 HOH HOH B . 
K 3 HOH 44 2044 2044 HOH HOH B . 
K 3 HOH 45 2045 2045 HOH HOH B . 
K 3 HOH 46 2046 2046 HOH HOH B . 
K 3 HOH 47 2047 2047 HOH HOH B . 
K 3 HOH 48 2048 2048 HOH HOH B . 
K 3 HOH 49 2049 2049 HOH HOH B . 
K 3 HOH 50 2050 2050 HOH HOH B . 
K 3 HOH 51 2051 2051 HOH HOH B . 
K 3 HOH 52 2052 2052 HOH HOH B . 
K 3 HOH 53 2053 2053 HOH HOH B . 
K 3 HOH 54 2054 2054 HOH HOH B . 
K 3 HOH 55 2055 2055 HOH HOH B . 
K 3 HOH 56 2056 2056 HOH HOH B . 
K 3 HOH 57 2057 2057 HOH HOH B . 
K 3 HOH 58 2058 2058 HOH HOH B . 
K 3 HOH 59 2059 2059 HOH HOH B . 
K 3 HOH 60 2060 2060 HOH HOH B . 
K 3 HOH 61 2061 2061 HOH HOH B . 
K 3 HOH 62 2062 2062 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12720  ? 
1 MORE         -281.5 ? 
1 'SSA (A^2)'  30350  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 11_555 -x+y,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-04-27 
2 'Structure model' 1 1 2011-05-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -15.2950 -32.8260 -7.5070  0.4434 0.4194 0.1948 0.0982  0.1177 0.0809  4.2202 -0.0112 0.2615 
0.3571  -0.7883 0.3708  0.1073  0.1237 0.6340  -0.2225 0.0037  -0.0039 -0.4656 -0.0608 -0.1111 
'X-RAY DIFFRACTION' 2 ? refined -22.5510 -48.1690 -6.8500  0.2166 0.4435 0.1093 0.1021  0.0594 0.0146  2.5083 2.4141  1.6761 
0.4672  -0.1497 0.4845  0.0887  0.1415 -0.0455 -0.2752 -0.1199 -0.0744 -0.0674 -0.0257 0.0312  
'X-RAY DIFFRACTION' 3 ? refined 0.8970   -57.3840 -15.9870 0.2273 0.4216 0.2180 -0.0901 0.0809 -0.0441 3.2269 0.3772  2.8827 
-0.6565 -1.8567 -0.7521 -0.1664 0.0934 -0.3316 -0.0769 0.1768  0.2224  0.2195  -0.0868 -0.0104 
'X-RAY DIFFRACTION' 4 ? refined 8.0810   -43.2450 -21.7660 0.2229 0.3738 0.1157 -0.0914 0.1063 0.0134  2.9694 3.0292  5.1858 
0.8254  -0.0548 0.2284  -0.0449 0.1884 0.1026  -0.1019 0.0257  0.0916  -0.6192 0.0150  0.0192  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 32  ? ? A 103 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 104 ? ? A 205 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 B 32  ? ? B 103 ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 B 104 ? ? B 201 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.5.0104 ? 1 
HKL-3000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 93  ? ? -119.23 -122.55 
2  1 THR A 96  ? ? -114.59 -76.23  
3  1 ASP A 103 ? ? 70.78   -1.89   
4  1 ASP A 105 ? ? 71.84   47.38   
5  1 CYS A 147 ? ? -134.45 -132.94 
6  1 SER A 152 ? ? -122.66 -65.08  
7  1 LEU A 184 ? ? -154.92 86.66   
8  1 ASP B 66  ? ? -103.48 -166.94 
9  1 THR B 96  ? ? -135.14 -65.52  
10 1 CYS B 147 ? ? -139.66 -149.23 
11 1 SER B 152 ? ? -122.31 -68.61  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B TYR 74 ? CG  ? B TYR 73 CG  
2 1 Y 1 B TYR 74 ? CD1 ? B TYR 73 CD1 
3 1 Y 1 B TYR 74 ? CD2 ? B TYR 73 CD2 
4 1 Y 1 B TYR 74 ? CE1 ? B TYR 73 CE1 
5 1 Y 1 B TYR 74 ? CE2 ? B TYR 73 CE2 
6 1 Y 1 B TYR 74 ? CZ  ? B TYR 73 CZ  
7 1 Y 1 B TYR 74 ? OH  ? B TYR 73 OH  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 2   ? A THR 1   
2  1 Y 1 A SER 3   ? A SER 2   
3  1 Y 1 A GLY 4   ? A GLY 3   
4  1 Y 1 A GLU 5   ? A GLU 4   
5  1 Y 1 A VAL 6   ? A VAL 5   
6  1 Y 1 A LYS 7   ? A LYS 6   
7  1 Y 1 A THR 8   ? A THR 7   
8  1 Y 1 A SER 9   ? A SER 8   
9  1 Y 1 A LEU 10  ? A LEU 9   
10 1 Y 1 A LYS 11  ? A LYS 10  
11 1 Y 1 A ASN 12  ? A ASN 11  
12 1 Y 1 A ALA 13  ? A ALA 12  
13 1 Y 1 A TYR 14  ? A TYR 13  
14 1 Y 1 A SER 15  ? A SER 14  
15 1 Y 1 A SER 16  ? A SER 15  
16 1 Y 1 A ALA 17  ? A ALA 16  
17 1 Y 1 A LYS 18  ? A LYS 17  
18 1 Y 1 A ARG 19  ? A ARG 18  
19 1 Y 1 A LEU 20  ? A LEU 19  
20 1 Y 1 A SER 21  ? A SER 20  
21 1 Y 1 A PRO 22  ? A PRO 21  
22 1 Y 1 A LYS 23  ? A LYS 22  
23 1 Y 1 A MET 24  ? A MET 23  
24 1 Y 1 A GLU 25  ? A GLU 24  
25 1 Y 1 A GLU 26  ? A GLU 25  
26 1 Y 1 A GLU 27  ? A GLU 26  
27 1 Y 1 A GLY 28  ? A GLY 27  
28 1 Y 1 A GLU 29  ? A GLU 28  
29 1 Y 1 A GLU 30  ? A GLU 29  
30 1 Y 1 A GLU 31  ? A GLU 30  
31 1 Y 1 A SER 207 ? A SER 206 
32 1 Y 1 A GLN 208 ? A GLN 207 
33 1 Y 1 A ARG 209 ? A ARG 208 
34 1 Y 1 A GLN 210 ? A GLN 209 
35 1 Y 1 A ASP 211 ? A ASP 210 
36 1 Y 1 A GLY 212 ? A GLY 211 
37 1 Y 1 A GLU 213 ? A GLU 212 
38 1 Y 1 A GLU 214 ? A GLU 213 
39 1 Y 1 A GLU 215 ? A GLU 214 
40 1 Y 1 A ASP 216 ? A ASP 215 
41 1 Y 1 A GLY 217 ? A GLY 216 
42 1 Y 1 A ARG 218 ? A ARG 217 
43 1 Y 1 A GLU 219 ? A GLU 218 
44 1 Y 1 A LEU 220 ? A LEU 219 
45 1 Y 1 B THR 2   ? B THR 1   
46 1 Y 1 B SER 3   ? B SER 2   
47 1 Y 1 B GLY 4   ? B GLY 3   
48 1 Y 1 B GLU 5   ? B GLU 4   
49 1 Y 1 B VAL 6   ? B VAL 5   
50 1 Y 1 B LYS 7   ? B LYS 6   
51 1 Y 1 B THR 8   ? B THR 7   
52 1 Y 1 B SER 9   ? B SER 8   
53 1 Y 1 B LEU 10  ? B LEU 9   
54 1 Y 1 B LYS 11  ? B LYS 10  
55 1 Y 1 B ASN 12  ? B ASN 11  
56 1 Y 1 B ALA 13  ? B ALA 12  
57 1 Y 1 B TYR 14  ? B TYR 13  
58 1 Y 1 B SER 15  ? B SER 14  
59 1 Y 1 B SER 16  ? B SER 15  
60 1 Y 1 B ALA 17  ? B ALA 16  
61 1 Y 1 B LYS 18  ? B LYS 17  
62 1 Y 1 B ARG 19  ? B ARG 18  
63 1 Y 1 B LEU 20  ? B LEU 19  
64 1 Y 1 B SER 21  ? B SER 20  
65 1 Y 1 B PRO 22  ? B PRO 21  
66 1 Y 1 B LYS 23  ? B LYS 22  
67 1 Y 1 B MET 24  ? B MET 23  
68 1 Y 1 B GLU 25  ? B GLU 24  
69 1 Y 1 B GLU 26  ? B GLU 25  
70 1 Y 1 B GLU 27  ? B GLU 26  
71 1 Y 1 B GLY 28  ? B GLY 27  
72 1 Y 1 B GLU 29  ? B GLU 28  
73 1 Y 1 B GLU 30  ? B GLU 29  
74 1 Y 1 B GLU 31  ? B GLU 30  
75 1 Y 1 B GLY 90  ? B GLY 89  
76 1 Y 1 B ARG 91  ? B ARG 90  
77 1 Y 1 B TRP 92  ? B TRP 91  
78 1 Y 1 B ASN 93  ? B ASN 92  
79 1 Y 1 B VAL 94  ? B VAL 93  
80 1 Y 1 B GLN 202 ? B GLN 201 
81 1 Y 1 B GLN 203 ? B GLN 202 
82 1 Y 1 B ARG 204 ? B ARG 203 
83 1 Y 1 B ARG 205 ? B ARG 204 
84 1 Y 1 B ARG 206 ? B ARG 205 
85 1 Y 1 B SER 207 ? B SER 206 
86 1 Y 1 B GLN 208 ? B GLN 207 
87 1 Y 1 B ARG 209 ? B ARG 208 
88 1 Y 1 B GLN 210 ? B GLN 209 
89 1 Y 1 B ASP 211 ? B ASP 210 
90 1 Y 1 B GLY 212 ? B GLY 211 
91 1 Y 1 B GLU 213 ? B GLU 212 
92 1 Y 1 B GLU 214 ? B GLU 213 
93 1 Y 1 B GLU 215 ? B GLU 214 
94 1 Y 1 B ASP 216 ? B ASP 215 
95 1 Y 1 B GLY 217 ? B GLY 216 
96 1 Y 1 B ARG 218 ? B ARG 217 
97 1 Y 1 B GLU 219 ? B GLU 218 
98 1 Y 1 B LEU 220 ? B LEU 219 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#